Vous êtes sur la page 1sur 104

Squence 4

Gntique et volution: le brassage gntique et sa contribution la diversit gntique, et processus de diversification du vivant
Sommaire
Chapitre 1. Prrequis : un mode de reproduction Chapitre 2. La reproduction sexue faisant intervenir la miose et la fcondation Chapitre 3. La reproduction sexue: une machine fabriquer du nouveau et de la variabilit Chapitre 4. La dynamique du gnome Chapitre 5. La gntique du dveloppement et la comprhension des mcanismes volutifs Chapitre 6. La diversification du vivant sans modification du gnome Synthse Exercices Devoir autocorrectif
Squence 4 SN02

Cned Acadmie en ligne

Chapitre

Prrequis
Exercice 1 Retrouver les composantes du cycle cellulaire Interprter un graphe, dessiner laspect des chromosomes pendant le cycle cellulaire Tester ses connaissances sur la mitose et les reprsentations des allles sur les chromosomes Tester ses connaissances sur lanalyse de caryotypes tudier un arbre gnalogique et interprter les donnes. Interprter les rsultats dune lectrophorse Identifier une mutation et ses consquences Maturation de lARN pr-messager en ARN messager : lpissage Exercice 2 Exercice 3 Exercice 4 Exercice 5 et 6 Exercice 7

Exercice 1
Document 1

Retrouver les moments cls du cycle cellulaire

Walther Flemming observe une mitose


Observs la premire fois en 1878 par le biologiste allemand Walther Flemming dans une cellule en division, les chromosomes sont dcrits ainsi : les chromosomes sont doubles quand ils apparaissent puis sont partags en deux et entrans dans deux directions opposes pour se rpartir dans les deux cellules filles. Il faudra attendre vingt ans pour que ses travaux associs aux lois de lhrdit dcouvertes par Johann Gregor Mendel aboutissent la naissance de la gntique.
1 Dessiner le contenu chromosomique de la cellule mre et des deux

cellules filles (deux paires de chromosomes identifiables).


Document 2

Quantit dADN dans une cellule au cours des cycles cellulaires


Quantit d'ADN contenue dans le matriel nuclaire (units arbitraires) 2Q 2 Q 1 3 4

0 Temps Cycle cellulaire

Squence 4 SN02

Cned Acadmie en ligne

2 Combien de mitoses identifiez-vous ? 3 Que se passe-t-il en 2 ? Expliquer et nommer ce phnomne. 4 Reprer et colorier les interphases et les mitoses. 5 Dessiner laspect dun chromosome avant la mitose et aprs (sur le

graphe).

Exercice 2

QCM : souligner les rponses exactes A. Les chromosomes : 1. sont toujours visibles dans la cellule. 2. sont toujours forms dune chromatide. 3. sont spars en deux lots gaux lors de la prophase de la mitose. 4. sont dupliqus la fin de linterphase. B. Le renouvellement cellulaire : 1. seffectue grce des mitoses chez les organismes eucaryotes. 2. concerne toutes les cellules de lorganisme. 3. nutilise pas le programme gntique. 4. est la reproduction de lorganisme. C. LADN est : 1. un polymre de dsoxyribose. 2. un polymre de bases azotes. 3. un polymre de nuclotides. D. Le rapport A + G/ T + C : 1. est toujours gal un. 2. est une valeur variable suivant les ADN. 3. est gal un dans lARN. E. Lordre des phases de la mitose est : 1. prophase, tlophase, anaphase, metaphase. 2. prophase, mtaphase, anaphase, tlophase. 3. prophase, anaphase, metaphase, tlophase. 4. prophase, mtaphase, tlophase, anaphase. F. Une mutation : 1. a toujours lieu sous leffet dun agent mutagne. 2. cre un nouvel allle. 3. est nfaste pour la cellule.

Squence 4 SN02

Cned Acadmie en ligne

G. Une mutation : 1. peut se produire spontanment. 2. est un vnement frquent. 3. conduit toujours la formation dune protine diffrente. H. Le gnotype dun individu : 1. comporte tous les allles de ses parents. 2. ne comporte que les allles dun seul parent. 3. comporte une partie des allles de ses parents. I. Voici la paire de chromosome n 4 dun individu portant un gne dont il existe plusieurs allles (A, a1, a2, a3) A : trait noir, a1 : trait hachur. Choisir la bonne reprsentation schmatique en justifiant votre rponse.

J. Le phnotype de cet individu est [ A], cela indique que : 1. lallle A est codominant. 2. lallle A est rcessif. 3. lallle A est dominant. K. Lindividu en question est de ce fait : 1. htrozygote pour ce gne. 2. homozygote pour ce gne. 3. htrozygote pour lensemble de ses gnes. 4. homozygote pour lensemble de ses gnes.

Exercice 3

Analyse de caryotypes humains (cellule somatique et cellule germinale)


Rappel: Lobtention dun caryotype Un caryotype est une prsentation photographique, dessine ou numrise, du nombre et de la forme des chromosomes. Il est tabli partir de la culture de cellules que lon a bloques en mtaphase de mitose grce un traitement appropri antimitotique. Les chromosomes sont numrots et rangs par paires de taille dcroissante. Ils peuvent avoir t au pralable colors pour une tude fine de leur structure. Pour les ftus, on prlve des cellules du ftus contenues dans le liquide amniotique ( amniocentse) entre la 15e et la 16e semaine de grossesse ou bien par prlvement de cellules des villosits choriales (cellules du futur placenta) ds la 8e semaine de grossesse (mais risque lev de fausses couches avec cette mthode).

Squence 4 SN02

Cned Acadmie en ligne

Document 1

Caryotype dune cellule somatique dun homme A et dune femme B


Caryotype A Caryotype B

Le caryotype dun individu est spcifique de lespce laquelle il appartient. Pour lespce humaine, les caryotypes des cellules somatiques renferment 46 chromosomes et la formule chromosomique de ces caryotypes scrit 2n = 46.
1 Indiquer la diffrence entre les deux caryotypes. 2 Que reprsente la lettre n ? 3 Schmatiser la paire de chromosome n 2 du caryotype et lgender

votre dessin (centromre, chromatides).


4 Quel vnement a eu lieu avant la prise de la photo dont est issu ce

caryotype ? Justifier.
Document 2

Caryotype de gamtes : spermatozode et ovocyte

Squence 4 SN02

Cned Acadmie en ligne

5 Comparer le caryotype des gamtes avec le caryotype dune cellule

somatique.
6 Vous savez que la fcondation est lunion dun spermatozode et dun

ovule : qui, dans un couple, est responsable du sexe de lenfant natre ?

Exercice 4

La mucoviscidose est une maladie autosomique rcessive La mucoviscidose est la maladie gntique la plus frquente du monde occidental (1 nouveau-n sur 2 500). Elle se manifeste par la production dun mucus visqueux par les cellules pithliales des bronches, du systme digestif. La cause de la maladie est une altration du gne CFTR port par le chromosome 7 qui code pour la protine CFTR. On connat plus de 1 000 mutations de ce gne dont les consquences sont variables (activit de la protine simplement altre ou supprime). En France, 2 millions de personnes sont htrozygotes (1/32). Vous pouvez consulter la fiche mthode Convention dcriture en gntique disponible la fin de la squence.
1 Expliquer les termes autosomique et rcessive .

Lexamen de larbre gnalogique dune famille risque permet au mdecin de proposer un diagnostic prnatal.
Document 1

Arbre gnalogique dune famille sur trois gnrations prsentant deux individus atteints de mucoviscidose (porteurs de lallle mut F508delta : allle le plus courant dans la population)
I 1 2
Femme saine Femme malade

II

Homme sain Homme malade Foetus

III

2 En choisissant M (allle dominant) et m (allle rcessif), dessiner la

paire de chromosomes 7 des parents de la gnration I en justifiant votre choix.


3 Dessiner ensuite la paire de chromosomes de la gnration II (envisa-

ger tous les cas possibles) en justifiant vos choix.


4 Prsenter larbre gnalogique en crivant les gnotypes (respecter

les consignes dcriture).

Squence 4 SN02

Cned Acadmie en ligne

5 Grce lanalyse de cet arbre, peut-on prvoir si le ftus sera atteint

ou pas ? Llectrophorse (technique vue en premire, tome 1, squence 4) permet danalyser lADN. Un dpistage des htrozygotes est rendu possible afin de permettre un diagnostic pour le ftus. Le couple II4 - II5 et ses trois enfants rvlent, lors dune analyse de leur ADN codant pour le gne CFTR, dont la mutation est lorigine de la maladie, les lectrophorgrammes ci-dessous.
Document 2

Rsultats dune lectrophorse


Puits de dpt II 4 II 5 III 1 III 2 III 3 Bande A Bande B

Sens de migration des protines

6 Analyser ce rsultat dlectrophorse et conclure. Aide Reprer les individus htrozygotes, lindividu malade qui est homozygote.

Pour aller plus loin : depuis 2002, en France, le dpistage systmatique de plusieurs maladies gntiques (phnylctonurie, mucoviscidose) la naissance permet une prise en charge prcoce du malade.

Exercice 5

Dficience en une enzyme (la G6PD) dans les les Vanuatu La glucose-6-phosphate dshydrognase (G6PD) est une enzyme intervenant dans une voie de dgradation du glucose au sein des cellules. Elle joue un rle particulirement important au sein des hmaties. La dficience hrditaire de lactivit de lenzyme G6PD affecte environ 400 millions de personnes dans le monde avec une frquence de 5 25 % en Afrique, dans le Moyen-Orient, en Asie tropicale et dans certaines zones du pourtour mditerranen.

Squence 4 SN02

Cned Acadmie en ligne

Les symptmes de cette dficience, gnralement discrets, peuvent devenir graves (destruction massive dhmaties) lors de la prise de certains mdicaments (antipaludens), lors de lingestion de certains aliments (fves) ou de certains tats infectieux. Cette enzyme, dont la squence comporte 515 acides amins, est code par un gne port par la partie propre au chromosome X (dans une rgion qui na pas de correspondance sur le chromosome Y). Il comporte plusieurs allles : quatre dentre eux, indiqus sur le document propos, sont prsents dans les populations des les Vanuatu situes au nord de la Nouvelle Caldonie. Les allles Vanua lava et Naone ne permettent pas la production denzyme fonctionnelle.
1 Expliquer ce que lon entend par polymorphisme dun gne au sein

dune population.
2 Indiquer la nature des diffrences entre les allles du gne (en pre-

nant lallle G6PD-B comme rfrence) et les consquences de ces diffrences sur les protines codes par ces allles. Montrer que les mutations ont des consquences phnotypiques variables.
Document 1

Tableau du code gntique


2me base U UUU Phe UUC Phe UUA Leu UUG Leu CUU Leu CUC Leu CUA Leu CUG Leu AUU Ile AUC Ile AUA Ile AUG Met GUU Val GUC Val GUA Val GUG Val C UCU Ser UCC Ser UCA Ser UCG Ser CCU Pro CCC Pro CCA Pro CCG Pro ACU Thr ACC Thr ACA Thr ACG Thr GCU Ala GCC Ala GCA Ala GCG Ala A UAU UAC UAA UAG CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG Tyr Tyr Stop Stop His His Gln Gln Asn Asn Lys Lys Asp Asp Gln Gln G UGU Cys UGC Cys UGA Stop UGG Trp CGU Arg CGC Arg CGA Arg CGG Arg AGU Ser AGC Ser AGA Arg AGG Arg GGU Gly GGC Gly GGA Gly GGG Gly U C A G U C A G U C A G U C A G
Ala : Arg : Asn : Asp : Cys : Gln : Gly : His : Ile : Leu : Lys : Met : Phe : Pro : Ser : Thr : Tyr : Val : Alanine Arginine Asparagine Acide aspartique Cystine Glutamine Glycine Histidine Isoleucine Leucine Lysine Methionine Phnylalanine Proline Serine Thronine Tyrosine Valine

1re base

3me base

AUG : codon d'initiation UAA UAG UGA : codons de terminaison

Document 2

Squence des allles du gne G6PD trouves dans les populations de Vanuatu (brins non transcrits)
69 127 165 453 ...G GCT ATG CC..G CCC TCC AC..A ACC GCA TC..G TGC GCA GA ...G GCC ATG CC..G CCC TCC AC..A ACC GCA TC..G TGC GCA GA ...G GCT ATG CC..G CCC CCC AC..A ACC GCA TC..G TGC GCA GA ...G GCT ATG CC..G CCC TCC AC..A ACC GCA TC..G TGC ACA GA ...G GCT ATG CC..G CCC TCC AC..A ACT GCA TC..G TGC GCA GA

G6pd allle normal G6pd Namoru G6pd Vanua lava G6pd Naone G6pd Union

Squence 4 SN02

Cned Acadmie en ligne

Exercice 6

Influence dune mutation sur la synthse dune protine Recenser, extraire et organiser des informations La dystrophie musculaire de Duchenne (DMD) est une maladie monogntique rcessive (un gne en cause appel DMD) qui touche lensemble des muscles de lorganisme : muscles squelettiques, muscle cardiaque... Les enfants atteints sont uniquement des garons (1 naissance sur 3 500 en France). Le gne DMD est situ sur le chromosome X et comporte plus de 2 millions de paires de nuclotides. Il permet la synthse dune protine musculaire : la dystrophine. Le fragment du brin transcrit dADN suivant correspond aux acides amins 109 114 de la dystrophine. CCAAACTAAACCTTATAT. Suite des mutations, la squence des nuclotides du gne peut changer : la myopathie de Duchenne nest quun exemple parmi de nombreuses autres dystrophies.
1 Expliquer pourquoi la dystrophie ne touche que les garons. 2 laide du code gntique, donner les acides amins 109 114 de

la protine.
3 Dterminer les consquences sur la squence polypeptidique forme

si : le gne possde un nuclotide T au lieu de C en position 12 ; le gne possde un nuclotide T au lieu de C en position 6.

Exercice 7

Maturation de lARN prmessager en ARN messager : lpissage Chez un eucaryote, la traduction dune molcule dARNm en protine ncessite au pralable une maturation de cet ARN appele pissage. Le schma du document illustre schmatiquement ce phnomne dpissage. Exploiter le document pour expliquer en quoi consiste cette maturation. On a hybrid exprimentalement le brin dADN transcrit dun gne avec lARNm lui correspondant et permettant la synthse dune protine dans le cytoplasme. Par complmentarit de bases, les nuclotides des brins dADN et dARN peuvent se reconnatre et sassocier.

10

Squence 4 SN02

Cned Acadmie en ligne

Document 2a

Observation au microscope lectronique de lhybridation entre ADN et ARN


A C 1 2 B 7 x 125 000 E 3 D 4 5 F 6 G ADN ARN

Numros : exons, parties codantes du gne. Lettres : introns, parties non codantes du gne.
Document 2b

Interprtation schmatique de lexpression dun gne


Gne A 1 B 2 C 3 D 4 E 5 F 6 G 7 ADN Transcription A 1 B 2 C 3 D 4 E 5 F 6 G pissage 1 2 3 4 5 6 7 ARN messager 7 ARN prmessager

Traduction

Numros : exons, parties codantes du gne. Lettres : introns, parties non codantes du gne.
retenir Les cellules dun organisme, lexception des cellules reproductrices, possdent la mme information gntique que la cellule uf dont elles proviennent par divisions successives appeles mitoses (exercices 1 et 2). Lors de la rplication de lADN, des mutations aux consquences variables peuvent se produire (exercices 5 et 6). La cellule uf, premire cellule dun nouvel individu chez les espces diplodes, est issue de la fcondation. La fcondation est lunion de deux cellules sexuelles dont le nombre de chromosomes est diffrent des autres cellules de lorganisme. Dans lespce humaine, chaque cellule reproductrice contient 23 chromosomes (exercice 3).

Squence 4 SN02

11

Cned Acadmie en ligne

Au cours de sa formation, chaque cellule reproductrice reoit au hasard un chromosome de chaque paire. Les cellules reproductrices produites par un individu sont gntiquement diffrentes. Lors de la fcondation, spermatozode et ovule participent la transmission de linformation gntique Pour chaque paire de chromosomes forme, un chromosome vient du pre, un de la mre.

12

Squence 4 SN02

Cned Acadmie en ligne

Chapitre

2 A

La reproduction sexue, un mode de reproduction faisant intervenir la miose et la fcondation


Pour dbuter
La reproduction est une des proprits fondamentales du monde vivant. Cette fonction permet de produire de nouveaux organismes mais la reproduction sexue nest pas une condition indispensable la vie. De nombreux organismes se reproduisent par voie asexue. Quelles que soient les modalits empruntes, un individu isol donnera naissance, par reproduction asexue, un ou plusieurs individus identiques (aux mutations prs) entre eux et lindividu de dpart. La reproduction sexue implique la formation dorganes reproducteurs produisant les gamtes, des structures permettant la rencontre de ces gamtes (cours de premire) et la ncessit de se mettre deux pour en faire un troisime. Le schma ci-dessous reprsente le cycle de dveloppement de lhomme.

Document 1

Le cycle de dveloppement dun mammifre : lhomme


Cellules _ _ _ _ _ _ ..... chromosomes Cellules _ _ _ _ _ _ ..... chromosomes

testicule

ovaire

adultes multicellulaires ou

1 Annoter le document en utilisant les mots suivants : mitoses, ovocyte

(ovule immature), spermatozode, fcondation, cellules somatiques, zygote, division conduisant la formation des gamtes. Complter la lgende en utilisant les termes suivants : haplode, diplode, 2n et n chromosomes.
2 Montrer que ce cycle de dveloppement se caractrise par une phase

haplode et diplode (voir glossaire, si ncessaire).


3 Montrer que la formation des cellules reproductrices ncessite une

division spcifique.
Squence 4 SN02

13

Cned Acadmie en ligne

Cours
On appelle miose la division qui permet dobtenir des cellules n chromosomes partir de cellules 2n chromosomes. Elle est donc caractrise par une rduction du nombre de chromosomes ou rduction chromatique. Dans ce chapitre, nous allons mettre en vidence les caractristiques de la miose lchelle cellulaire et chromosomique.

1. Un cycle de vie caractris par des phases haplode et diplode


Le cycle de dveloppement des tres vivants est caractris par lalternance dune phase haplode et dune phase diplode. La miose permet le passage de la phase diplode la phase haplode et la fcondation permet le passage de la phase haplode la phase diplode. La miose et la fcondation sont donc deux tapes ncessaires de la reproduction sexue. Au cours de ce cycle biologique, la phase diplode domine, la phase haplode tant rduite la production des gamtes. La production de gamtes (spermatozodes et ovules) ou gamtogense seffectue dans les glandes gnitales ou gonades. Lensemble des cellules lorigine ou issues de la gamtogense forme la ligne germinale.
Document 2

Schma bilan : Le cycle de dveloppement des mammifres


Spermatozodes Ovocyte

n n

MIOSE Adulte mle 2n Adulte femelle 2n

FCONDATION Cellule oeuf : zygote 2n Embryon 2n

Foetus 2n

Comment la miose permet-elle la production de cellules haplodes


partir de cellules diplodes ?

14

Squence 4 SN02

Cned Acadmie en ligne

2. La miose produit des cellules haplodes


Activit 1
Identifier les principales tapes de la miose Afin dapporter des lments de rponse au problme pos, on peut observer, au microscope, des tissus o se forment les cellules reproductrices en sintressant tout particulirement au comportement des chromosomes.
Aide la ralisation Observer le nombre de cellules, de chromosomes dans les cellules et lallure des chromosomes (nombre de chromatides) chaque tape de la miose. 1 Vous devez proposer, en vous

aidant de lensemble des ressources proposes (doc. 3, 4, 5 et 6), un classement chronologique des diffrentes photographies de miose prsentes dans le document 5 en justifiant vos choix.

Vous utiliserez un vocabulaire scientifique adapt : chromosome, chromatide, haplode, diplode, cellule, noyau.
2 La miose est une succession de deux divisions. Indiquer lvnement

qui caractrise chacune de ces divisions.


Document 3

Coupe dun tube sminifre et schma dinterprtation La coupe dun tube sminifre montre diffrentes cellules. Les cellules lorigine des spermatozodes sont situes la priphrie du tube sminifre. Elles subissent des transformations dont la miose et deviennent des spermatozodes, que lon observe dans la lumire du tube (centre du tube).
lintrieur du noyau des cellules, les chromosomes sont visibles.
Caryotype de la cellule A

Coupe de tube sminifre

Caryotype de la cellule B

Grossissement d'une portion de tube sminifre

Document 4

Dissection de testicules de criquets et figures de miose


Entrer SVT + Rennes sur votre moteur de recherche. Choisir Applications multimdia puis Dissection de testicules de criquets et figures de miose .

Squence 4 SN02

15

Cned Acadmie en ligne

Document 5

Photographies et schmas dinterprtation des diffrentes phases de la miose


Le document suivant prsente des photographies et des schmas dinterprtation illustrant les diffrentes tapes de la miose dune cellule. Ces photographies, numrotes de A H, ne sont pas reprsentes dans lordre chronologique.

Photographie

Schma dinterprtation

Photographie

Schma dinterprtation

Remarque Les schmas dinterprtation sont raliss avec deux paires de chromosomes pour plus de clart.

16

Squence 4 SN02

Cned Acadmie en ligne

Document 6

volution de la quantit dADN au cours du temps dans une cellule lorigine des gamtes lors dune interphase et lors de la miose
Quantit d'ADN par cellule

Interphase

Miose

2Q

Q/2

Temps

Activit 2

Mettre en relation lvolution de la quantit dADN et lvolution des chromosomes dans une cellule au cours de la miose Le document 7 prsente, sous forme schmatique, lvolution des chromosomes au cours de la miose. La formule chromosomique de la cellule est 2n = 4.

Document 7

Description et schmas des principales tapes de la miose


Premire division de miose Prophase I

Elle est longue et complexe : les chromosomes homologues 2 chromatides sindividualisent et saccolent par paires, ce sont des ensembles de quatre chromatides qui sont constitus (= ttrades). En fin de prophase, les chromosomes homologues apparis prsentent de nombreux points de contact troits entre leurs chromatides appels chiasmas. Mtaphase 1 Les chromosomes homologues de chaque paire se placent de part et dautre du plan quatorial de la cellule de faon alatoire : chaque chromosome prend une des deux positions possibles par rapport au plan quatorial.

Anaphase 1 Les chromosomes homologues se disjoignent : chaque chromosome dupliqu sloigne de son homologue et migre vers un ple.

Squence 4 SN02

17

Cned Acadmie en ligne

Tlophase 1 La cellule se divise en deux. Chaque cellule contient n chromosomes 2 chromatides (= bichromatidiens).

Seconde division de miose

Prophase 2 (parfois absente) Les n chromosomes 2 chromatides sont dj condenss.

Mtaphase 2 Chaque chromosome 2 chromatides se place par le centromre dans le plan quatorial.

Anaphase 2 Les chromatides de chaque chromosome se disjoignent et sloignent lune de lautre en direction des ples.

Tlophase 2 Chaque cellule se divise en 2 cellules n chromosomes une chromatide.

18

Squence 4 SN02

Cned Acadmie en ligne

Document 8

volution de la quantit dADN par cellule au cours de linterphase puis de la miose


Quantit d'ADN par cellule

Interphase

Miose

2Q

B A C D

Q/2

T1

T2 T3

Temps

1 Annoter les schmas du document 7 en utilisant les mots crits en

vert et indiquer pour chaque cellule le nombre de chromosomes quelle contient.


2 Nommer les vnements se droulant dans le noyau des cellules au

temps T1 puis T2 puis T3 (document 8). Reprer, sur le document 8, le moment o la cellule passe du stade diplode au stade haplode.
3 Schmatiser les chromosomes dans une cellule aux moments A puis

B puis C puis D de son cycle. Vous prendrez 2n = 4.


Aide la ralisation Bien identifier les deux paires de chromosomes homologues (taille, position du centromre). Choisir deux couleurs diffrentes (bleu et rouge) pour chaque chromosome de chaque paire. Ne pas oublier que les chromosomes changent dtat au cours du cycle cellulaire. 4 Montrer que le comportement des chromosomes homologues au

cours de la premire division de miose contribue au maintien du caryotype de lespce.


retenir La miose est un processus commun toutes les espces sexues. Elle est forme de deux divisions successives que prcde une rplication dADN (passage des chromosomes de une deux chromatides). lissue de la premire division, la cellule initiale diplode (2n chromosomes) a donn naissance deux cellules n chromosomes. Ainsi, la sparation des chromosomes homologues permet une rduction chromatique. Au cours de la seconde division de miose, les chromatides de chaque chromosome se sparent. Ainsi, la miose permet dobtenir, partir dune cellule 2n chromosomes, 4 cellules n chromosomes.

Squence 4 SN02

19

Cned Acadmie en ligne

3. La fcondation rtablit la diplodie


Quelles sont les caractristiques cytologiques et chromosomiques
de la fcondation ?

Activit 3

tudier les modalits de la fcondation


n Ressources disponibles pour cette activit
Vido

rechercher sur internet. Entrer fcondation + vido dans votre moteur de recherche. 9 et 10.

Documents

Document 9

Modalits cytologiques de la fcondation

Document 10

Modalits chromosomiques de la fcondation

n=3

Ovule (haplode) 2n = Spermatozode (haplode)

n=3

Le spermatozode est beaucoup plus petit que l'ovule. Il a t grossi pour qu'on puisse distinguer les chromosomes.

1 En utilisant les ressources proposes, dcrire chaque schma du

document 9.
2 Complter le document 10 et rdiger un texte mettant en vidence les

caractristiques chromosomiques de la fcondation.

20

Squence 4 SN02

Cned Acadmie en ligne

retenir

Lors de la fcondation, les gamtes fusionnent, leurs noyaux (appels pronuclus) se gonflent puis fusionnent, cest la caryogamie : il se forme une cellule uf (= zygote). Ce zygote est diplode et possde pour chaque paire de chromosomes homologue un chromosome dorigine paternel et un chromosome dorigine maternel. La fcondation par la mise en commun des n chromosomes de chaque gamte assure la diplodie du nouvel individu.

Bilan du chapitre
Chez tous les organismes prsentant une reproduction sexue, une phase haplode et une phase diplode alternent. Miose et fcondation sont les deux phnomnes fondamentaux et complmentaires de la reproduction sexue qui assurent le maintien du caryotype au cours des gnrations. La miose se produit au cours de la gamtogense. La miose est un type de division nuclaire particulier aux gamtes. La miose permet la rduction chromatique de 2n n chromosomes grce un ensemble de deux divisions cellulaires successives et particulires sans phase de rplication de lADN entre les deux. La premire division est rductionnelle car elle permet le passage de 2n n chromosomes par sparation au hasard des chromosomes homologues. Il se forme ainsi deux cellules contenant chacune n chromosomes bichromatidiens. Lors de la seconde division, les chromatides de chaque chromosome se sparent en anaphase 2 : chaque cellule fille forme reoit n chromosomes une chromatide. Cette seconde division est quationnelle car elle forme quatre cellules n chromosomes partir de deux cellules n chromosomes. Lors de la fcondation, chaque gamte apporte n chromosomes dorigine paternelle ou maternelle. La caryogamie restaure la diplodie et le zygote form se divise par mitoses dans les heures qui suivent la fcondation. La reproduction sexue, dont les tapes cls sont la miose et la fcon-

Squence 4 SN02

21

Cned Acadmie en ligne

dation, permet ainsi deux parents de transmettre une partie de leur patrimoine gntique des descendants. Deux individus sont lorigine dun nouvel individu dont le phnotype est diffrent de ses parents ou de ses frres ou surs : comment la reproduction sexue est-elle lorigine de cette diversit gntique ?

Schma bilan: La reproduction sexue


FCONDATION
Cellules haplodes : - Spermatozodes n Diffrenciation en n gamtes 2n - Ovule n ou Cellule diplode : Zygote Mitoses croissance dveloppement

2n

Adulte femelle 2n Adulte mle 2n

MIOSE

2n Cellules de la ligne germinale

22

Squence 4 SN02

Cned Acadmie en ligne

Chapitre

La reproduction sexue : une machine fabriquer du nouveau et de la variabilit


Pour dbuter
Les informations hrditaires se transmettent dune gnration lautre : un chat donnera naissance un chat et les enfants hritent de certains caractres de leurs parents. Il y a donc, court terme, une stabilit de linformation gntique transmise par les gnes au cours de la reproduction sexue. Cependant, au sein dune espce donne, on peut noter une grande diversit gntique. Si tous les individus dune mme espce possdent les mmes gnes, ces derniers existent sous de nombreuses formes ou allles. Un individu peut donc tre dfini comme une combinaison originale et unique dallles. Lexistence de ce polymorphisme gntique atteste dune certaine variation de linformation gntique. Cette variation de linformation gntique entre individus, sur laquelle va sexercer une slection par le milieu, constitue, sur le long terme, le moteur de lvolution. lorigine de cette variation de linformation gntique, il y a des mutations cest--dire des modifications de la squence dADN plus ou moins grande chelle (gnome, chromosome, gnes). Les mutations sont alatoires : elles ne rpondent pas une fin particulire et sont indpendantes du milieu. Ce dernier pourra cependant les slectionner. Les mutations crent donc de la variabilit au sein des populations. La reproduction sexue se caractrise par 2 mcanismes complmentaires : la miose et la fcondation. Dans le chapitre prcdent, nous avons envisag les caractristiques chromosomiques de ces deux phnomnes. Mais quen est-il sur le plan gntique ? Que deviennent, au cours de la miose puis de la fcondation, les combinaisons allliques qui caractrisent chaque parent ?

Cours
Nous allons chercher comprendre dans ce chapitre comment la miose, par le brassage intrachromosomique et interchromosomique, permet la

Squence 4 SN02

23

Cned Acadmie en ligne

cration de nouvelles combinaisons dallles et comment la fcondation, en rtablissant la diplodie, amplifie le brassage des allles raliss au cours de la miose. Cette cration de variabilit gntique par la reproduction sexue devra tre replace dans un cadre volutif.

1. Le brassage des allles au cours de la miose


a) Le brassage interchromosomique au cours de la miose
Depuis la classe de troisime, nous savons que les gamtes produits par un individu sont gntiquement diffrents cest--dire quils possdent des combinaisons dallles diffrentes. Cela explique que des enfants ayant les mmes parents soient diffrents. Nous cherchons savoir de manire plus prcise ce que devient au cours de la miose, donc lors de la formation des gamtes, une combinaison dallles initialement prsente dans les cellules diplodes lorigine des gamtes.
Premire division de la miose Deux paires de chromosomes homologues portant chacun une combinaison d'allles spcifiques Deuxime division de la miose

? ? ? ?

Une paire de chromosomes homologues

Deux allles d'un mme gne

Cellule diplode l'origine des spermatozodes

La combinaison d'allles porte par deux chromosomes homologues

Premire difficult : on ne peut pas observer directement les produits de la miose des organismes diplodes. Pour contourner cette difficult, les gnticiens utilisent les rsultats de croisements spcifiques. En croisant les gamtes dune ligne pure doublement rcessive pour les allles considrs avec les gamtes dont on veut connatre le gnotype, on pourra dduire, par lobservation du phnotype des individus obtenus, les allles prsents dans les gamtes tests. Ce croisement est nomm test-cross ou croisement test.

24

Squence 4 SN02

Cned Acadmie en ligne

Seconde difficult : les gamtes sont gntiquement diffrents. Ce nest quen ralisant de trs nombreux croisements que les rsultats pourront avoir du sens. Un seul croisement ne pourra videmment mettre en vidence quune seule possibilit. Ces contraintes impliquent le choix dun matriel exprimental adapt comme la drosophile. Celle-ci, galement appele mouche du vinaigre, est un organisme diplode (2n = 8). Ce choix est d sa facilit dlevage, son importante variation intraspcifique, limportante descendance obtenue chaque gnration permettant des tudes statistiques prcises et son cycle de dveloppement trs court.

Activit 1
Document 1

Comprendre et modliser le brassage interchromosomique lors de la miose

Un matriel gntique privilgi : les drosophiles

On croise des drosophiles de ligne pure qui diffrent par deux caractres : la longueur des ailes, qui peuvent tre longues ou rduites (vestigiales), et la couleur du corps, qui peut tre gris ou bne (noir). Les caractres ailes longues et corps gris sont les caractres dits sauvages. Un caractre est associ un gne et une version du caractre un allle. Les allles lorigine des caractres sauvages sont dominants. Les deux gnes gouvernant ces caractres sont situs sur des chromosomes diffrents qui ne sont pas des chromosomes sexuels. Cette remarque est importante : elle permet de conclure que le sens du croisement ne tient pas compte du sexe des individus cest--dire quil est indiffrent que ce soit le parent mle ou le parent femelle qui porte tel ou tel caractre. Les individus II1 sont issus dun premier croisement entre deux drosophiles homozygotes pour les deux gnes considrs. Dans chaque croisement, lun des parents I1 est de type sauvage (corps gris, ailes longues), lautre parent I2 est de type mut (corps bne, ailes vestigiales). Tous les individus obtenus sont htrozygotes de type sauvage. Les gnticiens nomment F1 ou gnration F1 les individus issus du croisement de deux parents homozygotes. Les individus obtenus en F1 (II1 sur le schma) sont ensuite croiss avec des individus mutants pour les deux caractres (II2) : ce second croisement porte le nom de croisement test. On peut donc suivre ce que deviennent, au cours des gnrations successives, les allles ports par les chromosomes des parents. Ces rsultats (croisement 1 et croisement 2) sont prsents dans le document 2. Les proportions obtenues sont des proportions statistiques donc obtenues la suite de trs nombreux croisements, ce qui explique lutilisation dorganismes cycle de dveloppement trs court comme les drosophiles.

Squence 4 SN02

25

Cned Acadmie en ligne

Comment obtenir des lignes pures ? Dans une population dune espce donne, plusieurs croisements entre individus prsentent un mme caractre phnotypique. chaque gnration, tous les individus ne prsentant pas ce caractre choisi sont limins de la procration suivante. Un tel levage permet de slectionner au bout de plusieurs gnrations une population o ce caractre reste stable. Le terme de ligne pure dsigne donc des individus homozygotes pour les gnes considrs.

Document 2

Reprsentation des croisements raliss


I
Drosophile ailes longues et corps gris
gamtes

1
Miose
gamtes

Drosophile ailes vestigiales 2 et corps bne Miose


On appelle aussi cette gnration "F1" Drosophile ailes vestigiales et corps bne ...comme gnration Fille Miose numro 1 gamtes

Fcondation

II

nombreuses cellules uf donnant... 100% de Drosophile Miose ailes longues gamtes et corps gris

2
Fcondation

III

nombreuses cellules uf donnant...

3
25% vestigiales corps gris

4
25% vestigiales corps bne

25% 25% ailes longues ailes longues corps gris corps bne

En croisant des gamtes issus de la ligne pure doublement rcessive pour les allles considrs (ailes vestigiales et corps bne) avec les gamtes issus de la miose des individus de la gnration F1, on pourra dduire, par lobservation du phnotype des individus obtenus, les allles des gamtes produits par les individus de la gnration F1. Ce croisement est un test-cross ou croisement-test. Cela a dj t signal mais il est important de comprendre que ces rsultats sont obtenus la suite de trs nombreux croisements cest--dire quon a crois de trs nombreux individus F1 avec de nombreux individus ailes vestigiales et corps bne. Question On nomme recombinaison une nouvelle association de matriel gntique partir de matriel gntique prexistant. Dans le cadre de la miose, la recombinaison dsigne une nouvelle combinaison dallles. Nouvelle sentend comme diffrente des combinaisons parentales. Le terme de recombin semploie galement pour qualifier un phnotype diffrent du phnotype parental.

26

Squence 4 SN02

Cned Acadmie en ligne

Aprs les avoir identifis, vous devez proposer une explication sur lorigine des phnotypes recombins obtenus lissue du second croisement. Cette explication doit tre cohrente avec les connaissances relatives au droulement de la miose acquises au cours du chapitre prcdent. Cette explication sera prsente sous forme de schmas correctement annots reprsentant la formation des gamtes au cours de la miose et dun texte mobilisant le vocabulaire scientifique adquat.
n Des ressources pour rsoudre le problme
u Site

de SVT de lacadmie de Rennes utilis lors du chapitre prcdent. u Point mthode (voir ci-dessous). u Fiche mthode : convention dcriture en gntique (disponible la fin du chapitre). u Aide la ralisation ( utiliser si ncessaire cest--dire aprs avoir essay par vous-mme).
n Point mthode

Schmatiser les cellules

Reprsenter les chromosomes

Dans le cours, les chromosomes sont reprsents de diffrentes manires. Il faut se familiariser avec ces diffrentes reprsentations. Afin de ne pas surcharger le dessin, on a mme parfois nglig le centromre afin de mieux montrer les gnes ports par ces chromosomes.

Squence 4 SN02

27

Cned Acadmie en ligne

Chromosomes o on a figur le centromre et un gne

Chromosomes o on a nglig le centromre et portant deux gnes

Schmatiser les tapes de la miose


Cellule diplode lorigine des gamtes Premire division de miose OU Seconde division de miose

n Aide la ralisation
n Nommer

et crire les allles. Pour cela, vous devez vous poser les questions suivantes : Quels sont les allles dominants ? Quels sont les allles rcessifs ? En dduire lcriture des allles en tenant compte des conventions dcriture en gntique. les gnotypes de II1 et II 2. Pour crire les gnotypes, vous devez vous poser les questions : Les gnes tudis sont-ils ports par une mme paire de chromosomes ? Sont-ils ports par des paires de chromosomes diffrentes ? Pour un gne donn, les allles sont-ils identiques (homozygotes) ? diffrents (htrozygotes) ?

n crire

n Schmatiser

les chromosomes et les allles quils portent en vous aidant du Point mthode. par II1 et II2.

n Raliser la miose afin de rechercher les gamtes possibles produits n La fcondation entre les gamtes produits par les individus F1 et les

gamtes produits par lhomozygote double rcessif permet de rtablir la diplodie. Lors de la fcondation, la rencontre des gamtes se fait au hasard. Chaque gamte dun des parents est susceptible de rencontrer nimporte quel gamte de lautre parent. Le hasard des

28

Squence 4 SN02

Cned Acadmie en ligne

rencontres lors de la fcondation peut tre mis en vidence par une reprsentation graphique : lchiquier de croisement.

retenir Lors de la mtaphase de la premire division de miose, les chromosomes homologues se rpartissent de manire alatoire et quiprobable de part et dautre du plan quatorial de la cellule. Ainsi, les allles de deux gnes situs sur deux chromosomes diffrents peuvent se retrouver associer de quatre faons diffrentes. Quatre types de gamtes sont donc possibles : deux types parentaux et deux types recombins, qui diffrent par les associations dallles quils renferment. Ce brassage interchromosomique est dautant plus important que le nombre de paires de chromosomes homologues est lev. Avec deux paires de chromosomes homologues, il y a 22 gnotypes de gamtes diffrents et, avec 23 paires de chromosomes homologues, 223 gnotypes de gamtes diffrents.

Le brassage interchromosomique
Les chromosomes homologues s'apparient...

...et se disposent de faon alatoire de part et d'autre du plan quatorial de la cellule

Premire division de la miose

Deuxime division de la miose

On observe alors la disposition du haut ou la disposition du bas

Ce qui, aprs la premire division de miose, donne les deux cellules du haut ...

ou
...les deux cellulles du bas

La rplication de l'ADN permet aux chromosomes de passer d'une chromatide deux chromatides

Squence 4 SN02

29

Cned Acadmie en ligne

b) Un brassage intrachromosomique peut se raliser en prophase 1 de miose Activit 2


Comprendre et modliser le brassage intrachromosomique Recenser, extraire et organiser des informations On croise une drosophile femelle ailes longues et yeux rouges (I1) avec une drosophile mle aux ailes vestigiales et yeux pourpres (I2). Ces deux drosophiles sont de souches pures cest--dire quelles sont homozygotes pour chacun des deux gnes considrs. Les caractres ailes longues et yeux rouges sont les caractres sauvages. Les allles ailes longues (v+) et yeux rouges (p+) sont dominants par rapport aux allles ailes vestigiales (v), yeux pourpres (p). La gnration F1 reprsente par les individus II1 issus de ce premier croisement est constitue de 100 % de drosophiles ailes longues et yeux rouges. Les individus de la gnration F1 sont ensuite croiss avec des mles II2. Ce second croisement est un croisement test ou test-cross. Les rsultats de ce second croisement sont prsents dans le document 4.
Document 4

Reprsentation des croisements raliss


I
Drosophile ailes longues et yeux rouges
gamtes

1
Miose
gamtes

Drosophile ailes vestigiales 2 et yeux pourpres Miose

Yeux rouges

Fcondation

II

nombreuses cellules uf donnant... 100% de Drosophile Miose ailes longues gamtes et yeux gris

2
Fcondation

Drosophile ailes vestigiales et yeux pourpres

Yeux pourpres Les contraintes d'impression du cours du CNED nous obligent utiliser ces couleurs qui ne correspondent pas la ralit

gamtes

Miose

III

nombreuses cellules uf donnant...

3
6,5% vestigiales yeux rouges

4
43,5% vestigiales yeux pourpres

43,5% 6,5% ailes longues ailes longues yeux rouges yeux pourpres

Question

Comme dans lactivit prcdente, on retrouve, lissue de croisements entre des individus de la gnration F1 et P2, quatre phnotypes : deux phnotypes parentaux et deux phnotypes recombins. Les pourcentages de chaque phnotype sont cependant diffrents de ceux obtenus lactivit prcdente. Expliquer les rsultats obtenus sous forme de schmas clairement annots. Vous devez expliquer deux choses : la formation des phnotypes recombins et la faible proportion de ces phnotypes recombins.

30

Squence 4 SN02

Cned Acadmie en ligne

n Des ressources pour rsoudre le problme


u Site

de SVT de lacadmie de Rennes utilis lors du chapitre prcdent. la ralisation ( utiliser si ncessaire cest--dire aprs avoir essay par vous-mme).

u Documents 5 et 6. u Aide

Document 5

Des changes de matriel gntique au cours de la miose


Nous avons vu dans le chapitre prcdent quau cours de la prophase de la premire division de miose de miose, les chromosomes homologues sappariaient et forment des bivalents. Au microscope, on observe de nombreuses zones de contacts entre les chromatides de chromosomes homologues apparis. Ce sont des chiasmas. Lexistence de chiasmas rend possible lchange de matriel gntique entre les chromatides. Cet change de fragments de chromatides entre chromosomes homologues est nomm crossing-over ou enjambement. Observation au microscope de paires de chromosomes homologues apparis en prophase 1 et schmas dinterprtation

Chiasma

Bivalents (4 chromatides)

Chromosomes homologues

Squence 4 SN02

31

Cned Acadmie en ligne

Deux chromosomes homologues doubles porteurs des chromatides et

Appariement de ces chromosomes lors de la miose d'une cellule germinale

Crossing-over entre deux bras des chromosomes. Ce crossing-over a pour consquence un change de matriel gntique

Obtention de chromatides recombines et

Dans lexemple schmatis ci-dessus, il y a eu un change dallles car le crossing-over sest produit entre les deux locus des deux gnes considrs. Il est important de comprendre que, pour deux gnes donns et ports par une mme paire de chromosomes, il ny a pas de crossing-over dans toutes les cellules engages dans la miose. La frquence de recombinaisons entre deux gnes lis dpend notamment de leur position respective sur le chromosome. Pour deux gnes donns, il y aura donc des mioses avec crossing-over et des mioses sans crossing-over.
Document 6

Carte chromosomique simplifie des chromosomes 1 et 2 de la drosophile


Le schma ci-dessous prsente, de faon trs simplifie, la localisation sur les chromosomes 1 et 2 de quatre gnes. Dans la ralit, ces chromosomes portent de trs nombreux gnes.
Deux des chromosomes d'une drosophile porteuse des allles sauvages de 4 gnes Deux des chromosomes d'une drosophile porteuse des allles muts de 4 gnes

corps gris

corps bne

yeux rouges soies longues soies courtes

yeux pourpres

Chromosome 1

ailes longues

Chromosome 1

ailes vestigiales

Chromosome 2

Chromosome 2

32

Squence 4 SN02

Cned Acadmie en ligne

Aide la ralisation

Observer le document 6 et remarquer la situation des deux gnes. Positionner correctement les allles sur les chromosomes en tenant compte des informations prsentes dans le document 4 et du Point mthode. Utiliser le document 5 et son interprtation schmatique pour comprendre le crossing-over. Raliser la miose afin de rechercher les gamtes possibles produits par les individus de la gnration F1 et les individus P2.

retenir lissue de la miose, les allles de gnes lis cest--dire ports par une mme paire de chromosomes peuvent tre rassocis diffremment. En effet, lors de la prophase I de miose, des fragments de chromatides et donc les allles quelles portent peuvent tre changs entre chromosomes homologues. On nomme crossing-over cet change de matriel gntique et chromatides recombines et les chromatides ainsi obtenues.

yeux rouges ailes longues yeux rouges ailes longues yeux pourpres ailes vestigiales

* *

yeux rouges ailes vestigiales yeux pourpres ailes longues yeux pourpres ailes vestigiales

: spermatozodes porteurs de chromosomes recombins

c) La chronologie des brassages au cours de la miose


Dans le droulement de ce cours, pour des raisons pdagogiques, nous avons dabord tudi le brassage interchromosomique puis le brassage intrachromosomique. Le brassage intrachromosomique se droulant lors de la prophase I de miose, et le brassage interchromosomqiue au cours de la mtaphase, ce sont des chromosomes remanis par le brassage intrachromosomique qui se sparent de manire alatoire en anaphase 1 lors du brassage interchromosomique.

Squence 4 SN02

33

Cned Acadmie en ligne

Le brassage intrachromosomique (2)

Deuxime division de la miose


Par exemple ce noir-gris-gris

Premire division de la miose

Crossing Over : Obtention de chromatides recombines

L'action des deux brassages permet d'obtenir des combinaisons de gnes qui n'existaient pas dans l'exemple prcdent

Ah, la diffrence est l !!!!


Ils introduisent le brassage interchromosomique qui va ajouter ses effets ceux du brassage intrachromosomique

Ce blanc-vert-vert n'existait pas non plus

Tu ne crois pas que quelqu'un devrait leur dire au CNED qu'ils ont fait deux fois le mme dessin ?

Tu as raison ...

retenir Lors de la reproduction sexue, les combinaisons allliques caractrisant chaque parent pour les diffrents gnes de lespce ne se transmettent pas directement aux descendants. La recombinaison gntique dsigne tout processus permettant dobtenir un assemblage nouveau dinformations gntiques partir densembles diffrents. Lors de la miose, deux recombinaisons gntiques se succdent :
Une Une

recombinaison intrachromosomique qui est une recombinaison issue de crossing-over et qui se droule en prophase 1 de miose. recombinaison interchromosomique due la rpartition alatoire et indpendante des chromosomes homologues dans les cellules filles lors de la premire division miotique en anaphase 1.

Le brassage intrachromosomique (en moyenne un trois enjambements par paire de chromosomes) prcde le brassage interchromosomique dans le droulement de la miose : les deux brassages se cumulent, augmentant encore la diversit des gamtes produits chaque miose.

2. La fcondation amplifie le brassage gntique et augmente la diversit entre individus


Activit 3
valuer le brassage gntique lors de la fcondation Considrons deux personnes htrozygotes pour le gne qui code pour les groupes sanguins situ sur le chromosome 9 et pour celui qui code pour le facteur rhsus dont on connat deux allles (Rh+ et Rh avec, Rh+ domine Rh) situ sur le chromosome 1.

34

Squence 4 SN02

Cned Acadmie en ligne

Point information

Les facteurs Rhsus (Rh) sont des facteurs (protines) prsents la surface des hmaties. Si ces facteurs apparaissent sur les globules rouges dune personne, elle est dite Rhsus (Rh) positif . Si ces facteurs napparaissent pas sur ses hmaties, elle est dite Rh ngatif . Le nom du systme de groupe sanguin rhsus vient du nom dun petit singe macaque, le macaque rhsus ou Macaca mulatta. En 1940, Landsteiner et Wienner immunisent des lapins avec des globules rouges dun singe Macacus Rhesus et identifient dans leur srum un anticorps actif non seulement sur les globules rouges de ces singes, mais aussi sur les hmaties de 85 % des sujets humains. Ces 85 % furent donc appels Rhsus positif. Le pre est de phnotype [A Rh+], la mre de phnotype [B Rh-] Question Montrer, en construisant un tableau de croisement, que la fcondation amplifie le brassage gntique.
Aide la ralisation

Dessiner les chromosomes de chaque parent. En dduire les gamtes possibles forms. Construire lchiquier de croisement (= tableau de fcondation) donnant toutes les associations possibles de gamtes paternels et maternels. En dduire les nouveaux phnotypes possibles.

Point mthode

Raliser un chiquier de croisement (tableau de fcondation) Ce tableau reprsente lensemble des possibles. On schmatise les gamtes possibles produits par le mle ( ) dans les cases colories en vert et les gamtes possibles produits par la femelle ( ) dans les cases colories en gris. Dans les cases blanches, on schmatisera le gnotype des cellules ufs issus de la fcondation (F). Le nombre de cases est bien entendu fonction du nombre de types de gamtes produits.

Squence 4 SN02

35

Cned Acadmie en ligne

Gamtes produits par le mle Gamtes produits par la femelle Gamtes produits par la femelle retenir

Gamtes produits par le mle

F F

F F

Du point de vue chromosomique, la fcondation est lunion des noyaux haplodes pour former un noyau diplode de la cellule uf. Si le hasard prside lors du brassage miotique, cest encore lui qui sexprime lors de la fcondation : le retour la diplodie se ralise grce une rencontre alatoire des gamtes. Ces derniers tant trs diffrents les uns des autres, il en rsulte des cellules ufs au patrimoine gntique unique pour chacune delles. La reproduction sexue produit chaque gnration des assortiments allliques nouveaux conduisant des individus uniques.

Bilan du chapitre
La reproduction sexue, une machine fabriquer du nouveau et de la variabilit. Au dbut du chapitre, nous nous interrogions sur ce que devenaient au cours de la miose les combinaisons allliques qui caractrisent chaque parent. Il apparat que ces combinaisons allliques sont remanies et que la combinaison dallles prsents dans chaque cellule reproductrice haplode est originale. Les combinaisons allliques parentales ne sont donc pas transmises aux descendants. Deux mcanismes survenant au cours de la miose sont lorigine de cette redistribution alllique. Lors de la prophase de la premire division de miose, les chromosomes homologues sapparient et forment des bivalents. Au niveau des chiasmas, des fragments de chromatides des chromosomes homologues peuvent schanger. Ce phnomne, nomm crossing-over, est lorigine de chromatides recombins. Cest le brassage intrachromosomique. Lors de la mtaphase, les chromosomes homologues peuvent se rpartir de faon alatoire de part et dautre du plan quatorial. La rpartition dune paire de chromosomes est indpendante du comportement dune autre paire de chromosomes. Dans lespce humaine, chaque cellule haplode hrite donc dune combinaison parmi 223 combinaisons possibles. Cest le brassage interchromosomique.

36

Squence 4 SN02

Cned Acadmie en ligne

Le brassage interchromosomique intervient aprs que les chromatides ont t remanies par le brassage intrachromosomique. Comme il existe de nombreux gnes htrozygotes chez la plupart des organismes, ces brassages gntiques lors de la miose conduisent la formation de gamtes pouvant possder une quasi-infinit de gnotypes diffrents. En outre, la rencontre au hasard des gamtes lors de la fcondation construit de nouvelles combinaisons allliques et amplifie la diversit potentielle des gnotypes. La variation gntique entre les individus dune population, en donnant prise la slection par le milieu, constitue sur le long terme un moteur de lvolution.

Schma bilan
MIOSE Brassage intrachromosomique + Brassage interchromosomique + REPRODUCTION SEXUE FCONDATION Rencontre au hasard des gamtes (amplification du brassage) = Variation gntique par production de nouvelles combinaisons dallles permettant lvolution des populations

La mme chose a lieu pour la miose des cellules germinales femelles, bien sr

Le crossing-over ou change de matriel chromosomique entre chromosomes homologues a pour consquence le brassage intra chromosomique
a b-c B-C A B-C a b-c

L'appariement alatoire des chromosomes homologues a pour consquence le brassage inter chromosomique
a A B-C

pas de brassage intra chromosomique

A b-c B-C A B-C b-c a b-C B-c a b-C a B-c A

et

a b-c

pas de brassage intra chromosomique

A b-c

et

a B-C

A A b-c B-C

brassage intra chromosomique

A B-c

et

a b-C

a A B-C b-c

brassage intra chromosomique

A b-C

et

a B-c

Cellule germinale

MIOSE

Gamtes produits

Squence 4 SN02

37

Cned Acadmie en ligne

Fiche mthode: Convention dcriture en gntique


1. Nommer et crire les allles
Lcriture des allles est gnralement reprsente par une lettre alphabtique ou lassociation de deux lettres. Lcriture des allles doit galement rendre compte de la notion de dominance et rcessivit.
n Si

lnonc apporte des prcisions sur le type sauvage ou mut des caractres tudis, alors on peut adopter lcriture suivante. Lallle mut est reprsent par une lettre alphabtique correspondant linitiale de la mutation ; lallle sauvage est reprsent par labrviation de la mutation laquelle on associe le signe + en exposant.

Remarque Seul le cas ou lallle mut est rcessif est envisag ici.

Exemple extrait de lactivit 1 du chapitre 3 :


On croise des drosophiles de ligne pure qui diffrent par deux caractres : la longueur des ailes, qui peuvent tre longues ou rduites (vestigiales), et la couleur du corps, qui peut tre gris ou bne (noir). Les caractres ailes longues et corps gris sont les caractres dits sauvages. Un caractre est associ un gne et une version du caractre un allle. Les allles lorigine des caractres sauvages sont dominants.

Intressons-nous au caractre : couleur du corps. Celle-ci peut tre grise ou noire. Le texte nous dit que le caractre corps gris est le caractre sauvage ; le caractre corps bne est donc le caractre mut.
Lallle mut sera donc reprsent par la lettre e (abrviation dbne). Lallle

sauvage sera donc reprsent de la manire suivante : e+.

Le mme raisonnement conduit, pour le caractre longueur des ailes, lcriture suivante :
Lallle

mut lorigine du caractre ailes rduite sera reprsent par la lettre v (abrviation de la mutation vestigiale). sauvage sera donc reprsent de la manire suivante : v+. aucune information nest apporte par lnonc sur le type sauvage ou mut des caractres tudis, alors on reprsente lallle dominant

Lallle

n Si

38

Squence 4 SN02

Cned Acadmie en ligne

par une lettre majuscule et lallle rcessif par une lettre minuscule. Il est conseill dutiliser la mme lettre pour le caractre dominant et rcessif. Reprenons lexemple prcdent.
On croise des drosophiles qui diffrent par deux caractres : la longueur des ailes, qui peuvent tre longues ou rduites (vestigiales), et la couleur du corps, qui peut tre gris ou bne (noir). Les caractres ailes longues et corps gris sont dominants.

Remarque Le choix des lettres est parfois impos par lnonc.

Lallle lorigine du caractre corps noir (caractre rcessif) sera reprsent par la lettre n en minuscule et lallle lorigine du caractre dominant corps gris sera reprsent par la lettre majuscule N.

2. crire le phnotype
On peut rappeler que le phnotype correspond aux caractres observables et rsulte de lexpression des gnes ports par les chromosomes. On reprsente le phnotype en utilisant labrviation de lallle ou des allles qui sexpriment que lon met entre crochets.
On croise des drosophiles de ligne pure ailes longues et corps gris avec des drosophiles de ligne pure ailes vestigiales et corps bne.

Application lexemple du cours : Ces drosophiles sont de ligne pure et par consquent homozygotes pour les gnes considrs. On pourra reprsenter les phnotypes de la manire suivante : Drosophiles ailes longues et corps gris : [v+, e+] Drosophiles ailes vestigiales et corps bne : [v , e ] Les drosophiles issues de ce croisement (gnration F1 dans lactivit du cours) sont hrozygotes mais leur phnotype sera galement reprsent de la manire suivante : [v+, e+].

Remarque On peut galement rencontrer le phnotype crit entre parenthses.

3. crire le gnotype
On peut rappeler qu un mme phnotype peuvent correspondre plusieurs gnotypes. En effet, les organismes diplodes prsentent deux versions dun gne donn : un allle sur chacun des chromosomes homologues. Ces deux allles peuvent tre identiques (homozygote) ou diffrents (htrozygotes).

Squence 4 SN02

39

Cned Acadmie en ligne

Si on a, sur une paire de chromosomes homologues, un allle dominant et un allle rcessif, seul lallle dominant sexprimera. Dans le cas o lindividu est homozygote pour un gne donn, les deux allles sexprimeront. Lcriture du gnotype doit permettre de rendre compte des points suivants :
lindividu

est-il homozygote ou htrozygote pour un gne donn (ce dont ne rend pas compte lcriture du phnotype) ? allles dominants et rcessifs ; le cas o ltude porte sur plusieurs gnes si ceux-ci sont ports par des chromosomes diffrents ou par des chromosomes identiques. Dans ce dernier cas de figure, les gnes sont dits lis. Soit a lallle lorigine de la mutation albinos et a+ lallle lorigine du phnotype sauvage. Le gnotype dune souris mle grise scrira : a+ // a+. Le souris du gnotype dune souris albinos scrira : a // a. Le gnotype des souris obtenues en F1 scrira : a // a+.

des

dans

n Situation o un seul gne est tudi.

Dans un levage de souris grises (phnotype sauvage), on a vu apparatre des souris mutantes albinos. Un croisement entre une souris mle grise et une souris femelle albinos a donn en F1 une premire gnration o toutes les souris sont grises. Le phnotype sauvage est dominant.

n Situation o deux gnes sont tudis.

On croise des drosophiles de ligne pure ailes longues et corps gris avec des drosophiles de ligne pure ailes vestigiales et corps bne.
Cas

1 : cas des gnes indpendants. Nous supposons que ces deux gnes sont ports par des chromosomes diffrents. Lcriture du gnotype dune drosophile de ligne pure ailes longues et corps gris sera : (v+ // v+ ; e+ // e+ ) ou

v + e + v + e +
Cas

2 : cas des gnes lis. Nous supposons que ces deux gnes sont ports par une mme paire de chromosomes cest--dire que ces gnes sont lis. Lcriture du gnotype dune drosophile de ligne pure ailes longues et corps gris sera : (v+ e+ // v+ e+ ) ou

v +e + v +e +

40

Squence 4 SN02

Cned Acadmie en ligne

Chapitre

4 A

La dynamique du gnome
Pour dbuter
La fin du XXe sicle a vu se dvelopper de nouvelles techniques molculaires qui ont permis de considrablement progresser sur le plan de la description mais galement de la comprhension du gnome. Concrtement, ces progrs ont permis le squenage cest--dire la dtermination de la succession de nuclotides de nombreux gnomes mais galement lidentification et la localisation des gnes quils portent. Ainsi, en 2011, le gnome de plusieurs dizaines deucaryotes a dj t squenc (la souris, le chien, le chat, le bl, la mas, le riz ou bien lHomme, dont le dchiffrement a t achev en 2003). On doit galement mettre lactif des chercheurs le squenage des gnomes de nombreuses bactries et archobactries ainsi que celui de nombreux virus. Outre les applications mdicales et agronomiques, le squenage permet des tudes comparatives de gnomes et donc de mieux comprendre lvolution de celui-ci. Le squenage des gnomes du chimpanz, du gorille et de lorang-outan par exemple devrait apporter des informations importantes sur lvolution de la ligne humaine. Les chercheurs ont mesur la taille en nombre de bases des diffrents gnomes squencs. Quelques exemples sont consigns dans les tableaux ci-dessous.

Document 1

Taille des gnomes chez diffrents groupes dtres vivants


BACTRIES
levure

CHAMPIGNONS
pois nnuphar

PLANTES
drosophile

INSECTES MOLLUSQUES
requin

POISSONS CARTILAGINEUX POISSONS OSSEUX AMPHIBIENS REPTILES OISEAUX MAMMIFRES 105 106 107 108 109
humain grenouille salamandre

1010

1011

Nombre de paires de bases par gnome haplode

Squence 4 SN02

41

Cned Acadmie en ligne

Document 2

Nombre de gnes et pourcentage de la fraction codante chez quelques espces


Espce Nombre total de chromosomes Nombre de gnes codant pour des protines 25000 25000 Fraction codante en % par rapport lADN total 01,5

Eucaryote Eucaryote Eucaryote Eucaryote Eucaryote Eucaryote Eucaryote Eucaryote Eucaryote Procaryote Eubactrie Archobactries
(1) Arabidopsis

Taille du gnome haplode en millions de bases Homo sapiens Homme ( 46) 3000,00 Mus musculus Souris (40) 2500,00 Gallus gallus 1200,00 Poulet (78) Drosophila melanogaster 180,00 drosophile ( 8 ) Aplysia californica 1800,00 Mollusque (34) Danio rerio Poisson 1700,00 Zbre (50) Arabidopsis thaliana (1) 120,00 Arabette (5) Triticum aestivum 16000,00 Bl (42) Saccharomyces cerevisiae 12,00 Levure (16) (champignon) Escherichia coli 1 Chromosome circulaire 4,94 Bactrie Sulfolobus acidocaldarius 2,23 Bactrie (1)

13700

15

25500 20000 5800 4400

30

72 87

thaliana est une plante facilement cultivable en laboratoire de la famille des crucifres dans laquelle on trouve galement le chou, le colza. Cette plante a constitu un modle pour linventaire des gnes des vgtaux.

Document 3

Relations phylogntiques entre tres vivants


Homme Chimpanz Macaque Lapin Souris Rat Chien Chat Cheval Cochon Vache Mouton Chvre Poulet Grenouille Axoloth Truite Oursin Moustique Mouche Nematode Schistosome Invertbrs

Mammifres

Oiseaux Amphibiens

Poissons

42

Squence 4 SN02

Cned Acadmie en ligne

1 Peut-on tablir une corrlation entre la complexit dun organisme et

la taille de son gnome ? Argumenter votre rponse en utilisant les donnes ci-dessus.
2 En classe de premire, vous avez vu que le gnome tait constitu de

gnes codant pour des protines. Montrer que les documents ci-dessus permettent de nuancer cette reprsentation.
3 Le document 3 rappelle que les tres vivants partagent des anctres

communs. Quelle consquence peut-on attendre au niveau des gnomes ? Les rcents travaux mens par les chercheurs sur les gnomes montrent que ceux-ci sont plus complexes que ce que lon pouvait imaginer. Une trs faible partie du gnome humain code pour des protines fonctionnelles et cela semble tre la rgle dans le monde du vivant. Ce constat pose la question de lorigine mais galement du rle ventuel jou par la partie non codante du gnome. Si on compare la taille des gnomes dorganismes dune complexit similaire, on observe des diffrences importantes. Le gnome dune sauterelle est trente fois plus grand que celui dune drosophile mais galement prs de deux fois plus grand que le gnome dun tre humain ! Si on regarde du ct des gnes codant pour des protines, on est aussi surpris de constater quArabidopsis thalinana compte autant de gnes quHomo sapiens. En classe de seconde, vous avez vu que la biodiversit sexprimait galement au niveau gntique. lchelle dune espce, cette biodiversit correspond la diversit des allles des diffrents gnes et leur frquence dans les diffrentes populations de cette espce. En classe de premire, vous avez vu que les mutations gniques craient de nouveaux allles. Au niveau dune espce, la biodiversit gntique est donc le rsultat dune accumulation de ces mutations. Le chapitre prcdent a permis de comprendre que la reproduction sexue par les mcanismes de la miose et de la fcondation permettait de crer de nouvelles combinaisons dallles dune gnration lautre. Pourtant, lassociation de mutations et du brassage gntique au cours de la miose puis de la fcondation ne suffit pas expliquer la diversification gntique des tres vivants.

Quels sont les processus autres que les mutations et le brassage


gntique pouvant rendre compte de la complexit des gnomes et donc de la diversification gntique des tres vivants ?

Squence 4 SN02

43

Cned Acadmie en ligne

Cours
Nous chercherons montrer que la complexit dun gnome un moment donn est le fruit dune volution passe et la possibilit dune volution future. Le gnome doit donc tre saisi dans une perspective dynamique. Des remaniements chromosomiques, des duplications de gnes, des duplications du gnome mais galement des transferts horizontaux de gnes cest--dire dune espce une autre contribuent la diversification gntique du vivant.

1. Les modifications du nombre de chromosomes


Nous savons que le nombre de chromosomes est caractristique dune espce donne et quune modification de ce nombre de chromosomes entrane des modifications importantes du phnotype. Vous avez dj rencontr plusieurs exemples dans les classes prcdentes (trisomie 21, syndrome de Turner, syndrome de Klinefelter).

Quels sont les mcanismes lorigine de ces anomalies chromosomiques ?

a) La non-sgrgation des chromosomes ou des chromatides lors de la miose Activit 1


Schmatiser la formation dune anomalie du nombre de chromosomes lors de la gamtogense
1 Comparer les caryotypes ci-dessous et prsenter vos rsultats dans

un tableau o figureront le nom, la formule chromosomique, les symptmes et la frquence de chaque syndrome.
Document 4

Trois caryotypes particuliers


Caryotype 2 Caryotype 3

Caryotype 1

44

Squence 4 SN02

Cned Acadmie en ligne

Document 5

La trisomie 21 : lanomalie chromosomique la plus frquente


Les personnes porteuses de cette anomalie (1 sujet sur 750) prsentent diverses caractristiques : nuque large, visage de forme spcifique (do drive le nom de mongolisme autrefois donn la maladie), problmes mtaboliques et retard mental plus ou moins important. Ces caractristiques ont t dcrites sous le nom de syndrome de Down. Lesprance de vie des personnes est rduite, mme si elle na cess de progresser et atteint de nos jours les 55 ans. Les hommes sont striles, mais les femmes peuvent se reproduire : elles ont alors 50 % de risque (en gnral) davoir un enfant lui-mme trisomique 21.

Document 6

Le syndrome de Turner
Maladie gntique touchant les femmes, le syndrome de Turner se caractrise par une insuffisance ovarienne, des malformations corporelles lgres dont une petite taille, une absence de caractres sexuels fminins (seins, rgles, pilosit pubienne) et une strilit dfinitive. Une telle anomalie chromosomique (un seul chromosome X) est probablement responsable dun nombre important de fausses couches spontanes. Actuellement, en France, le syndrome de Turner touche environ, la naissance, 1 petite fille sur 2 500.

Document 7

Le syndrome de Klinefelter
Cest en 1959 que lorigine chromosomique de ce syndrome fut dcouverte. Le syndrome de Klinefelter est une maladie chromosomique caractrise chez lhomme par un chromosome sexuel X supplmentaire. Lindividu est mle mais strile. Les individus atteints (1 sur 800) prsentent tout ou partie de lensemble des symptmes suivants : taille et poids suprieurs la moyenne, pilosit anormalement faible, ventuellement croissance mammaire, faible dosage en testostrone.
2 En faisant appel vos connaissances sur le droulement de la miose

et la fcondation, schmatiser deux scnarios diffrents pouvant tre lorigine dune trisomie 21. Vous ne reprsenterez que la paire de chromosomes 21. Pour reprsenter les cellules, vous conserverez les reprsentations utilises dans le chapitre prcdent.
Aide la ralisation
Vous Pour

devez chercher comment un gamte pourrait renfermer deux chromosomes 21. vous remettre en mmoire le droulement dune miose : entrer SVT + Rennes sur votre moteur de recherche. Choisir Applications multimdia. Dissection de testicules de criquets et figures de miose . schmatiser les chromosomes, vous pouvez vous reporter au chapitre prcdent.

Pour

Squence 4 SN02

45

Cned Acadmie en ligne

retenir Les anomalies de nombre peuvent se traduire par labsence dun ou de plusieurs chromosomes ou la prsence dun chromosome supplmentaire dans le caryotype de lespce. Les anomalies de nombre sexpliquent le plus souvent par la non-disjonction des chromosomes homologues au cours de lanaphase de la premire division de miose ou par la non-disjonction des chromatides lors de la seconde phase de la miose. Au final, deux chromosomes dune mme paire au lieu dun seul peuvent alors se retrouver dans un mme gamte. Si ce gamte est fcond par un gamte normal, luf qui en rsultera sera donc trisomique : si le gamte ne contient aucun chromosome de la paire considre, luf sera monosomique.

Remarque Les anomalies de nombre en mosaque Les anomalies de nombre en mosaque rsultent de la non-sparation dune paire de chromosomes aprs quelques mitoses de la cellule uf qui, initialement, avait un caryotype normal. Lindividu issu de cet uf possdera donc des cellules au caryotype normal et des cellules au caryotype anormal.

Nous venons de voir que, dans lespce humaine, les anomalies de nombre des chromosomes se traduisent lorsquelles sont viables par des phnotypes associs des maladies plus ou moins graves.

Comment des anomalies de nombre pourraient-elles contribuer la


diversification des gnomes ?

b) La polyplodie contribue la diversification des gnomes


La plodie est le nombre de jeu de chromosomes cest--dire le nombre de copies des diffrents chromosomes formant le gnome. Dans le noyau des cellules humaines, il y a deux copies de chaque chromosome. On parle alors de diplodie. Quand le nombre de lots de chromosomes est suprieur deux, on parle de polyplodie. Ainsi, on connat des organismes qui possdent trois lots de chromosomes (triplode), des organismes qui possdent quatre lots de chromosomes (ttraplodes) Le bl tendre (42 chromosomes), une gramine du genre triticum utilise pour la fabrication de la farine, est un organisme hexaplode et possde donc six jeux de chromosomes.

46

Squence 4 SN02

Cned Acadmie en ligne

travers lexemple des spartines, nous allons chercher prciser les mcanismes pouvant expliquer ce phnomne et son importance dun point de vue volutif.

Activit 2

Schmatiser un exemple de polyplodie et montrer son rle dans la spciation Les spartines sont des gramines qui occupent les zones sales des bords de ctes. Jusquen 1870, on ne rencontrait que deux espces de spartine : Spartina maritima sur les ctes europennes et Spartina alterniflora sur les ctes amricaines. En 1880, sur les ctes anglaises, est recense une troisime espce jusqualors inconnue, qui est nomme Spartina anglica. Ces trois espces possdent des caryotypes diffrents : Spartina maritima : 2n= 60 Spartina alterniflora : 2n= 62 Spartina anglica : 2n = 122 Comment Spartina anglica sest-elle forme ? Les scientifiques expliquent que, dans un premier temps, Spartina maritima et Spartina alterniflora se sont croises formant un hybride viable mais strile avant quun phnomne de polyplodisation ne restaure la reproduction sexue de lhydride. Ce dernier devenant alors une nouvelle espce, Spartina anglica.
1 Schmatiser les vnements cellulaires qui ont permis la formation

de Spartina anglica en vous aidant du document 8. (Afin de simplifier, on prendra pour Spartina maritima 2n = 4 et pour Spartina alterniflora 2n = 2). Vous devez expliquer la formation de lhybride, lorigine de sa strilit et la formation de Spartina anglica partir de cet hybride.
Aide la ralisation

Commencer par la ralisation des schmas de miose pour une espce, puis lautre. Envisager la fcondation entre deux des gamtes obtenus lissue des mioses. Expliquer la strilit de lhybride. Expliquer et schmatiser le mcanisme permettant le rtablissement de la fertilit et la formation dune nouvelle espce.

Squence 4 SN02

47

Cned Acadmie en ligne

2 Lactivit Pour dbuter a mis en relief quelques donne tonnantes

concernant la taille des gnomes. Proposer une explication en utilisant les informations de cette activit.
Document 8

La polyplodie, un mcanisme important sur le plan volutif


La polyplodie est un phnomne trs rpandu chez les vgtaux qui a contribu lvolution des plantes fleurs. Ainsi, le gnome de lanctre commun aux plantes fleurs rsulterait de trois fusions de gnomes. Par la suite, de nombreuses autres fusions de gnomes serait lorigine de la diversification des plantes fleurs. La polyplodie est peu rpandue dans le monde animal, ce qui pourrait sexpliquer par la production dindividus striles. En effet, chez de nombreuses espces, le sexe est dtermin par la garniture chromosomique de la cellule uf. Plusieurs mcanismes peuvent tre lorigine du phnomne de polyplodie. Le plus courant est une anomalie survenant lors dune mitose. Les chromosomes dupliqus ne sont pas rpartis dans les deux cellules filles car la cytokinse, cest--dire la division du cytoplasme, ne se ralise pas. lissue de la mitose, le noyau renferme donc deux fois plus de chromosomes que le noyau de la cellule mre. Ce phnomne est nomm endorplication et peut se produire spontanment ou tre induit par un stress thermique ou lemploi de colchicine. La colchicine est un alcalode extrait de la colchique. Cette molcule empche la dpolymrisation des microtubules au moment de la mtaphase. La polyplodie peut galement avoir pour origine lhybridation de deux gnomes appartenant des espces proches dun point de vue gntique mais nanmoins diffrentes. Les chromosomes sont en partie homologues, ce qui pose des problmes au moment de la miose et induit une strilit des hybrides. La fertilit peut tre restaure par un mcanisme dendorplication. Dans certains cas, la polyplodie a pour origine la fusion entre un gamte diplode et un gamte haplode conduisant la formation dindividus triplode striles. Le fait que la polyplodie soit rpandue chez les vgtaux est certainement li leur capacit se reproduire par multiplication vgtative, ce qui vite les problmes poss par lappariement de chromosomes dorigine diffrente lors de la miose. Les polyploidies sont parfois crs et exploits par lHomme des fins commerciales et/ou agronomiques. Les truites triplodes et les hutres triplodes sont striles et peuvent donc tre commercialises toute lanne. De nombreuses espces cultives sont soit autopolyplodes portant plusieurs exemplaires dun mme gnome (ex. : luzerne, pomme de terre, trfle, orangers), soit allopolyplodes prsentant des gnomes de plu-

48

Squence 4 SN02

Cned Acadmie en ligne

sieurs espces apparentes au niveau diplode (ex. : bl dur, bl tendre coton, colza, tabac, fraisier, prunier domestique). Les avantages sont divers : production de fruits sans ppins, obtention de fruits plus gros, de plantes plus grandes Certains scientifiques ont propos, pour expliquer lorigine de la diversification importante des vertbrs constate il y a 500 Ma, quil y aurait eu deux duplications compltes du gnome. Ce rservoir de nouveaux gnes aurait permis lacquisition de nouvelles fonctions et laccroissement de la complexit et de la diversification.
retenir La polyplodie caractrise les organismes qui possdent plus de deux jeux complets de chromosomes dans leur gnome. Ce phnomne contribue la complexification du gnome et la diversification gntique des tres vivants. Il peut tre lorigine de lapparition dune nouvelle espce par hybridation et est donc un mcanisme important sur le plan volutif. En effet, la duplication du gnome offre un large potentiel dinnovation et donc dadaptation des espces car les gnes dupliqus peuvent diverger. On doit galement noter que lhybridation conduit la fusion de gnes despces diffrentes. Ce phnomne de polyplodisation peut galement expliquer la taille importante des gnomes constats chez certains vgtaux chez qui ce phnomne est courant : 50 % 80 % des plantes fleurs sont nes danomalies de la division cellulaire ayant entran un assortiment supplmentaire de chromosomes.

2. Les remaniements chromosomiques modifient la structure des chromosomes


Le nombre de chromosomes dun individu au sein dune population peut tre conforme celui de lespce laquelle il appartient alors quune observation attentive de chaque chromosome peut rvler des remaniements dans la structure dun ou de plusieurs chromosomes.

Comment la structure des chromosomes peut-elle tre modifie ? a) Les principaux types de remaniements chromosomiques
Ces remaniements chromosomiques ont toujours pour origine deux coupures de la molcule dADN. Selon le devenir du fragment dADN coup, on distinguera les dltions, les duplications, les translocations et les inversions. Dans tous les cas, les extrmits encadrant la coupure sont ressoudes .

Squence 4 SN02

49

Cned Acadmie en ligne

Si le fragment dADN coup est perdu, cette perte dADN est lorigine dune dltion. Le fragment dADN peut tre recoll sur place mais lenvers, gnrant alors une inversion. Le fragment dADN coup peut aussi tre recoll sur un autre chromosome et tre ainsi lorigine dune translocation. Les duplications ont pour consquence la prsence, sur un chromosome, de deux exemplaires dune mme copie dun fragment de chromosome. Ces remaniements chromosomiques surviennent nimporte quel endroit du gnome. Ils se produisent au cours des divisons cellulaires au moment de lappariement et de la disjonction des chromosomes homologues. Si les dltions sont le plus souvent ltales, les translocations, duplications et inversions peuvent tre lorigine dinnovations gntiques qui, dans certains cas, peuvent conduire la formation de nouvelle espces.

Activit 3
Question

Identifier quelques remaniements chromosomiques Le document 9 schmatise diffrents remaniements chromosomiques. Retrouver quel type de remaniement chromosomique correspond chaque schma.

Document 9

Diffrents remaniements chromosomiques


A partir d'un chromosome

A partir de deux chromosomes

Ces remaniements sont souvent associs des pathologies et sont le plus souvent limins par la slection naturelle.

Comment les remaniements chromosomiques peuvent-ils tre lorigine dune diversification gntique ?

50

Squence 4 SN02

Cned Acadmie en ligne

b) Importance des remaniements chromosomiques dans lvolution des espces


Les cytognticiens ont depuis longtemps prcis le nombre et lampleur des remaniements chromosomiques existant entre le caryotype 46 chromosomes de lhomme et celui 48 du chimpanz.

Activit 4

Retrouver les traces de remaniements chromosomiques dans le caryotype de deux espces prsentant une troite parent En utilisant les documents ci-dessous et vos connaissances, montrer que les diffrences observes entre le caryotype du chimpanz et celui de lhomme peuvent sexpliquer par des remaniements chromosomiques.

Question

Document 10

Arbre phylogntique des grands singes

Gibbon

Orang-Outan

Gorille

Chimpanz

Bonobo Humain

Temps

Le document 11 est un montage dans lequel on a schmatis cte cte les chromosomes humains et les chromosomes du chimpanz. Un seul chromosome de chaque paire est reprsent. Les bandes blanc et noir ou vert et blanc reprsentent les bandes de coloration typique de chaque chromosome qui apparaissent aprs que les chromosomes ont subi un traitement particulier. noter que les chromosomes sont isols la mtaphase de la mitose aprs blocage de celle-ci.
Document 11

Comparaison du caryotype dun humain (en noir) et dun chimpanz


H C H C Chromosome humain Chromosome correspondant chez le chimpanz Zone diffrente Perte d'un fragment de chromosome Ajout d'un fragment de chromosome Duplication d'un fragment de chromosome Retournement d'un fragment de chromosome

Remarque Les toiles indiquent des segments de chromosomes identiques si on les retourne .
1
H C

H C

H C

H C

H C

H C

H C

H C

H C

10

H C

11

H C

12

H C

13

H C

14

H C

15

H C

16

H C

17

H C

18

H C

19

H C

20

H C

20

H C

22

HC

X
HC

Squence 4 SN02

51

Cned Acadmie en ligne

retenir Des dltions, des inversions, des translocations ou des duplications peuvent modifier la structure des chromosomes. lchelle des individus, les rpercussions phnotypiques sont variables. Certains chercheurs pensent que ces remaniements chromosomiques jouent un rle important sur le plan volutif, en particulier dans la formation de nouvelles espces.

c) Les duplications de gnes ont permis lenrichissement des gnomes au cours du temps
Les duplications sont lorigine de lapparition sur un chromosome de deux copies dun mme fragment de chromosomes. Dans certains cas, ces deux copies sont des gnes cest--dire quils codent pour des protines.

Comment ces duplications peuvent-elles tre lorigine de la complexification du gnome au cours du temps ?

Activit 5

Montrer le rle des duplications dans la formation de familles multigniques travers lexemple de la famille des globines
1 En utilisant les diffrentes ressources (diaporama, logiciel Phylogne,

documents), rechercher des indices tmoignant de la parente des globines et proposer une hypothse sur lorigine de cette parent. Votre production devra prsenter un texte argument qui comprendra la matrice des distances construite avec le logiciel Phylogne.
Aide lutilisation de Phylogne

Tlcharger le logiciel sur le site de lInrp (sur ce site, vous pouvez consulter le dossier documentation du logiciel). Menu Fichier puis Ouvrir, fichier molcules : choisir Hominins (ouvrir) puis molcules (ouvrir), familles multigniques (ouvrir), famille globine (ouvrir), globines aln (ouvrir). Chaque acide amin est reprsent par une lettre majuscule. Les lettres rouges correspondent aux acides amins identiques la squence alpha 1 prise comme rfrence. Slectionner en cliquant : alpha1, Zeta, gamma A, epsilon, delta et beta. Le bouton matrice des distances permet dafficher dans un tableau une comparaison quantitative des acides amins de chaque globine.

52

Squence 4 SN02

Cned Acadmie en ligne

Cliquer sur le bouton Options puis choisir longlet Distances puis pourcentage avec dltions ignores pour lensemble. Vous obtenez la matrice des distances qui reprsente le pourcentage dacides amins diffrents des globines prises deux deux. Information Il existe 20 acides amins. Si ces 20 acides amins taient galement utiliss dans les squences protiques, la probabilit davoir entre deux squences non apparentes (donc due au hasard) le mme acide amin un site dtermin serait de 5 %. On considre que les ressemblances indiquent une parent au-del de 20 % didentit de squence dacides amins entre deux protines.

Document 12

Informations sur les globines humaines et les gnes codant ces globines
Les globines humaines sont des protines reprsentes dune part par les globines qui constituent lhmoglobine et dautre part par la myoglobine prsente dans les cellules musculaires. Chaque molcule dhmoglobine est constitue par lassociation de quatre chanes polypeptidiques identiques deux deux : les globines. Ces chanes possdent une partie non protique quon nomme hme et qui fixe un atome de dioxygne. Toutes les chanes dhmoglobine participent au transport du dioxygne et sont synthtises dans les rythroblastes, cellules souches des globules rouges. Reprsentation simplifie dune molcule dhmoglobine dun adulte
Hme

Globine alpha

Globine beta

Les diffrentes chanes existantes sont identifies par des lettres grecques. Ainsi, on parle de chanes alpha, bta, gamma, delta, zta. Au cours du dveloppement de lorganisme humain, diffrentes molcules dhmoglobine sont synthtises (voir graphe ci-aprs). Quel que soit le stade de dveloppement, lhmoglobine est constitue de deux chanes se rattachant au groupe (alpha) [ou (zta)] et de deux chanes se rattachant au groupe(bta) [,(delta),(gamma),(epsilon)].

Squence 4 SN02

53

Cned Acadmie en ligne

Les diffrentes chanes de globines participant la formation de lhmoglobine au cours du dveloppement de lhomme
Expression des gnes de globine

globine globine globine globine globine globine

-6

-3

0 Naissance

Temps (mois)

Chaque globine est code par un gne diffrent ; les gnes des globines sont rpartis sur deux chromosomes : 16 et 11. Les gnes colors en noir reprsentent des pseudognes (mme structure que les gnes de globines) mais qui ne codent pas pour des protines fonctionnelles.
gne de la globine Le chromosome 11 humain : gne de la globine Le chromosome 16 humain :

gne de la globine

pseudogne pseudogne

pseudogne gne de la globine gne de la globine

pseudogne gne de la globine

2 Utiliser le logiciel Phylogne pour prouver lhypothse formule la

question prcdente.
Aide la ralisation
Construire

la matrice des distances pour les globines (alpha1, beta, gamma A, epsilon, delta, zta). Ne pas oublier daligner les squences. La globine alpha1 est prise comme rfrence avec les autres. Choisir pourcentage et dltions ignores dans longlet Options.

54

Squence 4 SN02

Cned Acadmie en ligne

On a constat que toutes les globines sont codes par des gnes diffrents mais prsentent des similitudes dans leurs squences nucliques attestant de leur parent. Ces gnes peuvent tre runis au sein dune famille. Comment expliquer cette parent ?
3 partir des informations apportes par les documents ci-dessous et

de vos rsultats prcdents, expliquer comment se forme une famille multignique et construire larbre volutif de la famille des globines. On se limitera lhistoire des gnes du groupe des globines beta (tous situs sur le chromosome 11).
Document 13

Un crossing-over ingal est lorigine des duplications


La forte homologie qui existe entre les gnes dune mme famille montre quils drivent dun gne ancestral commun qui sest dupliqu notamment par enjambement ingal. Lvolution des gnes dune mme famille seffectue de manire indpendante et divergente. En prophase 1 de miose, il arrive que deux chromosomes homologues apparis ne se brisent pas au mme niveau, ce qui entrane une duplication de gnes sur un chromosome et une suppression sur lautre. On appelle ce phnomne un enjambement ingal (crossing-over ingal). Ce phnomne est favoris par lexistence sur les chromosomes de squences identiques qui sapparient alors de faon dcale.
Crossing-Over gal lieu du crossing-over

Crossing-Over ingal

lieu du crossing-over

Gnes codant pour une protine

Squences d'ADN identiques

Au cours de ce phnomne, les changes de matriel gntique entre les chromosomes homologues apparis ne sont pas symtriques. Un des deux chromosomes perd une certaine quantit dADN qui est gagne par lautre.

Squence 4 SN02

55

Cned Acadmie en ligne

Document 14

Schmatisation des duplications, transpositions (dplacement sur un autre chromosome), mutations partir dun gne ancestral
Actuel Chromosome a Chromosome b Mutation (s) Mutation (s) Mutation (s)

TEMPS

Mutation (s) Mutation (s)

Duplication

Mutation (s)

Duplication Transfert Chromosome a Chromosome b

Document 15

Les donnes croises des zoologistes et palontologues ont permis de dater lapparition des diffrentes globines (voir tableau ci-dessous)
Plus ancien fossile connu Lamproie Poissons machoire Lzards, serpents Mammifres Oiseaux Primates 500 Ma 450 Ma 300 Ma 220 Ma 150 Ma 65 Ma Aide la ralisation
Utiliser

Globine possde(s) et , et , et , et , , , et

les rsultats de la matrice des diffrences entre les gnes obtenues avec le logiciel Phylogne. Construction dun arbre avec le logiciel Phylogne (arbre).
4 En utilisant le document ci-dessous et les connaissances acquises

au cours de cette activit, identifier dans les affirmations ci-dessous celles qui sont exactes. Vous devez corriger ou complter les affirmations fausses ou incompltes.
Document 16

La myoglobine appartient la famille des globines


Le gne ancestral commun aux diffrentes globines a galement donn naissance la myoglobine, une protine prsente dans les muscles squelettiques des vertbrs. Elle est forme chez lhomme dune chane unique de 153 acides amins. Elle sert au transport de loxygne et sa mise en rserve dans les muscles.

56

Squence 4 SN02

Cned Acadmie en ligne

Tous les vertbrs possdent de la myoglobine et les poissons sans mchoire (agnathes) apparus il y a environ 500 Ma possdaient dj cette protine.
Une

famille multignique :

a) est un ensemble dallles codant des protines ayant la mme fonction. b) est un ensemble de gnes codant des protines ayant la mme fonction. c) comprend des gnes ayant des squences nuclotidiques diffrentes. d) drive dun gne ancestral par accumulation de mutations.
Les

pseudognes :

a) sont des gnes qui nont jamais t fonctionels. b) confirment le caractre alatoire des mutations. c) codent pour des protines fonctionelles. d) ont accumul une mutation codant pour un codon stop.
Les

familles multigniques :

a) montrent que les gnomes se diversifient par cration de nouveaux gnes partir de gnes existants. b) sont le tmoin dinnovations gntiques survenues dans le pass de lespce. c) ont pour origine une modification de la structure des chromosome. d) ont pour origine une modification du nombre de chromosomes.
retenir

Au sein du gnome dune espce, des gnes diffrents codent pour des protines trs proches dites homologues. Ils prsentent des similitudes au niveau de leur squence nuclotidique tmoignant dune origine commune. Chez lhomme, il existe, en effet, plusieurs gnes codants pour des sous-units de lhmoglobine diffrentes, situs sur les chromosomes 11 et 16. Aprs avoir tudi leur squence, les biologistes pensent que ces gnes drivent dun gne ancestral commun. Ces gnes homologues constituent une famille multignique. Une similitude suprieure 25 % des nuclotides ne peut tre due au hasard et indique une parent entre les gnes correspondants. Les similitudes entre gnes sinterprtent comme le rsultat dune ou plusieurs duplications partir dun gne ancestral. La duplication gnique est un mcanisme gntique faisant appel, entre autres, au crossing-over ingal partir duquel on retrouve deux gnes identiques la place dun seul sur un mme chromosome.

Squence 4 SN02

57

Cned Acadmie en ligne

Ces gnes sont par la suite dupliqus plusieurs fois et les copies ont ensuite diverg par accumulation de mutations pour donner les gnes des familles actuelles. Les mutations sont alatoires. Les multiples copies du gne ancestral peuvent donc connatre plusieurs volutions possibles. Dans certaines copies, il apparat des mutations lorigine dun codon-stop par exemple. Ces copies ne codant plus pour des protines fonctionnelles sont des pseudognes. Certaines copies codent pour des protines ayant des fonctions identiques alors que, dans dautres cas, les mutations accumules sont lorigine de copies codant pour des protines ralisant de nouvelles fonctions. Les copies du gne issues des duplications peuvent rester proches sur les mmes chromosomes, ou tre localises sur des chromosomes diffrents (transposition). Une telle famille de gnes illustre bien comment a pu stablir la complexification du gnome par duplications de gnes puis mutations successives. La duplication gnique est donc un processus innovant lorigine de gnes nouveaux.

3. Lacquisition de gnes par transfert horizontal


Activit 6
Document 17

Montrer comment les virus ont contribu la complexification des gnomes

Un gne dorigine rtrovirale essentiel pour la formation du placenta


Les virus sont dpourvus de mtabolisme et ne possdent pas dorganites. Ils possdent cependant leur propre information gntique sous forme dADN ou dARN. Chez les rtrovirus cette information gntique est forme dARN. Les rtrovirus ont galement la particularit de possder un enzyme, la transcriptase inverse. Afin de se reproduire, les virus doivent pntrer dans une cellule hte. Ils utilisent la machinerie cellulaire de la cellule parasite qui va faire fonctionner le matriel gntique du virus. La cellule fabrique alors de nombreuses particules virales qui sont libres et infectent de nouvelles cellules. Les virus sont des parasites intracellulaires obligatoires. Les rtrovirus infectieux possdent la proprit remarquable de sintgrer dans lADN de nos chromosomes. En gnral, les cellules infectes sont des cellules somatiques qui ne sont pas impliques dans la transmission de notre patrimoine gntique. Cependant, lorsquun rtrovirus

58

Squence 4 SN02

Cned Acadmie en ligne

parvient infecter une cellule de la ligne germinale, le rtrovirus intgr peut se transmettre la descendance comme nimporte quel gne : il devient alors un rtrovirus endogne . Le gnome de tous les vertbrs est ainsi envahi par de telles structures et le squenage systmatique dun grand nombre de gnomes, dont ceux de lhomme et de la souris, montre que les rtrovirus endognes reprsentent prs de 8 % du matriel gntique de ces espces. Fort heureusement, la plupart des rtrovirus endognes sont inactifs, en raison daltrations gntiques, ou de la rpression de leur expression par diffrents systmes de contrle dvelopps par la cellule. Quelques rares lments sont cependant toujours capables de produire des protines dorigine rtrovirale. Parmi celles-ci, on trouve des protines denveloppe exprimes la surface de certaines cellules et qui ont gard une des proprits canoniques de leur anctre rtrovirus , savoir la capacit faire fusionner deux membranes lipidiques entre elles. Cette proprit est essentielle pour le rtrovirus car elle lui permet dentrer dans la cellule par un mcanisme de fusion de la membrane virale avec celle de la cellule infecte. Elle permet galement la fusion de deux cellules entre elles lorsque cette protine denveloppe sexprime la surface de lune dentre elles et que la cellule partenaire possde sa surface un rcepteur pour cette protine denveloppe. Cest le cas pour deux gnes du gnome humain dorigine rtrovirale, exprims spcifiquement au niveau du placenta, et qui possdent effectivement la capacit de faire fusionner des cellules entre elles, dans des tests raliss sur des cellules en culture. Ces phnomnes de fusion cellulaire conduisent la formation de structures gantes appeles syncytias , constitues par la runion de cellules individuelles en une seule nappe cellulaire multinucle. Cette proprit a conduit nommer les deux gnes en question gnes de syncytines et faire lhypothse que les protines codes par ces fameux gnes pourraient tre responsables de la formation dun constituant essentiel du placenta appel le syncytiotrophoblaste. Cette structure cellulaire constitue une interface continue et une zone dchange entre le sang maternel et le sang ftal. Elle joue un rle crucial pour la survie du ftus et serait ncessaire pour ltablissement de la tolrance immunitaire materno-ftale. Afin de valider cette hypothse, les chercheurs ont tout dabord recherch la prsence de gnes de syncytines chez la souris, un mammifre dont on peut aisment manipuler le gnome. De manire tout fait surprenante, ils ont dcouvert deux gnes, qui ne sont pas les orthologues des gnes humains mais qui en possdent nanmoins toutes les proprits. Ils prsentent une expression restreinte au placenta et les protines pour lesquelles ils codent sont dotes de la proprit de fusion cellulaire. Les chercheurs ont invalid lun des gnes de syncytines chez la souris. Les animaux porteurs du gne invalid ltat htrozygote sont parfaitement viables. Cependant, lorsque deux individus htrozygotes sont croiss entre eux, aucun descendant porteur de la dltion du gne syn-

Squence 4 SN02

59

Cned Acadmie en ligne

cytine ltat homozygote nest identifi. Plus prcisment, une tude des embryons et de leur placenta in utero en cours de gestation met en vidence une mort prcoce des embryons homozygotes pour la dltion. Lanalyse fine des placentas correspondants fait apparatre un dfaut de syncytialisation , qui se traduit par un transport transplacentaire trs altr, une rduction de la croissance et in fine la mort des embryons.
1 Rdiger un texte expliquant comment le matriel gntique des rtro-

virus peut intgrer le gnome des cellules eucaryotes et complter les schmas ci-dessous en utilisant les mots suivants : ADN viral, ARN viral, transcription, traduction, protines virales, fusion des membranes, transcriptase inverse, ADN de la cellule hte.
Document 18

Schma simplifi dun rtrovirus


Protine servant la reconnaissance et la fusion avec la cellule cible Membrane lipidique Gnome ARN Enzymes (transcriptase inverse) Capside protique Taille : 120 nm

La transcriptase inverse est une enzyme qui copie lADN en ARN.


Document 19

tapes de lintgration dun rtrovirus dans le gnome dune cellule eucaryote

tape 1

tape 3

tape 2

tape 4

60

Squence 4 SN02

Cned Acadmie en ligne

tape 5

tape 7

tape 6

tape 8

2 Rechercher dans le texte scientifique lhypothse pose par les cher-

cheurs. Pour rpondre quel problme ?


3 Les gnes de syncythines dcouverts chez la souris et les gnes

dcouverts chez les tres humains sont-ils issus dun mme gne ancestral ? Dans le cas contraire, comment expliquer leur prsence chez les primates et les rongeurs ?
4 Lexprience ralise par les chercheurs valide-t-elle lhypothse

pose ?
5 Les mammifres placentaires sont apparus il y a 100 Ma environ.

Formuler une hypothse pour expliquer leur apparition.


retenir Les rtrovirus intgrs dans le gnome humain forment 10 % de ce gnome. Les transferts de gnes entre espces diffrentes savrent frquents et participent lvolution des gnomes. Ils peuvent en outre tre lorigine dinnovations volutives.

4. Des squences mobiles au sein des gnomes


Dans les annes 1940, Barbara McClintock, en travaillant sur la coloration de mas, dmontre lexistence de fragments dADN qui se dplacent au sein du gnome. Ces courtes squences dADN produisent des copies delles-mmes et ces copies sinsrent en diffrents endroits du gnome ou bien la squence dADN est excise de son site initial et sinsre un autre endroit du gnome.

Squence 4 SN02

61

Cned Acadmie en ligne

Ces lments mobiles ont t nomms par les chercheurs lments transposables ou transposons. Ces courtes squences dADN ne codent pas pour des protines qui pourraient tre utiles lorganisme hte mais simplement pour des protines qui leur permettent de sintgrer dans le gnome. Les chercheurs estiment que le pourcentage de ces transposons atteint 40 % chez lhomme et que chez certains organismes la proportion de transposons au sein du gnome peut atteindre 75 %. Llment transposable alu est prsent en plus de 300 000 copies dans le gnome humain et reprsente 6 % du gnome. Linsertion de llment transposable est alatoire. Il peut sintgrer dans un exon ou dans un intron, ce qui conduit llaboration de protines le plus souvent non fonctionnelles. Mais le transposon peut sintgrer dans une partie non codante du gnome ou dans les squences qui rgulent lexpression des gnes. Ces squences dADN non codantes dterminent o et quand les gnes sexpriment cest--dire codent pour de protines. La modification de la rgulation de lexpression des gnes peut tre lorigine dune nouveaut volutive. La prsence en plusieurs exemplaires de ces squences identiques favorise galement les recombinaisons chromosomiques au moment des divisons cellulaires, ce qui donne naissance des inversions ou des dltions. Les transposons sont donc une source de variabilit gntique.

Bilan du chapitre
Nous avons cherch montrer que la complexit dun gnome un moment donn est le fruit dune volution passe et la possibilit dune volution future. Le gnome doit donc tre saisi dans une perspective dynamique. Des remaniements chromosomiques, des duplications de gnes, des duplications du gnome, mais galement des transferts horizontaux de gnes cest--dire dune espce une autre, contribuent la diversification gntique du vivant. Ce chapitre a permis de montrer que le gnome nest pas fig dans le marbre mais prsente une dynamique qui a contribu la diversification gntique du vivant. Des erreurs survenant lors de la formation des gamtes ou lors de la mitose dautres types de cellules peuvent gnrer des anomalies, que ce soit sur le plan du nombre de chromosomes ou de la structure de chromosomes.

62

Squence 4 SN02

Cned Acadmie en ligne

Les anomalies de nombre peuvent se matrialiser par un chromosome en plus ou en moins dans le caryotype. Certaines de ces anomalies sont lorigine de maladies graves chez lhomme. Un doublement complet du gnome dune espce aboutit la polyplodie qui a jou un rle majeur dans lvolution des espces vgtales. Ce phnomne peut expliquer la taille consquente des gnomes de certains vgtaux. Les remaniements de structure (translocation, inversion, dltion, duplication) se traduisent par des fragments de chromosomes manquants ou supplmentaires. Translocation, inversion et dltion ont jou un rle dans lmergence de la ligne humaine partir du dernier anctre commun. Le phnomne de duplication ayant pour origine un crossing-over ingal lors de la miose a donn naissance des familles mutigniques que lon sait nombreuses au sein des gnomes. Les gnes dupliqus permettent lapparition de nouvelles fonctions ou loptimisation de certaines fonctions. Des transferts de gnes entre espces diffrentes et loignes sont attests et ont pu tre lorigine dinnovations volutives. La multiplicit des exemples tudis montre que le matriel chromosomique est trs mallable et que cest au niveau molculaire que se manifeste le plus clairement laspect bricoleur de lvolution.

Squence 4 SN02

63

Cned Acadmie en ligne

Chapitre

5 A

La gntique du dveloppement et la comprhension des mcanismes volutifs

Pour dbuter
Au cours du XIXe puis du XXe sicle, la suite de Darwin, lide de parent entre tous les tres vivants sest impose. Tous les organismes sont donc drivs dun anctre commun. Pourtant, il est ais de constater des diffrences importantes dans lorganisation ou larchitecture des diffrents organismes. En effet, quoi de commun entre une mouche et une souris ? Se pose la question des mcanismes lorigine de changements aussi importants de la morphologie. Au dbut du XXe sicle, sappuyant sur les dcouvertes ralises dans le domaine de la gntique, les chercheurs proposent une thorie rendant compte de lapparition des espces au cours du temps. Selon celle-ci, les tres vivants se transformeraient par accumulations de petites mutations, modifications gntiques alatoires, des gnes synthtisant des protines quon nomme gnes de structure. Ces mutations tries par la slection naturelle conduiraient graduellement la formation de nouvelles espces. Lvolution serait donc le rsultat dune somme de micromutations produisant avec le temps une volution importante. Si cette thorie est tout fait pertinente pour expliquer les diffrences entre espces voisines, sest pose la question de savoir si elle pouvait expliquer lapparition de diffrences majeures telle lapparition dun nouveau plan dorganisation. Par ailleurs les archives palontologiques montrent lapparition soudaine (du moins lchelle des temps gologiques) dinnovations morphologiques et fonctionnelles, ce qui ne cadre pas vraiment avec les modifications graduelles voques ci-dessus. Le dveloppement ou ontogense est lensemble des tapes qui conduisent de la cellule uf lorganisme adulte. Les reprsentants dune espce donne prsentent au fil des gnrations un plan dorganisation identique suggrant que cette mise en place est rgie par une information gntique. De la mme manire, des diffrences sur le plan morphologique entre les espces doivent galement mobiliser les gnes participant la construction dun organisme. Malgr ces vidences, ce nest que dans les annes 1990 quune nouvelle discipline, lvo-dvo (pour volution et dveloppement )

64

Squence 4 SN02

Cned Acadmie en ligne

a vu le jour. Elle utilise les apports des mcanismes impliqus dans le dveloppement la comprhension de lvolution.

Quels sont les apports de la connaissance des mcanismes du dveloppement la comprhension des mcanismes volutifs ?

Cours
On cherchera montrer que des formes vivantes peuvent rsulter de variations dans la chronologie et lintensit dexpression de gnes communs plus que dune diffrence gntique.

1. Les gnes de dveloppement impliqus dans la construction dorganismes trs diffrents ont t conservs au cours de lvolution
a) Les mutations homotiques ont rvl lexistence de gnes de dveloppement particuliers: les gnes homotiques Activit 1
Identifier le rle des gnes homotiques Bateson, un biologiste de la fin du XIXe sicle, constate lexistence de variations brusques dans la morphologie des populations naturelles quil observe. Il formule le postulat que les grandes variations morphologiques ont jou un rle essentiel dans lvolution des plans dorganisation. Parmi les mutations quil dcrit, il nomme transformations homotiques les transformations par lesquelles une partie du corps dun organisme prend la forme dune autre partie. Comme pour les brassages chromosomiques, les drosophiles constituent un modle de choix pour ltude des mutations homotiques mais ces transformations homotiques sont galement observes chez les vgtaux o des tamines, par exemple, peuvent tre remplaces par des ptales.
1 Comparer les phnotypes sauvages et les mutants et dcrire la trans-

formation homotique observe.


Document 1

Comparaison du phnotype sauvage et de mutants chez des drosophiles

Squence 4 SN02

65

Cned Acadmie en ligne

Remarque Les gnes de structure sont des gnes codant pour une protine donne.

2 En utilisant vos connaissances, montrer que ces

transformations sont difficilement explicables par des mutations sur des gnes de structure.

Ce nest que cinquante ans aprs les observations de Bateson que des chercheurs dmontrent lexistence, chez les drosophiles, de gnes lorigine de ces transformations spectaculaires. Ces gnes sont nomms gnes homotiques et appartiennent la catgorie des gnes de dveloppement.
Document 2

Le complexe des gnes de dveloppement de la drosophile


Chez la drosophile, les gnes homotiques sont situs sur le chromosome 3. Ces gnes sont regroups en complexes : le complexe Antennapedia et le complexe Bithorax. Toutes les cellules, donc toutes les rgions du corps, les possdent mais ils ne sont actifs que dans une rgion prcise, dtermine. Les caractres de chaque rgion du corps, au cours du dveloppement, sont dtermins par les gnes actifs de ce complexe. Les gnes homotiques assignent une identit spatiale aux cellules embryonnaires le long de laxe antropostrieur cest--dire en imageant quils indiquent aux cellules quelles font partie de la tte, du thorax ou de labdomen. Chose remarquable, les gnes sont disposs sur le chromosome dans lordre o sont disposes les rgions dont ils commandent le dveloppement. Il existe en somme un plan, un patron, une reprsentation gntique du corps.
Complexe Antennapedia Complexe Bithorax

Gnes homotiques ports par cette cellule uf

Chromosome 3
Cellule uf de drosophile Larve de drosophile en cours de dveloppement (les couleurs correspondent aux gnes homotiques contrlant cette zone) Drosophile adulte

Document 3

Consquence des mutations sur les gnes homotiques


Les mutations sur les gnes homotiques peuvent schmatiquement se rsumer une perte ou un gain de fonction. La mutation gain de fonction aura pour consquence quun gne homotique sexprimera dans une rgion o il est normalement prsent mais ne sexprime pas. Par expression dun gne, on doit comprendre quil sera transcrit en ARN messager codant pour des protines spcifiques. Un gne homotique commandant le dveloppement dune rgion donne bloque lexpression du gne situ antrieurement sur le chromosome.

66

Squence 4 SN02

Cned Acadmie en ligne

Ub ad x b ad A bB

b pb Df d Sc r An tp

La

Par contre, la perte de fonction dun gne, la suite dune mutation, commandant le dveloppement dune rgion donne la suite dune mutation, permettra lexpression dans cette rgion du gne homotique situ en position antrieure sur le chromosome.
3 En utilisant les documents 2 et 3, proposer une explication lorigine

de la mouche quatre ailes rencontre prcdemment.


retenir Les gnes homotiques sont des gnes de dveloppement cest--dire quils interviennent durant la mise en place du plan dorganisation. Leur existence est rvle par des mutations. Au cours du dveloppement, ils dirigent, par exemple chez la drosophile, la formation des pattes ou des antennes au bon endroit. Les gnes homotiques existent galement chez les vertbrs. Chez la souris, les gnes homotiques sont regroups en quatre complexes HOX A HOX D. Des mutations de ces gnes de dveloppement entranent ainsi lapparition de vertbres cervicales la place des dorsales. Document 4

Les quatre complexes de gnes homotiques chez la souris


3 A1 A1 1 A1 0 A9
Chromosome 6 Chromosome 11

C1 3 C1 2 C1 1 C1 0 C9 C8 D1 3 D1 2 D1 1 D1 0 D9 D8

Chromosome 15 Chromosome 2
Cellule uf de souris

D4 D3

C3 C2 C1 D1
Embryon de souris en cours de dveloppement (les couleurs correspondent aux gnes homotiques contrlant cette zone)

Gnes homotiques ports par cette cellule uf

B6 B5 B4 B3 B2 B1

B9 B8 B7

A7 A6 A5 A4 A3 A2 A1

Souris adulte

Les mutations sur des gnes homotiques entranent des consquences phnotypiques importantes. Ce constat pose la question du mode daction des gnes homotiques.

Comment les gnes homotiques agissent-ils ? Comment une mutation sur un gne homotique peut-elle tre lorigine de modifications aussi spectaculaires ?

b) Le gnome est hirarchis


La reprsentation que lon se fait gnralement du gnome lissue de la classe de premire est que celui-ci est constitu dune succession de gnes codant pour des protines (enzymes, protines de structures).

Squence 4 SN02

67

Cned Acadmie en ligne

Labsence dune protine fonctionnelle ayant pour consquence lorigine dune maladie gntique, par exemple, sera interprte comme le rsultat dune mutation sur le gne de structure codant pour cette protine. Cette reprsentation est exacte mais doit cependant tre enrichie.

Activit 2

Montrer que lexpression des gnes est rgule


Remarque Lexemple utilis ci-dessous nest pas emprunt la gntique du dveloppement mais permettra de comprendre de manire simple la notion de rgulation des gnes.

Question

Montrer en utilisant les documents 5, 6 et 7 que ces rsultats suggrent quun changement dans la chronologie de lexpression dun gne peut se traduire par une diffrence phnotypique.

Document 5

Les adultes humains se rpartissent en deux phnotypes en ce qui concerne laptitude digrer le lactose
Les adultes humains se rpartissent en deux phnotypes en ce qui concerne laptitude digrer le lactose. Les uns nont quune aptitude trs faible digrer le lactose car ils ne produisent plus de lactase (ou trs peu). Ils sont dits lactase non persistants (LNP) ou intolrants au lactose. Les autres, qualifis de lactase persistants (LP), gardent laptitude digrer le lactose durant toute leur vie car leurs cellules intestinales continuent produire de la lactase. La lactase est une enzyme, donc une protine. Chez les individus au phnotype lactase non persistant , les manifestations dintolrance au lactose dbutent gnralement vers 3-5 ans et se traduisent par un ballonnement abdominal, des douleurs abdominales, des borborygmes et, dans les cas les plus nets, des diarrhes. Il faut bien voir que tous, durant les premires annes de la vie, exprimaient le gne de la lactase. Le phnotype dintolrance au lactose est donc totalement distinct du phnotype dficience congnitale en lactase. Des analyses ont montr que ce caractre tait gntiquement dtermin.

Document 6

Comparaison des squences codantes du gne de la lactase

68

Squence 4 SN02

Cned Acadmie en ligne

Document 7

Recherche dARN messager chez des individus lactase persistants et non persistants
Des chercheurs ont ralis des biopsies intestinales afin dtudier la production dARN messager chez les individus ayant le phnotype lactase non persistant (LNP) et lactase persistant (LP). Chez les individus LNP, aprs cinq ans, il ny a plus dARN messagers de la lactase. Cet exemple permet de faire voluer la notion de gne vue en classe de premire. En effet, les gnes comportent une portion transcrite en ARN messager et une portion non transcrite situe gnralement en amont du gne. Cette squence dite squence rgulatrice module lexpression du gne. Lexpression du gne est active quand des peptides codes dun gne rgulateur, les facteurs de transcription, se lient sur des sites spcifiques de la squence rgulatrice. Ce complexe form par lassociation du facteur de transcription et de la squence rgulatrice agit comme un commutateur en position ON / OFF et dclenche la transcription du gne en ARN messager.

Document 8

La rgulation de lexpression des gnes


Gne l'tat inactif Pas d'ARN produit Squence transcrite du gne Protines Gne l'tat actif ARN produit

Le bouton est en position "OFF", la lampe est teinte

Squence rgulatrice du gne

Le bouton est en position "ON", la lampe est allume

Peptides rgulateurs

Remarque La squence rgulatrice est de lADN. La forme dcoupe qui lui est donne sur ce dessin est l pour suggrer la ncessit dune complmentarit de forme avec les peptides rgulateurs.

On peut rsumer les diffrentes tapes sur le schma ci-aprs montrant la hirarchisation du gnome cest--dire le contrle de lexpression de certains gnes par dautres gnes.

Squence 4 SN02

69

Cned Acadmie en ligne

Gne rgulateur

ARN messager

Peptide=facteur de transcription

Fixation du facteur de transcription sur un site de liaison de la squence rgulatrice=position "ON"

Expression du gne

de structure

ARN messager

Protines

Remarque Les facteurs de transcription peuvent activer ou inhiber lexpression dun gne donn.

Toutes les cellules dun organisme contiennent les mmes gnes. Ce nombre est estim 20 000 pour lespce humaine. Il existe environ 200 types cellulaires et chaque type cellulaire assure une fonction diffrente et prsente par consquent un phnotype diffrent.

Les cellules nexpriment que les gnes en relation avec leur fonction. Par consquent, dans une cellule donne, la plupart des gnes sont inactifs. Dautres gnes, que lon qualifie de gnes domestiques, sont actifs dans la plupart des types cellulaires car ils codent pour des protines impliques dans des fonctions de base ncessaires au fonctionnement des cellules. Dans certaines circonstances, des signaux peuvent induire lexpression de certains gnes.
Cellule pancratique ON OFF ON ON Cellule visuelle OFF ON OFF ON Cellule hypophysaire OFF OFF OFF ON

Gne codant pour linsuline Gne rho Gne codant pour la LH Gne codant pour les protines des ribosomes retenir

Le gnome est hirarchis, ce qui signifie que certains gnes contrlent lexpression dautres gnes par lintermdiaire de facteurs de transcriptions se fixant de faon spcifique sur des sites de liaison situs sur les squences rgulatrices des gnes de structure.

70

Squence 4 SN02

Cned Acadmie en ligne

Le facteur de transcription rgule lexpression de gnes soit en activant, soit en inhibant leur expression. Au cours du dveloppement embryonnaire, les cellules se diffrencient. Or chaque cellule possde le mme gnome. La diffrenciation rsulte de facteurs de transcription qui activent ou rpriment certains gnes. Ce mcanisme de slection des gnes est le rsultat de nombreux niveaux de rgulation et de combinaisons de diffrents facteurs de transcription.

c) Des protines homotiques ont t conserves au cours de lvolution Activit 3


Document 9

Comparer les gnes de dveloppement pour en identifier les homologies de squence

Des gnes homobox


Des chercheurs ont dcouvert que les gnes homotiques de la drosophile possdent une squence commune de 180 paires de base quon nomme homobox (box) ou homobote. Cette squence de 180 paires de base code pour une squence de 30 acides amins nomme homodomaine.
Remarque Tous les gnes homotiques ne possdent pas cette squence et tous les gnes homobote ne sont pas des gnes homotiques.

Les chercheurs prcisent que tous les gnes homobox ont une origine volutive commune remontant plus de 500 millions dannes.
Document 10

Comparaison des squences nuclotidiques dune partie du gne Antennapedia de la drosophile, du gne Hox B6 de la souris et du gne Hox B6 de lhomme

Squence 4 SN02

71

Cned Acadmie en ligne

Document 11

Une drosophile transgnique


Cette drosophile a t obtenue par linjection dun gne Hox B6 de souris dans un uf de drosophile. Le gne Hox B6 a t incorpor au pralable dans un systme qui le rend actif particulirement au niveau de la tte.

Document 12

Squence de lhomodomaine de la protine Antennapedia de la drosophile et de lhomodomaine de protines homologues dautres espces
Drosophile Ver soie Abeillle Ver plat Oursin Ascidie Nemerte Amphioxus Grenouille Poulet Souris Homme
RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN ............................................................ .....................Y...................................... H..S...................K..............S...................DH ..........A..........Y......K......Q.V..S..................R S..T.TA..............Y...........S.......................... .......................K.................................... .......................K.................................... ...........................................................H ...........................................................H ...........................................................H ...........................................................H 100 % 98 % 90 % 88 % 90 % 98 % 98 % 98 % 98 % 98 % 98 %

Document 13

Disposition des gnes homotiques Hox B sur le chromosome 11 et squence de lhomodomaine de la protine code par quelques gnes Hox B de la souris
Chromosome 11 HoxB4 HoxB7 HoxB9 HoxB1
9 8 7 6 5 4 3 2 B B B B B B B B B 1

P KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKQKKDH R ..G.QT ...Y .T ..................I ........T .................KW SRKK.CP..KY.T .......L ..M ....D ..H.V.RL.N ................M ..LN .GGL..NF.TR.LT.......F.K..S.A......AT.G.N.T.V .............RE

72

Squence 4 SN02

Cned Acadmie en ligne

Document 14

Comparaison des squences des homodomaines de 346 protines homotiques connues chez diverses espces animales
On a compar les squences des homodomaines des 346 protines homotiques connues chez diverses espces danimaux. Le diagramme indique le nombre de protines dans lesquelles un mme acide amin occupe une position donne. Les acides amins reprsents en noir sont ceux qui sont impliqus soit dans le repliement de la protine, soit dans la fixation de la protine sur lADN.
Nombre de protines prsentant le mme acide amin sur la position considre 400 350 300 Le 5me acide amin est aussi R Toutes les 346 protines analyses ont R cette Les 346 protines 5me position analyses ont L (leucine) ici, en 16me position

250 Le premier acide amin de la protine produite 200 par le gne de la 150 drosophile est du R (arginine) 100 L'histogramme me montre que 55 des 346 protines analyses commencent par ce mme R 50 0

Je n'ai analys que 3 histogrammes. A vous de faire l'analyse globale

RKRGRQTY T R Y QTLELEKEF H F N RYLTR R RR I E I A H A LCL TERQI KI W F Q NRRM K W K K EN

C'est la squence de la protine code par le gne antennapedia qui sert de rfrence la comparaison

Squence de l'homodomaine d'antennapedia

Document 15

Symbole des acides amins


Les acides amins sont souvent reprsents par leur symbole international.
Acide aspartique Acide glutamique Alanine Arginine Asparagine Cystine Glutamine Glycine Histidine Isoleucine Leucine Lysine Mthionine Phnylalanine Proline Srine Thronine Tryptophane Tyrosine Valine Symbole international D E A R N C Q G H I L K M G P S T W Y V Symbole Asp Glu Ala Arg Asn Cys Gln Gly His Ile Leu Lys Met Phe Pro Ser Thr Trp Tyr Val

Squence 4 SN02

73

Cned Acadmie en ligne

1 Montrer, en utilisant les documents et vos connaissances, que les

gnes homotiques Hox B appartiennent une famille multignique.


2 Expliquer, en utilisant les documents et vos connaissances, le rsultat

de la transgense observe sur le document 11. Un schma fonctionnel est attendu.


3 Contrairement aux prdictions des chercheurs, les recherches ont

montr que les gnes impliqus dans la construction des organismes sont conservs au cours de lvolution. Utiliser les documents afin dapporter des arguments scientifiques justifiant cette affirmation.
4 Montrer que les connaissances acquises sur le fonctionnement des

gnes de dveloppement apportent des rponses aux problmes soulevs dans la partie Pour dbuter .
retenir Au cours des dernires annes, de nombreuses recherches ont t effectues afin de mieux comprendre les mcanismes impliqus dans le dveloppement des organismes. Ces recherches ont permis de comprendre que les gnes homotiques sont des gnes de rgulation qui dclenchent lactivit dautres gnes, ce qui explique quune mutation sur un gne homotique entrane des consquences phnotypiques importantes. Des mutations sur des gnes homotiques peuvent expliquer lapparition dinnovations volutives importantes sur le plan volutif. Ces recherches montrent en outre que des gnes impliqus dans la construction dorganismes trs diffrents se sont conservs au cours de lvolution. Cette conservation peut sexpliquer par une pression de slection stabilisante et tmoigne du rle fondamental jou par ces gnes.

2. La rgulation de lexpression des gnes, moteur de lvolution


Le squenage de nombreux gnomes a permis aux chercheurs de constater, non sans surprise, que des espces diffrentes sur le plan morphologique possdaient de nombreux gnes similaires. Comment expliquer ce paradoxe ? Rcemment, les chercheurs ont port leur attention sur les squences rgulatrices des gnes et se sont intresss aux consquences que des mutations dans ces squences rgulatrices pourraient avoir sur le plan volutif.

74

Squence 4 SN02

Cned Acadmie en ligne

a) Des formes diffrentes peuvent rsulter de variations dans lintensit dexpression de gnes communs Activit 4
Montrer que des formes diffrentes peuvent rsulter de variations dans lintensit dexpression de gnes communs Chez la drosophile, le gne yell code pour une protine lorigine dun pigment noir. Ce gne possde plusieurs squences rgulatrices. On connat certaines espces de drosophiles dont les mles prsentent une tache noire au bout des ailes et lextrmit de labdomen est galement noire. Dautres espces de drosophiles prsentent un abdomen clair ou des ailes non tachetes. Les scientifiques ont montr que la prsence de taches sur les ailes avait pour origine une concentration leve de la protine code par le gne yellow dans les cellules qui formeront les taches. Chez les espces ne prsentant pas de taches sur les ailes, la protine code par le gne yell nest synthtise quen petite quantit, ce qui est lorigine de la couleur grise des ailes. Question Montrer, en vous appuyant sur lexemple des drosophiles, comment des formes vivantes diffrentes peuvent rsulter de variations dans lintensit dexpression de gnes communs.

Document 16

Lexpression du gne yell est contrle par plusieurs squences rgulatrices


facteurs de transcription sites de fixation

Squence rgulatrice contrlant lexpression du gne yell uniquement active dans les cellules de laile

Squence rgulatrice contrlant lexpression du gne yell uniquement active dans les cellules de labdomen

Gne de structure yell codant pour un pigment

Squence 4 SN02

75

Cned Acadmie en ligne

Document 16a

Situation initiale chez lanctre des drosophiles

Document 16b

Des espces de drosophiles ont acquis un caractre nouveau reprsent par des taches noires lextrmit des ailes

Document 16c

Des espces de drosophiles ont perdu la coloration noire de lextrmit de labdomen

retenir Des modifications sur les squences rgulatrices des gnes modifient le profil dexpression des gnes et peuvent tre lorigine de la diversification des tres vivants.

76

Squence 4 SN02

Cned Acadmie en ligne

b) Des formes diffrentes peuvent rsulter de variations dans la chronologie de lexpression de gnes communs Activit 5
Montrer que des formes diffrentes peuvent rsulter de variations dans la chronologie de gnes communs Le squenage des gnomes de lhomme et du chimpanz montre que ceux-ci sont trs proches. Cette proximit des gnomes tmoigne de ltroite parent entre les deux espces. Les chercheurs situent lanctre commun aux deux espces environ 8 Ma. Malgr cette proximit gntique, de nombreuses diffrences existent. Lhomme se distingue du chimpanz par un dveloppement crbral plus important, une bipdie permanente, labsence de bourrelets susorbitaires, une mchoire non projete vers lavant, des capacits dapprentissages importantes. Comment expliquer cette apparente contradiction ?
1 Montrer, en utilisant lensemble des documents, que ces diffrences

pourraient rsulter dune variation dans la chronologie du dveloppement entre lespce ancestrale commune lhomme et au chimpanz et ses descendants.
2 Proposer une explication lorigine des ces variations dans la chrono-

logie des dveloppements de lhomme et du chimpanz.


Document 17

Crnes humains et crnes de chimpanz diffrents stades du dveloppement

Foetus de chimpanz Chimpanz adulte

La croissance des zones de la tte chez le chimpanz

Foetus d'humain

Humain adulte

: position du La croissance des zones de la tte chez l'homme trou occipital

Remarque Le changement de forme des quadrillages matrialise les pousses de croissance.

Squence 4 SN02

77

Cned Acadmie en ligne

Document 18

Comparaison dun crne de chimpanz juvnile et dun crne dhomme adulte


Sommet du crne Profil du crne d'humain adulte Occiput Face Profil du crne de chimpanz juvnile

Document 19

Dveloppement compar de lhomme et du chimpanz


Le dveloppement chez lhomme et le singe se droule en plusieurs tapes. la phase embryonnaire succdent la phase ftale puis la phase lactale marque par lacquisition de la premire dentition puis la phase de substitution au cours de laquelle les dents de lait sont remplaces par les dents dfinitives et enfin la phase adulte caractrise par lacquisition de la maturit sexuelle. On peut constater un allongement de la phase embryonnaire chez lhomme qui dure 8 semaines au lieu de 6 semaines chez le chimpanz. Cest durant cette seule phase que se multiplient les cellules nerveuses, jusqu 5 000 neurones par seconde, ce qui aboutit nos quelque 100 milliards de neurones. La phase ftale, en revanche, est plus courte chez lhomme que chez le chimpanz. Laccouchement se produit vers le 238e jour pour le chimpanz et vers le 266e jour chez lhomme, soit un mois de diffrence seulement pour la dure totale de la gestation, alors que la phase embryonnaire humaine est plus longue de six semaines. Aprs la naissance vient la phase dite lactale, qui sachve avec lapparition de la premire molaire suprieure. Cela se produit vers 3 ou 4 ans chez le chimpanz, et 6 ou 7 chez lhomme. Cest durant cette priode, vers lge de un an et demi, que se produit chez le chimpanz le processus de remonte du trou occipital vers larrire, ce qui entrane la quadrupdie. Jusque-l, le jeune chimpanz est autant bipde que quadrupde. Chez le gorille, plus loign de nous gntiquement que le chimpanz, cet pisode survient ds lge de un an. En revanche, chez le jeune humain, la remonte na pas lieu, permettant ainsi la bipdie permanente. Au cours de la phase de substitution apparaissent, chez le chimpanz, les caractres qualifis de simiesques que sont les bourrelets sus-orbitaires et la face projete vers lavant. Cest galement au cours de cette priode que seffectue lapprentissage de la pense rflchie.

78

Squence 4 SN02

Cned Acadmie en ligne

9 mois

6 ans

14 ans

8 mois

3 ans

7 ans

Avant la naissance

Aprs la naissance

Embryon

Foetus

Phase lactale

Phase de substitution

Phase adulte

Document 20

La formation des membres chez les vertbrs ttrapodes


La formation des membres chez les vertbrs ttrapodes est sous la dpendance de plusieurs gnes homotiques ; ils sont toujours construits selon un plan en trois phases successives :
Phase

I : mise en place de lhumrus (membre suprieur) et du fmur (membre infrieur). II : mise en place du radius puis du cubitus et de la mme manire le tibia puis le pron. III : mise en place de la main et du pied.

Phase

Phase

Des expriences sur le poisson-zbre ont montr que les mmes gnes homotiques existent (gnes homologues) et sexpriment mais seulement au stade prcoce du dveloppement, dans la partie proximale de la future nageoire. La phase III napparat pas. Le passage des poissons aux ttrapodes ne correspondrait, en ce qui concerne les quatre membres, qu lacquisition de la phase III, phase qui apparat comme une potentialit intrinsque du programme de dveloppement de poissons (puisque les gnes capables de la dclencher sont prsents dans leur gnme mais ne sy expriment pas). Il sagit bien dun cas dhtrochronie : la dure de chaque phase du dveloppement dtermine la structure finalement produite. Lanalyse des anctres fossiles du poisson clacanthe (une espce dont les nageoires sont plus volues que chez la plupart des poissons et trs fortement apparentes aux membres des vertbrs ttrapodes) permet de retrouver la trace de lapparition chez les poissons de cette succession de phases. On voit le fmur et lhumrus apparatre en premier, probablement vers le Silurien suprieur, puis la phase II au Dvonien infrieur et enfin la phase III au Dvonien suprieur.

Squence 4 SN02

79

Cned Acadmie en ligne

Dvonien suprieur (~365 Ma) Dvonien infrieur (~410 Ma) Le coelacanthe actuel

Silurien suprieur (~415 Ma) Parties du membre observes chez les anctres du coelacanthe

La structure osseuse de la nageoire du coelacanthe

fossiles retrouvs dans les sdiments


retenir

Les palontologues ont souvent t confronts au problme que pose lapparition brutale chez certaines espces fossiles dinnovations morphologiques importantes. Les recherches portant sur les htrochronies autorisent penser que lapparition de ces innovations peut tre lie des mutations portant sur des gnes de rgulation tels que les gnes homotiques. Une htrochronie est une diffrence de positions relatives, dans le temps, des tapes du dveloppement, entre une espce ancestrale et ses descendants. Ainsi, au cours du temps, la vitesse ou la dure du dveloppement embryonnaire ou de la phase de croissance peuvent tre modifies, faisant apparatre de nouveaux plans dorganisation. Des recherches rcentes ont permis de dmontrer que des mutations de gnes homotiques sont capables de dclencher des htrochronies du dveloppement. Il est donc possible quune simple mutation, autorisant, inhibant ou modifiant lexpression dun gne homotique une tape donne du dveloppement, peut suffire changer, chez un individu, la morphologie dun ou de plusieurs caractres, les fonctions dun ou de plusieurs organes, voire un plan dorganisation, et transmettre ces modifications sa descendance. Ces rsultats confortent lide avance en 1977 par Franois Jacob selon laquelle les mcanismes de lvolution rsultent dun vaste bricolage molculaire qui modifie constamment les structures prexistantes.

80

Squence 4 SN02

Cned Acadmie en ligne

Bilan du chapitre
Lidentification et la comprhension du fonctionnement des gnes du dveloppement, en particulier les gnes homotiques, ont permis dclairer dun jour nouveau les mcanismes volutifs. Ces gnes contrlent lexpression, via des facteurs de transcription, des gnes de structure. Cette hirarchisation du gnome a pour consquence quune mutation sur un gne homotique peut tre lorigine de modifications phnotypiques importantes comme la formation dun organe la place dun autre. Les chercheurs ont galement constat que ces gnes taient conservs au cours de lvolution chez des organismes aussi diffrents quune drosophile et une souris pourtant spars depuis plus de 500 millions dannes. Cette conservation tmoigne de limportance de ces gnes et de la pression stabilisatrice exerce par la slection naturelle. Nanmoins, des mutations sur ces gnes de dveloppement peuvent expliquer lapparition relativement soudaine dinnovations volutives. Le squenage des gnomes a rvl que des formes vivantes diffrentes sur le plan morphologique ou physiologique peuvent tre trs proches sur le plan gntique. Ce paradoxe apparent sexplique par une variation dans lintensit dexpression de gnes communs ou une variation dans la chronologie de lexpression de gnes communs.

Squence 4 SN02

81

Cned Acadmie en ligne

Chapitre

6 A

La diversification du vivant sans modification du gnome


Pour dbuter
Souvent, lvolution du vivant est associe lide de comptition entre les espces. Cependant, de nombreux mcanismes de coopration entre les espces semblent avoir contribu lvolution du vivant. Parmi les diffrentes associations possibles, la symbiose est dfinie comme une association durable entre deux organismes despces diffrentes et qui est bnfique chacun deux.

Comment la symbiose peut-elle contribuer la diversification des


tres vivants ? Des tudes rcentes montrent que le dveloppement de comportements nouveaux chez les vertbrs et transmis dune gnration lautre est galement source de diversit.

Comment des comportements nouveaux peuvent-ils tre acquis sans


modification du gnome ?

B
Activit 1

Cours
1. La symbiose, moteur de lvolution
Montrer quune diversification des tres vivants est aussi possible sans modifications des gnomes (symbiose)
1 Montrer, travers les diffrents exemples proposs, que la symbiose

peut tre dfinie comme une association physique durable entre deux organismes despces diffrentes et qui est bnfique chacun deux. Vous montrerez galement limportance de ces symbioses dans le fonctionnement des cosystmes.
Document 1

La vie dans les zones hydrothermales abyssales chaudes


Les abysses sont des zones marines profondes dpourvues de lumire. laxe des dorsales, on rencontre des sources hydrothermales chaudes riches en sulfures. Le refroidissement de la nouvelle crote ocanique forme au niveau de laxe des dorsales cre un rseau de fissures dans lesquelles circule de leau de mer froide (2 C). Au contact du magma, outre le rchauffement

82

Squence 4 SN02

Cned Acadmie en ligne

de leau, se produisent des ractions chimiques qui ont pour consquence une diminution du PH, de la teneur en 02 et un enrichissement en sulfures (hydrogne sulfur), en mtaux (Fe, Mn, Li, Ba) mais galement en mthane, en C02. Cette eau charge remonte ensuite vers la crote ocanique et ressort par des chemines. Le contact entre cette eau trs chaude et leau froide environnante provoque la prcipitation des sels mtalliques, gnrant ainsi un panache de fumes noires ( fumeurs noirs ). Ces fumes anoxiques sont caractrises par une temprature de lordre de 350 C, un pH acide et des teneurs leves en sulfures polymtalliques, H2S, CH4, He, H, Zn, Mn, Fe, Li, Cu, Pb et SiO2. Malgr ce contexte hostile, ces zones hydrothermales abritent une faune luxuriante et varie. Comment des organismes htrotrophes peuvent-ils se dvelopper dans ces conditions ? Riftia est un ver dun mtre de long qui ne possde pas de tube digestif mais abrite, dans les cellules dun organe spcialis, le trophosome des bactries chimiolithotrophes. Les bactries chimiolithotrophes tirent leur nergie de loxydation des molcules dhydrogne sulfur. Cette nergie est utilise pour fixer le C02 et produire des molcules organiques. Lhydrogne sulfur libre est cependant toxique pour les cellules car il bloque le mtabolisme respiratoire arobie. Lhmoglobine de Riftia, outre le fait de transporter l02, prend galement en charge lhydrogne sulfur. Ainsi combin lhmoglobine, il parvient au trophosome.
Vous

pouvez entrer les mots suivants vido + fumeur noir sur votre moteur de recherche.

CO2 H2S O2 Molcules organiques

Document 2

Les lichens peuvent coloniser des milieux extrmes


Les lichens sont constitus de lassociation de deux tres vivants : un champignon et une algue ou cyanobactrie. Nous les rencontrons frquemment sur le tronc des arbres, des roches o ils peuvent supporter des conditions de vie extrmes.

Squence 4 SN02

83

Cned Acadmie en ligne

Substances licheniques

nergie CO2 lumineuse

H2O,sels minraux

Glucides, acides amins

H2O

Sels minraux

Thalle de lichen

Coupe du thalle. Coexistence des algues (vertes) et du champignon (gris)

Les changes entre algues et champignon dans le thalle

Le champignon labore des substances dites licheniques uniquement si lalgue est prsente. Ces substances licheniques jouent un rle important pour le lichen en les protgeant des herbivores et en filtrant les radiations lumineuses par exemple.
Document 3

La digestion symbiotique
La cellulose est un polymre de glucose, donc une molcule organique complexe qui entre dans la composition des vgtaux. Les vertbrs ne possdent pas denzymes capables dhydrolyser cette molcule. Or de nombreux organismes sont herbivores et la cellulose constitue leur principale source dnergie. Le rumen (panse) des ruminants dont la temprature est comprise entre 38 et 40 C abrite des bactries, des protozoaires et des champignons. Les aliments ingrs subissent dabord une fermentation grce aux microbes du rumen ; cette fermentation microbienne est trs importante puisque 60 90 % des glucides de la ration, y compris ceux des parois vgtales, y sont ferments. Ces parois, qui sont les composants essentiels des fourrages pauvres, sont partiellement dgrades par les microbes laide de la cellulase (enzyme) quils scrtent et que ne possde pas lanimal hte. La fermentation des glucides conduit la production dnergie sous forme dadnosine triphosphate (ATP) utilise par les microbes pour leurs besoins dentretien et de multiplication. Les produits terminaux de cette fermentation sont :

les acides gras volatils (AGV) : essentiellement lacide actique, lacide propionique et lacide butyrique, dont les proportions dpendent de la nature des glucides alimentaires ; le gaz carbonique et le mthane limins lors de lructation des ruminants.

Les acides gras volatils, issus de la fermentation, sont absorbs dans le sang surtout travers la paroi du rumen. Ils constituent la principale source dnergie pour lanimal hte puisquils fournissent de 70 80 % de lnergie totale absorbe chez le ruminant. 84
Squence 4 SN02

Cned Acadmie en ligne

Les matires azotes (protiques et non protiques) ingres par lanimal sont soumises laction protolytique des microbes (bactries, protozoaires et champignons) du rumen. Les matires azotes non protiques des aliments, comme lure, sont dissoutes en totalit et hydrolyses en ammoniac. Lammoniac est un lment prcurseur essentiel pour la croissance microbienne de la plupart des espces bactriennes du rumen qui le prlvent et lutilisent pour la synthse de leurs propres acides amins constitutifs. Il est mme considr comme la principale source dazote pour plusieurs souches bactriennes, en particulier celles impliques dans la digestion de la cellulose et de lamidon.
Ractions chimiques effectues par les microbes gastriques Herbe Protines NH3 Squelettes carbons Synthse des protines microbiennes Acides amins Mtabolisme de l'animal nergie (ATP) CO2 Cellulose nergie (ATP) AVG CO2 Mthane Ractions chimiques effectues par l'organisme de du ruminant

2 Les organites, chloroplastes et mitochondries des cellules eucaryotes

auraient une origine endosymbiotique. Cette hypothse mise la fin du XIXe sicle fut nouveau dfendue par Lynn Margulis dans les annes 1970. Lendosymbiose dsigne une association symbiotique o lun des organismes vit lintrieur des cellules de son hte. On a dj rencontr un exemple avec le ver Riftia, mais ce processus est rpandu. On peut galement citer lexemple des rhyzobias, bactries qui induisent chez les plantes de la famille des lgumineuses (pois, luzerne, trfle..) des nodosits au sein desquelles les bactries rduisent lazote atmosphrique le rendant utilisable par la plante. Cette association joue un rle cologique fondamental. Aprs avoir rappel le rle des mitochondries et des chloroplastes, rechercher des arguments structuraux, fonctionnels et gntiques en faveur de cette hypothse.

Squence 4 SN02

85

Cned Acadmie en ligne

Document 4

Schma dune cellule eucaryote vgtale chlorophyllienne

Chloroplaste

Noyau

Mitochondrie

Document 5

Schma dune cellule eucaryote animale

Noyau

Mitochondrie

Document 6

Schma dune cellule bactrienne htrotrophe et chlorophyllienne

Matriel gntique

Matriel gntique Chloroplaste

86

Squence 4 SN02

Cned Acadmie en ligne

Les cyanobactries sont des bactries possdant de la chlorophylle sous forme de lamelles (thylakodes) et capables de raliser la photosynthse. Elles sont connues sur Terre depuis 3,8 Ga = 3,8 milliards dannes.
Document 7

Chloroplaste au microscope lectronique et schma dinterprtation


Granum (thylacodes accols) Ribosomes Thylacodes Amidon ADN Double membrane Cytoplasme de la cellule contenant ce chloroplaste

Document 8

Dtail dune cellule animale montrant des mitochondries au microscope lectronique et schma dinterprtation dune mitochondrie
Ribosomes ADN

Double membrane ADN

Document 9

Quelques comparaisons entre mitochondries, chloroplastes et bactries


Les chercheurs ont montr que les lipides entrant dans la constitution des membranes des mitochondries se retrouvent chez certaines bactries alors que lon ne les retrouve pas ailleurs dans la cellule eucaryote. Certains lipides formant la membrane des plastes se retrouvent galement chez les cyanobactries. Contrairement aux noyaux, lappareil de golgi ou au rticulum endoplasmique, qui peuvent se reformer lors dune mitose par exemple, les mitochondries et les plastes sont toujours issus de mitochondries et plastes prexistants.

Squence 4 SN02

87

Cned Acadmie en ligne

Les chercheurs ont mis en vidence lexistence dans le gnome des chloroplastes et des mitochondries de gnes homologues de gnes bactriens. Dans les mitochondries et les plastes, il existe des ribosomes qui participent la synthse des protines. Ceux-ci ressemblent plus aux ribosomes des bactries que ceux que lon trouve dans le cytoplasme des cellules eucaryotes. 3 Les lments A, B et C du document reprsentent une cyanobactrie,

une cellule eucaryote primitive et une bactrie capable dutiliser l02. (Ce nest pas dans lordre.) En tenant compte des documents proposs et des connaissances acquises au cours de cette activit, reconstituer un scnario volutif probable qui a conduit lapparition dune cellule eucaryote autotrophe.
Document 10

Trois acteurs dun scnario volutif lorigine dune cellule eucaryote autotrophe

88

Squence 4 SN02

Cned Acadmie en ligne

Document 11

Quelques repres dans lhistoire du vivant

Document 12

Phagocytose dune bactrie par une cellule phagocytaire


Dynamique de la phagocytose

Cellule phagocytaire Macrophage Bactrie Cellule phagocyte

4 Montrer quune diversification des tres vivants est aussi possible

sans modifications des gnomes.

Squence 4 SN02

89

Cned Acadmie en ligne

retenir En rapprochant des organismes distincts, la symbiose peut contribuer lapparition de nouvelles lignes en confrant un avantage sur le plan volutif mais galement en favorisant le transfert de gnes. Ainsi, le gnome contenu dans le noyau dune cellule humaine contient des gnes de cellule dorigine procaryote transmis par les mitochondries.

2. Chez les vertbrs, le dveloppement de comportements nouveaux est source de diversit


Activit 2
Document 13

La transmission de phnotypes comportementaux nouveaux

tude de comportements chez des chimpanzs rpartis sur quatre sites


Des primatologues ont dress un panorama de divers comportements de plusieurs groupes de chimpanzs rpartis sur quatre sites distincts : deux sites en Afrique de lOuest et deux sites en Afrique centrale.

2 1 4 3

1) Site de Ta en Cte-dIvoire 3) Site de Bossou en Guine

2) Site de Gombe en Tanzanie 4) Site de Budongo en Ouganda

90

Squence 4 SN02

Cned Acadmie en ligne

Comportements observs Casser des noix en utilisant des pierres comme marteau et enclume. La pche aux termites. Des morceaux de bois sont introduits dans les termitires afin de recueillir les termites qui sy trouvent. Rcuprer de la moelle des os des animaux tus. Confection dun ventail afin de chasser les mouches. Se chatouiller laide de btons ou de pierres.

Boussou +++ -

Ta +++ +++ ++ -

Gombe +++ ++

Budongo ++ -

+++ : Comportement observ chez tous les individus dune classe dge ou de sexe par exemple. ++ : Comportement observ mais moins frquemment. - : Comportement absent. 1 Identifier les rponses exactes et inexactes et justifier vos rponses.

Cette tude montre que : 1. les diffrences dans les phnotypes comportementaux rsultent de diffrences gntiques ; 2. les diffrences dans les phnotypes comportementaux sont transmises par apprentissage social ; 3. les nouvelles variations sont le produit du hasard ; 4. les comportements ne sont transmis qu des individus apparents.
retenir Diverses tudes chez des vertbrs montrent que des diffrences dans les phnotypes comportementaux sont transmises par apprentissage social plus que par diffrences gntiques.

Bilan du chapitre
Ce chapitre nous a montr que la diversification du vivant tait galement possible sans modifications des gnomes. Ainsi, la symbiose, association physique durable entre deux organismes despces diffrentes et bnfique chacun deux, constitue un moteur de lvolution. La symbiose a rendu possible la colonisation de milieux extrmes et conditionne mme lexistence de certains cosystmes. Des phnotypes comportementaux varis transmis dune gnration lautre par voie non gntique sont aussi source de diversit. Ces deux phnomnes compltent et enrichissent la thorie de lvolution.

Squence 4 SN02

91

Cned Acadmie en ligne

S ynthse
Le brassage gntique et sa contribution la diversit gntique
Miose et fcondation assurent le maintien du caryotype de lespce La miose est la succession de deux divisions cellulaires prcde dune rplication de lADN au cours de linterphase. Ce sont donc des chromosomes deux chromatides qui entrent en miose. La premire division de miose spare les chromosomes homologues de chaque paire et la seconde division spare les chromatides de chaque chromosome. La miose produit quatre cellules haplodes partir dune cellule diplode. Chacune de ces cellules contient donc un chromosome de chaque paire prsente au dpart. Par consquent, chaque cellule haplode ne contient que la moiti du patrimoine gntique de la cellule initiale. Au cours de la fcondation, un gamte mle et un gamte femelle sunissent. Leur fusion rtablit la diplodie dans la cellule uf. Les remaniements chromosomiques au cours de la miose Au cours de la premire division de la miose, des changes de fragments de chromatides (crossing-over) se produisent entre chromosomes dune mme paire. ce brassage intrachromosomique succde le brassage interchromosomique rsultant de la migration alatoire des chromosomes. Une diversit potentiellement infinie de gamtes est ainsi produite. La fcondation amplifie le brassage allllique Lors de la fcondation, les gamtes se rencontrent au hasard. La ralisation dun chiquier de croisement montre que, lors de la fcondation, de nouveaux gnotypes, cest--dire diffrents de ceux des parents, apparaissent. Le brassage des allles li la miose est donc amplifi par la fcondation. Des anomalies peuvent survenir lors de la miose La non-disjonction des chromosomes homologues lors de la premire division de miose ou la non-disjonction des chromatides lors de la seconde division de miose entranent la prsence dun nombre anormal de chromosomes dans les gamtes.

92

Squence 4 SN02

Cned Acadmie en ligne

Des remaniements chromosomiques peuvent aussi survenir lors de la miose et, selon certains chercheurs, ces phnomnes ont contribu lapparition de nouvelles espces. Un crossing-over ingal peut tre lorigine dune duplication de gne. Les deux copies du gne ainsi formes sont identiques et sont situes sur deux loci distincts du chromosome. Il arrive galement que lune des copies se dplace sur un autre chromosome : cest la transposition. Dans tous les cas, les deux copies initialement identiques accumulent des mutations diffrentes et vont diverger. Ce phnomne de duplication peut se reproduire plusieurs reprises et tre lorigine des familles multigniques.

Diversification gntique et diversification des tres vivants


Les mcanismes de diversification sont varis Des regroupements de gnes issus de lignes diffrentes dans une mme ligne ont contribu la diversification du vivant. Lhybridation rsulte de la fcondation entre gamtes issus de lignes diffrentes. Lhybride ainsi form est le plus souvent strile. Chez les vgtaux, un phnomne de polyplodisation peut restaurer la fertilit de lhybride et tre ainsi lorigine dune nouvelle espce. Ce mcanisme est particulirement impliqu dans la diversification des plantes fleurs. Des gnes peuvent galement tre transmis dun organisme dune espce un autre organisme dune autre espce. Chez lhomme, ce mcanisme volutif implique des virus et plus particulirement des rtrovirus qui ont la facult dintroduire leur gnome au sein dun gnome hte. Les gnes dorigine virale reprsentent 10 % du gnome humain. Au cours des dernires annes, la comprhension des mcanismes volutifs sest vu enrichir des apports de la gntique du dveloppement. Ainsi, des gnes homotiques contrlent lactivit dautres gnes. Cette hirarchisation du gnome explique quune mutation sur un gne homotique peut avoir des consquences importantes sur le plan du phnotype. Le squenage des gnomes a montr que des formes diffrentes pouvaient possder des gnes similaires. Les diffrences peuvent sexpliquer par une variation dans lintensit dexpression ou la chronologie dexpression de gnes communs.

Squence 4 SN02

93

Cned Acadmie en ligne

Une diversification du vivant sans modification du gnome Des mcanismes de coopration contribuent galement la diversification du vivant. Ainsi, la symbiose, association durable entre deux organismes despces diffrentes et bnfique chacun deux, permet la colonisation de milieux extrmes. Lendosymbiose est une symbiose o lun des partenaires vit dans les cellules de lautre. La prsence de mitochondries et de chloroplastes dans les cellules eucaryotes serait la consquence dune endosymbiose. Chez les vertbrs, le dveloppement de comportements nouveaux transmis dune gnration lautre par voie non gntique est source de diversit. Ainsi, chez les chimpanzs mais galement chez les orangsoutans, des tudes ont montr que des diffrences dans les phnotypes comportementaux sont transmises par apprentissage social.

94

Squence 4 SN02

Cned Acadmie en ligne

C E xercices
Exercices du chapitre 2
Exercice 1
Tester ses connaissances A. Dfinir les mots suivants : haplode, diplode, chromosomes homologues, zygote. B. Souligner les affirmations exactes et corriger les affirmations fausses. La fcondation : 1. permet le passage de la diplodie lhaplodie. 2. correspond la fusion de deux gamtes haplodes. 3. est une caractristique de la reproduction sexue. 4. se ralise au hasard. La miose : 1. rtablit la diplodie. 2. spare au hasard les chromosomes homologues dans deux cellules distinctes. 3. intervient juste aprs la fcondation chez les mammifres. 4. se droule dans les gonades chez les mammifres. La division rductionnelle de la miose : 1. divise par deux la quantit dADN mais pas le nombre de chromosomes. 2. est la premire division. 3. est la deuxime division. 4. est prcde dune phase de rplication de lADN. 5. aboutit deux cellules n chromosomes. La division quationnelle de la miose : 1. divise par deux la quantit dADN mais pas le nombre de chromosomes. 2. est la premire division. 3. est la deuxime division. 4. est prcde dune phase de rplication de lADN. Aprs la miose : 1. chaque cellule forme contient un seul reprsentant de chaque paire de chromosomes homologues. 2. chaque cellule forme contient toutes les paires de chromosomes homologues. 3. linformation gntique est qualitativement la mme que dans la cellule souche.
Squence 4 SN02

95

Cned Acadmie en ligne

4. linformation gntique contenue dans les cellules filles est quantitativement la mme que dans la cellule souche.

Exercice 2

Comparer la miose et la mitose tablir un tableau comparatif entre mitose et miose qui prenne en compte : la rplication de lADN, le nombre de divisions, le nombre de phases principales, le lieu de la division et les cellules concernes, le nombre de lots de chromosomes lissue de la division, le nombre de cellules filles et leur composition gntique.

Exercice 3

Comportement des chromosomes au cours de la miose Replacer ces schmas de miose dans lordre chronologique en justifiant votre rponse. B C D

Exercice 4

Comportement des chromosomes et formation des cellules reproductrices Les schmas A, B et C reprsentent de faon simplifie le comportement des chromosomes dans une cellule (2n = 4) engage dans la spermatogense. Le document de droite retrace les diffrentes tapes de ce processus. Indiquer, en justifiant vos rponses, quel moment prcis de ce processus correspondent les schmas A, B et C.

96

Squence 4 SN02

Cned Acadmie en ligne

Exercice 5

Quantit dADN et formation des cellules reproductrices


Quantit dADN contenue dans le matriel nuclaire (units arbitraires)

2Q

Q/2 Temps

Le schma ci-dessus reprsente lvolution de la quantit dADN dans le noyau dune cellule engage dans la formation de cellules reproductrices. Quels sont les vnements cytologiques et chromosomiques qui caractrisent lvolution de cette cellule ?

Exercices du chapitre 3
Exercice 1
Tester ses connaissances A. Dfinir les mots suivants : chromosomes homologues, gnes lis, crossing-over. B. Souligner les affirmations exactes : Le brassage interchromosomique : 1. intervient avant le brassage intrachromosomique. 2. correspond une migration alatoire des chromosomes homologues deux chromatides lors de la division 1 de miose. 3. correspond une migration alatoire des chromatides des chromosomes homologues en anaphase 2. Le brassage intrachromosomique : 1. peut intervenir au cours des deux phases de la miose. 2. succde au brassage interchromosomique. 3. correspond des changes entre les chromatides des chromosomes lors de la prophase 1 de miose. 4. correspond des changes entre chromatides de chromosomes homologues en prophase 1 de miose.

Squence 4 SN02

97

Cned Acadmie en ligne

Des gnes indpendants : 1. sont des gnes situs sur le mme chromosome. 2. sont des gnes situs sur des chromosomes diffrents. 3. sont affects par le brassage intrachromosomique. 4. sont des gnes dont les locus sont situs sur deux chromosomes diffrents. C. Indiquer quelles tapes de la gamtogense on peut observer chacun des vnements suivants : 1. Rplication des molcules dADN. 2. Appariement des chromosomes homologues. 3. changes entre chromatides de chromosomes homologues. 4. Sparation des deux chromatides de chaque chromosome. 5. Sparation des chromosomes homologues.

Exercice 2

Brassage intrachromosomique et brassage interchromosomique

1 Souligner et justifier les affirmations vraies et corriger les affirmations

fausses. 1. Le schma B illustre la notion de brassages intrachromosomique et interchromosomique. 2. Le schma A illustre la notion de brassage intrachromosomique. 3. lissue de la miose, les cellules de type A produisent deux types de gamtes. 4. lissue de la miose, les cellules de type A produisent quatre types de gamtes quiprobables. 5. lissue de la miose, les cellules de type B produisent quatre types de gamtes quiprobables.
2 Schmatiser les diffrents gamtes produits par les cellules de type B

lissue de la miose.

98

Squence 4 SN02

Cned Acadmie en ligne

Exercice 3

Schmatiser un crossing-over Schmatiser le comportement dun couple de chromosomes homologues portant deux gnes ltat htrozygote au cours dune miose sans crossing-over puis avec crossing-over. On prendra un gne A avec ses deux allles A et a et un gne B avec ses deux allles B et b.

Exercice 4

tude dun brassage gntique au cours de la reproduction sexue Relever en justifiant les affirmations exactes. Corriger les affirmations fausses.

Document 1

tude de la transmission de deux gnes chez un moustique (Aedes aegypti)


Lorsquon croise des moustiques homozygotes, lun de type sauvage (corps gris, il prune), lautre corps noir et il clair, tous les individus de la F1 obtenus sont de type sauvage. Lorsque les femelles F1 sont croises avec des mles corps noir et il clair, on obtient les rsultats suivants :
698

moustiques corps gris et il prune, 712 moustiques corps noir et il clair, 290 moustiques corps gris et il clair, 282 moustiques corps noir et il prune.
Document 2

Une tape de la miose

A. Le document 2 reprsente la prophase de la division rductionnelle dune miose. B. Un individu de souche pure ne possde quun type dallle pour un caractre. C. Les allles il prune et corps gris sont dominants. D. On dduit des proportions obtenues en F2 que les gnes sont situs sur deux chromosomes indpendants. E. Le phnotype (corps gris et il clair) est dit phnotype recombin. F. Si on prend les symboles suivants : g+ corps gris, g corps noir, p+ il prune, p il clair, le gnotype des femelles F1 doit tre not (g+//g, p+//p).

Squence 4 SN02

99

Cned Acadmie en ligne

Exercice 5

Croisements chez la drosophile Relever les affirmations exactes et corriger les affirmations fausses. Le caractre aspect des ailes est dtermin par un gne existant sous deux formes allliques : ailes normales et ailes tordues. Le caractre aspect des yeux est dtermin par un autre gne existant sous deux formes allliques : yeux lisses et yeux rugueux. Premier croisement : On croise deux drosophiles de races pures, lune ailes normales et yeux lisses, lautre ailes tordues et yeux rugueux. Les F1 obtenues ont toutes des ailes normales et des yeux lisses. Second croisement : On croise une femelle de F1 avec un mle aux ailes tordues et aux yeux rugueux. On obtient en F2 :
Phnotype Ailes normales, yeux lisses Ailes tordues, yeux rugueux Ailes normales, yeux rugueux Ailes tordues, yeux lisses Nombre de drosophiles prsentant ce phnotype 72 75 74 73

A. Les drosophiles de F1 ont toutes le mme gnotype : elles sont homozygotes. B. Le caractre tordu est dtermin par un allle dont lexpression est dominante. C. Les proportions de F2 permettent de dduire que les deux gnes sont lis. D. Le deuxime croisement met en vidence des brassages gntiques interchromosomiques.

Exercices du chapitre 4
Exercice 1
Tester ses connaissances Souligner les affirmations exactes : 1. Les gnes rsultant dune duplication : A. conservent toujours une squence identique la squence dorigine. B. peuvent avoir des squences diffrentes sils mutent. C. sont toujours obligatoirement situs sur le mme chromosome que le gne ancestral. D. ne se dupliqueront quune seule fois. E. codent pour des molcules homologues. F. forment une famille multignique. 100
Squence 4 SN02

Cned Acadmie en ligne

2. Sont des innovations gntiques : A. les remaniements chromosomiques. B. les mutations. C. les duplications de gnes. D. la miose. E. la slection naturelle. 3. Les familles multigniques : A. sont formes de gnes ayant des squences dADN communes. B. drivent dun gne ancestral par accumulation de mutations gniques. C. sont le tmoin dinnovations gntiques survenues dans le pass de lespce. D. drivent dun gne ancestral par duplication, transposition et mutation gnique.

Exercice 2
Document

Des anomalies chromosomiques lors de la miose

Syndrome de Klinefelter (XXY)

Syndrome de Turner (X0)

Si lon prend comme exemple la non-disjonction des chromosomes X de la mre, on peut aboutir aux diffrents cas suivants : Triplo-X (XXX) : strilit et dbilit mentale. Syndrome de Turner (XO) : sujets fminins de petite taille, strilit et des caractres sexuels secondaires peu ou pas dvelopps. Syndrome de Klinefelter (XXY) : sujets masculins qui prsentent la fois des caractres sexuels secondaires de type masculin (grande taille, paules larges) et strilit. Expliquer comment les caryotypes prsents dans les documents ci-dessus ont pu se constituer. Des schmas limits au seul comportement des chromosomes permettant de rendre compte de ces caryotypes devront illustrer votre explication.

Squence 4 SN02

101

Cned Acadmie en ligne

Exercice 3
Document

Des remaniements chromosomiques lors de la miose

Caryotype montrant une translocation quilibre

Le caryotype du document ci-dessus est celui de M. A. Cette personne est marie avec B. Ce couple a conu six fois : 2 conceptions se sont traduites par des fausses couches, 3 conceptions ont donn naissance des filles normales, 1 conception a donn naissance un fils mongolien .
1 Quelles garnitures chromosomiques pourront possder les gamtes

de A ? Illustrer votre rponse par des schmas appropris o vous figurerez uniquement les chromosomes 14, 21 et XY.

Y
Une paire de chromosomes 14 Une paire de chromosomes 21 Remarque

Chromosomes sexuels

On prcise que le chromosome 14-21 se comporte comme un chromosome unique lors de la formation des gamtes.

102

Squence 4 SN02

Cned Acadmie en ligne

2 Sachant que B possde un caryotype normal et quil ny a aucune

anomalie durant sa gamtogense, interprter, au niveau chromosomique, les rsultats noncs ci-dessus, en vous appuyant sur ceux de la question prcdente.

Exercice 4

Diversification du vivant par hybridation puis polyplodisation Les sneons sont des plantes appartenant la famille des astraces. Senecio squalidus est un hybride issu de deux espces siciliennes diplodes (2n = 20) : Senecio aethnensis et Senecio chrysanthemfolius. Introduit en Grande-Bretagne, il sest hybrid avec le sneon commun local, espce diplode comportant 40 chromosomes, pour donner par alloplyploidie Senecio cambrensis qui comporte 60 chromosomes. Expliquer, sous forme de schmas annots, la formation de Senecio cambresis. Deux hypothses peuvent tre envisages.

Squence 4 SN02

103

Cned Acadmie en ligne

Devoir autocorrectif
Important

Ce devoir nest pas envoyer la correction.

Partie 1 : Question de synthse Chaque individu dune population est unique. Vous montrerez que la miose conduit des combinaisons allliques nouvelles, lorigine de lunicit des individus. Vous appuierez votre expos sur des schmas soigneusement lgends. Ces schmas porteront sur la descendance dun couple en vous limitant trois gnes, chacun sous deux formes allliques : A, a ; B, b ; C, c ; ports par deux paires dautosomes. Partie 2 : Pratique du raisonnement scientifique et de largumentation (10 points)

Exercice 1

Recherche dinformations utiles la rsolution dun problme scientifique Au cours de la formation de gamtes, une cellule mre diplode subit de nombreuses transformations de son matriel chromosomique. Les figures prsentes dans le document 1 correspondent ces modifications.

104

Squence 4 SN02

Cned Acadmie en ligne

Aprs avoir nomm le phnomne reprsent sur les photographies, identifiez et classez dans lordre chronologique de leur droulement les diffrentes figures proposes. Justifiez votre rponse. Ralisez un schma annot de chacune des figures b, d et f en considrant que la cellule mre contient deux paires de chromosomes homologues.

Exercice 2

Choisir et exposer sa dmarche personnelle, laborer une argumentation et proposer une conclusion (6 points) Pour comprendre la diversit des tres vivants, les scientifiques ont ralis des croisements exprimentaux chez diverses espces diplodes. Exploitez les rsultats exprimentaux prsents dans les deux documents suivants pour expliquer la diversit des phnotypes obtenus. Vous vous appuierez sur un raisonnement rigoureux accompagn des schmas ncessaires une bonne comprhension des phnomnes chromosomiques mis en jeux.

Document 1

On croise deux souris de ligne pure qui diffrent par deux caractres
Les deux caractres tudis sont : la couleur du pelage : gris ou noir, la rpartition de la pigmentation : pelage uniforme ou pelage tachet. On croise une souris pelage gris et uniforme avec une souris pelage noir et tachet. la premire gnration, toutes les souris sont pelage gris et uniforme. On croise les hybrides obtenus avec des souris pelage noir et tachet. Les rsultats obtenus sont les suivants : 248 souris pelage gris et uniforme, 252 souris pelage gris et tachet, 249 souris pelage noir et uniforme, 251 souris pelage noir et tachet.

Document 2

Chez le rat, deux gnes R et P interviennent dans la synthse du pigment responsable de la couleur noire des yeux
Ces deux gnes sont situs sur le mme chromosome. Les allles rcessifs r et p de ces gnes ne permettent pas la synthse du pigment. Les rats ne possdant quun seul allle dominant, soit R, soit P, ont les yeux clairs. Des rats de ligne pure aux yeux noirs sont croiss avec des rats doubles rcessifs. On obtient alors des individus de gnration F1 aux yeux noirs. On ralise ensuite le croisement en retour (F1 x doubles rcessifs) aboutissant aux individus de la gnration F2. On obtient lissue de ce croisement en retour : 1 255 rats aux yeux noirs ; 1 777 rats aux yeux clairs.

Squence 4 SN02

105

Cned Acadmie en ligne