Vous êtes sur la page 1sur 1056

USF TAMPA

GRADUATE CATALOG
2013-2014
Published by
Office of Graduate Studies
4202 East Fowler Avenue, ALN226
Tampa, FL 33620-5816

813-974-2846
http://www.grad.usf.edu

20132014USFTampaGraduateCatalogUpdates

ItemsareapprovedbytheUSFTampaGraduateCouncilonthedatenotedorasOfficeofGraduateStudies(GS)approved.
NoteTheGraduateSchoolwasrenamedOfficeofGraduateStudieseffectivefall2013.

POLICYUPDATES Description DateApproved


AcademicStandardsandGrades RemovalofA+Option 10/3/12
AcceleratedProgramGuidelines Revisedguidelines 11/7/11,9/10/12
AdmissionRequirements ReinstatedDeadlines,removeSPEAK,AddPearson,PPI 4/1/13,5/6/13,3/4/13
Assistantships ClarifiyappointmentFTE,maximums,overallpolicy 5/21/12
CoAuthorship Addedlanguageregardingcoauthorship 2/4/13
DoctoralCommitteeandOutsideChair Revisedpolicy,addressedexternalmember 2/6/12,5/7/12
DoctoralHours(re:4000levelcourses) Revisedpolicytoaddressprerequisities 1/9/12
DualDegreePrograms Revisedpolicy,allowingforpercentagetobeshared 2/6/12,11/5/12
ElectronicSignatures Addedstatementregardingelectronicsignatures 11/5/12
ETDFormat Providedadditionalformatoptionsfortitlepage 11/7/11,12/3/12
ETDSubmission RevisedsubmissionoptionfromProquesttoother* 3/4/13(GS)
FirstClassAttendance RevisedpolicytobecongruentwithRegistrarsmandate 5/21/12
FulltimeStudentDefinition Addedlanguageregardingmaximumloadof18hours 2/4/13
InstitutionalEnrollmentPolicy(Residency) RevisedPolicy 2/6/12
ProgramofStudy Clarifiedwording 2/4/13
ResponsibleConductofResearch(RCR) Addedrequirementfornewdoctoralstudents 4/1/13
Student/AdvisorRelationship Addedstatement 5/6/13
*ChangetoBePress3/4/13;revisedtoasdeterminedbyGSbyGS6/25/13

CURRICULUM
NewGraduateProgramsandAcceleratedPrograms
AS CellandMolecularBiology(PhD) 5/21/12
AS IntegrativeBiology(PhD) 5/21/12
BA SportandEntertainmentManagement(MA) 1/14/13
BC AppliedBehaviorAnalysis(PhD) 9/19/11
EN EnvironmentalEngineering(PhD) 4/18/11
MD HealthInformatics(MSHI) 9/19/11
AS AcceleratedMicrobiology(BS/MS) 11/5/12

Coll GraduateProgram NewConcentration(s)


AS AppliedAnthropology(MA,PhD) ArchaeologicalandForensicScience 3/4/13
AS PublicAdministration(MPA) ExecutivePublicAdministration 5/21/12
BA BusinessAdministration(MBA) SportBusiness 6/18/12
ED CurriculumandInstruction(MEd) EducationalStudies 3/5/12
ED ForeignLanguageEducation(MAT) Chinese,French,German,Italian,Japanese,Latin,Russian,Spanish 1/9/12
ED ScienceEducation(MAT) Biology,Chemistry,Earth&SpaceScience,Physics 1/9/12
EN CivilEngineering(MSCE,MSES) MastersInternationalProgram 9/10/12
EN EnvironmentalEng.(MSES,MSEV) MastersInternationalProgram 9/10/12
GS GlobalSustainability(MA) SustainableTourism 12/5/11
NR Nursing(DNP) AdultGerontologyPrimarycare,AdultGerontology/OccupationalHealth,FamilyHealth,
Oncology/AdultGerontologyPrimaryCare(Dual),PediatricHealth 3/4/13
NR Nursing(MS) AdultGerontologyPrimaryCare/OncologyNP 3/4/13
PH PublicHealth(MPH) Health,Safety&Environment;InfectionControl 8/31/12,5/21/12
Coll GraduateProgram TerminatedProgramsandConcentrations
AS Biology(PhD) Program 5/20/13
AS Classics:Latin/Greek(MA) Program
AS LiberalArts(MLA) ConcentrationLiberalStudies 5/21/12
EN CivilEngineering(M.C.E.,M.S.C.E.,M.S.E.S.)ConcentrationInterdisciplinaryTransportation 9/10/12
EN ElectricalEngineering(ME) Program/concentrations:Circuits,Controls&Systems,Comm.&
SignalProcessing,DigitalArch.Design,ElectricPowerSystems,
Microelectronics,WirelessCircuitsandSystems 2/6/12
EN EngineeringScience(PhD ConcentrationPhysics 10/1/12
EN IndustrialEngineering(MSIE,MIE,PhD) EngineeringManagement,QuantitativeAnalysis 9/20/11
EN IndustrialEngineering(PhD) ManufacturingSystems 5/14/13
NR Nursing(MS) Acad.Role,CriticalCareNursing,GerontologicalNursing,HeathSystemsInformatics3/4/13
PH PublicHealth(DPH) BehavioralHealth,GlobalPract,Maternal&ChildHealth,PHEd,SocioHealthSciences5/21/12
PH PublicHealth(MPH) ExecProgramforMBAPhysicians,GlobalHealthInformatics,Occup.Med.Residency1/9/12
PH PublicHealth(MSPH) HealthPolicyandManagement update
PH PublicHealth(PhD) BehavioralHealth,EpidemiologyandBiostatistics,InternationalHealthManagement,Maternal
andChildHealth,PublicHealthEd,SocioHealthSciences 5/21/12

QuestionsabouttheseupdatesmaybedirectedtotheOfficeofGraduateStudiesatcdh@usf.edu



Office of Graduate Studies

USF Tampa
GRADUATE CATALOG
2013-2014

Thepoliciesandprocedureshereinhavebeenapproved,asappropriate,
bytheUSFTampaGraduateCouncilPolicyCommitteeandbythefullUSFTampaGraduateCouncil,
aStandingCommitteeoftheFacultySenate.

Thepolicies,procedures,andrequirementshereinareapplicabletostudentsadmittedto
agraduatedegreeprogramorgraduatecertificate,and/ornondegreeseekingstudentstakinggraduatecoursework.
UndergraduatestudentsshouldrefertotheUndergraduateCatalog,eveniftakinggraduatecoursework.
Itisthestudentlevelthatdictateswhichpublicationgoverns,notthelevelofcoursework.

USFOfficeofGraduateStudies,4202E.FowlerAvenue,ALN226
Tampa,FL33620~www.grad.usf.edu


OfficeofGraduateStudiesMissionStatement

The University of South Florida Office of Graduate Studies serves as the University hub of leadership for graduate
educationproducinggloballeaders,onescholaratatime.

OfficeofGraduateStudiesDiversityStatement

The Office of Graduate Studies at the University of South Florida is committed to the full engagement, empowerment and
encouragement of all of the members and constituents we serve; these include students, faculty, staff, academic departments,
aspirants,andaffiliates.

In recognizing that a university serves a diverse population, we strive not only to serve, but to lead the future in which we
stimulate, encourage and support graduate education efforts that build national distinction... We understand that in order to
realize this future, we must remain steadfast to the policies and practices that emphasize achievement, equal opportunity, trust,
respect,andcollaboration.Hence,equityandexcellencearenotmerelyespoused,butratherarethelivedvaluesthatwestrive
forandadvocateformembersofthecommunityofuniversitiesandaglobalworkforce.

USFsOfficeofGraduateStudiesAdministrationPolicyStatement

ForinformationontheUniversitysPolicyontheOfficeofGraduateStudiesAdministration,
RefertoUSFPolicy11.001,athttp://generalcounsel.usf.edu/policiesandprocedures/index.asp

2013,UniversityofSouthFloridaTampaOfficeofGraduateStudies

This catalog is effective for the 20132014 academic year. This catalog includes all policies, procedures, and program and course
descriptions in effect at the time of publication. USF reserves the right to repeal, change, or modify the policies, procedures,
programs,andcoursedescriptionsatanytime.

TheUniversityofSouthFloridaiscommittedtotheprinciplesofequaleducation,equalaccess,andequalemploymentopportunities
withoutregardtorace,color,maritalstatus,sex,religion,nationalorigin,disability,age,orVietnamordisabledveteranstatusas
providedbylawandinaccordancewiththeUniversitysrespectforpersonaldignity.Theseprinciplesareappliedintheconductof
Universityprogramsandactivitiesandtheprovisionoffacilitiesandservices.

Archivesonline:http://www.grad.usf.edu/newsite/catalog/archives.asp
ArchivedcopiesareavailableonlineforCatalogspublishedfrom1999through2013.Papercopiespriorto1998arearchivedat
theUSFLibraryandmayalsobearchivedintheUSFTampaOfficeofGraduateStudies.
USFTampaGraduateCatalog20132014

i

TableofContents

Section1WelcometoGraduateStudies.............................................................................................1
Section2AboutUSF.............................................................................................................................4
Section3GraduateFacultyandResearchInterests...........................................................................12
Section4GraduateAdmissions..........................................................................................................13
Section5RegistrationandGeneralInformation................................................................................25
Section6Tuition,Fees,andFinancialInformation............................................................................34
Section7AcademicPoliciesandRegulations....................................................................................35
Section8UniversityDegreeRequirements.......................................................................................49
Section9GraduationInformationandPostDoctoralAffairs............................................................67
Section10Degrees,Programs,andConcentrations............................................................................70
Section11GraduateCertificates.........................................................................................................89
Section12CollegeofArtsandSciences...............................................................................................93
Section13CollegeofBehavioralandCommunitySciences..............................................................281
Section14CollegeofBusiness...........................................................................................................331
Section15CollegeofEducation.........................................................................................................376
Section16CollegeofEngineering......................................................................................................526
Section17CollegeofGlobalSustainability........................................................................................617
Section18CollegeofMarineScience................................................................................................626
Section19CollegeofMedicine..........................................................................................................639
Section20CollegeofNursing............................................................................................................677
Section21CollegeofPublicHealth...................................................................................................702
Section22CollegeofTheArts...........................................................................................................770
Section23CollegeofGraduateStudies(AdministeredthroughtheOfficeofGraduateStudies)....799
Section24UniversityCollege.............................................................................................................802
Section25GraduateCourseInformation..........................................................................................805
Section26GraduateCourseDescriptions.........................................................................................809
Addendum:USFAtLakeland...................................................................................................Addendum

USFTampaGraduateCatalog20132014 Section1WelcometoGraduateStudies!

1
Section1
WelcometoGraduateStudies!

AMESSAGEFROMTHEPRESIDENT,DR.JUDYGENSHAFT

ThankyouforyourinterestingraduateeducationattheUniversityofSouthFlorida
System.USFisaTop50researchuniversitythathasbeennamedbytheChronicleof
HigherEducationasoneofthefastestgrowingresearchuniversitiesinthenationin
federalfunding.Wearedistinguishedbyourexcellentresearchandgraduate
educationandourlocationinamajorurbanregionthatisamongthenationsmost
diverseanddesirableplacestolive.

StronginterdisciplinaryprogramsputUSFontheleadingedgeofresearchand
graduateeducationinanumberofareas.Forexample,collaborationamong
researchersthroughouttheuniversityhasmadeUSFaleaderintheneuroscienceof
agingandUSFsinterdisciplinarydoctoralprograminAgingStudieswasthefirstofits
kindinthenation.Recently,USFsIndustrial/OrganizationalPsychologyprogramwasrankedhighestinthenationfor
publicationinpeerreviewedjournalsandthePrincetonReviewhasnamedUSFsCenterforEntrepreneurshiponeof
theTopEntrepreneurialGraduateProgramsinthecountry.

Inadditiontodoctoralprograms,USFoffersmanyopportunitiesforpostgraduatestudythroughourmanyMasters
andGraduateCertificateprograms,manyofwhicharedesignedtopreparegraduatestomakeimmediate
contributionstotheeconomic,culturalandsocialvitalityofcommunities.Agrowingfocusfortheuniversityis
enlistingleadingindustriesinourareaaspartnersingraduateprogramsasevidencedbyournewpartnershipwiththe
TampaBayLightning,TheLightningFoundationandUSFsCollegeofBusinessinanMBAinSportandEntertainment
Management,aprogramemphasizingthebusinessfundamentalsofthesportsandentertainmentindustry.

OurcommitmenttodiscoveryandtheapplicationofknowledgerelevanttourbancommunitieshasearnedUSF
frequentcitationsasamodelofanengageduniversity.TheopportunitiesforgraduateeducationatUSFarevast,
andwehaveworkedhardtobuildanenvironmentthatsupportsandencouragesinnovation.Inmanyareas,USF
offersprogramsthatprepareyoutomakeyourbestcontributiontoachallengingworld.Iinviteyoutoinquirefurther
aboutUSFprogramsofinteresttoyou.

Sincerelyyours,

JudyGenshaft,Ph.D.
President
OfficeofthePresident

http://system.usf.edu/president/aboutpresidentgenshaft.asp


USFTampaGraduateCatalog20132014 Section1WelcometoGraduateStudies!

2
AMESSAGEFROMTHEPROVOSTAND
EXECUTIVEVICEPRESIDENT,DR.RALPHWILCOX

Asoneofthenationsbestandfastestgrowingresearchuniversities,theUniversity
ofSouthFloridaisattractinginevergrowingnumbersmanyoftheworldsbestand
brighteststudents,whichtoday,asyoureadthis,includesyou.Thankyoufor
consideringUSFtobeyouracademichomeasyoupreparetoembarkonthe
challengingyetultimatelyrewardingjourneyofgraduateeducation.

Itisaseriouscommitment,andonetowhichthededicatedfacultyandstaffatUSF
attachutmostimportance.Oursharedpromiseistoengageyouinmeaningful
programsandinitiativesthatsupporttheeducational,health,andsocioeconomic
wellbeingofthelocal,national,andglobalcommunitiesweallserveeffortsthat
embraceinterdisciplinaryinquiryandcollaborationasthekeystosuccessnotonly
withinouracademicprograms,butalsointhegloballyinterwovenworldof21st
centurybusiness,communications,andculture.

ReflectiveofthisinnovativeapproachtoresearchwithrealworldimpactistheuniversitysnewCollegeofGlobal
Sustainability,thefirstintheUnitedStates,focusedonpreparingstudentsforanewgenerationofgreencollarcareers
findingsolutionsfortheincreasingdangerstoourfragileenvironmentandlimitedresources.Itsgraduateprogramin
globalsustainabilityintegratesvariousdisciplinessuchasnaturalandsocialsciences,engineering,economics,
government,publichealth,andpolicymakingincoursesmanyavailableonlineledbyUSFfacultymembersand
researcherseagertoinspiretomorrowsleadersforglobalchallengesneverbeforeimagined.

Amongourprofessorsareleadingscholarsintheirrespectivefields,whoreadilyengagenewgraduatestudentsinthe
laboratory,thelibrary,andotherresearchareas.TheirnumberincludesProfessorofMechanicalEngineeringand2012
U.S.ProfessoroftheYearAutarKaw,knownaroundtheworldforhisinnovativeuseoftechnologyandsocialmediato
expandlearningopportunitiesforstudents,aswellas15facultycolleagueselectedasfellowsoftheAmerican
AssociationfortheAdvancementofSciencein2012thefourthhighesttotalamongallU.S.universities.USFalsoranks
asaTopProducerofFulbrightScholars.Suchrecognitionspeakstoboththeprofessionalregardaffordedtoourfaculty
membersbytheirpeersworldwideandthequalityofacademicmentoringavailabletoourgraduatestudentsacrossa
broadrangeofscholarlyendeavors.

AtUSF,weencouragestudentsandfacultytoforgerealrelationshipsthatreplacethemoreacademicdepartment
centeredexperiencecommonofmostothergraduateschools.Webelieve,too,thatinterdisciplinarypartnerships
betweenstudents,faculty,andresearchersacrosscampus,inthecommunity,andaroundtheworldstrengthenboththe
universityandthegraduatestudentexperienceatUSF,creatingacollaborationforcompetitionthatoftenleadsto
newknowledgeandexciting,innovativesolutionstopervasiveandemergingproblems.

ContinuingtodelivertopqualitygraduateprogramsremainsaleadingpriorityforUSFasitenhancesfurtheritsposition
asapremierresearchuniversitywithstate,national,andglobalimpact.TheUniversityofSouthFloridaisaplacewhere
youcanchallengeyourselfandfocusonhowyouareabletocontributetoyourchosendiscipline,yourcommunity,and
theworldatlargeinameaningfulandsustainableway.Whetheryourcareeraspirationsaretoremaininacademeorto
pursueprofessionalpositionsinthepublicsector,businessorindustry,Iamconfidentthatyourinvestmentoftime,
talent,andenergyasagraduatestudentatUSFwillpresentyouwithwonderfulandexhilaratingprospectsforthe
future.

Ralph Wilcox

RalphC.Wilcox,Ph.D.
ProvostandExecutiveVicePresident
www.acad.usf.edu
USFTampaGraduateCatalog20132014 Section1WelcometoGraduateStudies!

3

Thispagehasintentionallybeenleftblank

USFTampaGraduateCatalog20132014 Section2AboutUSF
4
Section2
AboutUSF

Foundedin1956,theUniversityofSouthFloridawasthefirstindependentstateuniversityconceived,plannedand
builtinthe20thcentury.Theuniversityhasmadeincrediblestridesinfewmorethan50years,developingintoone
ofthenation'sleadingresearchinstitutions.

TheUniversityofSouthFloridaSystemisahighimpact,globalresearchsystemdedicatedtostudentsuccess.The
USFSystemincludesthreeinstitutions:USF;USFSt.Petersburg;andUSFSarasotaManatee.Theinstitutionsare
separatelyaccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegesandSchools.All
institutionshavedistinctmissionsandtheirowndetailedstrategicplans.Servingmorethan47,000students,the
USFSystemhasanannualbudgetof$1.5billionandanannualeconomicimpactof$3.7billion.USFisamemberof
theBigEastAthleticConference.

TheUniversity'smainTampacampusishometoUSFHealth,includingtheCollegesofMedicine,Nursing,Public
HealthandPharmacy.Withover230degreeprogramsattheundergraduate,graduate,specialtyanddoctoral
levels,includingthedoctorofmedicine,there'ssomethingforeveryoneatUSF.Theuniversityoffersadynamic
learningenvironmentthatinspiresinnovation,creativityandcollaborationandisfocusedonstudentsuccess.More
than2,000distinguishedscholars,researchersandexpertteachers,nearlyallholdingPh.Ds.orthehighestdegrees
intheirfields,makeuptheUSFfacultyincludingthe2012U.S.ProfessoroftheYear.

USFVision,Mission,Goals,Values,and,Accreditation

USFStrategicPlan:http://www.ods.usf.edu/Plans/Strategic/

Mission
TheUniversityofSouthFlorida'smissionistodelivercompetitiveundergraduate,graduate,andprofessional
programs,togenerateknowledge,fosterintellectualdevelopment,andensurestudentsuccessinaglobal
environment.

Vision
TheUniversityofSouthFloridaisaglobalresearchuniversitydedicatedtostudentsuccessandpositionedfor
membershipintheAssociationofAmericanUniversities(AAU).
AsFlorida'sleadingmetropolitanresearchuniversity,USFisdedicatedto:

Studentaccess,learning,andsuccessthroughavibrant,interdisciplinary,andlearnercenteredresearch
environmentincorporatingaglobalcurriculum

Researchandscientificdiscoverytostrengthentheeconomy,promoteciviccultureandthearts,anddesign
andbuildsustainablecommunitiesthroughthegeneration,dissemination,andtranslationofnewknowledge
acrossallacademicandhealthrelateddisciplines

Partnershipstobuildsignificantlocallyandgloballyintegrateduniversitycommunitycollaborationsthrough
soundscholarlyandartisticactivitiesandtechnologicalinnovation

AsustainableeconomicbasetosupportUSF'scontinuedacademicadvancement

USFTampaGraduateCatalog20132014 Section2AboutUSF
5
Values
TheUniversityofSouthFloridavalues:

Highqualityeducationandexcellenceinteachingandlearning.
Highimpactscholarship,research,andcreativeactivities
Diversityofstudents,faculty,andstaff
Affordableandaccessibleeducation
Globalresearch,communityengagement,andpublicservice
Social,economic,andenvironmentalsustainability
Focusanddisciplineinaligningthebudgetwithinstitutionalpriorities
Acampuslifewithbroadacademic,cultural,andathleticopportunities
Successandachievementofitsstudents,faculty,staff,andalumni
Sharedgovernancewithinallcomponentsoftheinstitution
Collegiality,academicfreedom,andprofessionalresponsibility
Entrepreneurialspirit,partnerships,andinnovation
Efficiencyandtransparentaccountability
Firstclassphysicalinfrastructureandasafecampusenvironment

LinkedGoalsandStrategies
Goal1
Welleducatedandhighlyskilledglobalcitizensthroughourcontinuingcommitmenttostudentsuccess:

Providethehighestquality,comprehensive,interdisciplinaryeducationalprogramsandstudentresearch
opportunitiestofostercriticalthinkingandintellectualinquirythroughavarietyofpedagogicaland
deliverymethods

Developdiverse,dynamicglobalcitizensandleaderstostrengthencommunitiesandimprovequalityoflife

Enhanceopportunitiesforallstudentsbyprovidingtransformationallearningincludinganincreased
commitmenttoscience,technology,engineering,andmathematics(STEM)andhealthfieldsthatis
intellectually,scientifically,andtechnologicallysoundandproducesrelevantappliedskillsandengaged
outcomes

Educatecompetitive,highlyskilledstudentspreparedtoexcelintheglobaljobmarketandtomake
meaningfulandlastingcontributionstosociety

Deliveraglobalizedcurriculumutilizingemergingtechnologiestoincreaseaccessibilityandcultural
understanding

Goal2
Highimpactresearchandinnovationtochangelives,improvehealth,andfostersustainabledevelopmentand
positivesocietalchange:

Engageinhighimpactresearch,scholarship,andcreativeactivitiesthatgeneratenewknowledge
Increaseglobalresearchopportunitiesandpartnershipsatalllevelswithintheuniversity
Developstrategicinterdisciplinaryresearchinitiativesthatsolvecriticalproblems
Promotecommunityengagedscholarshipandcreativeactivitiestobenefitallmembersofsociety

USFTampaGraduateCatalog20132014 Section2AboutUSF
6
Goal3
Ahighlyeffective,majoreconomicengine,creatingnewpartnershipstobuildastrongandsustainablefuturefor
Floridaintheglobaleconomy:

Pursueentrepreneurialendeavorsandpartnershipsthataugmentrevenueandmaximizeinstitutional
effectiveness

Establishmutuallybeneficialpartnerships(internalandexternal)thatenhancestudentaccesstoacademic
programs,research,andemploymentopportunities

Provideuniversitystewardshipthatrepresentsthecornerstoneofeconomicandculturalsignificancefor
Florida,thenation,andbeyond

Promoteastimulatingcampuslifethroughdiverseacademic,economic,cultural,andathletic
opportunities

Goal4
SoundfinancialmanagementtoestablishastrongandsustainableeconomicbaseinsupportofUSFscontinued
academicadvancement:

Alignbudgetandfiscalresourceswithacademicprioritiesthatsupporttherecruitmentandretentionof
intellectualtalentatUSF

Refinebusinesspracticestoensureastrongandsustainableeconomicfoundationfortheuniversity

Promoteandsustainapositiveworkingenvironment,highservicequality,andstrongstaffsupportthrough
competitivesalarystructuresandprofessionaldevelopmentopportunities

BuildUSFsfundraisingenterpriseandendowmentbycompletingacomprehensivecampaigntosupport
capitalprojects,endowedprofessorshipsandscholarships,andongoingoperatingneeds

ExpandUSFsinternationalidentitythroughdesignandimplementationofacomprehensive,powerful
brandingcampaign

Expandthecommercializationofemergingtechnologiestoenhanceregionalandstateeconomic
development

Enhancethephysicalinfrastructureofcampusthroughfiscallyresponsibleinvestments

Accreditation
TheUniversityofSouthFloridaisaccreditedbytheCommissiononCollegesoftheSouthernAssociationofColleges
andSchoolstoawarddegreesatthebaccalaureate,masters,specialist,anddoctorallevels,includingtheDoctorof
Medicine. Contact the Commission on Colleges at 1866 Southern Lane, Decatur, Georgia 300334097 or call 404
6794500forquestionsabouttheaccreditationoftheUniversityofSouthFlorida.

The institution was initially accredited in 1965 and was last reviewed and reaffirmed in 2005. The institution is
scheduledtoreceiveitsnextreaffirmationofaccreditationreviewin2015.

Inquiries to the Commission should relate only to the accreditation status of the institution, and not to general
admission information. The Commission is to be contacted only if there is evidence that appears to support an
institutionssignificantnoncompliancewitharequirementorstandard.

USFTampaGraduateCatalog20132014 Section2AboutUSF
7
UniversityAdministration

TheUniversityofSouthFloridaisamemberoftheStateUniversitySystem(SUS)ofFloridaandisgovernedbythe
FloridaBoardofGovernorsandtheUniversityBoardofTrustees.

FloridaBoardofGovernors
ForacurrentlistoftheBoardofGovernors(BOG),pleaserefertotheirwebsite:http://www.flbog.org/.

UniversityBoardofTrustees
TheUSFBoardofTrusteeswasestablishedbytheLegislaturein2001.The13trusteesincludedistinguishedfigures
in the law, commerce, medicine, education, philanthropy and public policy leadership. Six trustees are appointed
by the governor and five trustees are appointed by the Board of Governors. The Faculty Senate President and
Student Body President also serve as trustees. The President of the University serves as Corporate Secretary.
InformationabouteachTrusteeisavailableonlineat:
http://system.usf.edu/boardoftrustees/index.asp

JohnB.Ramil.Chair
HalW.Mullis,Esq.,ViceChair
ChristopherJ.Davis
StephanieE.Goforth
BrianD.Lamb
StanleyI.Levy.
MarkLombardiNelson
StephenJ.Mitchell
DebbieN.Sembler
ByronE.Shinn
NancyH.Watkins
JordanB.Zimmerman

President: JudyGenshaft,Ph.D.

ProvostandExecutiveVicePresident: RalphWilcox,Ph.D.

OfficeofGraduateStudiesAdministration:
ReferenceUSFPolicy11001http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy11001.pdf

Sr.ViceProvost & Dean, OfficeofGraduateStudies DwayneSmith,Ph.D.


AssistantDean,OfficeofGraduateStudies: PeterHarries,Ph.D.

USFSystemGraduateLiaisons:
OfficeofGraduateStudies DwayneSmith,Ph.D.
OfficeofGraduateStudies PeterHarries,Ph.D.
USFTampa GrahamTobin,Ph.D.
USFSt.Petersburg NoreneNoonan,Ph.D.
USFSarasotaManatee BonnieJones,Ph.D.
USFHealth DonnaPetersen,Ph.D.

CollegeDeans
CollegeofArtsandSciences EricEisenberg,Ph.D.
CollegeofBehavioralandCommunitySciences JulianneSerovich,Ph.D.
CollegeofBusiness MoezLimayem,Ph.D.
CollegeofEducation VastiTorres,Ph.D.,
CollegeofEngineering JohnWiencek,Ph.D.
CollegeofGlobalSustainability KalaVairavamoorthy,Ph.D.
CollegeofGraduateStudies DwayneSmith,Ph.D.
CollegeofMarineScience JacquelineDixon,Ph.D.
CollegeofMedicine StephenK.Klasko,Ph.D.
CollegeofPharmacy KevinSneed,Ph.D.
USFTampaGraduateCatalog20132014 Section2AboutUSF
8
CollegeofNursing DianneMorrisonBeedy,Ph.D.
CollegeofPublicHealth DonnaPetersen,Ph.D.
CollegeofTheArts JamesMoy,Ph.D.
HonorsCollege StuartSilverman,Ph.D.
UniversityCollege SandyCooper,Ph.D.,Interim
InternationalAffairs MariaCrummett,Ph.D.
Library WilliamGarrison,Ph.D.
UndergraduateStudies RobertSullins,Ph.D.

CollegeGraduateAssociateDeans(EGAD)http://www.grad.usf.edu/graduatecoordinators.php
CollegeofArtsandSciences BobPotter,Ph.D.
CollegeofBehavioralandCommunitySciences CatherineBatsche,Ph.D.
CollegeofBusiness JackieReck,Ph.D.
CollegeofEducation HaroldKeller,Ph.D.
CollegeofEngineering RafaelPerez,Ph.D.
CollegeofGlobalSustainability AliYalcin,Ph.D.,Interim
CollegeofGraduateStudies PeterHarries,Ph.D.,Interim
CollegeofMarineScience DavidNaar,Ph.D.
CollegeofMedicine MichaelBarber,
CollegeofNursing RitaDAoust,Ph.D.
CollegeofPublicHealth DeannaWathington
CollegeofTheArts BartonLee

USFTampaGraduateCouncil:
ForthemostcurrentlistofGraduateCouncilmembers,pleaserefertothewebsite:
http://www.grad.usf.edu/graduatecouncil.php

Membershipasof7/1/13for20132014
CollegeofArtsandSciences(4) AlexLevine,ViceChair
CollegeofArtsandSciences AnnetteCozzi
CollegeofArtsandSciences NatashaJonoska
CollegeofArtsandSciences XiaomeiJiang
CollegeofBehavioralandCommunitySciences(2) DebraDobbs
CollegeofBehavioralandCommunitySciences LorieFridell
CollegeofBusiness(2) NinaSutton
CollegeofBusiness vacancy
CollegeofEducation(2) vacancy
CollegeofEducation vacancy
CollegeofEngineering(2) SanjuktaBhanja
CollegeofEngineering vacancy
CollegeofMarineScience(2) AlHine
CollegeofMarineScience vacancy
CollegeofMedicine(3) LynnWecker
CollegeofMedicine MarzennaWiranowska
CollegeofMedicine PatriciaKruk
CollegeofNursing(2) BarbaraRedding
CollegeofNursing FrancesSahebzamani
CollegeofPublicHealth(2) HanaOsman
CollegeofPublicHealth RussellKirby,CouncilChair
CollegeofTheArts(2) DavidWilliams
CollegeofTheArts JohnCarmichael
Libraries(1) MathewTorrence
USFTampaGraduateCatalog20132014 Section2AboutUSF
9
Locations

UniversityofSouthFloridaTampa
4202E.FowlerAvenue
Tampa,Fl33620
(813)9742011
Website:www.usf.edu

USF'smaincampus,includingUSFHealth,islocatedinNortheastTampa,oneofthefastestgrowingareasinTampa
Bay. More than 39,000 students attend classes on the Tampa campus, which sits on more than 1,700 acres and
includes extensive health and medical (www.health.usf.edu) learning facilities, residence halls
(www.housing.usf.edu), research facilities (www.research.usf.edu), and more. USF Health is a partnership of the
Colleges of Medicine, Nursing, Pharmacy, and Public Health. Its research, education and healthcare missions are
accomplished with creative educational models, focused on emerging fields of research, and breaking the
boundariesoftraditionalhealthcaredeliverymodelstomeetthechangingneedsofagrowingcommunity.

UniversityofSouthFloridaSarasotaManatee
5700N.TamiamiTrail
Sarasota,FL342432197
(941)3594200
Website:www.sarasota.usf.edu

USF SarasotaManatee is located on the border of Sarasota and Manatee counties, a vibrant area featuring
educational and cultural institutions such as the John & Mable Ringling Museum of Art. The campus offers 44
bachelor'sdegree,master'sdegree,andcertificateprogramstothosewhohaveatleastanassociate'sdegree.

UniversityofSouthFloridaSt.Petersburg
140SeventhAvenueS.
St.Petersburg,FL33701
(727)873-4567
Website:www.usfsp.edu

USF's St. Petersburg is located on the beautiful waterfront in downtown St. Petersburg, an area featuring parks,
shops,restaurants,artgalleries,museumsandperformingartsandsportsvenues.USFSt.Petersburgservesmore
than3,700undergraduateandgraduatestudents.
USFTampaGraduateCatalog20132014 Section2AboutUSF
10
OfficeofGraduateStudiesDirectory
4202E.FowlerAve.,ALN226,Tampa,FL33620 8139742846 www.grad.usf.edu

PhoneNumber Email
Receptionist
DavidChapel (813)9742846 dchapel@usf.edu

DeansOffice
DwayneSmith,Ph.D.,Sr.ViceProvost&
Dean,OfficeofGraduateStudies
(813)9747359
dsmith@usf.edu
DebbieWilliams,ExecutiveAdministrativeSpecialist (813)9747359 dlw@usf.edu
PeterHarries,AssistantDean (813)9742623 harries@usf.edu
MattCordner,AdministrativeSpecialist (813)9742623 mcordner@usf.edu
KokitaWilson,OfficeManager (813)9743810 kwilson@usf.edu
Academics
CarolHinesCobb,AssistantDirector,Academics (813)9744239 cdh@usf.edu
JosephButts,AssistantDirector,Academics (813)9743586 tron@usf.edu
MaggieHogarth,AcademicProgramsSpecialist (813)9747727 mhogarth@usf.edu
CynthiaPumphrey,AdministrativeSpecialist (813)9742847 cpumphre@usf.edu
BusinessOperations
MildredHoward,AssociateDirector (813)9748356 mehoward@usf.edu
KimberlyCarter,FiscalandBusinessAnalyst (813)9743915 kfcarter@usf.edu
JavierRodriguez,FiscalandBusinessSpecialist (813)9749328 jrodriguez@usf.edu
TheresaFreeman,FiscalandBusinessSpecialist (813)3969010 tsfreeman@usf.edu
DoctoralLeadershipInstitute (813)9742846
GraduateandProfessionalStudentCouncil (813)9746939
GraduateStudentAffairs
GaryOliver,AssistantDirector,StudentSuccess (813)9747935 goliver@usf.edu
OfficeofPostdoctoralAffairs(OPA)
EricHoyer,Ph.D.,AssistantDirector (813)9747359 ehoyer@usf.edu

USFSYSTEMGRADUATEOFFICESANDOTHERCONTACTS
USFSarasotaManatee:BonnieJones,Ph.D.Assoc.VicePresidentandDean (941)3594504 bjj@sar.usf.edu
USFSt.Petersburg:Vivian Feuyo,Ph.D., Interim Reg.Assoc.ViceChancellor(727)873-4450 vfueyo@usfsp.edu
RegistrarsOfficehttp://www.registrar.usf.edu/index.php (813)9742000 n/a
Diversity&EEOOfficehttp://usfweb2.usf.edu/EOA/ (813)9744373 n/a
FinancialAidhttp://usfweb2.usf.edu/finaid/ (813)9744700 Financialaid@usf.edu
InformationTechnologyhttp://it.usf.edu/ (813)9741222 HelpdeskIT@usf.edu
StudentHealthServiceshttp://www.shs.usf.edu/ (813)9742331 n/a
ParkingandTransportation
http://usfweb2.usf.edu/parking_services/default.asp
(813)9743990
n/a
UniversityPolicehttp://www.usfpd.usf.edu/ (813)9742628 n/a
USFTampaGraduateCatalog20132014 Section2AboutUSF
11
AcademicCalendar
AcademicCalendar http://www.registrar.usf.edu/enroll/regist/calendt.php
Thesis/DissertationDeadlines http://www.grad.usf.edu/thesisdissertationdeadlines.asp
Cultural/DiversityCalendar http://usfweb2.usf.edu/eoa/deo_calendar/default.asp

AttendancePolicyfortheObservanceofReligiousDays
http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy10045.pdf

August 2013 - July 2014


August 9 Summer B, last day of classes
August 10 Summer Commencement, Tampa
August 26 Fall, first day of classes
September 2 Labor Day
November 11 Veteran's Day
November 28 & 29 Thanksgiving Holiday
December 6 Fall, last day of classes
December 7 - 13 Final Exam Week
December 8 Final Exams (Distance Ed)
December 14 Fall, Tampa Commencement
December 15 Fall, St. Petersburg Commencement
December 15 Fall, Sarasota-Manatee Commencement
December 25 Christmas Holiday
2014
January 1 New Year's Holiday
January 6 Spring, first day of classes
January 20 Martin Luther King, Jr.
March 10 - 15 USF Spring Break
April 25 Spring, last day of classes
April 26 - May 2 Spring Final Exams
April 27 Spring Final Exams (Distance Learning)
May 3 Spring Commencement, Tampa
May 4 Spring Commencement, St. Petersburg
May 4 Spring Commencement, Sarasota-Manatee
May 12 Summer A & C, first day of classes
May 26 Memorial Day
June 20 Summer A, last day of classes
June 30 Summer B, first day of classes
July 4 Independence Day Holiday
July 18 Summer C, last day of classes
August 8 Summer B, last day of classes
August 9 Summer Commencement, Tampa
USFTampaGraduateCatalog20132014 Section3GraduateFacultyandResearchInterests

12
Section3
GraduateFacultyandResearchInterests

GraduateFacultyDefinition

TheUniversityofSouthFloridarecognizesGraduateFacultyandAffiliateGraduateFaculty.

GraduateFacultyisdefinedtoconsistofalltenuretrackortenuredfacultyappointedattheAssistant,Associate,
or Professor rank, who holds a terminal degree or equivalent in their discipline. Graduate Faculty members are
eligibletoteachgraduatecoursesandmaydirectandserveonmasters,specialist,anddoctorallevelcommittees.
Tochairadoctorallevelcommittee,aGraduateFacultymembermustengageincurrentandsustainedscholarly,
creative, or research activities, such as publications, performances, exhibitions, patents, inventions and research
grants.

Affiliate Graduate Faculty membership may be granted by the Office of Graduate Studies Dean to individuals
whose skills or expertise meet criteria established by the College. Affiliate Graduate Faculty membership is in
effect for a specified period of time and specific purposes. Affiliate members may be eligible to teach graduate
courses, to serve on masters, specialist, and doctoral level committees, to direct master's and specialist's level
committees,andtocodirectdoctorallevelcommittees,atthediscretionoftheCollege.EmeritusProfessorsand
retired or recently resigned professors may also be appointed as Affiliate Graduate Faculty with the approval of
theCollegeandOfficeofGraduateStudiesDean.

ForacurrentlistofGraduateFacultyandAffiliateGraduateFacultyinanyprogramcontacttheprogramdirectoror
coordinator.

Graduate Faculty Approval Graduate faculty is defined as noted above; Colleges and Departments may have
additional requirements. The Office of Graduate Studies will maintain a list of Graduate Faculty along with
approvalguidelinesfromtheCollegesandDepartments.

SearchableFacultyDatabase
OntheOfficeofGraduateStudieswebsiteisasearchabledatabasethatprovidesinformationongraduatefaculty
andresearchinterests.http://www.grad.usf.edu/programs/faculty.asp

Also reference USF Policy 10115 Faculty Credentials for Teaching Undergraduate and Graduate Courses
http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy10115.pdf

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
13
Section4
GraduateAdmissions

OfficeofAdmissions
UniversityofSouthFlorida
OfficeofAdmissions
4202EastFowlerAvenue,SVC1036
Tampa,Fl336205816
Website: http://www.grad.usf.edu/graduateadmissions.asp
Email: admissions@grad.usf.edu
Phone: 8139743350
Fax: 8139747343

InterimDirectorforGraduateAdmissions ElizabethOConnell,Ph.D.

UniversityAdmissionsCriteriaandPolicies

USFRegulationUSF3008:
http://generalcounsel.usf.edu/regulations/pdfs/regulationusf3.008.pdf

StatementofPrinciples
In graduate admission decisions, multiple sources of information should be used to ensure fairness, promote
diversity and balance the limitations of any single measure of knowledge, skills, or abilities. The sources may
include: undergraduate grade point average, letters of recommendation, personal statements, samples of
academic work, portfolios, auditions, professional experience related to proposed graduate study, as well as
nationallyknown,standardizedtestscores.Itistheresponsibilityofeachgraduateprogramtoselectadmissions
criteriathatbestpredictsuccessintheirspecificfieldandtodeterminetheweightgiventoeachmeasure.

None of the sources of information, particularly standardized test scores, should be used in isolation nor should
such scores be used in combination or separately to establish minimum or cut off scores. Program specific
guidelines for the use of standardized test scores should be developed based on the experience of a given
departmentwithitspoolofapplicants.
1

1
Adapted from the GRE Guide to the Use of Scores 2003-2003
USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
14
AdmissionRequirements
EachapplicanttoagraduateprogramattheUniversityofSouthFloridaisrequiredtomeetthefollowingminimum
requirements:

1. Anapplicantmusthaveoneofthefollowing(a,b,orc):

a. Abachelorsdegreefromaregionallyaccreditedinstitutionandsatisfyingatleastoneofthe
followingcriteria:

i. Baverageorbetterinallworkattemptedwhileregisteredasanundergraduatestudent
workingforadegree,or

ii. Baverageorbetterinallworkattemptedwhileregisteredasanupperdivisionundergraduate
studentworkingforabaccalaureatedegree.

b. AbachelorsdegreewithaBaverageorbetterfromaregionallyaccreditedinstitutionanda
previousgraduatedegreewithaBaverageorbetterfromaregionallyaccreditedinstitution.

c. Theequivalentbachelorsand/orgraduatedegreesfromaforeigninstitution.

2. Submissionofstandardizedtestscoresifrequiredbythegraduateprogram.ForGraduateProgramsthat
requiretheGRE,thePersonalPotentialIndex(PPI)mayberequired.Refertoindividualprogram
admissionrequirementsforinformation.

3. ApplicantsfromcountrieswhereEnglishisnottheofficiallanguagemustalsodemonstrateproficiencyin
English*inoneofthefollowingways:

a. Byprovidingascoreof79orhigherontheInternetbasedTestofEnglishasaForeignLanguage
(TOEFLiBT)

b. Byprovidingascoreof6.5orhigherontheInternationalEnglishLanguageTestingSystem(IELTS).

c. Byprovidingascoreof53orhigheronthePearsonTestofEnglishAcademic(PTEA)

d. ByEarningascoreof153(orequivalent)ontheGREVerbalexam

e. ByearningabaccalaureateorhigherdegreeataregionallyaccreditedinstitutionintheUS

f. ByearningabaccalaureateorequivalentdegreeataforeigninstitutionwhereEnglishisthelanguage
ofinstruction(mustbedocumentedonthetranscriptoronanofficialCertificateofMediumof
Instructionfromtheinstitution).

4. Allspecificandadditionalrequirementsofthegraduateprogramtowhichadmissionissought(including
requirementstosubmitstandardizedtestscores)consistentwiththeaboveStatementofPrinciples.

The Program Chair and College Dean must approve any exceptions to these requirements before they will be
consideredbytheOfficeofGraduateStudies.SucharequestmustbesubmittedtotheOfficeofGraduateStudies
withjustificationanddocumentation.

*International students who are seeking employment as a teaching assistant (in departments that offer them)
mustmeetadditionalEnglishLanguageRequirements.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
15
ApplicationProcess(Howitworks)
Graduateapplicantsareurgedtosubmitaccurateandcompleteinformationasearlyaspossible.Applicationsand
supportingdocumentsreceivedaftertheapplicationdeadlinewillnotbeacteduponbutwillbekeptonfileforup
to one year. At the request of the applicant or graduate program, they will be processed for the next available
term.

Please note if the graduate program is a Direct Receipt Program (http://www.grad.usf.edu/graduateadmissions


directreceipt.asp). For Direct Receipt Programs application materials should be uploaded with the online
application AND the hard copies should be sent directly to the program (NOT to the Office of Graduate
Admissions.)AllinquiriesregardingapplicationstatusshouldalsobedirectedtotheProgram.

TheGraduateAdmissionsOfficeandtheGraduateProgramreviewyourapplicationforadmissiontotheOfficeof
Graduate Studies. Once the graduate program reviews your eligibility for its graduate program they will forward
theirdecisiontotheGraduateAdmissionsOfficewhich,inturn,willissuetheofficialdecision.

Ifyouareaforeigngraduateapplicant,theInternationalServicesOffice(http://global.usf.edu/isss/prospect.html)
willevaluateyourfinancialstatementafteryouareadmittedtodetermineyoureligibilityforastudentvisa.Your
financialstatementmustbedatedwithin6monthsofthestartingthedegreeprogram.Eachoftheseofficesmay
requestadditionaldocumentsfromyoutomakeadecision.

ForacompletelistofgraduateprogramsanddeadlinedatespleasevisittheOfficeofGraduateStudieswebsiteat
http://www.grad.usf.edu/programs.php

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
16
GraduateAdmissionApplicationDeadlines

TheUniversitydeadlinesforgraduateadmissionarelistedbelow.However,manyacademicprogramshaveearlier
deadlines than those established by the University, or may admit only for a specific term, A few programs may
havelaterdeadlines,ifapprovedbyGraduateCouncil.

ApplicationsmustbereceivedbytheapprovedGraduateProgramdeadline.However,Graduateapplicationsand
supportingmaterialsshouldbesubmittedwellinadvanceofthepublishedprogramdeadline,especiallyforthose
applicants who are interested inbeing considered for assistantships,tuition waivers, and fellowships. Applicants
whowanttobeconsideredforOfficeofGraduateStudiesfellowshipsmusthaveallapplicationdocumentsonfile
atUSFpriortotheprogramsapplicationdeadlineORFebruary15,whichevercomesfirst.Applicantsshouldcheck
with the prospective Program to determine if there is an earlier deadline for consideration of fellowships the
Programmayoffer.

University Graduate Admission Deadlines***


Admissionin
Spring2014
Admissionin
Summer2014
Admissionin
Fall2014

UniversityApplicationDeadline:

October15,2013 February15,2014 February15,2014

UniversityApplicationDeadline
forProfessionalPrograms:

October15,2013 February15,2014 June1,2014


***AssomeGraduateProgramsmayhaveearlierorlaterdeadlinesthantheUniversityDeadline,applicantsshouldcheck
theindividualGraduateProgramlistingtoconfirmtheGraduateAdmissionDate
http://www.grad.usf.edu/programs/search_all.phporhttp://www.grad.usf.edu/catalog.php

GraduateProgramsmaycontinuetoacceptandprocessapplicationsafterthepublisheddeadline
ifspaceexistswithintheprogram.CheckwiththeProgramforavailability.

AdditionalRequirementsforInternationalApplicants
InadditiontomeetingthepublishedapplicationdeadlinefortheProgramofinterest,allimmigrationdocuments
shouldbesubmittedassoonaspossible,butmustbeonfileatUSFnolaterthanthefollowingprocessing
deadlines*:
InternationalApplicantsApplyingfromOutsidetheUS:
FallSemesteradmissionMay1
SpringSemesteradmissionSeptember15
SummerSemester(allsessions)admissionJanuary15

InternationalApplicantsApplyingfromWithintheUS:
FallSemesteradmissionJune1
SpringSemesteradmissionOctober15
SummerSemester(allsessions)admissionFebruary15

*forprogramswithlateradmissionapplicationdeadlines,allmaterials,includingapplicationandsupporting
documents,mustbesubmittedbytheinternationalprocessingdeadlinenotedabove.

ForeignapplicantswhoareoutsidetheU.S.arerequiredtoapplyforavisa.Dependingonthecountryoforigin,
thismaytakeafewmonths.SothedeadlinesfortheseinternationalapplicantsmaybeearlierthantheProgram
deadlineandtheseapplicantsmustapplypriortobothdeadlines.Theyarestronglyencouragedtoapplyasearly
aspossible.ForeignapplicantswhoareintheU.S.andarecurrentlyonavisamayusethedomesticapplication
deadlinedates.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
17
ApplicationChecklist(ToDoList)
ToassistyouintheadmissionsprocessthefollowingisyourToDoList.Toexpeditetheprocessingofyour
applicationpleaseuploadacopyofallofyoursupportingdocumentswhenyousubmityourapplicationonline.
Youwillalsoneedtosendofficialtranscriptsandtestscoresduringtheapplicationprocess.

1. FillouttheGraduateApplicationonline
2. PaytheApplicationFee
3. SendTranscriptsofallpriorpostsecondarycoursestaken(includingtranslationsandevaluationsfor
internationaltranscripts)
4. HaveofficialTestScoressenttoUSF
5. ReviewandrespondtoConductClearancePolicy(LegalDisclosureStatement)
6. ReviewFloridaResidencyPolicyforTuitionPurposesandprovidedocuments,ifneeded

1.GraduateApplication:https://secure.vzcollegeapp.com/usf/
Applicants should also check with the Graduate Program to determine if they require any additional,
supporting documents beyond the ones listed here. Admission requirements may be found in the Program
listing in the Catalog. Applicants are encouraged to upload a copy of each supporting document required by
the program through the online application. You may upload documents after the application has been
submitted.

2.ApplicationFee:
All applicants are required to submit an application fee of $30.00 USD for EACH graduate program to which
they seek admission (USF Regulation USF40107: Special Fees, Fines and Penalties
http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0107.pdf). If they attended USF as a former
degree seeking student or nondegree student they will still be required to submit the application
fee.Applicantshavetheoptiontopaytheirapplicationfeebycreditcard(Discover,MasterCard,andVisa)or
by ECheck (personal checking/savings account) through the Graduate Online Application. ALL APPLICATION
FEESSUBMITTEDARENONREFUNDABLE.

3.Transcripts:
One (1) official transcript from all institutions of higher learning attended by the applicant is required
(reference USF Policy 10044). Former USF students should not submit their USF transcript; it is already on
file. Applicants may provide unofficial copies of transcripts to expedite the processing of their applications.
Pleaseuploadthemthroughtheonlineapplication.Anyofferofadmissionbasedonunofficialtranscriptswill
not be finalized until official transcripts are received in a sealed envelope from the Office of the Registrar
where they attended. All transcripts mustbe inEnglish; it is the applicants responsibility to have transcripts
translated and evaluated* before submitting them as part of the graduate application packet. If they are
applying while still completing an undergraduate degree, they must submit transcripts of at least six (6)
semestersofcompletedundergraduatework.Finaltranscriptsshowingtheawardofabachelorsdegreewill
berequiredifanapplicantisadmittedandenrolls.

*All foreign transcripts that are not in English must be accompanied by a certified English translation.
Documents signed by a notary or other public official with no affiliation to the institution of higher learning
willnotbeaccepted.Somegraduateprogramsrequireacoursebycourseevaluation.Intheeventthatthe
university receives documentation that is questionable, or suspicious in any way, the university will require
theapplicanttoobtainacoursebycourseevaluationfromaforeigntranscriptevaluationservice.Refertothe
Graduate Admissions website for a list of evaluation services (http://www.grad.usf.edu/graduate
admissions.asp).

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
18
4.TestScores

GRE(GraduateRecordExamination)*: http://www.gre.org
ApplicantstograduateprogramsrequiringtheGREmustsubmitGREtestscoresearnedwithinfive(5)yearsof
the desired term of entry. Official scores must be submitted to USF directly from the Educational Testing
Service, but applicants may provide unofficial copies of their test scores to expedite the processing of their
applications. Any offer of admission based on unofficial scores will not be finalized until official scores from
ETSarereceived.TheinstitutioncodeforUSFis5828andappliestoalltestsadministeredbyETS.

* The GRE requirement is determined by the individual graduate programs. Please contact your program of
interest directly for additional information. Editors Note: GRE has a new score scale; scores listed on the
Programpagesinthiscatalogmayreflecttheoldscale.RefertotheGREConcordanceTablestoseehowthe
scorescompare.http://www.ets.org/s/gre/pdf/gre_guide.pdf

GMAT(GraduateManagementAptitudeTest):http://www.gmac.com
ApplicantstoprogramsintheCollegeofBusinessshouldsubmitGMAT**scoresearnedwithinfive(5)yearsof
the desired term of entry. Official scores must be submitted to USF directly from the Pearson VUE Testing
Service, but applicants may provide unofficial copies of their test scores to expedite the processing of their
applications. Any offer of admission based on unofficial scores will not be finalized until official scores from
PearsonVUEarereceived.ThefollowingarethePearsonVUEinstitutioncodesforUSFprograms.

VP9M423 Ph.D.inBusinessAdministration
VP9M404 ExecutiveM.B.A.
VP9M441 HospitalityManagement,USFSarasotaManatee
VP9M497 M.B.A.,FullTime
VP9M480 M.B.A.,PartTime
VP9M421 M.B.A.,USFPolytechnicLakeland
VP9M401 M.B.A.,USFSarasotaManatee
VP9M425 M.B.A.,USFSt.Petersburg
VP9M418 MastersinAccountancy
VP9M467 M.A.inEconomics
VP9M486 M.S.inFinance
VP9M417 M.S.inManagement
VP9M466 M.S.inManagementInformationSystems
VP9M440 M.S.M.inMarketing
VP9M474 M.S.R.EinRealEstate
VP9M448 M.S.inEntrepreneurinAppliedTechnology
VP94J76 HealthAdministration,CollegeofPublicHealth

**ApplicantsmaynothavetosubmitaGMATiftheyhavetakentheGRE.Pleasecontactyourprogramofinterestdirectly
foradditionalinformation.

MCAT
ForthoseprogramsthatmayrequireoraccepttheMCAT,thetesttypicallymustbetakenwiththelastfive(5)
years;checkwiththeProgramforspecificrequirements

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
19
EnglishProficiencyTests
ApplicantswhosenativelanguageisnotEnglishorwhohavenotearnedadegreeintheUnitedStatesmust
demonstrateproficiencyinEnglishbysubmittingacceptablescoresononeoftheEnglishproficiencytests
listedbelow.Theymusthavebeenearnedwithintwo(2)yearsofthedesiredtermofentry.Applications
submittedwithEnglishproficiencyscoresthatdonotmeettheminimumrequirementswillbedenied.

Hasscoreda79orhigherontheinternetbasedTestofEnglishasaForeignLanguage(TOEFL)ora
213onthecomputerbasedtestor550onthepaperbasedTOEFL
Hasscored6.5onInternationalEnglishLanguageTestingSystem(IELTS)http://www.ielts.org/
Hasscoreda59orhigheronthePearsonTestofEnglishAcademic(PTEA)

TheEnglishproficiencyrequirementmaybewaivedforadmissioniftheapplicantmeetsoneofthe
followingconditions:
TheapplicantsnativelanguageisEnglish,or
Hasscoredtheequivalentof153orhigherontheGREVerbalTest,or
HasearnedacollegebachelorsorgraduatedegreeataregionallyaccreditedU.S.institutionofhigher
learning,or
Hasearnedacollegebachelorsorgraduatedegreefromaninstitutionwhoselanguageofinstruction
isEnglish(mustbenotedonthetranscriptoronanofficialCertificateofMediumofInstructionfrom
theinstitution)

PLEASE NOTE: International students from countries from predominantly EnglishSpeaking Countries (e.g.
http://iapply.iupui.edu/englishspeakingcountries/) who want to be considered for a teaching assistantship
must show proficiency in spoken English even if their TOEFL has been waived for admission to a graduate
program.Theyneedaminimumscoreof26onthespokenportionoftheInternetbasedTOEFL(iBT)or160
onthespokenportionoftheTOEICtestadministeredbyETS(http://www.ets.org/toeic).

Please reference http://usfweb2.usf.edu/admissions/internationallanguagerequirements.html for more


informationonlanguagerequirements.

5.ConductClearancePolicy(LegalDisclosureStatement):
All graduate applicants are required to answer the Conduct Clearancequestions ofthe graduate application.
The applicant will not be notified of the admission decision until answers to the two questions have been
received.Applicantswhomeetthecriteriafordisclosuremustprovidespecifieddocumentsandbereviewed
bytheVicePresidentofStudentAffairsorhis/herdesignee,ifwarranted.

6.FloridaResidencyPolicy:
Applicants desiring classification as Florida residents for tuition paying purposes must sign and complete the
FloridaResidentssectionoftheFloridaResidencyClassificationpageoftheGraduateApplication.Incomplete
orunsignedformswillbeclassifiedasnonFloridaresidents.TheOfficeofGraduateAdmissionswillclassify
applicantsasFloridaresidentsiftheyhaveprovideddocumentationthatverifiestheybeganlivinginFloridaat
leasttwelvemonthspriortothefirstdayofclassesoftheiradmittedtermofentry.Additionaldocumentation
other than what is required may be requested in some cases. All documentation is subject to verification.
ApplicantsareresponsibleforcheckingtheirresidencyclassificationwhenadmittedtotheUniversityofSouth
Florida.Theresidencyclassificationisnotedontheofficialacceptanceletter.Ifapplicantsfeelthattheirinitial
classificationisinerror,theyhaveuntilthelastdayofthetermtocontacttheappropriateadmissionsoffice
and request a reevaluation. After students have completed their first semester of study they may seek to
havetheirresidencyreconsidered.TheymaysubmitaRequestforReclassificationFormwiththeOfficeofthe
Registrar.Thismustbefiledbythe5thdayofclassesforthetermbeingrequested.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
20
IndependentStudent:
Astudentwhomeetsanyoneofthefollowingcriteriashallbeclassifiedasanindependentstudentfor
thedeterminationofresidencyfortuitionpurposes:
1. Thestudentis24yearsofageorolderbythefirstdayofclassesofthetermforwhichresidency
statusissoughtataFloridainstitution;
2. Thestudentismarried;
3. Thestudenthaschildrenwhoreceivemorethanhalfoftheirsupportfromthestudent;
4. Thestudenthasotherdependentswholivewithandreceivemorethanhalfoftheirsupport
fromthestudent;
5. ThestudentisaveteranoftheUnitedStatesArmedForcesoriscurrentlyservingonactiveduty
intheUnitedStatesArmedForcesforpurposesotherthantraining;
6. Bothofthestudentsparentsaredeceasedorthestudentisorwas(untilage18)a
ward/dependentofthecourt;
7. Thestudentisworkingonamastersordoctoraldegreeduringthetermforwhichresidency
statusissoughtataFloridainstitution;or
8. Thestudentisclassifiedasanindependentbythefinancialaidofficeattheinstitution.

Evidence that the student meets one of these criteria will be requested by the higher education
institution.Floridaresidencystatutesrequireatleasttwodocuments,dated12monthspriortothefirst
day of class for the entry term sought, to validate a claim for Florida residency for tuition purposes.
DocumentsareclassifiedintwotiersatleastoneoftherequireddocumentsmustbefromtheFirstTier.

FIRSTTIERDOCUMENTATION(atleastoneofthetwodocumentssubmittedmustbefromthislist)

1. FloridaDriversLicense(driverslicensesfromothersstatesmustberelinquished)oraState
ofFloridaIDcard(ifthereisnoevidenceoftiestoanotherstate)
2. FloridaVotersRegistrationcard
3. FloridaVehicleRegistration(proofofpreviousregistrationcanbeobtainedfromthelocal
tagoffice)
4. DeclarationofDomicileinFlorida(12monthsfromthedatethedocumentwasswornand
subscribedasnotedbytheClerkoftheCircuitCourt)
5. ProofofpurchaseofapermanenthomeinFloridathatisoccupiedasaprimaryresidenceof
theclaimant
6. ProofofpermanentfulltimeemploymentinFlorida(oneormorejobsforatleast30hours
perweekfora12monthperiodletterfromemployeronofficialletterheadrequired)
7. BenefithistoriesfromFloridaagenciesorpublicassistanceprograms

SECONDTIERDOCUMENTATION(maybeusedinconjunctionwithonedocumentfromFirstTier)

1. Floridaprofessionaloroccupationallicense
2. Floridaincorporation
3. ProofofmembershipinFloridabasedcharitableorprofessionalorganizations
4. Utilitybillsandproofof12consecutivemonthsofpayments
5. Leaseagreementandproofof12consecutivemonthsofpayments
6. StateorcourtdocumentsevidencinglegaltiestoFlorida

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
21
ApplicationDocumentsAccess/Forward/ReturnPolicy
No application, test scores, transcripts, letters of recommendations, or other documents submitted with the
applicationpacketwillbereturnedtotheapplicantorforwardedtoanotherinstitution/thirdparty.TheOfficeof
Graduate Admissions applicant file is not to be released to the applicant or other third parties. Requests,
subpoenas,orcourtordersaretobeforwardedtotheOfficeoftheGeneralCounselafterreviewbytheAssistant
Director of Graduate Admissions. Applicants once admitted and enrolled during the term of admission may
requestaccesstotheirstudentfileattheOfficeoftheRegistrar.LettersofRecommendationthattheapplicanthas
waivedtherighttoview(indicatedonRequestforRecommendationForm)arenottobegiven,copiedorviewed
bytheapplicantorthirdparties.Requestsfordegree/enrollmentverificationinformationshouldbereferredtothe
OfficeoftheRegistrar.
TheOfficeofGraduateAdmissionsgraduateapplicationfilesmaybecopiedandreleasedtoUSFstaffconducting
legitimateUniversitybusiness.
AdditionalRequirementsofPrograms(Ifapplicable)
Many programs require additional application materials such as resumes, writing samples, or letters of
recommendation. These items may be sent as part of the overall graduate application packet or directly to the
appropriatedepartment/program.These materialswillbeforwardedtotheappropriateprogramifsentwiththe
application packet, but they DO NOT become part of the applicants permanent file. Therefore, the Office of
GraduateAdmissionsdoesnottrackthemandcannotrespondtorequeststoverifyreceiptofthem.

FinalAdmissionClassification
Applicantsacceptedforadmissionswhoseofficialdocuments(transcriptsand/ortestscores)havebeenreceived
bytheOfficeofGraduateAdmissionsareadmittedasFinal.Theadmissionfileiscomplete.

ProvisionalAdmissionClassification
Applicants accepted for admission whose official documents (transcripts and/or test scores) have not been
receivedbytheOfficeofGraduateAdmissionsareadmittedprovisionallypendingreceiptofthesemissingitems.
The required transcripts and/or test scores must be received before a second semester registration is permitted.
During the first semester, the Office of Graduate Admissions will place a registration hold on the student's file.
When the missing documents are provided to the Office of Graduate Admissions the registration hold will be
removedandthestudentsadmissionstatuswillbecomefinal.

ExceptionAdmissionClassification
The University may admit up to 10% of new enrollees as exceptions to the Board of Trustees minimum
requirements. To be considered for an exception, applicants should present evidence that might account for the
previous academic record and demonstrate potential for academic success. Examples of this evidence include
excellentlettersofrecommendationfromtrustedacademicians,performanceingraduatecoursestakenasapost
bachelors student, professional experience in the discipline for a period of time, etc. Each request for a 10%
exceptionmustincludeastatementdescribingthespecialcircumstancesoftheapplicant.Itisthediscretionofthe
program.college,andOfficeofGraduateStudiestoacceptexceptionapplicationrequests.

ConditionalAdmissionCriteria
A program and/or college may admit applicants conditionally pending satisfaction of remedial or program
requirements. These conditions may include receipt of specific satisfactory scores on standardized tests,
attendance in and satisfactory grades in specific core or remedial courses, etc. It is the responsibility of the
College/Graduate Program to track the students satisfactory completion of the conditions and to notify the
Graduate Admissions Office when conditions are met. Failure to satisfy those conditions by the deadline
establishedbytheprogramwillresultinacademicdismissalfromtheprogram.TheCollege/GraduateProgramwill
submitaDismissalForm(http://www.grad.usf.edu/student-forms.php)totheOfficeofGraduateStudiesto
initiatedismissal.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
22
DefermentofAdmissionRequest
An applicants acceptance is granted for the semester and the particular program specified in the official
acceptance notification. In order to validate that acceptance, the applicant must enroll for that semester.
Applicants who do not validate their admission may contact the Graduate Program Director and request a
Deferment of Admission. This request must be made in writing within 12 months of the initial requested entry
date. If a request for Deferment of Admission is not activated within the 12 months, a new application and fee
mustbesubmittedforfutureconsideration.Defermentrequestsmustalsobereceivednolaterthantheprogram
or University application deadline for the semester desired, whichever is earlier (for deadlines go to
http://www.grad.usf.edu/programs/search6_alpha.asp?searchtext=null).

Applicants who were admitted provisionally upon receipt of official test scores and/or transcripts must supply
those missing items prior to having their deferment decision processed by the Office of Graduate Admissions.
International applicants must also provide a new financial statement dated no earlier than 6 months before the
requesteddateofentry.

SpecialexemptiontothispolicymaybegrantedtoactivedutyU.S.militarypersonnelwhoreceivemilitaryorders
that prevent them from beginning a graduate program during the requested term.. These applicants may have
their admission honored for up to 2 years, pending approval from their academic program, and proper
documentationoftheirdeployment.Theseextensionswouldbegrantedonacasebycasebasis.

UpdateofAdmissionRequest
Ifadmissionhasnotbeengrantedbecauseofalateapplicationormissingcredentialsandtheapplicantwantsto
beconsideredforafuturesemester,theapplicantmustrequestthattheOfficeofGraduateAdmissionsupdatethe
application and specify the new enrollment date. This request must be made in writing within 12 months of the
initialrequestedentrydateandmustbereceivednolaterthantheprogramorUniversityapplicationdeadlinefor
the semester desired, whichever is earlier. Applications are held for only 12 months. If a request for change in
entry date is not received in the specified time, a new application and fee must be submitted. The Office of
Graduate Admissions will not process any update requests without first receiving all official transcripts and
requiredtestscores.

DenialofAdmission/AppealforReconsiderationCriteria
Applicantsdeniedadmissionwillbegiventimelynoticebyemailorpostalservice.Deniedapplicantswhomeetthe
minimum standards may write the Graduate Program Director of the program to which they applied within 30
daysofthedateofdenialtorequestreconsideration.Therequestshouldpresentadditionalevidenceofpotential
for academic success at USF and contain reasons why reconsideration is warranted. Applicants denied admission
to a degree program are eligible to enroll as special (nondegree seeking) students, although course selection
restrictionsmayapply.NondegreeapplicationsmustbesubmittedtotheOfficeoftheRegistrar.

ActivationofAdmission
An applicants acceptance is granted for the semester and the particular program specified in the official
acceptancenotification.Inordertovalidatetheacceptancetheapplicantmustenrollforthatsemester.Applicants
who do not validate their admission may contact the Graduate Program Director and request a Deferment of
Admission.Thisrequestmustbemadeinwritingwithin12monthsoftheinitialrequestedentrydate.Ifarequest
forDefermentofAdmissionisnot activatedwithinthe12months,anewapplicationandfeemustbesubmitted
forfutureconsideration.

ReadmissionPolicy
A graduate student who is not registered and enrolled for a minimum of six (6) credits in a 12 month period is
automaticallyplacedininactivestatus(refertotheContinuousEnrollmentPolicyformoreinformation).Students
whowishtocontinuetheirstudiesmustbereadmittedtothedegreeprogram.Readmissionisatthediscretionof
theprogramandisnotguaranteed.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
23
Eligibilityforreadmission:

StudentswhohavebeenAcademicallyDismissedfromtheUniversityforAcademicDishonestymay
notapplytoanygraduateprogramatUSF.
Deadlines:Thereadmissionapplicationandallsupportingmaterialsmustbesubmittedbythe
applicationdeadline.

AdditionalRequirements:

Graduate Application: In order to be considered for readmission, students must submit a new
graduateapplication,applicationfee,andanyrequiredsupportingmaterials.

TestScores:TheDepartmentmayrequirenewTestscores(GRE/GMAT/TOEFL/IELTS)andtranscripts.

Catalog Year: Students who are readmitted must meet the admission standards and degree
requirementsandpoliciesintheGraduateCatalogineffectatthetimeofreadmission.

Prior Coursework taken at USF: Coursework taken at USF prior to readmission may be accepted
towardthedegreerequirementsatthediscretionoftheDepartment.However,allcourseworktaken
whenpreviouslyenrolledasagraduatestudentwillbeincludedintheoverallGPA.RefertotheTime
Limit Policy for time limits on coursework applied toward the degree. Students who completed
required coursework and were previously in doctoral candidacy do not have to retake courses that
areoutofcompliancewiththetimelimitrequirementunlessdeterminednecessarybytheprogram.
Studentsmayberequiredtotakenewcourseworkattheprogramsdiscretion.Thedecisiontoaccept
courses previously transferred to USF and applied toward the degree is at the discretion of the
program.Thereisnotimelimitationforwaivedhoursfromacompletedmaster'sdegreeusedtoward
adoctoraldegree.

Enrollment:Studentsmustenrollforthesemesterinwhichtheirreadmissioniseffective.

Doctoral Candidacy: Students who are readmitted to a doctoral program who were previously
admitted to doctoral candidacy may retain their candidacy status at the discretion of the
Department, College, and Office of Graduate Studies. Students must file an approved request for
Readmission to Doctoral Candidacy Form through Office of Graduate Studies procedures. Once
approved,theCandidacydateiseffectiveasofthesemesterofreadmission.

Dissertation Hours: Students must enroll for two hours of dissertation credit per the enrollment
policy, plus an additional three dissertation hours for a total of five dissertation hours in their first
semester.Programsmayrequireadditionalhours.

The Readmission policy does NOT apply to inactive students wishing to enroll in a program other than the
original admitting program. These students must submit an application for the new program of interest.
TranscriptsofanyworkcompletedwhilenotattendingUSFwillberequired.

USFTampaGraduateCatalog20132014 Section4GraduateAdmissions
24
ChangeofGraduateProgram

Achangeofgraduateprogramallowsastudenttowithdrawfromhis/hercurrentgraduateprogramandenterinto
adifferentgraduateprogram.Achangeofgraduateprogram:

willNOTbeconsideredforgraduatestudentsintheirfirstsemesterofstudy
is permissible only for a continuing graduate student enrolled for study in a particular program who
wishestochangetoanotherprogramatthesameorlowerlevel
requiresastudenttobeingoodacademicstanding
is up to the discretion of the students new program (note: some programs may require another
admissionapplicationtobesubmittedandreviewed)
mayaffectthestudentsfinancialaidstatus
requiresthesubmissionofaChangeofGraduateProgramApplication

Students not in good academic standing must consult with the Office of Graduate Studies prior to initiating a
ChangeofGraduateProgramApplication.StudentsmayviewtheproceduresandobtaintheChangeofGraduate
Program Application at http://www.grad.usf.edu/inc/linked
files/GRADUATE_SCHOOL_Chg_of_Program_Application.pdf. Students must consult with the new program and
OfficeofGraduateStudiesbeforecompletinganypaperwork.

StudentswithDisabilitiesPolicy
Applicantswithdisabilitiesapplyforadmissionunderthesameguidelinesasotherapplicants.Applicantsbelieving
thatadisabilityhashadanimpactongrades,coursechoice,orstandardizedadmissiontestscores,shouldrequest
considerationofthisduringtheadmissionsprocess.Applicantsrequestingsubstitutionofdepartmentalguidelines
will need to contact the appropriate department chairperson. Please submit supporting documentation when
requesting a disability exception. Applicants bear the responsibility for providing documentation of their
disabilities.

The University reviews documentation and determines if students are eligible for services and accommodations
because ofdisabilities.TheOfficeofStudentDisabilityServicesischargedwiththetaskofdeterminingeligibility.
Accommodations and services are not provided on a retroactive basis. Approval must be given prior to receiving
services or accommodations. The process begins when students provide documentation of disability and meet
withacoordinatorintheOfficeofStudentDisabilityServicestorequestinwritingservicesandaccommodations.
AnyfacultymembersorstudentswhohavequestionsaboutthisprocessareencouragedtocontacttheOfficeof
StudentDisabilityServicesat(813)9744309orvisitthewebsiteathttp://www.sds.usf.edu/

USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
25
Section5
RegistrationandGeneralInformation

ParkingInformationandCampusMaps

ForinformationonUSFParkingServices,policies,andregulations,referto:

USFParkingandTransportationServiceswebsite: http://usfweb2.usf.edu/parking_services/default.asp
Campusmapsareavailableonlineat: http://usfweb2.usf.edu/parking_services/maps.asp

USFRegulations:
USF4.0010ParkingGeneralGuidelines,Registration,PenaltiesandRates:
http://generalcounsel.usf.edu/regulations/pdfs/proposedregulationusf4.0010parkingguidelinesregistration
penaltiesratesposted021913.pdf

Alsoreference4.00211through400219and40023through40029,FAC,availableat:
http://generalcounsel.usf.edu/regulations/currentregulations.asp

OfficeoftheRegistrar

Website:http://www.registrar.usf.edu/
Email: regquest@admin.usf.edu
Phone: 8139742000
TTY: 8139744488

The Office of the Registrar maintains the official academic records for all students and course registrations for
currently enrolled students. Students are encouraged to contact the Office of the Registrar about general
questions concerning academic policies and procedures of their current registration or academic record. Note:
EachstudentmustbeawareoftheUniversitysacademicpoliciesandproceduresinsofarastheyaffecthim/her.

OASIS

Studentsuseaselfselectedpersonalidentificationnumber(PIN)intheUniversitysOnlineAccessStudent
InformationSystem(OASIS)to:

viewregistrationappointmentinformation
viewregistrationholdinformation
viewtheScheduleofClasses
registeranddrop/addcourses
viewtheirgrades
requestaddresschanges
requestprivacy
requesttranscripts

USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
26
RegistrationInformation

USFRegulationUSF40101,http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0101.pdf

RegisterforClasses
To register for classes students must login to the OASIS system. Current course offerings and registration
requirements are listed in the Schedule of Classes. Note that some courses may require permits from the
departmentforregistration.

OASIS: http://usfonline.admin.usf.edu/
Schedule: http://www.registrar.usf.edu/ssearch/search.php

LateRegistration
Degreeseeking students who do not register prior to the first day of classes may lateregister the first week of
classes. A late registration fee is charged during this week. To avoid cancellation of registration, fees and tuition
are due and payable for all registered courses of record on the fifth day of classes (end of drop/add period).
Studentsareresponsibleforverifyingtheaccuracyoftheircourseregistrationbytheendofthedrop/addperiod
(i.e.bythefifthdayofclasses).Intheeventtherearecoursesincorrectlylistedormissingontherecord,students
shouldgointoOASISandmakethenecessarycorrections.Courseregistrationnotcorrectedbytheendofthefifth
dayofclasseswillresultinliabilityoftuitionandfees.Ifcoursesneedtobeaddedordroppedafterthefifthdayof
classes,refertotheAdd/DropsectionsoftheCatalog.

MedicalRequirementsforRegistration
UniversityImmunizationPolicy: http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy33002.pdf
Forms: http://www.shs.usf.edu/immunization/immunizationforms.aspx

StudentHealthServicesischargedwiththeresponsibilityofevaluatingandmaintainingmedicalrequirementsfor
registrationforallUniversityofSouthFloridastudents.Floridalaw(Section1006.69Floridastatute)requiresthat
alladmittedFloridauniversitystudentsbeawareofMENINGOCOCCALMENINGITISandHEPATITISB,twodiseases
that may be prevented by vaccination. The vaccines for each of these diseases are available at the University of
South Florida Student Health Services. Please refer to http://www.shs.usf.edu/immunizations.aspx for further
information. In addition, students residing in oncampus housing must present (a) proof of vaccination against
MENINGOCOCCALMENINGITIS,and(b)proofofvaccinationagainstHEPATITISBorsignadeclinationofHEPATITIS
Bproof.

According to Florida Administrative Code Rule 6C6.001(5) "Each student accepted for admissions shall, prior to
registration, submit on a form, provided by the institution, a medical history signed by the student." As a
prerequisitetomatriculationorregistration,theStateUniversitySystemofFloridarequiresallstudentsbornafter
1956topresentdocumentedproofofimmunitytoMEASLES(Rubeola)andRUBELLA(GermanMeasles).

Inaddition,newadmits(internationalstudentsandUScitizenslivingabroad)mustshowproofofscreeningfor
Tuberculosis(TB)withinthepastyear.NewadmitswhohavenottakentheTBtestmaydosowhentheyarrive,
butwillnotbeallowedtoregisteruntilthetesthasbeentaken.(ReferenceUSFPolicy33.003
http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy33003.pdf

AllstudentsnewtoUSFarerequiredtosubmitasignedcopyoftheofficialUSFMedicalHistoryformandsubmit
immunizationdocumentationforthefollowing:
1. MedicalHistoryForm:SigntheMandatoryImmunizationHealthHistoryForm
2. Measles1,Measles2,Rubella(MMR):Vaccination(2dosesafter1stbirthday)ORTiter(labwork)Date&
Result
3. HepatitisB1:VaccinationORCheckthedeclinationboxORTiter(labwork)Date&Result
USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
27
4. Meningitis: Menactra/MCV4 vaccination at AGE 16 OR OLDER (if living on campus) OR check the
declination(ifnotlivingoncampus)
5. TB Screening: Tuberculosis Screening required for all International Students and U.S. born students
residingatanaddressoutsidetheU.S.atthetimeofapplication.

Inordertoregister,thisform,includingtherequireddocumentation,mustbecompleted,signed,andreturnedto:

StudentHealthServices
UniversityofSouthFlorida
4202EastFowlerAvenue,SHS100
Tampa,FL336206750
Fax:(813)9745888
Telephone:(813)9744056

ForFrequentlyAskedQuestionsontheImmunizationrequirementsgoto:http://www.shs.usf.edu/faqs.aspx

AdministrativeHolds
AstudentmaybeplacedonadministrativeholdbyfailuretomeetobligationstotheUniversity.Whenastudentis
on administrative hold, he/she may not be allowed to register, receive a diploma, or receive a transcript.
Settlement of financial accounts must be made at the University Cashiers Office. Each student placed on
administrative hold should determine from the Office of the Registrar which office placed him/her in this status
andcleartheobligationwiththatrespectiveoffice.

CancellationofRegistrationforNonPayment
USFRegulationUSF4010,http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.010.pdf

EqualOpportunityPolicy

DiversityandEqualOpportunity:DiscriminationandHarassmentPolicy:
http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy0007.pdf

DEOwebsite:http://usfweb2.usf.edu/eoa/
Phone:8139744373
The University of South Florida system (USF system) is a diverse community that values and expects respect and
fairtreatmentofallpeople.TheUSFsystemstrivestoprovideaworkandstudyenvironmentforfaculty,staffand
students that is free from discrimination and harassment on the basis of race, color, marital status, sex, religion,
nationalorigin,disabilityorage,asprovidedbylaw.TheUSFsystemprotectsitsfaculty,staff,andstudentsfrom
discriminationandharassmentbasedonsexualorientation.TheUSFsystemisalsocommittedtotheemployment
and advancement of qualified veterans with disabilities and veterans of the Vietnam era. Discrimination,
harassmentandretaliationareprohibitedattheUniversity,andcomplaintsofsuchconductmustbefiledwiththe
DiversityandEqualOpportunityOffice(DEO).DEOwillreviewsuchcomplaintsandprovideappropriateresponse
including counseling, mediation, and/or referral for disciplinary action, up to and including termination from
employment and/or expulsion from the University. A student or employee who believes that he or she has not
been treated in accordance with the Universitys Equal Educational and Employment Opportunity Policy or its
Policy on Sexual Harassment may file an Equal Opportunity Complaint. Additional information about these
procedures may be obtained from the Diversity and Equal Opportunity Office or by calling 9744373 or 813974
1510 (TDD). It is prohibited for any administrator, supervisor, or other employee of USF to take any retaliatory
action against an individual who, in good faith, has made a charge, testified, assisted, or participated in any
mannerinaninvestigation,proceeding,orhearingunderprovisionsofapplicablelaw.
USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
28
AcademicTermandStudentInformation

SemesterSystem
USF operates on a semester system. Semesters begin in August and January with Summer Sessions beginning in
MayandJune.SeeAcademicCalendarforappropriatedates.

AcademicLoad
SeeEnrollmentRequirementsintheAcademicPoliciesSection

AcademicStanding

ClassStandingAstudentsclassstandingisdeterminedbythenumberofcreditshe/shehasearnedwithout
relationtohis/herGPA.

6M GraduatestudentadmittedtoMastersDegreeProgram
6A GraduatestudentadmittedtoSpecialistDegreeProgram
6D GraduatestudentadmittedtoaDoctoralDegreeProgram(noteligibletoregisterfordissertationhours)
6C GraduatestudentadmittedtoDoctoralCandidacy(eligibletoregisterfordissertationhours)
7A7D1st4thyearprofessionalprogram(M.D.)orpostdoctoralstatus

AlsoseeIngoodstandingintheAcademicPoliciesSection

StudentDefinitions

DegreeSeekingStudents:
Studentswhohavebeenacceptedintoadegreeprogram

GraduateCertificateSeekingStudents:
Students who have been accepted into a Graduate Certificate program. Students who are nondegree
seeking,butwhoareadmittedtoaGraduateCertificatemayregisterduringthesameregistrationperiod
as DegreeSeeking Students. For more information about Graduate Certificates and specific
requirements, refer to Section 11 Graduate Certificates or go to the Graduate Certificate website at
http://www.outreach.usf.edu/gradcerts/.

NonDegreeSeekingStudents:
Students who have not been accepted into a degree or Graduate Certificate Program. NonDegree
Seeking students may enroll and enter classes on a space available basis by obtaining appropriate
approval from the degreegranting college or academic unit in which the courses are offered. Non
DegreeSeeking students must meet all prerequisites for courses in which they wish to enroll. Certain
classes are available only to degreeseeking students and may not be available for NonDegreeSeeking
students.

Should a student be accepted into a graduate degree program, no more than 12 hours of USF credit
earned as a NonDegree Seeking student may be applied to satisfy graduate degree requirements. All
coursework transferred into the graduate program must have a grade of B or better. Any application of
such credit must be approved by the degreegranting college and must be appropriate to the program.
For more information, refer to the Transfer of Credit policy in the Academic Policies Section. Prior to
completingtwelve(12)hoursinaspecificdegreeprogramitisstronglyrecommendedthataNonDegree
SeekingStudentapplyforadmissionandbeacceptedtothedegreeprogramtocontinuetakingcoursesin
theprogram.Programsmayhaveadditionalrequirements,socheckwiththeprogramofinterestformore
information.

USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
29
TransientStudents:
USF10.001TransientStudentPolicy:
http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy10001.pdf

TheSUSTransientStudentprogramenablesagraduatestudenttotakeadvantageofresourcesavailable
on other SUS campuses. A Transient Student, by mutual agreement of the appropriate academic
authorities in both the sponsoring and hosting institutions, receives a waiver of admission requirements
and application fee at the host institution and a guarantee of acceptance of earned credits by the
sponsoring institution. A graduate advisor, who will initiate a visiting arrangement with the appropriate
faculty of the host institution, must recommend a Transient Student. USF degreeseeking students who
wish to enroll at another regionally accredited institution MUST HAVE PRIOR WRITTEN APPROVAL from
their college academic advisor to receive credit for courses taken. For more information, contact the
Registrars Office at (813) 9742000. Transient Student Form: http://www.registrar.usf.edu/forms/TSF2008
0407_16_17_06.pdf

GraduateAssistantships(GA),ResearchAssistantships(RA),andTeachingAssistantships(TA):
Graduate Assistantships are intended to recruit quality students to graduate study at USF and to enhance the
graduate learning experience. Graduate assistantships exist within academic departments or other university
officesoncampus.Graduateassistantsmayteach,conductresearch,orperformothertasksthatcontributetothe
studentsprofessional development. Graduate studentsmay beclassified as Graduate Assistants (GAs), Graduate
Teaching Assistants/Associates (GTAs), Graduate Instructional Assistants (GIAs), and/or Graduate Research
Assistants/Associates (GRAs). All graduate assistants at USF work under a contract negotiated by the Graduate
Assistants United (GAU) and the USF Board of Trustees. The GAU is the labor union certified as the exclusive
bargainingagentforgraduateassistantsatUSF.Toreceiveanassistantship,thegraduatestudentmustmeetthe
followingeligibilityrequirements:

Acceptedinagraduatedegreeprogram;
Maintainanoverallminimumgradepointaverage(GPA)anddegreeprogramGPAof3.00;
Enrolledfulltimeduringthesemester(s)appointedasagraduateassistant;
For teaching assistantships, demonstrate proficiency in spoken English (if student is not from an English
speakingcountry).

Fulltime enrollment is considered nine (9) graduate credit hours in the fall semester, nine (9) graduate credit
hoursinthespringsemester,andsix(6)graduatecredithoursinthesummersemester.Ifagraduateassistantis
enrolled in the last semester of his/her program of study, the number of registered semester hours may be less
than the fulltime requirement. Graduate assistants must comply with all Office of Graduate Studies enrollment
requirementstoretaintheirassistantshipasstatedintheGraduateCatalog.

For specifics regarding Graduate Assistantship requirements, guidelines, and policies, refer to the Graduate
Assistantships Resource Center online at http://www.grad.usf.edu/assistantships.asp, the Graduate Catalog
AcademicPoliciesSection,andalsotheGraduateAssistantsPoliciesandGuidelinesHandbook.

StudentIdentificationCard(USFCardandIDBadge)Policy
Reference:USF5.108http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy0517.pdf

University policy requires all students obtain and carry the USFCard while on campus. The USFCard is primarily
used for identification, for verification of USF status, and for using University services, such as the Library, the
purchase of parking decals, obtaining passes for University sporting and theatrical events, and other related
events/services.USFCardsmaybeobtainedattheUSFCardCenteroneachcampus.LegalIdentification(passport,
driver'slicense,orState/GovernmentPhotoIdentificationcard)mustbepresentedtoobtainaUSFCard.Forthe
issuanceofafamilycard,thestudent(withtheirUSFCard)mustaccompanythefamilymember(s)whomustalso
providelegalidentification.Allprivilegesextendedtothefamily(s)arediscontinuedwhentheSponsorisnolonger
USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
30
a student. Use of the USFCard by anyone other than theperson to whom it was issued is strictlyprohibited. The
cardholder is responsible for any and all losses associated with their card. Fees for issuance of the first and
replacementcardsareinaccordancewithUSF5.018.Refertothefeescheduleforcostsofeachadditionalfamily
membercard.Financialservices,longdistancetelephoneservices,andotherfeaturesareoptionsavailableatthe
user'sdiscretion.USFCardsarethepropertyoftheUniversityofSouthFloridaandmustbereturnedonrequest.

StudentRecordsPolicy
Reference:USF2.0021http://generalcounsel.usf.edu/regulations/pdfs/regulationusf2.0021.pdf

PursuanttotheprovisionsoftheFamilyEducationalRightsandPrivacyAct(FERPA;20USCPar.1232g),34CFR
Par. 99.1 et seq,Florida Statutes Sub. Par.228.093and 240.237 and USF Rule 6C42.0021,FloridaAdministrative
Code,studentshavetherightto:

1. Inspectandreviewtheireducationrecords;
2. Privacyintheireducationrecords;
3. Challengetheaccuracyoftheireducationrecords;and
4. Report violations of FERPA to the FERPA Office, Department of Education, 400 Madison Avenue, SW,
Washington,D.C.20202and/orbringactionsinFloridaCircuitCourtforviolationsofUSF42.001,Florida
AdministrativeCode.

CopiesoftheUniversitysstudentrecordspolicy,USF2.0021,maybeobtainedfromtheOfficeoftheRegistraror
theGeneralCounsel.

AcademicRecord
The students academic record shall not be changed after the student has graduated. Except in cases of
administrativeerror,thestudentsacademicrecordshallnotbechangedoncethesemesterhasrolled.

ReleaseofStudentInformation
Pursuant to requirements of the Family Educational Rights and Privacy Act (FERPA), the following types of
information,designatedbylawasdirectoryinformation,maybereleasedviaofficialmediaofUSF(accordingto
USFpolicy):Studentname,localandpermanentaddresses,telephonelisting,majorfieldofstudy,participationin
officially recognized activities and sports, weight and height of members of athletic teams, dates of attendance,
degrees and awards received, full and parttime status, and the most recent previous educational agency or
institutionattended,andothersimilarinformation.TheUniversityDirectory,publishedannuallybytheUniversity,
contains only the following information, however: student name, local and permanent address, telephone listing,
classification,andmajorfieldofstudy.TheDirectoryandotherlistingsofdirectoryinformationarecirculatedin
the course of University business and, therefore, are accessible to the public, as well as to students, faculty, and
staff.StudentsmustinformtheUSFOfficeoftheRegistrarinwriting(formsavailableforthatpurpose),iftheywish
directory information to be withheld. Such requests must be received within the first two (2) weeks of the
semesterandwillremainineffectuntilthestudenthasnotbeenenrolledatUSFforthree(3)consecutiveterms.
Notification to the University of refusal to permit release of directory information via the University Directory
mustbereceivednolaterthantheendofthefirstweekofclassesintheFallSemester.

Exclusions
Members or former members of the faculty who hold or have held the rank of Assistant, Associate, or Full
Professor are not eligible to be granted degrees from USF, except upon prior authorization of the Office of
Graduate Studies and the Provost. In cases where a member of the immediate family of a faculty member is
enrolled in a graduate degree program, the faculty member may not serve on any advisory or examination
committeeorbeinvolvedinanydeterminationofacademicorfinancialstatusofthatindividual.

USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
31
CourseInformation

AvailabilityofCourses
USF does not commit itself to offer all the courses, programs, and majors listed in this catalog unless there is
sufficientdemandtojustifythem.Somecoursesmaybeofferedonlyinalternatesemestersoryears,orevenless
frequentlyifthereislittledemand.

MandatoryFirstDayAttendancePolicy
Allstudentsarerequiredtoattendclassthefirstdayaclassmeets,forbothonlineandoncampuscourses.Studentsunableto
attendmustcontacttheinstructorpriortothefirstdaytoensuretheyarenotdroppedfromthecourse..Thispolicyisnot
applicabletocoursesinthefollowingcategories:EducationalOutreach,,FEEDSProgram,CommunityExperientialLearning
(CEL),CooperativeEducationTraining,andcoursesthatdonothaveregularlyscheduledmeetingdays/times(suchas,directed
reading/researchorstudy,individualresearch,thesis,dissertation,internship,practica,etc.).Studentsareresponsiblefor
droppingundesiredcoursesinthesecategoriesbythe5thdayofclassestoavoidfeeliabilityandacademicpenalty.(SeeUSF
RegulationRegistration4.0101,http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0101.pdf)

AttendancePolicyfortheObservanceofReligiousDaysbyStudents
In accordancewith Sections1006.53 and 1001.74(10) (g)Florida Statutes and Board of Governors Regulation 6C
6.0115, the University of South Florida (University/USF) has established the following policy regarding religious
observances:http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy10045.pdf.

Crosslisting4000/6000Courses
Itisexpectedthatthe4000and6000courseswillhavedistinctsyllabidemonstratingdifferentdepthandbreadth
of the subject matter as reflected in the course requirements. The courses presuppose different audiences, and
theintentionistoofferthematdistinctlevels.

CourseDescriptions
Foralistingofthemostcurrent,approvedcoursedescriptionsrefertotheSearchaBullDatabaseavailableonline
athttp://www.ugs.usf.edu/sab/sabs.cfmorinthecoursedescriptionlistingintheGraduateCatalog.

Adds
After a student has completed his/her registration on the date assigned, he/she may add a course(s) during the
drop/add week (i.e. through the fifth day of classes) through the OASIS system. Courses may be added with
instructor approval and verification up to the last day to withdraw without academic penalty. See Academic
Calendar for deadlines. Courses may not be added after the deadline to withdraw without academic penalty or
retroactivelyexceptincasesofUniversityAdministrativeerror.

Drops
Astudentmaydropacourse(s)duringthefollowingtimes:

1. Duringregularregistrationandthedrop/addperiods(firstfivedaysofclasses).Noentryofthecourse(s)
willappearonanypermanentacademicrecordsandfullrefundoffeesisdueforcourse(s)dropped
withinthoseperiods.

2. Betweenthesecondandtenthweekofthesemester(exceptforsummersessionsseetheSummer
ScheduleofClassesfordates).Registrationfeesandtuitionmustbepaidforthecourse(s)andthe
academicrecordwillreflectaWgradeforthedroppedcourse(s).

Followingthetenthweekdeadlineiftherequestmeetsoneofthefollowingexceptions:

a) Illnessofthestudentofsuchseverityordurationtoprecludecompletionofthecourse(s)as
confirmedinwritingbyaphysician(M.D.).

USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
32
b) Deathofthestudentordeathintheimmediatefamily(parent,spouse,childorsibling)asconfirmed
bydocumentation(deathcertificate,obituary)indicatingthestudentsrelationshiptothedeceased.

c) Involuntarycalltoactivemilitarydutyasconfirmedbymilitaryorders.

d) AsituationinwhichtheUniversityisinerrorasconfirmedbyanappropriateUniversityofficial.

e) Otherdocumentedexceptionalcircumstancesbeyondthecontrolofthestudentwhichprecluded
completionofthecourse(s)accompaniedbyexplanatoryletterandsupportingdocumentation.

CoursesmaynotbedroppedafterthelastdayofclassesexceptincasesofUniversityAdministrativeerror.

FeeAdjustmentOptions
Students who receive approval to drop a course during the second through tenth week of classes are liable for
tuition and fees. However, the student may apply for a Fee Adjustment through the Registrars Office if the
student has any of the exceptional circumstances noted above in item 3. The Fee Adjustment form may be
submitted after the petition to drop is approved and processed. The Registrar will determine if a fee/tuition
refundisapplicable.

Deletes
A delete completely removes the course from the record with no history that it was ever part of the record.
CourseswillnotbedeletedfromastudentsrecordexceptincasesofUniversityAdministrativeerror.Requestsfor
course deletions must be submitted only during the semester in which the error has occurred and only with
written explanation from college faculty verifying the error. Such requests must be submitted by the last day of
classes and approved by the College Dean or designee and the Office of Graduate Studies Dean or designee.
Retroactive requests for course deletions will not be approved. Faculty and students are encouraged to review
course enrollment to verify accuracy of registration. In the event of extenuating circumstances such as
documented medical emergencies, military leave or University error, students may request special consideration
fordeletionsorretroactivedeletionsinwritingtotheDeanoftheOfficeofGraduateStudies.

RetroactiveActions
Requestsforretroactiveactionswillnolongerbeconsidered/approved.AlsoseeAcademicRecord.

AuditingPrivilegesandFees
A student who wishes to sit in on a class to review the course material may do so; however, the student is not
allowed to take exams, earn grades, or receive credit. The students status for that class is an audit and his/her
presenceintheclassroomisasalistener.Auditstatusmustbeobtainedonlyduringthefirstfivedaysoftheterm
byfilinganAuditFormandadatestampedpermitfromthecollege/departmentonthecampuswherethecourse
isbeingoffered,withtheRegistrarsOffice.INSTATEfeesareassessedforallauditcourses.Procedureandforms
forrequestingtoauditareavailableontheRegistrarswebsite.

CancellationofRegistrationbeforeFirstClassMeeting
Students may cancel their registration by notifying the Office of the Registrar in writing prior to the first day of
classes.Iffeeshavealreadybeenpaid,thestudentmayrequestafullrefundoffeesandtuitionfromtheOfficeof
PurchasingandFinancialServices.

Withdrawal(fromcourseregistration)
A student may withdraw from the University without academic penalty during the first nine weeks of any term
(except for Summer Sessions). He/she must submit a completed Withdrawal Form to the Office of the Registrar.
No entry is made on the academic record for withdrawals submitted during the first week of the term. All
subsequent withdrawals (through the ninth week of classes in the fall and spring semesters; see the Academic
Calendar for summer deadlines) are posted to the academic record with W grades assigned to the courses.
Withdrawal deadlines for the summer sessions are listed in the Academic Calendar
USFTampaGraduateCatalog20132014 Section5RegistrationandGeneralInformation
33
(http://www.registrar.usf.edu/enroll/regist/calendt.php#1213)andarepublishedintheScheduleofClassesforthe
Summer Term. Students who withdraw may not continue to attend classes. Students who withdraw during the
drop/addperiodasstatedintheAcademicCalendarmayreceiveafullrefundoffeesandtuition.Allrefundsmust
berequestedinwritingfromtheOfficeofPurchasingandFinancialServices.Norefundisallowedafterthisperiod
exceptforspecifiedreasons.

VoluntaryWithdrawal(fromtheprogram)
A student may voluntarily withdraw from their graduate degree program. A Voluntary Withdrawal cannot be
retroactive. The effective date of the withdrawal will be entered into the students record by the Office of the
Registrar as the first business day after the end of the semester. Students who wish to withdraw must submit a
Voluntary Withdrawal Form, available from the Office of Graduate Studies (www.grad.usf.edu). Once processed,
the students status will be changed from Graduate Degree Seeking to NonDegree Seeking. A change to Non
Degree Seeking status could adversely impact financial aid. Questions regarding this should be directed to the
Financial AidDepartment at (813)9744700. The studentwill remain financially and academically responsible for
anycourse(s)theyhaveregisteredfor.Thestudentmayrequesttodropordeletecoursestheyareregisteredfor
bysubmittingaOfficeofGraduateStudiesPetition.

AcademicDismissal

Students may be academically dismissed from their graduate degree program for a variety of reasons. Once
processed,thestudentsstatuswillbechangedfromGraduateDegreeSeekingtoNonDegreeSeeking.Achange
toNonDegreeSeekingstatuscouldadverselyimpactfinancialaid.Dismissalcannotberetroactive.Theeffective
datewillbeenteredintothestudentsrecordbytheOfficeoftheRegistrarastheFirstBusinessDayaftertheend
of the Semester, except in cases of academic dismissal due to academic dishonesty or disruption of academic
process.Someofthereasonsforacademicdismissalinclude*:

FailuretosuccessfullysatisfyrequirementstomeetConditionalAdmissionbythedeadlineestablishedby
theprogram.
ReceivinganFFgrade
Failuretomaintaingoodstanding
Failuretomakesatisfactoryprogress

*studentsmaybedismissedforotherreasons,suchasviolationsofstudentconduct.RefertotheUSF
Policy6.0021(http://generalcounsel.usf.edu/regulations/pdfs/regulationusf6.0021.pdf)formore
information.

To be readmitted, the student will need to reapply for admission, meeting the admission criteria in place at the
time. Graduate students who are assigned an FF grade will be academically dismissed from the University and
willnotbeeligibletoapplytoanygraduateprogramatUSF.

USFTampaGraduateCatalog20132014 Section6Tuition,Fees,andFinancialInformation
34

Section6
Tuition,Fees,andFinancialInformation

TuitionInformation

TuitionandFeesRegulation:http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0102.pdf

For tuition information refer to: http://usfweb2.usf.edu/finaid/. Tuition and fees are subject to change, without
priornotice.ForinformationonResidencyfortuitionpurposes,refertotheFloridaResidencyPolicy.

Allregistrationfeesandallcoursesaddedduringthedrop/addperiodmustbepaidinfullbythepaymentdeadline
datespecifiedinthecurrentScheduleofClasses.Registrationfeepaymentmaybemadeinpersonormailedtothe
Cashiers office. Students not on an authorized deferred payment plan and who have not paid their registration
feesinfullbythepublisheddeadlinewillhavetheirregistrationscanceled.Astudentwillnotreceivecreditforany
courses taken during that semester. Students who are allowed to register in error may have their registration
canceled.AnyfeespaidwillberefundedorcreditedagainstanychargesduetheUniversity.

StudentFinancialServices
HousestheCashiersoffice,studentaccounting,accountsreceivable,andtheStudentAccountInformationdesk.It
is located in SVC 1038, with the mailing address: Student Financial Services, 4202 E. Fowler Ave., ADM 0147,
Tampa,FL33620.

VeteranDefermentBenefits

Students receiving VA benefits who apply in writingno later than the specifieddate for the 60daydeferment of
fees from the Office of Veterans Services must pay registration fees in full by the date posted online. For more
informationcontactUSFVeteransServices:at(813)9742291orhttp://usfweb2.usf.edu/vetserve/

FinancialAid

Financial assistance is available through the Office of Financial Aid. Students requiring such assistance should
contact http://usfweb2.usf.edu/finaid/ for information. Students eligible for tuition waivers (through
assistantships,oremployeebenefits,etc.)shouldcontactthedepartmentand/orcollegeprovidingthewaiverfor
information.AlsoseeUSFRegulationUSF60121andUSF6012.

OfficeofFinancialAidPolicyonRefundsandRepayments
USFPolicy30013athttp://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy10013.pdf

SpecialFees,Fines,andPenalties
USFRegulationUSF4017,athttp://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0107.pdf

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
35

Section7
AcademicPoliciesandRegulations

AcademicPolicyandRegulationInformation

ForUSFRegulationsrefertohttp://generalcounsel.usf.edu/regulations/currentregulations.asp
ForUSFPoliciesrefertohttp://generalcounsel.usf.edu/policiesandprocedures/policyprocedures.asp

StudentResponsibilities

TheUniversity,theColleges,andthedegreeprogramshaveestablishedcertainacademicrequirementsthatmust
bemetbeforeadegreeisgranted.Whileadvisors,directors,departmentchairpersons,anddeansareavailableto
assistthestudentmeettheserequirements,itisultimatelytheresponsibilityofthestudenttobeacquaintedwith
allpoliciesandregulations,andberesponsibleforcompletingrequirements.Ifrequirementsforgraduationhave
not been satisfied, the degree will not be granted. The information presented here represents the University
AcademicPolicies.Collegesanddepartmentsmayhaveadditionalrequirements.CheckwithyourCollegeGraduate
Coordinator or your Department Program Director for more information. Courses, programs, and requirements
describedintheCatalogmaybesuspended,deleted,restricted,supplemented,orchangedatanytimeatthesole
discretionoftheUniversityandtheBoardofTrustees.Foralistofcurrentcoursedescriptions,refertotheSearch
ABulldatabaseonlineathttp://www.ugs.usf.edu/sab/sabs.cfm.

StudentConduct

Members of the University community support high standards of individual conduct and human relations.
Responsibilityforonesownconductandrespectfortherightsofothersareessentialconditionsforacademicand
personalfreedomwithintheUniversity.USFreservestherighttodenyadmissionorrefuseenrollmenttostudents
whoseactionsarecontrarytothepurposesoftheUniversityorimpairthewelfareorfreedomofothermembers
oftheUniversitycommunity.Disciplinaryproceduresarefollowedwhenastudentfailstoexercise responsibility
inanacceptablemannerorcommitsanoffenseasoutlinedintheStudentConductCode.RefertotheUSF6.0021,
StudentCodeofConductathttp://generalcounsel.usf.edu/regulations/pdfs/regulationusf6.0021.pdf

ResponsibleConductofResearch

ResponsibleConductofResearch(RCR)isacriticalelementintrainingforscholarship.USFhasinformationabout
RCRavailableonlineat:www.grad.usf.edu/rcr.php

EffectiveSpring2013,theOfficeofGraduateStudiesrequiresallnewdoctoralstudentstohavebasicRCRtraining
by completing the Collaborative Institutional Training Initiative (CITI) module most relevant to the students
programofstudy.TheCITImoduleshavebeendesignedtointroduceresearcherstovariouselementsofresearch
conductrangingfromresearchmisconducttodatamanagementtomentoring.Asthisisaminimumrequirement,
specificdoctoralprogramsmayrequiretrainingthatgoesbeyondthebasiccomponentsintroducedinthismodule.
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
36

Graduate Programs that have received Office of Graduate Studies approval for rigorous RCR training consistent
with disciplinary standards and practices may exempt their students from the CITI requirement. Students must
completethemodule,orprovideevidenceofpreviousqualifiedRCRtrainingtotheirProgramDirectorandOffice
ofGraduateStudies,inthefirstsemesterenrolledinadoctoralprogram.PreviousRCRtrainingshouldhavebeen
completed within the past year. Students will be unable to register for courses in a future semester until
successfulfulfillmentofthisRCRrequirement.Oncethetrainingiscompleted,theRegistrationholdwillbelifted.

IntellectualandScholarshipIntegrity

SharedAuthorshipandResearchEducationPolicy

USFcontainsabroadrangeofacademicprogramsindiversedisciplines,andtheUSFfacultyrecognizethatthe
conventionsonsharedauthorshipandcreditforscholarshipvaryamongdisciplines.Ingeneral,sharingin
authorshipimpliesbothsubstantiveintellectualcontributionstotheworkandalsoapprovaloftheworkasit
appearsinpublic.Righttoauthorshipcreditisnotautomaticallyconveyedbybeingtheinstructorofacourse,
beingastudentsmajorprofessor,orbeingaresearchassistantworkingwithfacultyandprofessionalresearchers;
neitheriscreditautomaticallyprohibitedbecauseofsuchstatus.

Eachcollege/programthatincludesresearcheducationshallincludeanexplicitdiscussionofsharedauthorship
issuesanddisciplinaryconventionsaspartoftheformalcurriculumaddressingresearchmethodsandethics,
includingtheconventionsofthedisciplinespublications.Inaddition,eachcollegeorprogramshallhaveaformal
statementaboutsharedauthorshipmadeavailabletostudents(suchasonacollegeorprogramwebsite)orgiven
tostudentsatthesametimeastheyaregivennoticeaboutotherprogramandcollegeexpectations.

Eachcollege/programshallalsohaveawrittenprocedureforresolvingquestionsorconflictsaboutshared
authorshipwherestudentsareinvolved.Thecollegeandprogrammayusethesameprocedureforresolving
questionsfornonstudentemployees,buttheprocedureforresolvingquestionsorconflictsinvolvingstudents
mustaddresstheeducationalneedsofstudents(e.g.,explicitlyaskingaboutthenatureoftheresearchmethods
andethicseducationasexperiencedbyastudentinvolvedinthecaseathand).

Thiswrittenproceduremustbemadeavailabletostudents(suchasonacollegeorprogramwebsite)orgivento
studentsatthesametimeastheyaregivennoticeaboutotherprogramanduniversityexpectations.

AcademicIntegrityofStudents

ReferenceUSFRegulation3.027ToreadtheentireRegulation,goto:
http://generalcounsel.usf.edu/regulations/pdfs/regulationusf3.027.pdfPleasenotethesectionsthatspecifically
pertaintograduatestudents.

DisruptionofAcademicProcess

Reference:USFRegulation3.025http://generalcounsel.usf.edu/regulations/pdfs/regulationusf3.025.pdf

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
37

StudentAcademicGrievanceProcedure
Reference:USF10.002StudentAcademicGrievanceProcedurehttp://generalcounsel.usf.edu/policiesand
procedures/pdfs/policy10002.pdf

Formattersthatarenotacademicinnature,referenceUSF30053StudentGrievanceProcessesandNonAcademic
GrievancePolicy.

GraduateCatalog

The USF Tampa Graduate Catalog, including college and program requirements, and program and course
descriptions, is available on the web at http://www.grad.usf.edu. Each Catalog is published and in effect for the
academicterm(s)notedonthetitlepage.

StudentsProgramDegreeRequirements
Inordertograduate,studentsmustmeetallrequirementsspecifiedintheUSFCatalogoftheirchoice,exceptas
noted below. As the University is dynamic, changes and updates to the catalog are anticipated. In contract to
programrequirements, whicharetiedtoaspecificcatalog,allstudentsmustcomplywithUniversitypoliciesand
proceduresthatcomeintoeffecteachcatalogyear.

Students cannot choose a USF Catalog published prior to admission (or readmission) or during an
academic year in which they did not complete at least two terms. If a student is dropped from the
systemandmustbereinstated,thestudentschoiceofCatalogislimitedtotheUSFCatalogineffectat
thetimeofreadmissionoranyoneCatalogpublishedduringtheircontinuousreenrollment.

If state law or certification requirements change, the student must comply with the most current
standardorcriteria.

IftheCollegeorDepartmentmakesfundamentalchangestotheprogramthatnecessitateschangesin
thedegreerequirementsofenrolledstudents,theneedsofthosestudentswillbeexplicitlyaddressedin
theproposalforchangeandscrutinizedbytheOfficeofGraduateStudies.

USF policies and procedures not related to degree requirements such as academic grievance
procedures,studentconductcodeandotherproceduralprocessesanddefinitionsmaybeupdatedeach
yearandthestudentwillbeheldtothemostcurrentcatalogandproceduresavailable.

USF does not commit itself to offer all the courses, programs, and majors listed in this Catalog. If the
studentcannotmeetallofthegraduationrequirementsspecifiedintheCatalogofchoiceasaresultof
decisions and changes made by the University, appropriate substitutions will be determined by the
programtoensurethatthestudentisnotpenalized.

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
38

Student/AdvisorRelationship
Althoughitisultimatelytheresponsibilityofthestudenttobeacquaintedwithallpoliciesandregulations,andbe
responsible for completing requirements, the Advisor's role is to guide students in all aspects of their academic
program and to monitor and evaluate students progress toward their degrees. He/she should be aware of any
difficultiesthatstudentsmaybefacingintheircourseworkorresearchexperiencesandshouldworkwithstudents
in resolving these issues. It is recommended that the advisor and student understand each others expectations
and that effective means of communication are established. The advisor and student are encouraged to meet at
appropriate intervals to critically evaluate the student's progress. These meetings may be requested by the
studentortheadvisor.Theadvisoralsohastheobligationtoexpresstothestudentanyconcernshe/shemayhave
regardingthestudent'sperformance,tostipulatethelevelandqualityofworkexpected,andtooffersuggestions
leading to student success. As such, the advisor neither gives the student excessive guidance nor allows the
student to struggle needlessly. The goal of this relationship is to foster student independence, which results in
successfulcompletionoftheprogramofstudy.

StudentsProgramofStudy
In addition to the graduate degree program requirements as specified in the Graduate Catalog, each student
should have a written, flexible program of study that includes the student's choice of Catalog year, choice of
concentration, cognate, or other options available in the degree program, and a tentative identification of other
appropriate choices available to the student in the program, which may (but does not need to) include specific
courses.Aprogramofstudyisnotaguaranteethatspecificcourseswillbeavailableinaspecificsemesterorthat
statutoryandregulatoryrequirementswillnotchangeduringthestudent'senrollmentintheprogram.Asrequired
or appropriate, the program of study should be revisited and modified by the student and the student's
advisor/majorprofessor(s).

ElectronicSignatures
Where procedures described in this catalog require signatures, requirements for original signatures may be satisfied by
Universityapproved electronic signatures or other secure methods of verifying approval by advisors, major professors,
committeemembers,orotherUniversityadministrators,faculty,andstaff.

Assistantships
Graduate Assistantships (GA), Research Assistantships (RA), and Teaching Assistantships (TA) Graduate
Assistantships are intended to recruit quality students to graduate study at USF and to enhance the graduate
learning experience. Graduate assistantships exist within academic departments or other university offices on
campus.Graduateassistantsmayteach,conductresearch,orperformothertasksthatcontributetothestudents
professional development. Graduate students may be classified as Graduate Assistants (GAs), Graduate Teaching
Assistants/Associates (GTAs), Graduate Instructional Assistants (GIAs), and/or Graduate Research
Assistants/Associates (GRAs). All graduate assistants at USF work under a contract negotiated by the Graduate
Assistants United (GAU) and the USF Board of Trustees. The GAU is the labor union certified as the exclusive
bargainingagentforgraduateassistantsatUSF.

Eligibility
Toreceiveanassistantship,thegraduatestudentmustmeetthefollowingeligibilityrequirements:

Acceptedinagraduatedegreeprogram;
Maintainanoverallminimumgradepointaverage(GPA)anddegreeprogramGPAof3.00;
Enrolledfulltimeduringthesemester(s)appointedasagraduateassistant.
ForTeachingAssistants,demonstrateproficiencyinspokenEnglish(ifstudentisnotfromanEnglish
speakingcountry)

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
39

Appointments
Graduate Assistants may be appointed up to a maximum of 0.50 FTE for a single assistantship. Programs who
desire to appoint a Graduate Student, in any classification, more than 0.50 FTE up to 0.75 FTE, for single or
multipleappointments,mustsubmitjustificationtotheOfficeofGraduateStudiesforapproval.Studentshiredin
nonGA positions on campus must also not exceed 0.75 FTE for the combined position and assistantship
appointments. It is preferred that students refrain from employment outside of the assistantship appointment.
Departmentsmaydeterminethemaximumnumberofsemestersforteachingassistantshipappointments.

Enrollment
Fulltime enrollment is considered nine (9) graduate credit hours in the fall semester, nine (9) graduate credit
hoursinthespringsemester,andsix(6)graduatecredithoursinthesummersemester.Ifagraduateassistantis
enrolled in the last semester of his/her program of study, the number of registered semester hours may be less
than the fulltime requirement. Graduate assistants must comply with all Office of Graduate Studies enrollment
requirements to retain their assistantship as stated in the Graduate Catalog. For specifics regarding Graduate
Assistantship requirements, guidelines, and policies, refer to the Graduate Assistants Policies and Guidelines
Handbook

NoteCriminalHistoryBackgroundChecksmayberequireddependingontheappointmentreferenceUSFPolicy
0615http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy0615.pdf

EnrollmentRequirements

StudentsreceivingVeteransAdministrationbenefitsshouldconfirmtheirenrollmentrequirementswiththeOffice
ofVeteransServicesorVeteransCoordinator.

MinimumUniversityRegulations

USFFullTimeStudentDefinition
Students taking a minimum of nine (9) hours toward their degree in the fall or spring semester, or taking a
minimumofsix(6)hoursinthesummersemester,willbeclassifiedasFullTimestudentsforacademicpurposes.
Students may take a maximum of eighteen (18) hours in any given semester; exceeding eighteen (18) hours
requiresasignedprogramofstudyorwrittenapprovalfromtheCollege.Forfinancialaidrequirements,contact
theOfficeofFinancialAid.

ContinuousEnrollmentforAllGraduateStudents
All graduate degreeseeking students must be continuously enrolled. Continuous enrollment is defined as
completing, with grades assigned, a minimum of 6 hours of graduate credit every three continuous semesters.
Colleges and programs may have additional requirements. Students on an approved leave of absence are not
subjecttotheenrollmentrequirementforthetimeapprovedfortheleave.Studentswhohavebeenadmittedto
Doctoral Candidacy must follow the Dissertation Hour Enrollment in place of the Continuous Enrollment
requirementasspecifiedhereforallgraduatestudents(notincandidacy).SeealsotheTimeLimitationsPolicy.

ReadmissionFollowingNonenrollment
A graduate student who is not registered and enrolled for a minimum of six (6) credits in a 12 month period is
automatically placed in nondegree seeking (i.e. inactive) status. Students must be readmitted to the degree
programtocontinuetheirstudies.Readmissionisatthediscretionoftheprogramandisnotguaranteed.Referto
theReadmissionPolicyintheGraduateAdmissionsSectionformoreinformation.

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
40

EnrollmentduringComprehensiveExamsandAdmissiontoCandidacy
During the term in which students take the comprehensive exams, students must be enrolled for a minimum of
two(2)hoursofgraduatecredit.Iftheexamistakenbetweensemesters,thestudentmustenrollforaminimum
oftwo(2)hoursofgraduatecreditinthesemesterbeforeorfollowingtheexam.Studentsmustalsobeenrolled
foraminimumoftwo(2)hoursofgraduateworkinthesemesterofadmissiontodoctoralcandidacy.

DissertationHours
Students working on a dissertation must enroll for a minimum of two (2) hours of dissertation every semester,
starting with the semester following Admission to Doctoral Candidacy, up to and including the semester the
dissertationissubmittedtoandapprovedbytheOfficeofGraduateStudies.Dissertationhoursmayapplytothe
Continuous Enrollment Requirement. Colleges and programs may have additional requirements. Students who
are dropped from degreeseeking status and formally readmitted to the program must enroll in a minimum of 5
dissertation hours in the semester that the readmission is effective. Refer to the Readmission Policy in the
GraduateAdmissionsSectionformoreinformation.

EnrollmentduringSemesterofThesisSubmission
Studentsmustbeenrolledforaminimumoftwo(2)thesishoursduringthesemesterthatthethesisissubmitted
andapprovedbytheOfficeofGraduateStudies,usuallythesemesterofgraduation.Studentsnotenrolledforthe
minimum requirement will not have the thesis/dissertation approved and therefore may not be certified for
graduation.

EnrollmentduringSemesterofGraduation
Studentsmustbeenrolledforaminimumoftwo(2)graduatehoursduringthesemesterofgraduation.

EnrollmentforGraduateTeachingandResearchAssistants
Graduate Teaching and Research Assistants should be fulltime students. Exceptions must be approved by the
CollegeDeanandtheDeanoftheOfficeofGraduateStudies.

LeavesofAbsence(LOA)
Leaves of absence may be granted to students under exceptional and unavoidable circumstances. Students
requestingaLOAmustspecifythereasonsfortheleave,aswellastheduration.RequestedLOAmaybeapproved
foruptotwoyears.Studentsrequiringlessthanthree(3)consecutivetermsofabsencedonotneedanapproved
LOAiftheymeetthecontinuousenrollmentrequirement.

StudentswithanapprovedLOAmustbeenrolledinthefirstsemesteraftertheleaveexpires.TorequestanLOA,
the student must complete the form available from the Office of Graduate Studies website. The LOA must be
approvedbytheMajorProfessor,theProgram,theCollege,andtheOfficeofGraduateStudies,andisnotedinthe
studentsrecord.IftheLOAisgranted,thetimeabsentdoesnot countagainstthestudentstimelimittoobtain
thedegree.

StudentsreturningfromanapprovedLOAmustreactivatetheirstatusbycontactingtheOfficeofGraduateStudies
forprocedures.DoctoralcandidatesreturningfromaLOAmustalsohavetheircandidacystatusreactivated.

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
41

AcademicStandardsandGrades

MinimumUniversityRequirements

InGoodStanding
Tobeconsideredastudentingoodstanding,graduatestudentsmust
Maintainanoverallminimumgradepointaverage(GPA)of3.00(ona4.00scale)inallcoursestakenasa
graduatestudent,and

Maintainanoverallminimumgradepointaverage(GPA)of3.00(ona4.00scale)inallcoursestakenin
eachofthestudentsdegreeseekingprograms.

NogradeofCorbelowwillbeacceptedtowardagraduatedegree.Studentsmustmeettherequirementstobein
goodstandingtograduate.AllIandMgradesmustbeclearedforgraduationtobecertified.Studentswhofail
tomaintaingoodstandingmaybeplacedonprobationoracademicallydismissed.

GradePointAverage(GPA)
The GPA is computed by dividing the total number of quality points by the total number of graded (AF) hours
completed.Thetotalqualitypointsarefiguredbymultiplyingthenumberofcreditsassignedtoeachcoursebythe
qualitypointvalueofthegradegiven.TheGPAistruncatedtotwodecimals(3.48)andisnotroundedup.

CredithoursforcourseswithgradesofI,IU,M,MU,N,S,U,W,ZandgradeswhichareprecededbyT(Transfer)
aresubtractedfromthetotalhoursattemptedbeforetheGPAiscalculated.Graduatestudentsarenoteligiblefor
grade forgiveness. All grades earned, regardless of course level, will be posted on the transcript. If a student
retakesacourse,bothgradeswillbeusedinthedeterminationoftheGPA.CoursestakenatUSFasnondegree
seeking are not computed in the GPA unless the courses are transferred in and applied to the degree
requirements.Theprogramandthecollegemustapprovesuchactions.

Grades for transfer credits accepted toward the degree program will not be counted in the GPA unless the
coursework in question was taken as a nondegreeseeking student at USF and meets the requirements stated
above(seeInstitutionBasedCredit/TransferofCreditsection).

GraduateGradingSystem

Plus/MinusGrading:
Effectivefallsemester2000,graduateandundergraduategradeswillbeassignedqualitypointsintheGrade
Point Average (GPA) grading system. The +/ designation must be included in the syllabus provided at the
beginningofthecourse.Theuseofthe+/gradingsystemisat thediscretionoftheinstructor.Thesyllabus
policyisavailableintheofficeoftheProvost.

Lettergrade=numberofgradepoints
A 4.00
A 3.67
B+ 3.33
B 3.00
B 2.67
C+ 2.33
C 2.00
C 1.67
D+ 1.33
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
42

D 1.00
D .67
F 0.00
FF Failureduetoacademicdishonesty
2

CF CancelledFinancially(Coursewascancelledduetofinancialreasons)
CMU Cancelled,MissingGradethathasturnedtoaU
IA Incomplete,gradepointsnotapplicable
IB Incomplete,gradepointsnotapplicable
IC Incomplete,gradepointsnotapplicable
ID Incomplete,gradepointsnotapplicable
IF Incomplete,gradepointsnotapplicable*
M Missinggrade/nogradereportedbyinstructor,gradepointsnotapplicable
N Audit,gradepointsnotapplicable
S/U Satisfactory/Unsatisfactory,gradepointsnotapplicable
W Withdrawalordropfromcoursewithoutpenalty,gradepointsnotapplicable
Z ContinuingregistrationinmultisemesterinternshiporThesis/Dissertationcourses,
gradepointsnotapplicable

*Incompletegradepolicychangeeffectivefall08.IFgradesearnedandpostedpriortofall2008do
calculateintheGPA;IFgradesearnedasoffall2008forwarddonotcalculateintheGPAreferto
IncompleteGradePolicyformoreinformation.

Satisfactory(S)/Unsatisfactory(U)
Graduate students may not take courses in the major on an S/U (satisfactory / unsatisfactory) basis unless
coursesarespecificallydesignatedS/UintheCatalog.Studentsmaytakecoursesoutsideofthemajoronan
S/Ubasiswithpriorapprovalofthecourseprofessor,majorprofessororadvisor,andtheDeanoftheCollege
in which the student is seeking a degree. The student may apply a maximum of six (6) hours of such credit
(excluding those courses for which S/U is designated in the Catalog) toward a masters degree. Directed
Research, Thesis, and Dissertation courses are designated as variable credit and are graded on an S/U basis
only. Before a student begins work under Directed Research, a written agreement must be completed
betweenthestudentandtheprofessorconcerned,settingforthindetailtherequirementsofthecourse.

Incomplete(I)
Definition: An Incomplete grade (I) is exceptional and granted at the instructors discretion only when
students are unable to complete course requirements due to illness or other circumstances beyond their
control.Thisappliestoallgradablecourses,includingpass/fail(S/U).
StudentsmayonlybeeligibleforanIwhen:
majorityofthestudentsworkforacoursehasbeencompletedbeforetheendofthesemester
theworkthathasbeencompletedmustbequalitativelysatisfactory
thestudenthasrequestedconsiderationforanIgradeassoonaspossiblebutnolaterthanthelast
dayoffinalsweek.
The student must request consideration for an Incomplete grade and obtain an I Grade Contract from the
instructorofrecord.Eventhoughthestudentmaymeettheeligibilityrequirementsforthisgrade,thecourse
instructorretainstheright tomakethefinaldecisionongrantingastudent'srequestforanIncomplete.The
courseinstructorandstudentmustcompleteandsigntheIGradeContractFormthatdescribestheworkto

2
GraduateStudentswhoreceiveanFFwillbeacademicallydismissedfromtheUniversityandwillnotbeeligibletoapplytoanygraduate
programatUSF.SeesectiononAcademicDishonestyandGraduateStudiesPolicyonAcademicIntegrityformoreinformation.
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
43

becompleted,thedateitisdue,andthegradethestudentwouldearnfactoringinazeroforallincomplete
assignments. The due date can be negotiated and extended by student/instructor as long as it does not
exceedonesemesterfromtheoriginaldategradesweredueforthatcourse.

The instructor must file a copy of the I Grade Contract in the department that offered the course and the
OfficeofGraduateStudiesbythedategradesaredue.Theinstructormustnotrequirestudentstoeitherre
registerforthecourseorauditthecourseinordertocompletetheIgrade.Studentsmayregistertoaudit
thecourse,withtheinstructorsapproval,butcannotretakethecourseforcredituntiltheIgradeiscleared.

An I grade not cleared within the next academic semester (including summer semester) will revert to the
gradenotedonthecontract.IgradesarenotcomputedintheGPA,butthegradenotedonthecontractwill
be computed in the GPA, retroactive to the semester the course was taken, if the contract is not fulfilled by
the specified date. When the final grade is assigned, if applicable, the student will be placed on academic
probation or academically dismissed (refer to Automated Academic Probation Procedures for information).
StudentscannotbeadmittedtodoctoralcandidacyorcertifiedforgraduationwithanIgrade.

Example:
CurrentSemester
student has a B in the course, not including the grade for the missing assignment,
thereforeiseligibleforanI
studentsgrade,includingazeroforthemissedwork,wouldbeanD
student and instructor complete the I Grade Contract, assigning an ID (Incomplete +D
grade)

DeadlineAgreedUponinContract(e.g.twoweeks)*

IfthestudentcompletestheworkasagreeduponintheContractbythenoteddeadline
theinstructorofrecordwillsubmitachangeofgradeinegrades
studentearnsfinalgradecomprisedofallcompletedcoursework

IfthestudentdoesnotcompletetheworkasagreeduponintheContractbythenoteddeadline
IautomaticallydropsoffandthegradeofDremains.
GPAisrecalculatedforthecurrentsemesterandretroactivelyrecalculatedforthesemester
inwhichtheIwasgranted.

*Althoughtheinstructorestablishesthedeadlineforcompletionofthework,thedeadlinemayonly
extendthroughtheendofthesubsequentsemester.

Missing(M)
TheUniversitypolicyistoissueanMgradeautomaticallywhentheinstructordoesnotsubmitanygradefora
graduatestudent.Untilitisremoved,theMisnotcomputedintheGPA.Toresolvethemissinggrade,
studentsreceivinganMgrademustcontacttheirinstructor.Iftheinstructorisnotavailable,thestudentmust
contacttheinstructorsdepartmentchair.CourseswithanMgrademaynotbeappliedtothedegreeprogram
requirements.StudentswithanMgradewillnotbeadmittedtodoctoralcandidacyuntiltheMgradeis
resolved.

ContinuingRegistrationGrades(Z)
TheZgradeshallbeusedtoindicatecontinuingregistrationinmultisemesterinternshiporthesis/dissertation
courses where the final grade to be assigned will indicate the complete sequence of courses or satisfactory
completion of the thesis/dissertation. Upon satisfactory completion of a multisemester internship or
thesis/dissertation,thefinalgradeassignedwillbeanS.TheOfficeofGraduateStudiessubmitsthechangeof
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
44

gradeforthelastregistrationofthesis/dissertationcoursesoncethethesis/dissertationhasbeenacceptedfor
publication.

Note:Graduationwillnotbecertifieduntilallcourseshave beensatisfactorilycompleted.Nogradechanges
willbeprocessedafterthestudenthasgraduatedexceptinthecaseofuniversityerror.Proceduresrequiring
petitionsareprocessedthroughtheOfficeofGraduateStudies.

Probation
Any student who is not in good standing at the end of a semester shall be considered on probation as of the
followingsemester.Thecollegeorprogrammayalsoplacestudentsonprobationforotherreasonsasdesignated
by the college or program. Notification of probation shall be made to the student in writing by the department,
withacopytotheCollegeDean.Attheendofeachprobationarysemester,thedepartmentshallrecommend,in
writing,totheCollegeDeanoneofthefollowing:

1.Removalofprobation
2.Continuedprobation;OR
3.Dismissalfromthedegreeprogram.

Students with a GPA below 3.00 for two consecutive semesters will be prevented from registering for courses
without the permission of the College Dean. The College Dean will notify the Dean of the Office of Graduate
Studiesincasesofacademicdismissal.Tobereadmitted,thestudentwillneedtoreapplyforadmission,meeting
theadmissioncriteriainplaceatthetime.ForinformationontheAutomatedProbationProcessgoto
http://www.grad.usf.edu/inc/linked
files/Catalog%20and%20Policies/2012_2013/Policies/Automating_Academic_Probation_with_Examples_updated_
10_24_12.pdf

VoluntaryWithdrawal
AstudentmaywithdrawfromtheuniversitywithoutgradepenaltybytheUniversitydeadline.Informationonthe
differenttypesofwithdrawal(i.e.,withdrawingfromasingleclassseetheDropsection,anentiresemester,or
from the degree program itself) can be obtained from the Registrars Office. Appropriate alternative calendar
datesmayapply.Studentswhowithdrawmaynotcontinuetoattendclasses.

TransferofCredit
Studentsmay,withtheapprovaloftheirgraduatedegreeprogram,transfercreditsfromanyregionallyaccredited
institution intotheirgraduatedegreeprogram,aslongasthemajorityofthecreditsareearnedattheinstitution
grantingthedegree.CreditsobtainedfromUSFSystemInstitutionswillbecalculatedintotheGPAatUSFandwill
benotedonthetranscriptasthegradeearned.Creditsfromotherregionallyaccrediteduniversitiesarenot
calculatedintotheGPAatUSF.

OnlycreditswithagradeofBorbettermaybetransferred.
Creditforcourseworkexpiresseven(7)yearsafterreceivingthecredit.
Thereisnotimelimitationforcoursesfromacompletedmastersdegreeorprofessionaldegreeapplied
towardadoctoraldegree.
Thegraduatedegreeprogram/departmentwillberesponsibleforevaluating,approving,andinitiating
thetransferassoonaspossibleatthetimeofadmission.

NoteStudentstakingcoursesatUSFSystemInstitutionsotherthantheirhomeUSFinstitutionshouldseekthe
approvaloftheirgraduateprogramdirectorpriortotakingthecoursestoensurethatthecoursesareeligiblefor
transfer.

Seetableonnextpage
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
45

TransferofCreditTable
ToGraduateCertificates ToMastersorEd.S.Degree ToDoctoralDegree**
Courses(4000andabove)
takenasanundergraduate
butnotappliedtocompleted
undergraduatedegrees
DiscretionoftheGraduate
DegreeProgram,iftakenatUSF
System.Uptoonecourseifnot
takenataUSFSystemInstitution.
DiscretionoftheGraduateDegreeProgram,iftakenatUSF.
Upto12creditsifnottakenatUSFSystemInstitution.

GraduateCoursesapplied
toundergraduatedegrees
None None(Discretionofthe
ProgramforapprovedUSF
AcceleratedDegree
Programs)
None
NondegreeSeekingStatus Uptoonegraduatecourse Upto12graduatehours*

CertificateCoursework
(GraduateDegreeSeeking
Students)
Uptoonegraduatecourse(1
coursemaybeappliedtoupto2
certificates)

Upto12graduatehours*
UncompletedMastersor
Ed.S.Degree
DiscretionoftheGraduateDegreeProgram,iftakenataUSFSystemInstitution
FortransfersfromnonUSFInstitutions,upto49%ofrequiredcreditsmaybetransferredinatthe
discretionoftheGraduateDegreeorCertificateProgram.

CompletedMastersor
Ed.S.Degree
Specificcourserequirementsincommonacrossbothdegree
programsmaybewaivedwiththesubstitutionofotherapproved
courseworkatthediscretionoftheprogram.

Coursesfromacompleted
MastersorEd.S.Degreemaynot
betransferredtoanewgraduate
degreeprogram.

AcompletedMastersorEd.S.
Degreemaybeappliedtothe
MastersorEd.S.component
requirementforadoctoral
program,withGraduateDegree
ProgramApproval.

FornonUSFInstitutions,Specific
courserequirementsincommon
acrossbothdegreeprogramsmay
bewaivedwiththesubstitutionof
otherapprovedcourseworkatthe
discretionoftheprogram.
UncompletedDoctoralor
completedProfessional
Degree
DiscretionoftheProgram Specificcourserequirements
incommonacrossboth
degreeprogramsmaybe
waivedwiththesubstitution
ofotherapproved
courseworkatthediscretion
oftheprogram.
Upto49%ofthedoctoral
programrequirementfortotal
coursehours(excluding
dissertationhours)
CompletedDoctoralDegree CoursesfromacompleteddoctoralDegreemaynotbe
transferredtoaGraduateCertificateoraMastersProgram.For
USFandnonUSFsystemSpecificcourserequirementsincommon
acrossbothdegreeprogramsmaybewaivedwiththesubstitution
ofotherapprovedcourseworkatthediscretionoftheprogram.
Specificcourserequirementsin
commonacrossbothdegree
programsmaybewaivedwiththe
substitutionofotherapproved
courseworkatthediscretionof
theprogram.

*amaximumoftwelve(12)creditscanbetransferredtoadegreeregardlessofthesource(s)
**Programsthatwishtotransfercreditfromacompleteddoctoralprogramtoaprofessionalprogrammustsubmitthe
proposaltotheOfficeofGraduateStudiesforapproval.

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
46

ChangeofGraduateDegreeProgram

SeeChangeofGraduateProgramintheAdmissionsSection.

AcceleratedProgramGuidelines

Programs who desire to offer Accelerated Degree Programs must establish guidelines that define the following.
The guidelines must then be submitted and approved by the Policy Committee of the Graduate Council. These
guidelinesareusedinthedevelopmentofanewAcceleratedProgram.

ForDepartmentsDevelopinganAcceleratedProgram:

ProposedProgramsmustmeettheAcceleratedProgramRequirements,aswellasfollowthebestpracticeslisted
below:

Programshaveachoiceofconferringdegreessimultaneouslyorsequentially,butitisrecommendedthat
undergraduatedegreesaretobeconferredinatimelymannerassoonasundergraduaterequirementsare
fulfilled.

ProgramsmustcompleteaProgramofStudy,developaplanforacademicadvising,andtrackingof
students,includingnotationofpotentialfinancialaidimpact.

Typically,uptotwelve(12)hoursofgraduatecreditmaybesharedbetweenthegraduateand
undergraduatedegree.Although,withGraduateCouncilandOfficeofGraduateStudiesapproval,programs
mayofferacceleratedprogramswithmoresharedcredits.

Typically,aminimumundergraduateGPAofatleast3.33overallandaminimumGPAof3.50inthemajor,
havingtakenaminimumof15hoursintheundergraduatemajorarerequiredforstudentstobeadmitted
toanacceleratedprogram.WithGraduateCouncilandOfficeofGraduateStudiesapproval,programsmay
offeracceleratedprogramswithdifferentGPArequirements.StudentsmusthaveaminimumofaB(3.00)
ineachgraduatecourse.ConsequencesfornotobtainingaBineachgraduatecoursemustbenotedin
theDepartmentalAcceleratedProgramrequirements.

Followingcompletionofaminimumof15hoursintheundergraduatemajor,thestudentmaybe
consideredforacceptanceintotheAcceleratedDegreeprograminoneoftwoways:facultynominationor
studentselfnomination,viasubmissionoftheAcceleratedGraduateProgramNominationForm.
Programswillreviewtheapplicationsandapprovethenomination.

Programswillsubmittherequiredpaperwork(AcceleratedGraduateProgramAdmissionForm)toofficially
convertthestudenttograduatestanding,nolaterthanwhenthestudenthasreached90hoursor
Bachelorsdegreehasbeenconferred.TheapplicationrequiresapprovalfromtheGraduateProgram,
College,andOfficeofGraduateStudies.

WhatDepartmentswillsubmitforCurriculumApprovalandcatalogcopy:

ACADEMICINFORMATION(CatalogCopy):

AcceleratedProgramRequirements
AcceleratedProgramsallowacademicallyqualifiedstudentstocompleteanundergraduateBachelorsdegree
andagraduatemastersdegreeonanacceleratedtimeline,graduatingsoonerthanintraditionalprograms.
USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
47

AdmissionRequirements
AdmissionintoanAcceleratedProgramisaccomplishedinoneoftwoways:
1) FacultyNomination
2) StudentSelfApplication

TobeeligibleforconsiderationforanAcceleratedProgram,studentsmust:
Havecompletedaminimumof15undergraduatehoursinthemajor
HaveaminimumundergraduateGPAof3.33overall
HaveaminimumundergraduateGPAof3.50inthemajor

AcceleratedDegreeProgramAcademicRequirements
EachProgramwillindicatethespecificacademicrequirements,includingtheupto12hoursofshared
courseworkbetweentheundergraduateandgraduatedegrees.
UndergraduateDegreeRequirementsspecify
SharedRequirementsspecify
GraduateDegreeRequirementsspecify

AcceleratedProgramInformationforStudents:
AcceleratedProgramsallowacademicallyqualifiedstudentstocompleteanundergraduateBachelorsdegreeand
a graduate degree (typically master's degree) on an accelerated timeline, graduating sooner than in traditional
programs. Typically students will complete a portion of the required graduate coursework while classified as an
undergraduate student and have it count towards both degrees. As soon as the student completes the
undergraduate degree requirements, the student is converted to graduate status, where the remaining graduate
requirementsarefulfilled.StudentsinterestedinpursuinganAcceleratedProgrammustcompleteanAccelerated
ProgramApplication(http://www.grad.usf.edu/inc/linkedfiles/Accelerated_Program_Application.pdf).

EditorsNote:AlthoughstudentsmaybeinanAcceleratedProgram,pursuingaBachelorsandMastersDegreeat
thesametime,theycannotbeintwolevelsatonce.

DualDegreeDesignation

A student may pursue two graduate degrees at USF through a formal, approved Dual Degree Designation. The goal is for a
studenttoattaintwograduatedegrees.(Studentspursuingacombinedbachelorsandgraduatedegreeareconsideredtobein
anAcceleratedProgramseecatalogsectionforinformationonthisseparateprocess.)

ADualDegreedesignationisrequiredforastudentpursuingtwoseparategraduatedegrees.Eitherthroughanestablished
relationshipbetweentwodegreeprograms(see1below)orthroughanindividualizeddesignation(see2below),between0%
and 15% of the total combined credit hours for the two degree programs may be shared, with Department (or equivalent),
College, and Office of Graduate Studies approval. With the exception of shared coursework, all other separate degree
requirements must be successfully met (e.g. two dissertations, one thesis/one dissertation, projects, exams, etc.), unless
approved by Graduate Council. (Note: where a single degree is preferred, refer to the Interdisciplinary Degree Program
informationbelow).

Example:
Astudentisenrolledintwomastersdegreeprogramsrequiringthesesand30creditsminimumeach.Withapproval,
the student may share 9 hours (equal to or less than 15%) across the combined 60 total minimum credit hours
required.Thestudentwouldalsocompletetwoseparatetheses.

Once the degree requirements are successfully completed, the degrees may be conferred concurrently or sequentially.
However,bothdegreesmustbeconferredwithinthetimelimitforthefirstdegreetowhichthestudentisadmitted.

USFTampaGraduateCatalog20132104 Section7AcademicPoliciesandRegulations
48

ApplicationforDualDegreeDesignation
ProceduresforapplyingforDualDegreeDesignationareavailableontheOfficeofGraduateStudieswebsite.

AdvisingandapprovalofaDualDegreeDesignation
DualDegreeDesignationmaybedevelopedinthefollowingways:

1) an established relationship between two degree programs formulated through the Department(s) and then
formalized through the College(s), Office of Graduate Studies, and Graduate Council. A current list of formalized
programswithDualDegreedesignationmaybefoundintheGraduateCatalog.

2) formulated by an individual student who is interested in pursuing two degree programs that are not currently a
formalized relationship with Dual Degree Designation. Students must request from both programs of interest
approvaltopursueDualDegreeDesignationwiththoseprograms.Forproceduresandthenecessaryforms,referto
the Office ofGraduate Studieswebsite. Note: whena Program has this occur more than three times, the Program
shouldfollowtheprocesstoformalizethatDualDegreeDesignation.

InterdisciplinaryDegreePrograms
Astudentmaypursueasinglegraduatedegreethatspansseveralacademicareas.

AnInterdisciplinaryDegreeProgramisdefinedasastudentpursuingasinglestandalonegraduatedegree,whichisoffered
across two or more graduate degree programs. (Note: where two separate degrees are preferred, refer to the Dual Degree
Programinformationabove).

ApplicationtoanInterdisciplinaryDegreeProgram
StudentsinterestedinapplyingforadmissiontoanInterdisciplinaryDegreeProgramfollowtheestablishedUniversity,College,
and Program admission requirements refer to the Office of Graduate Studies website for specific information for that
particularprogram.

DevelopmentofanInterdisciplinaryDegreeProgram
Interdisciplinary Degree Programs are formalized through the College, Office of Graduate Studies, and Graduate Council and
must follow the University requirements for new degree program development, including notation on the Workplan.
Procedures for developing an Interdisciplinary Degree Program are available on the Office of Graduate Studies website. For
informationcontacttheOfficeofGraduateStudies.

OffCampusCoursesandPrograms

Graduate courses and programs are offered at locations other than the Tampa, Sarasota, St. Petersburg, and
Lakeland campuses. Information on course enrollment procedures for offcampus courses and programs may be
obtainedfromtheCollegeinwhichthecoursesorprogramsareoffered.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
49

Section8
UniversityDegreeRequirements

DegreeRequirements

ThefollowingsectionsdescribetheUniversityrequirementsestablishedbytheOfficeofGraduateStudiesforthe
Masters, Education Specialist, and Doctoral degrees. However, individual programs and colleges may establish
additionalormorestringentrequirements.


StudentResponsibilities

The University of South Florida and all colleges, departments and programs therein establish certain academic
requirements that must be met before a degree is granted. These requirements concern such things as curricula
andcourses,majorsandminors,andacademicresidence.Facultyandgraduateprogramdirectorsareavailableto
helpthestudentunderstandandarrangetomeettheserequirements,butthestudentisresponsibleforfulfilling
them. At the end of a student's course of study, if all requirements for graduation have not been satisfied, the
degreewillnotbegranted.Forthisreason,itisimportantforstudentstoacquaintthemselveswithallregulations
and to remain currently informed throughout their college careers. Courses, programs, and requirements
describedinthecatalogmaybesuspended,deleted,restricted,supplemented,orchangedinanyothermannerat
anytimeatthesolediscretionoftheUniversityandtheUSFBoardofTrustees.

GraduateFacultyDefinition

TheUniversityofSouthFloridarecognizesGraduateFacultyandAffiliateGraduateFaculty.

GraduateFacultyisdefinedtoconsistofalltenuretrackortenuredfacultyappointedattheAssistant,Associate,
orProfessorrank,whoholdaterminaldegreeorequivalentintheirdiscipline.

GraduateFacultymembers
areeligibletoteachgraduatecoursesand
maydirectandserveonmasters,specialist,anddoctorallevelcommittees.

Tochairadoctorallevelcommittee,aGraduateFacultymembermustengageincurrentandsustainedscholarly,
creative, or research activities, such as publications, performances, exhibitions, patents, inventions and research
grants.

Affiliate Graduate Faculty membership may be granted by the Office of Graduate Studies Dean to individuals
whose skills or expertise meet criteria established by the College. Affiliate Graduate Faculty membership is in
effectforaspecifiedperiodoftimeandspecificpurposes.

Affiliatemembersmaybeeligible
toteachgraduatecourses,
toserveonmasters,specialist,anddoctorallevelcommittees,

USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
50

todirectmaster'sandspecialist'slevelcommittees,and
tocodirectdoctorallevelcommittees,atthediscretionoftheCollege.

Emeritus Professors and retired or recently resigned professors may also be appointed as Affiliate Graduate
FacultywiththeapprovaloftheCollegeandOfficeofGraduateStudiesDean.

Graduate Faculty Approval Graduate faculty is defined as noted above; Colleges and Departments may have
additional requirements. The Office of Graduate Studies will maintain a list of Graduate Faculty along with
approval guidelines from the Colleges and Departments. For a current list of Graduate Faculty and Affiliate
Graduate Faculty in any program contact the program director or coordinator. Also see Section 3 Faculty and
ResearchInterests.

MastersDegreeRequirements

MinimumHours
Aminimumofthirty(30)hoursisrequiredforamastersdegree,at leastsixteen(16)hoursofwhichmustbeat
the 6000 level. At least twenty (20) hours must be in formal, regularly scheduled course work, ten (10) of which
must be at the 6000 level. Up to six (6) hours of 4000level courses may be taken as part of a planned degree
program. Additional graduate credit may be earned in 4000level courses only if specifically approved by the
appropriate College Dean. Lower level undergraduate course may not be used to satisfy masters course
requirementsbutmaybetakentomeetspecificprerequisites.Studentsenrolledinundergraduatecoursesaspart
of a planned degree program are expected to demonstrate a superior level of performance in these courses. All
graduate and undergraduate courses taken as a graduate student count in the overall GPA, whether or not they
counttowardtheminimumhoursforthedegree.Graduatestudentsmaynotenrollformorethan18hoursinany
semesterwithoutwrittenpermissionfromtheCollegeDean.

InstitutionalEnrollmentRequirement
The majority of credits toward a graduate degree must be earned through instruction offered by the home
institution (e.g., USF Tampa, USF St. Petersburg, USF SarasotaManatee) granting the degree. For information
about the minimum number of credit hours required for the degree refer to the degree requirements in the
programlisting.Studentsareresponsibleforconsultingwiththeirdegreeprogramcoordinatorforinformationon
courses that may be taken outside their graduate degree program, as well as the Transfer of Credit Policy for
course transfer eligibility requirements. Although equivalent courses may be offered at other institutions
(includingwithintheUSFSystem),theymaynotsatisfydegreerequirements.

TimeLimitations
Masters and Ed.S. degrees must be completed within five (5) years from the students date of admission for
graduatestudy.CoursestakenpriortoadmissiontotheUSFgraduateprogram,forexampleasnondegreeseeking
or from other institutions that were transferred in, can be no older than seven years at the time of graduation.
Master andEd.S. degrees (includingdualdegree programs) that require course work in excess of 50 credit hours
maybegrantedalongerstatuteoflimitationsbytheUniversityGraduateCouncil.

TimeLimitExtensions
In the event that a student nears the end of the time limitation as specified above, but the student needs more
time to complete the degree, the student may submit a request for an extension using the Time Limit Extension
RequestForm,availableontheOfficeofGraduateStudieswebsitehttp://www.grad.usf.edu/studentforms.php
Requestsmustinclude

thereasonsforthedelayincompletion,
theanticipatedtimeneededforcompletion,
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
51

andendorsementsfromthegraduatefacultyadvisor,graduateprogram,andCollegeDeanordesignee,
adetailedplanofstudyandtimelinefortheremainingrequirementsforthedegreepriortosubmissionto
theOfficeofGraduateStudiesforapproval.

(Editorsnoteforthetimelimitextensionprocedures,ifthetimelimitextensionwillcausecoursestakenor
transferredintotheprogramtobeolderthan7years,thenarequestforcourseconcurrencymayberequiredorthe
coursesmaybeinvalidatedtowardthedegreerequirements,perthetimelimitpolicy)

Ifapproved,thetimelimitextensionalsoappliestocoursesappliedtowardthedegree.However,programsmay
requireadditionalorrepeatcourseworkaspartoftheconditionofthetimelimitextension.Studentswhoexceed
thetimelimitationsmayhavetheirregistrationplacedonholduntilarequestforextensionhasbeenapproved.
Onlyonetimelimitextensionrequestispermitted.Studentswhoaretemporarilyunabletocontinuetheprogram
shouldsubmitaLeaveofAbsenceRequest,whichextendsthetimelimitforthedurationoftheapprovedLeave
(seethesectiononLeaveofAbsenceintheEnrollmentRequirementssection.).

EnrollmentRequirements
RefertotheAcademicPoliciesSection

MajorProfessor
The Major Professor serves as the student's advisor and mentor. Students should confer with the department to
confirmtheinternalprocessandtimelinefortheselectionandappointmentoftheMajor Professor.Thestudent
mustidentifyamajorprofessorandreceivethatpersonsagreementtoserveasmajorprofessor.Theselectionof
theMajorProfessormustbeapprovedandappointedbythedepartmentassoonaspossible,butnolaterthanthe
timethestudenthascompleted50%oftheprogram.Studentsmusthaveamajorprofessorinordertomaintain
Satisfactory Academic Progress. If a major professor cannot be identified or in the event a major professor is
unableorunwillingtocontinueservingonthestudentscommittee,thestudentisresponsibleforfindinganother
majorprofessor.StudentswhoareunabletofindareplacementmajorprofessorshouldconferwiththeProgram
Directorforavailable options(includingconvertingtoanonthesis programifavailable.)Ifnootheroptionsexist
thestudentmayberequestedtovoluntarilywithdrawfromtheprogramormaybehonorablywithdrawningood
academicstanding.Thestudentandmajorprofessorshouldplanaprogramofstudywhich,whencompleted,will
satisfy the degree requirements specified. A copy of this program, signed by the student and professor, must be
maintainedinthestudentsdepartmentfile.

MajorProfessorsmustmeetthefollowingrequirements:

Begraduatefaculty,asdefinedbytheUniversity.Facultywhodonotmeetthisdefinitionmayserveas
CoMajorProfessorwithfacultywhodo.

Beengagedincurrentandsustainedscholarly,creative,orresearchactivitiesandhavemetdepartmental
(orequivalent)requirements.

HavebeenapprovedbytheDepartmentChair(orequivalent)toserveasaMajorProfessororCoMajor
Professor.

Themembershipofgraduatefacultywillbebaseduponcriteriadevelopedwithintheappropriateprogramor
departmentandapprovedatthecollegelevel.ThesecriteriamustbeforwardedtotheDeanoftheOfficeof
GraduateStudies.

In the event a Major Professor leaves the University (i.e., for an appointment at another university, due to
retirement, etc.) and the Major Professor is willing to continue serving on the students committee, the Major
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
52

ProfessorthenbecomesaCoMajorProfessoronthecommitteeandanotherfacultyisappointedastheotherCo
MajorProfessor.ItisimportantthatoneoftheCoMajorProfessorsbeaccessibleontheuniversitycampusforthe
student to make satisfactory progress on the thesis/dissertation. In the event a Major Professor is on temporary
leave(e.g.sabbatical,research,etc.);theMajorProfessorshall coordinatewiththeProgramDirectortofacilitate
the needs of the student. In some instances a student may choose to have two professors serve as Major
Professor. In this situation the faculty are approved as CoMajor Professors and jointly serve in that role.
Consequentlybothfacultymustsignapprovalonpaperworkpertainingtothestudentsprocessing(i.e.committee
form,changeofcommitteeform,etc.)

Appointment of a (Co)Major Professor(s) may be rescinded by the Department Chair (or equivalent), with the
approval of the appropriate Department (or equivalent) faculty committee (separate from student advisory
committee.)

(Co)MajorProfessor(s)oftheGraduateStudentSupervisoryCommitteeResponsibilities
AvailableontheOfficeofGraduateStudiesWebsite:http://www.grad.usf.edu/policies.php

ThesisCommittee
Studentsworkingtowardathesisdegreewillhavethebenefitofacommitteeofmembersofthegraduatefaculty.
Thecommitteewillapprovethecourseofstudyforthestudentandplanforresearch,supervisetheresearchand
anycomprehensivequalifyingexams,andreadandapprovethethesisforcontentandformat.

Composition
Thecommitteewillconsistofthemajorprofessorandatleasttwoothermembersorcomajorprofessors
and at least one other member of the department or area of interest in which the degree is sought.
(CollegesandProgramsmayrequireadditionalcommitteemembersandspecifycharacteristics.)

MemberDefinition
All graduate faculty, as defined by the University and the College/Department, and approved by their
department and college, are assumed by the Office of Graduate Studies as qualified to be a member of
and/orsuperviseacommittee.PersonsdesiringtoserveonaGraduatecommitteewhoarenotdefinedas
Graduate Faculty (i.e. visiting faculty, professionals, etc.) by the University and the College/Department
must submit a curriculum vitae (CV) and be approved by the Department, College, and, as needed, the
OfficeofGraduateStudies,foreachcommittee.

Committeemembersmustmeetthefollowingrequirements:
Begraduateoraffiliategraduatefaculty,asdefinedbytheUniversity
Havethebackgroundandexpertisethatcontributestothesuccessofthestudent.

InadditiontotherequirementsspecifiedintheGraduateFacultydefinition,committeemembershipwill
be based upon criteria developed within the appropriate program or department and approved at the
collegelevel.ThesecriteriamustbeforwardedtotheDeanoftheOfficeofGraduateStudies.

Approval
Once a committee has been determined, a Supervisory Committee Form needs to be completed by the
student and submitted to the Committee Members for original signatures. Check with the College for
instructions and forms. The original appointment form and two (2) copies should be submitted to the
CollegeAssociateDeansofficeforapproval.Acopyoftheapprovedformshouldbekeptinthestudents
file.AnapprovedandcurrentCommitteeFormmustbeonfileintheprogram/collegebeforegraduation
maybecertified.Committeeformsneedtobeprocessedasearlyintheprogramaspossible,butnolater
thanthesemesterpriortograduation.(Collegesanddepartmentsmayinstituteadditionalrequirements
formembershiponSupervisoryCommittees.)
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
53

ChangestoCommittee
ChangestoaSupervisoryCommitteemustbesubmittedonaChangeofCommitteeForm.Checkwiththe
College for instructions and forms. Original signatures of faculty being added to the Committee, along
with the approval signature of the (Co) Major Professor(s), must be on the form. Faxed signatures are
acceptable. Faculty who are removed from the Committee are not required to sign the form, provided
that the (Co) Major Professor(s) has signed. In such instances the signature of the (Co) Major
Professor(s)indicate(s)approvalofthechange,aswellasacknowledgementandapprovalofthechange
by the removed member. Any nonfaculty being added to a committee must submit a Curriculum Vitae
(CV) for college approval. Change of Committee Forms should be submitted for approval as soon as the
changetakesplace.ChangestoaCommitteeareofficialonlyonceapprovedandfiledbytheprogramand
college.

MastersComprehensiveExamination
Prior to clearance for the degree, candidates must perform satisfactorily on a comprehensive examination or an
alternativemethoddesignatedbytheacademicunittomeasurestudentcompetencyinthemajorarea.Students
mustbeenrolledforaminimumoftwo(2)hoursofgraduatecreditduringthesemesterwhenthecomprehensive
examinationistaken.Iftheexamistakenbetweensemesters,thestudentmustbeenrolledforaminimumoftwo
(2)hoursofgraduatecreditinthesemesterbeforeorfollowingtheexam.

Thesis
Ifathesisisrequired,itmustconformtotheguidelinesoftheUniversity.RefertotheThesisandDissertation
Guidelines,availableonthewebathttp://www.grad.usf.edu/ETDresmain.phpforcompleteinformationabout
requirements,procedures,anddeadlines.Forenrollmentrequirements,refertotheAcademicPoliciessectionin
theCatalog.

Format
TheThesismustconformtooneoftwoformats:

Option1atraditionalformat
3
inclusiveof:

PartI:PreliminaryPages
TitlePage
Dedication(optionalpage)
Acknowledgments(optionalpage)
TableofContents
ListofTables(ifapplicable)
ListofFigures(ifapplicable)
Abstract

PartII:Text(dividedbychapterorsectionheadings)


PartIII:References/Bibliography

AppendixSectionsandcopyrightpermission(ifapplicable)

AbouttheAuthor(optionalpage)


3
DeviationsfromtheavailableformatareacceptableifapprovedinadvancebytheSupervisoryCommitteeandOfficeof
GraduateStudies.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
54

Option2collectionofarticles/papersinsteadofchapters.Referencesmaybeattheendofeachsectionoratthe
endoftheentiredocument.Copyrightpermissions(ifapplicable)mustbenotedintheAppendix.

PartI:PreliminaryPages
TitlePage
Dedication(optionalpage)
Acknowledgments(optionalpage)
TableofContents
Abstract

PartII:Introduction
CollectionofArticles/Papers*
Conclusion

PartIII:References/Bibliography

AppendixSectionsandcopyrightpermission(ifapplicable)
AbouttheAuthor(optionalpage)

*Studentsmustbefirstauthorforarticlesandpapersusedforthethesis/dissertation,oranotherdesignationor
affirmationthatthestudenthadprimaryintellectualresponsibilityforthepublication.

DirectedResearch
DirectedResearchhoursmaysatisfyupto50%ofthethesishourrequirement.

ManuscriptProcessingFee
USFRegulationUSF40107,http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0107.pdf
Students participating in the thesis/dissertation process are required to pay a processing fee. More
informationisavailableontheThesisandDissertationwebsite.

ExchangeofThesisforNonThesisCredit
Ifastudentchangesfromthesistononthesisduringasemesterandiscurrentlyenrolledinthesiscredit,the
current thesis credits may be exchanged withoutacademic penalty ifaOfficeof Graduate Studies Petition is
filedwiththeOfficeofGraduateStudiesnolaterthanthelastdaytowithdrawwithoutAcademicPenalty.Ifa
studentenrolledinathesisrequiredprogramhastakenthesiscreditsbutelectstochangetononthesistrack
or program, the accumulated thesis credits may not be exchanged or converted to another nonstructured
credit.ThethesishourswillremainonthetranscriptandwillretaintheZgrade.

ThesisDefense
Policies and procedures for the thesis defense are handled within the College and Program. Contact the
CollegeandProgramforrequirements.

ThesisFinalSubmissionGuidelines
Informationonrequirementsforsubmissionofthefinishedandapprovedmanuscriptcopiesisavailable
onlineattheThesisandDissertationwebsitehttp://www.grad.usf.edu/ETDresmain.php.Studentswhofail
tosubmitthefinalcopyofathesisbythepostedsubmissiondeadlinewillbeconsideredforgraduationinthe
followingsemesterandmustthereforeapplyforgraduationbytheposteddeadline,enrollinaminimumof
two(2)thesishoursforthatsubsequentsemester,andmeetthesubmissionrequirementsaspostedonthe
Thesis/Dissertationwebsite.OnlyaftertheOfficeofGraduateStudieshasapprovedthemanuscriptcanthe
studentbecertifiedforthedegree.

USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
55

MandatoryElectronicSubmission
Studentsarerequiredtosubmitthethesisinanelectronicformat(ETD).Requirementsandproceduresare
availableattheOfficeofGraduateStudieswebsitehttp://www.grad.usf.edu/ETDresmain.php

SubmissionforOfficialPublicationandArchiving
Alltheses/dissertationswillbesubmittedtotheOfficeofGraduateStudiesdesignatedSystemforofficialpublicationand
archiving.

ChangesafterPublication
Once a thesis is approved and accepted by the Office of Graduate Studies for publication, it cannot be
changed.

ReleaseofThesisPublications
The University recognizes the benefits from collaboration with sponsors on research projects but also
recognizesthepossibilityofconflictsofinterestinthedisclosureoftheresultsofthecollaborations.Whilethe
sponsorseconomicinterestsintherestrictionofdisclosureshouldbeconsidered,theUniversityhasaprimary
mission to extend knowledge and disseminate it to the public and the broader academic community. The
UniversitysStatementofPolicyRegardingInventionsandWorksacknowledgesthepossibleneedfordelays
inpublicationofsponsoredresearchtoprotectthesponsorsinterests,butitprovidesnodefiniteguidelines
for the restrictions of publication beyond the statement: Disclosure delays mutually acceptable to the
Inventor, the Vice President for Research, and the sponsor, if any, are authorized in order to allow patent
applicationstobefilledpriortopublication,therebypreservingpatentrights...
4

To protect the Universitys primary goal from undue compromise, the University has adopted the following
guidelines:

1. Therecommendationsofsponsors,regardingpublicationofresearchresultsshouldbeconsidered
advisoryratherthanmandatory.

2. Insupportofacademicdiscourseandthemissiontopromoteandshareacademicworks,Theses
will be released for worldwide access once submitted to and approved by the USF Office of
GraduateStudies.Intheeventthatapatentorcopyrightapplicationprovidesreasontodelaythe
release of the Thesis, a petition to request a one year delay may be submitted to the Office of
Graduate Studies for consideration. Such requests must be received by the format check of the
thesis.

3. Students should not be delayed in the final defense of their theses by agreements involving
publicationdelays.


4
AprilBurke,UniversityPoliciesonConflictofInterestandDelayofPublications,ReportoftheClearinghouseonUniversity
IndustryRelations,AssociationofAmericanUniversities,February,1985.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
56

DutytoDiscloseNewInventionsandWorks
USF0300http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy0300.pdfandUSF12.003
http://generalcounsel.usf.edu/regulations/pdfs/regulationusf12.003.pdf.
ForinformationabouttherequirementsofthispolicycontacttheDivisionofPatentsandLicensingat(813)
9740994.

ThesisChangeofGrade
Inthesemesterinwhichthefinalmanuscripthasbeenreceived,reviewed,andcertifiedforpermanentfiling
in the University Library, theOffice of Graduate Studies submits the change ofgradefrom Z to S for the
last registration of thesis courses to the office of the registrar when all grades are due at the end of the
semester.

EducationSpecialistDegree(Ed.S.)Requirements

Ed.S.Thesis
StudentswhoarerequiredtosubmitanEd.S.Thesismustmeetalloftherequirementsforthethesis,asspecified
intheMastersDegreesectionofthispublication.Forspecificdegreeprograminformation,refertotheCollegeof
Education.

Ed.S.Project
StudentswhoarerequiredtosubmitanEd.S.NonThesisprojectmustmeetalloftherequirementsasspecifiedby
theCollegeofEducation.Aprojectdoesnotneedtomeettherequirementsofathesisandisnotsubmittedtothe
OfficeofGraduateStudiesforapprovalandarchiving.

DoctoralDegreeRequirements

The doctoral degree is granted in recognition of high attainment in a specific field of knowledge. It is a research
degree and is not conferred solely upon the earning of credit, the completion of courses, or the acquiring of a
number of terms of residency, but also the successful completion of scholarly work. The length of residency and
therequirementsbelowareminimums;programs/collegesmayelecttoestablishmorerigorousrequirements.The
degreewillbegrantedafterthestudenthasshownproficiencyanddistinctiveachievementinaspecifiedfield,has
demonstrated the ability to do original, independent investigation, and has presented these findings with a high
degreeofliteraryskillinadissertation.Amajorprofessorwillbeappointedassoonaspossiblebutnolaterthan
the time the student has completed 50% of the program. The advisor will advise on any specific subject matter
deficienciesandassistinthechoiceofamajorprofessorandareaofresearch.

ResponsibleConductofResearch

ResponsibleConductofResearch(RCR)isacriticalelementintrainingforscholarship.USFhasinformationaboutRCRavailable
onlineat:www.grad.usf.edu/rcr.php

EffectiveSpring2013,OfficeofGraduateStudiesrequiresallnewdoctoralstudentstohavebasicRCRtrainingby
completingtheCollaborativeInstitutionalTrainingInitiative(CITI)modulemostrelevanttothestudentsprogram
ofstudy.TheCITImoduleshavebeendesignedtointroduceresearcherstovariouselementsofresearchconduct
rangingfromresearchmisconducttodatamanagementtomentoring.Asthisisaminimumrequirement,specific
doctoral programs may require training that goes beyond the basic components introduced in this module.
Graduate Programs that have received Office of Graduate Studies approval for rigorous RCR training consistent
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
57

with disciplinary standards and practices may exempt their students from the CITI requirement. Students must
completethemodule,orprovideevidenceofpreviousqualifiedRCRtrainingtotheirProgramDirectorandOffice
ofGraduateStudies,inthefirstsemesterenrolledinadoctoralprogram.PreviousRCRtrainingshouldhavebeen
completed within the past year. Students will be unable to register for courses in a future semester until
successfulfulfillmentofthisRCRrequirement.Oncethetrainingiscompleted,theRegistrationholdwillbelifted.

DoctoralMinimumHours
Becausethedoctoraldegreeisearnedonthebasisofadvancementtodoctoralcandidacystatusandsatisfactory
completionofthedissertation,theOfficeofGraduateStudiesdoesnotspecifyanyminimumnumberofcoursesor
credit hours that must be completed for award of the degree. However, programs with formally approved
concentrationsmusthavecoremajorrequirementsthatallstudentsmustsuccessfullycomplete.

Students must comply with general enrollment requirements and also institutional residency requirements. All
doctoralstudentsmusthaveatleastonegradable(AF)graduatecoursetakenatUSFtosatisfytheGPAminimum
requirements. Up to six (6) hours of 4000level courses may be taken as part of a planned degree program.
Additional graduate credit may be earned in 4000level courses only if specifically approved by the appropriate
CollegeDean.Lowerlevelundergraduatecoursemaynotbeusedtosatisfydoctoralcourserequirementsbutmay
betakentomeetspecificprerequisites.Studentsenrolledinundergraduatecoursesaspartofaplannedgraduate
degreeprogramareexpectedtodemonstrateasuperiorlevelofperformanceinthesecourses.Allgraduateand
undergraduate courses taken as a graduate student count in the overall GPA, whether or not they count toward
theminimumhoursforthedegree.Noundergraduatecoursemaybeusedtosatisfythegradableminimalcourse
requirementforthedoctoraldegree.

TimeLimitations
Doctoral degrees must be completed within seven (7) years from the students original date of admission for
doctoral study. All courses applied to the doctoral degree must be completed within seven (7) years, including
coursestaken

1) priortoadmissiontotheUSFdoctoralprogram,
2) takenasnondegreeseeking,or
3) transferredinfromotherinstitutions.

There is no time limitation for courses from a completed masters degree used toward a doctoral degree. For
studentswhoarereadmitted,seeReadmissionPolicy.Typicallyastudentwillreachcandidacywithinfouryears,
butthismayvaryperdiscipline.

TimeLimitExtensions
In the event that a student nears the end of the time limitation as specified above, but the student needs more
time to complete the degree, the student may submit a request for an extension using the Time Limit Extension
RequestForm,availableontheOfficeofGraduateStudieswebsitehttp://www.grad.usf.edu/studentforms.php.

Requestsmustinclude

thereasonsforthedelayincompletion,
theanticipatedtimeneededforcompletion,
andendorsementsfromthegraduatefacultyadvisor,graduateprogram,andCollegeDeanordesignee,
adetailedplanofstudyandtimelinefortheremainingrequirementsforthedegree

Prior to submission to the Office of Graduate Studies for approval. If approved, the time limit extension also
appliestocoursesappliedtowardthedegree.However,programsmayrequireadditionalorrepeatcourseworkas
part of the condition of the time limit extension. Students who exceed the time limitations may have their
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
58

registrationplacedonholduntilarequestforextensionhasbeenapproved.Onlyonetimelimitextensionrequest
is permitted. Students who are temporarily unable to continue the program should submit a Leave of Absence
Request, which extends the time limit for the duration of the approved Leave (see Leave of Absence in the
EnrollmentRequirementssectionforinformation;theLeaveofAbsenceRequestFormisavailableonlineat:
http://www.grad.usf.edu/studentforms.php).

EnrollmentRequirements
SeeAcademicPoliciesSection

InstitutionalEnrollmentRequirement
The majority of credits toward a graduate degree must be earned through instruction offered by the home
institution (e.g., USF Tampa, USF St. Petersburg, USF SarasotaManatee) granting the degree. For information
about the minimum number of credit hours required for the degree refer to the degree requirements in the
programlisting.Studentsareresponsibleforconsultingwiththeirdegreeprogramcoordinatorforinformationon
courses that may be taken outside their graduate degree program, as well as the Transfer of Credit Policy for
course transfer eligibility requirements. Although equivalent courses may be offered at other institutions
(includingwithintheUSFSystem),theymaynotsatisfydegreerequirements.

MajorProfessor
The Major Professor serves as the student's advisor and mentor. Students should confer with the department to
confirmtheinternalprocessandtimelinefortheselectionandappointmentoftheMajor Professor.Thestudent
mustidentifyamajorprofessorandreceivethatpersonsagreementtoserveasmajorprofessor.Theselectionof
theMajorProfessormustbeapprovedandappointedbythedepartmentassoonaspossible,butnolaterthanthe
timethestudenthascompleted50%oftheprogram.Studentsmusthaveamajorprofessorinordertomaintain
Satisfactory Academic Progress. If a Major Professor cannot be identified or in the event a Major Professor is
unableorunwillingtocontinueservingonthestudentscommittee,thestudentisresponsibleforfindinganother
MajorProfessor.StudentswhoareunabletofindareplacementMajorProfessorshouldconferwiththeProgram
Directorforavailableoptions.Ifnootheroptionsexistthestudentmayberequestedtovoluntarilywithdrawfrom
theprogramormaybehonorablywithdrawningoodacademicstanding.ThestudentandMajorProfessorshould
plan a program of study which, when completed, will satisfy the degree requirements specified. A copy of this
program,signedbythestudentandprofessor,shouldbemaintainedinthestudentsdepartmentfile.

MajorProfessorsmustmeetthefollowingrequirements:

Be active in scholarly pursuits as evidenced by at least one refereed publication in the last three
years.

Begraduatefaculty,asdefinedbytheUniversity.Facultywhodonotmeetthisdefinitionmayserve
asCoMajorProfessorwithfacultywhodo

Be engaged in current and sustained scholarly, creative, or research activities and have met
departmental(orequivalent)requirements

Have been approved by the Department Chair (or equivalent) to serve as a Major Professor or Co
MajorProfessor

The membership of graduate faculty will be based upon criteria developed within the appropriate program or
department and approved at the college level. These criteria must be forwarded to the Dean of the Office of
GraduateStudies.

USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
59

In the event a Major Professor leaves the University (i.e. for an appointment at another university, due to
retirement, etc.) and the Major Professor is willing to continue serving on the students committee, the Major
ProfessorthenbecomesaCoMajorProfessoronthecommitteeandanotherfacultyisappointedastheotherCo
MajorProfessor.ItisimportantthatoneoftheCoMajorProfessorsbeaccessibleontheuniversitycampusforthe
studenttomakesatisfactoryprogressonthethesis/dissertation.IntheeventaMajorProfessorisontemporary
leave(e.g.sabbatical,research,etc.);theMajorProfessorshall coordinate withtheProgramDirector tofacilitate
the needs of the student. In some instances a student may choose to have two professors serve as Major
Professor. In this situation the faculty are approved as CoMajor Professors and jointly serve in that role.
Consequentlybothfacultymustsignapprovalonpaperworkpertainingtothestudentsprocessing(i.e.committee
form,changeofcommitteeform,admissiontocandidacy,etc.).

Appointment of a (Co)Major Professor(s) may be rescinded by the Department Chair (or equivalent), with the
approval of the appropriate Department (or equivalent) faculty committee (separate from student advisory
committee.)

(Co)MajorProfessor(s)oftheGraduateStudentSupervisoryCommitteeResponsibilities
AvailableontheOfficeofGraduateStudiesWebsite:http://www.grad.usf.edu/policies.php
DoctoralCommittees
SomeCollegeshaveaProgramCommitteecomprisedofgraduatefaculty,whoadvisethestudentfromadmission
uptodoctoralcandidacy,whentheformalDoctoralDissertationCommitteeisformed.Assoonasanareaof
researchisdeterminedandamajorprofessorisselected,aDoctoralDissertationCommitteewillbeappointedand
approvedforthestudent.TheDepartmentwillrequestapprovaloftheDoctoralCommitteefromtheDeanofthe
Collegeand,asneeded,theDeanoftheOfficeofGraduateStudies.
RoleofDoctoralCommittees
DependingontheCollege,eithertheProgramCommitteeortheDoctoralDissertationCommitteeis
responsiblefor

approvingthestudentscourseofstudy
gradingthewrittencomprehensivequalifyingexamination

DoctoralDissertationCommittee
DoctoralDissertationCommitteeswill,

approvetheplanforresearch
supervisetheresearch,,
readandapprovethedissertation,and
conductthedissertationdefense.
Composition
TheDoctoralDissertationCommitteewillconsistofatleastfourmembers
threemustcomefromtheacademicarea(i.e.,discipline)ofthestudent
atleastoneexternalmember(fromoutsidetheDepartment,School,orequivalent,hostingthe
doctoralprogram,butmaybewithintheacademicdiscipline)
Facultyholdingjointoradjunctappointmentsinthedegreegrantingacademicunit(i.e.Departmentor
equivalent)cannotbeexternalmembersonastudentscommittee.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
60

MemberDefinition
All graduate faculty, as defined by the University and the College/Department, and approved by their
department and college, are assumed by the Office of Graduate Studies as qualified to be a member of
and/orsuperviseadoctoralcommittee.Personsdesiringtoserveonacommitteewhoarenotdefinedas
Graduate Faculty (i.e. visiting faculty, professionals, etc.) by the University and the College/Department
must submit a curriculum vitae and be approved by the Department, College, and Office of Graduate
Studies,foreachcommittee.

Committeemembersmustmeetthefollowingrequirements:

Begraduateoraffiliategraduatefaculty,asdefinedbytheUniversity
Havethebackgroundandexpertisethatcontributestothesuccessofthestudent.

InadditiontotherequirementsspecifiedintheGraduateFacultydefinition,committeemembershipwill
be based upon criteria developed within the appropriate program or department and approved at the
collegelevel.ThesecriteriamustbeforwardedtotheDeanoftheOfficeofGraduateStudies.
Approval
Onceacommitteehasbeendetermined,aDoctoralDissertationCommitteeFormneedstobecompleted
bythestudentandsubmittedtotheCommitteeMembersfororiginalsignature.CheckwiththeCollege
forinstructionsandforms.Toinsureuniformityofexcellenceacrossthecolleges,the(Co)Major
Professor(s)ofDoctoralDissertationCommitteeswillneedtosubmitacurrentcurriculumvitae
(equivalenttoanNIHBio,approximatelytwopageslongwiththelastthree(3)yearsofscholarlyactivity
included)withthecommitteeappointmentformtotheCollegeDeanordesignee.Thisapprovalisin
additiontotheapprovalfromtheirdepartmentchairperson.(Collegesanddepartmentsmayinstitute
additionalrequirementsformembershiponDoctoralDissertationCommittees.)Onceapproved,the
originalformandtheapprovedCurriculumVitae(CV)areplacedinthestudentsfile.Anapprovedand
currentFormmustbeonfileintheprogram/collegebeforegraduationmaybecertified.Doctoral
DissertationCommitteeFormsneedtobeprocessedasearlyintheprogramaspossible,butnolaterthan
thesemesterpriortograduation.
ChangestoCommittee
ChangestoaDoctoralDissertationCommitteemustbesubmittedonaChangeofCommitteeForm.Check
withtheCollegeforinstructionsandforms.OriginalsignaturesoffacultybeingaddedtotheCommittee,
alongwiththeapprovalsignatureofthe(Co)MajorProfessor(s),mustbeontheform.Faxedsignatures
areacceptable.FacultywhoareremovedfromtheCommitteearenotrequiredtosigntheform,provided
thatthe(Co)MajorProfessor(s)hassigned.Insuchinstancesthesignatureofthe(Co)Major
Professor(s)indicate(s)approvalofthechange,aswellasacknowledgementandapprovalofthechange
bytheremovedmember.AnynonfacultybeingaddedtoacommitteemustsubmitaCVforapproval.Ifa
facultymemberisbeingaddedasaCoMajorProfessor,orifthereisanappointmentchangetotheMajor
Professorposition,aCVmustbeincludedforthefacultymemberwhoisbeingaddedtothatposition.
ChangeofCommitteeFormsshouldbesubmittedforapprovalassoonasthechangetakesplace.Changes
toaCommitteeareofficialonlyonceapprovedandfiledbytheprogramandcollege.Anapprovedand
currentDoctoralDissertationCommitteeFormmustbeonfilebeforegraduationmaybecertified.

USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
61

DoctoralQualifyingExamination
As soon as the substantial majority of the course work is completed, the student must pass a written qualifying
examinationcovering the subject matter in the major and related fields. This examination maybe supplemented
by an oral examination. Students must be enrolled for a minimum of two (2) hours of graduate credit in their
disciplineatthetimetheytakethequalifyingexamination.Iftheexamistakenbetweensemesters,studentsmust
beenrolledforaminimumoftwo(2)hoursofgraduatecreditinthesemesterbeforeorfollowingtheexam.

AdmissiontoCandidacy
Inordertobeadmittedtodoctoralcandidacy,studentsmustmeetthefollowingrequirementsatUSF:
1. admissiontoadoctoralprogram
2. appointmentofaDoctoralCommittee,
3. attainmentofanoverallanddegreeprogramGradePointAverage(GPA)of3.00atUSFatthetimeof
candidacy.(AllIandMgrades,includingIFandMF,mustbeclearedbeforecandidacymaybe
finalized.)
4. successfulcompletionofaqualifyingexamination
5. certificationbytheDoctoralCommitteethattheabovequalificationshavebeensuccessfullycompleted.

TheAdmissiontoCandidacyformshouldbesubmittedforapprovalduringthesemesterthatthequalifyingexams
werecompleted,butnolaterthanthesemesterfollowingthesuccessfulcompletionoftheexam.Theformwillbe
approved by the Dean of the College and forwarded to the Dean of the Office of Graduate Studies for final
approval.DoctoralCandidacyiseffectiveasofthedaythattheOfficeofGraduateStudiesapprovesoftherequest
and changes the students status to 6C. For procedures and processing deadlines refer to the Office of Graduate
Studieswebsiteatwww.grad.usf.edu.

Once candidacy status is approved, students with approved candidacy are eligible to enroll in dissertation hours
(7980) in the semester that immediately follows the last business day of the approval window. For example,
studentsapprovedduringtheFallapprovalwindowmayenrollintheSpring.StudentsapprovedduringtheSpring
approval window may enroll in the summer and students approved during the Summer approval window may
enrollintheFall.StudentsmayNOTenrollindissertationhourspriortobeingadmittedtodoctoralcandidacy.

Each degree program has a required number of dissertation hours for completion of the degree. Departments
may, with College approval, apply Directed Research hours toward the total number of dissertation hours
required. Directed Research hours shall not exceed 50% of the dissertation hour requirement. No directed
researchhourswillbeconvertedtodissertationhours(i.e.adirectedresearchcoursedroppedandadissertation
courseadded)priortoorduringtheapprovalwindow.FormoreinformationrefertoEnrollmentRequirementsin
theAcademicPoliciessection.

Dissertation
DissertationrequirementsarefortheacademicdegreesofPh.D.andEd.D.FortheprofessionaldegreesofAu.D.
and D.P.T., contact the professional school for doctoral project requirements. The Dissertation must conform to
the guidelines of the University. Refer to the Thesis and Dissertation Guidelines, available on the web at
http://www.grad.usf.edu/ETDresmain.php for information about requirements, procedures, and deadlines. For
enrollmentrequirements,refertotheAcademicPoliciessectionintheCatalog.

USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
62

Format
TheDissertationmustconformoneoftwoavailableformats

Option1traditionalformat
5
inclusiveof:
PartI:PreliminaryPages
TitlePage
Dedication(optionalpage)
Acknowledgments(optionalpage)
TableofContents
ListofTables(ifapplicable)
ListofFigures(ifapplicable)
Abstract

PartII:Text(dividedbychapterorsectionheadings)

PartIII:References/Bibliography
6

AppendicesTitlePage
AppendixSections(ifapplicable)

PartIV:AbouttheAuthor(requiredfordissertations)

Option2collectionofarticles/papersinsteadofchapters.Referencesmaybeat theendofeach
sectionorattheendoftheentiredocument.Copyrightpermissions(ifapplicable)mustbenotedon
theAcknowledgementspage.

PartI:PreliminaryPages
TitlePage
Dedication(optionalpage)
Acknowledgmentsandcopyrightpermission(ifapplicable)
TableofContents
Abstract

PartII:CollectionofArticles/Papers

PartIII:References/Bibliography
7

AppendicesTitlePage
AppendixSections(ifapplicable)

DirectedResearch
DirectedResearchhourstakenwiththe(Co)MajorProfessor(s)priortoapprovaltodoctoralcandidacyby
theOfficeofGraduateStudiesmaysatisfyupto50%ofthedissertationhourrequirement,withprogram
approval.


5
DeviationsfromthetwoavailableformatsareacceptableifapprovedinadvancebytheSupervisoryCommitteeandOfficeof
GraduateStudies.
6
IncludeeitherReferencesoraBibliography,asspecifiedbyyourstyleguide.
7
IncludeeitherReferencesoraBibliography,asspecifiedbyyourstyleguide.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
63

ManuscriptProcessingFee
USF Regulation USF40107, http://generalcounsel.usf.edu/regulations/pdfs/regulationusf4.0107.pdf
Students participating in the thesis/dissertation process are required to pay a processing fee. More
informationisavailableonthewebsiteathttp://www.grad.usf.edu/ETDresmain.php

DoctoralDissertationDefense
After the Doctoral Dissertation Committee has determined that the final draft of the dissertation is suitable for
presentation;theCommitteewillrequesttheschedulingandannouncementoftheDissertationDefense(alsocalled
Final Oral Examination or Oral Defense). Check with the College and Program for college and program specific
proceduresforthisprocess.AcopyoftheannouncementshouldbesenttotheOfficeofGraduateStudies,preferably
twoweeksinadvanceofthedefensedate.Theannouncementmustalsobepostedinapublicforumforaminimum
of twentyfour hours to comply with statute requirements fora public meeting. A student must successfully defend
thedissertationinordertobeabletoproceedandcompletethefinalsubmissionprocess.

DoctoralDissertationDefenseChair
TheDoctoralDissertationDefense(FinalOralExamination)shallbepresidedoverby

anexternalcommitteememberfromoutsidetheDepartment,School,orequivalent,hostingthe
doctoralprogram,butmaybewithintheacademicdiscipline,

OR,

anoncommitteemember(a.k.a.OutsideChair)
(RefertotheindividualProgramsDegreeRequirementsintheGraduateCatalogforinformation).
IftheChairisfromanotherinstitution,thisindividualmustbeapprovedforAffiliateGraduate
Facultystatus.
TheDoctoralDissertationDefenseChairsroleincludesoverseeingtheproceedingsaswellasservingasthestudents
advocate,byensuringfairnessoftheprocess.Facultyholdingjoint,courtesy,oradjunctappointmentsinthedegree
grantingacademicunit(i.e.Departmentorequivalent)cannotserveastheDefenseChair.
ProceduresforConductingtheDoctoralDissertationDefense(FinalOralExamination)

1. TheDoctoralDissertationdefense(finaloralexamination)shouldbeconductedwithinatimeline
to allow for the student to make any necessary corrections following the defense and still meet
thefinalcopydeadlineforturningintheDissertationtotheOfficeofGraduateStudies.

2. ThepresentationshouldbeconsideredanimportantfunctionintheDepartmentandallgraduate
studentsandfacultybeencouragedtoattend.

3. Thepresentationanddefenseareopentothepublicandassuch,mustmeettherequirementsof
the Sunshine Laws for the State of Florida. The Doctoral Dissertation Committee deliberation is
notpublic.

4. The room selected for the examination should have adequate seating with an alternate room
selectedincaseofproblems.

5. It is required that all members of the Doctoral Dissertation Committee be present for the
examination unless an absence is approved prior to the defense taking place by the Office of
Graduate Studies Dean. In the event that a member cannot attend in person, participation is
permissible via speakerphone or video conference. A minimum of three members, including the
Major Professor is required to proceed with the defense. If a noncommittee member (Outside
Chair)chairstheDefense,thisindividualdoesnotcountasoneofthethreerequiredmembersin
attendance. If an unforeseeable situation arises that would prevent compliance with this
requirementtheMajorProfessororDoctoralDissertationDefenseChairshouldcontacttheOffice
ofGraduateStudiesforguidanceandapprovaltoproceedwiththedefense.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
64

6. Thelengthoftheexaminationperiodwillgenerallynotexceedthreehours.Throughoutthistime
the Doctoral Dissertation Defense Chair is to be in charge of all proceedings and, ideally, is
expectedtoplayabalancingrolebetweenadvocacyandcontention.

7. The Doctoral Dissertation Defense Chair, at any time during the course of the examination, may
requestallvisitorstoleave.

8. Presentation

The Doctoral Dissertation Defense Chair should open the proceedings by introducing the
candidateandtheDoctoralDissertationCommittee.

The examination should beginwith a presentation by the candidate designed to summarize


thedissertation.

9. Questions

Following the presentation the Defense may be moved to a different setting for the main
examination.TheCollegedeterminestheorderoftheproceedingsdescribedbelow:

The examination will consist of questions about the research by the Doctoral Dissertation
DefenseChairandtheDoctoralDissertationCommittee.

It is suggested that questioning should be limited to about 15 minutes for each Doctoral
DissertationCommitteememberwithsubsequentroundsofquestioningasnecessary.

Questions from the facultyatlarge and/or the public may be allowed following the
presentation.Itissuggestedthatquestioningfromthegeneralaudiencebelimitedupto5
minutesperperson.

10. DeliberationsandVoting

Followingthecompletionoftheseproceedings,theDoctoralDissertationDefenseChair
will ask all visitors and the candidate to leave and will reconvene the Doctoral
DissertationCommitteeonly.

will preside over the deliberations and voting of the Committee. (Note: If a non
committeemember[OutsideChair]isused,he/shewillnotparticipateinthevoting).

is responsible for tallying the votes and informing the candidate of the final decision.
The voting is to be limited to pass and fail votes. The vote of the Doctoral
Dissertation Committee must be unanimous. If unanimous agreement cannot be
reached, the Doctoral Dissertation Defense Chair notifies the Department Chair (or
appropriate equivalent) who will endeavor to resolve the dispute in an expedient
fashion.

records the vote on the Successful Defense Form and conveys the decision of the
Doctoral Dissertation Committee (Successful Defense form) to the Department/College
Graduateofficetobekeptinthestudentsfile.

DissertationFinalSubmissionGuidelines
Informationonrequirementsforsubmissionofthefinishedandapprovedmanuscriptcopiesisavailable
online at the Thesis and Dissertation website at http://www.grad.usf.edu/ETDresmain.php. Students
who fail to submit the final copy of a dissertation by the posted submission deadline will not be
consideredfor graduation.Thestudentmaybeconsideredforgraduationinthefollowingsemesterand
mustthereforeapplyforthedegree(graduation)bytheposteddeadline,enrollinaminimumoftwo(2)
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
65

dissertationhoursforthatsubsequentsemester,andmeetthesubmissionrequirementsaspostedonthe
Thesis/Dissertation website. Only after the Office of Graduate Studies has approved the manuscript can
thestudentbecertifiedforthedegree.

MandatoryElectronicSubmission
Students are required to submit the dissertation in an electronic format (ETD). Requirements and
procedures are available at the Office of Graduate Studies website at http://www.grad.usf.edu/ETDres
main.php

SubmissionforOfficialPublicationandArchiving
Alltheses/dissertationswillbesubmittedtotheOfficeofGraduateStudiesdesignatedSystemforofficial
publicationandarchiving.

ChangesafterPublication
OnceadissertationisapprovedandacceptedbytheOfficeofGraduateStudiesforpublication,itcannot
bechanged.

ReleaseofDissertationPublications
The University recognizes the benefits from collaboration with sponsors on research projects but also
recognizes the possibility of conflicts of interest in the disclosure of the results of the collaborations.
While the sponsors economic interests in the restriction of disclosure should be considered, the
University has a primary mission to extend knowledge and disseminate it to the public and the broader
academic community. The Universitys Statement of Policy Regarding Inventions and Works
acknowledgesthepossibleneedfordelaysinpublicationofsponsoredresearchtoprotectthesponsors
interests, but it provides no definite guidelines for the restrictions of publication beyond the statement:
DisclosuredelaysmutuallyacceptabletotheInventor,theVicePresidentforResearch,andthesponsor,
if any, are authorized in order to allow patent applications to be filled prior to publication, thereby
preservingpatentrights...
8

To protect the Universitys primary goal from undue compromise, the University has adopted the
followingguidelines:
1. The recommendations of sponsors, regarding publication of research results should be
consideredadvisoryratherthanmandatory.

2. In support of academic discourse and the mission to promote and share academic works,
Dissertations will be released for worldwide access once submitted to and approved by the
USF Office of Graduate Studies. In the event that a patent or copyright application provides
reasontodelaythereleaseoftheDissertation,apetitiontorequestaoneyeardelaymaybe
submitted to the Office of Graduate Studies for consideration. Such requests must be
receivedbytheformatcheckofthedissertation.

3. Students should not be delayed in the final defense of their dissertations by agreements
involvingpublicationdelays.

DutytoDiscloseNewInventionsandWorks
USF0300http://generalcounsel.usf.edu/policiesandprocedures/pdfs/policy0300.pdfandUSF12.003
http://generalcounsel.usf.edu/regulations/pdfs/regulationusf12.003.pdf.

8
AprilBurke,UniversityPoliciesonConflictofInterestandDelayofPublications,ReportoftheClearinghouseonUniversity
IndustryRelations,AssociationofAmericanUniversities,February,1985.
USFTampaGraduateCatalog20132014 Section8UniversityDegreeRequirements
66

ForinformationabouttherequirementsofthispolicycontacttheDivisionofPatentsandLicensingat
(813)9740994.
DissertationChangeofGrade
In the semester in which the final manuscript has been received, reviewed, and certified for permanent
filingintheUniversityLibrary,theOfficeofGraduateStudiessubmitsthechangeofgradefromZtoS
forthelastregistrationofdissertationcoursestotheofficeoftheregistrarwhenallgradesaredueatthe
endofthesemester.

TheUseofPh.D.inCredentialsandPublication

Students may only use the credential of Ph.D. after degree conferral is granted. It is inappropriate to use the
credentialuntilitisofficiallyandformallygranted.TheuseoftheabbreviationPh.D.inuniversitypublications,
correspondence, etc., including websites and other electronic media, shall be upper case P, lower case h
followed by aperiod,anupper case D and anotherperiod. It shall not beused in the format of all upper case
letterswithoutperiods,asinPHD.

USFTampaGraduateCatalog20132014 Section9GraduationInformation
67

Section9
GraduationInformationandPostDoctoralAffairs

ApplicationforDegree(Graduation)

To graduate, a student must submit the Application for Degree through their College. This application must be
submittedinthetermofexpectedgraduationbythedeadlinenotedintheacademiccalendar.Ifastudentapplies
for graduation and is not approved, a new Application for Degree must be submitted by the deadline in a new
term. In order for the degree statement to appear on a students academic record, the student must file the
aforementionedapplicationwhetherornotparticipationinthecommencementceremonyisdesired.

Theapplicationforagraduatedegreeisonlineat
http://www.registrar.usf.edu/forms/GraduateGraduationApp8241120110824_16_24_22.pdf

The application must be submitted to the College advising office prior to the graduation application deadline.
Inquiries concerning approval or denial of graduation should be made to the appropriate college. It is the
studentsresponsibilitytoclearallI(Incomplete)andM(Missing)gradesinallcoursesandtoprovideofficial
transcriptsofalltransferredcourseworkneededforgraduationatleastthreeweekspriortotheendoftheterm
inwhichhe/sheexpectstograduate.

GraduationRequirements

It is the students responsibility to make sure that he/she has met all degree requirements (e.g. be in good
standing)asspecifiedinthePoliciesandDegreeRequirementssectionsofthispublication,aswellasanyCollege
andProgramrequirementsforthedegree.

Commencement

Graduatestudentsmaynotparticipateincommencementexercisesuntilallrequirementsforthedegreesought
havebeenfulfilled.StudentsgraduatingfromprogramsbasedfromtheTampacampus(despitelocation,i.e.may
be located in St. Petersburg, Sarasota, Lakeland, etc., such as students in Marine Science) participate in
commencementexercisesontheTampacampus.AlldoctoralgraduatesreceivedegreeconferralfromtheTampa
campusandthereforeparticipateincommencementexercisesinTampa.

Diplomas

Diplomas are mailed to the students permanent address approximately six (6) weeks after commencement.
Students with a change of address need to fill out a change of address form at the Registrars office. Questions
regardingdiplomasanddegreecertificationshouldbedirectedtotheRegistrarsofficeat9742000.

USFTampaGraduateCatalog20132014 Section9GraduationInformation
68

LettersofCertification

StudentsinneedofverificationofthedegreepriortoreceivingtheirdiplomamayrequestaLetterofCertification.
This letter specifies that thestudent has finished all of the requirements for the degree and the date the degree
will be conferred on. The letter must include the students social security number, name of degree program and
officialnameofthedegree.TheMajorProfessor,theCollegeDean(ordesignee),theCoordinator(ordesignee)in
the Office of Graduate Studies, and the Registrar must sign the Letter of Certification. A template for the
Certification Letter is available on the Office of Graduate Studies website at http://www.grad.usf.edu/student
forms.php

PosthumousDegreesorDegreesinMemoriam

TheUniversitymayawardaposthumousmastersordoctoral(andmedical)degreetoastudentwhowasingood
standingattheUniversityatthetimeofhisorherdeathandwhohadcompletedallsubstantiverequirementsfor
thedegree.TheUniversitymayalsoawardmasters,doctoralandmedicaldegreesinmemoriamtoastudentwho
wasingoodstandingattheUniversityatthetimeofhisorherdeath.

To award a nonthesis degree, the student would need to have completed all courses required for the degree.
Coursesrequiredforthedegree,inwhichthestudentisenrolledatthetimeofhisorherdeath,musthavebeen
completed tothe satisfaction of the faculty so that passinggrades might be posted.All other requirements (e.g.,
gradepointaverage,tests,etc.)musthavebeensatisfiedaswell.

To award a thesis degree, all courses must be completed as described above and the thesis must be sufficiently
complete to the satisfaction of the faculty so that certification of completion may be posted to the students
record.

ProceduresforAwardofPosthumousDegreesorDegreesinMemoriam
The Chairperson of a Department, on his or her own initiative or upon the request of the family of the student,
may recommend a posthumous degree, or a degree in memoriam, by forwarding the recommendation to the
respective College Dean and then to the Office of Graduate Studies Dean. If approved by the Office of Graduate
StudiesDean,therecommendationwithsupportingdocumentationwillbeforwardedtotheProvostforapproval.
If the Provost approves the recommendations, the Office of the Registrar will be notified and the degree will be
awarded at the next commencement ceremony or will be presented to the student's family in an appropriate
setting.

Diplomas for posthumous degrees will be identical to other degrees awarded in the same colleges and majors.
Diplomas for Degrees in Memoriam will be prepared toread Masterof Arts in Memoriam, Master of Science in
Memoriam,DoctorofPhilosophyinMemoriam,etc.,dependinguponthedegreethestudentwaspursuingat
thetimeofhisorherdeath.

Transcripts

Transcripts of a student's USF academic record may be requested by the student through the Office of the
Registrar. A student's academic record can only be released upon authorization of the student. Students
requesting transcripts may do so in person or by writing to the Office of the Registrar. By law, the request must
include the student's signature and date. For transcripts to be issued, the student must have no financial
obligations to the University. Procedures for requesting a transcript are available on the Office of the Registrars
website at http://www.registrar.usf.edu/. Degree statements are posted approximately five weeks after the
USFTampaGraduateCatalog20132014 Section9GraduationInformation
69

graduationceremony.Currenttermgradesarepostedapproximatelyoneweekafterthefinalexamsend.Ifgrades
forthecurrenttermareneeded,clearlyindicatethatthetranscriptrequestistobeheldforgrades.

OfficeofPostdoctoralAffairs

The Office of Postdoctoral Affairs (OPA) serves as an administrative and academic center of excellence for
postdoctoral scholars, and ensures they have an exemplary professional and personal development experience
while at USF. It fosters a robust postdoctoral community, provides opportunities to enhance the postdoctoral
experience and future success of its constituents, and serves as a dedicated resource for postdoctoral scholars,
faculty,andadministrators.

ObjectivesoftheOPA:
Provideguidancetocollegesandpostdoctoralscholarsthroughoutthehiringprocess.
Establish,maintain,andevaluatepostdoctoralpolicies.
Buildcollaborationamongpostdoctoralscholars,colleges,andgraduatestudents.
Offerprofessionaldevelopmentworkshopsforpostdoctoralscholarsandtheirmentors.
Maintainadetaileddatabaseofcurrentandalumnipostdoctoralscholars.
Submitpostdoctoraldataforuniversity,state,national,andinternationalreports.
FacilitatethedevelopmentofaUSFPostdoctoralAssociation.

Formoreinformation,pleaseseewww.grad.usf.edu/postdoc

USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

70

Section10
Degrees,Programs,andConcentrations

New graduate degrees, programs and concentrations are continually under development and may now be
approvedandavailable.Checkthewebsiteforrecentlyapprovedprogramsandforinformationonwhichprograms
are currently accepting applications and which are currently closed for admission. For the most current list of
authorizeddegrees,programsandconcentrations,AcceleratedDegreePrograms,andDualDegreePrograms,goto
http://www.grad.usf.edu/programs.php.Asofthedateofthispublication,theUniversityisauthorizedtooffer49
differentdegreeswithgraduateprograms(majors)offeredasfollows:

127 Mastersprograms(includingtheMPAS) 229 ConcentrationsattheMasterslevel


2 EducationSpecialistprograms 15 ConcentrationsattheSpecialistleve
45 Doctoralprograms(includingPh.D.,Ed.D.,Au.D.,DNP,DrPH) 105 ConcentrationsattheDoctorallevel
3 Professionaldoctoralprograms(includingM.D.,D.P.T.,PharmD)

HowtounderstandDegrees,versusPrograms,versusConcentrations.

The University offers a number of degrees (e.g. M.A., M.S.E.S., Ph.D., etc.) under which various
programs (a.k.a. majors) are offered for example Accounting. Concentrations are formalized areas
ofstudyavailablewithintheprogramandmaybenotedonthetranscriptanddiplomaforexample
Tax/Audit.Definitionsarenotedonthefollowingpage.

Some programs are offered as the area of study presented. Other programs are offered through a
variety of concentrations within the Program. The Degree is awarded in the Program, e.g. M.S. in
Nursing.Forexample:
AdultEducation(CurriculumandInstruction) M.Ed. Education

Wouldtranslateto:M.Ed.inCurriculumandInstructionwithaConcentrationinAdultEducation

M.Ed. =thenameofthedegreeMasterofEducation
CurriculumandInstruction =thenameoftheprogramofstudythedegreeisawardedin
AdultEducation =thenameoftheconcentrationwithintheprogram

TolearnmoreabouttheProgramorConcentration,refertothecorrespondingcollegesectionofthe
Catalog.Note: Programs may also offer plans, tracks, orareas of study which are informal groupings
withinaprogramorconcentration.

QuestionsaboutdegreesandconcentrationsmaybedirectedtotheOfficeofGraduateStudies.

USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

71

Definitions

Degrees
(http://files.acad.usf.edu/edout/NewDegree/USFProceduresonNewAcademicProgram.pdf)
Adegreeprogramisdefinedasanorganizedcurriculumleadingtoacollegedegreeinanareaofstudyrecognized
asanacademicdisciplinebythehighereducationcommunity,asdemonstratedbyassignmentofaClassificationof
InstructionalPrograms(CIP)codebytheNationalCenterforEducationalStatistics,orasdemonstratedbysimilar
programs existing at other colleges and universities, and having designated faculty and instructional resources.
Each degree program will be assigned a CIP code and included in the State University System Academic Degree
ProgramInventory.

Example:DoctorofPhilosophy(Ph.D.)

GraduateProgram(Major)(ref:BOGRegulation6C8.011)
An organized curriculum offered as a major area of studythat is part ofan existing orproposeddegree program
and does not constitute sufficient distinct coursework, faculty, and instructional resources to be considered a
separatedegreeprogram.AProgramMajormustbereasonablyassociatedwiththedegreeprogramunderwhich
itisofferedandsharecommoncoreorprerequisitecourseswithothermajorswithinthesamedegreeprogram.A
Program Major will not be assigned a CIP Code, will not be included in the State University System Academic
Degree Program Inventory, and will not be recognized as a standalone degree program at the University. The
numberofcredithoursforaProgramMajorwillbeestablishedbytheUniversityforeachdegreelevel.

Example:CurriculumandInstruction

Concentration(approvedbyGraduateCouncil3/15/10)
AConcentrationisacoordinatedsetofcoursesinconjunctionwithexaminations,thesisand/ordissertation,sub
curriculumthatisapplicabletooneormoreexistinggraduateprograms.Thetotalnumberofcredithoursmust
notequalorexceedthenumberofcredithoursestablishedfortheDegreeProgram(s).Concentrationsmustbe
approvedbytheDepartment(orequivalent),College,andGraduateCouncil.Concentrationsarelistedona
studentstranscript,butnotonthediploma.AlsoreferenceBOGRegulation6C8.011.

Example:AdultEducation

FullExample:
DoctorofPhilosophy(Ph.D.)inCurriculumandInstruction(program)
withaConcentrationinAdultEducation

USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

72

ListofAuthorizedDegreesGraduateandProfessionalProgramsByDegreeandLevel
DegreeCode

DegreeDescription GraduateandProfessionalPrograms
OfferedUnderThatDegree
(MedicalProfessionalprogramsnotedwith*)
MASTERSDEGREES
M.A. MasterofArts AdultEducation
AmericanStudies
AppliedAnthropology
AppliedBehaviorAnalysis
ArtHistory
AutismSpectrumDisordersandSevereIntellectual
Disabilities
BusinessEconomics(beingterminated)
CareerandTechnicalEducation
Chemistry(nonthesisoption)
Communication
CounselorEducation
CriminalJusticeAdministration
Criminology
EarlyChildhoodEducation
Economics
ElementaryEducation
English
EnglishEducation
ExceptionalStudentEducation
ForeignLanguageEducation
French
Geography
Gerontology
GlobalSustainability
History
LatinAmerican,CaribbeanandLatinoStudies
LiberalArts
LibraryandInformationScience
Linguistics
Linguistics:EnglishasaSecondLanguage
MassCommunications
Mathematics
MathematicsEducation
MusicEducation
Philosophy
PhysicalEducation
PoliticalScience
Psychology
ReadingEducation
RehabilitationandMentalHealthCounseling(Post
Baccalaureate)
ReligiousStudies
SchoolPsychology
ScienceEducation
SocialScienceEducation
Sociology
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

73

DegreeCode

DegreeDescription GraduateandProfessionalPrograms
OfferedUnderThatDegree
(MedicalProfessionalprogramsnotedwith*)
Spanish
SpecialEducation,BehaviorDisorders
SpecialEducation,Gifted
SpecialEducation,IntellectualDisabilities
SpecialEducation,MotorDisabilities
SpecialEducation,SpecificLearningDisabilities
Statistics
Women'sStudies

M.A.B.M.H. MasterofArtsinBioethicsand
MedicalHumanities

BioethicsandMedicalHumanities
M.A.T. MasterofArtsinTeaching ElementaryEducation
EnglishEducation
ExceptionalStudentEducation
ForeignLanguageEducation
MathematicsEducation(612)
MiddleGradesMathematics
ScienceEducation
SocialScienceEducation

M.Acc. MasterofAccountancy

Accountancy
M.Arc. MasterofArchitecture

Architecture
M.B.A. MasterofBusinessAdministration

BusinessAdministration
ExecutiveMBA
M.C.E. MasterofCivilEngineering

CivilEngineering
M.C.H.E. MasterofChemicalEngineering

ChemicalEngineering
M.E. MasterofEngineering

ChemicalEngineering
MechanicalEngineering
M.E.V.E. MasterofEnvironmentalEngineering

EnvironmentalEngineering
M.Ed. MasterofEducation

CurriculumandInstruction
EducationalLeadership
M.F.A. MasterofFineArts

Art
CreativeWriting

M.H.A. MasterofHealthAdministration HealthAdministration


M.I.E. MasterofIndustrialEngineering

IndustrialEngineering
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

74

DegreeCode

DegreeDescription GraduateandProfessionalPrograms
OfferedUnderThatDegree
(MedicalProfessionalprogramsnotedwith*)
M.M. MasterofMusic Music
M.M.E. MasterofMechanicalEngineering

MechanicalEngineering
M.P.A. MasterofPublicAdministration

PublicAdministration
M.P.A.S. MasterofPhysicianAssistantStudies PhysicianAssistantStudies*(NEW)
M.P.H. MasterofPublicHealth

PublicHealth
M.S. MasterofScience Audiology(PostBaccalaureate)
Aural(Re)Habilitation(PostBaccalaureate)
Biology
Chemistry
EngineeringScience(5yearprogram)
EntrepreneurshipinAppliedTechnologies
EnvironmentalScienceandPolicy
ExerciseScience(NEW)
Finance
Geology
Management
ManagementInformationSystems
MarineScience
Microbiology
Nursing
Physics
SpeechLanguagePathology(postBacc)
SportandEntertainmentManagement(NEW)
M.S.B. MasterofScienceinBiotechnology

Biotechnology
M.S.B.C.B. MasterofScienceinBioinformatics&
ComputationalBiology

BioinformaticsandComputationalBiology
M.S.B.E. MasterofScienceinBiomedical
Engineering

BiomedicalEngineering
M.S.C.E. MasterofScienceinCivilEngineering

CivilEngineering
M.S.C.H. MasterofScienceinChemical
Engineering

ChemicalEngineering
M.S.C.P. MasterofScienceinComputer
Engineering

ComputerEngineering
M.S.C.S. MasterofScienceinComputerScience

ComputerScience
M.S.E.E. MasterofScienceinElectrical
Engineering
ElectricalEngineering
M.S.E.M. MasterofScienceinEngineering
Management
EngineeringManagement
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

75

DegreeCode

DegreeDescription GraduateandProfessionalPrograms
OfferedUnderThatDegree
(MedicalProfessionalprogramsnotedwith*)

M.S.E.S. MasterofScienceinEngineering
Science

BiomedicalEngineering
ChemicalEngineering
CivilEngineering
ElectricalEngineering
EngineeringScience(5yearprogram)
EnvironmentalEngineering
MechanicalEngineering
M.S.E.V. MasterofScienceinEnvironmental
Engineering

EnvironmentalEngineering
M.S.H.I. MasterofScienceinHealth
Informatics
HealthInformatics(NEW)
M.S.I.E. MasterofScienceinIndustrial
Engineering

IndustrialEngineering
M.S.M. MasterofScienceinMarketing

Marketing
M.S.M.E. MasterofScienceinMechanical
Engineering

MechanicalEngineering
M.S.M.S. MasterofScienceinMedicalSciences

MedicalSciences
M.S.M.S.E. MasterofScienceinMaterialsScience
andEngineering
MaterialsScienceandEngineering
M.S.P.H. MasterofScienceinPublicHealth

PublicHealth
M.S.R.E. MasterofScienceinRealEstate

RealEstate
M.S.W. MasterofSocialWork

SocialWork
M.U.C.D. MasterofUrbanandCommunity
Design

UrbanandCommunityDesign
M.U.R.P. MasterofUrban&RegionalPlanning

UrbanandRegionalPlanning

EDUCATIONSPECIALISTDEGREES
Ed.S.

EducationSpecialist

CurriculumandInstruction
EducationalLeadership

DOCTORATEDEGREES
Au.D. DoctorofAudiology

Audiology
D.N.P. DoctorofNursingPractice

Nursing
D.P.T. DoctorofPhysicalTherapy* PhysicalTherapy*
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

76

DegreeCode

DegreeDescription GraduateandProfessionalPrograms
OfferedUnderThatDegree
(MedicalProfessionalprogramsnotedwith*)
Dr.P.H. DoctorofPublicHealth

PublicHealth
Ed.D. DoctorofEducation

EducationalProgramDevelopment
M.D. DoctorofMedicine Medicine*
Pharm.D. DoctorofPharmacy Pharmacy**
Ph.D. DoctorofPhilosophy AgingStudies
AppliedAnthropology
BiomedicalEngineering
BusinessAdministration
CancerBiology
CellandMolecularBiology(NEW)
ChemicalEngineering
Chemistry
CivilEngineering
Communication
CommunicationSciencesandDisorders
ComputerScienceandEngineering
Criminology
CurriculumandInstruction
Economics
EducationalLeadership
ElectricalEngineering
EngineeringScience
EnvironmentalEngineering(NEW)
English
GeographyandEnvironmentalScienceandPolicy
Geology
Government
History
IndustrialEngineering
IntegrativeBiology(NEW)
MarineScience
Mathematics
MechanicalEngineering
MedicalSciences
Music
NursingScience
Philosophy
Physics,Applied
Psychology
PublicHealth
SchoolPsychology
SecondLanguageAcquisitionandInstructional
Technology
SocialWork
Sociology
Listisaccurateasof7/6/13.Toviewthemostcurrentlistandavailableconcentrationareaswithinthedegree
programsgoto:http://www.grad.usf.edu/programs.php
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

77

ListofAuthorizedGraduateandProfessionalDegreeProgramsByProgram

(MedicalProfessionalProgramsnotedwith*)
MASTERSPROGRAMS DEGREE DEGREEDESCRIPTION CONCENTRATIONS
1. Accountancy M.Acc. MasterofAccountancy Audit/Systems
Tax
2. AdultEducation M.A. MasterofArts HumanResourceDevelopment
3. AmericanStudies M.A. MasterofArts
4. AppliedAnthropology M.A. MasterofArts ArchaeologicalandForensicScience
BioCulturalMedicalAnthropology
CulturalResourceManagement
HeritageStudies
5. AppliedBehaviorAnalysis M.A. MasterofArts
6. Architecture M.Arc. MasterofArchitecture
7. Art M.F.A. MasterofFineArts
8. ArtHistory M.A. MasterofArts
9. Audiology(PostBacc) M.S. MasterofScience
10. Aural(Re)Habilitation(PostBacc) M.S. MasterofScience
11. AutismSpectrumDisordersandSevere
IntellectualDisabilities
M.A. MasterofArts
12. BioethicsandMedicalHumanities M.A.B.M.H. MasterofArtsinBioethics
andMedicalHumanities
13. BioinformaticsandComputational
Biology
M.S.B.C.B. MasterofSciencein
Bioinformatics&
ComputationalBiology
14. Biology M.S. MasterofScience CellBiology,Microbiology&Molecular
Biology
EcologyandEvolution
EnvironmentalandEcologicalMicrobiology
PhysiologyandMorphology
15. BiomedicalEngineering M.S.B.E. MasterofSciencein
BiomedicalEngineering
16. BiomedicalEngineering M.S.E.S. MasterofSciencein
EngineeringScience
17. Biotechnology M.S.B. MasterofSciencein
Biotechnology
18. BusinessAdministration M.B.A. MasterofBusiness
Administration
SportBusiness
19. BusinessEconomics(beingterminated) M.A. MasterofArts
20. CareerandTechnicalEducation M.A. MasterofArts
21. ChemicalEngineering M.C.H.E. Masterof Chemical
Engineering
BiomedicalandBiotechnology
22. ChemicalEngineering M.E. MasterofEngineering BiomedicalandBiotechnology
23. ChemicalEngineering M.S.C.H. MasterofSciencein
ChemicalEngineering
BiomedicalandBiotechnology
24. ChemicalEngineering M.S.E.S. MasterofSciencein
EngineeringScience
BiomedicalandBiotechnology
25. Chemistry M.S. MasterofScience AnalyticalChemistry
Biochemistry
ComputationalChemistry
EnvironmentalChemistry
InorganicChemistry
OrganicChemistry
PhysicalChemistry
PolymerChemistry
26. Chemistry(nonthesisoption) M.A. MasterofArts
27. CivilEngineering M.C.E. MasterofCivilEngineering Geotechnical
Materials
Structures
Transportation
WaterResources
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

78

28. CivilEngineering M.S.C.E. MasterofScienceinCivil
Engineering
Geotechnical
MastersInternationalProgram
Materials
Structures
Transportation
WaterResources
29. CivilEngineering M.S.E.S. MasterofSciencein
EngineeringScience
Geotechnical
MastersInternationalProgram
Materials
Structures
Transportation
WaterResources
30. Communication M.A. MasterofArts
31. ComputerEngineering M.S.C.P. MasterofSciencein
ComputerEngineering
32. ComputerScience M.S.C.S. MasterofSciencein
ComputerScience
33. CounselorEducation M.A. MasterofArts CareerCounseling
ClinicalMentalHealthCounseling
SchoolCounseling
34. CreativeWriting M.F.A. MasterofFineArts Fiction
Poetry
35. CriminalJusticeAdministration M.A. MasterofArts
36. Criminology M.A. MasterofArts
37. CurriculumandInstruction M.Ed. MasterofEducation AdultEducation
CollegeStudentAffairs
EarlyChildhoodEducation
EducationalStudies
ElementaryEducation
InterdisciplinaryEducation
MeasurementandEvaluation
MiddleSchoolEducation(General)
MiddleSchoolEducation,English
MiddleSchoolEducation,Mathematics
MiddleSchoolEducation,Science
MiddleSchoolEducation,SocialStudies
ReadingEducation
SecondaryEducation
SecondaryEducation:Biology
SecondaryEducation:Chemistry
SecondaryEducation:English
SecondaryEducation:ForeignLanguage
SecondaryEducation:Instruct.Technology
SecondaryEducation:Mathematics
SecondaryEducation:Physics
SecondaryEducation:SocialScience
SecondaryEducation:TESOL
SpecialEducation,BehaviorDisorders
SpecialEducation,Gifted
SpecialEducation,MentalRetardation
SpecialEducation,MotorDisabilities
SpecialEducation,SpecificLearning
Disabilities
38. EarlyChildhoodEducation M.A. MasterofArts
39. Economics M.A. MasterofArts
40. EducationalLeadership M.Ed. MasterofEducation
41. ElectricalEngineering M.S.E.E. MasterofSciencein
ElectricalEngineering
Circuits,ControlsandSystems
CommunicationsandSignalProcessing
DigitalArchitectureandDesign
ElectricPowerSystems
Microelectronics
WirelessCircuitsandSystems
42. ElectricalEngineering M.S.E.S. MasterofSciencein
EngineeringScience
Circuits,ControlsandSystems
CommunicationsandSignalProcessing
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

79

DigitalArchitectureandDesign
ElectricPowerSystems
Microelectronics
WirelessCircuitsandSystems
43. ElementaryEducation M.A. MasterofArts EarlyChildhood
ElementaryCurriculum
LanguageArts
ScienceandMathematics
44. ElementaryEducation M.A.T. MasterofArtsinTeaching
45. EngineeringManagement M.S.E.M. MasterofSciencein
EngineeringManagement
46. EngineeringScience(5yearprogram) M.S.E.S. MasterofSciencein
EngineeringScience
47. English M.A. MasterofArts Literature
RhetoricandComposition
48. EnglishEducation M.A. MasterofArts
49. EnglishEducation M.A.T. MasterofArtsinTeaching
50. EntrepreneurshipinApplied
Technologies
M.S. MasterofScience
51. EnvironmentalEngineering M.E.V.E. MasterofEnvironmental
Engineering
52. EnvironmentalEngineering M.S.E.S. MasterofSciencein
EngineeringScience
MastersInternationalProgram

53. EnvironmentalEngineering M.S.E.V. MasterofSciencein


EnvironmentalEngineering
MastersInternationalProgram

54. EnvironmentalScienceandPolicy M.S. MasterofScience


55. ExceptionalStudentEducation M.A. MasterofArts
56. ExceptionalStudentEducation M.A.T. MasterofArtsinTeaching
57. ExecutiveMBAProgram M.B.A. MasterofBusiness
Administration
58. ExerciseScience(NEW) M.S. MasterofScience HealthandWellness
StrengthandConditioning
59. Finance M.S. MasterofScience
60. ForeignLanguageEducation M.A. MasterofArts French
German
Spanish
61. ForeignLanguageEducation M.A.T. MasterofArtsinTeaching Chinese
French
German
Italian
Japanese
Latin
Russian
Spanish
62. French M.A. MasterofArts
63. Geography M.A. MasterofArts EnvironmentalGeography
GeographicInformationScienceandSpatial
Analysis
HumanGeography
64. Geology M.S. MasterofScience
65. Gerontology M.A. MasterofArts
66. GlobalSustainability M.A. MasterofArts Entrepreneurship
SustainableTourism
Water
67. HealthAdministration M.H.A. MasterofHealth
Administration
68. HealthInformatics(NEW) M.S.H.I. MasterofScienceinHealth
Informatics
69. History M.A. MasterofArts AmericanHistory
AncientHistory
EuropeanHistory
LatinAmericanHistory
MedievalHistory
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

80

70. IndustrialEngineering M.I.E. MasterofIndustrial
Engineering
71. IndustrialEngineering M.S.I.E. MasterofSciencein
IndustrialEngineering
72. LatinAmerican,CaribbeanandLatino
Studies
M.A. MasterofArts
73. LiberalArts M.A. MasterofArts AfricanaStudies
FilmStudies
Humanities
SocialandPoliticalThought
74. LibraryandInformationScience M.A. MasterofArts
75. Linguistics M.A. MasterofArts
76. Linguistics:EnglishasaSecondLanguage M.A. MasterofArts
77. Management M.S. MasterofScience
78. ManagementInformationSystems M.S. MasterofScience
79. MarineScience M.S. MasterofScience BiologicalOceanography
ChemicalOceanography
GeologicalOceanography
Interdisciplinary
MarineResourceAssessment
PhysicalOceanography
80. Marketing M.S.M. MasterofSciencein
Marketing
81. MassCommunications M.A. MasterofArts MediaStudies
MultimediaJournalism
StrategicCommunicationManagement
82. MaterialsScienceandEngineering M.S.M.S.E. MasterofSciencein
MaterialsScienceand
Engineering
83. Mathematics M.A. MasterofArts PureandApplied
84. MathematicsEducation M.A. MasterofArts
85. MathematicsEducation(612) M.A.T. MasterofArtsinTeaching
86. MechanicalEngineering M.E. MasterofEngineering
87. MechanicalEngineering M.M.E. MasterofMechanical
Engineering
88. MechanicalEngineering M.S.E.S. MasterofSciencein
EngineeringScience
89. MechanicalEngineering M.S.M.E. MasterofSciencein
MechanicalEngineering
90. MedicalSciences M.S.M.S. MasterofScienceinMedical
Sciences
AgingandNeuroscience
Anatomy
AthleticTraining
Biochemistry&MolecularBiology
ClinicalandTranslationalResearch
HealthInformatics
HealthScience
InterdisciplinaryMedicalSciences
MedicalMicrobiologyandImmunology
MetabolicandNutritionalMedicine
MolecularMedicine
Women'sHealth
91. Microbiology M.S. MasterofScience
92. MiddleGradesMathematics M.A.T. MasterofArtsinTeaching
93. Music M.M. MasterofMusic ChamberMusic
Composition
Conducting
ElectroAcousticMusic
JazzComposition
JazzPerformance
Performance
PianoPedagogy
Theory
94. MusicEducation M.A. MasterofArts
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

81

95. Nursing M.S. MasterofScience AdultGerontologyAcuteCareNursing
AdultGerontologyPrimaryCare/
OccupationalHealthNursingDual
AdultGerontologyPrimaryCareNursing
AdultGerontologyPrimaryCare/Oncology
NP
ClinicalNurseLeader
FamilyHealthNursing
NurseAnesthesia
NursingEducation
AdultGerontologyPrimaryCare/
OccupationalHealthNursingDual
AdultGerontologyPrimaryCare/Oncology
NursingDual
PediatricHealthNursing
PsychiatricMentalHealthNursing
96. Philosophy M.A. MasterofArts PhilosophyandReligion
97. PhysicalEducation M.A. MasterofArts
98. PhysicianAssistantStudies*(NEW) M.P.A.S. MasterofPhysician
AssistantStudies
99. Physics M.S. MasterofScience AppliedPhysics
AtmosphericPhysics
AtomicandMolecularPhysics
LaserPhysics
MaterialsPhysics
MedicalPhysics
OpticalPhysics
SemiconductorPhysics
SolidStatePhysics
100. PoliticalScience M.A. MasterofArts
101. Psychology M.A. MasterofArts ClinicalPsychology
Cognition,Neuroscience&Social
Psychology
IndustrialOrganizationalPsychology
102. PublicAdministration M.P.A. MasterofPublic
Administration
ExecutivePublicAdministration
103. PublicHealth M.P.H. MasterofPublicHealth AcceleratedHealthEd.(OnlyBS/MSPH)
BehavioralHealth
Biostatistics
EnvironmentalHealth
Epidemiology
EpidemiologyandBiostatistics
EpidemiologyandGlobalCommunicable
Disease
EpidemiologyandGlobalHealth
EpidemiologyandMaternal&ChildHealth
ExecutiveProgramforHealthProfessionals
GlobalCommunicableDisease
GlobalDisasterManagementand
HumanitarianRelief
GlobalHealthPractice
HealthCareOrganizationsand
Management
HealthPoliciesandPrograms
HealthSafety&Environment
InfectionControl
MaternalandChildHealth
OccupationalHealth
OccupationalSafety
PublicHealthAdministration
PublicHealthEducation
PublicHealthPractice
PublicHealthPracticeProgram
SocioHealthSciences
ToxicologyandRiskAssessment
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

82

104. PublicHealth

M.S.P.H. MasterofScienceinPublic
Health

BehavioralHealth
Bioinformatics
Biostatistics
EnvironmentalHealth
Epidemiology
GlobalCommunicableDisease
IndustrialHygiene
InternationalPublicHealthResearch,Policy
andPlanning
MaternalandChildHealth
OccupationalHealth
OccupationalMedicineResidency
OccupationalSafety
PublicHealthEducation
SocioHealthSciences
ToxicologyandRiskAssessment
105. ReadingEducation M.A. MasterofArts
106. RealEstate M.S.R.E. MasterofScienceinReal
Estate
107. RehabilitationandMentalHealth
Counseling(PostBaccalaureate)
M.A. MasterofArts AddictionsandSubstanceAbuse
Counseling
MarriageandFamilyTherapy
108. ReligiousStudies M.A. MasterofArts
109. SchoolPsychology M.A. MasterofArts
110. ScienceEducation M.A. MasterofArts Biology
Chemistry
Physics
111. ScienceEducation M.A.T. MasterofArtsinTeaching Biology
Chemistry
Earth&SpaceScience
Physics
112. SocialScienceEducation M.A. MasterofArts
113. SocialScienceEducation M.A.T. MasterofArtsinTeaching
114. SocialWork M.S.W. MasterofSocialWork
115. Sociology M.A. MasterofArts
116. Spanish M.A. MasterofArts
117. SpecialEducation,BehaviorDisorders M.A. MasterofArts
118. SpecialEducation,Gifted M.A. MasterofArts
119. SpecialEducation,Intellectual
Disabilities
M.A. MasterofArts
120. SpecialEducation,MotorDisabilities M.A. MasterofArts
121. SpecialEducation,SpecificLearning
Disabilities
M.A. MasterofArts
122. SpeechLanguagePathology(PostBacc) M.S. MasterofScience
123. SportandEntertainmentManagement
(NEW)
M.S. MasterofScience
124. Statistics M.A. MasterofArts
125. UrbanandCommunityDesign M.U.C.D. MasterofUrbanand
CommunityDesign
126. UrbanandRegionalPlanning M.U.R.P. MasterofUrban&Regional
Planning
127. Women'sandGenderStudies M.A. MasterofArts

*TheMPASisofferedthroughtheMorsaniCollegeofMedicine

USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

83

EDUCATIONSPECIALISTPROGRAMS DEGREE DEGREEDESCRIPTION
CurriculumandInstruction Ed.S. EducationSpecialist AdultEducation
CounselorEducation
EarlyChildhoodEducation
ElementaryEducation
HigherEd,Administration
HigherEd,CollegeTeaching
InstructionalTechnology
InterdisciplinaryEducation
MathematicsEducation
MeasurementandEvaluation
ReadingandLanguageArtsEducation
SchoolPsychology
ScienceEducation
SpecialEducation
VocationalEducation
EducationalLeadership Ed.S. EducationSpecialist

DOCTORATEPROGRAMS DEGREE DEGREEDESCRIPTION


1. AgingStudies Ph.D. DoctorofPhilosophy
2. AppliedAnthropology Ph.D. DoctorofPhilosophy ArchaeologicalandForensicScience
BioCulturalMedicalAnthropology
CulturalResourceManagement
HeritageStudies
3. AppliedBehaviorAnalysis(NEW) Ph.D. DoctorofPhilosophy
4. Audiology Au.D. DoctorofAudiology
5. BiomedicalEngineering Ph.D. Doctor ofPhilosophy
6. BusinessAdministration Ph.D. DoctorofPhilosophy Accounting
Finance
InformationSystems
Marketing
7. CancerBiology Ph.D. DoctorofPhilosophy
8. CellandMolecularBiology(NEW) Ph.D. DoctorofPhilosophy
9. ChemicalEngineering Ph.D. DoctorofPhilosophy BiomedicalandBiotechnology
Manufacturing
10. Chemistry Ph.D. DoctorofPhilosophy AnalyticalChemistry
Biochemistry
ComputationalChemistry
EnvironmentalChemistry
InorganicChemistry
OrganicChemistry
PhysicalChemistry
PolymerChemistry
11. CivilEngineering Ph.D. DoctorofPhilosophy EnvironmentalEngineering
Geotechnical
InterdisciplinaryTransportation
Materials
Structures
Transportation
WaterResources
12. Communication Ph.D. DoctorofPhilosophy
13. CommunicationSciencesandDisorders Ph.D. DoctorofPhilosophy HearingSciencesandAudiology
NeurocommunicativeSciences
SpeechLanguageSciences
14. ComputerScienceandEngineering Ph.D. DoctorofPhilosophy
15. Criminology Ph.D. DoctorofPhilosophy
16. CurriculumandInstruction Ph.D. DoctorofPhilosophy AdultEducation
CareerandWorkforceEducation
CounselorEducation
EarlyChildhoodEducation
EducationalPsychology
ElementaryEducation
EnglishEducation
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

84

HigherEd,Administration
HigherEd,CommunityCollegeTeaching
InstructionalTechnology
InterdisciplinaryEducation
LiteracyStudies
MathematicsEducation
MeasurementandEvaluation
ScienceEducation
SecondaryEducation
SocialScienceEducation
SpecialEducation
StudentAffairsAdministration
TeachingandLearningintheContentArea:
GeneralEducation
17. Economics Ph.D. DoctorofPhilosophy
18. EducationalLeadership Ph.D. DoctorofPhilosophy
19. EducationalProgramDevelopment Ed.D. DoctorofEducation AdministrationofSpecialEducation
AdultEducation
ElementaryEducation
VocationalEducation
20. ElectricalEngineering Ph.D. DoctorofPhilosophy Circuits,ControlsandSystems
CommunicationsandSignalProcessing
DigitalArchitectureandDesign
ElectricPowerSystems
Microelectronics
WirelessCircuitsandSystems
21. EngineeringScience Ph.D. DoctorofPhilosophy
22. English Ph.D. DoctorofPhilosophy Literature
RhetoricandComposition
23. EnvironmentalEngineering(NEW) Ph.D. DoctorofPhilosophy
24. GeographyandEnvironmentalScience
andPolicy
Ph.D. DoctorofPhilosophy
25. Geology Ph.D. DoctorofPhilosophy
26. Government Ph.D. DoctorofPhilosophy
27. History Ph.D. DoctorofPhilosophy
28. IndustrialEngineering Ph.D. DoctorofPhilosophy
29. IntegrativeBiology(NEW) Ph.D. DoctorofPhilosophy EcologyandEvolution
EnvironmentalandEcologicalMicrobiology
PhysiologyandMorphology
30. MarineScience Ph.D. DoctorofPhilosophy BiologicalOceanography
ChemicalOceanography
GeologicalOceanography
Interdisciplinary
MarineResourceAssessment
PhysicalOceanography
31. Mathematics Ph.D. DoctorofPhilosophy PureandApplied
Statistics
32. MechanicalEngineering Ph.D. DoctorofPhilosophy Manufacturing
33. MedicalSciences Ph.D. DoctorofPhilosophy Allergy,ImmunologyandInfectiousDisease
Anatomy
Biochemistry&MolecularBiology
ClinicalandTranslationalResearch
MicrobiologyandImmunology
MolecularMedicine
MolecularPharmacologyandPhysiology
Neuroscience
PathologyandCellBiology
PathologyandLaboratoryMedicine
PharmacologyandTherapeutics
PhysiologyandBiophysics
34. Medicine* M.D. DoctorofMedicine
35. Music Ph.D. DoctorofPhilosophy MusicEducation
36. Nursing D.N.P. DoctorofNursingPractice AdultGerontologyPrimaryCare(NDP)
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

85

AdultGerontology/OccupationalHealth
(NAO)
FamilyHealth
NursingPractice
Oncology/AdultGerontologyPrimaryCare
(Dual)
PediatricHealth
37. NursingScience Ph.D. DoctorofPhilosophy
38. Pharmacy* PharmD. DoctorofPharmacy
39. Philosophy Ph.D. DoctorofPhilosophy PhilosophyandReligion
40. PhysicalTherapy* D.P.T. DoctorofPhysicalTherapy
41. Physics,Applied Ph.D. DoctorofPhilosophy
42. Psychology Ph.D. DoctorofPhilosophy ClinicalPsychology
Cognition,Neuroscience&Social
Psychology
IndustrialOrganizationalPsychology
43. PublicHealth Dr.P.H. DoctorofPublicHealth
44. PublicHealth

Ph.D. DoctorofPhilosophy Biostatistics


CommunityandFamilyHealth
EnvironmentalandOccupationalHealth
EnvironmentalHealth
Epidemiology
GlobalCommunicableDisease
HealthServicesResearch
IndustrialHygiene
OccupationalHealthforHealth
Professionals
ToxicologyandRiskAssessment
45. SchoolPsychology Ph.D. DoctorofPhilosophy
46. SecondLanguageAcquisitionand
InstructionalTechnology
Ph.D. DoctorofPhilosophy
47. SocialWork Ph.D. DoctorofPhilosophy
48. Sociology Ph.D. DoctorofPhilosophy

TheM.D.isofferedthroughtheMorsaniCollegeofMedicine;theD.P.T.isofferedthroughtheSchoolofPhysicalTherapy;the
PharmD.IsofferedthroughtheCollegeofPharmacy.
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

86

AcceleratedGraduateDegreePrograms

AcceleratedProgramsallowforastudenttocompletetheundergraduateandgraduatedegreeonanaccelerated
timeline.StudentsmustapplyforacceptanceintoanAcceleratedProgram,andthenmustfileaProgressionForm
tomoveintograduatestudentstatus.MoreinformationandtheApplicationandProgressionFormsareavailable
onlineat:http://www.grad.usf.edu/accelerated.php

The following lists some of the Accelerated Graduate Degree Programs offered through USFTampa. New
acceleratedprogramsmayhavebeenapprovedsincethepublicationofthislist,othersmaynowbeinactive.Fora
currentlist,refertothewebsiteaboveorcontacttheprogramofinterest.Atthetimeofpublicationtherewere20
AcceleratedGraduateDegreePrograms.

NameofProgram(Major)or
Concentration(Specialization)
Program
College(s)
Degree ProgramInformation
1. Architecture SACD M.Arc. 6YearProgram
2plus4acceleratedtotheM.Arc.degree
2. ArtsandSciences
Business

CAS
COB
BAor
BS/MBA
5YearProgram
3plus2maybemappedtomostUGdepartmentsin
ASandawardsaBAorBS&MBAsimultaneously
3. Biology CAS B.S./M.S.in
CMMB
5YearProgram
3plus2awardssimultaneousdegrees
4. Business
HonorsCollege
COB
Honors
B.A./
M.B.A. 5YearProgram
5. BusinessEconomicsbeingterminated COB BA/MA 5YearProgram
6. Chemistry

CAS BA/MA 5YearProgram


3plus2awardssimultaneousdegrees
7. Engineering COEN M.E.,M.S. 5YearProgram
3plus2maybemappedtoanyEngineering
departmentandtheBachelorsdegreemaybe
awardedoncedegreerequirementscompleted
8. EnvironmentalScienceandPolicy
PublicHealth
CAS
COPH
BS/MPHor
MSPH
3plus2BSandMPHorMSPH
9. ManagementInformationSystems COB BS/MS
10. Mathematics CAS BA/MA 5YearProgram
3plus2awardssimultaneousdegrees
11. Medicine
HonorsCollege
COMHonors
College
BA/M.D. 7YearProgram Medicinehasanacceleratedprogram
agreementwiththeHonorsCollege.TheBAis
awardedafterthe4
th
yearthenthestudent
acceleratestothe2
nd
yearasamedicalstudent.
12. Medicine
MedicalSciences
COM M.D./Ph.D. Ph.D.PlusProgram
13. Microbiology CAS BS/MS 5YearProgram
3plus2acceleratestoMS
14. Nursing CON BS/MS 5YearProgram
UGwithanASinnursingprogressingtowardtheMSin
nursingBS/MSsimultaneousdegrees
15. Nursing:NursingEducationConc. CON M.S. 5 YearProgram/Concentration
16. PublicHealth COPH BS/MPH
BS/MSPH
5YearProgram ConcentrationsinPublicHealth
EducationadmitsUGstudentsat90hours,PHC,and
acceleratestothemasterdegree
17. RehabilitationandMentalHealth
Counseling
CBCS

B.A/M.A. 5YearProgram
3plus2acceleratestotheMA
18. SchoolofPhysicalTherapy
HonorsCollege
COM
Honors
B.A./
D.P.T.
6YearProgram
19. SpecialEducation,Varying
Exceptionalities
COED BS/MA 5YearProgram
3plus2awardssimultaneousdegrees
20. SpeechPathologyINACTIVE CBCS M.S. 5YearProgram plus2acceleratestotheMS
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

87

DualDegreePrograms

Reference:Section7AcademicPoliciessectiononDualDegreeDesignationfortheofficialpolicy.
The following lists some of the formalized Dual Degree Programs offered through the University of South Florida. New Dual
Degreeprogramsmayhavebeenapprovedsincethepublicationofthislist;othersmaynowbeclosedtonewadmissions.Ifthe
program you are interested in is not listed below, contact the program of interest to see if your program qualifies for a Dual
Degreeoption.Informationaboutthedegreerequirementsforthesedualdegreesmaybefoundinthecorrespondingcollege
sectionsoftheCatalog.ToapplyforaDualDegreeProgramDesignationstudentsmustcompletetheDualDegreeApplication,
availableonlineat:http://www.grad.usf.edu/studentforms.php.Atthetimeofpublicationtherewereeighteen(18formalized
Dual Degree Programs, Dual Concentrations, and combined programs. Some Colleges also offer Dual Concentrations. For
informationonthese,checktheCollegeSectionsoftheCatalogorcontacttheCollege.

Eachislistedtwice,onceundereachprogram.
DualDegreePrograms Effective College(s)
AppliedAnthropology(M.A.) PublicHealth(M.P.H.) n/a ArtsandSciences
PublicHealth
AppliedAnthropology(Ph.D.) PublicHealth(M.P.H.) n/a ArtsandSciences
PublicHealth
Audiology(Au.D.) CommunicationSciencesand
Disorders(Ph.D.)
4/17/06 BehavioralandCommunity
Sciences
BiochemistryandMolecularBiology(Ph.D.)

PublicHealth(M.P.H.) 2003 Medicine


PublicHealth
BiomedicalEngineering(MSBE) EntrepreneurshipinApplied
Technologies(M.S.)
3/26/07 Engineering
Business
BiomedicalEngineering(PhD) Medicine(MD) 3/19/07 Engineering
Medicine
Biotechnology(M.S.B.) EntrepreneurshipinApplied
Technologies(M.S.)
9/15/08 Medicine
Business
BusinessAdministration(MBA) SportandEntertainment
Management(M.S.)
5/6/13 Business
CommunicationSciencesandDisorders(Ph.D.) Audiology(Au.D.) 4/17/06 BehavioralandCommunity
Sciences
Education(M.Ed.) ReligiousStudies(M.A.) n/a Education
ArtsandSciences
EntrepreneurshipinAppliedTechnologies(M.S.) BiomedicalEngineering(MSBE) 3/26/07 Engineering
Business
EntrepreneurshipinAppliedTechnologies(M.S.) Biotechnology(MSB) 9/15/08 Medicine
Business
EntrepreneurshipinAppliedTechnologies(M.S.)

GlobalSustainability(M.A.) n/a Business


GlobalSustainability
GlobalSustainability(M.A.) EntrepreneurshipinApplied
Technologies(M.S.)
n/a Business
GlobalSustainability
HealthAdministration(MHA) PublicHealth:
HealthPoliciesandPrograms(M.P.H.)
n/a PublicHealth
Law(J.D.) PublicHealth(MPH) 4/16/07 PublicHealth
StetsonLawSchool
Law(J.D.) Medicine(M.D.) 2007 Medicine
StetsonLawSchool
MedicalSciences(Ph.D.) Medicine(M.D.) 11/20/06 Medicine

Medicine(M.D.) BiomedicalEngineering(Ph.D.) n/a Engineering


Medicine
Medicine(M.D.) Law(J.D.) 2007 Medicine
StetsonLawSchool
Medicine(M.D.) MedicalSciences(Ph.D.) 11/20/06 Medicine
Medicine(MD) BiomedicalEngineering(PhD) 3/19/07 Engineering
Medicine
Nursing(M.S.) PublicHealth:Environmentaland
OccupationalHealth(MPH)

9/14/09 PublicHealth
USFTampaGraduateCatalog20132014 Section10Degrees,Programs,andConcentrations

88

DualDegreePrograms Effective College(s)
Nursing(M.S.) PublicHealth:OccupationalHealth
(M.P.H.)
10/27/99 Nursing
PublicHealth
PhysicalTherapy(D.P.T.) PublicHealth(M.P.H.) 10/17/05 Medicine
PublicHealth
PublicHealth(M.P.H.) BiochemistryandMolecularBiology
(Ph.D.)
2003 Medicine
PublicHealth
PublicHealth(M.P.H.) AppliedAnthropology(M.A.) ArtsandSciences
PublicHealth
PublicHealth(M.P.H.) AppliedAnthropology(Ph.D.) ArtsandSciences
PublicHealth
PublicHealth(M.P.H.) PhysicalTherapy(D.P.T.) 10/17/05 Medicine
PublicHealth
PublicHealth(M.P.H.) Law(J.D.) 4/16/07 PublicHealth
StetsonLawSchool
PublicHealth:OccupationalHealth(M.P.H.) Nursing(M.S.) 10/27/99 Nursing
PublicHealth
PublicHealth:EpidemiologyandBiostatistics
DualConcentration(M.P.H.)
PublicHealth:Epidemiologyand
Biostatistics(M.P.H.)
PublicHealth
PublicHealth:HealthPoliciesandPrograms(M.P.H.) HealthAdministration(M.H.A.) PublicHealth
PublicHealth:MaternalandChildHealthand(MPH) SocialWork(M.S.W.) BehavioralandCommunity
Sciences
PublicHealth
PublicHealth:EnvironmentalandOccupational
Health(MPH)
Nursing(M.S.) 9/14/09 PublicHealth
ReligiousStudies(M.A.) Education(MEd) Education
ArtsandSciences
SocialWork(M.S.W.) PublicHealth:
MaternalandChildHealthand
(M.P.H.)
BehavioralandCommunity
Sciences
PublicHealth

USFTampaGraduateCatalog20132014 Section11GraduateCertificates

89

Section11
GraduateCertificates

OfficeofGraduateCertificates

UniversityofSouthFlorida
4202E.FowlerAve.,SVC1072
Tampa,FL336208470

Webaddress: www.gradcerts.usf.edu
Emailaddress: askusf4you@usf.edu
Phone: 8139748031
Fax: 8139747061

Coordinator: KathyBarnes

CertificatesOffered

FollowingisanalphabeticallistofGraduateCertificatesofferedatUSF.Somecertificatesmaybecurrentlyinactive
and new certificates may now be available. For information about Graduate Certificates currently offered and
certificaterequirements,gototheGraduateCertificatewebsiteat:www.gradcerts.usf.edu

AddictionsandSubstanceAbuseCounseling
AfricanaStudies
AgingandNeuroscience
AnalyticsandBusinessIntelligence
AutismSpectrumDisorder(ASD)
BehavioralHealthCounseling*
BiochemistryandMolecularBiology
Bioinformatics
BiomedicalEthics
Biostatistics
Biotechnology
BusinessFoundations
CardiovascularEngineering
CareerCounseling*
ChildrensMentalHealth**
ClinicalInvestigation**
CollegeStudentAffairs
CollegeTeaching*
CommunityDesignandDevelopment
CommunityDevelopment
ComparativeLiteraryStudies
ConceptsandToolsofEpidemiology
CreativeWriting
CriminalJusticeAdministration*
CubanStudies
DiasporasandHealthDisparities
DigitalMusicEducation**
DisabilitiesEducation:Severeand/orProfound
DisasterManagement**
Diversity
Entrepreneurship*
EnvironmentalHealth
EnvironmentalPolicyandManagement
Epidemiology
ESOL**
Evaluation
ForeignLanguageEducation:Professional
ForeignLanguageEducation:CultureandContent
GenocideandHumanRights
GeographicalInformationSystems
GeriatricSocialWork/ClinicalGerontology
Gerontology
GiftedEducation**
GlobalHealthandLatinAmericanandCaribbean
Studies
GlobalHealthPractice
GlobalizationStudies
HealthCareRiskManagement&PatientSafety
HealthInformatics
HealthManagementandLeadership*
HealthSciences
HearingSpecialist:EarlyIntervention
Hospice,PalliativeCareandEndofLifeStudies
HumanitarianAssistance**
Hydrogeology
InfectionControl
USFTampaGraduateCatalog20132014 Section11GraduateCertificates

90

InstructionalTechnology:DistanceEducation**
InstructionalTechnology:FloridaDigitalEducator**
InstructionalTechnology:InstructionalDesign*
InstructionalTechnology:MultimediaDesign
InstructionalTechnology:WebDesign**
IntegratedSTEMEducationGrades69
IntellectualProperty
InterdisciplinaryTransportation
LatinAmerican&CaribbeanStudies
LeadershipinDevelopingHumanResources
MarriageandFamilyTherapy
MaterialsScienceandEngineering
MaternalChildHealthEpidemiology
MaternalandChildHealth
Mathematics
MedicalBiochemistry,Microbiology&Immunology
MedicineandGender
MentalHealthCounseling*
MentalHealthPlanning,Evaluationand
Accountability
MetabolicandNutritionalMedicine
MolecularMedicine
MultimediaJournalism*
MuseumStudies
Music
NonprofitManagement
NursingEducation
NursingandHealthcareInformatics*
OccupationalHealthNursing**
PharmacySciences**
PlanningforHealthyCommunities
PoliticalScience
PositiveBehaviorSupport
PostMastersClinicalNurseLeader
PostMastersinHigherEducationLeadership
PostMastersNursePractitioner
PostMaster'sEducationalLeadership(K12)
ProfessionalEngineeringExcellence(APEX)
PostMaster's:LibraryandInformationScience*
ProfessionalandTechnicalCommunication
PrograminNationalandCompetitiveIntelligence
PublicHealthGeneralist**
PublicHealthPolicyandPrograms**
PublicManagement
Reading*
RegulatoryAffairsMedicalDevices**
RehabilitationTechnology
ResearchAdministration
ResearchMethods*
SafetyManagement
SchoolCounselingPostMasters
SchoolLibraryMediaSpecialist*
SocialMarketing&PublicHealth
SocialScienceEducation
StatisticalDataAnalysis
SystemsEngineering**
TeacherLeadership
TeachingComposition
TeachingEnglishasaSecondLanguage(TESL)
TechnologyManagement**
TotalQualityManagement**
TransportationSystemsAnalysis**
ViolenceandInjury:PreventionandIntervention
Water,HealthandSustainability
WirelessEngineering**
Women'sHealth
Women'sandGenderStudies

*Partiallyonline
**Fullyonline

GraduateCertificatePolicies

Theareasofstudyforthegraduatecertificatesarecreatedwithinthemissionofgraduateeducation.Studentswill
be awarded certificates upon completion of specific course work, which has been approved by the Graduate
Council.ThegraduatecertificateisnotdefinedasadegreebytheOfficeofGraduateStudies;rather,itisafocused
collectionofcoursesthat,whencompleted,affordsthestudentsomerecordofdistinctacademicaccomplishment
inagivendisciplineorsetofrelateddisciplines.Moreover,thegraduatecertificateisnotviewedasaguaranteed
meansofentryintoagraduatedegreeprogram.Whilethecoursescomprisingagraduatecertificatemaybeused
as evidence in support of a students application for admission to a degree program, the certificate itself is not
consideredtobeaprerequisite.

ProcessofApprovalforNewGraduateCertificates
Proposals for new areas of study for graduate certificates are created and submitted by the academic unit that
wishes to offer such a certificate. Proposals must be accompanied by endorsement from the department heads
and deans of the colleges/schools in which the contributing course work is offered as well as from the academic
unit or units whose students or degree programs could be impacted by the creation of the graduate certificate.
USFTampaGraduateCatalog20132014 Section11GraduateCertificates

91

The Graduate Council will consider all the proposals for new graduate certificates to assure proposal guidelines
have been followed and that repetition and redundancy across areas of study for certificates are not evident.
ThosemeetingthecriteriasetforthbyGraduateCouncilwillthenberecommendedtotheProvostforapproval.

CriteriaforApproval
The general principles applied to the assessment of the academic quality of proposals for new graduate areas of
studyforcertificateinclude:

1. Theproposedsequenceofcourseworkmustofferaclearandappropriateeducationalobjectiveatthe
postbaccalaureatelevel.

2. Theproposedcurriculumwillachieveitseducationalobjectiveinanefficientandwelldefinedmanner.

3. Aperceivedneedforsuchacertificateshouldexist.Thisprovisionmightbedefinedintermsofeither
externalmarkets(i.e.,externaldemandfortheskillsassociatedwithsuchacertificate)orinternal
academicmeans(i.e.,theneedforacriticalmassofstudentsinagivendiscipline).

4. Anappropriatenumberofcredithoursmustcomprisetheareaofstudyforthecertificate.Thenumberof
graduatecreditscannotbelessthannine(9)ormorethanonehalfofthecreditsnecessaryforarelated
mastersdegreefromtheOfficeofGraduateStudies.

5. Iftheareaofstudyforacertificaterequiresnewcourses,thosecoursesmustbeapprovedbythe
appropriateCollegebodiesorofficesandtheGraduateCouncil.

StudentEligibilityandAdmissionCriteria
Student must apply and be accepted into the graduate certificate area of study to be eligible to receive a
certificate. The prerequisites and general criteria of eligibility for admission to any graduate certificate area of
studyinclude:

1. Anearnedbaccalaureatedegreeoritsequivalentfromaregionallyaccreditedcollegeoruniversityor
enrollmentinaUSFfiveyearacademicprogramisrequired.Studentsinfiveyearacademicprogramsmay
beadmitteduponcompletionof120semesterhours.

2. Eachgraduateareaofstudysetstherequirementsforadmission,includingminimumgradepointaverage,
standardizedtestscores,andothersimilarcriteriaaspartoftheapplication.However,prospective
nondegreeseekinggraduatecertificatestudentsmustmeetUniversitygraduateadmissionsgradepoint
averagerequirements.

Students who wish to pursue a graduate certificate must apply to the Graduate Certificate Office
(www.gradcerts.usf.edu) and be admitted to the certificate area. Students are encouraged to contact the
coordinatorpriortoapplying.

NonDegreeSeekingStudents
Allnondegreeseekingstudentswhowishtopursueapprovedgraduatecertificatesshouldapplyfor
admissiontothecertificatethroughtheGraduateCertificateOffice(www.gradcerts.usf.edu)assoon
aspossibleformaximumbenefit,butmustapplytothecertificateandcompleterequiredcoursework
within five years of taking the first course applicable to the certificate. Students must submit a
CompletionFormforthecertificatetobeawarded.

USFTampaGraduateCatalog20132014 Section11GraduateCertificates

92

DegreeSeekingStudents

o All degree seeking students who wish to pursue approved graduate certificates must apply for
admissiontothecertificatethroughtheGraduateCertificateOffice(www.gradcerts.usf.edu).
The application must be received prior to conferral of the degree that includes the same
coursework. Students who have completed all coursework must apply for admission to the
certificate and submit a Completion Form prior to the deadline to apply for graduation by the
fourthweekofthesemesterinwhichthestudentplanstograduate.

o DegreeseekingstudentswhoarepursuingaGraduateCertificate inadisciplineoutsideoftheir
graduate degree program (major) must apply for admission to the certificate through the
Graduate Certificate Office (www.gradcerts.usf.edu). The application must be received prior to
thedeadlinetoapplyforgraduation(by thefourthweekofthesemester)inwhichthestudent
planstograduate.Requiredcourseworkforthecertificatemustbecompletedwithinfiveyears
oftakingthefirstcourseapplicabletothecertificate.StudentsmustsubmitaCompletionForm
forthecertificatetobeawarded.

3. Certificateseekingstudentsnotcurrentlyenrolledinadegreegrantinggraduateprogram,willbe
admittedintoaseparateclassificationwithintheUniversity,andwillbeclassifiedasGraduateCertificate
Students.ThisseparateclassificationwillpermittheUniversitytomonitorstatisticalandenrollmentdata
forcertificateareasofstudy,andwillallowinclusionofsucheffortsintheannualreportsandacademic
planning.TheGraduateCertificateOfficewillnotesuccessfulcompletionofacertificateonthestudents
transcriptuponcompletion.

4. Studentspursuingagraduatecertificatewillberequiredtomeetthesameacademicrequirementsas
thosedefinedfordegreeseekingstudentstoremainingoodstanding.

5. Allgraduatecertificatestudentsmayapplyonegraduatecoursetotwograduatecertificates.

6. Allgraduatecertificatestudentsmustmeetallprerequisitesforcoursesinwhichtheywishtoenroll.
Shouldagraduatecertificatestudentsubsequentlyapplyandbeacceptedtoadegreegrantingprogram,
uptotwelve(12)hoursofUSFcreditearnedasagraduatecertificatestudentmaybeappliedtosatisfy
graduatedegreerequirements.Anyapplicationofsuchcreditmustbeapprovedbythedegreegranting
collegeandmustbeappropriatetotheprogram.SeetheTransferofCreditPolicyformoreinformation.

7. ForinformationontransferofcreditpoliciespertainingtoGraduateCertificates,refertothetransferof
creditpolicyinSection7,AcademicPolicies,ofthiscatalog,

CertificateRequirements
Toreceiveagraduatecertificate:

1. Studentsmustsuccessfullycompletecertificaterequirementsasestablishedbytheuniversity.Graduate
Certificatestudentswillbeheldtotheacademicstandardsforallgraduatestudentsasspecifiedinthe
GraduateCatalog,unlessotherwisenotedinthesectionintheGraduateCatalogregardingGraduate
Certificates.

2. Studentsmustsubmitacompletionform.Degreeseekingstudentsmustsubmitthisformbefore
graduatingfromtheirdegreeprogram.Nondegreeseekingstudentsmustsubmitthisformnolaterthan
onesemesteraftercompletingtheircertificatecoursework.

3. Studentsmusthavebeenawardedabachelorsorhigherdegree.


93
http://www.cas.usf.edu/
S SE EC CT TI IO ON N1 12 2
C
C
O
O
L
L
L
L
E
E
G
G
E
E
O
O
F
F

A
A
R
R
T
T
S
S
A
A
N
N
D
D
S
S
C
C
I
I
E
E
N
N
C
C
E
E
S
S

USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


94
http://www.cas.usf.edu/
ChangestoNote

ThechangesfortheCollegeofArtsandScienceswereapprovedbytheUSFTampaGraduateCouncilonthedatesnoted.
CreationofNewDepartment/School:
SchoolofPublicAffairs ConsolidationofPublicAdministration,UrbanandRegionalPlanningintothenewSchoolofPublic
Affairs(equivalenttodepartment),withintheschoolofSocialSciences

12/3/12

NewProgramsandAcceleratedPrograms
CellandMolecularBiology NewPh.D.Program 5/21/12
IntegrativeBiology NewPh.D.Program 5/21/12
MicrobiologyBS/MS NewAcceleratedProgram 11/5/12

ProgramChanges
AmericanStudies(MA) ReviseCore,electives 5/21/12
AppliedAnthropology(MA) ReviseMedicalTrack,NewConcentrationinArchaeologicalandForensicScience 5/21/12
AppliedAnthropology(PhD) ReviseMedicalTrack,NewConcentrationinArchaeologicalandForensicScience 5/21/12
Biology(MS) ChangePCB5525toPCB6525 12/5/11
CancerBiology(PhD) ChangeCurriculum 3/4/13
Communication(Ph.D.) Modifycopysothatthetotalhoursrequiredisclear n/a
CreativeWriting(MFA) Changecurriculum 11/7/11
Changeadmissiondeadlines 5/21/12
Economics(MA) ChangeCurriculum,ChangetoDirectReceiptforAdmissions(5/21/12),updatedeadlines(11/29/12) 4/2/12
Economics(PhD) Changecurriculumrequirements 5/21/12
English(MA)and(Ph.D.) ChangeAdmissionDeadlines,catalogcopy 5/21/12
English(Ph.D.) DeletionofGRESubjectScoreRequirement 5/20/13
Geography(MA) RenameConcentrationsandchangecorecourse: 4/2/12
ChangeTitlefromGeographicInformationSystemsandSpatialAnalysisto
GeographicInformationScienceandSpatialAnalysis
ChangeTitlefromEconomic,SocialandPlanningIssuesintheUrbanEnvironmenttoHumanGeography
ChangetitlefromNatural/TechnologicalHazardsandEnvironmentalJusticetoEnvironmentalGeography
Geography&ESP(PhD) Changeareasofemphasis,requiredesignateareaatapplication 4/2/12
Geology(MA) ReviseHydrogeologyInternship 4/1/13
Geology(Ph.D.) Revisecopytoinclude90postbaccminimumhoursstatement 4/1/13
History(MA) ChangetoDirectReceiptforAdmissions 11/5/12
History(PhD) ChangetoDirectReceipt,updatecourses 11/5/12
LACS(MA) Changeadmissiondeadlines,minoreditstocopy 4/3/13
LiberalArts(MLA) ChangeDegreefromMLAtoMA(pendingfinalstateapproval) 5/21/12
Changecurriculum,reviseconcentrations,andterminatetheLiberalStudiesConcentration
LibraryandInformationScience(MA)Addelectiveoptions 12/3/12
MassCommunications(MA) Reviseadmissiondeadlines,GREscores 3/4/13
Mathematics(MA)and(Ph.D.) Moverequiredcorecoursetoelectiveoption 3/4/13
Philosophy(MA)and(Ph.D.) ChangeCurriculum 3/4/13
Physics,Applied(Ph.D.) ClarifiedCurriculum,updatedselectedtopicscourseforPracticum 5/20/13
PoliticalScience(MA) Changecurriculum 11/3/11
Psychology(MA) Minorrevisiontoprogram,catalogcopy 5/21/12
Psychology(PhD) ChangetoRegularAdmissionforallconcentrations 12/12/12
PublicAdministration(MPA) Coursechanges,NewConcentration:ExecutivePublicAdministration 11/7/11
ReligiousStudies UpdateCoursePrefixfromfieldreview 1/3/13
UrbanandRegionalPlanning(MURP)ChangeCurriculum 5/6/13
WomensStudies(MA) Addnonthesisoption,ChangenameofprogramtoWomensandGenderStudies(WGS) 3/5/12

ProgramTermination
Biology(Ph.D.) Terminationforadmissioneffectivefall2013 5/20/13

DualDegreeProgramChanges
AppliedAnthropology(MA/PhD)/PublicHealth(MPH)AddinglanguagetoMedicalTrack 5/21/12

GraduateCertificates
ResearchAdministration NewGraduateCertificate 11/7/11
Prof.andTechnicalComm. Changecurriculum 10/3/11
WomensStudies ChangenameofCertificatetoWomensandGenderStudies 3/5/12

ProgramReactivation/inactivation
MaterialsScienceandEngineering(MSMSE)reactivateeffectivesummer2012 9/10/12
USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


95
http://www.cas.usf.edu/
UniversityofSouthFlorida
CollegeofArtsandSciences
4202E.FowlerAveSOC107
Tampa,FL33620

Webaddress: http://www.cas.usf.edu/
Email: seeindividualdepartmentlistings
Phone: 8139746957
Fax: 8139744075

CollegeDean: EricEisenberg
AssociateDean: RobertPotter

Accreditation:
TheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.Contactcollegeforother
accreditationinformation.

CollegeStructure:
The College of Arts and Sciences is USFs largest college. The College is comprised of three schools including the
SchoolofSocialSciences,theSchoolofNaturalSciences&Mathematics,andtheSchoolofHumanities,allwithstrong
interdisciplinaryconnectionsamongthemandthroughouttheUniversity.

MissionStatement:
TheCollegeofArtsandSciencesisacommunityofscholarsdedicatedtotheideathateducatedpeoplearethebasis
of a just and free society. The essences of education are a capacity for the appreciation of social change within a
contextofpriorhumanachievement.ThefacultyoftheArtsandSciencesstrivetoinstillintheirstudentsahistoryof
humanideas,aloveoflearning,andanunderstandingofthemeansthatscholarshaveusedintheirsearchforbeauty
andorderinthenaturalworld.TheeducationprovidedbythedisciplinesoftheArtsandSciencesisthefoundation
uponwhichthelivesandprofessionsofourstudentsarebuilt,andthebasisfromwhichpersonalgrowthoccurs.

TheCollegeofArtsandSciencestakesasitsgoalameldingofthenatural,humanisticandsocialphilosophiesintoa
comprehensive whole that encourages the development of new ideas and new approaches to the understanding of
ouruniverse.Itistheresponsibilityofscholarstosharetheirdiscoveriesforthebettermentofsociety.Thus,theArts
andSciencesembracethedisciplinesthatstrivetomakeimmediateuseofknowledgeintheserviceofsocialgoalsas
well as the disciplines whose discoveries contribute to the fund of basic information that is the stepping stone of
appliedknowledge.

Degrees,Programs,andConcentrationsOffered:
MasterofArts(M.A.)
AmericanStudies(AMS)
AppliedAnthropology(ANT)
ArchaelogicalandForensicScience()
BioculturalMedicalAnthropology(BCM)
CulturalResourceManagement(CRM)
HeritageStudies(HGS)
Chemistry(nonthesis)(CHA)
Communication(SPE)
Economics(ECO)
English(ENG)
Literature(LIT)
Rhetoric&Composition(RAC)
USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


96
http://www.cas.usf.edu/
French(FRE)
Geography(GPY)
HumanGeography(USG)
GeographicInformationScienceandSpatialAnalysis(TGP)
EnvironmentalGeography(EVG)
History(HTY)
AmericanHistory(AHY)
AncientHistory(AHS)
EuropeanHistory(EHS)
LatinAmericanHistory(LAH)
MedievalHistory(MHS)
LatinAmerican,Caribbean,andLatinoStudies(LAS)
LiberalArts(MA)
AfricanaStudies(AFT)
FilmStudies(FLM)
Humanities(HTS)
SocialandPoliticalThought(SPT)
LibraryandInformationScience(LIS)
Linguistics(LIN)
Linguistics:EnglishasaSecondLangauge(ESL)
MassCommunications(COM)
MediaStudies(MCM)
MultimediaJournalism(MMJ)
StrategicCommunicationManagement(PRS)
Mathematics(MTH)
Pure&Applied(PAA)
Philosophy(PHI)
Philosophy&Religion(PHR)
PoliticalScience(POL)
Psychology(PSY)
ClinicalPsychology(PSC)
Cognition,Neuroscience&SocialPsychology(PCN)
IndustrialOrganizationalPsychology(PSI)
ReligiousStudies(REL)
Sociology(SOC)
Spanish(SPA)
Statistics(STC)
WomensandGenderStudies(WGS)

MasterofFineArts(M.F.A.)
CreativeWriting(CWR)
Fiction(CFI)
Poetry(CPO)

MasterofPublicAdministration(M.P.A.)
PublicAdministration(PAD)
ExecutivePublicAdministration(EPA)

MasterofScience(M.S.)
Biology(BIO)
CellBiology&MolecularBiology(MBG)
EcologyandEvolution(EEV)
USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


97
http://www.cas.usf.edu/
Environmental&EcologicalMicrobiology(EVM)
PhysiologyandMorphology(PMY)
Chemistry(CHM)
AnalyticalChemistry(ACH)
Biochemistry(BCH)
ComputationalChemistry(CPC)
EnvironmentalChemistry(EVC)
InorganicChemistry(IOG)
OrganicChemistry(OCH)
PhysicalChemistry(PCH)
PolymerChemistry(POC)
EnvironmentalScienceandPolicy(ESP)
Geology(GLY)
Microbiology(MIC)
Physics(PHY)
AppliedPhysics(APM)
AtmosphericPhysics(APZ)
Atomic&MolecularPhysics(AMZ)
LaserPhysics(APZ)
MaterialsPhysics(MPZ)
MedicalPhysics(MEZ)
OpticalPhysics(OPZ)
SemiconductorPhysics(SCZ)
SolidStatePhysics(SSZ)

MasterofScienceinMaterialsScienceandEngineering(M.S.M.S.E.)
MaterialsScienceandEngineering(MSE)

MasterofUrbanandRegionalPlanning(M.U.R.P.)
UrbanandRegionalPlanning(URP)

DoctorofPhilosophy(Ph.D.)
AppliedAnthropology(APA)
ArchaelogicalandForensicScience()
BioculturalMedicalAnthropology(BCM)
CulturalResourceManagement(CRM)
HeritageStudies(HGS)
CancerBiology(CNB)
CellandMolecularBiology
Chemistry(CHM)
AnalyticalChemistry(ACH)
Biochemistry(BCH)
ComputationalChemistry(CPC)
EnvironmentalChemistry(EVC)
InorganicChemistry(IOG)
OrganicChemistry(OCH)
PhysicalChemistry(PCH)
PolymerChemistry(POC)
Communication(SPE)
Economics(ECO)
English(ENG)
Literature(LIT)
USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


98
http://www.cas.usf.edu/
Rhetoric&Composition(RAC)
GeographyandEnvironmentalScienceandPolicy(GEP)
Geology(GLY)
Government(GOV)
History(HTY)
IntegrativeBiology
EcologyandEvolution(EEV)
Environmental&EcologicalMicrobiology(EVM)
PhysiologyandMorphology(PMY)
Mathematics(MTH)
Pure&Applied(PAA)
Statistics(STT)
Philosophy(PHI)
PhilosophyandReligion(PHR)
Physics(Applied)(APD)
Psychology(PSY)
ClinicalPsychology(PSC)
Cognition,Neuroscience&SocialPsychology(PCN)
IndustrialOrganizationalPsychology(PSI)
SecondLanguageAcquisition&InstructionalTechnology(throughtheDept.ofSecondaryEducation)
Sociology(SOC)

GraduateCertificatesOffered:
SeeGraduateCertificatesSection

COLLEGEREQUIREMENTS
ThesisEnrollment
Upon successful completion of all M.A./M.S. degree requirements except for thesis, Arts and Sciences graduate
students must enroll in a minimum of two (2) credit hours of Thesis each semester (except Summers) until the
completionofthemastersdegree.

DissertationEnrollment
Doctoralstudentswhohavebeenadmittedtocandidacyarerequiredtoaccumulateaminimumofsix(6)credithours
ofDissertationduringeach previous12monthperiod(previous three(3)terms,e.g.,Fall,Spring,Summer)untilthe
degreeisgranted.
USFTampaGraduateCatalog20132014 Section12CollegeofArtsandSciences


99
http://www.cas.usf.edu/
AbouttheCatalog

The University of South Florida Graduate Catalog is organized with the degree programs offered listed in the
section of the College that offers them. For example, the Master of Science degree with a program (also
known as major) in Biology is listed in the College of Arts and Sciences section. Some colleges offer areas of
specialization,orconcentrationswithinadegreeprogram.

PROGRAMS

BIOLOGYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

CONCENTRATIONS

ConcentrationRequirementsarelistedseparatelyundereachProgram.

TheProgramandConcentrationarelistedontheofficialtranscript.Otherareas,suchasapplicationtracks,are
notlistedonthetranscript.

Example:
MasterofArtsinAppliedAnthropology
withaConcentrationinBioculturalMedicalAnthropology
Green denotes
Program (or Major)
Black denotes degree
USFTampaGraduateCatalog20132014 AmericanStudies(M.A.)


100
http://www.cas.usf.edu/
AMERICANSTUDIESPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 05.0102
Dept.Code: HCS
Program(Major/College) AMSAS

CONTACTINFORMATION

College: ArtsandSciences
Department: HumanitiesandCulturalStudies

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheMasterofArtsinAmericanStudiesoffersstudentstheopportunitytostudythesocialrelationsandculturalpatterns
that have both unified and divided Americans over time. Topics covered include popular and elite cultures; the material
and technological foundations of American society; cultural heroines and heroes; and the values, ideals, and lifestyles of
ordinary people as well as those of recognized historical figures. Students learn how to analyze a broad range of texts,
includingliterature,art,music,film,andmaterialculture,forevidenceofthesepatternsinAmericanlifeandculture.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
3.00upperdivisionundergraduateGPA
anofficialtranscript
GRErequiredwithapreferredverbalscoreof500orhigherandapreferredanalyticalwritingscoreofnotlessthan4.5
anacademicwritingsample

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 33credithours

COREREQUIREMENTS 15hours
HUM6814 IntroductiontoGraduateStudy 3
AMS6156 TheoriesandMethodsofCulturalStudies 3
AMS6254 CulturalEra 3
AMS6805 EnduringQuestionsinAmericanCulture3
AMS6938 ResearchSeminar 3

Electives 12hours
Tobeselectedfrom5000or6000levelcoursesinAmericanStudiesand/orrelateddepartments,suchas:English,History,
Humanities, Philosophy, Religious Studies, Sociology, and Women's and Gender Studies. No more than 6 hours from any
onedepartmentmaybecreditedtowardthedegreewithoutwrittenconsentfromtheGraduateDirector.
Workinthefollowingmaybeincluded:
USFTampaGraduateCatalog20132014 AmericanStudies(M.A.)


101
http://www.cas.usf.edu/

AMS6002AmericanLives(3)
AMS6375TheAmericanSouth(3)
AMS6901DirectedReadingsinAmericanStudies(13)
AMS6915DirectedResearch(112)
AMS6934SelectedTopics(13)
AMS6940InternshipinAmericanStudies(13)

Thesis 6hours
AMS6971Thesis

Upon nearing the completion of coursework, each student will select a thesis topic, constitute a thesis committee, and
writeandorallydefendathesisproposal.Thestudentwillthenwriteandorallydefenda40to80pagethesis.Duringthe
proposalandthesiswritingstage,studentsarerequiredtoenrollforatleast6hoursofThesiscredit.Thesubmissionand
oraldefenseofthethesisproposalequatestothecomprehensiveexam.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)


102
http://www.cas.usf.edu/
APPLIEDANTHROPOLOGYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: December15
Falladmissiononly

MinimumTotalHours: 40
ProgramLevel: Masters
CIPCode: 45.0201
Dept.Code: ANT
Program(Major/College): APAAS

Concentrations:
ArchaeologicalandForensicScience
BioculturalMedicalAnthropology(BCM)
CulturalResourceManagement(CRM)
HeritageStudies(HGS)

CONTACTINFORMATION

College: ArtsandSciences
Department: Anthropology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu
http://anthropology.usf.edu/graduate/

PROGRAMINFORMATION

The M.A. program, initiated in 1974, was the first in the country to focus on career training for the practice of Applied
Anthropology. Faculty at USF specialize in various areas, including medical anthropology, biological anthropology, urban
policy and community development, education, archaeology, cultural resource management (CRM), economic
development, immigration, media, and issues pertaining to race, gender, and ethnicity. Geographic specializations
emphasizetheCaribbean,LatinAmerica,SubSaharanAfrica,Europe,andtheUnitedStates.Morethan200graduateshave
received an education in anthropology and its practical uses, leading to employment in government and private sector
agencies and organizations. For many, the MA is a terminal degree that qualifies them for professional careers in
administration, program evaluation, planning, research, and cultural resource management. Others have gone on to earn
doctoraldegreesandhavegainedemploymentinacademicorhigherlevelnonacademicpositions.

Students entering the Masters program in Applied Anthropology at USF choose from one of four tracks: Archaeology,
BiologicalAnthropology,CulturalAnthropology,orMedicalAnthropology.Althoughthesefourtrackssharesomecommon
requirements,andareboundbygeneralrulesoftheUSFGraduateSchool,theyhavedifferentcurriculaandemployment
trajectories.ArchaeologyTrackgraduatestypicallyentercareersincontractarchaeology,orpublicandprivateagenciesand
museums responsible for managing archaeological resources. The Cultural Anthropology Track is designed to lead to
employment in diverse areas that include education, urban planning, human services, private sector consulting and
research, and nongovernmental community organizations. Museum and heritage programming represent an area of
overlapbetweenthetwoemphases.Studentswhowishtopursuethesekindsofspecialtieswilldevelopcurriculathatdraw
from both applied and public archaeology requirements in consultation with their advisors. Biological Anthropology
students are trained to work in law enforcement, private sector consulting and research, and nongovernmental
organizations. The Medical Anthropology track prepares students to conduct research, evaluation, and consulting in a
varietyofsettings,includingcommunitybasedorganizations,countyandstatehealthdepartments,andnongovernmental
organizations. In addition to following the curriculum of a track, M.A. students can select elective courses to fulfill one of
four concentrations in Archaeological and Forensic Sciences, Biocultural Medical Anthropology, Cultural Resource
Management,orHeritageStudies.

ForinformationregardingthedualdegreeM.A./MPHprogramwiththeCollegeofPublicHealth,refertotheseparate
listingunderAppliedAnthropologyorPublicHealth

USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)


103
http://www.cas.usf.edu/
Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Human biology; biocultural medical anthropology; nutrition/diet; growth and development; population genetics; forensic
anthropology and human rights; neuroanthropology; stress; immune function; maternal and child health; reproductive
health; HIV/AIDS; disasters; water and sanitation; migrant health; health policy; sociocultural and historical anthropology;
transnational migration; labor; neoliberal globalization; citizenship; media and visual anthropology; environmental
anthropology; urban anthropology; pedagogy and educational anthropology; heritage and memory studies; Florida
archaeology; Eastern U.S. prehistory; Mesoamerican archaeology; Mediterranean prehistory; archaeological science;
bioarcheaology;culturalresourcemanagement;publicarcheology.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
MustmeetalladmissionscriteriaestablishedbyUSF.WhiletheGREisrequired,thereisnominimumscoreforadmission
intotheprogram.Otheradmissionrequirementsinclude:

astatementofpurpose
asignedresearchethicsstatement
atleastthreelettersofrecommendation
aresumeorcurriculumvitae
graduateassistantapplicationform(optional)
writingsample(optional)

DEGREEPROGRAMREQUIREMENTS
Totalrequiredhours(40)

CoreRequirements 6hours
Track 24hours
Internship 4hours
Thesis 6hours
OptionalConcentrations912hours

CoreRequirements(requiredforstudentsinalltracks 6hours
ANG6705FoundationsofAppliedAnthropologyI 3
ANG5486QuantitativeMethodsinAnthropology(orequivalentinanotherdepartment)3

RequiredTrack 24hours
StudentsselectfromoneofthefollowingTracks:
ArchaeologyTrack 24hours
ANG6198RegionalProblemsinMethodsofPublicArchaeology 3
ANG6110ArchaeologicalTheoryandCurrentIssues 3
ANG6197PublicArchaeology 3
plustwo(2)electivesinArchaeology 6
one(1)electiveinBiologicalAnthropology 3
one(1)electivefromanygraduateseminarinAnthropology 3
one(1)graduateseminaroutsidetheDepartment 3


BiologicalAnthropologyTrack 24hours
ANG6701ContemporaryAppliedAnthropology 3
USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)


104
http://www.cas.usf.edu/
ANG6766ResearchMethodsinAppliedAnthropology 3
ANG6511SeminarinPhysicalAnthropologyHumanVariation) 3

ANG6469SelectedTopicsinMedicalAnthropology 3
ORANG6585SeminarinPhysicalAnthropology:
TheoryandMethodsinAppliedBioanthropology 3
plusthree(3)additionalgraduateseminarsinAnthropology 9
one(1)graduateseminaroutsidetheDepartment 3

CulturalAnthropologyTrack 24hours
ANG6701ContemporaryAppliedAnthropology 3
ANG6766ResearchMethodsinAppliedAnthropology 3
plusfive(5)electivegraduateseminarsinAnthropology 15
one(1)graduateseminaroutsidetheAnthropologyDepartment 3

MedicalAnthropologyTrack 24hours
ANG6701ContemporaryAppliedAnthropology 3
ANG6766ResearchMethodsinAppliedAnthropology 3
ANG6469TheoryandMethodsinMedicalAnthropology 3
plusfour(4)electivegraduateseminarsinAnthropology 12
one(1)graduateseminaroutsidetheAnthropologyDepartment 3

CONCENTRATIONREQUIREMENTS(Optional)
Studentsmayselectoneofthefollowingconcentrations:

ConcentrationinArchaeologicalandForensicSciences 12hours
Tworequiredcourses(3creditseach),consistingof
ANG6115 ArchaeologicalScience 3
ANG6588 ForensicAnthropologyorANG6511ForensicScience 3

Twoelectivescourses(3creditseach;onemaybeoutsideAnthropology): 6
ANG6145 AncientDiets
ANG6193 AncientTrade
ANG6511 Anthrogenetics
ANB6586 Bioarchaeology
ANG6588 ForensicAnthropology
ANG6511 ForensicScience
ANG6511 AdvancedMethodsinForensicAnthropology
ANG6511 Osteology
ANG6115 Soils
ANG6115 TechnologiesforHeritagePreservation

Externalelectivesthatalsoqualify(onlyonecancounttowardsconcentration):
AdvancedRemoteSensing(GIS6038C),RemoteSensingSeminar(GIS6039),Tracer
Geochemistry(GLY6255),AnalyticalTechniquesinGeology(GLY6285C),Principlesof
AppliedGeophysics(GLY6475),PrinciplesofStableIsotopeGeochemistry(GLY6739)

ConcentrationinBioculturalMedicalAnthropology 12hours
FourgraduatemedicalanthropologycourseswiththeANGprefix:

1. ANG6469TheoryandMethodsinMedicalAnthropology
2. ANG6511TheoryandMethodsofAppliedBiologicalAnthropology
3. ANG 6511 Seminar in Physical Anthropology (e.g. Human Variation, Anthropology of Growth and
Development,orForensicAnthropology)
USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)


105
http://www.cas.usf.edu/
4. ANG 6566, 6569, 6469, or 5937 E.g. Nutritional Anthropology, SocioCultural Aspects of HIV/AIDS, Issues in
MigrantHealth,AnthropologyandDevelopment,ReproductiveHealth,Health&MedicalSystem(studentsselect
one)

PleaseNote:theFoundationsofMedicalAnthropologyonlinecourseofferedthroughtheSchoolofSustainability
is a service course intended for nonanthropology students and cannot count towards the Applied Anthropology
degree.

ConcentrationinCulturalResourceManagement 9hours

ANG6197 PublicArchaeology 3
ANG6115 SpecialTopicsinArchaeology:CurrentIssuesandTechniques
inCulturalResourcesManagement 3

Oneofthefollowingelectives:
ANG6448 RegionalProblemsinUrbanAnthropology:IssuesinHeritageTourism 3
(orotherasapprovedbyGraduateDirector)
ANG6115 TopicsinPublicArchaeology 3
(HistoricalArchaeology,FloridaArchaeology,SoutheasternArchaeology,MuseumMethods,
orotherasapprovedbyGraduateDirector)

GraduateclassinGeographicInformationSystems,whetherofferedinAnthropologyoranotherdepartment.
Graduate students pursuing a concentration in Cultural Resource Management must take the basic course
requirementsoftheirgraduateprogram.

ConcentrationinHeritageStudies 9hours

ANG6437SelectedTopicsinAppliedAnthropology:IssuesinHeritageStudies 3

Twoelectivesfromamongthefollowingoptions: 6hours
ANG5395 VisualAnthropology 3
ANG6081 MuseumMethods 4
ANG6197 PublicArchaeology 3
ANG6436 IssuesinHeritageTourism 3
ANG6448 RegionalProblemsinUrbanAnthropology 3
(topicsincludeEthnohistory,MuseumsinCulture,EthnicityandPublic
Policy,HeritageResearchandManagement,CultureandEnvironmentalResources)
ANG6676 SeminarinAnthropologicalLinguistics 3
(whentopicisLanguageandCultureorLanguageandRacism)
ANG7487 QuantitativeResearchMethods 3

ComprehensiveExam
ThecomprehensiveexamrequirementissatisfieduponsuccessfulcompletionofFoundationofAppliedAnthropology(ANG
6705).SuccessfulcompletionentailsearningafinalgradeofBorbetterinthiscourse.

Internship 4hoursminimum
ANG6915DirectedResearchinInternship(4)

Thesis 6hoursminimum
ANG6971:Thesis(2)
Atleast2credithourspersemesteruntilthesisisaccepted.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)andPublicHealth(M.P.H.)


106
http://www.cas.usf.edu/
APPLIEDANTHROPOLOGYANDPUBLICHEALTHPROGRAMS

DualDegreeProgram
MasterofArts(M.A.)/MasterofPublicHealth(M.P.H.)Degrees

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: December15
Falladmissionsonly

MinimumTotalHours: AppliedAnthropology37
PublicHealth42
ProgramLevel: Masters
CIPCode: Anthro:45.0201
PublicHealth:51.2201
Dept.Codes: ANT,DEA
Program(Major/College): ANTAS/MPHPH

Concentrations:
BioculturalMedicalAnthropology
CONTACTINFORMATION

Colleges: ArtsandSciences
PublicHealth

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu
http://anthropology.usf.edu/graduate/

PROGRAMINFORMATION

The two programs review applicants independently. Application forms for Anthropology and Public Health are completed
witheachlistingbothasmajorareasorstudy.

Afteradmissiontobothprograms,theGraduateAdmissionsofficeinstructstheRegistrarsOfficetoclassifythestudentas
dually enrolled in anthropology and public health. In choosing which program to apply to first, students should take into
considerationthefollowing:requirementsinAnthropologyforadmissionaredifferentthaninPublic Health;admissionto
one program does not guarantee admission to the other; and of course, the students interests and career plans. Upon
completion of all requirements for the dual degree program, the student submits separate applications for graduation to
AnthropologyandPublicHealth,andiscertifiedforgraduationbybothprogramsandreceivestwodiplomas.Dualdegree
studentscanalsoselectelectivecoursestofulfillaconcentrationinBioculturalMedicalAnthropology.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Must meet all admissions criteria established by USF with the exception that applicants must have a 3.20 undergraduate
GPA. The GRE is required for consideration in both programs, but there is no minimum score for admission into
Anthropology.ForspecificinformationontheadmissionrequirementsforPublicHealth,pleaserefertotheCataloglisting
for the MPH in Public Health. Admission to any of the dual programs will also consider letters of recommendation, past
experience,goalstatement,andavailabilityoffaculty.Otheradmissionrequirementsinclude:

astatementofpurpose
asignedresearchethicsstatement
atleastthreelettersofrecommendation
USFTampaGraduateCatalog20132014 AppliedAnthropology(M.A.)andPublicHealth(M.P.H.)


107
http://www.cas.usf.edu/
aresumeorcurriculumvitae
graduateassistantapplicationform(optional)
writingsample(optional)
.

DEGREEPROGRAMREQUIREMENTS

M.A.inAppliedAnthropology(40hours)
ForspecificinformationontherequirementsfortheMAinAppliedAnthropology(includingoptionalconcentrations),
pleaserefertheCataloglistingforthatprogram.

ANG6705FoundationofAppliedAnthropology 3
ANG6701ContemporaryAppliedAnthropology 3
ANG6766ResearchMethodsinAppliedAnthropology 3

PHC6050BiostatisticsI(3)orANG5486QuantitativeMethods(3) 3

Fourgraduatelevelseminars(variabletopics)inAnthropology 12

Atleasttwointheareaofmedicalanthropology(oftenANG6469SelectedTopicsinMedicalAnthropology);oneof
thesefulfilledbytakinginpublichealthPHC6410SocialandBehavioralSciencesAppliedtoHealthorPHC6931
AdvancedSeminarinSBSAppliedtoHealth

Specificseminarsshouldbetakentofulfillspecifictrackrequirementsforthe
MAinAppliedAnthropologydegree(oranoptionalconcentration)

Externalelectiverequirement(onegraduatelevelcourseoutsidethe
DepartmentofAnthropology)isfulfilledbyaPublicHealthcourse 3

ComprehensiveexaminationrequirementmetbysuccessfullycompletingANG6705(FoundationsofAppliedAnthropology).
SuccessfulcompletionentailsearningafinalgradeofBorbetterinthiscourse.

Internship:ANG6915;onesemester,fulltimeaftercompletionofcourserequirements,4hoursminimum,inthefieldof
publichealthtoduallyfulfillMPHrequirementforSupervisedFieldExperience,PHC6945,4credithoursminimum

Thesis:ANG6971:DuallyfulfillsMPHrequirementforSpecialProject,PHC6977,6credithoursminimum

M.P.H.inPublicHealth(42hours)
Requirements include public health core courses, concentration area courses, electives, supervised field placement,
comprehensiveexam,andspecialproject.

Forspecificinformationontherequirements,pleaserefertotheCataloglistingfortheMPHinPublicHealth

COURSES

Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


108
http://www.cas.usf.edu/
APPLIEDANTHROPOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: December15
Falladmissiononly

MinimumTotalHours: 46beyondMA
ProgramLevel: Doctoral
CIPCode: 45.0201
Dept.Code: ANT
Program(Major/College): APAAS

Concentrations:
ArchaeologicalandForensicSciences
BioculturalMedicalAnthropology(BCM)
CulturalResourceManagement(CRM)
HeritageStudies(HGS)
CONTACTINFORMATION

College: ArtsandSciences
Department: Anthropology

ContactInformation:www.grad.usf.edu
http://anthropology.usf.edu/graduate/

PROGRAMINFORMATION

ThePh.D.programinAppliedAnthropology,initiatedin1984,wasthefirstdoctoralprogramofitskind.Itsprimaryfocusis
to prepare students in the theories, methods, skills and techniques of applied anthropology. The program is designed to
preparestudentstoconductresearch,teach,andpracticeinbothacademicandnonacademicsettings.Studentsparticipate
in either a structured research internship or independent field research for two consecutive semesters. Students must
choose one of four tracks, which guide curriculum and required courses: Archaeology, Biological Anthropology, Cultural
Anthropology,orMedicalAnthropology.Inaddition,studentscanselectelectivecoursestofulfillanoptionalconcentration
in Archaeological and Forensic Sciences, Biocultural Medical Anthropology, Cultural Resource Management, or Heritage
Studies.

For information regarding the dual degree Ph.D./MPH program with the College of Public Health, see the separate listing
underAppliedAnthropologyandPublicHealth.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools

MajorResearchAreas:
Human biology; biocultural medical anthropology; nutrition/diet; growth and development; population genetics; forensic
anthropology and human rights; neuroanthropology; stress; immune function; maternal and child health; reproductive
health; HIV/AIDS; disasters; water and sanitation; migrant health; health policy; sociocultural and historical anthropology;
transnational migration; labor; neoliberal globalization; citizenship; media and visual anthropology; environmental
anthropology; urban anthropology; pedagogy and educational anthropology; heritage and memory studies; Florida
archaeology; Eastern U.S. prehistory; Mesoamerican archaeology; Mediterranean prehistory; archaeological science;
bioarcheaology;culturalresourcemanagement;publicarcheology.

USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


109
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Must meet all admissions criteria established by USF. Applicants must take the GRE, and provide the results in the
application process. GRE scores will be a factor in the overall admissions decision. Dual degree applicants
(Anthropology/Public Health) will be required to meet any GRE requirements specific to the College of Public Health.
Applicantsmustalsoprovide:

astatementofpurpose
asignedresearchethicsstatement
atleast3lettersofrecommendation
aresumeorcurriculumvitae
graduateassistantapplicationform(optional)
writingsample(optional)

DEGREEPROGRAMREQUIREMENTS

Totalrequiredhours: 46hoursbeyondtheM.A.

CoreRequirements 3hours
Track 24hours
Electives 6hoursminimum
ExternalCurriculumRequirement 6hoursminimum
Internship 4hours
Dissertation 6hours
ConcentrationOptional912hours

COREREQUIREMENTS 3hours
ANG6705FoundationsofAppliedAnthropology 3

MustreceiveagradeofBorbetter.Ph.D.studentswitharecent(withinthepastfiveyears)M.A.inAnthropologyarenot
requiredtotakeFoundationsofAppliedAnthropology,althoughtheymaydosoiftheiradvisorrecommendsit.

Tracks 24hours
Studentsselectoneofthefollowingtracks:

ArchaeologyTrack: 24hours
ANG6198 ArchaeologicalMethods 3
ANG6110 ArchaeologicalTheoryandCurrentIssues 3
ANG6197 PublicArchaeologyand 3
ANG7487 AdvancedQuantitativeResearchMethodsand 3
ANG6115 SeminarinArchaeology:AdvancedArchaeologicalTheory3

BiologicalAnthropologyTrack 24hours
ANG7487 QuantitativeResearchMethods 3
ANG6701 ContemporaryAppliedAnthropology 3
ANG6511 HumanVariation 3
ANG6585 TheoryandMethodsinAppliedBioanthropology 3
ANG6766 ResearchMethodsinAppliedAnthropology 3

USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


110
http://www.cas.usf.edu/
CulturalAnthropologyTrack 24hours
ANG6494 SeminarinCulturalAnthropology:AnthropologicalTheoryToday3
ANG6701 ContemporaryAppliedAnthropology 3
ANG6766 ResearchMethodsinAppliedAnthropology 3
ANG7704 LegalandEthicalAspectsofAppliedAnthropology 3
ANG7487 QuantitativeResearchMethods 3

MedicalAnthropologyTrack 24hours
ANG6494 SeminarinCulturalAnthropology:AnthropologicalTheoryToday3
ANG6701 ContemporaryAppliedAnthropology 3
ANG6766 ResearchMethodsinAppliedAnthropology 3
ANG7704 LegalandEthicalAspectsofAppliedAnthropology 3
ANG7487 QuantitativeResearchMethods 3
ANG6469 TheoryandMethodsinMedicalAnthropology 3

CONCENTRATIONREQUIREMENTS(Optional,notrequired)
Studentsmayselectoneofthefollowingconcentrations:

ConcentrationinArchaeologicalandForensicSciences 12hours
Tworequiredcourses(3creditseach),consistingof
ANG6115 ArchaeologicalScience 3
ANG6588 ForensicAnthropologyorANG6511ForensicScience 3

Twoelectivescourses(3creditseach;onemaybeoutsideAnthropology): 6
ANG6145 AncientDiets
ANG6193 AncientTrade
ANG6511 Anthrogenetics
ANB6586 Bioarchaeology
ANG6588 ForensicAnthropology
ANG6511 ForensicScience
ANG6511 AdvancedMethodsinForensicAnthropology
ANG6511 Osteology
ANG6115 Soils
ANG6115 TechnologiesforHeritagePreservation

Externalelectivesthatalsoqualify(only1cancounttowardsconcentration):
AdvancedRemoteSensing(GIS6038C),RemoteSensingSeminar(GIS6039),Tracer
Geochemistry(GLY6255),AnalyticalTechniquesinGeology(GLY6285C),Principlesof
AppliedGeophysics(GLY6475),PrinciplesofStableIsotopeGeochemistry(GLY6739)

ConcentrationinBioCulturalMedicalAnthropology(12hours)

FourgraduatemedicalanthropologycourseswiththeANGprefix:

1. ANG6469 TheoryandMethodsinMedicalAnthropology
2. ANG6511 TheoryandMethodsofAppliedBiologicalAnthropology
3. ANG6511 SeminarinPhysicalAnthropology(e.g.HumanVariation,AnthropologyofGrowth
andDevelopment,ForensicAnthropology)
4. ANG6566,6569,6469,or5937
E.g.NutritionalAnthropology,SocioCulturalAspectsofHIV/AIDS,IssuesinMigrantHealth,
AnthropologyandDevelopment,ReproductiveHealth,HealthandMedicalSystems

PleaseNote:theFoundationsofMedicalAnthropologyonlinecourseofferedthroughtheSchoolofSustainability
is a service course intended for nonanthropology students and cannot count towards the Applied Anthropology
degree.

USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


111
http://www.cas.usf.edu/
ConcentrationinCulturalResourceManagement(9hours)

Required:
ANG6197 PublicArchaeology 3
ANG6115 SeminarinArchaeology;CurrentIssues&TechniquesinCulturalResourceManagement3

Oneofthefollowingelectives:
ANG6448 RegionalProblemsinUrbanAnthropology:IssuesinHeritageTourism
(orotherasapprovedbyGraduateDirector)
ANG6115 TopicsinPublicArchaeology(HistoricalArchaeology,FloridaArchaeology,Southeastern
Archaeology,MuseumMethods,orotherasapprovedbyGraduateDirector)

GraduateclassinGeographicInformationSystems,whetherofferedinAnthropologyoranotherdepartment.

ConcentrationinHeritageStudies 9hours

Required
ANG6437 SelectedTopicsinAppliedAnthropology:IssuesinHeritageStudies 3

Twoelectivesfromamongthefollowingoptions:
ANG5395 VisualAnthropology 3
ANG6081 MuseumMethods 4
ANG6197 PublicArchaeology 3
ANG6436 IssuesinHeritageTourism 3
ANG6448 RegionalProblemsinUrbanAnthropology 3
(topicsincludeEthnohistory,MuseumsinCulture,Ethnicityand
PublicPolicy,HeritageResearchandManagement,Cultureand
EnvironmentalResources,)

ANG6676 SeminarinAnthropologicalLinguistics 3
(whenthetopicisLanguageandCultureorLanguageandRacism)
ANG7487 QuantitativeResearchMethods 3

Electives 6hoursminimum
ThreeelectivegraduatelevelAnthropologycourses.Two electivegraduatelevelAnthropologycoursesforstudentsinthe
medicalanthropologytrack.

ExternalCurriculumRequirement 6hoursminimum
Theexternalcurriculumrequirementisdesignedtopromoteinterdisciplinaryperspectives.Studentsareexpectedtoenroll
in a minimum of two (2) or a maximum of three (3) graduatelevel courses in departments other than Anthropology,
selected on the basis of professional interests and in consultation with the major advisor (if the student takes only two
externalcourses,he/shemusttakeanadditionalanthropologyelective).StudentswhoenterthePh.D.programwithpost
baccalaureatedegreesindisciplinesotherthanAnthropologymaybeabletousethatexpertisetosatisfytherequirement,
afterconsultationwiththemajoradvisorandapprovaloftheGraduateDirector.Inthesecases,theremainingcredithours
willbefulfilledthroughadditionalcourseworkinAnthropology.

LanguageRequirement
All Ph.D. students are required to demonstrate proficiency in a foreign language, the specifics to be determined by the
student and the supervisory committee, taking into account the nature of the students research. Minimal proficiency is
demonstratedbytheabilitytosatisfactorilytranslateaselectionofthescholarlyliteratureintheforeignlanguage,withthe
occasional aid of a dictionary. The supervisory committee may require additional levels of proficiency depending on the
natureofindividualstudentresearch.Thelanguagerequirementmustbesatisfiednolaterthanthedateofthedissertation
defense.

InternshipandQualifyingexamination 4hoursminimum
Qualifyingexaminationcoveringareaofspecializationwithinappliedanthropologyandexternalspecialization.
USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


112
http://www.cas.usf.edu/
Twosemester internship or dissertation research ANG 7940 (Doctoral Internship in Applied Anthropology, minimum of 4
credithours).

Dissertation 6creditsminimum
ANG7980DoctoralDissertation.
Dissertation,basedonresearchorinternship

COURSES

Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


113
http://www.cas.usf.edu/
APPLIEDANTHROPOLOGYANDPUBLICHEALTHPROGRAMS

DualDegreeProgram
DoctorofPhilosophy(Ph.D.)/MasterofPublicHealth(M.P.H.)Degrees

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: December15
Falladmissionsonly

MinimumTotalHours: 46AppliedAnthropology
42PublicHealth
ProgramLevel: DoctoralandMasters
CIPCode: AppliedAnthropology:
45.0201
PublicHealth:51.2201
Dept.Code: ANT,DEA
Program(Major/College): APAAS,MPHPH

Concentrations:
BioculturalMedicalAnthropology
CONTACTINFORMATION

Colleges: ArtsandSciences
PublicHealth
Departments: Anthropology,PublicHealth

ContactInformation: www.grad.usf.edu
http://anthropology.usf.edu/graduate/

PROGRAMINFORMATION

Students interested in combining a program of study leading to a doctorate plus masters degree have two choices: they
mayobtainaPh.D.inAppliedAnthropologywithanM.P.H.inaPublicHealthconcentration;ortheymayobtainaPh.D.in
Public Health with an M.A. in Applied Anthropology. For the doctoral/masters combination, students develop individual
programsofstudyinconsultationwithaninterdisciplinaryacademicadvisorycommittee.Thecommitteemustapprovethe
plan of study as well as the proposal to fulfill the thesis and dissertation requirements or dissertation and special project
requirementsthroughasingleproject.

The two programs review applicants independently. After admission to both programs, the Graduate Admissions office
instructs the Registrars Office to classify the student as dually enrolled in Anthropology and Public Health. In choosing
which program to apply to first, students should take into consideration the following: requirements in Anthropology for
admissionaredifferentthaninPublicHealth;admissiontooneprogramdoesnotguaranteeadmissiontotheother;andof
course, the students interests and career plans. Upon completion of all requirements for the dual degree program, the
studentsubmitsseparateapplicationsforgraduationtoAnthropologyandPublicHealth,andiscertifiedforgraduationby
bothprogramsandreceivestwodiplomas.Dualdegreestudentscanalsoselectelectivecoursestofulfillaconcentrationin
BioculturalMedicalAnthropology.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

USFTampaGraduateCatalog20132014 AppliedAnthropology(Ph.D.)/PublicHealth(M.P.H.)


114
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
MustmeetalladmissionscriteriaestablishedbyUSF.TheGREisrequiredforconsiderationinbothprograms,butthereis
no minimum score for admission into Anthropology. Please see the Catalog listing for admission requirements for each
program. In addition, admission to any of the dual degree programs will consider letters of recommendation, past
experience,goalstatementandavailabilityoffaculty.Otheradmissionrequirementsinclude:

astatementofpurpose
asignedresearchethicsstatement
atleast3lettersofrecommendation
aresumeorcurriculumvitae
graduateassistantapplicationform(optional)
writingsample(optional)

DEGREEPROGRAMREQUIREMENTS

Ph.D.inAppliedAnthropology(46hoursbeyondtheM.A.)

COREREQUIREMENTS
ForspecificinformationontherequirementsforthePh.D.inAppliedAnthropology(includingoptionalconcentrations),
pleaserefertheCataloglistingforthatprogram

M.P.H.inPublicHealth (42hours)

REQUIREMENTS
Requirementsincludepublichealthcorecourses,concentrationareacourses,electives,supervisedfieldplacement,
comprehensiveexam,andspecialproject.

ForspecificinformationontherequirementspleaserefertotheCataloglistingfortheMPHinPublicHealth

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Biology(M.S.)


115
http://www.cas.usf.edu/
BIOLOGYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January1forfullconsideration;
howeverapplicationsareaccepted
toFebruary15(U.S.Applicants)
January1(International)

Spring: August1(U.S.Applicants)
July1(International)

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 26.0101
Dept.Code: BIO
Program(Major/College): BIOAS

Concentrations:
CellBiologyandMolecularBiology(CMB)
EcologyandEvolution(EEV)
EnvironmentalandEcologicalMicrobiology(EVM)
PhysiologyandMorphology(PMY)

CONTACTINFORMATION

College: ArtsandSciences
Departments: CellBiology,Microbiology, and
Molecular Biology (CMMB)
IntegratedBiology(IB)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheDepartmentofBiologywasexpandedintotheDepartmentofCellBiology,MolecularBiologyandMicrobiology(CMMB)
andtheDepartmentofIntegratedBiology(IB)in2009.EachDepartmenthasitsownChairandGraduateDirectorandoffers
studentsaMasterofScienceinBiologywithaspecificconcentrationassociatedwitheitherCMMBorIB.Thereisnogeneral
Biology MS degree program. The CMMB andIBDepartments are located in modern, wellequipped buildings. Research in
theCMMBDepartmentisdonebyfacultyhousedinInterdisciplinaryScienceBuildingandtheBioScienceFacultybuilding
(BSF), and most of the research within the IB Department is conducted by faculty housed in the Science Center building
(SCA).Becauseoftheinterdisciplinaryaspectofmostresearchprojects,facultyandgraduatestudentsoftenworktogether
on broad training research projects that bring together many of the traditionally separate areas of biology. Many of the
facultywithinCMMBandIBareinvolvedincooperativeresearchwiththeircolleaguesinChemistry,PublicHealth,Nursing,
Medicine, Geology, Psychology, Geography, Marine Science, and Environmental Science. Often CMMB and IB graduate
studentshavefacultymembersfromtheseotherareasofUSFasmembersoftheirgraduatecommittees.

Becauseofthemanyundergraduatecoursesthatrequirehandsonexperimentallaboratories,bothCMMBandIBsupport
many graduate students as Teaching Assistants. CMMB and IB values high quality teaching at all levels of instruction.
Research Assistant positions also are available to support research with specific faculty members depending on an
individual faculty members funding. Numerous scholarship opportunities are also offered on a competitive basis through
theUSFGraduateSchool.

ApplicationtotheBiologyProgramisthroughoneofthetwodepartments,withstudentsselectingaformalConcentration.
RefertotheConcentrationlistingintheCatalogforspecificinformationandrequirements.

USFTampaGraduateCatalog20132014 Biology(M.S.)


116
http://www.cas.usf.edu/
Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:CellBiology,MolecularBiology,SignalTransductionandGeneRegulation,CancerBiology,
DevelopmentalBiology,Microbiology,EcologyandEvolution,EnvironmentalandEcologicalMicrobiology,Physiologyand
Morphology

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

ProspectivestudentsmustapplytoaspecificBiologyMSprogramconcentrationviatheonlineapplicationprocessthrough
theUSFGraduateSchool.

Musthave3.00GPAlast60hoursofB.S.degree

GRE:Preferredscoresof500V,600Q,4.5AWpriortoAugust1,2011;GRE:Preferredscoresof153V,148Q,4.5AWforGRE
revisedgeneraltesttakenafterAugust1,2011

AllinternationalstudentsarerequiredtosubmittheTOEFLtest.NonnativeEnglishspeakinggraduatestudentsmustscore
aminimumofatleast570onthepaperbasedtestoraminimumtotalscoreof79ontheinternetbasedtestontheTOEFL
andatleast50ontheTSEtobeeligibleforateachingassistantship.

ForacceptanceintotheIBDepartment,acceptancebyafacultymemberinIBisMANDATORY.IBencouragesapplicantsto
contactfacultyviaemailtoindicateaninterestintheresearchbeingconductedintheirlaboratory.IBwillmakeeveryeffort
to pair potential graduate students with appropriate faculty; however, it is recommended that applicants make direct
contactwithindividualfaculty.

ItisexpectedthatcandidatesfortheM.S.degreeswillhavecompletedcoursesequivalenttothoserequiredfortheB.S.in
BiologyatU.S.F.

ApplyingtotheDepartmentofCellBiology,MicrobiologyandMolecularBiology

StudentsinterestedinattendinggraduateschoolwithintheCMMBDepartmentshouldvisittheCMMBwebsitethatcanbe
accessedfromthemainUSFsiteandreviewthecurrentCMMBfaculty.Itisrecommendedthatpotentialstudentsconsider
atleast23CMMBfacultythattheywouldbeinterestedinworkingwithandcommunicatethisinformationintheirletterof
application.ItisalsorecommendedthatpotentialstudentscontacttheCMMBGraduateDirectoraswellastheindividual
faculty members they are interested in working with via email. Such communication will facilitate the assignment of the
laboratory rotations that CMMB students will participate in during their first semester of residency and also allow the
applicanttodeterminewhetherthedesiredfacultymemberhaspositionsavailableinthelaboratory.Allstudentsadmitted
totheMastersconcentrationinCellBiologyandMolecularBiologymustestablishaGraduateSupervisoryCommittee.The
Graduate Committee shall constitute the major professor and at least two additional credentialed faculty. At least one of
thecommitteemembersmustbeafacultymemberatUSF.Supervisorycommitteemustbeformedwithintwosemesters
after matriculation. Refer to Committee information in the University Requirements Section of the Catalog for more
information.

The CMMB Graduate Director, CMMB Chair, and the College Associate Dean (or designee) must approve the Graduate
Committee.Onceamajorprofessorhasbeenassignedand/orastudentoccupiesorutilizessignificantspaceorfacilitiesfor
researchoranalogousscholarlyactivitydirectlypertinenttothegenerationofathesis,thestudentshallenrollfortwo(2)
hoursofresearchcrediteachsemester(otherthansummersemester),untileligibletoenrollinthesiscredits.

ApplyingtotheDepartmentofIntegrativeBiology

USFTampaGraduateCatalog20132014 Biology(M.S.)


117
http://www.cas.usf.edu/
Students interested in attending graduate school within the IB Department should contact potential major professors to
communicate their research ideas and establish that the professor will consider the students application. The IB
Department requires that all students admitted into the MS program have the approval of a major professor. Applicants
shouldcontactfacultyconductingresearchinthestudentsareaofinterestwellinadvanceoftheapplicationdeadline.

For all masters students, the major professor and at least two additional faculty constitute the students supervisory
committee, the major professor and at least one of the committee members must be from the Integrative Biology
Department.Supervisorycommitteesmustbeestablishedwithintwosemestersaftermatriculation.Failuretodosowillbe
causefordismissal.

TheIBGraduateDirector,IBChair,andtheCollegeAssociateDean(ordesignee)mustapprovetheSupervisoryCommittee.
Onceamajorprofessorhasbeenassignedand/orastudentoccupiesorutilizessignificantspaceorfacilitiesforresearchor
analogousscholarlyactivitydirectlypertinenttothegenerationofathesis,thestudentshallenrollforaminimumoftwo
(2)hoursofresearchcrediteachsemester(otherthansummersemester),untileligibletoenrollinthesiscredits.

Materialsnecessaryforacompleteapplicationarelistedbelow.

Thefollowingitemsshouldbesubmittedintheenvelopeprovidedto:

IntegrativeBiologyGraduateOffice
Attention:IBGraduateDirector
UniversityofSouthFlorida
4202E.FowlerAveSCA110
Tampa,FL336205150

CMMBGraduateOffice
Attention:CMMBGraduateDirector
UniversityofSouthFlorida
4202E.FowlerAve,ISA2015
Tampa,FL336205150

1. Two official transcripts in a sealed envelope from each postsecondary institution. Transcripts of work completed at
USFwillbesecuredbytheOfficeofAdmissions.Thus,applicantsneedonlytosecuretranscriptsfromotherinstitutionsfor
yourapplicationpacket.

2. Three letters of recommendation from faculty in sealed envelopes (on their university letterhead) with the envelope
seal signed by the recommender. Students shall complete a Student Recommendation Form that can be found on the
CMMBandIBwebsiteandsubmitittotherecommenders.

3. A brief essay stating your intended field of research and professional goals. Please indicate your specific research
interests,inorderthatwemayreferyourapplicationtoappropriateCMMBorIBfacultymembers.Intheessaypleaselist
23 CMMB or IB faculty members that you would like to have review your file. Acceptance into the IB graduate program
requirestheidentificationofspecificfacultywhoarewillingtodirectyourresearch.Thisfinalrequirementdoesnotapplyto
studentswishingtostudyintheCMMBDepartment.

4. Applicant mustcomplete the Application for Teaching Assistantship (TA) Form that can be found on the CMMB or IB
websiteiftheywishtobeconsideredforaTAposition.Applicantswhodonotreturnthisformwillnotbeconsideredfora
teachingposition.ApplicantsshouldattacharesumetotheApplicationforTeachingAssistantship(TA)Formthathighlights
anypreviousteachingexperience.

5. OFFICIAL test scores must be sent to USF directly from the testing agency. The University of South Floridas 4Digit
InstitutionCodeis:5828.OfficialGREscores:Thisexammusthavebeentakenwithinthelastfiveyears.
DEGREEPROGRAMREQUIREMENTS

ThethesisbasedM.S.degreerequiressuccessfulcompletionofthefollowing:

USFTampaGraduateCatalog20132014 Biology(M.S.)


118
http://www.cas.usf.edu/
1.structuredcoursework
2.anoralqualifyingexam
3.researchthesis
4.comprehensivefinalexamination

TheMastersDegreeRequirementsshouldbecompletedintwotothreeyears.TheCMMBandIBDepartmentsrequireall
graduate work applied toward the completion of degree requirements be completed within a five year period after
matriculation.Thesisresearchshouldbepublishableandstudentsareencouragedtopublishtheirfindings.Studentsmust
chooseaspecificconcentrationintheM.S.degreethatwillbecompletedwithineithertheCMMBorIBDepartment.The
specificrequirementsfortheMasterofScience(M.S.)andthespecificconcentrationsareprovidedbelow.

1. Credithourrequirement:Atotalof30semesterhourcreditsbeyondtheBaccalaureateDegreeisrequired.
(IncludingBSC6910,BSC6971,BSC6935,andotherstructuredandunstructuredcoursesapprovedbyCMMBorIB).

2. StudentsadmittedtotheCMMBDepartmentmustcompletethreelaboratoryrotationsduringtheirfirst
semesterofresidency.

3. Successfulcompletionoftheoralcomprehensivequalifyingexamination.Theexamshouldbetakenatthe
endofthefirstyear,orearlyinthesecondyearofstudy.Theexaminationisadministeredandevaluatedbythe
studentsgraduatecommittee.

4. Submissionofathesisproposalandapprovalbythemajorprofessor,graduatecommitteeandgraduate
director.

5. Aminimumofeight(8)thesisresearchcredithours(BSC6971).

6. Seminarrequirement:Onepresentation,excludingthethesisseminaranddefense.Studentsshouldpresent
postersororalpresentationsbasedontheirthesisresearchatnational/regionalprofessionalmeetings.Thestudents
graduatecommitteemustapprovethepresentation.

7. Submissionofanacceptablethesis.

8. Presentationofthethesisseminar(BSC6935)andsuccessfuldefenseofthethesis.

DegreeProgress
Astudentmustberegisteredforanappropriateload(innocasefewerthantwo[2]graduatehours)inthecollegeforthe
semesterinwhichalldegreerequirementsaresatisfactorilycompleted.AstudentwhoreceivesthreegradesbelowBin
structuredcoursesrequiredbytheadvisorycommitteewillbedroppedfromtheprogram.Registrationincoursesentitled
DirectedResearch;thesismustbewiththeapprovalofthemajorprofessorandmustbecommensuratewitheachstudents
researchplan.StudentsmaynotregisterinThesis:MastersuntilaSupervisoryCommitteehasbeenformedandcompleted
theoralqualifyingexamination.AstudentwhoenrollsincoursesentitledThesis:Mastersbutdoesnotsubmitathesiswill
notbecertifiedforgraduation.

COREREQUIREMENTS

M.S.inBiologyCore(4credithours)
BSC6930LecturesinContemporaryBiology(1)
Enrollment in this course is required for at least two semesters of residency. (Note: Students in the Integrated Biology
Departmentarerequiredtoenrollinthiscourseforanadditionalsemesterforatotalofthreesemesters)

USFTampaGraduateCatalog20132014 Biology(M.S.)


119
http://www.cas.usf.edu/
CONCENTRATIONREQUIREMENTS

CELLBIOLOGYANDMOLECULARBIOLOGY(CMM)
OfferedfromtheDepartmentofCellBiology,MolecularBiologyandMicrobiology(CMMB)
Description:Seeprogramdescription.

ConcentrationRequirements
BSC6932AdvancesinScientificReview 2
BSC6932AdvancesinScientificWriting 2
PCB6930AdvancesinCellandMolecularBiology 1

Electives*(minimumof6credithours)
MCB5206PublicHealthandPathogenicMicrobiology 3
MCB5655AppliedandEnvironmentalMicrobiology 3
PCB5235PrinciplesofImmunology 3
PCB6236AdvancedImmunology 3
MCB5815MedicalMycology 3
BSC5931MolecularMicrobialEcology 3
BSC5931ProkaryoticMolecularGenetics 3
MCB5410CellularMicrobiology 3
PCB5256DevelopmentalMechanisms 3
BSC5420GeneticEngineeringandRecombinantDNATechnology 3
PCB5616MolecularPhylogenetics 3
PCB6525MolecularGenetics 3
PCB6107AdvancedCellBiology 4
BSC5931EukaryoticGenomics 3
*Thesupervisorycommitteemayapproveadditionalcoursesnotlistedhere.

ACCELERATEDNONTHESISB.S./M.S.PROGRAMOPTION

This program allows B.S. majors to take graduate courses for the elective part of the Biology degree and apply them to a
nonthesis M.S. degree in Biology. Successful students will be able to earn the M.S. degree in two additional semesters
beyond the completion of the B.S. degree. This accelerated program shares 12 credits between already existing
degrees/concentrations:

B.S.inBiology,ConcentrationinCellandMolecularBiology(submitted)
M.SinBiology,ConcentrationinCellandMolecularBiology(nonthesisoption)

DescriptionandRequirements

Biologymajorswhohavecompletedthefollowingcoursesmayapplytothisprogram:
PCB3023CellBiology
PCB3063Genetics
MCB3410CellMetabolism
PCB4024MolecularBiologyoftheCellorPCB4026MolecularBiologyoftheGene

Studentswhohavebeenadmittedtotheprogrambutsubsequentlyfailtoachievea3.0GPAinthelast60hours
oftheirB.S.degree,orwhodonotcompleteatleast30oftheirlast60hoursatUSF,willbedismissedfromthe
program.

Onceaccepted,studentsmustmeetwithBioAdvise(theadvisingofficeforbiologicalscienceswithintheCollege
ofArtsandSciences)toprepareanactionplantocompletetheB.S./M.S.acceleratedprogram.Thisrequiresthem
totakeallthecoursesrequiredfortheB.S.inBiology:ConcentrationinCellandMolecularBiology.Studentsmay
takeupto12creditsofgraduatecoursesaselectivesinCMMBandapplythosecoursestoboththeB.S.andM.S.
degrees.TheywillnotbeadmittedasgraduatestudentsuntiltheyhavecompletedtheirB.S.degreeandmetall
USFTampaGraduateCatalog20132014 Biology(M.S.)


120
http://www.cas.usf.edu/
the requirements for admission to CMMB as graduate students. The action plan should include a schedule of
courseworktocompletetheirB.S.degreesandadateintheirlastyearintheB.S.programtotaketheGRE.

For fall admission to the M.S. portion of the accelerated program, all application materials must be received by
February 15 of the same year. For spring admission, the deadline is August 1 of the previous year. Application
materialsarethesameastheM.S.inBiology:

1. Two official transcripts of undergraduate work from other institutions. Applicants need not supply USF
transcripts.
2. Threelettersofrecommendation
3. Abriefessaystatingyourprofessionalgoals
4. GREscoresmustbesenttoUSFdirectlyfromthetestingagency(USFinstitutioncodeis5828).

GraduateDegreeRequirements
StudentsadmittedintotheM.S.portionoftheprogrammustcompletealltherequirementsfortheM.S.degree
(nonthesis)withinthreesemestersofadmission.Therequirementis30hoursofgraduateworkwithatleast16
ofthesehourscompletedatthe6000level;26hoursmustbeformallystructuredcourses;andatleast15hours
mustbeinCMMBcourses.Studentswillberequiredtotake3corecoursesfromthelistbelowaspartofthese26
hours.Oftherequired26hours,9hourswillbederivedfromthecoreCMMBgraduatecourseslistedbelow(see
associatedcurriculum).Theserequirementscanbepartiallymetbyupto12hoursofgraduatecoursestakenas
undergraduates.AnygraduateclasstakenoutsideofCMMBmustbeapprovedbytheCMMBGraduateDirector.
StudentsshouldbeawarethataBgradeorbetterisrequiredforeverygraduateclassappliedtotheMSportion
of their degree. In addition, students will be required to pass an oral qualifying exam based on a review paper
submittedintheirfinalsemester.Studentsmustformacommitteeaspartoftheiractionplantocompletetheir
graduate work. This committee will be comprised of at least 3 CMMB faculty, and will serve asthe examination
committeeforthereviewpaperrequiredaspartoftheM.S.portionoftheirdegree.Uponapprovalofthatpaper,
studentsmustsuccessfullycompleteacomprehensiveoralexambytheircommittee.

Timelineandbenchmarks:

1. Completionofprerequisiteupperdivisioncoursesandapplicationtotheacceleratedprogram.Typically
studentswillbeintheirjunioryear.

2. Acceptanceintotheprogramandanactionplanwithinasemesterofapplication.

3. Studentswilltakeupto12creditsofgraduatecreditinCMMBcoursesfollowingacceptanceintothe
program.Typicallythesecourseswillbetakeninthelatterhalfofthejunioryearandinthesenioryear.
BioAdvisewillmonitortheprogressofthestudentsandensuretheyfollowtheiractionplan.Studentswho
donotcompleteatleast9hoursofgraduateworkbygraduationwillbedroppedfromtheacceleratedM.S.
program.

4. GREexamswillbetakeninatimelymannersoscoreswillbeavailableforadmissiontotheM.S.portionof
theprogram.StudentswhodonotcompletetheGREintimewillnotbeadmittedtotheacceleratedM.S.
program.

5. StudentsmustapplyforadmissiontotheM.S.portionoftheprograminatimelymanner(Falladmission
deadlineisFebruary15,SpringdeadlineisAugust1).

6. Studentsadmittedtotheacceleratedprogrammustformacommitteepriortothebeginningoftheirfirst
semesterintheM.S.portionoftheprogramandmustcontinuetofollowtheactionplanwhichwillbe
monitoredbyBioAdvise.

7. StudentsadmittedtotheacceleratedM.S.programmustcompletetherequirementswithinthreesemesters
orwillbedismissedfromtheprogram.

USFTampaGraduateCatalog20132014 Biology(M.S.)


121
http://www.cas.usf.edu/
ModelCurriculumforAcceleratedNonthesisM.S./B.S.

Year1
BSC2010andBSC2011withlabs 8

Year2
MCB3410CellMetabolism 3
PCB3063Geneticsandlab 4
PCB3023CellBiologyandlab 4

Year3
PCB4024MolecularBiologyoftheCell 3
PCB4026MolecularBiologyoftheGene 3
3hourgraduateelectivestructuredcourse(5000) 3

Year4
9hourgraduateelectivecourses(5000or6000 9

Year5
18hourgraduatecourses
9hrofwhichmustbederivedfromthelistbelow

BSC6932Bioinformatics 14
BSC6932Virology 14
PCB6525MolecularGenetics 3
BSC5425GeneticEngineering 3
PCB6236AdvancedImmunology 4
BSC6932ProkaryoticMolecularGenetics 14

4hournonstructured(seminar,independentstudy,laboratoryresearch)
Oralexamandreviewpaperdoneattheendofyear5

ECOLOGYANDEVOLUTION(EEV)
OfferedfromtheDepartmentofIntegrativeBiology(IB)
Description:SeeProgramlisting.

ConcentrationRequirements17hoursminimum
Seventeen(17) credithoursof courseworkselected fromthelistbelow:Thegraduatestudent,majorprofessor
and Graduate committee will establish the specific courses for each graduate student. Other courses, not listed
below,canbesubstitutedifapprovedbytheGraduateCommittee.Specificcoursetrainingbeyondthispointwill
bedeterminedineachindividualcasebythespecialneedsofthestudentasdecidedbythestudent'sGraduate
Committee.

BSC5931ConservationBiology 3
BOT5185MarineBotany 4
PCB6455StatisticalEcology 3
PCB6456BiometryI 4
PCB6458BiometryII 3
BSC5931ComparativeApproachesinEvolution 3
PCB6426PopulationEcology 3
ZOO5463Herpetology 4
ZOO5456Ichthyology 4
BSC6932AdvancesinPopulationBiology 1
USFTampaGraduateCatalog20132014 Biology(M.S.)


122
http://www.cas.usf.edu/
BSC6932AdvancesinIchthyology 1
BSC6932AdvancesinHerpetology 1
BSC6932AdvancesinMarineEcology 1
BSC6932ScientificWriting 2
BSC6932RestorationEcology 3
BSC6447CommunityEcology 3
PCB6933SeminarinEcology (variablecredit)

ENVIRONMENTALANDECOLOGICALMICROBIOLOGY(EVM)
OfferedfromtheDepartmentofIntegrativeBiology
Description:SeeProgramlisting.

ConcentrationRequirements17hoursminimum
Aminimumof17credithoursofcourseworkselectedfromthelistbelow.Thegraduatestudent,majorprofessor
and graduate committee will establish the specific courses for each graduate student. Other courses, not listed
below,canbesubstitutedifapprovedbytheGraduateCommittee.Specificcoursetrainingbeyondthispointwill
bedeterminedineachindividualcasebythespecialneedsofthestudentasdecidedbythestudent'sGraduate
Committee.GraduatestudentsconcentratingintheareaofEnvironmentalandEcologicalMicrobiologywillselect
fromthefollowinglistofcourses:

MCB5206PublicHealthandPathogenicMicrobiology 3
MCB5655AppliedandEnvironmentalMicrobiology 3
PCB5235PrinciplesofImmunology 3
MCB6930SeminarinAppliedandEcologicalMicrobiology 1
PCB6525MolecularGenetics 3
BSC5931Genomics 4
PCB6456BiometryI 4
PCB6458BiometryII 3
PCB6455StatisticalEcology 3
BSC6932AdvancesinEnvironmentalEcology 1

PHYSIOLOGYANDMORPHOLOGY(PMY)
OfferedfromtheDepartmentofIntegrativeBiology
Description:SeeProgramlisting.

ConcentrationRequirements17hoursminimum
Aminimumof17credithoursofcourseworkselectedfromthelistbelow.Thegraduatestudent,majorprofessor
and graduate committee will establish the specific courses for each graduate student. Other courses, not listed
below,canbesubstitutedifapprovedbytheGraduateCommittee.Specificcoursetrainingbeyondthispointwill
bedeterminedineachindividualcasebythespecialneedsofthestudentasdecidedbythestudent'sGraduate
Committee.GraduatestudentsconcentratingintheareaofEnvironmentalandEcologicalMicrobiologywillselect
fromthefollowinglistofcourses:

MCB5206PublicHealthandPathogenicMicrobiology 3
MCB5655AppliedandEnvironmentalMicrobiology 3
PCB5235PrinciplesofImmunology 3
MCB6930SeminarinAppliedandEcologicalMicrobiology 1
PCB6525MolecularGenetics 3
BSC5931Genomics 4
PCB6456BiometryI 4
PCB6458BiometryII 3
PCB6455StatisticalEcology 3
BSC6932AdvancesinEnvironmentalEcology 1
USFTampaGraduateCatalog20132014 Biology(M.S.)


123
http://www.cas.usf.edu/

M.S.inBiologyNonThesisOption

NonThesis.Forstudentsenrolledinthenonthesisprogram,a30hourminimumisrequiredatthe50006000level;
26 hours must be in formally structured courses, 16 hours must be at the 6000 level; 15 structured hours must be
offeredbyBiology.Areviewpaperofatopicapprovedbythesupervisorycommitteeisrequiredaswellassuccessful
completion of the comprehensive oral qualifying exam after all course work has been completed. For nonthesis
mastersstudents,thisexamwilloccurattheendoftheprogramofstudy.

Comprehensive Oral Qualifying Examination. A comprehensive examination (thesis proposal, seminar/presentation


and defense of thesis proposal) is required for all masters students. This examination is open to all departmental
faculty.Studentsmusttaketheircomprehensiveexamwithintwosemestersofmatriculationandtheexamisnormally
takenafterthecompletionofallformalcoursework.Thesisstudentsmusttaketheexaminationatleastonesemester
before the thesis is presented. Any graduate work counted toward the requirement for the M.S. degree must be
completedwithinfive(5)yearsaftermatriculation.

AllthesisbasedMastersDegreestudentsmustpresentaseminartotheDepartmentofBiologyandmustbeenrolled
in BSC 6935, during the final semester. The seminar should be a concise summary of the CMMB or IB research
completed to satisfy the requirements for the M.S. Degree. The seminar is open to the general public and must be
announcedtwoweekspriortothepresentation.Uponcompletionoftheseminar,thegeneralpublicwillbeinvitedto
ask questions. At the discretion of the students graduate committee, members of the committee may continue to
question the graduate student after the general public has departed the seminar room. Each student is expected to
defendhis/herresearchtotheunanimoussatisfactionofthegraduatecommittee.

COURSES
Forupdatedlistofcoursessee:http://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 CancerBiology(Ph.D.)


124
http://www.cas.usf.edu/
CANCERBIOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall:
U.S. February1
International: January2

MinimumTotalHours: 96
ProgramLevel: Doctoral
CIPCode: 26.0911
Dept.Code: BIO
Program(Major/College): CNBAS
CONTACTINFORMATION

College: ArtsandSciences
Department: CellBiology,Microbiology,and
MolecularBiology(CMMB)

ContactInformation:www.grad.usf.edu

PROGRAMINFORMATION

TheCancerBiologyProgramconsistsofinterdisciplinarytraininginmultiplefieldsemphasizingthefacetswhichimpact
cancer. This will prepare students to enter the emerging new technological workforce required to implement
biomedicaladvancesthatwillhaveakeyimpactonglobalhealthandyieldsignificantsocietaladvantages.

TheProgramisajointendeavorbetweentheMoffittCancerCenterandtheUniversityofSouthFlorida.Tremendous
advancesinthedetectionandtreatmentofcancerhasoccurredthroughbasicresearchandtranslationalmedicine,yet
cancer continues to adversely affect millions of people worldwide in terms of quality of life, life span, and economic
burden.TheMoffittCancerCenterlocatedattheUniversityofSouthFloridaisaleadinginstitutionofbasicresearch,
clinicalresearch,andpatienttreatmentwithafocusedmissiontocontributetothepreventionandcureofcancer.
TheMoffittCancerCenterisofficiallydesignatedasaComprehensiveCancerCenterbytheNationalCancerInstituteof
theNationalInstitutesofHealth.

The Cancer Biology Ph.D. Programs goal is to train the next generation of cancer researchers. Studies of cancer
require specific knowledge in multiple fields that have traditionally been independent. Our Cancer Biology Ph.D.
program emulates the Moffitt Cancer Center and eliminates these boundaries. Students receive cancer oriented
traininginmultipleareasinclude:molecularbiology,immunology,functionalgenomics,bioinformatics,drugdiscovery
& development, cancer genetics, cancer prevention & control, cancer therapeutics, cell biology, biochemistry, and
proteomics.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Extensivebackgroundinfieldofbiologyorchemistry
GRErequiredforfullconsideration
GPAofatleast3.00orgreater
Advancedcourseworkandresearchexperiencepreferred

USFTampaGraduateCatalog20132014 CancerBiology(Ph.D.)


125
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

AllstudentsarerequiredtosuccessfullycompletetheCancerBiologyProgramCoreCourses.DissertationCommittees
may require students to take additional course work if needed to correct deficiencies. In special circumstances the
Cancer BiologyEducation Committee can waive course requirements, if the student has recently completed identical
coursework elsewhere.Students arerequiredtoachieveaminimumGPAofBinallCancerBiologyCorecoursesand
anoverallGPAof3.00(B)inordertoremainingoodstanding.

Stipends
All Cancer Biology Ph.D. students in good standing will receive a highly competitive stipend All students also receive
studenthealthinsurancecoverageanddirectpaymentinfullofallrequiredtuitionandrequiredfees.Pleasevisitthe
Programswebsiteforcurrentstipendlevels

TotalMinimumHours: 96credithours

COREREQUIREMENTS
RequiredCancerBiologyCoreCourses 16hoursminimum
BSC6457 CancerResearchTechniques 2
PCB6230 BasicsofMolecularOncology 3
PCB6231 CancerImmunology 4
PCB6205 CancerGenomicsandDrugDiscovery 3
PCB6521 CancerGenetics 3
PCB6932 BioethicsforCancerResearchers 1

LabRotations 2Hoursminimum
PCB6910 CancerLaboratoryRotations 13

Duringthefirstyear,studentswillberequiredtocompletetwoorthreelaboratoryrotationsaccordingtotheir
interest.Laboratoryrotationsmaybeforafullsemesteror10weeksforstudentsthatchoosetodothreerotations.
Studentsdoingrotationswillneedtoenrollinthelaboratoryrotationcourse.Ifastudenthasnotchosenamajor
professoraftertwosemesters,theymayenrollinanadditionalsummerrotation.Rotationshaveseveralpurposes.The
foremostistohelpthestudentschooseacompatiblemajorprofessorandanexcitingresearchproject.Asecond
purposeisforstudentstodevelopnecessarytechnicalskills.Studentswillbeevaluatedbythehostprofessorandthe
GraduateAdvisorwillassignagradetoeachstudentattheendofthesemester.

OtherCourseRequirements: 18Hoursminimum
BSC7911 DirectedResearch 412
PCB6931 AdvancesinCancerBiology 412
PCB6930 CurrentTopicsinOncology 48

OptionalCancerBiologyCourses:
BCS6939 SelectedTopicsinCancerBiology 16

QualifyingExam
Therequiredqualifyingexamconsistsofawrittenresearchproposalandanoraldefenseoftheproposalbythe
student.

Dissertation 24hoursminimum
BSC7980 Dissertation
Priortothedissertationdefense,studentsmusthaveanoriginalfirstauthorresearchreportacceptedforpublication
inapeerreviewedscientificjournal.

OtherRequirements 36hoursminimum
Remainingcredithoursrequiredtomeetthe96hourminimumforgraduationwillconsistofadditionalDissertation
hours(BSC7980),SelectedTopicsinCancerBiology(BCS6939),and/orProgramapprovedelectives.

COURSES Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 CellandMolecularBiology(Ph.D.)


126
http://www.cas.usf.edu/
CELLANDMOLECULARBIOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Domestic
Fall: January1
forfullconsideration;
ApplicationsareacceptedtoFebruary1(USapplicants
only)
Spring: August1
Summer: NoAdmission

InternationalStudentsLivingOutsidetheU.S.
Fall: January1
Spring: July1
Summer: NoAdmission

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 26.0406
DeptCode:
Program(Major/College): Tobeassigned

CONTACTINFORMATION

College: ArtsandSciences
Department: CellBiology,Microbiology, and
Molecular Biology(CMMB)
ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:CellBiology,MolecularBiology,CancerBiology,SignalTransductionandGeneRegulation,
DevelopmentalBiology,AppliedandGeneralMicrobiology

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

3.00GPAlast60hoursofB.S.degree.

GRE:57
th
percentileVerbal,35
th
percentileQuantitative,73
rd
percentileAW

AllinternationalstudentsarerequiredtosubmittheTOEFLtest.NonnativeEnglishspeakinggraduatestudents
mustscoreaminimumofatleast570onthepaperbasedoraminimumtotalscoreof79ontheinternetbased
testTOEFLandatleast50ontheTSEtobeeligibleforateachingassistantship.

ItisexpectedthatcandidatesforthePh.D.degreewillhavecompletedcoursesequivalenttothoserequiredfor
theB.S.inBiologyatU.S.F.

Interview
USFTampaGraduateCatalog20132014 CellandMolecularBiology(Ph.D.)


127
http://www.cas.usf.edu/

PersonalStatementofgoals,experience

Threelettersofrecommendation

DEGREEPROGRAMREQUIREMENTS

TotalMinimumProgramHours 90

CoreRequirements 6Hours
PCB6525MolecularGenetics 3
PCB6956ScientificGrantWriting 3

OtherRequiredCourses 7Hours
PCB6920AdvancesinCellularandMolecularBiology 1
BSC6930LecturesinContemporaryBiology(1)takenfourtimes 4
PCB6093AdvancesinScientificReview 2

Electives* 6hoursminimum
Selectedfrom:
PCB5616MolecularPhylogenetics 3
PCB6107AdvancedCellBiology 4
BSC5425GeneticEngineeringandRecombinantDNATechnology 3
MCB5206PublicHealth&PathogenicMicrobiology 3
PCB6236AdvancedImmunology 4
PCB5256DevelopmentalMechanisms 3
BSC6932SelectedTopics 14
*ClassesnotonthislistmaybeusedwiththeapprovaloftheCMMBGraduateProgramDirector

ResearchRequirements71hoursminimum
BSC7910DirectedResearch 32hoursminimum
BSC7980DissertationResearch 38hoursminimum
BSC7936PhDSeminar 1hour

QualifyingExams
All students in the Cell and Molecular Biology Ph.D. program must complete a written and oral qualifying
examination.

Thewrittenexamshallbeintheformatofagrantproposalandcontainthefollowingsections:
Abstract{300words}
SpecificAims[1page]
BackgroundandSignificanceoftopics[45pages]
Proposedresearchprogram(conductedover3yearperiod)[910pages]
Bibliography(nopagelimit)

Thelengthoftheproposalshallbenomorethan15pages(theabstractandbibliographydoesnotcountinthe
pagelimit).Thetopicoftheexamshallmeetthefollowingguidelines:
Thewrittenproposalcannotbebasedinthesamemodelorganismthatthestudentwillusetocarryout
theirdissertationresearch
Thewrittenproposalcannotbebasedontheanalysisofthesamegene/proteinthatthestudentwill
investigateduringtheirdissertationresearch
Thewrittenproposalcannotbebasedontheanalysisofthesamepathwaythatthestudentwillinvestigate
duringtheirdissertationresearch

The oral exam is centered around a formal dissertation proposal presentation, followed by a period of
questioningbythedissertationadvisorycommittee.
USFTampaGraduateCatalog20132014 CellandMolecularBiology(Ph.D.)


128
http://www.cas.usf.edu/

AdmissiontoCandidacy
The doctoral student is eligible for admission to candidacy after completing structured course requirements,
passingthequalifyingexaminationsandapprovalbythesupervisorycommittee.Appropriateformstodocument
promotion to candidacy must be completed and to the Graduate School. Following admission to candidacy, a
student must enroll in BSC 7980 when engaged in research, data collection, or writing activities relevant to the
doctoral dissertation. Advisors should assign the number of credits in this course in accordance with policy and
appropriatetothedemandsmadeonfaculty,staff,andUniversityfacilities,butinnoeventwillthetotalnumber
of earneddissertation credits be fewer than 38.Students not admitted to candidacy are not eligible to enroll in
BSC7980.

DissertationRequirements
The dissertation of all graduate students admitted to a graduate degree program at the University of South
FloridamustconformtotheguidelinesoftheHandbookforGraduateThesisandDissertationsavailablefromthe
USFGraduateSchool(http://www.grad.usf.edu/thesis.asp).

DoctoralSeminarandDefense
AlldoctoralstudentsmustpresentapublicseminartotheCMMBDepartmentandmustbeenrolledinBSC7980,
during the semester in which the seminar is given. The seminar should be a concise summary of the research
completed to satisfy the requirements for the Ph.D. The seminar is open to the general public and must be
announced two weeks prior to the presentation. Upon completion of the seminar, the general public will be
invitedtoaskquestions.Atthediscretionofthestudentsadvisorycommittee,membersofthecommitteemay
continuetoquestionthegraduatestudentafterthegeneralpublichasdepartedtheseminarroom.Eachstudent
is expected to defend his/her research to the unanimous satisfaction of the advisory committee. Following the
defense, students will make any editorial modifications to the dissertation as recommended by the advisory
committeeandsubmitthedissertationtotheGraduateSchool.

OtherRequirements
1ScientificPublication
2presentationsatScientificMeetings

CourseSequence
Fallyear1 BSC7910DirectedResearch(2) ResearchReq.
BSC6093AdvancesinScientificReview (2) OtherRequired
PCB6920AdvancesinCellular&MolecularBiology(1) OtherRequired
BSC6930LecturesinContemporaryBiology(1) OtherRequired
PCB6525MolecularGenetics(3) Core

Springyear1 BSC7910DirectedResearch(2) ResearchReq.


BSC6956ScientificGrantWriting(3) Corecourse
Elective(3) Elective
BSC6930LecturesinContemporaryBiology(1) OtherRequired

Summeryear1 BSC7910DirectedResearch(6) ResearchReq.

Fallyear2 BSC7910DirectedResearch(5) ResearchReq.


Elective(3) Elective
BSC6930LecturesinContemporaryBiology(1) OtherReq.

Springyear2 BSC7910DirectedResearch(8) ResearchReq.


BSC6930LecturesinContemporaryBiology(1) OtherRequired

Summeryear2 BSC7910DirectedResearch(6) ResearchReq.

Fallyear3* BSC7910DirectedResearch(9) Research



*studentsshouldadvancetocandidacybythecloseoftheFallofyear3..Untilcandidacyisattained,studentsmustenrollin
BSC7910.Oncecandidacyhasbeenachieved,studentsmustenrollinBSC7980,startingwiththesemesterfollowingadmissionto
candidacy.

USFTampaGraduateCatalog20132014 CellandMolecularBiology(Ph.D.)


129
http://www.cas.usf.edu/
Springyear3 BSC7980DoctoralDissertation (9) Research

Summeryear3 BSC7980DoctoralDissertation (6) Research

Fallyear4 BSC7980DoctoralDissertation (9) Research

Springyear4 BSC7980DoctoralDissertation (8) Research


BSC7936PhDSeminar(1) Research

*Studentsareexpectedtofinishintheir4
th
yearbutsomemayrequireadditionaltime

COURSES
Foranupdatedlistofcourseofferingssee:http://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Chemistry(M.A.)


130
http://www.cas.usf.edu/
CHEMISTRYPROGRAM(NONTHESISOPTION)

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October1
MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 40.0501
Dept.Code: CHM
Program(Major/College): CHAAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Chemistry

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu
http://chemistry.usf.edu

PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
In addition to the five (5) traditional areas, research opportunities also are available in such interdisciplinary and
specialized areas as Bioorganic and Bioinorganic Chemistry, Environmental Chemistry, Nuclear Magnetic Resonance
Spectroscopy, Computer Modeling, Polymers, Photochemistry, Marine Chemistry, Medicinal Chemistry,
Electrochemistry,NucleicAcidChemistry,andEnzymology.

TheDepartmentofChemistryoffersDoctorofPhilosophy,MasterofScience,andNonthesisMasterofArtsdegrees.
TheChemistrygraduatefacultyiscomprisedof24fulltimeseniorfacultymembers,allholdingthePh.D.degree.The
combinationofalargeandstrongfacultywithawidevarietyofcoursesandelectivesprovidesstudentswithprograms
of study that can be tailored to fit individual needs, while maintaining a sound background in all general aspects of
Chemistry.Theexcellentresearchfacilitiesandverylowstudentfacultyratiocombinetoafforduniqueopportunities
foradvancedstudyinChemistry.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
ApplicantsmusthaveearnedaBAorBSdegreeinChemistry.*Inaddition,applicantsmusthavethefollowing:

apreferredscoreof430V,570Q,3.0AWontheGRE.Subjectexamisrecommended,butnotrequired.
aminimumofa3.00gradepointaverageinthelasttwoyearsofchemistrycoursework
lettersofrecommendationfromatleastthreeormorepeoplewhoknowthestudentsacademicbackground
and, for applicants whose native language is not English, a minimum of 550 on the TOEFL exam and for such
applicantsaminimumof50ontheTSEifalsoapplyingforanassistantship.

*Applicantswithotherdegreeswillbeconsideredonacasebycasebasis.

InternationalstudentsfollowUSFInternationalAdmissionsdeadlines.Domesticstudentsfollowrollingadmission.

USFTampaGraduateCatalog20132014 Chemistry(M.A.)


131
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

GeneralProgramRequirements
Graduatestudentsmustmaintainanoverallgradepointaverage(GPA)of3.00(B)inallcourses.Anygraduatestudent
whofallsbelow a3.00GPAattheendofanygivensemesterwillbeplacedon academicprobationandhasthenext
two semesters (excluding summers) to remedy the situation before being dismissed from the program. No grade
belowCwillbeacceptedtowardagraduatedegree,butwillbeusedinthecomputationoftheoverallGPA.

EnforcementofMinimumStandards
TheGraduateCouncilshallberesponsibleforensuringthatallgraduatestudentsmeettheminimumstandardsasset
down in the Graduate Student Handbook. The Graduate Coordinator will periodically review the standing of each
studentwithregardtogradepointaverage(GPA),academicprogress,and(inthecaseofteachingassistants)teaching
performance and notify the Graduate Council as necessary. Should disciplinary action appear in order, the students
majorprofessorwillbeconsulted(inordertoobtainasmanyrelevantfactsaspossible)beforesuchactionistaken.

Probation
StudentswhofailtomeettheminimumGPA(3.00forallgraduatecourses)shallbeplacedonprobation.Thestudents
GPAmustmeettheminimumof3.00bytheendofthesemesterinwhichprobationwasinitiatedorterminationfrom
thegraduateprogramwillresult.

Appeals
In actions based on departmental requirements, petitions and appeals shall be directed to the Chemistry Graduate
Council throughthestudentsmajorprofessor.(Incaseofastudentwhohasnotyetselected amajorprofessor,the
appeal may be carried out through the Graduate Coordinator or through some other chemistry faculty member
selected by the student.) Unsuccessful appeals to the Chemistry Graduate Council may be further carried to the
chemistryfacultyasawhole,andfromtheretotheDeanoftheCollegeandthentotheUniversityGraduateCouncilif
necessary.

MinimumGradesinCourses
AlthoughallgradesingraduatelevelcourseswillbeusedincomputingthestudentsGPA,nogradebelowCmaybe
counted toward fulfillment of the approved course of study. Consequently, any such course in which a student
receives a grade below C must be repeated, or have the requirement waived by the Supervisory Committee. A
student who receives three grades lower than a B in structured courses required by his supervisory committee to
meet the structured course requirement will be dropped from the program. A student who receives a grade of U
while a chemistry graduate student will be placed on automatic probation. A second U grade is grounds for
termination from the Program, and the Chemistry Graduate Council will automatically review the students status.
Studentsonprobationarenotexcludedfromhavingteachingassistantshipsduringtheprobationarysemester.

Seminars
AllchemistrygraduatestudentsmustsatisfythefollowingminimumrequirementsforCHM6935:

enrollmenteverysemesteroftheregularacademicyearduringhis/hercareerasagraduatestudent,or

enrollmentinseven(7)credithoursforthePh.D.;four(4)credithoursfortheMastersdegree.A
maximumoftwounexcusedabsenceswillbepermittedeachsemester,whicheverisless.Under
exceptionalcircumstances,studentsmaypetitionforawaiveronasemesterbysemesterbasisif
employmentorotherobligationsconflictwiththerequirement.

MastersDegreeGeneralRequirements
Students must meet all degree requirements as specified by the Graduate School. Study for the M.A and the M.S.
should take between two and three calendar years beyond the baccalaureate degree to complete. Specific
requirementsinclude:aminimumofthirty(30)credithoursbeyondthebaccalaureatedegree;sixteen(16)hoursmust
beatthe6000level.

USFTampaGraduateCatalog20132014 Chemistry(M.A.)


132
http://www.cas.usf.edu/
M.A.inChemistry(NonThesisOption)
ProgramRequirements

a) 26hoursmustbeinformallystructuredcoursesapprovedbythestudentscommittee.

b) Preparationofareviewpaperonatopicapprovedbythesupervisorycommittee.Thefinalpapermustbe
approvedbythesupervisorycommittee.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Chemistry(M.S.)


133
http://www.cas.usf.edu/
CHEMISTRYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October1
MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 40.0501
Dept.Code: CHM
Program(Major/College): CHMAS

Concentrations:
AnalyticalChemistry(ACH),Biochemistry(BCH),
ComputationalChemistry(CPC),Environmental
Chemistry(EVC),InorganicChemistry(IOG),Organic
Chemistry(OCH),PhysicalChemistry(PCH),Polymer
Chemistry(POC)

Alsoofferedasa5yearProgram

CONTACTINFORMATION

College: ArtsandSciences
Department: Chemistry

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheDepartmentofChemistryoffersDoctorofPhilosophy,MasterofScience,andNonthesisMasterofArtsdegrees.
TheChemistrygraduatefacultyiscomprisedof24fulltimeseniorfacultymembers,allholdingthePh.D.degree.The
combinationofalargeandstrongfacultywithawidevarietyofcoursesandelectivesprovidesstudentswithprograms
of study that can be tailored to fit individual needs, while maintaining a sound background in all general aspects of
Chemistry.Theexcellentresearchfacilitiesandverylowstudentfacultyratiocombinetoafforduniqueopportunities
foradvancedstudyinChemistry.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
In addition to the five (5) traditional areas, research opportunities also are available in such interdisciplinary and
specialized areas as Bioorganic and Bioinorganic Chemistry, Environmental Chemistry, Nuclear Magnetic Resonance
Spectroscopy, Computer Modeling, Polymers, Photochemistry, Marine Chemistry, Medicinal Chemistry,
Electrochemistry,NucleicAcidChemistry,Enzymology,MaterialsChemistryandChemicalEducation.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
ApplicantsmusthaveearnedaB.A.orBSdegreeinChemistry.*Inaddition,applicantsmusthave

officialtranscripts
apreferredGREscoreof430V,570Q,3.0AWThesubjectexamisrecommended,butnotrequired.
aminimumofa3.00gradepointaverageinthelasttwoyearsofchemistrycoursework
lettersofrecommendationfromatleastthreeormorepeoplewhoknowthestudentsacademicbackground
USFTampaGraduateCatalog20132014 Chemistry(M.S.)


134
http://www.cas.usf.edu/
and,forapplicantswhosenativelanguageisnotEnglish,aminimumof550ontheTOEFLexamandforsuch
applicantsaminimumof50ontheTSEifalsoapplyingforanassistantship.

*Applicantswithotherdegreeswillbeconsideredonacasebycasebasis.

InternationalstudentsfollowUSFInternationalAdmissionsdeadlines.Domesticstudentsfollowrollingadmission.

DEGREEPROGRAMREQUIREMENTS

GeneralProgramRequirements
Graduatestudentsmustmaintainanoverallgradepointaverage(GPA)of3.0(B)inallcourses.Anygraduatestudent
whofallsbelowa3.0GPAattheendofanygivensemesterwillbeplacedonacademicprobationandhasthenexttwo
semesters(excludingsummers)toremedythesituationbeforebeingdismissedfromtheprogram.NogradebelowC
willbeacceptedtowardagraduatedegree,butwillbeusedinthecomputationoftheoverallGPA.

EnforcementofMinimumStandards
TheGraduateCouncilshallberesponsibleforensuringthatallgraduatestudentsmeettheminimumstandardsasset
down in the Graduate Student Handbook. The Graduate Coordinator will periodically review the standing of each
studentwithregardtogradepointaverage(GPA),academicprogress,and(inthecaseofteachingassistants)teaching
performance and notify the Graduate Council as necessary. Should disciplinary action appear in order, the students
majorprofessorwillbeconsulted(inordertoobtainasmanyrelevantfactsaspossible)beforesuchactionistaken.

Probation
StudentswhofailtomeettheminimumGPA(3.0forallgraduatecourses)shallbeplacedonprobation.Thestudents
GPAmustmeettheminimumof3.0bytheendofthesemesterinwhichprobationwasinitiatedorterminationfrom
thegraduateprogramwillresult.

Appeals
In actions based on departmental requirements, petitions and appeals shall be directed to the Chemistry Graduate
Council throughthestudentsmajorprofessor.(Incaseofastudentwhohasnotyetselected amajorprofessor,the
appeal may be carried out through the Graduate Coordinator or through some other chemistry faculty member
selected by the student.) Unsuccessful appeals to the Chemistry Graduate Council may be further carried to the
chemistryfacultyasawhole,andfromtheretotheDeanoftheCollegeandthentotheUniversityGraduateCouncilif
necessary.

MinimumGradesinCourses
AlthoughallgradesingraduatelevelcourseswillbeusedincomputingthestudentsGPA,nogradebelowCmaybe
counted toward fulfillment of the approved course of study. Consequently, any such course in which a student
receives a grade below C must be repeated, or have the requirement waived by the Supervisory Committee. A
student who receives three grades lower than a B in structured courses required by his supervisory committee to
meet the structured course requirement will be dropped from the program. A student who receives a grade of U
while a chemistry graduate student will be placed on automatic probation. A second U grade is grounds for
termination from the Program, and the Chemistry Graduate Council will automatically review the students status.
Studentsonprobationarenotexcludedfromhavingateachingassistantshipsduringtheprobationarysemester.

Seminars
All chemistry graduate students must satisfy the following minimum requirements for CHM 6935: enrollment every
semester of the regular academic year during his/her career as a graduate student, or enrollment in seven (7) credit
hours for the Ph.D.; four (4) credit hours for the Masters degree. A maximum of two unexcused absences will be
permittedeachsemester,whicheverisless.Underexceptionalcircumstances,studentsmaypetitionforawaiverona
semesterbysemesterbasisifemploymentorotherobligationsconflictwiththerequirement.

MastersDegreeGeneralRequirements
Students must meet all degree requirements as specified by the Graduate School. Study for the M.A and the M.S.
should take between two and three calendar years beyond the baccalaureate degree to complete. Specific
USFTampaGraduateCatalog20132014 Chemistry(M.S.)


135
http://www.cas.usf.edu/
requirementsinclude:aminimumofthirty(30)credithoursbeyondthebaccalaureatedegree;sixteen(16)hoursmust
beatthe6000level.

ProgramRequirements
a) 20hoursofformallystructuredcoursesapprovedbythestudentscommittee
b) aresearchprojectresultinginawrittenthesis
c) anoralthesisdefense,whichwillserveasthefinalcomprehensiveexaminationrequiredbytheGraduateSchool

AgraduatestudentworkingonamastersdegreeinaprogramthatrequiresathesismustregisterincourseCHM6973
or CHM 6971 when engaged in research, data collection, or writing activities relevant to the masters thesis. The
numberofcreditsinthesecoursesmustbeappropriatetothedemandsmadeonfaculty,staff,anduniversityfacilities.
Editorsnote:forinformationontheUniversitysenrollmentpolicyrelevanttoathesis,refertotheenrollmentsection
oftheAcademicPoliciesinthiscatalog.

FinalThesisDefense
Each student should consult with their supervisory committee for deadlines in submitting the thesis prior to the
defense. Thesis or dissertation defense are not normally scheduled during final exam week or during the weeks
between regularly scheduled sessions. The thesis defensemust be scheduled through the Chemistry Graduate Office
atleasttwoweeksinadvance.TheChemistryGraduateOfficewillthenannouncethedefensetotheentireChemistry
Department. The candidate normally defends their thesis in the fourth or fifth year. EDITORS NOTE: these deadlines
are in addition to those imposed by the Graduate School. The Graduate School sets deadlines pertaining to
thesis/dissertationseachsemester.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Chemistry(Ph.D.)


136
http://www.cas.usf.edu/
CHEMISTRYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October1
Summer: January1

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 40.0501
Dept.Code: CHM
Program(Major/College): CHMAS

Concentrations:
AnalyticalChemistry(ACH),Biochemistry(BCH),
ComputationalChemistry(CPC),Environmental
Chemistry(EVC),InorganicChemistry(IOG),Organic
Chemistry(OCH),PhysicalChemistry(PCH),Polymer
Chemistry(POC)

CONTACTINFORMATION

College: ArtsandSciences
Department: Chemistry

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheDepartmentofChemistryoffersDoctorofPhilosophy,MasterofScience,andNonthesisMasterofArtsdegrees.
TheChemistrygraduatefacultyiscomprisedof19fulltimeseniorfacultymembers,allholdingthePh.D.degree.The
combinationofalargeandstrongfacultywithawidevarietyofcoursesandelectivesprovidesstudentswithprograms
of study that can be tailored to fit individual needs, while maintaining a sound background in all general aspects of
Chemistry.Theexcellentresearchfacilitiesandverylowstudentfacultyratiocombinetoafforduniqueopportunities
foradvancedstudyinChemistry.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Inadditiontothe5traditionalareas,researchopportunitiesalsoareavailableinsuchinterdisciplinaryandspecialized
areas as Bioorganic and Bioinorganic Chemistry, Environmental Chemistry, Nuclear Magnetic Resonance
Spectroscopy, Computer Modeling, Polymers, Photochemistry, Marine Chemistry, Medicinal Chemistry,
Electrochemistry,NucleicAcidChemistry,andEnzymology.

TheDepartmentofChemistryoffersDoctorofPhilosophy,MasterofScience,andNonthesisMasterofArtsdegrees.
TheChemistrygraduatefacultyiscomprisedof24fulltimeseniorfacultymembers,allholdingthePh.D.degree.The
combinationofalargeandstrongfacultywithawidevarietyofcoursesandelectivesprovidesstudentswithprograms
of study that can be tailored to fit individual needs, while maintaining a sound background in all general aspects of
Chemistry.Theexcellentresearchfacilitiesandverylowstudentfacultyratiocombinetoafforduniqueopportunities
foradvancedstudyinChemistry.

USFTampaGraduateCatalog20132014 Chemistry(Ph.D.)


137
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
ApplicantsmusthaveearnedaB.A.orBSdegreeinChemistry.Applicantswithotherdegreeswillbeconsideredona
casebycasebasis.Inaddition,applicantsmusthave

officialtranscripts
apreferredGREscoreof430V,570Q,3.0AW.Thesubjectexamisrecommended,butnotrequired
aminimumofa3.00gradepointaverageinthelasttwoyearsofchemistrycoursework
lettersofrecommendationfromatleastthreeormorepeoplewhoknowthestudentsacademicbackground
andforapplicantswhosenativelanguageisnotEnglish,aminimumof550ontheTOEFLexamandforsuch
applicantsaminimumof50ontheTSEifalsoapplyingforanassistantship

InternationalstudentsfollowUSFInternationalAdmissionsdeadlines.Domesticstudentsfollowrollingadmission.

DEGREEPROGRAMREQUIREMENTS

Students with only a Bachelors degree must take 4 ACS entrance exam (with an option to take Biochemistry or
Analytical and a requirement to take core exams in Organic, Inorganic, and Physical Chemistry). They must obtain at
leastthenationalmedianACSscoreintherequiredcoreexamstopass.Iftheyfail,theyhavetheoptiontoretakethe
examorremediatethedeficiencybyobtainingatleastB(notaB)inoneofourupperdivisionundergraduatecourses
(or by taking the exams in the appropriate course and obtaining the equivalent grade) in the area of the deficiency
before their candidacy exam. Students with a Masters degree may be required to adhere to the policy at the
discretion of the Graduate Council at the time of acceptance. Entering students will have a Promotion to Candidacy
Committee established upon entering the Ph.D. Program. The Committee advises students as to what courses they
need to take in their first semester. There are no set course requirements, but the decision of the Committee is
binding. Students will normally be expected to take the first semester of the first year covering Tools of Research,
including literature search and analysis, proposal writing, oral presentation skills, and laboratory instrumental
techniques. The second semester of the course may be required by a students promotion to Candidacy committee.
Advanced courses in other subject areas may be assigned by the Committee, where appropriate. Final coursework
decisionsaremadebythecandidatesresearchadvisor.

AdvisorSelection
Students need to choose a prePh.D. candidate research adviser by the beginning of the second semester to begin
precandidateresearchinthatlaboratory(Seebelow).Thestudentwillthenproceedtoinitiatearesearchprojectby
thebeginningofthesecondsemesterandthroughthefirstsummerofstudy.Selectionofaresearchadvisorisoneof
the most important decisions a student will make during the graduate career. In order to avoid hasty or poorly
foundeddecisionseachstudentmustdiscusspotentialresearchprojectswithatleastthreemembersofthechemistry
faculty. Appropriate forms can be obtained from the Chemistry Graduate Office and should be completed and
returnednolaterthantheendofthesecondsemester(excludingsummersemester)afterenteringtheprogram.

PromotiontoCandidacy
At the conclusion of the first year (before the start of the third semester), a written research document outlining
progress to date and future plans is submitted to and approved by the Promotion to candidacy Committee. This
proposal is subsequently defended in front of the committee. A successful defense results in Promotion to Ph.D.
Candidacy, contingent upon the student being formally accepted into a research group. The committee must vote
three quarters in favor of the candidate (for a four person committee) or two thirds in favor (for a three person
committee)forapass.Avoteoftwoorfourmembers(oroneofthree)infavorresultsinaconditionalpass,andthe
committeemustsetconditionstobemettopromotethestudentwithin30daysofthefirstmeeting.Atthediscretion
of the committee, the student not promoted to candidacy may be given a pass at a JM.A. level of competency and
proceed to obtain a terminal research masters degree or be terminated from the program. Appropriate forms to
document promotion to candidacy must be completed and forwarded to the Graduate School. The forms may be
obtainedfromtheChemistryGraduateOffice.

USFTampaGraduateCatalog20132014 Chemistry(Ph.D.)


138
http://www.cas.usf.edu/
DissertationCommittee
Upon promotion the candidate must formally choose and declare a research adviser and a dissertation committee
must be established initially with at least three members. An additional committee member from outside the
departmentoruniversitymustbeaddedbeforethefinaldefense.Theresearchadvisorchairsthecommittee.

OriginalResearchProposal
Anoriginalresearchproposalmustbewrittenanddefendedbytheendofthefirstsemesterofthethirdyear.Atthe
discretionoftheresearchadviser,thestudentsoriginalresearchproposalmayormaynotberelatedtothestudents
currentorfutureresearch.Thestudentmustbeinformedoftheresearchadvisers preference inadvanceofseeking
approval for the thesis topic. The dissertation committee formally approves the proposal and its defense. The
candidateshouldmeetwiththedissertationcommittee members(individually orasagroup)todiscusstheproposal
topic. The original research proposal should follow the format of a major federal granting agency appropriate to the
nature of the proposed research. The format of the proposal, in conjunction with the topic, should be approved in
advance by the dissertation committee. The written proposal must be given to the dissertation committee members
twoweeksinadvanceofthescheduleddefense.Afterthedefense,thecommitteemustvotethreequartersinfavorof
thecandidate(forafourpersoncommittee)ortwothirdsinfavor(forathreepersoncommittee)forapass.Avoteof
twooffourmembers(oroneofthree)infavorresultsinaconditionalpass,andthecommitteemustsetconditionsto
be met to pass the candidate within 30 days of the first meeting. Students not passing will normally be terminated
fromthePh.D.program.

ResearchDataPresentationandDissertation
By the end of the fourth year, a research data presentation must be made to dissertation committee and the
committeeformallyadvisesthecandidateonresearchmilestonesthatneedtobemetbeforepermissiontowriteup
thedissertationisgranted.Thepermissiontowriteupthedissertationcanbegivenatanysubsequenttime.Apeer
reviewedpublicationbaseduponthedissertationresearchisrequiredtoobtainthedegreeofPh.D.Note:Extenuating
circumstanceswillbereviewedonacasesbycasebasis.Further,studentshavetowaitaminimumof6monthsafter
successful completion of the Research Data Presentation (aka Data Defense) (and the associated online data base
forms) before they will be permitted to defend their dissertation. This rule can only be waived by the Department
ChairwiththewrittenapprovalofthemajorityoftheThesisCommitteeinthecaseofexceptionalcircumstances.

FinalDissertationDefense
Eachstudentshouldconsultwiththeirsupervisorycommitteefordeadlinesinsubmittingthedissertationpriortothe
defense. Thesis or dissertation defense are not normally scheduled during final exam week or during the weeks
between regularly scheduled sessions. The dissertation defense must be scheduled through the Chemistry Graduate
Office at least two weeks in advance. The Chemistry Graduate Office will then announce the defense to the entire
Chemistry Department. The candidate normally defends their dissertation in the fourth or fifth year. NOTE: these
deadlines are in addition to those imposed by the Graduate School. The Graduate School sets deadlines pertaining to
thesis/dissertationseachsemester.

CandidatesmaybeofferedadepartmentalTApositioninyearfivegivensatisfactoryprogressinresearchasjudgedby
thedissertationcommitteeandapprovaloftheDepartmentChair,TAsarenotnormallyawardedbeyondyear5.RAs
are only permitted beyond year six in exceptional cases with the written approval of the department chair. It is
important to note that the Graduate School will not award tuition waivers for credit hours beyond 120 for students
enteringwithabaccalaureatedegreeand90forstudentsenteringwithamastersdegree.

SupervisoryCommittees
TheM.S.andM.A.supervisorycommitteeshouldconsistofatleastthreemembersincludingthemajorprofessor,and
two other chemistry faculty members, at least one of whom is outside the students major area (analytical,
biochemistry, etc.)According to University Regulations, the Ph.D. supervisory committee must consist of at least four
(4)members,includingthestudentsresearchdirector.Atleasttwo(2)ofthemembersmustbefromanarearelated
tothestudentsresearch.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Communication(M.A.)


139
http://www.cas.usf.edu/
COMMUNICATIONPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Spring: October15
MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 23.1001
Dept.Code: SPE
Program(Major/College): SPEAS
CONTACTINFORMATION

College: ArtsandSciences
Department: Communication

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheDepartmentofCommunicationoffersabroadandintegratedapproachtocommunicationstudiesthatembraces
the traditions of the humanities, the convergence of rhetorical and communication theory, and the relations among
aesthetic, humanistic, and scientific approaches to inquiry. Students are encouraged to examine the pragmatics of
rhetoricalandcommunicationtheoryinsuchsettingsasbusinessandindustry,government,education,medicineand
healthcare,media,thearts,andthefamily.ThedepartmentofferscourseworkleadingtotheMasterofArtsdegree
andtheDoctorofPhilosophy.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityrequirements,plus
twolettersofrecommendation;
awritingsample,
astatementofpurpose.
GREwithpreferredscoresofatleast153V(500VpriortoAugust1,2011)
TOEFLScores
Transcripts
CVorresume

DEGREEPROGRAMREQUIREMENTS

Totalminimumhours 36credithours

ProgramRequirements
1) Establishasupervisoryfacultycommitteeconsistingofamajorprofessorandtwoadditionalmembers,atleast
oneofwhomisamemberoftheDepartmentofCommunication.Thesupervisorycommitteemustbeapproved
bytheDirectorofGraduateStudies.

2) PrepareaPlanofStudyapprovedbythestudent'ssupervisorycommittee.ThePlanofStudyexpressestheways
inwhichthestudentwillshowevidenceofthefollowing:
USFTampaGraduateCatalog20132014 Communication(M.A.)


140
http://www.cas.usf.edu/
a) expertiseinoneormoreofthecentraldomainsofcommunicationstudy
b) expertiseintheresearchmethodologiesneededtocarryoutoriginalresearchinthespecialized
areaofconcentration(ThesisProgramstudentsonly)

CoreRequirements 3hours
COM6001TheoriesandHistoriesofCommunication(3)
Thiscoursemustbetakenthefirsttimeitisofferedafterthestudentisadmittedtothegraduateprogram.

Selectaprogramoption,eitherThesisorNonThesis.

ThesisProgram 33hours

Inadditiontothethree(3)hoursofcorerequirements,eachstudentmustalsotake
COM 7325 Seminar in Communication Research Methods (3) either Qualitative Methods OR Critical
Methods

Electives
24 hours of elective course work, six (6) hours of which may consist of a course or courses from other
departmentsandmusthaveadvisorapproval.

ThesisRequirements
SPC6971Thesis(6)
Eachstudentmustcompleteatleastsix(6)hoursofthesiscredit(SPC6971)andsubmitanapprovedthesis.
In consultation with the major professor, Thesis Program students will select a thesis topic, constitute a
thesis committee, and write orally defend a thesis proposal. The thesis is an extended research project
within a specific area of communication research culminating in a written academic analysis. Upon
completionofthethesis,thestudentmustpassanoraldefense.

NonThesisProgram 33hours
Inadditiontothethree(3)hoursofcorerequirements
Electives
33 hours of elective course work are required, six (6) hours of which may consist of courses from other
departmentsandmusthaveadvisorapproval.

ComprehensiveExamRequirements
AllNonThesisprogramstudentsmustpassbothwrittenandoralcomprehensiveexaminations.
ThesisProgramstudentsdonotcompletecomprehensiveexams.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Communication(Ph.D.)


141
http://www.cas.usf.edu/
COMMUNICATIONPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Falladmissiononly.
MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 23.1001
Dept.Code: SPE
Program(Major/College): SPEAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Communication

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

TheDepartmentofCommunicationoffersabroadandintegratedapproachtocommunicationstudiesthatembraces
the traditions of the humanities, the convergence of rhetorical and communication theory, and the relations among
aesthetic, humanistic, and scientific approaches to inquiry. Students are encouraged to examine the pragmatics of
rhetoricalandcommunicationtheoryinsuchsettingsasbusinessandindustry,government,education,medicineand
healthcare,media,thearts,andthefamily.TheDepartmentofferscourseworkleadingtotheMasterofArtsdegree
andtheDoctorofPhilosophy.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityrequirements,plus
threelettersofrecommendation;
awritingsample,
astatementofpurpose
GRE with preferred scores of at least 153V (500V prior to August 1, 2011)
TOEFLScores
Transcripts
CVorresume

DEGREEPROGRAMREQUIREMENTS
TotalMinimumhours: 51credithourspostmasters

ProgramRequirements
1. Establishasupervisoryfacultycommitteeconsistingofamajorprofessorandatleasttwoadditionalmembers
fromtheDepartmentofCommunicationandatleastonememberoutsidetheDepartmentofCommunication.
ThesupervisorycommitteemustbeapprovedbytheDirectorofGraduateStudies..

2. PrepareaPlanofStudyapprovedbythestudent'ssupervisorycommittee.ThePlanofStudyexpressestheways
inwhichthestudentwillshowevidenceofthefollowing:
USFTampaGraduateCatalog20132014 Communication(Ph.D.)


142
http://www.cas.usf.edu/
expertiseinoneofthecentraldomainsofcommunicationstudy;
expertiseintheresearchmethodologiesneededtocarryoutoriginalresearchinthespecialized
areaofconcentration

CoreRequirements 6hours
COM6001TheoriesandHistoriesofCommunication(3)
COM7325SeminarinCommunicationResearchMethods(3)eitherQualitativeMethodsORCriticalMethodsCourse

Requirements 33hours
In addition to the six (6) hours of core requirements, students are required to take a minimum of 33 hours of
courseworkbeyondtheM.A.degree(notcountingcreditsfordissertationresearch).Six(6)hoursofcourseworkmust
be in an area of study outside the department. Students must enroll in and successfully complete a minimum of 12
hoursdesignatedasPh.D.Seminars(COM7933)aspartoftheirelectivecoursework.

ResearchToolRequirement 6hours
InadditiontoCOM7325,completeanadditionalsix(6)hoursofcourseworktofulfilltheresearchtoolrequirement.If
studentselecttotakebothQualitativeandCriticalMethods,theymusttakeanadditionalmethodscourse(3hours)
subjecttotheapprovaloftheirmajorprofessor.

QualifyingExamRequirement
All students must pass a written and oral qualifying examination covering the student's area of specialization and
methodologicalcompetence.Thisexaminationwillbepreparedandevaluatedbythestudent'ssupervisorycommittee

Dissertation 6credithoursminimum
SPC7980Dissertation
Inconsultationwiththemajorprofessorandsupervisorycommittee,studentswillselectadissertationtopicandwriteand
orallydefendadissertationproposal.Uponcompletionofthedissertation,thestudentmustpassanoraldefense.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 CreativeWriting(M.F.A.)


143
http://www.cas.usf.edu/
CREATIVEWRITINGPROGRAM

MasterofFineArts(M.F.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January1
Falladmissiononly
MinimumTotalHours: 45
ProgramLevel: Masters
CIPCode: 23.0501
Dept.Code: ENG
Program(Major/College): CWRAS

Concentrations:
Fiction(CFI)
Poetry(CPO)
CONTACTINFORMATION

College: ArtsandSciences
Department: English

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheMasterofFineArtsinCreativeWritingisagraduatelevelprogramofferingconcentrationsinfictionandpoetry
(with the opportunity to study other genres of writing such as screenwriting and creative nonfiction). The program
emphasizes the craft of writing and concentrates on the students original work. The MFA requires 45 hours of
coursework and typically will take three years for the student to complete. Our goal is to help MFA students to
producepublishablethesesandsecureteachingoreditingpositionsupongraduation.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Studentsacceptedintotheprogramwillbegincourseworkinthefall.Noapplicationswillbeconsideredforspringor
summeradmission.

Anundergraduatedegree,preferablyinEnglish,fromanaccreditedinstitution,witha3.20average,orits
equivalent

AcompetitiveVerbalaptitudescoreontheGREgeneraltest,withatargetAnalyticalWritingscoreof4.0(while
theQuantitativescoreisnotadeterminingfactorinouradmissiondecisions,bothVerbalandQuantitativescores
arefactorsinsomeuniversityscholarshipsandfellowships)

Three(3)lettersofrecommendation,preferablyfromformerEnglishinstructors,assessingthestudentspotential
todograduatelevelwork

Awritingsampleinonegenreonly:1220pagesofdoublespacedfiction;1220pagesofdoublespacedcreative
nonfiction,or1015pagesofsinglespacedpoetry

USFTampaGraduateCatalog20132014 CreativeWriting(M.F.A.)


144
http://www.cas.usf.edu/
Atwotothreepagepersonalstatement,describingthestudent'sbackground,purposeforattendinggraduate
school,andcareergoals

AcompletedapplicationsubmittedonlinethroughtheGraduateAdmissionsOffice

Allsupplementaryapplicationmaterials(i.e.,statement,writingsample,andlettersofrecommendation)maybe
submittedelectronicallythroughtheonlineapplicationormaybesubmitteddirectlytotheDepartmentatthe
followingaddress:

GraduateDirector
DepartmentofEnglish,UniversityofSouthFlorida
4204E.FowlerAve.,CPR107
Tampa,FL336205550

MaterialsincludingGREscoresandtranscriptsmustbereceivedbytheapplicationdeadlineinorderforstudentstobe
consideredforadmission.GraduatesofUSFdonotneedtoorderofficialtranscripts.Applicationsarereviewedbyan
admissionscommitteeafterthedeadline.Studentswillbenotifiedbymailoftheadmissionsdecisionwithfourtosix
weeksafterthedeadline.

DEGREEPROGRAMREQUIREMENTS

TocompletetheMasterofFineArtsinCreativeWriting,studentsmustsatisfythefollowingrequirements:

TotalMinimumHours: 45hours

Earn45credithourswithanoverallgradepointaverageof3.00orbetterintherequiredcourses.Thedistributionof
therequirementswillbe

18hoursinwritingworkshopsandcraftseminars
3hoursingraduatestudies
15hoursinpedagogyandliteraturecourses,and
9hoursinthesisstudies(takeninthefinalyearoftheprogram).

Completeabooklengthmanuscriptincreativenonfiction,fiction,orpoetrythatwillmeetdepartmentaland
universityrequirementsforthethesis.Thethesisshallconsistof4864pagesofpoems(singleordoublespaced),at
least100pagesoffiction(doublespaced)oratleast100pagesofcreativenonfiction(doublespaced)..Allstudents
mustwriteathreetotenpageintroductiontotheirthesisthatexplainstheirgoalsforthework.

CoreRequirements 18hoursminimum

SelectSix(6)courses(18hours)fromthefollowing:
CRW6130FictionWriting 3*
CRW6331PoetryWriting 3*
CRW6236NonfictionWriting 3*
*maybetakenuptothreetimesforamaximumof9credits.
CRW6164TheCraftofFiction 3
Requiredforstudentsadmittedtothefictionconcentration,optionalforothers.
CRW6352TheCraftofPoetry 3
Requiredforstudentsadmittedtothepoetryconcentration;optionalforothers.
CRW6025TheCraftofNonfiction 3
Requiredforstudentsadmittedtothenonfictiontrack,optionalforothers.
CRW6025SpecialTopicsinCreativeWriting 3
Thiscourseconcentratesonscreenwriting,translation,editing,creativewritingpedagogy(withacommunity
servicecomponent),orstudyofaparticulargenreortechnique.

USFTampaGraduateCatalog20132014 CreativeWriting(M.F.A.)


145
http://www.cas.usf.edu/
Course(3credits)ingraduatestudies 3hoursminimum
ENG6009IntroductiontoGraduateStudies 3
Mustbetakeninthestudentsfirstorsecondsemesterofgraduatestudies.

OtherCourserequirements 15hoursminimum
5courses(15credits)inanycombinationofthecoursesbelow:

ENC6745 PracticeinTeachingComposition 3
Requiredofallfirstyearteachingassistantsincomposition
CRW6025 PracticeinTeachingCreativeWriting 3
Requiredofallteachingassistantsincreativewritingcourses.Thiscoursemaybetakenmorethan
once,butwillonlycountforatotalofthreecreditstowarddegreerequirements.
LIT6934 SelectedTopics:LiteraryEditingandPublishing 3
RequiredofallstudentsworkingonSawPalm,USFscreativewritingjournal.Thiscoursemaybe
takenmorethanonce,butwillonlycountforatotalofthreecreditstowarddegreerequirements.

Anyofthefollowinggraduatelevel(6000andabove)literaturecoursesofferedbytheEnglishDepartment.These
coursesarecodedAML6,ENL6,andLIT6.Samplecoursesinclude:

AML6017 StudiesinAmericanLiteratureto1860 3
AML6018 StudiesinAmericanLiterature18601920 3
AML6027 StudiesinModernAmericanLiterature 3
AML6608 StudiesinAfricanAmericanLiterature 3
ENL6206 StudiesinOldEnglish 3
ENL6216 StudiesinMiddleEnglish 3
ENL6226 StudiesinSixteenthCenturyBritishLiterature 3
ENL6228 StudiesinSeventeenthCenturyBritishLiterature 3
ENL6236 StudiesinRestorationandEighteenthBritishLiterature 3
ENL6246 StudiesoftheEnglishRomanticPeriod 3
ENL6256 StudiesinVictorianLiterature 3
ENL6276 StudiesinModernBritishLiterature 3
LIT6096 StudiesinContemporaryLiterature 3
LIT6105 StudiesinContinentalLiterature 3
LIT6934 SelectedTopicsinEnglishStudies 3

Thesis 9hoursminimum
ENG6971Thesis:Master's(9hourstotal)takeninthestudent'sfinalyearofstudy.
Thestudentmustberegisteredinatleast3hoursofENG6971duringthesemesterpriortograduation.

GraduateCertificates
ForinformationonGraduateCertificatespleasevisithttp://www.outreach.usf.edu/gradcerts/

EnglishGraduateCertificatesOffered:
CreativeWriting ContactProfessorRitaCiresiatrciresi@usf.edu
ComparativeandInterdisciplinaryLiteraryStudies ContactDr.SusanMooneyatsmooney@usf.edu
TeachingComposition ContactDr.DebraJacobsatdjacobs@usf.edu
Professional&TechnicalCommunication ContactDr.MeredithZoeteweyat
Zoetewey@usf.edu

COURSES

Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Economics(M.A.)


146
http://www.cas.usf.edu/
ECONOMICSPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
DomesticStudents:
Fall: June1*
Spring: October15*
Summer: Noadmission
*for full consideration; however, space
permitting, applications will be accepted
through July 15 and December 1.

InternationalStudentslivingoutsidetheU.S.:
Fall: May1
Spring: September15
Summer: Noadmission

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 45.0601
Dept.Code: ECN
Program(Major/College): ECO/AS

CONTACTINFORMATION

College: ArtsandSciences
Department: Economics

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheM.A.inEconomicspreparesstudentsforcareersasprofessionaleconomistsinbusinessandgovernment.Itisalso
excellentpreparationforcontinuedgraduatestudyineconomics.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools(SACS)

MajorResearchAreas:
Healtheconomics,publiceconomics,urbanandregionaleconomics,internationaltrade,economicdevelopment,
industrialorganization,advancedtheory,andadvancedeconometrics

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Bachelorsdegreeorequivalentfromaregionallyaccrediteduniversityorinternationalequivalent.
Musthavea3.00orhigherupperlevelGPA.
MusthavetakentheGREwithintheprecedingfiveyearswithtargetscoresof152(490)ontheverbal
portionand152(670)onthequantitativeportion.
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550orhigher
onthewrittenversion,aminimumscoreof213onthecomputerbasedtestora79ontheinternetbased
test.
USFTampaGraduateCatalog20132014 Economics(M.A.)


147
http://www.cas.usf.edu/
Minimumof1courseincalculus.*
Minimumof1courseinstatistics.*
UndergraduateIntermediatelevelmicroeconomicsandundergraduateintermediatelevelmacroeconomics*

*ApplicantsmustearnagradeofBorbetterineachofthesecourses.

DEGREEPROGRAMREQUIREMENTS

ProgramMinimumhours: 30hours

Allstudentsarerequiredtotakecoursesinadvancedeconomic theoryandeconometrics.Undergraduateeconomics
majors at USF may complete the program in one year beyond the B.A. in the 5Year B.A./M.A. Program. Students
preparing for doctoral studies select from these and additional courses in economic theory, mathematics, and
quantitativemethods.WhereappropriatestudentsmayselectcoursesinotherdepartmentsintheUniversity.

StudentsmustsatisfyallUniversityrequirementsfortheM.A.degree.Departmentalrequirementsinclude30hoursof
graduate credit selected with the approval of the department's graduate advisor. At least 24 hours must be in
Economics not including Independent Study (ECO 6906) and Directed Research (ECO 6917). To graduate, a student
musthaveatleastanoverall3.0GPAandatleasta3.0GPAforalleconomicscourses,andpassanoralexamination.

CoreRequirements 12hours
ECO6115 MicroeconomicsI 3
ECO6206 MacroeconomicsI 3
ECO6405 MathematicalEconomicsI 3
ECO6424 EconometricsI 3

Electives 18hours
Economics atleast12credits
Unrestricted atmost6credits

Economics electives must be drawn from the following set of graduatelevel courses offered in the Department of
Economics:

ECO6120 EconomicPolicyAnalysis 3
ECO6305 HistoryofEconomicThought 3
ECO6425 EconometricsII 3
ECO6505 PublicFinance 3
ECO6525 PublicSectorEconomics 3
ECO6706 InternationalTrade:TheoryandPolicy 3
ECO7116 MicroeconomicsII 3
ECO7207 MacroeconomicsII 3
ECO7406 MathematicalEconomicsII 3
ECO7426 EconometricsIII 3
ECP6405 IndustrialOrganizationI 3
ECP6408 EconomicsofOrganization 3
ECP6415 IssuesinRegulationandAntiTrust 3
ECP6456 LawandEconomics 3
ECP6536 EconomicsofHealthCareI 3
ECP6614 UrbanEconomics 3
ECP6624 RegionalEconomics 3
ECP7406 IndustrialOrganizationII 3
ECP7537 EconomicsofHealthCareII 3
ECS6015 EconomicDevelopment 3

USFTampaGraduateCatalog20132014 Economics(M.A.)


148
http://www.cas.usf.edu/
With the approval of the Graduate Director, unrestricted elective courses may be satisfied either by graduatelevel
coursesofferedbyanydepartmentwithintheUniversityorbycertainMBAcoursestaughtwithintheDepartmentof
Economics:

Inadditiontocompletingthe30hoursofcourseworkwithoverallandmajorGPAsofatleast3.0,astudentmustpass
an oral examination conducted by a panel of three faculty members who have taught courses in the student's
program. At least one faculty member must bedrawn from those who teach the core courses. The oral examination
providesaforumforthestudenttoprovideevidencethats/hehassufficientknowledgeandbreadthoffundamental
economicconceptssoastobeabletoundertakerigorouseconomicanalysis,boththeoreticalandempiricalinnature.

Totalminimumhours: 30

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Economics(Ph.D.)


149
http://www.cas.usf.edu/
ECONOMICSPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January31

MinimumTotalHours: 69
ProgramLevel: Doctoral
CIPCode: 45.0601
Dept.Code: ECN
Program(Major/College): ECO/AS

CONTACTINFORMATION

College: ArtsandSciences
Department: Economics

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION
TheDoctorofPhilosophyinEconomicspreparesstudentsforcareersasprofessionaleconomistsinacademia,
businessandgovernment.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:HealthEconomics,IndustrialOrganization,InternationalTrade/EconomicDevelopment,Public
Economics,UrbanandRegionalEconomics

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Bachelorsdegreeorequivalentfromaregionallyaccrediteduniversityorinternationalequivalent
3.00GPAorbetterinallupperdivisionundergraduateclasses
MusthavetakentheGREwithintheprecedingfiveyearswithtargetscoresof155(530)onthe
verbalportionand155(710)onthequantitativeportion.
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550
orhigheronthewrittenversion,aminimumscoreof213onthecomputerbasedtestora79on
theInternetbasedtest.
Minimumof2coursesincalculus*
Minimumof1courseinprobabilityandstatistics*
UndergraduateIntermediatelevelmicroeconomicsandundergraduateintermediatelevel
macroeconomics*

*ApplicantsmustearnagradeofBorbetterineachofthesecourses.

USFTampaGraduateCatalog20132014 Economics(Ph.D.)


150
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 69hours

COREREQUIREMENTS 27hours
ECO6115 MicroeconomicsI 3
ECO6206 MacroeconomicsI 3
ECO6405 MathematicalEconomicsI 3
ECO6424 EconometricsI 3
ECO6425 EconometricsII 3
ECO7116 MicroeconomicsII 3
ECO7207 MacroeconomicsII 3
ECO7406 MathematicalEconomicsII 3
ECO7426 EconometricsIII 3

Fields 12hours
Selecttwopairsfromthegroupingsbelow:

ECP6536 EconomicsofHealthCareI 3
ECP7537 EconomicsofHealthCareII 3

ECS6015 EconomicDevelopment 3
ECO6706 InternationalTrade:TheoryandPolicy 3

ECP6405 IndustrialOrganizationI 3
ECP7406 IndustrialOrganizationII 3

ECO6505 PublicFinance 3
ECO6525 PublicSectorEconomics 3

ECP6614 UrbanEconomics 3
ECP6624 RegionalEconomics 3

Electives 9hours
Threegraduatecoursessecondaryfieldoutsideofeconomics,asapprovedbytheadvisor

QualifyingExamination
Examinationsineconomictheoryandeconometrics

Dissertation 21hoursminimum
ECO7980 Dissertation

GraduationRequirements:
Complete27credithoursofrequiredcourseworkwithrequiredGPA.
Complete12credithoursofeconomicsfieldcourseworkwithrequiredGPA.
Complete9hoursofsecondaryfieldcourseworkwiththerequiredGPA.
Passthequalifyingexaminationsineconomictheoryandeconometrics.
Writeandsuccessfullydefendthedoctoraldissertationproposal.
Completeatleast21credithoursofdissertationcoursework.
Writeandsuccessfullydefendadoctoraldissertation.

COURSES
Foranupdatedlistofcourseofferingssee:http://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 English(M.A.)


151
http://www.cas.usf.edu/
ENGLISHPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January1
Falladmissiononly

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 23.0101
Dept.Code: ENG
Program(Major/College): ENGAS

Concentrations:
Literature(LIT)
RhetoricandComposition(RAC)

CONTACTINFORMATION

College: ArtsandSciences
Department: English

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The MA in English with a concentration in Literature is a continuation of the BA with greater depth in literary
knowledge and an introduction and implementation of methods, standards, and conventions of scholarship on
literature. It is a generalist degree with broadbased distribution requirements, but it has the flexibility to study
cuttingedge theories and newly emerging fields of interests (including cultural and comparative studies, ethnic
literatures,andgenrestudiessuchasfilm).TheoptionforPhDpreparationwillconcludewithaportfolioofthree15
20 page essays and an oral defense; the option for teacher preparation will have two additional courses required,
includingonewithpedagogicalemphasisandacomprehensiveexamination.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
B.A.inEnglish
AcompetitiveVerbalaptitudescoreontheGREgeneraltest,withatargetAnalyticalWritingscoreof4.0(while
theQuantitativescoreisnotadeterminingfactorinouradmissiondecisions,boththeVerbaland
Quantitativescorearefactorsinsomeuniversityscholarshipsandfellowships)
UndergraduateGPA3.50
Three(3)lettersofrecommendation
Scholarlywritingsampleofapproximately2500words(tendoublespacedpages)excludingbibliographyorworks
cited;applicantsmayexcerptfromalongeressay.Generallythecommitteeseekstoreviewacademicwriting
fromanEnglishcourse.
Atwotothreepagepersonalstatementdescribingthestudentsbackground,purposeforattendinggraduate
school,andcareergoals
USFTampaGraduateCatalog20132014 English(M.A.)


152
http://www.cas.usf.edu/
ForstudentspursuingtheMAinEnglishwithaConcentrationinLiterature,declarationofwhichMALiterature
optiontheapplicantwouldliketobeconsideredfor,andanexplanationofwhytheapplicantwouldprefer
thatoption.DeclareeitherOption1:Ph.D.preparationorOption2:TeachingEnhancement(generallyoption2
isforteachingprofessionalswhowishtopursuethemastersdegreeparttime)

Allsupplementaryapplicationmaterials(i.e.statement,writingsample,andletters),maybesubmittedelectronically
throughtheonlineapplicationormaybesubmitteddirectlytothedepartmentatthefollowingaddress:

GraduateDirector
DepartmentofEnglish
UniversityofSouthFlorida
4202E.FowlerAve.,CPR107
Tampa,FL336205550

Allmaterials,includingGREscoresandtranscripts,mustbereceivedbytheapplicationdeadlineinorderforstudentstobe
consideredforadmission.GraduatesofUSFdonotneedtoorderofficialtranscripts.Applicationsarereviewedbyan
admissionscommitteeafterthedeadline.Studentswillbenotifiedbymailoftheadmissionsdecisionwithinfourtosix
weeksafterthedeadline.

DEGREEPROGRAMREQUIREMENTS

ProgramofStudy 33CreditHours

COREREQUIREMENTS 3hours
ENG6009IntroductiontoGraduateStudies(3)
(thisshouldbetakeninthefirstsemesterofcoursework)

CONCENTRATIONREQUIREMENTS:
Inadditiontothecorerequirements,studentsmustcompletetherequirementsbelowfortheselectedconcentration:

LiteratureConcentrationOPTIONIPh.D.Preparation(30credits)
Required 3credits
ENG6018orENG6019 StudiesinCriticismandTheoryI&II 3

HistoricalDistribution* 12credits
Fourcourseschosenfromthefollowing:
1MedievalorRenaissance(including17thCentury)
ENL6206 StudiesinOldEnglish 3
ENL6216 StudiesinMiddleEnglish 3
ENL6226 StudiesinSixteenthCenturyBritishLiterature 3
ENL6228 StudiesinSeventeenthCenturyBritishLiterature 3

118
th
Century(EitherBritishtraditionorLiteratureoftheAmericas)
AML6017 StudiesinAmericanLiteratureto1860 3
ENL6236 StudiesinRestorationandEighteenthCentury 3
BritishLiterature

119
th
Century(EitherBritishtraditionorLiteratureoftheAmericas):
AML6017 StudiesinAmericanLiteratureto1860 3
AML6018 StudiesinAmericanLiteratureto1860jto1920 3
ENL6246 StudiesoftheEnglishRomanticPeriod 3
ENL6256 StudiesinVictorianLiterature 3

120
th
Century(EitherBritishtraditionsorLiteratureoftheAmericas):
AML6027 StudiesinModernAmericanLiterature 3
ENL6276 StudiesinModernBritishLiterature 3
LIT6096 StudiesinContemporaryLiterature 3
USFTampaGraduateCatalog20132014 English(M.A.)


153
http://www.cas.usf.edu/

Cultural&CriticalStudies* 6credits
Twocoursesinethnicliterature(includingAfricanAmerican,Latino/a,postcolonial),
worldliterature,womensliteratureorgenderstudies,criticaltheory,film,orgenre
AML6608 StudiesinAfricanAmericanLiterature 3
ENG6018 StudiesinCriticismandTheoryI 3
ENG6019 StudiesinCriticismandTheoryII 3
ENG6067 HistoryoftheEnglishLanguage 3
LIT6934 SelectedTopicsinEnglishStudies 16
OrothercoursesasapprovedbytheGraduateDirector

*OfthesixcoursesinHistoricalDistributionandCulturalCriticalStudies,twomustbefromBritishtraditionsand
twofromAmericanTraditions.

Electives 6credits
StudentstakingENC6745TeachingPracticummustusethisasanelectiveiftheycountittowardthe33creditsin
thedegree.NoCRWcourseswillbeallowedintheliteraturetrack.Onlyonepracticumwillbeallowedtosatisfy
degreerequirements(includingENC6745)inOptionI.OneDirectedStudymaybeusedtosubstitutefordegree
requirementwiththeapprovaloftheGraduateDirector.

PortfolioandDefense 3credits
Threedirectedstudyhourstoprepareportfolio.Intheirfourthandfinalsemester(excludingsummerterms),MA
studentswillsubmitaportfolioforreviewtoathreememberfacultycommitteesixweekspriortotheGraduate
Schooldeadlineforthesis/dissertationsubmission.Uponsubmission,thestudentandchairofthecommitteewill
establishadefensedatewiththeGraduateProgramSpecialist.

Theportfoliowillcontainthefollowing:

Anintroductoryfirstpersonessayinwhichthestudentoffersaselfevaluationofthecontentsofthe
portfolioandhowitreflectshisorherownprocessofrevision,intellectualgrowth,plansfor
publication/dissemination,andprofessionaldevelopment(minimumfivepages,nottoexceedfifteen).
Threerevisedseminarpapers1520pagesinlength,includingappropriateMLAorChicagoStyle
documentation.
o Papersshouldrepresentthreedistinctliteraryperiods,includingatleastonepriorto1800andone
after1800.Inaddition,thecontentsoftheportfolioshouldrepresentdiversityonanationallevel,
withatleastonepaperfocusingonliteratureoftheAmericasandtheotheronliteraturefrom
Britain(broadlyconstrued)oritscolonies.
o Papersshouldbedevelopedunderthedirectionofthreedifferentfacultymembersfromthe
EnglishDepartment,whothenwillformthecommitteeforthedefense.Onememberofthe
committeewillserveasthechair,whowillcoordinatethecirculationoftheportfolio,the
schedulingofthedefense,andthesubmissionofevaluationformstothegraduatedirectorwithin
specifieddeadlines.

The portfolio will be reviewed and evaluated by this threemember faculty committee using the published
assessmentrubric.

Membersoftheportfoliocommitteewillbeaskedtoworkwiththestudenttorevisethepapersshe/hewrotefor
class.Thegoalistogetthepapersintoaformthatmightreasonablybepublished.

Because this option is not a thesis, it does not have to be submitted to the Graduate School, and so it does not
need to adhere to the Graduate School deadlines. Defenses should be concluded two weeks before the end of
classes.Thewholeportfolio,alongwiththerevisedpapersandtheintroductoryessay,shouldbecirculatedtwo
weekspriortothedefense,togivecommitteemembersanopportunitytoreaditthrough.

Eachportfoliopaperwillbescoredonascalefrom1to4overallusingtherubricattheendofthehandbook.To
pass,aportfoliorequiresatotalscoreof9withnopapersearninga1.
USFTampaGraduateCatalog20132014 English(M.A.)


154
http://www.cas.usf.edu/

Each portfolio paper will also be scored on a scale from 1 to 4 on content using the rubric at the end of the
handbook.Topass,aportfoliorequiresaminimumscoreof9incontent.

Pass with Distinction: portfolios scoring between 11 and 12 will merit distinction; this will be noted in the
studentsfileandcanbereferencedonastudentsCV.

Deficiency:portfoliosscoringbetween7and8orwithonepaperearninga1willbedeficient.Anypaperscoring
lessthan3willrequirerevision.Individualfacultyneedtospecifyinwritingwhattheessayrequiresforrevisionin
order to pass. Students will have the opportunity to revise during the remaining time of the semester; revised
paper(s)needtobesubmittedtoallcommitteemembersforapprovalnolaterthanthelastdayofclassforthe
semester. No second defense is required. Students who fail to revise appropriately before the end of the
semester will be put on academic probation and will be required to finalize their papers the following semester
(excludingsummerunlessfacultyagreetoserveduringthesummer).

Failure:portfoliosthatscorea6orlessorportfoliosthatscorelessthan9inoverallcontentfail.Studentswhofail
willautomaticallybeputonacademicprobationandgiventheopportunitytorevisepaperssothattheportfolio
reachesaminimumscoreof9thefollowingsemester(excludingsummerunlessfacultyagreetoserveduringthe
summer).Afailedportfoliorequiresaseconddefenseafterrevision,andthecommitteewilldetermineifitpasses
orfails(nodeficienciesordistinctionsmaybeawarded).Iftheportfoliofailsaftertheseconddefensethestudent
willbeacademicallydismissedfromtheprogram.

GraduateAssistantsonprobationintheinitialtermmaintaineligibilityforanassistantship.Ifprobationarystatus
isnotremoved,thestudentcanberemovedfromassistantshipandacademicallydismissedfromtheprogram.

Thecommitteewillalsoevaluatetheintroductoryessayusingtheappropriaterubric;thisgradewillberecorded
forpurposesofprogramassessment.

OralDefense
Thecommitteechairconvenesameetingwiththecommitteeandstudentfor30minutes;thisoralexamination
providestheopportunityforfacultytoquestionthestudentonvariousaspectsoftheportfolio,anditgivesthe
student the opportunity to expand upon and refine ideas represented in writing. The defense also provides an
opportunity for further suggestions on publication and revision. After 30 minutes, the committee will convene
withoutthestudenttodiscussafinalassessmentfortheportfoliousingthepublishedrubric.

LiteratureConcentrationOPTIONIITeacherEnrichment(30hours)
Required:
ENG6018orENG6019 StudiesinCriticismandTheoryI&II 3credits

HistoricalDistribution* 18credits

1MedievalorRenaissanceCourse(including17thC):
ENL6206 StudiesinOldEnglish 3
ENL6216 StudiesinMiddleEnglish 3
ENL6226 StudiesinSixteenthCenturyBritishLiterature 3
ENL6228 StudiesinSeventeenthCenturyBritishLiterature 3

118
th
CenturyCourse(EitherBritishtraditionsorLiteratureoftheAmericas):
AML6017 StudiesinAmericanLiteratureto1860 3
ENL6236 StudiesinRestorationandEighteenthCentury 3
BritishLiterature

219
th
CenturyCourses(EitherBritishtraditionsorLiteratureoftheAmericas):
AML6017 StudiesinAmericanLiteratureto1860 3
AML6018 StudiesinAmericanLiteratureto1860jto1920 3
USFTampaGraduateCatalog20132014 English(M.A.)


155
http://www.cas.usf.edu/
ENL6246 StudiesoftheEnglishRomanticPeriod 3
ENL6256 StudiesinVictorianLiterature 3

120
th
CenturyCourse(EitherBritishtraditionsorLiteratureoftheAmericas):
AML6027 StudiesinModernAmericanLiterature 3
ENL6276 StudiesinModernBritishLiterature 3
LIT6096 StudiesinContemporaryLiterature 3

CulturalCriticalStudies* 3credits
One course in ethnic literature (including AfricanAmerican, Latino/a, postcolonial), world literature, womens
literatureorgenderstudies,criticaltheory,film,orgenre
AML6608 StudiesinAfricanAmericanLiterature 3
ENG6018 StudiesinCriticismandTheoryI 3
ENG6019 StudiesinCriticismandTheoryII 3
ENG6067 HistoryoftheEnglishLanguage 3
LIT6934 SelectedTopicsinEnglishStudies 16
OrothercoursesasapprovedbytheGraduateDirector

*Of the seven courses from Historical Distribution and CulturalCritical Studies, three must be from British
traditionsandthreefromAmericantraditions

PedagogicalEmphasis 3credits
Chooseonefromthefollowing:
CRW6025 SelectedTopics:PracticeinTeachingCreativeWriting 3
ENC6700 CompositionTheory 3
ENC6745 TeachingPracticum(TAsonly) 3
ENG6067 HistoryoftheEnglishLanguage 3
LAE6375 ContemporaryCompositionStudies 3
LAE6389 PracticeinTeachingLiterature 13
LIT6934 SelectedTopics:PracticeinTeachingProfessional 16
andTechnicalWriting
LIT6934 SelectedTopics:PracticeinTeachingWritingCenter 16

Elective 3credits
StudentstakingENC6745TeachingPracticummustusethisasanelectiveiftheycountittowardthe33creditsin
thedegree.NoCRWcourseswillbeallowedintheliteraturetrack.Onlyonepracticumwillbeallowedtosatisfy
degreerequirements(includingENC6745)inOptionI.OneDirectedStudymaybeusedtosubstitutefordegree
requirementwiththeapprovaloftheGraduateDirector.

ComprehensiveExam:
Duringtheirfinaltermofcoursework,studentswilltakeacomprehensivewrittenexamonliteraturefromthesix
areasofhistoricaldistribution:
1) MedievalandEarlyModern
2) EighteenthcenturyBritishandEarlyLiteratureoftheAmericas
3) NineteenthcenturyBritishandcolonies
4) NineteenthcenturyLiteratureoftheAmericas
5) TwentiethcenturyBritishandpostcolonial
6) TwentiethcenturyLiteratureoftheAmericas

Studentswillpreparefortheexambyreadingthelistofidentifiedworks(availableatthestartoftheprogram).
Thelistwillbeestablishedandpublishedwithaclearexpirationdate(fiveyears);thesucceedinglistwillbeready
atleastoneyearpriortoimplementationintheexam.

USFTampaGraduateCatalog20132014 English(M.A.)


156
http://www.cas.usf.edu/
RhetoricandCompositionConcentration(39hours)
Requirements: 12credits
ENC6700 StudiesinCompositionTheory 3
ENC6720 StudiesinCompositionResearch 3
ENC6421 StudiesinRhetoricandTechnology 3
ENC6336 StudiesintheHistoryofRhetoric 3

Electives 15credits
Three(3)electiveswithinLiteratureorRhetoricandCompositionfromthefollowing(9credithours):

ENC AdvancedTechnicalWriting 3
ENC6261 ProfessionalandTechnicalCommunication 3
ENC6333 ContemporaryRhetorics 3
ENC6422 NewMediaProduction 3
ENC6740 TheoryandDevelopmentofWritingPrograms 3
LAE6375 ContemporaryCompositionStudies 3

OutsideElectives 6credithours
TwoelectivesinEnglishoroutsidedepartment,relatedtocourseofstudy

Thesis 6creditsminimum
ENG6971 Thesis:Masters 6
MAThesisonaRhetoricandCompositionsubjectplusanoraldefense

TheM.A.thesis4050pages,typedbodyin12pointTimesNewRomanfont,doublespacedshouldbebased
on students specialization in Rhetoric and Composition. This manuscript can be a revision and extension of a
course paper or conference paper. It must contribute to the discipline by advancing scholarly discussion sin
RhetoricandCompositionstudiesandofferingnewknowledge.

GraduateCertificateProgram
ForinformationonGraduateCertificatespleasevisithttp://www.outreach.usf.edu/gradcerts/

EnglishGraduateCertificatesOffered:
CreativeWriting ContactProfessorRitaCiresiatrciresi@usf.edu
ComparativeandInterdisciplinaryLiteraryStudies ContactDr.SusanMooneyatsmooney@usf.edu
TeachingComposition ContactDr.DebraJacobsatdjacobs@usf.edu
Professional&TechnicalCommunication ContactDr.MeredithZoeteweyatzoetewey@usf.edu

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 English(Ph.D.)


157
http://www.cas.usf.edu/
ENGLISHPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January1
Falladmissiononly
MinimumTotalHours: 4PostMasters
ProgramLevel: Doctoral
CIPCode: 23.0101
Dept.Code: ENG
Program(Major/College): ENGAS

Concentrations:
Literature(LIT)
RhetoricandComposition(RAC)

CONTACTINFORMATION

College: ArtsandSciences
Department: English

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

ThePh.D.programinEnglishwithaconcentrationinLiteratureseekstoproduceteacherscholarswhohaveasound
generalknowledgeofBritishandAmericanliteratureandaspecializedknowledgeoftheirfieldsofconcentration.Each
student in the program must take courses in teaching college English. These courses in teaching are practicums that
includeactualteachingexperience.

The Ph.D. program in English with a concentration in Rhetoric and Composition seeks to equip teacherscholars with
botharobustfamiliaritywithcritical,literary,andrhetoricaltheoryandwiththepedagogicalexperiencesrequisitefor
qualityinstruction.Studentswillspecializetheirstudiestowardaparticularfieldofconcentration.

The Ph.D. in English involves a minimum of 30 hours of course work beyond the MA degree, exclusive of credits
devoted to the foreign language requirement and to the doctoral dissertation after Included in these hours must be
ENG6005ScholarlyResearchandWriting,ENG6018orENG6019andoneothertheoryrichcourse,andtwocourses
designated as Doctoral Seminars, with an extra credit of ENG 7939. After completing the necessary course work,
students must take a written qualifying exam with oral defense. Students passing this exam and fulfilling the foreign
languagerequirementarethenadmittedtodoctoralcandidacy.Studentswhocarrydeficienciesonthisexamformore
than two terms, or who fail this exam more than once, are dismissed from the program. Upon the completion and
approvalofthedissertation,studentswilldefendthedissertationinanoralexamination.Aftersuccessfulcompletion
ofthedissertationanddefense,studentsareawardedthedoctoraldegree.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
M.A.inEnglishfromanaccrediteduniversity
AcompetitiveVerbalaptitudescoreontheGREgeneraltest,withatargetAnalyticalWritingscoreof4.0(while
theQuantitativescoreisnotadeterminingfactorinouradmissiondecisions,bothVerbalandQuantitativescores
factorinsomeuniversityscholarshipsandfellowships)
GPAminimum3.70graduateGPA
USFTampaGraduateCatalog20132014 English(Ph.D.)


158
http://www.cas.usf.edu/
Three(3)lettersofrecommendation,atleasttwooftheselettersshouldbefromprofessorswhohavetaughtthe
applicantatthegraduatelevel
Atwotothreepagepersonalstatementdescribingthestudentsbackground,purposeforattendinggraduate
school,andcareergoals
Ascholarlywritingsampleofapproximately2500words(tendoublespacedpages)excludingbibliographyor
workscited;applicantsmayexcerptfromalongeressay.Generallythecommitteeseekstoreviewacademic
writingfromanEnglishcourse.

Allsupplementaryapplicationmaterials(i.e.,statement,writingsample,andletters),maybesubmitted
electronicallythroughtheonlineapplicationormaybesubmitteddirectlytothedepartmentatthefollowing
address:

GraduateDirector
DepartmentofEnglish
UniversityofSouthFlorida
4202E.FowlerAve.,CPR107
Tampa,FL336205550

Allmaterials,includingGREscoresandtranscripts,mustbereceivedbytheapplicationdeadlineinorderfor
studentstobeconsideredforadmission.GraduatesofUSFdonotneedtoorderofficialtranscripts.
Applicationsarereviewedbyanadmissionscommitteeafterthedeadline.Studentswillbenotifiedbymailof
theadmissionsdecisionwithinfourtosixweeksafterthedeadline.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumhours: 40hoursbeyondtheMAdegree

COREREQUIREMENTS 3hours
ENG6005ScholarlyResearchandWriting(3)

CONCENTRATIONREQUIREMENTS 2732hours
Studentsselectfromthefollowingconcentrations:

LiteratureConcentration 27hours

ENG6018orENG6019 StudiesinCriticismandTheoryI&II 3credits


(MayhavebeentakenattheMAlevel)

Onetheoryrichcoursechosenfromthefollowing 3credits
ENC6336StudiesintheHistoryofRhetoric 3
ENG6018 Criticism&TheoryI 3
ENG6019 Criticism&TheoryII 3
OrothercoursesdesignatedtheoryrichinthedepartmentsGraduateBulletinorotherwiseapprovedbythe
GraduateDirector

ENG7939DoctoralSeminar 8credits
Mustbetakentwice(twocreditstotal)inconjunctionwithathreecreditcourse;thetwocoursesplusthetwo
seminarcreditstotal8credits

OnepracticuminteachingorintutoringfortheWritingCenter 3credits
ENC6745TeachingPracticum 3
LAE6375ContemporaryCompositionStudies 3
USFTampaGraduateCatalog20132014 English(Ph.D.)


159
http://www.cas.usf.edu/
LAE6389PracticeinTeachingLiterature 13
OrothercoursesasapprovedbytheGraduateDirector

Electives 10credits
10hoursminimumfromothercoursesintheDepartmentofEnglish

Other
Demonstratedproficiencyinoneforeignlanguagebyoneofthefollowingmeans:
PlacebeyondLevelIVinalanguageplacementtest(administeredbyWorldLanguageEducation
Department)
EarnaBorbetterinoneofthegraduatecoursesReadingforFrench,Spanish,orGerman
EarnaBorbetterintwosemestercoursesofanintermediateforeignlanguage(e.g.,SpanishIIIandSpanish
IV)
EarnaBorbetterinafourthsemesterlanguagecourse(e.g.,SpanishIV)
EarnaBorbetterinasecondsemesterLatincourse

QualifyingExam
Ph.D.qualifyingexam(studentsmayenrollindirectedreadinghourswithexamcommitteemembers)

Rhetoric&CompositionConcentration 32hours

Requirements 12credits
ENC6700 StudiesinCompositionTheory 3
ENC6720 StudiesinCompositionResearch 3
ENC6421 StudiesinRhetoricandTechnology 3
ENC6336 StudiesintheHistoryofRhetoric 3

ENG7939DoctoralSeminar 8credits
Mustbetakentwice(twocreditstotal)inconjunctionwithathreecreditcourse;thetwocoursesplusthetwo
seminarcreditstotal8credits

Electives 12creditsminimum
(1215credits,dependentuponwhetherENC6745wastakenattheMAlevel)
FourorfiveelectivecoursesinRhetoricandCompositionchosenfromthefollowing:
ENC AdvancedTechnicalWriting 3
ENC6261 ProfessionalandTechnicalCommunication 3
ENC6333 ContemporaryRhetorics 3
ENC6422 NewMediaProduction 3
ENC6740 TheoryandDevelopmentofWritingPrograms 3
LAE6375 ContemporaryCompositionStudies 3

Other:ForeignLanguageRequirement
Demonstratedproficiencyinoneforeignlanguagebyoneofthefollowingmeans:

PlacebeyondLevelIVinalanguageplacementtest(administeredbyWorldLanguageEducation)
EarnaBorbetterinoneofthegraduatecoursesReadingforFrench,Spanish,orGerman
EarnaBorbetterintwosemestercoursesofanintermediateforeignlanguage(e.g.SpanishIIIand
SpanishIV)
EarnaBorbetterinafourthsemesterlanguagecourse(e.g.SpanishIV)
EarnaBorbetterinasecondsemesterLatincourse

Ph.D.QualifyingExam
Aftercompleting30hoursofcoursework,thelanguagerequirement,andallincompletegrades,astudentmay
takethePh.D.examination.Thestandardizedexamwillbeofferedtwiceeachacademicyearforalleligible
studentsandconsistsof:

USFTampaGraduateCatalog20132014 English(Ph.D.)


160
http://www.cas.usf.edu/
A24hourtakehomeexamdividedintofourwrittensections(1,000wordsapiece),thecontentof
whichcorrespondstothefourcorecourses:CompositionTheory,ResearchMethods,Rhetoricand
Technology,andHistoricalRhetorics.QuestionswillbeavailableinCanvasofficeat9:00a.m.onthe
dayoftheexam.Questionswillbedigitallysubmittedtotheexamchairby9:00a.m.onthefollowing
dayforSafeAssign(orothersoftwareasapprovedbyUniversityandDepartment)submissioninCanvas.

Amanuscriptsuitableforpublicationinaspecifiedscholarlyjournal(7,0008,500words)tobeturned
inatthesametimeasthe24hourexam.Thetopicofthemanuscriptshouldbebasedonthestudents
specializationinRhetoricandComposition.Thismanuscriptcanbearevisionofacoursepaperor
conferencepaperoranextensionoftheirprojectfromtheScholarlyWritingandResearchclass.Itmust
contributetothedisciplinebyadvancingscholarlydiscussionsinRhetoricandCompositionstudiesand
offeringnewknowledge.

Bothpartsoftheexamcarryequalweight.Allexamswillbeassessedbyarotatingcommitteeofatleast3
RhetoricandCompositionfacultyrepresentingdifferentareasofdisciplinaryexpertise.Everyexamquestionwill
begradedbyeachmemberofthecommittee,althoughemphasiswillbeplaceduponreadersareasof
specializationwhendeterminingthefinalscoreforeachquestion.

Dissertation 10hoursminimum

ENG7980Dissertation:DoctoralMinimumof10dissertationhours(nomaximum),plusoraldefense

GraduateCertificateProgram
ForinformationonGraduateCertificatespleasevisithttp://www.outreach.usf.edu/gradcerts/

EnglishGraduateCertificatesOffered:
CreativeWriting ContactProfessorRitaCiresiatrciresi@cas.usf.edu
ComparativeandInterdisciplinaryLiteraryStudies ContactDr.SusanMooneyatsmooney@cas.usf.edu
TeachingComposition ContactDr.DebraJacobsatdjacobs@cas.usf.edu
Professional&TechnicalCommunication ContactDr.MeredithZoeteweyatzoetewy@usf.edu

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 EnvironmentalScienceandPolicy(M.S.)


161
http://www.cas.usf.edu/
ENVIRONMENTALSCIENCEANDPOLICYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 3.0104
Dept.Code: ESP
Program(Major/College): ESPAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Geography,Environmentand
Planning

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Contacttheprogramforinformation.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ApplicantmustholdB.S.orB.A.degreeinarelevantsubjectarea

ApplicantmustsubmittranscriptsofundergraduatedegreeandresultsofGREtakenatmostfive(5)years
beforetheapplication.

Applicantmustsubmitastatementofinterests,documentingcapabilities,achievements,goalsandintended
areaofacademicandresearchconcentrationintheDepartmentifadmitted.

Applicantmustsubmitatleastthree(3)lettersofrecommendationfrompersonsfamiliarwiththe
applicantsachievements,capabilities,andpotential,includingtwopersonsqualifiedtojudgetheapplicants
academicperformance.

Programmayhaveadditionalrequirements;checkbeforeapplying.Itisstronglyrecommendedthatthe
applicantcontacttheDepartmentsGraduateProgramDirectorforguidanceinapplyingtotheM.S.Degree
Program.

ProgramAdmissionRequirements
Sameasuniversityrequirements.Studentsmustsubmit

GREscores
AGPAofatleast3.0inhis/herlast60undergraduatehours
IfnonnativeEnglishspeaker,TOEFLofatleast600.

USFTampaGraduateCatalog20132014 EnvironmentalScienceandPolicy(M.S.)


162
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

Thecurriculumconsistsof36creditsdividedintothreecategories:

1) CoreRequirements 15credits
2) ElectiveRequirements 12credits
3) ResearchRequirements 9credits

CoreRequirements 15credits

Applications/Tools:Studentsselectacoursewhoseprimaryobjectiveismasteryofresearchtoolsormethods
withapplicationstoresearchintheenvironmentalfield,subjecttotheapprovaloftheGraduateDirectorandthe
studentsSupervisoryCommittee.Coursesthatmeetthesecriteriainclude:

a) GIS5049GeographicInformationSystemsforNonMajors 3
b) GIS6100AdvanceGeographicInformationSystems 3
c) STA5166ComputationalStatistics 3
(orotherstatisticscourseapprovedbytheGraduateDirector
suchasPCB6456orGEO6166)
d) PCB6456Biometry 4
e) GEO6166MultivariateStatisticalAnalysis 3

AdvancedtopicsinEnvironmentalScienceStudentsmustcompletebothofthefollowingcourses:

a) GEO6116PerspectiveinEnvironmentalThought 3
b) EVR6922ESPCapstoneSeminar 3
(takenafteraminimumof24programhourshavebeencompleted)

Studentsmusttaketwocoursesfromthefollowinglist.AtleastoneclassmustbeanEVRcourse.
EVR6934 SeminarinEnvironmentalScience(varyingspecialtopics)
EVR6937 SeminarinEnvironmentalScienceandPolicy 3
(varyingspecialtopics)
EVR6216 AdvancesinWaterQualityPolicyandManagement 3
EVR6101 GeomorphologyforEnvironmentalScientists 3
EVR6408 WildlifeEcology 3
GEO6347 NaturalHazards 3
GEO6288 HydrologicSystems 3
GEO6286 AdvancesinWaterResources 3
GEO6263 SoilsSeminar 3
GEO6217 KarstGeomorphologySeminar 3
GEO6215 GeomorphologySeminar 3
GEO6209C PhysicalGeographySeminar 3
GEO6345 TechnologicalHazardsandEnvironmentalJustice 3
PHC6712 AirPollutionResearchSeminar 1

ElectiveRequirements 12credits

Studentsmustcomplete12credithoursofelectivecourseswithinanareaofconcentrationselectedaccordingto
their interests and career goals. Students should select appropriate advanced coursework within their chosen
area of concentration, in close consultation with their major professor and Supervisory Committee, to develop
programs of study that fit theirscholarly and career interests, and for thesis option students, the needs of their
research. Students completing an approved (by the Graduate Director) graduate certificate as part of their
programs can count 12 hours from the certificate program towards the M.S. degree elective requirements.
StudentscompletingtheEnvironmentalPolicyandManagementCertificatecanapplyGEO6116andEVR6922(or
approved course substitutions) toward the M.S. degree core requirements. Additional certificate courses that
meet M.S. degree core requirements will be applied to the core and remaining courses will be counted as
electivesintheMSprogram.EachstudentselectiveprogramofstudyissubjecttotheapprovaloftheGraduate
USFTampaGraduateCatalog20132014 EnvironmentalScienceandPolicy(M.S.)


163
http://www.cas.usf.edu/
Director. Areas in which students may decide to complete their electives, where courses are supported by the
ES&PProgramand/oraffiliatedDepartments,include:

1. Ecology.12creditsprimarilyfromcoursesofferedwithintheES&PProgramintheDepartmentof
Geography,andcoursesintheDepartmentofBiology,tobeselectedinconsultationwiththestudents
majorprofessorandSupervisoryCommittee.Thisareafeaturesaparticularconcentrationinlandscape
ecology,wildlifeecologyandmanagement,conservationbiology,ecologicalmodeling,andfieldmethods,
includingtheuseofGIS,GPS,andremotesensingtechnologies.

2. EnvironmentalPolicyandManagement.15credits(only12hourscanbeappliedtowardstheMSprogram)
guidedbytheguidelinesfortheGraduateCertificateinEnvironmentalPolicyandManagement.Creditswill
beappliedtothecoreandelectiverequirementsfortheM.S.programasdescribedabove.

3. Geology.12creditsprimarilyfromcoursesofferedwithintheES&PProgramintheDepartmentof
GeographyandcoursesintheDepartmentofGeologytobeselectedinconsultationwiththestudents
SupervisoryCommittee.Thisareafeaturesaparticularconcentrationinkarstgeologyandpublicpolicy
planninginkarsticenvironments:andaconcentrationinpaleogeology.

4. Hydrogeology.15credits(only12hourscanbeappliedtowardstheMSprogram)asrequiredbythe
GraduateCertificateinHydrogeology,asspecifiedbytheDepartmentofGeology.

5. HazardsAssessmentandMitigation.12creditsprimarilyfromcoursesofferedwithintheES&PProgramin
theDepartmentofGeography,andcoursesintheDepartmentofGeology,andCivilEngineering,tobe
selectedinconsultationwiththestudentsmajorprofessorandSupervisoryCommittee.

6. UrbanEnvironment.12credithoursprimarilyintheDepartmentofGeography,tobeselectedin
consultationwiththestudentsmajorprofessorandSupervisoryCommittee.

7. WaterQualityandPolicy.12creditsdrawnfromrelevantcoursesofferedwithintheES&PPrograminthe
DepartmentofGeography,andcoursesintheDepartmentofCivilandEnvironmentalEngineering,andthe
SchoolofPublicAffairs,tobeselectedinconsultationwiththestudentsmajorprofessorandSupervisory
Committee.Thisareafeaturesaparticularconcentrationinurbanrunoffwaterquality,watershedbased
waterqualityassessment,andwatershedplanningandmanagementforwaterqualityprotection.

8. Other.12creditsinotherareasofconcentrationarealsoconsidered.Thestudentmayselectanareaof
concentrationthatisstronglysupportedbygraduatestudiesatUSFandbyoneormorefacultymembersin
theDepartmentofGeography.Thestudentshouldbeabletodescribehowthecoursesformacoherentarea
ofconcentrationrelevanttohisorherscholarlyinterests,researchobjectives,and/orcareergoals,and
prepareabriefstatementtothateffectfortheapprovaloftheGraduateDirector.Thestudentshouldthen
selectcoursesinconsultationwithhis/hermajorprofessorandSupervisoryCommittee.

ResearchRequirements(9credits)

The M.S. in ES&P is a researchoriented degree. Thesis track students complete a Thesis which constitutes an
originalscholarlycontributionandisconductedunderthedirectionofaMajorProfessoranda3memberFaculty
Supervisory Committee (of which the Major Professor serves as chair). Students should form their Supervisory
Committee before completion of 18 credits of coursework, typically near the end of their first full year in the
Program.StudentscompleteaThesisProposalsubjecttoapprovaloftheSupervisoryCommitteetypicallyearlyin
thesecondyearofstudies.StudentsdefendtheirThesisinanoralpresentation,andsubmitawrittendocument
for the approval of the Supervisory Committee, which is then submitted to the University as a requirement for
earningthedegree.

Theresearchrequirementsincludethefollowingcoursework,foraminimumtotalof9credithours:

1. Directed Research (Thesis Preparation, EVR (6920): Students complete at least 6 credit hours of thesis
research under the direct supervision of their major professor, typically during the second year of studies.
After completion of all Core and Elective requirements, students remain enrolled in at least 2 credit hours
USFTampaGraduateCatalog20132014 EnvironmentalScienceandPolicy(M.S.)


164
http://www.cas.usf.edu/
per semester of EVR 6920 until the completion and submittal of the Thesis which completes the
requirements for the degree. Throughout this period students must work in close cooperation with their
major professor and Supervisory Committee, and provide the Committee a summary of progress at least
oncepersemester.

2. Research Methods/Design Preparation: All students selecting the Thesis option will complete a research
methods/designcourse(GEO6970ResearchMethodsinGeography).Othercoursesmaybesubstitutedfor
thisrequirementwiththepermissionofthestudentsadvisorandtheGraduateProgramDirector.

3. ResearchColloquium(EVR6930),1credithour

Thesis/NonThesisOptions
TherearetwooptionstocompletetheM.S.Degree:

A. Thesis Option. The thesis option is a 36hour program designed for students who wish to complete original
researchaspartoftheirgraduatestudies.Thethesisoptionisaviableoptionforallstudents.Thoseintendingto
continuegraduateworktothePh.D.levelarestronglyencouragedtocompleteathesis.

B. NonThesisOption.Studentscompleteaminimumof36hours,with24hoursofelectives,keepinginmindthata
minimum degree requirement is 16 hours at the 6000 level. Students must pass a comprehensive written
examinationthatisadministeredduringthesemestertheyplantograduate.

ComprehensiveExamination

ThesisOption:
1. Thestudentisrequiredtopresenthis/herthesisresearchatapublicthesisdefense.

2. Aspartofthethesisdefense,anoralcomprehensiveexamisalsoadministered.Thedefenseandoralexamis
scheduledandorganizedbythestudentsmajorprofessor,inconsultationwiththestudentsSupervisory
CommitteeandtheGraduateDirector.Aspartofthisprocess,aPresentationsForm(availableinthedepartment
office)needstobecompletedoneweekpriortothedefensedate.

3. TheexamcanbecompletedonlyduringthespringandfallSemesters.

4. Acopyofthethesismustbemadeavailableinthedepartmentofficeoneweekpriortothedefenseforpublic
review.

NonThesisOption:
1. TheexaminingcommitteewillbecomprisedofthestudentsSupervisoryCommittee.

2. Nonthesisstudentsarerequiredtocompleteasixhourlong,written,closedbook,comprehensiveexam,which
typicallyconsistsofseriesofquestionsthatarepreparedbytheexaminationcommittee.Studentsarenot
allowedanyoutsidematerialsduringtheexam,whichistobehandwrittenonpapersuppliedbytheexamination
committee.

3. Theexamcanbecompletedduringthespringorfallsemesters,butnotduringthesummer.

4. Studentsareencouragedtocompletetheexamduringthelastsemesteroftheircoursework.Theexammustbe
completednolaterthanonesemesterafterthestudentcompletesthecourseworkforthedegree.Youmustbe
registeredfortwocreditsinthatsemesterinthesemesterthattheexamiscompleted.

5. Allnonthesisexaminationswillbescheduledforthesamedayeachsemester(i.e.allstudentswillsitforthe
examatthesametime),thedatebeingsetbytheGraduateDirector.Studentsmustcoordinatewiththeirmajor
professorswhentheywilltaketheexam.

USFTampaGraduateCatalog20132014 EnvironmentalScienceandPolicy(M.S.)


165
http://www.cas.usf.edu/
6. Questionsaresolicitedandorganizedbythestudentsmajorprofessorinconsultationwiththestudents
examinationcommittee.

7. TheanswerstothequestionsareevaluatedbythestudentsSupervisoryCommitteewithintwoweeksofthe
exam.

8. Iftheanswertoanyquestionisdeterminedtobeincorrectorincomplete,thestudentmayberequiredtoretake
thatportionoftheexamintheformofanoralexamthatisonlyopentothecommittee.Studentsareencouraged
tocompletetheoralexaminthesamesemestertheycompletedthefirstwrittenexam.

9. Ifthestudentfailsallportionsoftheexam,theywillhaveoneopportunitytoretaketheentireexam.Thissecond
exammustbecompletednolaterthanthesemesterafterthestudentreceivesnotificationthatasecondexamis
necessary.

10. Ifitisdeterminedthatthestudentdidnotsuccessfullycompletehis/hercomprehensiveexamaftertheirsecond
attempt,he/shewillbedismissedfromtheprogram.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 French(M.A.)


166
http://www.cas.usf.edu/
FRENCHPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 34
ProgramLevel: Masters
CIPCode: 16.0901
Dept.Code: WLE
Program(Major/College): FREAS

CONTACTINFORMATION

College: ArtsandSciences
Department: WorldLanguages
ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

ContactProgramforInformation.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus

23lettersofrecommendation,
AwritingsampleinFrench,and
AnoralinterviewinFrench(canbedonebyphone).
GREisnotrequired.

DEGREEPROGRAMREQUIREMENTS

Corerequirements
1. Proficiencyinasecondforeignlanguage.

2. SatisfactorycompletionofawrittencomprehensiveexaminationonFrenchlanguage,literature,andcivilization.
Thisexamisbasedonareadinglist.

3. FOW6805Bibliographyfor1credithour

4. Courseworkfollowingoneoftheplanslistedbelow:

USFTampaGraduateCatalog20132014 French(M.A.)


167
http://www.cas.usf.edu/
PlanA37hoursofgraduatecoursesinFrench.

Students take the required FOW 6805 and select the remaining 12 French graduate courses as approved by
theGraduateProgramDirector.

ComprehensiveExam
5examsfromaselectedreadinglistthesemesterthestudentcompletescoursework

Thesis
Thisisanonthesisoption.

PlanB37hours

Students take the required FOW 6805 and select the remaining graduate courses as approved by the
Graduate Program Director. Nine to 10 of those courses will be in French and two to three will be graduate
coursesinanotherarea/department(foratotalof12courses),asapprovedbytheFrenchGraduateProgram
Director.

ComprehensiveExam
5examsfromaselectedreadinglistthesemesterthestudentcompletescoursework,with4examsinFrench
andoneintheselectedotherarea/department

Thesis
Thisisanonthesisoption.

PlanC28semesterhoursinFrenchplusathesis(6credithours)

StudentstaketherequiredFOW6805andselecttheremaining9Frenchgraduatecoursesasapprovedbythe
GraduateProgramDirector.

ComprehensiveExam
5examsfromaselectedreadinglistthesemesterthestudentcompletescoursework

Thesis
Thesis,including6credithoursofFRE6971Thesis

PlanD28semesterhoursplusathesis(6credithours)

Students take the required FOW 6805 and select the remaining graduate courses as approved by the
GraduateProgramDirector.SixtosevenofthosecourseswillbeinFrenchandtwotothreewillbegraduate
coursesinanotherarea/department(foratotalof9courses),asapprovedbytheGraduateProgramDirector.

ComprehensiveExam
5examsfromaselectedreadinglistthesemesterthestudentcompletescoursework,with4examsinFrench
andoneintheselectedotherarea/department

Thesis
Thesis,including6credithoursofFRE6971Thesis

USFTampaGraduateCatalog20132014 French(M.A.)


168
http://www.cas.usf.edu/
OTHERINFORMATION

SpecialProgramsOverseas
The Department of World Languages, in cooperation with the International Affairs Center, offers several study
programs overseas. These include study in several locations in France and Canada. For complete details, contact the
programadvisorsortheInternationalAffairsCenter.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Geography(M.A.)


169
http://www.cas.usf.edu/
GEOGRAPHYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15(GAApplication)
April1(withoutGAApplication)
Spring:October15(withorwithoutGA
application)

MinimumTotalHours: 30ThesisOption
36NonThesisOption
ProgramLevel: Masters
CIPCode: 45.0701
Dept.Code: GPY
Program(Major/College): GPYAS

Concentrations:
HumanGeography(USG)
EnvironmentalGeography(EVG)
GeographicInformationScience&SpatialAnalysis(TGP)

CONTACTINFORMATION

College: ArtsandSciences
Department: Geography,Environment,and
Planning

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu
PROGRAMINFORMATION

Geographyisthestudyofthehumanenvironmentrelationshipeitherinaglobalormoreregionalcontext.

Human Geography studies the construction of space, place, and power. It encompasses the study of economic
geographies (e.g. globalization and development), political geographies (e.g. geopolitical struggles and new social
movements),andsocialandculturalgeographies(e.g.identitiesandexclusions).Humangeographyiskeytoproviding
insights into contemporary spatial arrangements, including the role of cities within the global economy, locating
urbanrural intersections in theproduction of uneven development, and howclass, gender, and raceshape struggles
forsocialjustice.

EnvironmentalGeographylinksthestudyofnatureandsocietyandconsidersthewaysinwhichconventionaldivisions
between human and nonhuman (natural) worlds are bridged through the production of socionatures. This
understanding is crucial to explaining and ameliorating contemporary environmental problems, including the
privatization of natural resources, inequalities in access to food and water, injustices associated with environmental
hazardsandundesirablelanduses,andtheroleofhumanactivitiesinspurringlargescaleenvironmentalchange

GIScienceandSpatialAnalysisconcentratesontheuseofadvancedgeospatialtechnologies,andthedevelopment
and use of spatial analysis methodologies, to applied research problems in human and environmental geography. A
thoroughunderstandingofsuchgeospatialtechnologiesasRemoteSensing,GIS,andGPS,aswellasmodernmethods
of spatial statistical analysis and emerging spatial analytical techniques such as agentbased modeling, is a critical
aspectofdevelopingappropriateapproachestotheanalysisofgeographicdata.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

USFTampaGraduateCatalog20132014 Geography(M.A.)


170
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus
Atleasttwolettersofrecommendation,
transcripts,
Aletterofintent,and
AgraduateassistantapplicationiftheapplicantisapplyingforaGAposition.
GREisrequired.
BAwith3.0GPA

DEGREEPROGRAMREQUIREMENTS

TheDepartmentofGeography,Environment,andPlanningoffersaMastersofArts(M.A.)inGeographywithathesis
andnonthesisoption.Studentsmustcompleteaminimumof30semesterhoursofgraduatelevelcourseworkforthe
thesisoptionand36hoursforthenonthesisoption.

CoreRequirements 9hours

RequiredCoreCourses(9Hours)
Allstudentsmusttakethefollowingcorecourses:

GEO6058 GeographicLiteratureandHistory 3
GEO6116 PerspectivesinEnvironmentalThought 3

Baseduponthestudentsareaofinterest,he/shemusttakeonecoursefromthefollowingQuantitativeorQualitative
courseofferings:

GEO6166 MultivariateStatisticalAnalysis 3
GEO6119 GeographicalTechniquesandMethodology:QualitativeResearchMethods3

Regional:
Studentsarestronglyencouragedtocompleteatleastoneofthefollowingregionalcourses:
GEA6195 SeminarinAdvancedRegionalGeography 3
GEA6215 SeminarinNorthAmericanGeography 3
GEA6252 SeminarintheGeographyoftheAmericanSouth 3
GEA6406 SeminarinLatinAmericanandCaribbeanGeography 3
GEA6504 SeminarinEuropeanGeography 3
GEA6745 AsianGeographySeminar 3

ConcentrationRequirements
Studentsspecializeinoneofthethreeconcentrations(A,B,andC)thatthedepartmentoffers.Studentsmustselecta
minimumofthreecourses(9credits)fromtheselectedconcentration.

ThesisoptionStudentstakesixcredithoursofelectivesatalevelof5000orhigher,keepinginmindthataminimumof
ten hours is required at the 6000level. At least one of the electives must be taken outside of the students
concentrationexcludingGEO6908,6918,and6944.Electivesmayalsobeselectedfromcoursesofferedoutsideofthe
Department, with the consent of the students advisor and the graduate program coordinator. A maximum of six
approved hours taken outside the department can be used in the students degree program. The remaining 6 credit
hours are taken as Thesis (GEO 6971). Students in the thesis option can only apply three credit hours of Internship
(GEO6944),andthreecredithoursofDirectedResearch(GEO6918)orIndependentResearch(GEO6908)towardthe
degree.Uponcompletionofaminimumof18hoursstudentsarerequiredtodefendathesisproposal.Studentsmust
USFTampaGraduateCatalog20132014 Geography(M.A.)


171
http://www.cas.usf.edu/
alsocompleteathesisdefenseduringthesemestertheyplantograduate,andtheymustbeenrolledinaminimumof
2semesterhoursofthesiscreditduringthesemesterinwhichtheysubmittheirthesistotheGraduateSchool.

Nonthesis option Students complete a total of 36 hours, with 27 hours of electives completed at a level of 5000 or
higher,keepinginmindthataminimumdegreerequirementis16hoursatthe6000level.Studentscanalsotakeupto
ninehoursoutsidethedepartmentwiththeconsentoftheiradvisorandthegraduateprogramcoordinator,toapply
toward their degree program. Students can apply three credit hours of Internship (GEO 6944), three credit hours of
DirectedResearch(GEO6918)and/orIndependentResearch(GEO6908)towardtheirdegreeprogram.Studentsmust
passacomprehensivewrittenexaminationthatisadministeredduringthesemesterinwhichtheyplantograduate.

Studentsselectoneofthefollowingconcentrations:

HumanGeography
GEO6058 GeographicLiteratureandHistory 3
GEO6428 SeminarinAdvancedHumanGeography 3
GEO6605 ContemporaryUrbanIssues 3
GEO6475 PoliticalGeographySeminar 3
GEO6345 TechnologicalHazardsandEnvironmentalJustice 3
GEO6545 EconomicGeographySeminar 3
GEO6627 SiteFeasibilityAnalysis 3
GEO6704 TransportationGeography 3
GEO6119 GeographicalTechniquesandMethodology:QualitativeResearchMethods3
GEO6166 MultivariateStatisticalAnalysis 3
GEO7606 SeminarinUrbanEnvironments 3
GIS6307 SocioeconomicApplicationsofGIS 3

Aregionalgeography(GEA)coursemaybesubstitutedforacourseintheHumanGeographyconcentration.

EnvironmentalGeography
GEO6116 PerspectiveofEnvironmentalThought 3
GEO6345 TechnologicalHazardsandEnvironmentalJustice 3
GEO6209C PhysicalGeographySeminar 3
GEO6215 GeomorphologySeminar 3
GEO6217 KarstGeomorphology 3
GEO6255 Weather,Climate,andSociety 3
GEO6263 SoilsSeminar 3
GEO6286 WaterResources 3
GEO6288 HydrologicalSystems 3
GEO6347 NaturalHazards 3
GEO6166 MultivariateStatisticalAnalysis 3
GIS6038C AdvancedRemoteSensing 3
GIS6039 ReadingsinRemoteSensing 3
GIS6306 EnvironmentalApplicationsofGIS 3
GIS6355 WaterResourcesApplicationsofGIS 3

GeographicInformationScienceandSpatialAnalysis
GEO5075 GlobalPositioningSystems 3
GIS6038C RemoteSensing 3
GIS6039 RemoteSensingSeminar 3
GIS6100 GeographicInformationSystem 3
GIS6103 ProgrammingforGIS 3
GIS6112 SpatialDatabaseDevelopment 3
GEO6115 FieldTechniques 3
GEO6119 GeographicalTechniquesandMethodology 3
GIS6146 GISSeminar 3
GEO6166 MultivariateStatisticalAnalysis 3
GIS6306 EnvironmentalApplicationsofGIS 3
USFTampaGraduateCatalog20132014 Geography(M.A.)


172
http://www.cas.usf.edu/
GIS6307 GISSeminar 3
GIS6355 WaterResourcesApplicationsofGIS 3

Thesamecoursecannotbeusedtosatisfyboththerequiredcoreandconcentrationcourserequirements.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 GeographyandEnvironmentalScienceandPolicy(Ph.D.)


173
http://www.cas.usf.edu/
GEOGRAPHYANDENVIRONMENTALSCIENCEANDPOLICYPROGRAM

DoctorofPhilosophy(Ph.D.)

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

MinimumTotalHours: 60
ProgramLevel: Doctoral
CIPCode: 45.0799
Dept.Code: GEP
Program(Major/College): GEPAS

CONTACTINFORMATION

College: ArtsandSciences
Departments: Geography,Environment,and
Planning

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

ThePh.D.degreeinGeographyandEnvironmentalScienceandPolicyisaninterdisciplinaryprogram,thecurriculumof
whichisdesignedtotakeadvantageoftheDepartmentofGeography,Environment,andPlannings(GEP)strengthsin
criticalareasofgeographyandenvironmentalscienceandpolicy.Emphasisisplacedonprovidingtheoreticalrigorand
methodologicalskillsenablingstudentstomakesignificantandoriginalresearchandpolicycontributionsinan
integratedinterdisciplinaryenvironment.Inaddition,thedegreehasaverystrongappliedcomponentreflectingthe
Departmentsstrongemphasesinworkingonsolutionstorealworldgeographicalandenvironmentalproblems.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

AreasofEmphasis:
Geography
EnvironmentalScienceandPolicy

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Undergraduatedegreeinrelevantfield,withpreparationingeographyand/orenvironmentalscienceandpolicy
GraduateRecordExamisrequired
GPAatleast3.20inupperdivisionundergraduateandgraduatecredits
IfnonnativeEnglishspeaker,TOEFLofatleast600
Abilitytoconductresearchinafieldofcurrentinteresttodepartmentalfaculty

SeeDepartmentguidelinesforapplicationmaterialsexpectedandotherexpectedqualificationsforadmittance.

Incomingstudentsarerequiredtodesignateeither'Geography'or'EnvironmentalScienceandPolicy'astheirareaof
emphasis(track)intheirapplicationforadmission.

USFTampaGraduateCatalog20132014 GeographyandEnvironmentalScienceandPolicy(Ph.D.)


174
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumProgramHours: 60hourspostmasters
90hourspostbachelors

CoreRequirements 3credits
Allstudentsmustcompletethefollowingcourse:
DoctoralDissertationPreparation 3credits
GEO7021 DoctoralDissertationPreparation 3
EVR7021 DoctoralDissertationPreparation 3

AreaofEmphasisRequirements
UponenteringtheProgram,studentsselecteitherGeographyor'EnvironmentalScienceandPolicy(ESP)'astheirarea
of emphasis (track). Students complete six (6) credits of required coursework within their chosen area of emphasis as
designated by either the Geography or ESP Graduate Coordinator. The coursework should be selected to support the
studentsdissertationresearch.AwidevarietyofadvancedgraduatecoursesareofferedintheGEPDepartmentineach
ofthetwoareasofemphasis.

GEOGRAPHYTRACK:
AreaofEmphasisRequirements 6Hours
GEO7606 SeminarinUrbanEnvironments

Onecoursefromthefollowinglistofquantitative,qualitative,orGIScourseofferings:

GEO6166 MultivariateStatisticalAnalysis
GEO6119 GeographicalTechniques&Methodology:QualitativeResearchMethods
GIS6100 GeographicInformationSystems

ENVIRONMENTALSCIENCE&POLICYTRACK:
AreaofEmphasisRequirements 6Hours
EVR6922 ESPCapstoneSeminar
EVR6920 EnvironmentalManagement

3.Electives 33hours

Studentscomplete51credithoursintheformofelectivecourseworkrelatedtotheirareaofemphasis,directedreading,
independent study, or dissertation hours (18 hours minimum required). The students major professor and Faculty
SupervisoryCommitteewilladvisestudentsontheselectionofthepropermixofcourseworkandotherstudytosupport
the agreed upon dissertation research. Students can include coursework from a variety of departments to support the
elective requirements, and students may choose to complete a Graduate Certificate in a particular field, from GEP or
anotherdepartment,aspartoftheirstudies.StudentsenteringthePh.D.programwhohavenotcompletedaMasters
DegreeineitherGeographyorEnvironmentalScienceandPolicyshouldexpecttocompletecourseworkequivalenttothe
requirementsofoneofthoseMastersprograms.

GeographyTrack
Electives 33Hours
GEO6058 GeographicLiteratureandHistory
GEO6428 SeminarinAdvancedHumanGeography
GEO6605 ContemporaryUrbanIssues
GEO6475 PoliticalGeographySeminar
GEO6545 EconomicGeographySeminar
GEO6627 SiteFeasibilityAnalysis
GEO6704 TransportationGeography
GEO6116 PerspectivesinEnvironmentalThought
GEO6119 GeographicalTechniques&Methodology
GEO6166 MultivariateStatisticalAnalysis
USFTampaGraduateCatalog20132014 GeographyandEnvironmentalScienceandPolicy(Ph.D.)


175
http://www.cas.usf.edu/
GEO6209 PhysicalGeographySeminar
GEO6215 GeomorphologySeminar
GEO6217 KarstGeomorphology
GEO6255 Weather,Climate,andSociety
GEO6263 SoilsSeminar
GEO6286 AdvancesinWaterResources
GEO6288 HydrologicalSystems
GEO6347 NaturalHazards
GEO6345 TechnologicalHazardsandEnvironmentalJustice
GEA6195 SeminarinAdvancedRegionalGeography
GEA6215 SeminarinNorthAmericanGeography
GEA6745 AsianGeographySeminar
GEA6252 SeminarintheGeographyoftheAmericanSouth
GEA6406 SeminarinLatinAmericanandCaribbeanGeography
GEA6504 SeminarinEuropeanGeography
GIS5049 GISforNonMajors
GIS5075 GlobalPositioningSystems
GIS6306 EnvironmentalApplicationsofGIS
GIS6307 SocioeconomicApplicationsofGIS
GIS6355 WaterResourcesApplicationsofGIS
GIS6038 AdvancedRemoteSensing
GIS6039 ReadingsinRemoteSensing
GIS6100 GeographicInformationSystems
GIS6103 ProgrammingforGIS
GIS6112 SpatialDatabaseDevelopment
GEO6115 FieldTechniques
GIS6146 GISSeminar

EnvironmentalScienceandPolicyTrack
Electives 33Hours
EVR6101 GeomorphologyforEnvironmentalScientists
EVR6216 AdvancesinWaterPolicyandManagement
EVR6408 WildlifeEcology
EVR6936 SeminarinEnvironmentalScience
EVR6937 SeminarinEnvironmentalPolicy
GEO6116 PerspectivesonEnvironmentalThought
GEO6255 Weather,ClimateandSociety
GEO6286 AdvancesinWaterResources
GEO6345 TechnologicalHazardsandEnvironmentalJustice
GIS6306 EnvironmentalApplicationsofGIS
GIS6355 WaterResourceApplicationsofGIS
URP6056 CityandRegionalPlanning
URP6100 PlanningTheoryandHistory
URP6115 Planning,PolicyandPolitics
URP6232 ResearchMethodsforUrbanandResearchPlanning
URP6930 SpecialTopicsinUrbanandRegionalPlanning
URP6940 InternshipinUrbanandRegionalPlanning
CWR6305 UrbanHydrology
CWR6533 WaterQualityModeling
ECP6305 EnvironmentalEconomicsandPolicy
GLY6573 FluvialHydrologyandGeomorphology
GLY6824 Ecohydrology
GLY6828 GroundWaterGeochemistry
IDS6215 SeminarinGlobalSustainability
PAD6338 UrbanLandUseandPolicyAdministration
PAD6339 HousingandPublicPolicy
USFTampaGraduateCatalog20132014 GeographyandEnvironmentalScienceandPolicy(Ph.D.)


176
http://www.cas.usf.edu/
PCB6933 SeminarinEcology
PHC6301 WaterPollutionandTreatment
PHC6312 EnvironmentalFateofChemicalReleases
PHC6313 IndoorEnvironmentalQuality
PHC6353 EnvironmentalRiskAssessment
POS5159 UrbanPolicyAnalysis

Ph.D.CandidacyandDissertation 18hours

A student will be admitted to candidacy following successful completion of comprehensive qualifying exams and the
successful oral defense of a dissertation proposal. To complete the degree, a student will be required to pass an oral
defense of her/his Ph.D. dissertation. See Program guidelines for detailed procedures on dissertation research, faculty
supervision, structure of examinations and defenses, and completion of the dissertation. A minimum of 18 hours of
DoctoralDissertationResearch(EVR7980/GEO7980)arerequired.

GEO7980 DoctoralDissertationResearch 18
EVR7980 DoctoralDissertationResearch 18

SeeProgramguidelinesforadditionalinformation.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Geology(M.S.)


177
http://www.cas.usf.edu/
GEOLOGYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15*

Falladmissiononly

*Springadmissionavailableonlyforstudentsentering
theProfessionalScienceMastersDegreeoption

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 40.0601
Dept.Code: GLY
Program(Major/College): GLYAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Geology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

*Deadlineforstudentsseekingassistantship/fellowship
supportisonemonthearlier.Foreignstudentapplicants
shouldprovidetheirmaterialsasearlyasisfeasibleto
permittimetomeetimmigrationandvisarequirements
ifadmitted.

PROGRAMINFORMATION

Geology incorporates the fundamentals of biology, chemistry, mathematics, and physics to study the earth and the
processesthataffectourplanet.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityadmissionrequirementsplus

3lettersofrecommendation,
personalstatement,
listingofpreviouscoursework,
transcripts,and
GRErequired,butnominimumspecified.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 30hours

CoreRequirements 24hours
Structuredcoursework,ofwhichatleasttenhoursmustbeat6000level,selectedwiththeadvisor
fromthefollowinglist,orothercourseasapprovedbythegraduateprogramdirector:

USFTampaGraduateCatalog20132014 Geology(M.S.)


178
http://www.cas.usf.edu/
GLY5752 GeologicalFieldExcursion 2
GLY5865 StatisticalModelsinGeology 3
GLY5932 SelectedTopicsinGeology 14
GLY6075 GreenhouseIcehouseEarth 3
GLY6156 GeologyofNorthAmerica 2
GLY6246 GeneralGeochemistry 3
GLY6248 SedimentaryGeochemistry 3
GLY6255 TracerGeochemistry 3
GLY6285C AnalyticalTechniquesinGeology 3
GLY6345 SedimentaryPetrography 3
GLY6395C TopicsinIgneousandMetamorphicPetrology 24
GLY6424 GlobalTectonics 2
GLY6475C PrinciplesofAppliedGeophysics 4
GLY6492 HydrogeologyInternshipProject 3
GLY6573 FluvialHydrologyandGeomorphology 3
GLY6575C CoastalSedimentation 3
GLY6739 SelectedTopicsinGeology 14
GLY6824 Ecohydrology 3
GLY6827C AdvancedHydrogeology 4
GLY6828 GroundWaterGeochemistry 3
GLY6836 NumericalModelingofHydrogeologicSystems 3
GLY6905 IndependentStudy 119

ThesisOption:
Thesis 6hours
GLY6971Thesis 6

ProfessionalScienceMasters(PSM)DegreeOption 6hours
GLY6xxx IntroductiontoProfessionalGeology 3
GLY6492ProfessionalInternshipResearchProject 3
The Professional Internship projects are typically supervised bya Professional Geologists (PG) and must receive prior
approval by the internship coordinator. The student must submit an Internship Project Report approved by the
supervisingPG.Thestudentmustthenpresenttheresultsoftheirprojectsataneveningpublicmeetinghostedbythe
GeologyAlumniSocietytypicallyattheSouthwestFloridaWaterManagementDistrict(SWFWMD)Tampaoffice.

ComprehensiveExam
For students in the thesis option, the thesis defense serves as the comprehensive exam. For students in the
ProfessionalScienceMastersDegreeoption,thecomprehensiveexitexamisbasedoncourseworkandaninternship
project.Beforetheexam,thestudentmustsubmitanInternshipProjectReportapprovedbythesupervisingPG.The
internshipcommitteedeterminestheformatoftheexam.Normally,it isanoralexaminationfollowingthestudents
presentationoftheresultsoftheinternshipprojecttothehydrogeologyinternshipcommittee.

OtherInformation:
ThecurriculumforaGeologygraduatestudentvariesdependingontheareaofresearchinterest.Specificcoursework
for the degree is determined via consultation between the student, his/her primary advisor and his/her student
advisorycommittee.OtherpertinentinformationregardinggraduatestudyiscontainedintheDepartmentsGraduate
StudentHandbook,whichisavailableuponrequest.

All degree candidates are required to maintain satisfactory academic progress at all times. Satisfactory academic
progress in this program is defined as progress in course and thesis work. Evidence of academic progress includes
timely completion of departmental requirements such as selecting a primary advisor, forming a student advisory
committee, completion of any prerequisites or deficiencies, timely progress toward completion of the thesis,
maintainingasatisfactoryGPA,defendingathesisproposal,andmakingapublicpresentation.Ascheduleformeeting
theserequirementsiscontainedintheDepartmentsGraduateStudentHandbook.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Geology(Ph.D.)


179
http://www.cas.usf.edu/
GEOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15*
Summer: February15

MinimumTotalHours: 60(postmasters)
90(postbachelors)
ProgramLevel: Doctoral
CIPCode: 40.0601
Dept.Code: GLY
Program(Major/College): GLYAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Geology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

*Deadlineforstudentsseekingassistantship/fellowship
supportisonemonthearlier.Foreignstudentapplicants
shouldprovidetheirmaterialsasearlyasisfeasibleto
permittimetomeetimmigrationandvisarequirements
ifadmitted.

PROGRAMINFORMATION

Geology incorporates the fundamentals of biology, chemistry, mathematics, and physics to study the earth and the
processesthataffectourplanet.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityadmissionrequirementsplus

3lettersofrecommendation,
personalstatement,
listingofpreviouscoursework,
transcripts,and
GREisrequired,butnominimumspecified.

USFTampaGraduateCatalog20132014 Geology(Ph.D.)


180
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 60hourspostmasters
90hourspostbachelors
PostMasters
Corerequirements 15hours
Structuredcoursework,ofwhichatleastfifteenhoursmustbeat6000level,selectedwiththeadvisor
fromthefollowinglist,orothercourseasapprovedbythegraduateprogramdirector:

GLY5752 GeologicalFieldExcursion 2
GLY5865 StatisticalModelsinGeology 3
GLY5932 SelectedTopicsinGeology 14
GLY6075 GreenhouseIcehouseEarth 3
GLY6156 GeologyofNorthAmerica 2
GLY6246 GeneralGeochemistry 3
GLY6248 SedimentaryGeochemistry 3
GLY6255 TracerGeochemistry 3
GLY6285C AnalyticalTechniquesinGeology 3
GLY6345 SedimentaryPetrography 3
GLY6395C TopicsinIgneousandMetamorphicPetrology 24
GLY6424 GlobalTectonics 2
GLY6475C PrinciplesofAppliedGeophysics 4
GLY6492 HydrogeologyInternshipProject 3
GLY6573 FluvialHydrologyandGeomorphology 3
GLY6575C CoastalSedimentation 3
GLY6739 SelectedTopicsinGeology 14
GLY6824 Ecohydrology 3
GLY6827C AdvancedHydrogeology 4
GLY6828 GroundWaterGeochemistry 3
GLY6836 NumericalModelingofHydrogeologicSystems 3
GLY6905 IndependentStudy 119

OtherCourseRequirements 33hours
Determinedatthediscretionofthestudentscommittee
MayincludeGLY7912DirectedResearch

QualifyingExamandAdmissiontoCandidacy
Admission to candidacy will be based on the results of a general examination administered by the students
committee.Theformatoftheexamwillbedeterminedbythecommitteeatleastoneweekpriortotheonsetofthe
examination.Normally,itwillconsistofawrittensectionorsections,followedbyanoralexaminationchairedbythe
students research advisor. After admission to candidacy, all doctoral students will make at least one formal
presentationoftheirresearchpriortograduation.Anyappropriatevenueisacceptable,e.g.,Dept.colloquium,oralor
postersessionsatascientificmeetingofatleastregionalscope.

General examinations and presentations of dissertation proposals should be completed no later than the end of the
second year in the doctoral program or at the time determined by the students committee. The examining and
dissertationcommitteesarethesameandwillbecomprisedofnolessthanfivemembers,atleastthreeofwhichmust
beUSFfaculty,andatleastonememberfromoutsidethedepartment.

Dissertation 12hours
GLY7980Dissertation

OtherInformation
Aminimumof90credithourswillberequiredforstudentspursuingaPh.D.degreefromaB.S.degree.Thisincludes
anygraduatecreditsearnedpriortoadmissiontothedoctoralprogram.Comparedtotherequirementsstartingfrom
aM.S.degreeasdescribedintheparagraphbelow,30additionalcredithoursarerequiredforstudentsstartingfroma
USFTampaGraduateCatalog20132014 Geology(Ph.D.)


181
http://www.cas.usf.edu/
B.S.degree.StudentsarerecommendedtosatisfytherequirementssimilartothatofaMSdegreeduringthefirsttwo
yearsofthePh.D.study.

AlldoctoralstudentsmustmaintaingoodstandingintheGraduateSchool(overallGPA=3.0)andmaintainsatisfactory
academicprogresstowardthedegree.AnystudentwhoreceivesaCinastructuredcoursewillbeplacedonacademic
probation.ThisprobationcanbeterminatedbyachievinggradesofBorhigherinthesubsequentsemesteroffulltime
enrollment. If a second grade of C is received, the student is terminated from the doctoral program. Only courses in
which the student receives at least a B may be counted toward the structuredcourse requirement. There is also a
requirement that Ph.D. students have at least two semesters of fulltime residence. While meeting the residency
requirements,candidatesmustbefulltimestudentsingoodacademicstanding.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Government(Ph.D.)


182
http://www.cas.usf.edu/
GOVERNMENTPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Falladmissionsonly
MinimumTotalHours: 57(postmasters)
ProgramLevel: Doctoral
CIPCode: 45.0901
Dept.Code: GIA
Program(Major/College): GOVAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Governmentand
InternationalAffairs
ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
StudentsapplyforadmissiondirectlyintothePh.D.program.ThosewhoareinterestedinfirstearningaMasters
inPoliticalScienceoraMastersinPublicAdministrationneedtoapplytothoseprogramsseparately.

Studentsmustsubmit
acompletedapplication,
2officialtranscriptsfromtheirundergraduateorgraduateinstitutions,
officialGREScores,
3lettersofrecommendation(fromacademicsourcesorfromthoseabletojudgetheapplicants
academicabilities),
a500wordpersonalstatementexpressingreasonsforpursuingaPh.D.inPoliticalScienceatthe
UniversityofSouthFlorida,and
awritingsample

At a minimum, students must have either a 3.3 or 1100 combined verbal and quantitative GRE score to be
admitted. A Masters degree in Political Science, Public Administration, International Studies, or a related field
willcountfavorablytowardsadmission,butitisnotarequirementforadmission.

USFTampaGraduateCatalog20132014 Government(Ph.D.)


183
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

The57credithourpostM.A.programisasfollows:

InterdisciplinaryProfessionalSeminar 3

DisciplinaryCoreRequirements 9hoursrequired
INR5012Globalization 3
PAD6041EthicsinPublicService 3
POT6007TheoriesofGovernance 3

Tracks

Track1:PublicAffairs
CoreElectiveswithinDiscipline(9hoursrequired)
INR6107ComparativeForeignPolicy 3
INR6XXXInternationalLaw&Organizations 3
PAD6XXXBudgetingandInternationalFinance 3
PAD5044EnvironmentofPublicAdministration 3
PAD6060PublicAdministrationTheory 3
POS6045SeminarinAmericanNationalGovernment 3
POS6157SeminarinUrbanGovernmentandPolitics 3

Track2:SustainablePoliticalCommunities
CoreElectiveswithinDiscipline(9hoursrequired)
CPO5934AreaStudiesinComparativePolitics(areasvary) 3
CPO6036PoliticsinDevelopingAreas 3
CPO6XXXComparativeEnvironmentalPolitics 3
INR6XXXPeaceandConflictStudies 3

CoreElectivesinLinkedPrograms(12hoursrequired,inatleasttwodifferentdisciplines)

Anthropology
ANG6315InternationalHealthandAppliedSociology 3
ANG7936AppliedAnthropologyandHumanProblems 3
ANG5937EnvironmentalAnthropology 3
ANG6448RegionalProblemsinUrbanAnthropology 3

GeographyandEnvironmentalScience
GEO5605ContemporaryUrbanIssues 3
GEO6408GeographyandGlobalization:RemappingtheWorld 3
GEO6345TechnologicalHazardsandEnvironmentalJustice 3
GEO6119PerspectivesofEnvironmentalThought 3
EVR6937SeminarinEnvironmentalPolicy 3

History
HIS6939ColonialismandCulture 3
HIS6939U.S./LatinAmericanRelations 3
HIS6939FloridaEnvironmentalHistory 3
HIS6939EnvironmentalHistory 3
HIS6939ImmigrationandEthnicityinAmerica 3
HIS6939RuralCultureoftheAmericanSouth 3
HIS6939GenderandSexualityinUSHistory 3

USFTampaGraduateCatalog20132014 Government(Ph.D.)


184
http://www.cas.usf.edu/
Sociology
SYD6605CommunityAnalysis 3
SYD6605CityandCommunity 3
SYD6706RaceandEthnicity 3

[Note:additionalcoursesfromvariousdisciplineswillbeaddedastheyaredevelopedandimplemented]

CapstoneInterdisciplinarySeminar(Required) 3

DisciplinaryDissertationResearchProposalPreparation 6
POS7980Dissertation 18

TotalCreditHours(beyondtheM.A.) 57

OtherRequirements
Inadditiontothecourseworkhoursdescribedabove,studentsmustalsocompletethefollowingtoearnaPh.D.

ComprehensiveExam
Allstudentsmustpasstwowrittencomprehensiveexaminations.Thefirstexamtestsstudentsinthegeneralareasof
politicalscienceandinternationalstudies,andthesecondexamteststudentsontheirchosentrack.Bothexamsmust
be taken on the same day. A rotating committee of faculty members composes and grades those exams. The
comprehensiveexaminationsforthePh.D.programareseparatefromthecomprehensiveexaminationsfortheMAin
PoliticalScienceprogram.StudentsmaynotsubstitutecomprehensiveexaminationstakentofulfillaMastersdegree
fortheirPh.D.comprehensiveexams.

ForeignLanguage
Allstudentsmustdemonstratecompetencyinatleastoneforeignlanguage.Studentsmustpassthecompetencyexam
administrated by the World Language Education Department. Additionally, students, whose research focuses on a
particularareaoftheworld,mustbeproficientinlanguage(s)nativetothatregion.

DissertationProposal
Students must present their dissertation proposal in written and oral form to their dissertation committee.
DissertationcommitteesmustcontainfourmembersfromtheDepartmentofGovernment&InternationalAffairs,one
of whom is the students major dissertation advisor. Students must also select a professor from outside the
department. After passing this oral defense, students then research and write their dissertation. Students must
present their dissertation at an oral defense, and their committees determine whether the students passed. Finally,
students must submit written copies of their dissertations with the signatures of their committee members. All
dissertationsmustconformtoUniversityofSouthFloridaformatrules.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 History(M.A.)


185
http://www.cas.usf.edu/
HISTORYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Falladmissiononly

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 54.0101
Dept.Code: HTY
Program(Major/College): HTYAS

Concentrations:
AmericanHistory(AHY)
AncientHistory(AHS)
EuropeanHistory(EHS)
LatinAmericanHistory(LAH)
MedievalHistory(MHS)

CONTACTINFORMATION

College: ArtsandSciences
Department: History

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The Department of History offers the M.A. degree. Members of the graduate faculty in History have earned
recognitionasteachers,scholars,andcontributorstothecommunity.TheDepartmentoffersaMasterofArtsdegree
organizedaroundthefollowingfields:

Field1:AmericanHistoryto1877
Field2:AmericanHistorysince1877
Field3:AncientHistory
Field4:MedievalHistory
Field5:EarlyModernWorlds
Field6:ModernEuropesince1789
Field7:LatinAmerica

Across these fields, students can request, in consultation with their Major Professor, concentrations organized
thematicallyorgeographically.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus
GPAofatleast3.00
GREScoresofatleast500Verbal,500Quantitative,and4.5inwriting.Onlycurrentscoreswithinthelast5
years)willbeaccepted.

USFTampaGraduateCatalog20132014 History(M.A.)


186
http://www.cas.usf.edu/
LettersofRecommendation:Twolettersofrecommendationonbehalfoftheapplicantarerequired.These
lettersshouldcomefromacademicsourcesfamiliarwiththequalityoftheapplicantscollegelevelworkand
indicatehis/hergraduateprogrampotential.WerequirelettersofRecommendationtobesubmittedinhard
copysigned,andonofficialletterhead.Electronicallysubmittedlettersofrecommendation(i.e.email)will
notbeaccepted.
StatementofPurpose:Atwopagestatementisrequiredthatdelineateshistoricalandintellectualareasof
interest,proposedfieldsofstudy,educationalandprofessionalgoals,thefacultytheapplicantispotentially
interestedinworkingwith,andwhytheapplicantseeshim/herselfasagoodfitwithourprogram.
AWritingSample:Asampleofwrittenworkwhichindicatestheapplicantsabilitytowriteeffectivelyand
preferably,toconducthistoricalresearchandanalysismustbesubmitted.Thesampleshouldbe
approximately15pagesinlength.Appropriateexamplesincludeatermpaper,researchpaper,orthesis
chapter.
Noapplicationmaterials(e.g.letters,writingsamples,statementsofpurposes)willbeaccepted
electronically.TheLettersofRecommendation,StatementofPurpose,andwritingsampleshouldbesent
directlyto
GraduateProgramDirector
UniversityofSouthFlorida
DepartmentofHistory
4202E.FowlerAve.,SOC107
Tampa,FL36208100

A B.A. in history is preferred. The Department will consider applicants without a recent background in
undergraduate history, but they may be required to complete Theory of History (HIS 4104) as well as several
upper division and/or graduate level courses in relevant fields with a grade of B or higher. These should be
choseninconsultationwiththeGraduateProgramDirectororMajorProfessor.

DEGREEPROGRAMREQUIREMENTS

InadditiontothegeneralrequirementsoftheUniversity,acandidateisrequiredtocompleteatotalof36hoursinthe
followingdistribution:

TotalMinimumHours: 36

CoreRequirements(4hours)
CoreCourses
HIS6112AnalysisofHistoricalKnowledge 4

MajorField(16hours)
HIS6939SeminarinHistory 4
HIS6925ColloquiuminHistory 4
HIS6908DirectedResearch 119

MinorField(8hours)
HIS6939SeminarinHistory 4
HIS6925ColloquiuminHistory 4
HIS6908DirectedResearch 119

Of the 36 hours required for the Master of Arts, at least 20 must be in formal, regularly scheduled course work. A
minimumof16mustbeatthe6000level.Subjecttothesatisfactionofaboverequirements,coursesatthe5000level
areacceptableaspartofaplanneddegreeprogram.Inspecialcircumstances,majoradvisorsmayapproveuptosix(6)
hours at the 4000 level with the understanding that additional and superior work will be required of the graduate
student.Studentsmaytakeamaximumof8hoursinDirectedResearchand/orIndependentStudyandamaximumof
8hoursinColloquia(HIS6925).

USFTampaGraduateCatalog20132014 History(M.A.)


187
http://www.cas.usf.edu/
Afterbeginningcoursework,M.A.studentsselectanadvisorintheiranticipatedmajorfieldofstudy.Studentsarrange
their programs and schedules of appropriate courses with their Major Professor. Additionally, the student in
consultationwiththeadvisoraskstwoothermembers(normallyonefromthemajorandonefromtheminorfields)to
serveonasupervisorycommittee.Thestudentisrequiredtohavecompletedsuccessfullyatleast4creditsofcourse
workwitheachmemberofhis/hercommittee.StudentswithtwounresolvedIncompletegrades(ofanycredittotal)
willnotbepermittedtoregisterforadditionalhistorycoursesuntilatleastoneIncompletegradeisresolved.

Thesis(HIS6971)(8hours)

NonThesis(8hours)
8hoursof6000levelregularlyscheduledhistorycourses.

ComprehensiveExaminations:
Asixhourwrittencomprehensiveexaminationwillbeinfieldsandconsistofansweringtwoquestionsinamajorfield
andoneinaminorfield.Inaddition,atthediscretionofthecommittee,anoralexaminationmaybeadministered.The
examination questions and student answers will form part of the students Department file. A student must have no
incompletegradesandbeenrolledforaminimumoftwo(2)hoursduringthetermthecomprehensiveexamination
istaken.

TransferringclassesfromotherInstitutionsorfromUSFTampa
With approval, graduate courses taken at other institutions (including USF St. Petersburg and other separately
accredited USF Institutions) or taken at USF Tampa may be transferred in or provide for a waiver of degree
requirements. For the History Program at USF Tampa a student may transfer up to 9 credits of graduate level
courseworkfromanoncompleteddegreefromanotherinstitution(includingseparatelyaccreditedUSFInstitutions),
or12creditsfromenrollmentatUSFTampa(forinstanceasanondegreeseekingstudent).InallcasesagradeofB
orbetterisrequired.ToviewtheentirebaselineUniversityPolicyonwhatmaybetransferredorwaived,refertothe
TransferofCreditPolicyintheGraduateCatalogonlineatwww.grad.usf.edu/catalog

LanguageRequirements:
A reading proficiency in one foreign language most applicable to a students field of research (as determined by the
Major Professor) must be demonstrated by all students in the M.A. program. The language requirement will be
fulfilledinoneoftwoways:

1) AtwohourexaminationadministratedbytheDepartment.Thestudentwillbeexpectedtotranslate
satisfactorilya500wordpassage,withtheassistanceofadictionary.

2) Withtheapprovalofthemajorprofessor,thestudentmaytaketwosemestersofanintermediatelevel
foreignlanguage.Inordertofulfilltheforeignlanguagerequirement,thestudentmustreceiveaBor
aboveineachsemesterscourse.Thosestudentswhohavemettheserequirementsasan
undergraduatemayhavethelanguagerequirementwaivedbypetitioningtheGraduateCommittee.

StudentswithamajorfieldinAmericanHistoryandwithathesistopicthatdoesnotrequireuseofaforeignlanguage
maysubstitutequantitativemethodsforthelanguagerequirements.Thequantitativemethodsoptionwillbefulfilled
bysuccessfulcompletionwithagradeofatleastBinoneofthefollowingcourses:

ANG5486QuantitativeMethodsinAnthropology 3
EDF6407StatisticalAnalysisinEducationalResearch 4
POS6736PoliticalResearchMethods 3
MAT5932SelectedTopics 3

GraduationandMastersThesis:

Asatisfactoryperformanceinthecorecourse,twofields,andthecompletionofacomprehensive
examinationarerequiredofallM.A.studentsforgraduation.
Inordertograduate,astudentmustsubmitanApplicationforDegreetotheCAS
Graduate/UndergraduateOfficebythedeadlinenotedintheAcademicCalendarforthetermduringwhich
graduationisanticipated.
USFTampaGraduateCatalog20132014 History(M.A.)


188
http://www.cas.usf.edu/
StudentsselectingthethesisoptionmustfollowthefinalsubmissionprocessintheGraduateSchooltobe
consideredforgraduation.ForinformationrefertotheGraduateSchoolwebsitewww.grad.usf.edu
Studentsmaynotparticipateincommencementunlessallrequirementshavebeensatisfactorilycompleted.
Allrequirementsformastersdegreesmustbecompletedwithinfive(5)calendaryearsfromthestudents
dateofadmissionforgraduatestudy.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 History(Ph.D.)


189
http://www.cas.usf.edu/
HISTORYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Falladmissiononly

MinimumTotalHours: 58(postmasters)
ProgramLevel: Doctoral
CIPCode: 54.0101
Dept.Code: HTY
Program(Major/College): HTYAS
CONTACTINFORMATION

College: ArtsandSciences
Department: History
ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

OurPh.D.programfeaturesaninnovativemodelofdoctoraleducationdesignedtoinsurebroadinterdisciplinary
connection with related disciplines. Areas of specialization cover a number of fields, including Colonial through
ModernUS;theAncient,Medieval,andEarlyModernWorlds;ModernEurope;andLatinAmerica.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
TheminimumrequirementsforconsiderationforadmissiontothePh.D.programinhistoryinclude:

Masters Degree and Grade Point Average: Applicants must have completed an M.A. in History or a
relatedfield(asdeterminedbytheadmissionscommittee)withaG.P.A.ingraduatelevelcourseworkof
atleast3.50asdemonstratedbyofficialtranscripts.
GRE:Applicantswillhaveapreferredminimumscoreofatleast600Verbaland500Quantitative.Only
currentscores(withinthelast5years)willbeaccepted..
LettersofRecommendation:ThreeLettersofRecommendationonbehalfoftheapplicantarerequired.
These letters should come from academic sources familiar with the quality of the applicants scholarly
work and indicate his/her doctoral program potential. We accept only signed, hard copies, on official
letterhead.Noelectroniclettersofrecommendationwillbeaccepted.
Statement of Purpose: A statement is required that delineates historical and intellectual areas of
interest,proposedfieldsofstudy,educationalandprofessionalgoals,facultytheapplicantispotentially
interestedinworkingwith,andwhytheapplicantseeshim/herselfasagoodfitwithourprogram.
SampleofWriting:Asampleofwrittenworkwhichindicatestheapplicantsabilitytoconductprimary
source based research and to write effectively must be submitted. The sample may include a
publication,seminarpaper,orathesischapter
Language: Applicants will provide evidence of proficiency in the foreign language(s) of their primary
fieldofstudy.
Further Information: may be requested by the Department as necessary, possibly including a finalist
interview.
USFTampaGraduateCatalog20132014 History(Ph.D.)


190
http://www.cas.usf.edu/
TheLettersofRecommendation,StatementofPurpose,andWritingSampleshouldbesentdirectlyto:

GraduateProgramDirector
DepartmentofHistory
UniversityofSouthFlorida
4202E.FowlerAve.,SOC107
Tampa,FL336208100

Electronicsubmissionsofapplicationmaterials(includinglettersofrecommendation)willnotbeaccepted.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 58

PlanofStudy
InadditiontothegeneralrequirementsoftheUniversityasexplainedintheUSFGraduateCatalog,acandidateisrequired
tocompleteatotalof58credithoursinthefollowingdistribution:

CoreRequirements
HIS7937InterdisciplinaryPh.D.ProSeminar 3hours
This course is as an Introduction to the interdisciplinary nature of this unique Ph.D. program, and will offer new
studentstotheHistoryprogramtheopportunitytoengagewiththeircolleaguesinPoliticalScienceandSociology.This
ProSeminarisorganizedaroundonecommonthemeandfocusesonthemethodologiesandtheoriesoftheserelated
disciplinessothatstudentsgainaworkingknowledgeofthecomplementaryaspectsofthesefields

HIS6112AnalysisofHistoricalKnowledge 4hours
Analysis of Historical Knowledge examines both the theories behind and the practical effects of varieties of
methodologicalapproachestohistoricalresearch.StudentswhohavetakenthiscourseaspartofaUSFHistoryM.A.
willnotberequiredtorepeatit.

HIS7289SeminarinComparativeStudies 4hours
Seminar in Comparative Studies introduces doctoral candidates to the breadth of historical scholarship on social
concepts such as globalization, imperialism, identity, urbanization, etc. These seminars will guide students through
historical scholarship on various times and places, all organized and united around the same central concept, to
demonstratethedifferentperspectivesachievedbycomparativestudy.

MajorFieldStudies 20hours
StudentswillcompleteapproximatelyfivecourseswithintheHistorydepartmentdevotedtothestudyoftheirprimary
regionandperiodofinterest.

InterdisciplinaryElectives 68hours
StudentswillcompletetwocourseschosenfromthegraduatecourseofferingsintheDepartmentofSociologyand/or
theDepartmentofGovernmentandInternationalAffairs.

GovernmentandInternationalAffairs
INR6036 SeminarinInternationalPoliticalEconomy 3
CPO6036 PoliticsofDevelopingAreas 3
INR5012 Globalization 3
PAD6041 EthicsandPublicService 3
CPO6xxx ComparativeEnvironmentalPolitics

USFTampaGraduateCatalog20132014 History(Ph.D.)


191
http://www.cas.usf.edu/
Anthropology
ANG6197 PublicArchaeology
ANG6447 SelectedTopicsinUrbanAnthropology:AnthropologyandDevelopment 3
ANG6469 SelectedTopicsinMedicalAnthropology:FoundationsofMedical
Anthropology 3
ANG6465 RegionalProblemsinMedicalAnthropology 3
ANG6315 AppliedAnthropologyandInternationalHealth
ANG7709 AppliedAnthropologyandHumanProblems
ANG5937 SeminarinAnthropology:EnvironmentalAnthropology
ANG6448 RegionalProblemsinUrbanAnthropology 3

Sociology
SYA7475 CommunityAnalysis
SYO7420 ComparativeSociologyofHealthCareSystems
SYD7237 ImmigrantstoAmerica:CommunityImpacts
SYP7111 CommunitiesandIdentity 3
SYG7209 CityandCommunity
SYA7930 GlobalizationandCities
SYD7505 SeminarinUrbanResearch
SYO7435 SociologyofDisabilityinUrbanSociety 3
SYD6225 SeminarintheSociologyofEducationandInequalities
SYA6008 SocialProblems,Identities,andCommunities 3
SYP6425 SociologyofConsumerCulture 3
SYP6425 SociologyofConsumerCulture:SocialMovementsinaGlobalSociety
SYD6706 GlobalPerspectivesonRaceandEthnicity 3

CapstoneSeminar
HIS7938 Ph.D.CapstoneSeminar 34hours
This course will act as the final participatory coursework of the Ph.D. candidates before they proceed to the
dissertationwritingstage.

LanguageRequirementforPh.D.Students
Studentsmustdemonstrateproficiencyintheir primarylanguageofresearchbytheendofthefirstyearofstudy. In
fieldswheremorethanonelanguageisrequired,studentsmustcompletetheirlanguageexamsbeforetheycantake
the comprehensive exam. Language requirements must be fulfilled before students can progress to the dissertation
stage. Written examinations to test a students language proficiency will be administered through the USF Dept. of
World Languages in conjunction with the students Major Advisor. The precise format of the exam and the level of
languagecompetencyneededtopasswillbedeterminedineachcasebythestudentsadvisor.

Field Language(s)Required
Ancient ClassicalGreek,ClassicalLatin,French,andGerman
Asia PrimaryAsianlanguageofresearchplusoneadditionallanguage
Byzantine ByzantineGreek,Latin,French,andGerman
EarlyModernEurope PrimaryEuropeanlanguageofresearchplusoneadditionalEuropean
language(Latinmayberequiredinsomecases)
Europe PrimaryEuropeanlanguageofresearchplusonadditional
Europeanlanguages
LatinAmerica SpanishandPortuguese
MedievalEurope MedievalLatin,plustwoadditionalEuropeanlanguages
MiddleEast PrimaryMiddleEasternlanguageofresearchplusoneadditionallanguage
UnitedStates Foreignlanguagemostpertinenttoresearchagenda

ComprehensiveExam
AfteradmissiontothePh.D.program,thestudentmustcomplete40hours(minimum)ofcourseworkbefore
takingwrittenandoralcomprehensiveexaminationsintheapplicablemajorandminorfields.
USFTampaGraduateCatalog20132014 History(Ph.D.)


192
http://www.cas.usf.edu/
IfastudenthassatisfactorilycompletedtheAnalysisrequirementattheMAlevelthatisbeforeadmission
tocandidacythestudentiseligibletotakethecomprehensiveexaminationafteraminimumof36hoursof
coursework.
TheseexamswillbeconductedbythestudentsSupervisoryCommittee.Theoralexamsshallbetaken
withinoneweekafterthewrittenexamshavebeencompleted.Examsmayberetakenonceifnecessary.

DissertationProposal
Students must complete an oral dissertation defense with the members of the dissertation committee. Dissertation
committeesmustbecomposedofaminimumoffourfacultymembers,oneofwhommaybedrawnfromanacademic
institutionotherthanUSF.FacultyfromfieldsotherthanHistorymayserveondissertationcommitteesuponapproval
ofthestudentsfacultyadvisor.

DissertationWritingHours 18hours
HIS7980 Dissertation:Doctoral(19) 18
Thesehoursareintendedtogivestudentstheopportunitytoworkcloselywiththeirdissertationcommitteeandfocus
onresearch,writing,andrevision.

TransferringclassesfromotherInstitutionsorfromUSFTampa
With approval, graduate courses taken at other institutions (including USF St. Petersburg and other separately
accredited USF Institutions) or taken at USF Tampa may be transferred in or provide for a waiver of degree
requirements. For the History Program at USF Tampa a student may transfer up to 9 credits of graduate level
courseworkfromanoncompleteddegreefromanotherinstitution(includingseparatelyaccreditedUSFInstitutions),
or12creditsfromenrollmentatUSFTampa(forinstanceasanondegreeseekingstudent).InallcasesagradeofB
orbetterisrequired.ToviewtheentirebaselineUniversityPolicyonwhatmaybetransferredorwaived,refertothe
TransferofCreditPolicyintheGraduateCatalogonlineatwww.grad.usf.edu/catalog

Timeframe
AllrequirementsmustbecompletedwithintheuniversitymandatedtimeframeafteradmissiontothePh.D.program.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 IntegrativeBiology(Ph.D.)


193
http://www.cas.usf.edu/
INTEGRATIVEBIOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
DomesticStudents:
Fall: January1
Spring: August1
Summer: NoAdmission

InternationalStudentslivingoutsidetheU.S.
Fall: January1
Spring: July1
Summer: NoAdmission

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 26.1399
DeptCode: BIO
Program(Major/College):

Concentrations:
EcologyandEvolution
EnvironmentalandEcologicalMicrobiology
PhysiologyandMorphology

CONTACTINFORMATION

College: ArtsandSciences
Department: IntegratedBiology(IB)

ContactInformation: www.grad.usf.edu
PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:EcologyandEvolution,EnvironmentalandEcologicalMicrobiology,andPhysiologyand
Morphology,

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

ItisexpectedthatcandidatesforthePhDdegreewillhavecompletedcoursesequivalenttothoserequiredfor
theB.S.inBiologyatU.S.F.

3.00GPAlast60hoursofB.S.degree.

GRE:70%V,70%Q,70%AW

AcceptancebyafacultymemberintheDepartmentofIntegrativeBiologyismandatory.Studentsareexpectedto
contactfacultyviaemailtoindicateaninterestintheresearchbeingconductedintheirlaboratory.The
Departmentwillmakeeveryefforttopairpotentialgraduatestudentswithappropriatefaculty.

USFTampaGraduateCatalog20132014 IntegrativeBiology(Ph.D.)


194
http://www.cas.usf.edu/
AllinternationalstudentsarerequiredtosubmittheTOEFLtest.NonnativeEnglishspeakinggraduatestudents
mustscoreaminimumofatleast570onthepaperbasedoraminimumtotalscoreof88ontheinternetbased
testTOEFLandatleast50ontheTSEtobeeligibleforateachingassistantship.

OnCampusInterview

PersonalStatement

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 90hourspostbacc

The graduate student, major professor and Graduate Committee will establish the specific course requirement for
eachgraduatestudent.Everygraduatestudentmustsatisfyminimumcourserequirements.TheGraduateCommittee
consistsoffourindividuals;threemustbemembersoftheIntegrativeBiologyDepartment.

CoreRequirements 8hours
PCB6456CBiometryI 4
BSC6932LecturesinContemporaryBiology(1)take4times 4
Enrollmentinthiscourseisrequiredduringfoursemestersofresidency

AdditionalStructuredCoursework 6hours
Anadditionalsixhoursofstructuredcourseworkisrequired.Thestructuredcoursesarelistedbelowforeachofthe
three concentrations. The Major Professor and Graduate Committee may approve courses from outside the
Department to satisfy this requirement. Doctoral students typically will take 2025 semester hours of coursework
selected from the lists of courses presented below. The remainder of the required 90 hours is obtained through
researchcredits.
Concentrations
StudentsselectfromoneofthefollowingConcentrations:

ECOLOGYANDEVOLUTION(EEV)
Aminimumoftwocoursesselectedfromthelistbelowforaminimumof6credithours.

AnycourseapprovedbytheGraduateCommittee.
BSC5931ConservationBiology 3
BOT5185MarineBotany 4
PCB6455StatisticalEcology 3
PCB6458BiometryII 3
BSC5931ComparativeApproachesinEvolution 3
PCB6426PopulationEcology 3
ZOO5463Herpetology 4
ZOO5456Ichthyology 4
BSC6932AdvancesinPopulationBiology 1
BSC6932AdvancesinIchthyology 1
BSC6932AdvancesinHerpetology 1
BSC6932AdvancedinMarineEcology 1
BSC6932ScientificWriting 2
BSC6932RestorationEcology 3
BSC6447CommunityEcology 3
PCB6933SeminarinEcology (variablecredit)

USFTampaGraduateCatalog20132014 IntegrativeBiology(Ph.D.)


195
http://www.cas.usf.edu/
ENVIRONMENTALANDECOLOGICALMICROBIOLOGY(EVM)
Aminimumoftwocoursesselectedfromthelistbelowforaminimumof6credithours.

AnycourseapprovedbytheGraduateCommittee.
MCB5206PublicHealthandPathogenicMicrobiology 3
MCB5655AppliedandEnvironmentalMicrobiology 3
PCB5235PrinciplesofImmunology 3
MCB6930SeminarinAppliedandEcologicalMicrobiology 1
PCB6525MolecularGenetics 3
BSC5931Genomics 4
PCB6455StatisticalEcology 3
PCB6458BiometryII 3
BSC6932ScientificWriting 2
BSC6932AdvancesinEnvironmentalEcology 1

PHYSIOLOGYANDMORPHOLOGY(PMY)
Aminimumoftwocoursesselectedfromthelistbelowforaminimumof6credithours.

AnycourseapprovedbytheGraduateCommittee.
PCB6458BiometryII 3
BSC6932ScientificWriting 2
ZOO5463Herpetology 4
ZOO5456Ichthyology 4
ZOO54xxOrnithology 3
PCB5256DevelopmentalBiology 3
BSC6932PhysiologicalEcology 3
BSC6932AdvancesinPhysiology 1
BSC6932Ecoimmunology 3
BSC5931ComparativeApproachesinEvolution 3
BSC5931EcologicalandFunctionalMorphology 3

QualifyingExam
All students in the IB PhD degree must complete a qualifying examination. Successful completion of the preliminary
doctoralexaminationbytheendofthe4
th
semester.Theexamconsistsof3parts:
1. Dissertationproposal
2. Seminar/presentationofproposal
3. Defenseofdissertationproposal

AdmissiontoCandidacy
The doctoral student is eligible for admission to candidacy after completing structured course requirements, passing
thequalifyingexaminationandapprovalbythesupervisorycommittee.Appropriateformstodocumentpromotionto
candidacymustbecompletedandtotheGraduateSchool.Followingadmissiontocandidacy,astudentmustenrollin
BSC7980whenengagedinresearch,datacollection,orwritingactivitiesrelevanttothedoctoraldissertation.Advisors
shouldassignthenumberofcreditsinthiscourseinaccordancewithpolicyandappropriatetothedemandsmadeon
faculty, staff, and University facilities, but in no event will the total number of earned dissertation credits be fewer
than16.StudentsnotadmittedtocandidacyarenoteligibletoenrollinBSC7980.

DissertationRequirement 24hoursminimum
BSC7980Dissertation 24

DoctoralSeminarandDefense.
All doctoral students must present a public seminar to the IB Department and must be enrolled in BSC 7980,
during the semester in which the seminar is given. The seminar should be a concise summary of the research
completed to satisfy the requirements for the Ph.D. The seminar is open to the general public and must be
USFTampaGraduateCatalog20132014 IntegrativeBiology(Ph.D.)


196
http://www.cas.usf.edu/
announced two weeks prior to the presentation. Upon completion of the seminar, the general public will be
invitedtoaskquestions.Atthediscretionofthestudentsgraduatecommittee,membersofthecommitteemay
continuetoquestionthegraduatestudentafterthegeneralpublichasdepartedtheseminarroom.Eachstudent
is expected to defend his/her research to the unanimous satisfaction of the graduate committee. Following the
defense, students will make any editorial modifications to the dissertation as recommended by the supervisory
committeeandsubmitthedissertationtotheGraduateSchool.

Dissertation
SubmissionofadoctoralresearchproposalmustbeapprovedlbytheMajorProfessor,GraduateCommittee,and
GraduateDirector.Successfulcompletionofthedissertationproposal,presentationofadissertationseminarand
passingthedoctoralexaminationenablesthestudenttobecomeadoctoralcandidate.Submissionofan
acceptabledissertation,presentationofthedoctoralseminar(BSC7936)andsuccessfuldefenseofthe
dissertationenablethestudenttoobtainthePh.D.Degree.

OtherRequirements

Presentationrequirement:
Twopresentations,excludingthedoctoralseminaranddefensearerequired.Studentsareexpectedtopresent
postersororalpresentationsbasedontheirdissertationresearchattwonational/regionalprofessionalmeetings.
TheGraduateCommitteemustapprovethepresentation.

Publicationrequirement:
OneresearchpapermustbesubmittedforpublicationtoarefereedscientificjournalbythedateoftheDoctoral
SeminarandDefense.Thepapermaybesoleorcoauthored,butitmustbebasedonthedissertationresearch.
Thestudentssupervisorycommitteemustapprovethepaperpriortosubmission.TheGraduateCommittee
mustapprovethejournaltowhichthepaperissubmitted.

COURSES
Foranupdatedlistofcourseofferingssee:http://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 LatinAmerican,Caribbean,andLatinoStudies(M.A.)


197
http://www.cas.usf.edu/
LATINAMERICAN,CARIBBEAN,ANDLATINOSTUDIESPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 5.0107
Dept.Code: GIA
Program(Major/College): LASAS

CONTACTINFORMATION

College: ArtsandSciences
Department: GovernmentandInternational
Affairs:InstitutefortheStudyofLatinAmericaandthe
Caribbean(ISLAC)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The mission of ISLAC is to promote research and study in and about Latin America and the Caribbean. ISLAC is an
academic unit devoted to interdisciplinary research and teaching focused on economic, social, political and cultural
formationsinLatinAmericaandtheCaribbeanandamongtheHispanic/LatinopopulationsinNorthAmerica.
The Institute fosters greater knowledge of Latin America and the Caribbean and Latino issues, through partnerships
withcommunityorganizationsandotherUSFdepartmentstosponsorlecturesandculturaleventsthatareopentothe
public throughout the year. We also support graduate students and faculty research in the area, and provide
opportunitiesforLatinAmericanistscholarsatUSFtocollaborateanddisseminatetheirwork..

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

FacultyInterestsInclude:
ISLACs affiliate faculty members are drawn from the social sciences, humanities, arts, and human service fields. We
include faculty from the following departments: History, SpanishAmerican and Caribbean Languages and Literature,
Humanities, Anthropology, Political Science, Sociology, Economics, Business, Geography, Public Administration, Fine
Arts,PublicHealth,Education,AfricanaStudies,WomensandGenderStudiesandMentalHealth.

ResearchAreas:
Includes,butisnotlimitedto:AfrodescendantsinLatinAmericaandtheCaribbean,transatlanticstudies,human
rights,citizenship,raceandethnicity,educationandpublichealthmigrationandDiaspora.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
SameasUniversityinadditiontothefollowing:

3.00GPA
threelettersofrecommendation
statementofpurpose
resume
GREnotrequired,butsuggestedforfullfinancialconsideration

USFTampaGraduateCatalog20132014 LatinAmerican,Caribbean,andLatinoStudies(M.A.)


198
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TheCurriculumconsistsof36creditsdividedintothreecategories:

Corerequirements 9credits(6seminar,3methodology)
MajorFieldrequirements 12credits
Electives 9credits
ThesisorComprehensiveElectives 6credits

CoreRequirements
Studentsmusttaketwointerdisciplinarycoreseminarsandamethodscourseuponenteringtheprogram.Thecore
seminars, directed by a faculty member from one of the participating departments, will familiarize students with
the literature, existing knowledge, and research approaches of the various fields of area studies and invited to
acquaintstudentswithfacultyandtheirresearch.Thepurposesoftheseminarsare:

toprovideaninterdisciplinarygraduateexperience

tofosteracommunityofscholarsandlearnersfocusedonLatinAmerican,Caribbean,andLatino
experiences

Studentswillalsotakeathree(3)hourmethodologycoursethatacquaintsthemwithparticularresearchrelevant
to their major field of study and when possible, Latin America and/or the Caribbean. This includes special
approachestofindingdocumentationfromLatinAmericaandtheCaribbean;newlyavailablesearchtoolsavailable
ontheinternet;andanoverviewofhowdisciplinesutilizedifferentresearchmaterials.

Major
WiththeconcurrenceoftheISLACadvisor,studentswillelectmajorandminorfieldsduringtheirfirstsemester.
These fields will draw heavily on participating departments (e.g. Anthropology, History, Government and
International Affairs, Art History). At that time the student will constitute a supervisory committee, made up of
two professors from the major field and one from the minor field. The committee members will counsel the
studentandserveasmembersoftheexamorthesiscommittees.

A large number of courses are available to fulfill the major and minor field requirements. These are listed
separately and change somewhat from year to year. Departments who frequently work with ISLAC are
Anthropology, Government and International Affairs, Sociology, Mass Communication, Geography, Social Work,
Womens andGenderStudies,GlobalHealth, Philosophy,Economics, History, WorldLanguages,Humanitiesand
American Studies, Art History, Africana Studies and Education. Students may also request to have courses from
otherdepartmentscounttowardmajororminorfields.

Electives
Students can take one elective from outside the major and minor fields, in order to complement their core
studies. These might be technical courses, study abroad courses, internships, math and science courses,
methodology, or another unrelated field. In all cases, students must justify their elective hours and receive
approvalfromtheircommittees.Inaddition,studentsoptingforthenonthesistrackmusttakeonemorecourse
ineachoftheirmajorandminorfields(2coursestotal).Studentsconsideringteachingincommunitycollegesare
encouragedtotakemoreclassesintheirmajorfield.

GraduationRequirements
At the conclusion of their coursework, students who opted for thesis must gain approval of the thesis by the
committee.Allcandidatesforthedegreemustalsodemonstratelanguageproficiencyeitherbyexaminationorby
completinga3000levelcourseinSpanishorPortuguesewithaBorbetter.Finally,allnonthesiscandidatesmust
pass a six (6) hour comprehensive written exam of three questions, which will be composed and graded by the
committee.StudentsmustalsomeetallCollegeandUniversityGraduationRequirements.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfmorhttp://shell.cas.usf.edu/islac/
USFTampaGraduateCatalog20132014 LiberalArts(M.A.)


199
http://www.cas.usf.edu/
LIBERALARTSPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 24.0101
Dept.Code: HSC
Program(Major/College): MLAAS

Concentrations:
AfricanaStudies(AFT)
FilmStudies(FLM)
Humanities(HTS)
SocialandPoliticalThought(SPT)

CONTACTINFORMATION

College: ArtsandSciences
Departments: AfricanaStudies
HumanitiesandCultural
Studies

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheMasterofArts(M.A.)offersstudentsanopportunitytostudyfromaninterdisciplinaryperspectivetheideasandworks
thathaveshapedworldculture.Fourprogramconcentrationsareavailable:AfricanaStudies(AFT),FilmStudies(FLM),
Humanities(HTS),SocialandPoliticalThought(SPT).

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

UpperdivisionundergraduateGPAof3.00
ApplicantsarerequiredtotaketheGREaspartoftheapplicationprocessandmatterofrecord.
Contactindividualconcentrationadvisorsforpossibleadditionalrequirements(e.g.,transcripts,
recommendations,preferredGREScores,writingsamples,etc.)

DEGREEPROGRAMREQUIREMENTS

ProgramMinimumHours 33

CoreRequirements 3
HUM6815ResearchSeminar

ConcentrationRequirements
Studentsselectfromthefollowingconcentrations:
USFTampaGraduateCatalog20132014 LiberalArts(M.A.)


200
http://www.cas.usf.edu/

AfricanaStudiesConcentration 30hours
ConcentrationCourses 12hours
AFA6120SocialTheoryandSocialThought 3
AFA6207AfricanAmericanHistoriography 3
AFA6355AfricanAmericanCommunityResearch 3
AFA6805AfricanHistoriography 3
*StudentsmustearnaBorhigher(3.00)inallcorecoursesortheywillberequiredtoretakethecourse.

Electives 15hours
Students must complete 15 additional hours in approved graduate electives. These may include additional courses
withinAfricanaStudiesoroutsidethedepartment.Studentsmayalsochoosetocompleteagraduatecertificateasthe
basisoftheirelectivework.

ApprovedElectives
AFA6108SocialConstructionofRaceandRacism
AFA6387SeminaronGenocideandHumanRights
AFA6390GlobalChallengesofDiversity
AFA6905IndependentStudy
AFA6910DirectedResearch
AFA6932SpecialTopics

*AdditionalexternalelectivesmaybechoseninconsultationwiththeGraduateDirector

ThesisorInternship 3hours
AFA6971ThesisorAFA6945Internship
Studentsmustcompleteathesisorinternshipaspartoftheirgraduateprogram.Studentswillmakethischoiceatthe
endoftheirfirstyearofstudy.Thesisstudentsmustregisterfornolessthanthreethesishours(AFA6971).Internship
studentsmustregisterfornolessthanthreehoursofinternship(AFA6945).

ComprehensiveExam
Internshipstudentsmustsuccessfullypassacomprehensiveexam.Thesuccessfuloraldefenseofthethesisequates
tothecomprehensiveexamforthesisstudents.*Anystudentwhoinitiallychoosesthethesis,butlaterchangestoan
Internship(whichwillonlybeapprovedwithextenuatingcircumstances)mustcompletecomprehensiveexams.

FilmStudiesConcentration 30hours
ConcentrationCourses 24hours
HUM6814IntroductiontoGraduateStudy 3
HUM6583GlobalCinemaandNewMediato1960 3
HUM6584GlobalCinemaandNewMediasince1960 3
HUM6586FilmTheory 3

AdditionalcourseworkselectedinconsultationwiththeGraduateDirector. 12

Thesis 6hours
HUM6971Thesis
After the completion of coursework, each student will select a thesis topic; constitute a thesis committee; and write
and orally defend a thesis proposal. Each student will then write and orally defend a 4080 page thesis. During the
proposalandthesiswritingstage,studentsarerequiredtoenrollfor6thesishours.

ComprehensiveExam
Thesubmissionandoraldefenseofthethesisproposalequatestothecomprehensiveexam.

USFTampaGraduateCatalog20132014 LiberalArts(M.A.)


201
http://www.cas.usf.edu/
HumanitiesConcentration 30hours
ConcentrationCourses 24hours
HUM6814IntroductiontoGraduateStudy 3
HUM6801TheoriesandMethodsofCulturalStudies 3
AdditionalHUMcoursesselectedinconsultationwiththeGraduateDirector 9
HUMorOutsideelectivesselectedinconsultationwiththeGraduateDirector 9

Atleast15hoursmustbeatthe6000level;6hoursmaybeatthe4000level.

LanguageTranslationExam
Before defending the thesis proposal, each student will take a translation exam in a language chosen in consultation
withthethesisdirector;

ComprehensiveExam
Thesubmissionandoraldefenseofthethesisproposalequatestothecomprehensiveexam.

Thesis
HUM6971Thesis 6hours
After the completion of coursework, each student will select a thesis topic; constitute a thesis committee; and write
andorallydefendathesisproposal.Eachstudentwillthenwriteandorallydefenda40to80pagethesis.Duringthe
proposalandthesiswritingstage,studentsarerequiredtoenrollfor6thesiscredits.

SocialandPoliticalThoughtConcentration 30hours
ConcentrationCourses 24hours
Coursesapprovedbyacommitteeselectedbythestudentfromtheprogramfaculty.

ComprehensiveExam
Theoraldefenseofthethesisequatestothecomprehensiveexam

Thesis 6hours
After the completion of coursework, each student will select a thesis topic; constitute a thesis committee; and write
andorallydefendathesisproposal.Eachstudentwillthenwriteandorallydefenda40to80pagethesis.Duringthe
proposalandthesiswritingstage,studentsarerequiredtoenrollfor6thesishours.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 LibraryandInformationScience(M.A.)


202
http://www.cas.usf.edu/
LIBRARYANDINFORMATIONSCIENCEPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: June1
Spring: October15
Summer: March1

MinimumTotalHours: 39
ProgramLevel: Masters
CIPCode: 25.0101
Dept.Code: LIS
Program(Major/College): LISAS

CONTACTINFORMATION

College: ArtsandSciences
Department: SchoolofInformation

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The mission of the School of Information is to educate students for careers and leadership roles in library and
informationprofessionsthatservetheneedsofaculturallydiverse,technologicalsociety;tocontributetothebodyof
theoretical and applied knowledge in the discipline; and to serve current and emerging needs in the University, the
community, and the profession. For Goals, Objectives, and Student Learning Outcomes, refer to the programs web
page.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools and the American
LibraryAssociation(ALA).

For students interested in School Library Media as a profession, completion of the USF/SLIS program results in (1) a
Master of Arts degree accredited by the American Library Association, which will allow the recipient to work in all
types of libraries, (2) appropriate coursework for passing the state examination for certification as an Educational
MediaSpecialistforGradesK12inthestateofFlorida.Formoreinformation,see
http://si.usf.edu/graduate/programs/media/

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
GREisrequiredwithpreferredminimumscoresof550V,450Q.However,theLISprogramwillwaivetheGRE
requirementifthestudentmeetsoneofthefollowingcriteria:

A3.50orhigherGPAinacompletedmastersdegreeprogramfromaregionallyaccreditedinstitution

A3.25orhigherGPAinupperdivisionundergraduateworkfromaregionallyaccreditedinstitution.

Doctoraldegree(includingprofessionaldegreessuchastheJDandMD)fromaregionallyaccredited
institution.

Allstudentsnotmeetingoneoftheabovecriteriawillbeconsideredforconditionaladmissionbasedonallofthe
followingcriteria:
USFTampaGraduateCatalog20132014 LibraryandInformationScience(M.A.)


203
http://www.cas.usf.edu/

Apreferredminimumscoreof550ontheVerbalsectionand450ontheQuantitativesectionofthe
GeneralGREtest.

Anacademicwritingsample

Threewrittenlettersofrecommendation

ConditionaladmissionstatuswillbeconvertedtoregularstatusuponcompletionofthefirstthreeLIScourseswitha
GPAof3.5orabove.LIS5020mustbeincludedasoneofthesecourses.

1. AsatisfactoryscoreontheTOEFL(79ontheinternetbasedtestand550onthepaperbasedtest)maybe
requiredfornativesofnonEnglishspeakingcountries.

2. AllstudentsarerequiredtowriteastatementdescribingtheirpurposeandgoalsintheLISprogram

DEGREEPROGRAMREQUIREMENTS

A minimum of 39 semester hours is required for the Masters degree program. Students must maintain a 3.0 grade
point average of B or better and no more than two grades below "B" will be accepted. Transfer credit from other
recognized graduate schools is limited to six semester hours taken within the last five years with grades of B or
better. All transfers must be approved by the candidates faculty advisor. Transfer credits must be posted to a
studentspermanentrecordnolaterthanonefulltermpriortograduation.

RequiredCourses
Thestudentmustcompletethefollowing39hourprogram,includingsixcorecourses:
LIS5020 FoundationsofLibraryandInformationScienceor 3
LIS6260 InformationScienceinLibrarianship 3
LIS6271 ResearchMethodsinLibraryandInformationScience 3
LIS6409 IntroductiontoLibraryAdministration 3
LIS6511 CollectionDevelopmentandMaintenance 3
LIS6603 BasicInformationSourcesandServices 3
LIS6711 OrganizationofKnowledgeIor 3
LIS6735 TechnicalServicesinLibraries 3

Electivecoursestotaling21credithours.Thesecoursesmustbeapprovedbythestudent'sadvisor.Someoptions
include:

LIS5268 MicrocomputerApplicationsLibraryandInformationCenters 3
LIS5315 InstructionalGraphics 3
LIS5333 TVinSchoolsandLibraries 3
LIS5418 HealthInformaticsforMedicalLibrarians 3
LIS5566 MulticulturalLiteratureforChildrenandYoungAdults 3
LIS5937 SelectedTopicsinLibraryStudies 4
LIS6110 HistoryofLibraries 3
LIS6111 HistoryofChildren'sLiterature 3
LIS6206 AdultServicesinLibraries 3
LIS6212 ReadingGuidanceProgramsinLibrariesandClassrooms 3
LIS6225 Storytelling 3
LIS6303 PreparingInstructionalMedia 3
LIS6316 VisualizationofKnowledge 3
LIS6402 AdvancedLibraryAdministration 3
LIS6432 SeminarinAcademicLibraries 3
LIS6445 SeminarinPublicLibraries 3
USFTampaGraduateCatalog20132014 LibraryandInformationScience(M.A.)


204
http://www.cas.usf.edu/
LIS6455 OrganizationandAdministrationoftheSchoolMediaCenter 3
LIS6463 LibraryNetworksandSystems 3
LIS6464 LibrarySystemsAnalysisandPlanning 3
LIS6472 SeminarinSpecialLibraries 3
LIS6473 LawLibrarianship 3
LIS6475 HealthSciencesLibrarianship 3
LIS6773 DigitalCuration 3
LIS6482 WebArchiving 3
LIS6542 TheCurriculumandInstructionalTechnology 3
LIS6565 BooksandRelatedMaterialsforYoungAdults 3
LIS6585 MaterialsforChildren 3
LIS6609 OnlineInformationSourcesandServices 3
LIS6610 InformationSourcesandServicesintheHumanities 3
LIS6620 InformationSourcesandServicesintheSocialSciences 3
LIS6624 InformationSourcesandServicesinBusinessandLaw 3
LIS6630 InformationSourcesandServicesinScienceandTechnology 3
LIS6661 GovernmentDocuments 3
LIS6724 ClassificationandCatalogingofNonBookMaterials 3
LIS6726C IndexingandAbstracting 3
LIS6712 OrganizationofKnowledgeII 3
LIS6514 DigitalLibraries 3
LIS6906 IndependentStudy 3
LIS6946 SupervisedFieldwork 3
LIS6949 PracticuminArchivesandSpecialCollections 26

CoursesOutsidetheSchool
Degreeseekingstudentsarepermittedtoenrollincourses,usuallylimitedtosixsemesterhours,outsidetheSchoolof
Information when, in the context of the development of a purposeful program, an interdisciplinary approach seems
appropriate.StudentsmustobtainthepriorapprovaloftheirFacultyadvisor.

ComprehensiveExamination
Studentsmustpassawrittencomprehensiveexamination.Studentswilltakethecomprehensiveexaminationintheir
last semester. Students must be enrolled for a minimum of two credit hours during the semester in which they take
the comprehensive examination. The School conducts comprehensive examinations only in the spring, summer, and
fallsemesters.

OTHERINFORMATION

ALAUSF, ASISTUSF, and SLAUSF are student chapters of the American Library Association, American Society for
InformationScience&TechnologyandSpecialLibrariesAssociationlinkedwiththeSchoolofInformationandareopento
allmembersoftheUniversitycommunityinterestedininformationscienceorlibrarianship.Allprovideprogramsandguest
speakers of interest to the campus community, maintain several discussion lists, and publish a newsletter for their
members. These organizations are the voice of students in the school, and members of the associations are included on
committeeswithintheSchool.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
http://si.usf.edu/

USFTampaGraduateCatalog20132014 Linguistics(M.A.)


205
http://www.cas.usf.edu/
LINGUISTICSPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Closedfornew
admissions

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 16.0102
Dept.Code: WLE
Program(Major/College): LINAS

CONTACTINFORMATION

College: ArtsandSciences
Department: WorldLanguages

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

Currently,studentsarenotbeingadmittedtothisprogram.
USFTampaGraduateCatalog20132014 Linguistics:EnglishasaSecondLanguage(M.A.)


206
http://www.cas.usf.edu/
LINGUISTICS:ENGLISHASASECONDLANGUAGEPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

MinimumTotalHours: 39
ProgramLevel: Masters
CIPCode: 16.0102
Dept.Code: WLE
Program(Major/College): ESLAS
Alsoofferedas: AppliedLinguistics

CONTACTINFORMATION

College: ArtsandSciences
Department: WorldLanguages
ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Linguistics is primarily an upperlevel and graduate discipline with strong interdisciplinary concerns. The Linguistics
Programofferstwograduatetracks:

1. TheMasterofArtsinLinguistics(thesis)(currentlyinactive),and

2. TheMasterofArtsinAppliedLinguistics(TeachingEnglishasaSecondLanguage);(nonthesis).

ForinformationontheM.A.inLinguistics,refertothatProgramlisting.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Languagetesting,curriculumdevelopment,andsecondlanguagelearningandteaching.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
GREisrequiredbutmaybewaivedforapplicantswithamastersdegree.Scoresatorabove430Vand4.0AWare
generallyconsideredacceptable.Studentsalsomusthavethefollowing:

Threelettersofrecommendation,
Atwopagestatementofpurpose,writtenbytheapplicant.
StudentswhosenativelanguageisotherthanEnglishandwhosebachelorsdegreewasnotearnedin
anEnglishmediumuniversityinanEnglishspeakingcountrymustprovideaTOEFLscoreof600(250on
thecomputerizedversion).

Applicantsshouldnotethatproficiencyinasecondlanguageisrequiredbythetimeofgraduation.

USFTampaGraduateCatalog20132014 Linguistics:EnglishasaSecondLanguage(M.A.)


207
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

NonThesis:AppliedLinguistics(TESL)

CoreRequirements 27hours
LIN5700AppliedLinguistics 3
LIN6081IntroductiontoGraduateStudiesinLinguistics 3
LIN6675GrammaticalStructureofAmericanEnglish 3
LIN6720SecondLanguageAcquisition 3
LIN6748ContrastiveAnalysis 3
TSL5371MethodsofTESL 3
TSL5372ESLCurriculumandInstruction 3
TSL5440LanguageTesting 3
TSL5525CrossCulturalIssuesinESL 3

Electives 6hours
SixhoursofapprovedelectivesStudentsselectelectivesinconsultationwiththeprogramadviser.

Internship 6hours
TSL6945Internship

AthreepartExitAssessmentconsistingofalinguisticanalysisofanESLstudent,theorytopracticepaperandportfolio
of major course assignments and other relevant items is required for the program. Students are required to
demonstrateproficiencyinalanguageotherthantheirnativelanguagebytheendoftheprogram.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 MassCommunications(M.A.)


208
http://www.cas.usf.edu/
MASSCOMMUNICATIONSPROGRAM

MasterofArts(M.A)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15

MinimumTotalHours: 39
ProgramLevel: Masters
CIPCode: 9.0102
Dept.Code: MCM
Program(Major/College): COMAS

Concentrations:
MediaStudies(MCM)
StrategicCommunicationManagement(PRS)
MultimediaJournalism(MMJ)inactive

CONTACTINFORMATION

College: ArtsandSciences
Department: SchoolofMass
Communications

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The M.A. degree program in Mass Communications is designed for students who are seeking advanced studies in
preparation for professional and academic careers in mass communications. The program offers one degree, the
MasterofArtsinMassCommunications.

The Media Studies Concentration emphasizes the theoretical principles and research methods of mass
communications.TheStrategicCommunicationManagementConcentrationemphasizespublicrelationsmanagement
and social science research. The Multimedia Journalism Studies Concentration focuses on storytelling through the
integrationofdifferentdeliveryplatforms,andonmanagementissuesinconvergednewsrooms.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityexceptthatthestudentsarerequiredtohave

a3.0upperdivisionGPA
153V,144QpreferredontheGRE
aresume
threelettersofrecommendation(academicrecommendationspreferred)
astrongletterofintent
anappropriatebachelorsdegreefromanaccreditedinstitution
Students who lack an appropriate background in the selected concentration may be required to take
additionalcoursestomeetconcentrationminimums.

USFTampaGraduateCatalog20132014 MassCommunications(M.A.)


209
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 39

CoreRequirements 12hours
MMC6920IntroductiontoMassCommunicationResearch 3
MMC6401MassCommunicationTheory 3
MMC6421ResearchMethods 6

ConcentrationRequirements 12hours
Studentsselectfromthefollowingconcentrationoptions:

ConcentrationinMediaStudies
Thisprogramrequires39hoursofcoursework,including6hoursofthesis.Atleasttwentyfourhoursaretakenin
theSchoolofMassCommunications.Theremaining912hoursmaybetakeningraduatelevelcoursesofferedin
otherdepartmentsoftheUniversity.

ConcentrationinMultimediaJournalismINACTIVE
ThegraduateconcentrationinMultimediaJournalismpreparesstudentstotakeleadershippositionsinjournalism
through their knowledge of the field of mass communications, management in the media environment and the
ability to combine storytelling skills in the areas of print, broadcast and electronic communication. The
concentrationrequiresatotalof39hoursofwhich12arecorerequirements,12areinthemultimediacore,6are
thesisorappliedresearchproject,6areelectivesintheMassCommunicationsgraduateprogramand3areinan
outsiderequirement.

Requirements 12hours
JOU6501MediaManagement 3
JOU5344MultimediaJournalism 3
JOU6349AdvancedMultimediaJournalism 3
MMC6612LawandMassMedia 3

ThesisORMMC6950AppliedResearchProject 6
Electives 6
1OutsideRequirement:EME6936WebDesignandMultimedia 3

ConcentrationinStrategicCommunicationManagement
The Strategic Communication Management Concentration emphasizes the integration of organizational
communication functions such as public relations and advertising into a single communication management
function. This program requires 39 hours of course work, including six (6) hours of thesis or six (6) hours of an
appliedresearchproject,twelve (12)hoursofthemasscommunicationscore,fifteen (15)hoursofthestrategic
communicationcore,three(3)hoursinmanagementorleadershipstudies,andsix(6)hoursofelectives.

Students in these concentrations are required to take a comprehensive written examination after they have
completed at least 21 hours of mass communications course work, including the required courses for each
concentrationofstudy.

CoreRequirements 15hours
PUR6603StrategicCommunicationCampaigns 3
PUR6607StrategicCommunicationManagement 3
PUR5505IntroductiontoStrategicCommunicationTheoryandResearch 3
MMC6415StrategicCommunicationMedia 3
MMC6418StrategicMessageDesign 3
Outside requirement (3 hours): A course in organizational communication, management or leadership. Thesis OR Applied
researchproject(6)hoursarrangedwithprojectcommitteechair.MassCommunicationsorotherelectives(3hours).

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 MaterialsScienceandEngineering(M.S.M.S.E.)


210
http://www.cas.usf.edu/
MATERIALSSCIENCEANDENGINEERINGPROGRAM

MasterofScienceinMaterialsScienceandEngineering(M.S.M.S.E.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15
MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 14.1801
Dept.Code: PHY/AllEngineeringDept.
exceptComputerScience
andEngineering
Program(Major/College): MSEASorMSEEN

CONTACTINFORMATION

Colleges: ArtsandSciences
Engineering

Departments: Physics
ChemicalEngineering
CivilEngineering
ElectricalEngineering
IndustrialEngineering
MechanicalEngineering

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The field of Materials Science and Engineering (MSE) applies the fundamental principles of physics and chemistry to
engineering materials, with a focus on the interrelationship between material structure, their properties, and the
means by which they are processed. MSE impacts multiple facets of our economy, such as aerospace, electronics,
transportation, communication, construction, recreation, entertainment, environment and energy. It is, by its very
nature,aninterdisciplinaryfield.ThegoaloftheMSprograminMaterialsScienceandEngineeringistoprovidearoute
for wellqualified undergraduate students who desire indepth graduatelevel work including structured courses and
research experience, in preparation for work in industry or for entrance into a relevant science or engineering Ph.D.
program.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
ApplicantsshouldhaveaBachelorsdegreeinEngineering(Chemical,Mechanical,Industrial,Electrical,Civil,
MaterialsScience,Ceramic,Metallurgy,Manufacturing,Polymerandrelateddisciplines)orNaturalSciences
(Physics,ChemistryorBiology)fromanaccreditedinstitution.
AnapplicantmusthaveacumulativeGPAof3.0orhigherduringundergraduatestudies.
ForspecificGRErequirementsallapplicantsshouldcontacttheadmittingdepartment
Atleast2lettersofreference
Statementofobjectives/purposemustbeincludedwiththeapplication.

USFTampaGraduateCatalog20132014 MaterialsScienceandEngineering(M.S.M.S.E.)


211
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

Studentswillrequireaminimumof30totalcredithourstoqualifyfortheMSdegreeinMSE.Thedegreemaybecompleted
within 12 months by taking 12credit hours in each of the fall and springsemesters followed by 6 credit hours during the
summer.Studentsmusttake15credithoursofcorecourses(includingamaximumof3credithoursforaninterdisciplinary
GraduateMaterialsSeminar),9hoursofelectivecoursesforthethesisoptionwhichrequiresanadditional6hoursofthesis
research.Forthenonthesisoption,6additionalhoursofelectivecourseswouldberequiredinlieuofthesishours.Courses
takenforthisprogramcannotbeusedtofulfillrequirementsofanotherMastersdegreeprogram.

CoreRequirements
RequiredCoreCourses 15credithours
EML/ECH6931&
PHY6938 MaterialsCharacterization 3
PHY/ENG6935 GraduateSeminarSeriesinMSE Min2,Max3

Andthreeofthefollowingfivecourses 9credithours
EML/ECH6930 AdvancedMaterials 3
PHY6938 MaterialsPhysicsI 3
PHY6938 MaterialsPhysics2 3
ECH/EGN6930 Diffusion,TransportandKineticsinSolidMaterials 3
PHZ5405 IntroductiontoSolidStatePhysics 3

ElectiveCourses 9credithours
EEL6318 CharacterizationofSemiconductors 3
EEL6353,6354 SemiconductorDeviceTheoryIandII 3,3
CHE/EEL6355 CompoundSemiconductorTechnology 3
PHY6446 LasersandApplications 3
PHY6447 PhysicsofLightwaveDevicesandApplications 3
EEL6386,6389 PrinciplesofSemiconductorDeviceModelingI,II 3,3
EEL6935 MicrosystemsandMEMSTechnology 3
PHZ5156C ComputationalPhysicsI 3
EEL6935/ECH6391Chemical/BiologicalSensorsandMicrofabrication 3
ECH6749 BiomaterialsandBiocompatibility 3
PHZ6426 SolidStatePhysicsII 3
CGN6933 CorrosionofEngineeringMaterials 3
CGN6933 DurabilityIssuesinCementitiousMaterials 3
EML6930 FailureMechanismsinMaterial 3
PHZ6136 PhysicalApplicationsofGroupTheory 3
EEL6937 IntroductiontoNanotechnology 3
ECH/EEL6935 WideBandGapSemiconductorTechnologyI 3
ECH/EEL6931 WideBandGapSemiconductorTechnologyII 3
CES6107 AdvancedMechanicsofMaterialsII 3
EEL6935 CharacterizationofDefectsinElectronicMaterials 3
EIN6935 StatisticalQualityControl 3
ESI6247 StatisticalDesignModels 3
EML6232 LaminatedCompositeMaterials 3
EML6653 AppliedElasticity 3
EEL5382 PhysicalBasisofMicroelectronics 3
ECH6230 AdvancedMassTransfer 3
EEE5356 IntegratedCircuitTechnology 3
EEL6935 AdvancedI.C.Technology 3
EEL6936 Bioelectricity 3
EML6930 CellularEngineering 3
EIN6934 IntroductiontoHapticInterfacesforVirtualEnvironments 3
EML6930 MicroandNanoManufacturing 3
EEL0000 MaterialsforEnergyApplications 3
EEL6936 SiCTechnology 3
USFTampaGraduateCatalog20132014 MaterialsScienceandEngineering(M.S.M.S.E.)


212
http://www.cas.usf.edu/

Thesis/NonThesisOptions 6credits
ThesisHours(6credithours)
ForNonthesisOptionsixadditionalcredithoursofelectivecoursesisrequiredinlieuofthesishours.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Mathematics(M.A.)


213
http://www.cas.usf.edu/
MATHEMATICSPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
ForTeachingAssistants,InternationalandFinancialAid
Applicants:
Fall: February1
Spring: August1

ForDomesticapplicants(UScitizensorpermanent
residents)withoutfinancialaidorTeachingAssistant
applications:
Fall: February15
Spring: October1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 27.0101
Dept.Code: MTH
Program(Major/College): MTHAS

Concentration:
PureandApplied(PAA)

Alsoofferedasa5yearprogram

CONTACTINFORMATION

College: ArtsandSciences
Department: MathematicsandStatistics

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The Department of Mathematics at the University of South Florida, Tampa Campus, is composed of approximately
thirtyfacultywhodoresearchinavarietyoffields,andteachcoursesrangingfromthefreshmantothedoctorallevel.

TheDepartmentservesastheeditorialbasefortheinternationaljournals:AbstractandAppliedAnalysisandJournalof
Theoretical Probability. The Center for Mathematical Services within the department provides lectures, special
programsforsecondarystudents,andinservicetrainingprogramsinmathematics.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Algebra, Analysis, Discrete Mathematics, Partial Differential Equations, Probability, Statistics, and Topology, including
the following fields: Applied Mathematics, Approximation Theory, Combinatorics, Computational Statistics, Control
Theory,DNAcomputing,DynamicalSystems,GraphTheory,KnotTheory,NonlinearAnalysis,NumberTheory,Special
Functions,TheoreticalComputerScience,andotherareas.

USFTampaGraduateCatalog20132014 Mathematics(M.A.)


214
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasgeneraluniversityrequirementsplus:

ABachelorsdegreeorequivalentinmathematicalsciencesorrelatedarea
Atleasta650quantitativepreferredscoreontheGRE
Atleasta3.0GPAinundergraduatemathcourses
Acompletedmathdepartmentapplicationform
Astatementofgoals

Studentswithinsufficientpreparationinrealanalysisand/orabstractalgebrawillberequiredtotakeMAA4211
and/orMAS4301beforeorduringtheirfirstsemesterofstudy.

DEGREEPROGRAMREQUIREMENTS

InadditiontotheUniversityandCollegerequirements,thestudentsmustfulfillthefollowingrequirements:

TotalMinimumHours: 30hours

CreditHours:Acandidatemustcompleteatleast30credithoursinMathematics.Somegraduatecoursesareorganized
intoCoreandElectiveSequencesasfollows:

CoreRequirements
Sequences:
Algebra:
MAS5107AdvancedLinearAlgebra 3
MAS5311AlgebraI 3
MAS5312AlgebraII 3

Analysis:
MAA5306RealAnalysisI 3
MAA5307RealAnalysisII 3
MAA6616AbstractIntegration 3

Topology:
MTG5316Topology! 3
MTG5317TopologyII 3

Electives
AppliedMathematics:threecourses,onefromeachgrouplistedbelow.

(GroupA)
MAP5407MethodsofAppliedMathematics 3
MAP5345AppliedPartialDifferentialEquations 3

(GroupB)
MAA5405AppliedComplexAnalysis 3
MAT5932(MAD4401)SelectedTopics 14

(GroupC)
MAP6205ControlTheoryandOptimization 3
MAT6932SelectedTopics 14
USFTampaGraduateCatalog20132014 Mathematics(M.A.)


215
http://www.cas.usf.edu/
Combinatorics:
MAD6206CombinatoricsI 3
MAD6207CombinatoricsII 3

ComplexAnalysis:
MAA6406ComplexAnalysisI 3
MAA6407ComplexAnalysisII 3

StatisticalMethods:
STA5166StatisticalMethodsI 3
STA6167StatisticalMethodsII 3

DynamicalSystems:
MAT5932SelectedTopics 14
MAT6932SelectedTopics 14

Foundations:
MHF5306MathematicalLogicandFoundationsI 3
MHF6307MathematicalLogicandFoundationsII 3

LinearModelsandMultivariateAnalysis:
STA6208 LinearStatisticalModels3
STA6356

MathematicalStatistics:
STA5326MathematicalStatistics 3
STA6326

NonlinearAnalysis:
MAP5316OrdinaryDifferentialEquationsI 3
MAP5317OrdinaryDifferentialEquationsII 3

OrdinaryDifferentialEquations:
MAP6336TheoryOrdinaryDifferentialEquationsI 3
MAT5932SelectedTopics 14

PartialDifferentialEquations:
MAP5345AppliedPartialDifferentialEquations 3
MAP6356PartialDifferentialEquations 3

Probability:
STA5446ProbabilityTheoryI 3
STA6447ProbabilityTheoryI 3

StochasticalProcessesandTimeSeriesAnalysis:
STA6206StochasticProcesses 4
STA6876TimeSeriesAnalysis 3

TheoryofComputing:
MHF5306MathematicalLogicandFoundationsI 3
MAD6616AlgebraicAutomataTheory 3

For degree requirements, each course from the Elective Sequence list above counts towards only one Elective
Sequence.

USFTampaGraduateCatalog20132014 Mathematics(M.A.)


216
http://www.cas.usf.edu/
QualifyingExam
A qualifying examination based on a Core Sequence is called a Core Qualifying Examination. The syllabus for each
examination is available from the Department. Core Qualifying Examinations are offered in January, May and
September.AstudentwhopassesaCoreQualifyingExaminationatPh.D.levelwillbeconsideredtohavecompleted
the corresponding Core Sequence. Credit hours of MAT 6908 Independent Study, MAT 6939 Graduate Seminar, and
MAT 6911 / 7912 Directed Research, earned before passing two Core Qualifying Examinations at Ph.D. level, do not
count towards M.A. or Ph.D. degree. These courses, MAT 6908, 6911, 6939 and 7912, however, can be taken by a
studentbeforepassingtwoCoreQualifyingExaminationsatPh.D.level,withanapprovalfromtheGraduateProgram
Director,andalsofromtheSeminarOrganizerforMAT6939.ThecourseworkformorethanonecredithourforMAT
6939needsanapprovalfromtheGraduateCommittee.

1. TheMathematicsgraduatecoursesof5000levelorhigher,offeredregularlyformathematicsmajorsfromthe
Mathematicsdepartment,arecountedtowardsthe30hourrequirement.

2. Upto6hoursof4000levelorhighercourses,takenfromourdepartmentorotherdepartmentsatUSF,maybe
countedtowardsthe30hourrequirementwithapprovalbytheGraduateProgramDirectorandtheDepartment
Chairperson.

3. CompletionofSequences:ACandidatemustcompletetwoCoreorElectiveSequences,atleastoneofwhichmust
beaCoreSequence,andreceiveatleasta3.0averageineachsequence.

4. ThesisorExaminationRequirement:EachcandidatefortheM.A.degreemusteitherbeexaminedonathesisor
passoneofthewrittenCoreQualifyingExaminations.

ComprehensiveExam
The comprehensive examination takes the form of an oral thesis defense, in which the candidate must demonstrate
knowledgeofthegeneralsubjectareaofthethesis.

AstudentwhoelectstheexamoptionmustpassoneoftheCoreQualifyingExaminationsatM.A.level.Astudentmay
repeateachexaminationonce.

Thesis 6hours
MAT6971
Astudentwhoelectsthethesisoptionmustregisterforaminimumofsix(6)credithoursinMAT6971,onlysix(6)hoursof
whichmaybeappliedtowardthe30hourdegreerequirement.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Mathematics(Ph.D.)


217
http://www.cas.usf.edu/
MATHEMATICSPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
ForTeachingAssistants,InternationalandFinancialAid
Applicants:
Fall: February1
Spring: August1

ForDomesticapplicants(UScitizensorpermanent
residents)withoutfinancialaidorTeachingAssistant
applications:
Fall: February15
Spring: October1

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 27.0101
Dept.Code: MTH
Program(Major/College): MTHAS

Concentrations:
PureandApplied(PAA)
Statistics(STT)
CONTACTINFORMATION

College: ArtsandSciences
Department: MathematicsandStatistics

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Department of Mathematics at the University of South Florida, Tampa Campus, is composed of approximately
thirtyfacultywhodoresearchinavarietyoffields,andteachcoursesrangingfromthefreshmantothedoctorallevel.
TheDepartmentservesastheeditorialbasefortheinternationaljournals:AbstractandAppliedAnalysisandJournalof
Theoretical Probability. The Center for Mathematical Services within the department provides lectures, special
programsforsecondarystudents,andinservicetrainingprogramsinmathematics.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Algebra, Analysis, Discrete Mathematics, Partial Differential Equations, Probability, Statistics, and Topology, including
the following fields: Applied Mathematics, Approximation Theory, Combinatorics, Computational Statistics, Control
Theory,DNAcomputing,DynamicalSystems,GraphTheory,KnotTheory,NonlinearAnalysis,NumberTheory,Special
Functions,TheoreticalComputerScience,andotherareas.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

In addition to the M.A. program requirements, entrants to the Ph.D. Program must have a Masters degree in
MathematicsorastrongenoughbackgroundasdeterminedbytheGraduateAdmissionsCommittee,andthreeletters
of recommendation, at least two of which from mathematicians indicating an aptitude for doctoral study. See list
below.
USFTampaGraduateCatalog20132014 Mathematics(Ph.D.)


218
http://www.cas.usf.edu/

ProgramAdmissionRequirements
Sameasgeneraluniversityrequirementsplus:

aBachelorsdegreeorequivalentinmathematicalsciencesorrelatedarea
atleasta650quantitativepreferredscoreontheGRE
atleasta3.5GPAingraduateand/orupperundergraduatemathcourses
threelettersofrecommendation(twoofwhichshouldbefromcollegelevelmathprofessors)
acompletedmathdepartmentapplicationform
astatementofgoals

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 90hours
InadditiontotheUniversityandCollegerequirements,thestudentsmustfulfillthefollowingrequirements.
SomegraduatecoursesareorganizedintoCoreandElectiveSequencesasfollows:

CoreSequences:
Algebra: MAS5107,5311,5312
Analysis: MAA5306,5307,6616
Topology: MTG5316,5317

ElectiveSequences:
AppliedMathematics:threecourses,onefromeachgrouplistedbelow.
(GroupA) MAP5407,5345
(GroupB) MAA5405,MAT5932(MAD4401)
(GroupC) MAP6205,MAT6932(DynamicalSysII)

Combinatorics: MAD6206,6207
ComplexAnalysis: MAA6406,6407
StatisticalMethods: STA5166,6167
DynamicalSystems: MAT5932,6932
Foundations: MHF5306,6307
LinearModelsandMultivariateAnalysis: STA6208,6356
MathematicalStatistics: STA5326,6326
NonlinearAnalysis: MAP5316,5317
OrdinaryDifferentialEquations: MAP6336,MAT5932(DynamicalSystemsI)
PartialDifferentialEquations: MAP5345,6356
Probability: STA5446,6447
StochasticalProcessesandTimeSeriesAnalysis: STA6206,6876
TheoryofComputing: MHF5306,MAD6616

For degree requirements, each course from the Elective Sequence list above counts towards only one Elective
Sequence.

QualifyingExam
A qualifying examination based on a Core Sequence is called a Core Qualifying Examination. The syllabus for each
examination is available from the Department. Core Qualifying Examinations are offered in January, May and
September.AstudentwhopassesaCoreQualifyingExaminationatPh.D.levelwillbeconsideredtohavecompleted
the corresponding Core Sequence. Credit hours of MAT 6908 Independent Study, MAT 6939 Graduate Seminar, and
MAT 6911 / 7912 Directed Research, earned before passing two Core Qualifying Examinations at Ph.D. level, do not
count towards M.A. or Ph.D. degree. These courses, MAT 6908, 6911, 6939 and 7912, however, can be taken by a
studentbeforepassingtwoCoreQualifyingExaminationsatPh.D.level,withanapprovalfromtheGraduateProgram
Director,andalsofromtheSeminarOrganizerforMAT6939.ThecourseworkformorethanonecredithourforMAT
6939needsanapprovalfromtheGraduateCommittee.

USFTampaGraduateCatalog20132014 Mathematics(Ph.D.)


219
http://www.cas.usf.edu/

1. CoreQualifyingExaminations:ThestudentisrequiredtopasstwooftheCoreQualifyingExaminationsatPh.D.
Level.Astudentisexpectedtocompletebothwithin13monthsafterenteringthePh.D.programunlessan
extensionisgrantedbytheMathematicsGraduatecommittee.Astudentmayrepeateachexaminationonce.

2. ElectiveQualifyingExamination:AfterpassingtwoCoreQualifyingExaminations,thestudentwillselecta
DissertationAdvisorandaDoctoralCommitteewillbeappointedbytheDepartmentChairperson.TheCommittee
willdetermineacourseofstudyleadingtothewrittenElectiveQualifyingExamination,whichmaybebasedon
oneoftheElectiveSequencesabove,possiblysupplementedbyothermaterial.Thesyllabusforthisexamination,
andthenamesoftwoexaminersfromtheFaculty,mustbeapprovedbytheMathematicsGraduateProgram
Directoratleastonesemesterbeforetheexaminationistotakeplace.Astudentisexpectedtocompleteallthree
examinationswithin25monthsafterenteringthePh.D.programunlessanextensionisgrantedbythe
MathematicsGraduateCommittee.Astudentmayrepeateachexaminationonce.Thestudentwillbeadmittedto
candidacyaftercompletionoftheabovetworequirements.

3. CompletionofFourSequences:ThestudentmustcompletefoursequencesfromamongCoreandElective
Sequenceswithatleasta3.0averageineachsequence.

4. ProgressEvaluation:EachSpringsemesterafteradmissiontodoctoralcandidacy,thecandidateshallgiveanoral
presentationtotheDoctoralCommitteeoftheproblem(s)underinvestigation.Thepresentationmayalsoinclude
adiscussionofpartialresults.TheDissertationAdvisorshallsubmittotheDepartmentChairpersonawritten
reportofthepresentation.

5. Dissertation:Studentsadmittedtodoctoralcandidacyarerequiredtotakeatleast16hoursinMAT7980
DoctoralDissertation,withaminimumof6creditsofdissertationhoursaccumulatedduringeachprevious12
monthperiod(previous3terms,e.g.Fall,Spring,Summer)untilthedegreeisgranted.Thedissertationis
expectedtocontainnewmathematicalresultswhichareworthyofpublication.Researchtowardsthedissertation
typicallyformsthemajorpartoftheworkrequiredforthePh.D.inMathematics.

6. TheFinalOralExamination:TheFinalOralExaminationisalsocalledtheDissertationDefense.Thedepartment
deferstotheuniversityrequirements.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Microbiology(M.S.)


220
http://www.cas.usf.edu/
MICROBIOLOGYPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
U.S.Students:
Fall: January1forfull
consideration;however
applicationsareaccepted
toFebruary15(U.S.
Applicants)
January1(International

Spring: August1

InternationalStudents:
Fall: January1
Spring: July1

ApplicationmustbecompletedbyJanuary1by
applicantswhowishtobeconsideredforassistantships.

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 26.0503
Dept.Code: BIO
Program(Major/College): MICAS

Alsoofferedasan
AcceleratedProgram(BS/MS)inMicrobiology

CONTACTINFORMATION

College: ArtsandSciences
Department: CellBiology,Microbiologyand
MolecularBiology(CMMB)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The M.S. in microbiology degree is administered by the Department of Cell Biology, Molecular Biology and
Microbiology (CMMB). Most research in the CMMB Department is done by faculty housed in the BioScience Facility
building(BSF).DuetotheinterdisciplinaryaspectofmostResearchprojects,facultyandgraduatestudentsoftenwork
together on broad ranging research projects that bring together many of the traditionally separate areas of biology.
ManyofthefacultywithinCMMBareinvolvedincooperativeresearchwiththeircolleaguesinChemistry,Integrative
Biology, Public Health, Nursing, Medicine, Geology, Psychology, Geography, Marine Science, and Environmental
Science. Often CMMB graduate students have faculty members from these other areas of USF as members of their
graduatecommittees.

Because of the many undergraduate courses that require handson experimental laboratories, CMMB support many
graduate students as Teaching Assistants. CMMB values high quality teaching at all levels of support. Research
Assistantpositionsmayalsobeavailabletosupportresearchwithspecificfacultymembersdependingonanindividual
facultymembersfunding.NumerousscholarshipopportunitiesarealsoofferedonacompetitivebasisthroughtheUSF
GraduateSchool.

ApplyingtotheDepartmentofCellBiology,MicrobiologyandMolecularBiology
Students interested in attending graduate school within the CMMB Department should visit the CMMB website that
can be accessed from the main USF site and review the current CMMB faculty. It is recommended that potential
students consider at least 23 CMMB faculty that they would be interested in working with and communicate this
USFTampaGraduateCatalog20132014 Microbiology(M.S.)


221
http://www.cas.usf.edu/
informationintheirletterofapplication.ItisalsorecommendedthatpotentialstudentscontacttheCMMBGraduate
Directoraswellastheindividualfacultymemberstheyareinterestedinworkingwithviaemail.Suchcommunication
will facilitate the assignment of the laboratory rotations that CMMB students will participate in during their first
semester of residency and also allow the applicant to determine whether the desired faculty member has positions
availableinthelaboratory.

AllstudentsadmittedtotheMastersconcentrationinCellBiologyandMolecularBiologymustestablishasupervisory
committee. The supervisory committee shall constitute the major professor and at least two additional credentialed
faculty. At least one of the committee members must be a faculty member at USF. Supervisory committee must be
formed within two semesters after matriculation. The CMMB Graduate Director and CMMB Chair must approve the
Supervisory Committee. Once a major professor has been assigned and/or a student occupies or utilizes significant
space or facilities for research or analogous scholarly activity directly pertinent to the generation of a thesis, the
studentshallenrollforaminimumoftwo(2)hoursofresearchcrediteachsemester(otherthansummersemester),
untileligibletoenrollinthesiscredits.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:AppliedMicrobiology,PathogenicMicrobiology,CellularMicrobiology,MolecularMicrobiology,
EcologicalMicrobiology

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

ProspectivestudentsmustapplytotheMicrobiologyMSprogramviatheonlineapplicationprocessthrough
theUSFGraduateSchool.

Musthave3.00GLAlast60hoursofB.S.degree

Preferredminimumscoresof153V(500Vontheoldtest),and148Q(600Qontheoldtest),4.5AWonGRE

AllinternationalstudentsarerequiredtosubmittheTOEFLtest.NonnativeEnglishspeakinggraduate
studentsmustscoreatleast570ontheTOEFLandatleast50ontheTSEtobeeligibleforateaching
assistantship.

ItisexpectedthatcandidatesfortheM.S.degreeswillhavecompletedcoursesequivalenttothoserequired
fortheB.S.inMicrobiologyatU.S.F.

Materialsnecessaryforacompleteapplicationarelistedbelow:

Thefollowingitemsshouldbesubmittedintheenvelopeprovidedto:

CMMBGraduateOffice
Attention:CMMBGraduateDirector
UniversityofSouthFlorida
4202E.FowlerAveISA2015Tampa,FL336205150

1) Twoofficialtranscriptsinasealedenvelopefromeachpostsecondaryinstitution.Transcriptsofworkcompleted
atUSFwillbesecuredbytheOfficeofAdmissions.Thus,applicantsonlyneedtosecuretranscriptsfromother
institutionsfortheapplicationpacket.

USFTampaGraduateCatalog20132014 Microbiology(M.S.)


222
http://www.cas.usf.edu/
2) Threelettersofrecommendationfromfacultyinsealedenvelopes(ontheiruniversityletterhead)withthe
envelopesealsignedbytherecommender.StudentsshallcompleteaStudentRecommendationFormthatcan
befoundontheCMMBwebsiteandsubmitittotherecommenders.

3) Abriefessaystatingyourintendedfieldofresearchandprofessionalgoals.Pleaseindicateyourspecificresearch
interests,inorderthatwemayreferyourapplicationtoappropriateCMMBfacultymembers.Intheessayplease
list23CMMBfacultymembersthatyouwouldliketohavereviewyourfile.

4) ApplicantsmustcompletetheApplicationforTeachingAssistantship(TA)FormthatcanbefoundontheCMMB
orIBwebsiteiftheywishtobeconsideredforaTAposition.Applicantswhodonotreturnthisformwillnotbe
considerforateachingposition.ApplicantsshouldattacharesumetotheApplicationforTeachingAssistantship
(TA)Formthathighlightsanypreviousteachingexperience.

5) OFFICIALtestscoresmustbesenttoUSFdirectlyfromthetestingagency.TheUniversityofSouthFloridas4
DigitInstitutionCodeis:5828OfficialGREscores.Thisexammusthavebeentakenwithinthelastfiveyears.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 30hours

ThethesisbasedM.S.degreerequiressuccessfulcompletionofthefollowing:

1.structuredcoursework
2.anoralqualifyingexam
3.researchthesis
4.comprehensivefinalexamination

TheMastersDegreeRequirementsshouldbecompletedintwotothreeyears.TheCMMBDepartmentrequiresthat
allgraduateworkappliedtowardthecompletionofdegreerequirementsbecompletedwithinafiveyearperiodafter
matriculation. Thesis research should be publishable and students are encouraged to publish their findings. The
specificrequirementsfortheMasterofScience(M.S.)inMicrobiologyareprovidedbelow

1. Credithourrequirement:30semesterhourcreditsbeyondtheBaccalaureateDegreearerequired.
(including:BSC6910,BSC6971,BSC6935andotherstructuredandunstructuredcoursesapprovedbyCMMB
orIB)

2. StudentsadmittedtotheCMMBDepartmentmustcompletethreelaboratoryrotationsduringtheirfirst
semesterofresidency.

3. Successfulcompletionofthecomprehensivequalifyingexamination.Theexamshouldbetakenattheend
ofthefirstyear,orearlyinthesecondyearofstudy.Theexaminationisadministeredandevaluatedbythe
studentsgraduatecommittee.

4. Submissionofathesisproposalandapprovalbythemajorprofessor,graduatecommitteeandgraduate
director.

5. Aminimumofeight(8)thesisresearchcredithours(BSC6971).

6. Seminarrequirement:onepresentation,excludingthethesisseminaranddefense.Studentsshouldpresent
postersororalpresentationsbasedontheirthesisresearchatnational/regionalprofessionalmeetings.The
studentsgraduatecommitteemustapprovethepresentation.

7. Submissionofanacceptablethesis.

8. Presentationofthethesisseminar(BSC6935)andsuccessfuldefenseofthethesis.

USFTampaGraduateCatalog20132014 Microbiology(M.S.)


223
http://www.cas.usf.edu/

M.S.inMicrobiologyCourseRequirements

Requiredcoursework 9hours
BSC6930LecturesinContemporaryBiology 1
Enrollmentinthiscourseisrequiredduringeachsemesterofresidency
BSC6932AdvancesinScientificReview 2
BSC6932AdvancesinScientificWriting 2
PCB6930AdvancesinCellandMolecularBiology 1

MicrobiologyElectives* 6hoursminimum
MCB5206 PublicHealthandPathogenicMicrobiology 3
MCB5655 AppliedandEnvironmentalMicrobiology 3
PCB5335 PrinciplesofImmunology 3
PCB6236 AdvancedImmunology 3
MCB5815 MedicalMycology 3
BSC5931 MolecularMicrobialEcology 3
BSC5931 ProkaryoticMolecularGenetics 3
MCB5410 CellularMicrobiology 3
PCB5616 MolecularPhylogenetics 3
PCB6525 MolecularGenetics 3
BSC5420 GeneticEngineeringandRecombinantDNATechnology 3
*Thesupervisorycommitteemayapproveadditionalcoursesnotlistedhere

M.S.inMicrobiologyNonThesisOption
NonThesisForstudentsenrolledinthenonthesisprogram,a30hourminimumisrequiredatthe50006000level;
26 hours must be in formally structured courses; 16 hours must be at the 6000 level; 15 structured hours must be
offeredbyCMMB.Areviewpaperofatopicapprovedbythesupervisorycommitteeisrequiredaswellassuccessful
completionofthecomprehensivequalifyingexamafterallcourse workhasbeencompleted.Fornonthesismasters
students,thisexamwilloccurattheendoftheprogramofstudy.

AcceleratednonthesisBS/MSprograminMicrobiology
ThisprogramallowsB.S.majorsinMicrobiologytotakegraduatecoursesfortheelectivepartoftheMicrobiologydegree
andapplythemtoanonthesisM.S.degreeinMicrobiology.SuccessfulstudentswillbeabletoearntheM.S.degreeintwo
additionalsemestersbeyondthecompletionoftheB.S.degree.

Thisacceleratedprogramshares12creditsbetweenalreadyexistingdegrees/concentrations:
B.S.inMicrobiology
M.SinMicrobiology(NT)

Targetstudentsandexpectedoutcomes
This program will appeal to the more competitive Microbiology majors who would benefit professionally from having the
M.S.whentheyenterthejobmarketbutdonotwanttocommittothelongertimeathesisM.S.oraPh.D.programtakes
to complete. Professions that do not require bench laboratory experience but desire the broadened knowledge base are
targeted.Graduatesfromthisprogramwouldbeideallysuitedforhealthprofessions,technologybasedindustry,education
andgovernment.Wealsoexpectthatsomestudentswillbeinterestedindoctoraleducationinthebiologicalorbiomedical
areas.

DescriptionandRequirements
Biologymajorswhohavecompletedthefollowingcoursesmayapplytothisprogram:
PCB3023CellBiology
PCB3063Genetics
MCB3410CellMetabolism
MCB3032Microbiology
MCB4115CDeterminativeBacteriology
USFTampaGraduateCatalog20132014 Microbiology(M.S.)


224
http://www.cas.usf.edu/
GraduateDegreeRequirements

StudentsadmittedintotheM.S.portionoftheprogrammustcompletealltherequirementsfortheM.S.degree
(nonthesis)withinthreesemestersofadmission.Therequirementis30hoursofgraduateworkwithatleast16
ofthesehourscompletedatthe6000level;26hoursmustbeformallystructuredcourses;andatleast15hours
mustbeinCMMBcourses.Studentswillberequiredtotake3corecoursesfromthelistbelowaspartofthese26
hours.Oftherequired26hours,9hourswillbederivedfromthecoreCMMBgraduatecourseslistedbelow(see
associatedcurriculum).Theserequirementscanbepartiallymetbyupto12hoursofgraduatecoursestakenas
undergraduates.AnygraduateclasstakenoutsideofCMMBmustbeapprovedbytheCMMBGraduateDirector.
StudentsshouldbeawarethataBgradeorbetterisrequiredforeverygraduateclassappliedtotheMSportion
of their degree. In addition, students will be required to pass an oral qualifying exam based on a review paper
submittedintheirfinalsemester.Studentsmustformacommitteeaspartoftheiractionplantocompletetheir
graduate work. This committee will be comprised of at least 3 CMMB faculty, and will serve asthe examination
committeeforthereviewpaperrequiredaspartoftheMSportionoftheirdegree.Uponapprovalofthatpaper,
studentsmustsuccessfullycompleteacomprehensiveoralexambytheircommittee.

Timelineandbenchmarks:

1.Completionofprerequisiteupperdivisioncoursesandapplicationtotheacceleratedprogram.
Typicallystudentswillbeintheirjunioryear.
2.Acceptanceintotheprogramandanactionplanwithinasemesterofapplication.
3.Studentswilltakeupto12creditsofgraduatecreditinCMMBcoursesfollowingacceptanceintotheprogram.
Typicallythesecourseswillbetakeninthelatterhalfofthejunioryearandinthesenioryear.BioAdvisewill
monitortheprogressofthestudentsandensuretheyfollowtheiractionplan.Studentswhodonotcompleteat
least9hoursofgraduateworkbygraduationwillbedroppedfromtheacceleratedM.S.program.
4.GREexamswillbetakeninatimelymannersoscoreswillbeavailableforadmissiontotheM.S.portionofthe
program.StudentswhodonotcompletetheGREintimewillnotbeadmittedtotheacceleratedM.S.program.
5.StudentsmustapplyforadmissiontotheM.S.portionoftheprograminatimelymanner(Falladmission
deadlineisFebruary15,SpringdeadlineisAugust1).
6.Studentsadmittedtotheacceleratedprogrammustformacommitteepriortothebeginningoftheirfirst
semesterintheM.S.portionoftheprogramandmustcontinuetofollowtheactionplanwhichwillbemonitored
byBioAdvise.
7.StudentsadmittedtotheacceleratedM.S.programmustcompletetherequirementswithinthreesemestersor
willbedismissedfromtheprogram.

ModelCurriculumforAcceleratedNonthesisMS/BS

Year1
BSC2010,BSC2011withlabs 8

Year2
MCB3410CellMetabolism 3
PCB3063Geneticsandlab 4
PCB3023CellBiologyandlab 4
MCB3032GeneralMicrobiology 4

Year3
MCB4115DeterminativeBacteriology 5
3hourgraduateelectivestructuredcourse(5000) 3

Year4
MCB4320MolecularMicrobiology 3
9hoursofgraduateelectivecourses(5000or6000) 9

Year5
18hoursofgraduatecourses
9hoursofwhichmustbederivedfromthelistbelow
USFTampaGraduateCatalog20132014 Microbiology(M.S.)


225
http://www.cas.usf.edu/
BSC6932Virology
PCB5525MolecularGenetics
BSC5420GeneticEngineering
PCB6236AdvancedImmunology
BSC6932ProkaryoticMolecularGenetics
MCB5206PublicHealth&PathogenicMicrobiology
MCB5655Applied&EnvironmentalMicrobiology
MCB5818MedicalMycology
BSC6932Immunology
4hournonstructured(seminar,independentstudy,laboratoryresearch)
Oralexamandreviewpaperdoneattheendofyear5

ComprehensiveOralQualifyingExamination.
A final comprehensive oral examination is required for all masters students. This examination is open to all
departmentalfaculty.Studentsmusttaketheircomprehensiveexamwithintwoyearsofmatriculationandtheexamis
normallytakenafterthecompletionofallformalcoursework.Thesisstudentsmusttaketheexaminationatleastone
semesterbeforethethesisispresented.AnygraduateworkcountedtowardtherequirementfortheM.S.degreemust
becompletedwithinfive(5)yearsaftermatriculation.

All thesisbased Masters Degree students must present a seminar to the Department of CMBB Biology and must be
enrolledinBSC6935,duringthefinalsemester.Theseminarshouldbeaconcisesummaryoftheresearchcompleted
tosatisfytherequirementsfortheM.S.Degree.Theseminarisopentothegeneralpublicandmustbeannouncedtwo
weekspriortothepresentation.Uponcompletionoftheseminar,thegeneralpublicwillbeinvitedtoaskquestions.
At the discretion of the students graduate committee, members of the committee may continue to question the
graduatestudentafterthegeneralpublichasdepartedtheseminarroom.Eachstudentisexpectedtodefendhis/her
researchtotheunanimoussatisfactionofthegraduatecommittee.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Philosophy(M.A.)


226
http://www.cas.usf.edu/
PHILOSOPHYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
U.S.Students
FinancialAssistance:January2
Fall: February15
Spring: October15

InternationalStudents
FinancialAssistance:January2
Fall: February15
Spring: August1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 38.0101
Dept.Code: PHI
Program(Major/College): PHIAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Philosophy

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Contactprogramforinformationorvisithttp://philosophy.usf.edu/

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Aesthetics
AnalyticPhilosophy
AncientGreekPhilosophy
ContinentalPhilosophy
Epistemology
Ethics&ContemporaryMoralPhilosophy
FeministPhilosophy
MedievalPhilosophy
ModernPhilosophy
PhilosophyofMind
PhilosophyandReligion
PhilosophyofScience
Social&PoliticalPhilosophy
19
th
and20
th
CenturyPhilosophy

USFTampaGraduateCatalog20132014 Philosophy(M.A.)


227
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplusthefollowingdocumentsmustbesubmitted:

three(3)lettersofrecommendation
Aten(10)pagephilosophywritingsample
BriefstatementoftheApplicantsPhilosophicalInterests
GREscores

DEGREEPROGRAMREQUIREMENTS

TotalMinimumhours: 30

Corerequirements 6hours
ProseminarI
ProseminarII

Studentscompletetheremainingcourseworkeitherorthroughgeneralcourserequirementsbycompletingthe
Concentration:

CourseRequirements 24hours
StudentsshouldtakePHI5135SymbolicLogicoranapprovedsubstitute,ORpassanexaminationadministeredbythe
DepartmentofPhilosophy

Studentsmustcompleteatleast24hoursofregularlyscheduledcoursework,withatleastonecourseorgraduate
seminarineachofthefollowingareas:

AncientandMedievalPhilosophy
ModernPhilosophy
19
th
and20
th
CenturyPhilosophy
ProblemsofKnowledge
ProblemsofValueTheory
ProblemsofMetaphysics

Coursesareselectedfromthefollowinglist,orothercourseasapprovedbytheGraduateProgramDirector:

PHH6105 SeminarinAncientPhilosophy 3
PHH6265 ContinentalPhilosophyI:PhenomenologytoHermeneutics 3
PHH6266 ContinentalPhilosophyII:PoliticalTheoryandContinentalSocialTheory 3
PHH6267 ContinentalPhilosophyIII:FromStructuralismtoDeconstructionism 3
PHH6420 18
th
CenturyPhilosophy 4
PHH6435 17
th
CenturyPhilosophy 4
PHH6640 ContemporaryContinentalPhilosophy 4
PHH6938 SeminarintheHistoryofPhilosophy 3
PHI5135 SymbolicLogic 3
PHI5225 PhilosophyofLanguage 3
PHI5934 SelectedTopics 13
PHI6305 SeminarinEpistemology 3
PHI6405 SeminarinthePhilosophyofNaturalScience 3
PHI6425 SeminarinthePhilosophyofSocialScience 3
PHI6506 SeminarinMetaphysics 3
PHI6605 SeminarinEthics 3
USFTampaGraduateCatalog20132014 Philosophy(M.A.)


228
http://www.cas.usf.edu/
PHI6634 SeminarinBiomedicalEthics 3
PHI6665 Metaethics 3
PHI6706 SeminarinthePhilosophyofReligion 3
PHI6808 SeminarinAesthetics 3
PHM5125 TopicsinFeministPhilosophy 3
PHM5126 SocialIssuesinBiomedicalEthics 3
PHM6105 SeminarinSocialPhilosophy 3
PHM6305 SeminarinPoliticalPhilosophy 3
PHM6406 SeminarinthePhilosophyofLaw 3
PHM6506 SeminarinthePhilosophyofHistory 3
PHM6646 SeminarinDevelopmentEthics 3
PHP6005 Plato 3
PHP6015 Aristotle 3
PHP6400 SeminaronDescartesPhilosophy 4
PHP6415 Kant 3
PHP6420 SeminaronLeibnizsPhilosophy 4
PHP6500 SeminaronHegalsPhilosophy 4
PHP6520 NietzscheandtheNietzscheans 4
PHP6530 SeminarinGermanIdealism 4
PHP6624 Adorno 4
PHP6640 Foucault 4

ConcentrationinPhilosophyandReligion
Threecorecoursesasfollows:
ProSeminarIandProSeminarII
PHI6706SeminarinthePhilosophyofReligion 3
RLG6035TheoryandMethodsinReligiousStudies 4

Courserequirements 9
One(1)coursefromeachofthefollowingthreeareas:

PhilosophyandReligioninAntiquity
PHH6105 SeminarinAncientPhilosophy
PHP6005 Plato
PHP6015 Aristotle
RLG6327 Seminar:AncientReligionsandLiterature 3
RLG6938 FormativeChristianity
RLG6938 EarlyJewishLiterature
RLG6285 StudiesinBiblicalArchaeology 3

PhilosophyandReligionintheMedievalandModernPeriods
RLG6938AugustinesConfessions
RLG6938MedievalChristianNaturalTheology
PHH6938SeminarinHistoryofPhilosophy 3
PHH6205SeminarinMedievalPhilosophy 4
PHP6500SeminaronDescartesPhilosophy 4
PHH643517
th
CenturyPhilosophy 4
PHH642018thCenturyPhilosophy 4
PHP6415SeminaronKant 3
RLG6938ModernJewishThought
RLG6938HermeneuticsandEpistemologyinModernReligiousThought

Philosophy,andReligion:Ethics,Politics,andCulture
PHI6605SeminarinEthics 3
PHI6634SeminarinBiomedicalEthics 3
PHI6665SeminarinMetaethics 3
USFTampaGraduateCatalog20132014 Philosophy(M.A.)


229
http://www.cas.usf.edu/
PHIxxxx EnvironmentalEthics
RLG6189 ComparativeReligiousEthics 3
RLG6938 BuddhistEthics
PHH6265 ContinentalPhilI:PhenomenologytoHermeneutics 3
PHH6266 ContinentalPhilII:PoliticalTheoryandContinentalSocialTheory 3
PHH6267 ContinentalPhilIII:FromStructuralismtoPostmodernism 3
PHI6425 SeminarinthePhilosophyofSocialScience 3
PHI6808 SeminarinAesthetics 3
PHM5125 TopicsinFeministPhilosophy 3
PHM6105 SeminarinSocialPhilosophy 3
PHM6305 SeminarinPoliticalPhilosophy 3
RLG6126 ReligioninAmerica 3
RLG6143 Religion,Culture,andSociety 3
RLG6196 ReligionandModernization 3
RLG6938 BuddhismandPostmodernism
RLG6938 ReligiousIssuesintheCaribbeanWorld

WorldReligionsandNonWesternPhilosophy
RELxxxx Buddhism 3
RELxxxx ComparativePhilosophyofReligion 3
RELxxxx BuddhismandPostmodernism 3
RELxxxx SeminarinConfucianism 3
RELxxxx MedicalPhilosophy:Chinese,Greek,Indian 3
RELxxxx ComparativeMysticism 3
PHM5125 TopicsinFeministPhilosophy 3
PHIxxxx LatinAmericanThought 3
RLG6189 ComparativeReligiousEthics 3
RLG6938 BuddhistEthics
RLG6938 ReligiousIssuesintheCaribbeanWorld

LanguageCompetency
StudentswritingaboutatextortextswritteninalanguageotherthanEnglishshoulddemonstratean
elementaryreadingknowledgeofthatlanguage.StudentswritingaboutatextortextswritteninEnglish
shoulddemonstrateanelementaryreadingknowledgeofatleastoneotherlanguageinwhichonefinds
researchorscholarshipdevotedtothetext(s)beingstudied.

ComprehensiveExamination
StudentscompleteeitherPHI6971Thesis(3credithours)ORacomprehensiveexaminationonarequiredlistof
readingsconstructedbythecandidateandacommitteeofexaminers

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Philosophy(Ph.D.)


230
http://www.cas.usf.edu/
PHILOSOPHYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
U.S.Students
FinancialAssistance: January2
Fall: February15
Spring: October15

InternationalStudents
FinancialAssistance: January2
Fall: February15
Spring: August1

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 38.0101
Dept.Code: PHI
Program(Major/College): PHIAS

Concentration:
PhilosophyandReligion

CONTACTINFORMATION

College: ArtsandSciences
Department: Philosophy

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

Contactprogramforinformationorvisithttp://www.cas.usf.edu/philosophy/index.html

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Aesthetics
AnalyticPhilosophy
AncientGreekPhilosophy
ContinentalPhilosophy
Epistemology
EthicsandContemporaryMoralPhilosophy
FeministPhilosophy
MedievalPhilosophy
ModernPhilosophy
PhilosophyofMind
PhilosophyandReligion
PhilosophyofScience
Social&PoliticalPhilosophy
19
th
and20
th
CenturyPhilosophy

USFTampaGraduateCatalog20132014 Philosophy(Ph.D.)


231
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityandthefollowingdocumentsmustbesubmitted:

three(3)lettersofrecommendation
aten(10)pagephilosophywritingsample
GREScores
Abriefstatementoftheapplicantsphilosophicalinterests

DEGREEPROGRAMREQUIREMENTS

TotalMinimumhours: 90

Once admitted, students must successfully complete at least 90 credit hours in accordance with the requirements
below.

Requirements 12hours
ProseminarIandProseminarII
StudentsshouldtakePHI5135SymbolicLogicoranapprovedsubstitute,ORpassanexaminationadministeredbythe
DepartmentofPhilosophy

Coursework 44hours
Studentsmustcompleteatleast44hoursofregularlyscheduledcoursework,withatleastonecourseorgraduate
seminarineachofthefollowingareas:

AncientandMedievalPhilosophy
ModernPhilosophy
19
th
and20
th
CenturyPhilosophy
ProblemsofKnowledge
ProblemsofValueTheory
ProblemsofMetaphysics

Coursesareselectedfromthefollowinglist,orothercourseasapprovedbytheGraduateProgramDirector:

PHH6100 SeminarinAncientPhilosophy 3
PHH6265 ContinentalPhilosophyI:PhenomenologytoHermeneutics 3
PHH6266 ContinentalPhilosophyII:PoliticalTheoryandContinentalSocialTheory 3
PHH6267 ContinentalPhilosophyIII:FromStructuralismtoDeconstructionism 3
PHH6420 18
th
CenturyPhilosophy 4
PHH6435 17
th
CenturyPhilosophy 4
PHH6640 ContemporaryContinentalPhilosophy 4
PHH6938 SeminarintheHistoryofPhilosophy 3
PHI5135 SymbolicLogic 3
PHI5225 PhilosophyofLanguage 3
PHI5934 SelectedTopics 13
PHI6305 SeminarinEpistemology 3
PHI6405 SeminarinthePhilosophyofNaturalScience 3
PHI6425 SeminarinthePhilosophyofSocialScience 3
PHI6506 SeminarinMetaphysics 3
PHI6605 SeminarinEthics 3
PHI6634 SeminarinBiomedicalEthics 3
PHI6665 Metaethics 3
PHI6706 SeminarinthePhilosophyofReligion 3
USFTampaGraduateCatalog20132014 Philosophy(Ph.D.)


232
http://www.cas.usf.edu/
PHI6808 SeminarinAesthetics 3
PHM5125 TopicsinFeministPhilosophy 3
PHM5126 SocialIssuesinBiomedicalEthics 3
PHM6105 SeminarinSocialPhilosophy 3
PHM6305 SeminarinPoliticalPhilosophy 3
PHM6406 SeminarinthePhilosophyofLaw 3
PHM6506 SeminarinthePhilosophyofHistory 3
PHM6646 SeminarinDevelopmentEthics 3
PHP6005 Plato 3
PHP6015 Aristotle 3
PHP6400 SeminaronDescartesPhilosophy 4
PHP6415 Kant 3
PHP6420 SeminaronLeibnizsPhilosophy 4
PHP6500 SeminaronHegalsPhilosophy 4
PHP6520 NietzscheandtheNietzscheans 4
PHP6530 SeminarinGermanIdealism 4
PHP6624 Adorno 4
PHP6640 Foucault 4

Language
StudentswritingaboutatextortextswritteninalanguageotherthanEnglishshoulddemonstrateareading
knowledgeofthatlanguage.StudentswritingaboutatextortextswritteninEnglishshoulddemonstratean
elementaryreadingknowledgeofatleasttwootherlanguagesinwhichonefindsresearchorscholarshipdevotedto
thetext(s)beingstudied.

DoctoralResearch
12credithoursinarea(s)ofdoctoralresearch

ComprehensiveExam
Acomprehensiveexaminationonarequiredlistofreadingsconstructedbythecandidateandacommitteeof
examiners

Dissertation
Awrittenprospectusforthedissertationandanoraldefenseofthisprospectus.

ConcentrationinPhilosophyandReligion

Onceadmitted,studentsmustsuccessfullycompleteatleast90credithoursincludingthefollowingrequirements:

Three(3)CoreCourses:
ProseminarIandProseminarII
PHI6706 ProSeminarinthePhilosophyofReligion
REL6035 TheoryandMethodsinReligiousStudies

Atleastthreecoursesfromeachofthefollowingfiveareas:

A. PhilosophyandReligioninAntiquity

PHH6100 SeminarinAncientPhilosophy
REL6327 SeminarinAncientLiterature
RELxxxx FormativeChristianity
RELxxxx EarlyJewishLiterature
REL6285 StudiesinBiblicalArchaeology

B. PhilosophyandReligionintheMedievalandModernPeriods

USFTampaGraduateCatalog20132014 Philosophy(Ph.D.)


233
http://www.cas.usf.edu/
RELxxxx AugustinesConfessions
RELxxxx MedievalChristianNaturalTheology
PHH6205 SeminarinMedievalPhilosophy
PHP6400 Descartes
PHH6435 SeminarinSeventeenthCenturyPhilosophy
PHH6420 SeminarinEighteenthCenturyPhilosophy
PHP6005 Plato
PHP6015 Aristotle
PHP6415 Kant
RELxxxx ModernJewishThought
RELxxxx HermeneuticsandEpistemologyinModernReligiousThought

C. PhilosophyandReligion:Ethics,Politics,andCulture

PHI6605 SeminarinEthics
PHI6634 SeminarinBiomedicalEthics
PHI6665 SeminarinMetaethics
REL6178 ComparativeReligiousEthics
RELxxxx BuddhistEthics
RELxxxx ComparativePhilosophyofReligion
PHH6265 ContinentalPhilI:PhenomenologytoHermeneutics
PHH6266 ContinentalPhilII:PoliticalTheoryandContinentalSocialTheory
PHH6267 ContinentalPhilIII:FromStructuralismtoPostmodernism
PHI6425 SeminarinthePhilosophyofSocialScience
PHI6808 SeminarinAesthetics
PHM5125 TopicsinFeministPhilosophy
PHM6105 SeminarinSocialPhilosophy
PHM6305 SeminarinPoliticalPhilosophy
REL6126 ReligioninAmerica
REL6143 Religion,Culture,andSociety
REL6195 ReligionandModernization
RELxxxx BuddhismandPostmodernism
RELxxxx ReligiousIssuesintheCaribbeanWorld
PHIxxxx AfricanPhilosophy
RELxxxx Buddhism
RELxxxx ComparativePhilosophyofReligion
RELxxxx BuddhismandPostmodernism
RELxxxx SeminarinConfucianism
RELxxxx MedicalPhilosophy:Chinese,Greek,Indian
RELxxxx ComparativeMysticism
PHM5125 TopicsinFeministPhilosophy
PHI5934 LatinAmericanThought
REL6178 ComparativeReligiousEthics
RELxxxx BuddhistEthics
RELxxxx ReligiousIssuesintheCaribbeanWorld

Language
StudentswritingaboutatextortextswritteninalanguageotherthanEnglishshoulddemonstrateareading
knowledgeofthatlanguage.StudentswritingaboutatextortextswritteninEnglishshoulddemonstratean
elementaryreadingknowledgeofatleasttwootherlanguagesinwhichonefindsresearchorscholarshipdevotedto
thetext(s)beingstudied.

DoctoralResearch
12credithoursinarea(s)ofdoctoralresearch.

USFTampaGraduateCatalog20132014 Philosophy(Ph.D.)


234
http://www.cas.usf.edu/
ComprehensiveExam
Acomprehensiveexaminationonarequiredlistofreadingsconstructedbythecandidateandacommitteeof
examiners.

Dissertation
Awrittenprospectusforthedissertationandanoraldefenseoftheprospectus.
Awrittendissertationandanoraldefenseofthisdissertation.

Thedissertationcommitteewillbecomposedof

a. EitheraMajorProfessorappointedinbothPhilosophyandReligiousStudies,orcoMajorProfessors,
oneofwhomisappointedinPhilosophyandtheotherofwhomisappointedinReligiousStudies;and

b. AtleastoneothermemberfromPhilosophyandonefromReligiousStudies.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Physics(M.S.)


235
http://www.cas.usf.edu/
PHYSICSPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1
Spring: September1
Summer: February1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 40.0801
Dept.Code: PHY
Program(Major/College): PHYAS

Concentrations:
AppliedPhysics(APM)
AtmosphericPhysics(APZ)
AtomicandMolecularPhysics(AMZ)
LaserPhysics(LPZ)
MaterialsPhysics(MPZ)
MedicalPhysics(MEZ)
OpticalPhysics(OPZ)
SemiconductorPhysics(SCZ)
SolidStatePhysics(SSZ)

CONTACTINFORMATION

College: ArtsandSciences
Department: Physics

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Contactprogramforinformation.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus

threelettersofrecommendation
astatementofpurpose
GREGeneralTestscoresrequired,GREPhysicsSubjectTestscoresrecommended.

USFTampaGraduateCatalog20132014 Physics(M.S.)


236
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

StudentsadmittedtothegraduateprograminPhysics,willconsultwiththePhysicsDirectorofGraduateStudies,
who will be the students course advisor and monitor the students progress. After a decision has been made
concerningthestudentsacademicgoals,thedutiesofgraduateadvisingwillbeassumedbythemajorprofessor
and the supervisory committee appointed by the department chairperson. In keeping with the students
academic goals, the supervisory committee will determine the appropriate course of study and examinations
requiredforgraduationforboththethesisandnonthesisoptions.

TotalMinimumHours: 30

CoreRequirements 15credithours
Corecourses:(Allfivearerequired)

a)PHZ5115MathematicalMethodsI 3
b)PHY6346ElectricityandMagnetismI 3
c)PHY6645QuantumMechanicsI 3
d)PHY6646QuantumMechanicsII 3
e)PHY6536StatisticalMechanics 3

Thesisoption 15credithours
Threegraduatelevelelectiveclasses(ninecredithours),atleasttwoofwhichmustbewithinphysics,plussix
credithoursofmastersthesisordirectedresearch.PHY6911,andPHY6971willnotcounttowardtheelectives.
Inaddition,thecandidatemustpresentandsuccessfullydefendawrittenthesis.

Nonthesisoption 15credithours
Fivegraduatelevelelectiveclasses(fifteencredithours),atleasttwoofwhichmustbeinphysics.PHY6911,and
PHY6971willnotcounttowardtheelectives.

LaboratoryorComputingExperience
Thestudent,aspartoftheirelectiveworkorthesis,orthroughpreviouscoursework,shoulddemonstrateeither
laboratoryorcomputationalexperience.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 AppliedPhysics(Ph.D.)


237
http://www.cas.usf.edu/
PHYSICS(APPLIEDPHYSICS)PROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1
Spring: September1
Summer: February1

MinimumTotalHours: 57
ProgramLevel: Doctoral
CIPCode: 40.0801
Dept.Code: PHY
Program(Major/College): APDAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Physics

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

Thisprogramemphasizesthepractical,engineeringapplicationsoftheoreticalandfundamentalphysicalconcepts.The
programencompassestheareasoflaserphysics,materialsphysics,computationalphysics,environmentalphysicsand
sensors,biomedicalphysicsandimagingscience.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
SameasUniversityplus

threelettersofrecommendation
astatementofpurpose
GREGeneralTestscoresrequired,GREPhysicsSubjectTestscoresrecommended.

DEGREEPROGRAMREQUIREMENTS

Theprogramrequiresatotalof57credithoursdistributedasfollows:

1. Corecourses:(all6required)

a)PHZ5115 MathematicalMethodsI 3
b)PHY6346 ElectricityandMagnetismI 3
c)PHY6645 QuantumMechanicsI 3
d)PHY6646 QuantumMechanicsII 3
d)PHY6536 StatisticalMechanics 3
f)PHZ7940 IndustrialPracticum(contactdepartmentfordetails)

USFTampaGraduateCatalog20132014 AppliedPhysics(Ph.D.)


238
http://www.cas.usf.edu/
2. Laboratoryexperience:01classes:
Thismaybemet,forexample,bysubmittinganexperimentalthesisordissertation,by:anapprovedgraduate
levelelective;submittinganexperimentalthesisordissertation;orthroughsufficientlyrigorousrelevant
experience(e.g.,priorcourses,industrialemployment,etc.).Contacttheprogramforacurrentlistofapproved
courses.

3. Computationalexperience:01classes
Thismaybemet,forexample,bythefollowing:anapprovedgraduatelevelelective;submittingacomputational
thesisordissertation;orthroughsufficientlyrigorousrelevantexperience(e.g.,priorgraduateorundergraduate
courses,industrialemployment,etc.).Contacttheprogramforacurrentlistofapprovedcourses.

4. Electives:
Atleastanadditional4graduatelevelclasses,ofwhichatleast2areinPhysics
Anygraduatelevelclasses(excludingresearchandseminars)notusedtofulfillotherrequirements.Contactthe
programforacurrentlistofapprovedcourses.

5. QualifyingProcess:
Thestudent,inconsultationwithhisorherresearchadvisor,willassembleasupervisoryconsistentwiththerules
oftheGraduateSchool.TheQualifyingProcesswillevaluatethestudentsacademicandresearch
accomplishmentsandpotential.Ifthesupervisorycommitteejudgesthequalifyingprocesstobesuccessfully
completed,thestudentmayproceedtothecandidacystage.Contacttheprogramformoredetails.

6. Admissiontocandidacy:
TobecomeaPh.D.Candidate,thestudentmustpresentadissertationproposalandsuccessfullydefendthat
proposaltothesupervisorycommittee.

7. Dissertation:
Thecandidatewillconductoriginalandsignificantresearch,describethatresearchandtheresultsinadoctoral
dissertationanddefendthatdissertationinanoralpresentationtothesupervisorycommittee.Thedefenseis
opentothepublicandmustbescheduledaccordingtotheregulationsoftheGraduateSchool.

CoreRequirements
Coursesintheoreticalandappliedareas 18hours
Labtraining 3hours
Electives 12hours
DissertationResearch(PHY7980) 24hours

An important feature of this program is a course in laboratory measurement and instrumentation and a fieldsite
industrialpracticum,whichcomprisethesixhoursoflabtraining.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Physics/EngineeringScience(M.S.)


239
http://www.cas.usf.edu/
PHYSICS/ENGINEERINGSCIENCEJOINTPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
SeelistingsforPhysicsand
EngineeringScience

MinimumTotalHours: 51
ProgramLevel: Masters
CIPCodes: 40.0801and14.0101
Dept.Codes: PHYandESB
Program(Major/College): PHYASandEGCEN

CONTACTINFORMATION

Colleges: CollegeofArtsandSciences
CollegeofEngineering
Departments: Physics,EngineeringScience

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Contacttheprogramforinformation.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
SeelistingsforPhysicsandEngineeringScience.

ProgramAdmissionDeadlines
SeedeadlinesforPhysicsandforEngineeringScience.

DEGREEPROGRAMREQUIREMENTS

Contacttheprogramforinformation.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Physics/EngineeringScience(Ph.D.)


240
http://www.cas.usf.edu/
PHYSICS/ENGINEERINGSCIENCEJOINTPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
SeelistingsforPhysicsand
EngineeringScience

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCodes: 40.0801and14.0101
Dept.Codes: PHYandESB
Program(Major/College): PHYASandEGCEN


CONTACTINFORMATION

Colleges: ArtsandSciences,Engineering
Departments: Physics,EngineeringScience

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

Contactprogramforinformation

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
SeelistingsforPhysicsandEngineeringScience.

ProgramAdmissionDeadlines
SeedeadlinesforPhysicsandforEngineeringScience

DEGREEPROGRAMREQUIREMENTS

Contacttheprogramforinformation.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 PoliticalScience(M.A.)


241
http://www.cas.usf.edu/
POLITICALSCIENCEPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15
Applicationsacceptedonanongoingbasis
MinimumTotalHours: 39
ProgramLevel: Masters
CIPCode: 45.1001
Dept.Code: GIA
Program(Major/College): POLAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Governmentand
InternationalAffairs
ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The graduate program leading to the M.A. in Political Science is designed to offer advanced general instruction in
PoliticalScience.Itpreparesitsgraduatesforpositionsofresponsibilityinthepublicandprivatesectors,aswellasin
research, teaching, and study at the doctoral level. For instructional purposes, the graduate curriculum in Political
Sciencehasbeendividedintothreefields:

Field1ComparativeGovernmentandPolitics (courseswithaCPOprefix)
Field2InternationalRelations (courseswithanINRprefix)
Field3PublicPolicy (courseswithaPUP,POS,POT,URP,orPADprefix)

Students select one field as a major area and another field as a minor area. They must consult with the graduate
coordinatortomapoutacourseplan.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus:

Undergraduatedegreefromaregionallyaccreditedinstitution
GRErequired,withapreferredverbalscoreof62%orhigherandquantitativescoreof26%orhigher
Three(3)lettersofrecommendation
A500wordpersonalstatement
Officialtranscripts
MinimumGPAof3.00
Musthaveanundergraduatebackgroundinpoliticalscience.

USFTampaGraduateCatalog20132014 Psychology(M.A.)


242
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 39hours

1. RequiredResearchMethodsSequence(9hours):
POS6735 FoundationsofPoliticalInquiry 3
POS6736 ResearchDesign 3
POS6746 QuantitativeAnalysis 3

2. Majorfield(15hours):
Corecourseinmajorarea
Either
CPO6091 SeminarinComparativePolitics,or 3
INR6007 SeminarinInternationalRelations,or 3
PUP6007 SeminarinPublicPolicy 3
And4additionalcourses.

3. Minorfield(9hours):
Corecourseinmajorarea
Either
CPO6091 SeminarinComparativePolitics,or 3
INR6007 SeminarinInternationalRelations,or 3
PUP6007 SeminarinPublicPolicy 3
And2additionalcourses.

4. Thesis/NonThesis(Minimumof6hours):
POS6971 Thesis:Masters 6minimum

Thesis: Students must provide new insight into a relevant topic in political science or international studies. As students
approach the thesis stage, they need to compose a thesis committee consisting of a major professor, who must be a
memberoftheDepartmentofGovernmentandInternationalAffairs,andtworeaders.Oneofthetworeaderscanbefrom
anotherdepartment,butthatpersonmustfirstbeapprovedbytheprogramdirector.Thethesiscommitteemustapprove
proposals before students embark on their projects. Students must prepare a written thesis and defend their work in a
formaloralpresentationbeforetheircommittee.

NonThesis:Studentswhochooseanonthesisoptionwillberequiredtocompleteanadditional6hoursofcourseworkat
the 6000 level in place of the thesis. (Choose 1 of the below courses to fulfill 3 of your required nonthesis option. Other
coursesmaysatisfythisrequirementandmustbeapprovedbytheGraduateProgramDirector.)

INR6107 AmericanForeignPolicy
INR6036 SeminarinInternationalPoliticalEconomy
POS6933 ComparativeRevolutionaryMovements

The second course determines competency and serves as the equivalent of a comprehensive examination. The student is
requiredtodemonstratecompetencybysuccessfullycompletingasubstantialliteraturereviewinhisorhermajorfield.The
studentwillenrollin:

POS6909 IndependentStudy 3

ComprehensiveExamination
For students in the thesis program, successful completion of the Thesis serves in lieu of the Comprehensive Exam. For
students in the nonthesis program, the second course determines competency and serves as the equivalent of a
comprehensiveexamination.Thestudentisrequiredtodemonstratecompetencybysuccessfullycompletingasubstantial
literaturereviewinhisorhermajorfield.

USFTampaGraduateCatalog20132014 Psychology(M.A.)


243
http://www.cas.usf.edu/
CourseListings

CPO5934 SelectedTopicsinComparativePolitics 3

CPO6091 SeminarinComparativePolitics 3

INR5086 IssuesinInternationalRelations 3
INR6007 SeminarinInternationalRelations 3
INR6036 SeminarinInternationalPoliticalEconomy 3
INR6107 AmericanForeignPolicy 3

PAD6060 PublicAdministrationTheory 3
PAD6275 PoliticalEconomyforPublicManager 3
PAD6307 PolicyAnalysis,Implementation,andProgramEvaluation3
PAD6338 UrbanLanduseandPolicyAdministration 3
PAD6339 HousingandPublicPolicy 3
PAD6355 UrbanGrowthManagement 3

POS6045 SeminarinAmericanGovernmentandPolitics 3

POS6127 IssuesinStateGovernmentandPolitics 3
POS6455 PoliticalPartiesandInterestGroups 3

POT6007 SeminarinPoliticalTheory 3

PUP5607 PublicPolicyandHealthCare 3
PUP6007 SeminarinPublicPolicy 3

URP6056 CityandRegionalPlanning 3

Students may take a maximum of 3 hours of Independent Study (POS 6909) and 3 hours maximum of Directed
Research(POS6919)

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Psychology(M.A.)


244
http://www.cas.usf.edu/
PSYCHOLOGYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
StudentsarenotadmittedtoaterminalM.A.degreein
Psychology.SeedeadlinesforPh.D.inPsychology

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 42.0101
Dept.Code: PSY
Program(Major/College): PSYAS

Concentrations:
ClinicalPsychology(PSC)
Cognition,Neuroscience,andSocialPsychology(PCN)
IndustrialOrganizationalPsychology(PSI)

CONTACTINFORMATION

College: ArtsandSciences
Department: Psychology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The graduate faculty of the Psychology Department is divided into three broad concentrations: Clinical, Cognition,
Neuroscience,&SocialPsychology,andIndustrialOrganizational.EachoftheseareasoffersPh.D.leveltraininginthe
followingareasofspecialexpertise.

Clinical Psychopathology, Psychological Assessment and Interventions, Health Psychology, Addictive


Behaviors,ClinicalChildPsychology,ClinicalNeuropsychology.

Cognition,Neuroscience,&SocialPsychologyBehavioralNeuroscience,Cognition,JudgmentandDecision
Making,Development,Memory,Perception,Social.Inaddition,withfacultyinCommunicationSciencesand
Disorders, the Cognitive and Neural Sciences faculty offer a specialization in Speech/Language/Hearing
Sciences.

IndustrialOrganizational Selection, Training and Evaluation of Organization Members, Job Analysis,


Motivation and Satisfaction, Occupational Health Psychology, Organizational Theory, Leadership,
Organizational Change. Methodological offerings across areas cover Psychometrics, Statistics, Factor
Analysis,StructuralEquationModeling,andResearchDesign.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools; Clinical Program:
AmericanPsychologicalAssociation,PsychologicalClinicalSciencesAccreditationSystem,andmemberoftheAcademy
ofPsychologicalClinicalScience.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
NotaterminalMA.SeePh.D.Requirements.
USFTampaGraduateCatalog20132014 Psychology(M.A.)


245
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

The Department of Psychology does not admit students seeking a terminal M.A. degree in Psychology. Additional
informationisavailableintheGraduateStudentHandbook:http://psychology.usf.edu/policies/students.aspx

TotalMinimumHours:30(Borbetterforeachrequiredcourse)

Corerequirements:
PSY6971MastersThesis 6
PSY6217RegressionandAnalysisofVariance 4

Twoofthefollowing:
EXP6608CognitivePsychology 3
SOP6266SocialPsychology 3
PSB6056PhysiologicalPsychology 3

Theremainderoftherequiredhoursisfulfilledbysatisfyingconcentrationrequirementsdescribedbelow.

ConcentrationRequirements:

ClinicalPsychology

GraduateBreadthRequirements:StudentsmusttakeonecourseineachofthethreeBreadthareas:Biological
AspectsofBehavior,SocialAspectsofBehavior,andCognitive/AffectiveAspectsofBehavior.

Biologicalaspectsofbehavior
PSB6056PhysiologicalPsychology 3
CLP6937HumanNeuropsychology 3
CLP7379HealthPsychology 3
EXP7099Psychopharmacology 3
EDF6938PediatricPsychopharmacology 3
EXP7099GraduateSeminar:Psychophysiology 3
EXP7099GraduateSeminar:SurveyofNeuroscience 3

Socialaspectsofbehavior
SOP6266Social 3
PSY6266PsychologyofGender 3
EXP7099StressandCoping 3
INP6935OrganizationalPsychology 3
EXP7099GraduateSeminar:SocialandPersonalityDevelopment 3
EXP7099GraduateSeminar:SocialPsychologyofInterpersonalRelationships 3

Cognitiveandaffectiveaspectsofbehavior
EXP6608Cognitive 3
EXP7099Memory 3
EXP7099Forgetting 3
CLP7379EmotionanditsDisorders 3
CLP7379MoodDisorders 3
EXP7099GraduateSeminar:ImageandMind 3
EXP7099GraduateSeminar:CognitiveNeuroscienceofPerception 3

GraduateResearchMethodsRequirements
Allclinicalstudentsarerequiredtotakeatotaloffourgraduateresearchmethodscourses.

PSY6217ANOVA/Regressionpluslab 4
SOP7265MultivariateStatistics(orequivalentoutsideofdepartment)
PSY6217/SOP6266ClinicalPsychometrics(orequivalentoutsideofdepartment)
USFTampaGraduateCatalog20132014 Psychology(M.A.)


246
http://www.cas.usf.edu/

PlusONEadditionalresearchmethodscourse(3credits).Studentsmaychoosefromthelistofapprovedcourses
below.Studentswishingtofulfillthismethodsrequirementwithanycoursenotlistedbelowmustsubmita
requesttotheclinicalfaculty.

SOP6266FactorAnalysis 3
SOP6266StructuralEquationModeling 3
SOP6266MetaAnalysis 3
EXP7099DevelopmentalResearchMethods 3
CLP6937GrantWriting 3
SOP6266ItemResponseTheory 3
SOP6266HierarchicalLinearModeling 3

ClinicalCoreRequirements
ClinicalDidacticCourses:Studentsneedtotakeatleastonefundamentalcourseineachofthethreeareas
assessment,interventions,andpsychopathology.
CLP6438ClinicalAssessment
CLP7188ClinicalInterventions
CLP6166PsychopathologyanditsDevelopment

SpecializedTopicCourseRequirements:
Studentsmustalsocompletefourcoursesinspecializationtopicsrelatedtopsychologicalassessment,
intervention,andpsychopathology/dysfunction.Thefollowingcourseswouldfulfillthisrequirement:

CLP6937NeuropsychologicalAssessment 3
CLP6937Preventionscience 3
CLP7379Emotionanditsdisorders 3
CLP7379Mooddisorders 3
CLP7379Eatingdisorders 3
CLP7379Addictions 3
CLP7379HealthPsychology 3
CLP7379NewParadigmsinPsychology 3
CLP7379CulturalDiversity 3
CLP7379AdvancedPsychologicalInterventionSeminar/SpecializedTreatments 3
PSY6946AdvancedPsychologicalAssessmentSeminar 3
CLP7379ClinicalScienceSeminar 3

ClinicalPracticum
PSY6946(1hourpersemesterbeginningthesecondyearofgraduatetraining)

Othercourserequirements:
PSY6946SkillsforPsychologicalIntervention 2
CLP6937IntroductiontoClinicalPsychology/CulturalDiversityProSeminar 3
PSY7931EthicsandProfessionalProblems 2

ResearchRequirements:
PSY6971Thesis 6

ConcentrationRequirements:

Cognition,Neurosciences,&SocialPsychology

PriortotheComprehensiveExam
TotalMinimumHours:30

CoreRequirements(16hours)
AtleastaBinaminimumoftwoofthefollowing:
USFTampaGraduateCatalog20132014 Psychology(M.A.)


247
http://www.cas.usf.edu/
CognitivePsychology(3),PhysiologicalPsychology(3),orSocialPsychology(3).
Studentsmaybeallowedtosubstituteanadvancedthreehourcourseforoneorbothofthesecourseswiththe
writtenpermissionoftheCNSAreaDirector.(6totalhours)

TwobasicmethodscourseswithgradesofatleastB:AnalysisofVariance(4)andRegression(4).(8totalhours)
IntroductiontoCNS(2semesters,1houreach)

ConcentrationRequirements(6hours)
*Aminimumoftwoseminarsoradvancedcoursesincognition,neuroscience,orsocialpsychologyfromCNS
facultyor,withwrittenpermissionoftheAreaDirector,relateddisciplineswithgradesofatleastB.

TotalThesisHoursRequired(6hours)
Master'sthesisresearch(minimum6PSY6971Thesis:MastersorPSY6917DirectedResearchcreditsitis
recommendedthatstudentstakethesiscreditsinordertoretaintheoptionofapplyingforamastersdegree).

ConcentrationRequirements:

IndustrialOrganizationalPsychology

I/OConcentrationRequirements(30hours)
EXP6608CognitivePsychology 3
SOP6669Personality
SOP6058SocialPsychology 3
INP6935PersonnelPsychology 3
INP6935OrganizationalPsychology 3
PSY7931EthicsandProfessionalProblems 3
INP7097ResearchinI/OPsychology 1(2times)
SOP6669Psychometrics 3
PSY6217ANOVAMultipleRegression 4
SOP6669OrganizationalResearchMethods 3
PSY6971Thesis:Masters 6

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Psychology(Ph.D.)


248
http://www.cas.usf.edu/
PSYCHOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall:
Clinical: December1
Cognition,Neuroscience
&SocialPsychology: January2
IndustrialOrganizational: January2

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 42.0101
Dept.Code: PSY
Program(Major/College): PSYAS

Concentrations:
ClinicalPsychology(PSC)
Cognition,Neuroscience,&SocialPsychology(PCN)
IndustrialOrganizationalPsychology(PSI)

CONTACTINFORMATION

College: ArtsandSciences
Department: Psychology

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Psychology Department graduate program is divided into three broad concentrations: Clinical, Cognition,
Neuroscience,&SocialPsychology,andIndustrialOrganizational.EachoftheseareasoffersPh.D.leveltraininginthe
followingareasofspecialexpertise:

Clinical
Psychopathology, Psychological Assessment and Interventions, Health Psychology, Addictive Behaviors,
ClinicalChildPsychology,ClinicalNeuropsychology.

Cognition,Neuroscience,&SocialPsychology
Behavioral Neuroscience, Cognition, Judgment and Decision Making, Development, Memory, Perception,
Social. In addition, with faculty in Communication Sciences and Disorders, the CNS faculty offers a
specializationinSpeech/Language/HearingSciences.

IndustrialOrganizational
Selection, Training and Evaluation of Organization Members, Job Analysis, Motivation and Satisfaction,
OccupationalHealthPsychology,OrganizationalTheory,Leadership,OrganizationalChange.Methodological
offerings across areas cover Psychometrics, Statistics, Factor Analysis, Structural Equation Modeling, and
ResearchDesign.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools; Clinical Program:
AmericanPsychologicalAssociation,PsychologicalClinicalSciencesAccreditationSystem,andmemberoftheAcademy
ofPsychologicalClinicalScience.

USFTampaGraduateCatalog20132014 Psychology(Ph.D.)


249
http://www.cas.usf.edu/
ADMISSIONINFORMATION

MustmeetUniversityrequirements(application,fee,transcripts,GRE/TOEFLscores,seeGraduateAdmissions)aswell
asrequirementslistedbelow.

ProgramAdmissionRequirements
Universityrequirementsplus

apersonalgoalsstatement
threelettersofrecommendation
strongpreferenceforGREVandQscoreseachatthe50
th
percentileorbetter
anupperdivisionundergraduateGPA3.4orbetter.

DEGREEPROGRAMREQUIREMENTS

After completion of all M.A. requirements in Psychology or its equivalent with a minimum GPA of 3.0, the following
requirementsmustbemet:

TotalMinimumHours:12

SuccessfulcompletionofthePh.D.ComprehensiveQualifyingExam(CL,CNS,IO)ormajorareapaper(CL,
CNS).
PSY7980DoctoralDissertation(12)
SuccessfulDefenseoftheDoctoralDissertation

AdditionalinformationisavailableintheGraduateStudentHandbook:
http://psychology.usf.edu/policies/students.aspx

ConcentrationRequirements:

ClinicalPsychology

GraduateBreadthRequirements:
StudentsmusttakeonecourseineachofthethreeBreadthareas:BiologicalAspectsofBehavior,SocialAspects
ofBehavior,andCognitive/AffectiveAspectsofBehavior.

Biologicalaspectsofbehavior
PSB6056PhysiologicalPsychology 3
CLP6937HumanNeuropsychology 3
CLP7379HealthPsychology 3
EXP7099Psychopharmacology 3
EDF6938PediatricPsychopharmacology 3
EXP7099Psychophysiology 3
EXP7099SurveyofNeuroscience 3

Socialaspectsofbehavior
SOP6266Social 3
PSY6266PsychologyofGender 3
EXP7099StressandCoping 3
INP6935OrganizationalPsychology 3
EXP7099SocialandPersonalityDevelopment 3
EXP7099SocialPsychologyofInterpersonalRelationships 3

Cognitiveandaffectiveaspectsofbehavior
EXP6608Cognitive 3
USFTampaGraduateCatalog20132014 Psychology(Ph.D.)


250
http://www.cas.usf.edu/
EXP7099Memory 3
EXP7099Forgetting 3
CLP7379EmotionanditsDisorders 3
CLP7379MoodDisorders 3
EXP7099ImageandMind 3
EXP7099CognitiveNeuroscienceofPerception 3

GraduateResearchMethodsRequirements
Allclinicalstudentsarerequiredtotakeatotaloffourgraduateresearchmethodscourses.

PSY6217ANOVA/Regressionpluslab 4
SOP7265MultivariateStatistics(requivalentoutsideofdepartment)
PSY6217/SOP6266ClinicalPsychometrics(orequivalentoutsideofdepartment)

PlusONEadditionalresearchmethodscourse(3credits).Studentsmaychoosefromthelistofapprovedcourses
below. Students wishing to fulfill this methods requirement with any course not listed below must submit a
requesttotheclinicalfaculty:
SOP6266FactorAnalysis 3
SOP6266StructuralEquationModeling 3
SOP6266MetaAnalysis 3
EXP7099DevelopmentalResearchMethods 3
CLP6937GrantWriting 3
SOP6266ItemResponseTheory 3
SOP6266HierarchicalLinearModeling 3

ClinicalCoreRequirements
ClinicalDidacticCourses:Studentsneedtotakeatleastonefundamentalcourseineachofthethreeareas
(assessment,interventions,andpsychopathology).
CLP6438ClinicalAssessment
CLP7188ClinicalInterventions 4
CLP6166PsychopathologyandItsDevelopment 3

SpecializedTopicCourseRequirements:
Studentsmustalsocompletefourcoursesinspecializationtopicsrelatedtopsychologicalassessment,
intervention,andpsychopathology/dysfunction.Thefollowingcourseswouldfulfillthisrequirement:
CLP6937NeuropsychologicalAssessment 3
CLP6937Preventionscience 3
CLP7379GraduateSeminar:Emotionanditsdisorders 3
CLP7379GraduateSeminar:Mooddisorders 3
CLP7379GraduateSeminar:Eatingdisorders 3
CLP7379GraduateSeminar:Addictions 3
CLP7379GraduateSeminar:HealthPsychology 3
CLP7379GraduateSeminar:NewParadigmsinPsychology 3
CLP7379GraduateSeminar:CulturalDiversity 3
CLP7379GraduateSeminar:AdvancedPsychologicalInterventionSeminar/SpecializedTreatments3
PSY6946AdvancedPsychologicalAssessmentSeminar 3
CLP7379GraduateSeminar:ClinicalScienceSeminar 3

ResearchRequirements:
PSY6971Thesis 6
PSY7980Dissertation 12

InternshipRequirements:
EachstudentintheClinicalProgramisrequiredtocompleteaoneyear,fulltime,APAapproved(orCPAapproved)
internshipinatrainingfacilityapprovedbytheProgram.

ComprehensiveExams/MajorAreaPaperRequirements
USFTampaGraduateCatalog20132014 Psychology(Ph.D.)


251
http://www.cas.usf.edu/
Cognition,Neurosciences,andSocialPsychology

PriortotheComprehensiveExam
TotalMinimumHours:30

CoreRequirements(16hours)
AtleastaBinaminimumoftwoofthefollowing:
CognitivePsychology(3),PhysiologicalPsychology(3),orSocialPsychology(3).

Studentsmaybeallowedtosubstituteanadvancedthreehourcourseforoneorbothofthesecourseswiththe
writtenpermissionoftheCNSAreaDirector.(6totalhours)

TwobasicmethodscourseswithgradesofatleastB:AnalysisofVariance(4)andRegression(4).(8totalhours)

IntroductiontoCNS(2semesters,1houreach)

ConcentrationRequirements(6hours)
Aminimumoftwoseminarsoradvancedcoursesincognition,neuroscience,orsocialpsychologyfromCNSfacultyor,
withwrittenpermissionoftheAreaDirector,relateddisciplineswithgradesofatleastB.

TotalThesisHoursRequired(6hours)
Master'sthesisresearch(minimum6PSY6971Thesis:MastersorPSY6917DirectedResearchcreditsitis
recommendedthatstudentstakethesiscreditsinordertoretaintheoptionofapplyingforamastersdegree).

DoctoralRequirements(inadditiontotherequirementsfortheM.A.degree)(33morehours)

Electiverequirements(21hours)
Completionofatleastfouradditionalseminarsoradvancedcoursesthatarerelevanttothestudentsareaofresearch
specialization. Of the six courses that are the required minimum for the doctorate (2 before admission to doctoral
candidacy), at least three must be offered in the Psychology Department. Students may substitute the third core
course(Cognitive,Physiological,orSocial)foroneofthesixwiththewrittenpermissionoftheAreaDirector.Atleast
two of the courses must be outside the students concentration and will serve as the minor. These fulfill the minor
requirementandmustbeapprovedbytheGraduateProgramCommittee.

* Completion of at least three additional advanced methods courses. These fulfill the tools of research requirement,
which must be approved by the Graduate Program Committee. Methods courses are those that deal primarily with
researchdesign,datacollectiontechniques,quantitativeorqualitativeanalyticmethods,orinstrumentation.

Comprehensive/QualifyingExamRequirements
Studentsmustpassacomprehensiveexaminationormajorareapaper.

*Admissiontodoctoralcandidacy.
*PSY7980Dissertation(minimumof12dissertationcredits).

IndustrialOrganizationalPsychology
EXP6608CognitivePsychology 3
SOP6709TopicsinSocialPsychology:Personality 3
SOP6068PersonalityandSocialPsychology 3
INP6935PersonnelPsychology 3
INP6935OrganizationalPsychology 3
PSY7931EthicsandProfessionalProblems 3
INP7097ResearchinI/OPsychology 1(2times)
SOP6709TopicsinSocialPsychology:Psychometrics 3
PSY6217ANOVAMultipleRegression 4
SOP6709TopicsinSocialPsychology:OrganizationalResearchMethods 3

USFTampaGraduateCatalog20132014 Psychology(Ph.D.)


252
http://www.cas.usf.edu/
PSY6971Thesis:Masters 6

InadditiontotherequirementsfortheM.A.degree:
2additionalelectivegraduatemethodscourses(3hourseach)
7additionalelectivegraduatecourses(3hourseach)
2graduatecourseminor(3hourseach)workdoneoutsideofstudentsconcentration
6monthparttime,3monthfulltimeinternship
SubmissionofM.A.thesisorequivalenttoconferenceorjournal
Comprehensive/qualifyingexamination

PSY7980Dissertation:Doctoral 12

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 PublicAdministration(M.P.A.)


253
http://www.cas.usf.edu/
PUBLICADMINISTRATIONPROGRAM

MasterofPublicAdministration(M.P.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 44.0401
Dept.Code: SPF
Program(Major/College): PADAS

Concentrations:
ExecutiveMPAConcentration(EPA)
Alsoofferedas:
ADoctoralMinorinPublicAdministration

CONTACTINFORMATION

College: ArtsandSciences
Department: SchoolofPublicAffairs

ContactInformation: www.grad.usf.edu

OtherResources:
www.spa.usf.edu TraditionalProgram
http://onlinempa.usf.edu/Exec.MPAConcentration

PROGRAMINFORMATION

The Public Administration Program offers a multidisciplinary course of study leading to the Master of Public
Administration (M.P.A.). The M.P.A. degree is designed primarily to prepare students for successful leadership roles
and management careers in the public (i.e., governmental and quasigovernmental organizations) and nonprofit
sectors. Students enrolled in the M.P.A. Program pursue careers in local, state, or federal agencies of government,
nonprofit organizations, and special service districts. Additionally the M.P.A. degree prepares individuals for further
academicstudyleadingtoadoctorateinPublicAdministration,aPh.D.inPublicPolicyandAdministration,aswellasa
varietyofotherdisciplines.ThoseemployedinpublicmanagementpositionsmaywishtopursuetheM.P.A.inorderto
broaden educational backgrounds to prepare for increased job responsibilities, or to change career paths. Such in
servicestudentscurrentlymakeupthemajorityoftheM.P.A.studentbody.

ThePublicAdministrationProgramalsoofferscoursesofstudyleadingtoaGraduateCertificateinPublicManagement
(G.C.P.M.), Graduate Certificate in Research Administration (G.C.R.A.) and Graduate Certificate in Nonprofit
Management (G.C.N.M.). These programs are designed for individuals who wish to acquire knowledge of public and
nonprofitmanagementtheoryandpractices,butwhodonotfinditnecessaryorfeasibletopursuetheM.P.A.degree.
The M.P.A. Program also servespreservice students who have recently completed a bachelors degree, who wish to
gainentrytoaprofessionalcareertrack.StudentsadmittedtotheM.P.A.arenoteligiblefortheGraduateCertificate
inPublicManagement.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools; the National
AssociationofSchoolsofPublicAffairsandAdministration(NASPAA).

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
USFTampaGraduateCatalog20132014 PublicAdministration(M.P.A.)


254
http://www.cas.usf.edu/
Admission decisions to the M.P.A. Program are based on an overall assessment of the applicant's potential for
successfullycompletingtheM.P.A.degree.GeneraladmissioncriteriaincludescoresobtainedontheGraduateRecord
Examination(GRE),performanceasanundergraduate.
Specificcriteriaare:

CompletionofaBachelor'sdegreefromaregionallyaccrediteduniversity.

TheUniversityofSouthFloridarequiresa3.00(B)gradepointaverage(calculatedusinggradesearnedforall
courseworkcompletedduringjuniorandsenioryearsofundergraduatestudy),andGREscoresof60
percentileoraboveontheverbalportion,25percentileoraboveonthequantitativeportionand4.0or
aboveontheanalyticalportionpreferred.Thisprovisionappliestoallapplicants,includingthosewhohave
alreadycompletedcoursesintheMPAcurriculum.RegardlessofGPA,thosewhoscorebelow20percentile
oneithertheverbalorquantitativesectionsontheGREarerequiredtoretaketheexam.

Twolettersofrecommendation,onefromafacultymemberfamiliarwiththeapplicant'sacademic
performanceandpotential.Shouldtheapplicantbeunabletoprovidetheletterfromaformerprofessor,
withthedirector'sapproval,lettersfromothersourceswillbeaccepted.

Thesubmissionofaonepagecareerstatementdetailingtheapplicant'scareergoalsandaspirations,
includingwaysinwhichtheapplicantbelievestheM.P.A.degreecanhelptofacilitatethestatedgoals.

ApprovalbytheM.P.A.AdmissionsCommitteeand,ifdeemednecessary,anadmissionsinterview.
ApplicantslackingthebackgroundnecessaryforgraduatestudyintheM.P.A.Programmaybeaskedtotake
additionalundergraduatecoursespriortoadmission.

TheGREisarequiredelementforMPAadmission.However,atthediscretionoftheMPAprogram,itmaybe
waivedundercertainconditions.ExampleswhereGRErequirementsmaybewaivedinclude:

o Applicantalreadypossessesagraduatedegreefromaregionallyaccrediteduniversity

o Awrittenapplicationbythestudentandacurrentresumeindicatingseniorlevelexperience

o Fiveyearsormoreofpractical,professionalexperienceataseniorlevel(tobedeterminedupon
reviewofdocumentationbytheadmissionscommittee)

o Documentationofpastexperiencethroughlettersofrecommendationfromseniormanagement,
and

o CompletionoftheGCPMorGCNMcertificateswithagradepointaverageof3.5/4.0orbetterand
nocertificatecoursegradelessthanaB.

o ApprovalofthePublicAdministrationAdmissionCommittee;decisiontobemadeonacasebycase
basis.(Additionaldocumentationandapersonalinterviewmayberequired)

DEGREEPROGRAMREQUIREMENTS

TherearetwooptionsfortheM.P.A.StudentsareineithertheTraditionalM.P.A.trackortheonlineConcentrationin
ExecutivePublicAdministration(EPA).StudentsintheConcentrationcompleteaminimumtotalof36hours;students
inthetraditionalM.P.A.completeaminimumof45hours.

ProgramCoreRequirements(21hours)
PAD6060PublicAdministrationTheoryandPractice 3
PAD6041EthicsandPublicService 3
PAD6227PublicBudgeting 3
PAD6307PolicyAnalysis,Implementation,andProgramEvaluation 3
PAD6703QuantitativeAidsforPublicManagers 3
USFTampaGraduateCatalog20132014 PublicAdministration(M.P.A.)


255
http://www.cas.usf.edu/
PAD6710PublicInformationManagement 3
PAD6275PoliticalEconomyforPublicManagers 3

TraditionalM.P.A.Requirements
Courserequirements:6hours
PAD5700ResearchMethodsinPublicAdministration 3
PAD6417HumanResourcesManagement 3

Electives(1215credithours)
Eachstudentmusttake1215electivecredithoursdependingontheexitoptionchosen.Studentsshouldrefertothe
MPAwebsitehttp://www.cas.usf.edu/pad/index.htmlhttp://www.spa.usf.eduforcoursesapprovedbytheProgram.
StudentsmustmaintainanoverallGPAof3.00orbetterinalloftheircourseworkduringtheprogram.

Internship(6credithours)
Preservicestudentsarerequiredtocompleteasupervisedinternship(PAD6946.InternshipinPublicAdministration)
inagovernmentalornonprofitorganization.Internshipsprovidestudentstheopportunitytogainvaluableexperience
in the public sector, thereby enhancing the academic course of study. Internship credits must be earned while the
student is in residence and before the student has completed regular course work requirements. Exceptions to this
rulecanonlybemadebytheM.P.A.Directorandmustbemadeinadvance.Inservicestudents,whohaveappropriate
managerial/work experience commensurate with their career goals, may not be required to complete an internship.
Afterconsultationwiththestudent,theM.P.A.Directormaychoosetowaivetheinternshiprequirement.

ExitRequirements
CapstoneCourse(3credithours)
PAD6056, The Practice of Public Management, is a final step before graduation. The course is designed to
providestudents with the opportunity to apply their knowledge, leadership, communication, and decisionmaking
skillsacquiredduringtheMPAProgram.Thiscourseisdesignedtochallengestudentstodemonstratetheircapability
in synthesizing and integrating conceptual frameworks, and relate these skills to managerial or administrative
situations. To be eligible for the Capstone course, students must be in their last semester or have completed a
minimum of 13 courses. A minimum grade of Bmust be earned in the Capstone Course. Students who transfer
before completing all of the requirements forthe MPA at USF will need to enroll intoa capstone class at another
NASPAAaccreditedinstitutionwithpriorapprovalprovidedbytheDirectorofPublicAdministration.AnIndependent
ResearchclasscannotbesubstitutedforPAD6056ThePracticeofPublicAdministration.

ConcentrationinExecutivePublicAdministration(EPA) 12hours
Contactinformation:http://onlinempa.usf.edu/

TheConcentrationinExecutivePublicAdministrationisavailabletostudentswithsignificantexecutivelevel
experiences and substantial future leadership potential. This program is only offered on an online basis.
Students admitted to the M.P.A. in Public Administration with a Concentration in Executive Public
Administrationareadmittedonlyonacohortbasis.

Admittedstudentsareexpectedtoremainintheircohortthroughouttheirgraduatematriculation.Executive
Public Administration students, once admitted, may not transfer into the Traditional Master of Public
Administrationdegreeprogramortakecourseworkacrossthesetwotracks.

TheConcentrationinExecutivePublicAdministrationalsorequiresthecompletionofanexitcapstonecourse
requirement(thatis,thecohortsPAD6056:ThePracticeofPublicManagement).

ExecutivePublicAdministration(Cohort)Requirements:
PAD6134ProjectManagement/Evaluation 3
PAD5836ComparativePublicAdministration 3
PAD6934SeminarinCollaborativeGovernance 3
PAD6934SeminarinExecutiveLeadership 3

USFTampaGraduateCatalog20132014 PublicAdministration(M.P.A.)


256
http://www.cas.usf.edu/
DoctoralMinorinPublicAdministration
Studentsenrolledindoctorallevelcoursesofstudyinotherprograms(e.g.,Anthropology,Psychology,Education)can,
with their programs approval, complete a doctoral minor in Public Administration. Students should complete a
minimumoffourgraduatepublicadministrationcoursestobedeterminedwith theadviceandconsentofanM.P.A.
facultymemberorM.P.A.Director.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 ReligiousStudies(M.A.)


257
http://www.cas.usf.edu/
RELIGIOUSSTUDIESPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

Dept.Code: REL
CIPCode: 38.0201
ProgramLevel: Masters

CONTACTINFORMATION

College: ArtsandSciences
Department: ReligiousStudies

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

MinimumTotalHours: 36
Program(Major/College): RELAS

PROGRAMINFORMATION
TheM.A.degreeinReligiousStudiesprovidesopportunitiesforstudentswithbackgroundsinthescholarlystudyof
religiontoexpandtheirknowledgeofthesocial,cultural,intellectual,andhistoricalcontextsofreligion,todevelopa
greaterindepthknowledgeofparticularreligioustraditions,andtoacquireproficiencywithavarietyofpertinent
methodologiesandtheoreticalperspectives.Thedegreeservestheneedsofstudentswhopursuecareersinhealth
professionsineducation,journalism,law,business,politics,andsocialwork.Itwillbeofspecialvaluetothose
interestedinpursuingadoctorateinreligiousstudies.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:BiblicalStudies,BiblicalArchaeology,Christianity,Judaism,Mysticism,PhilosophyofReligion,
Buddhism,Daoism,Confucianism,Hinduism,ChineseMedicine,ReligioninCultureandSociety,AfricanReligion,
AfricanAmericanReligion,AfroCaribbeanReligion.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus:

Three(3)lettersofrecommendation,and
Awritingsample
Apersonalstatement(13pages,doublespace)
GRErequired,butnominimumspecified

DEGREEPROGRAMREQUIREMENTS

Studentsselecta major professor and developa plan for completing a minimumof36credithours.Thethesistrack


requires six (6) of these creditsbe devoted to a thesis project. The nonthesis track requires that all 36 credits come
from graduate seminars. The plan of study is subject to approval of the Graduate Committee. A majority of these
USFTampaGraduateCatalog20132014 ReligiousStudies(M.A.)


258
http://www.cas.usf.edu/
courses will be in religious studies, although the plan may include approved courses in other departments. No more
than 6 credit hours of 4000level courses may be counted for graduate credit. There is no uniform language
requirement; however, language skills may be required for particular areas of study. All students are required to
demonstrateexpertiseinatleasttworeligioustraditions,aswellassatisfactorilycompleteawritten,comprehensive
examinationwhereintheydemonstratecompetencein:

1) pertinenttheoreticalissuesandresearchmethodologies;
2) theanalysisandinterpretationofrelatedtexts,artifacts,andactivities;and
3) socialandhistoricalcontextsofthereligionsstudied.

The Department of Religious Studies Graduate Student Handbook should be consulted for additional information
aboutbasicrequirementsandspecificprocedures.

TotalMinimumhours 36hours
CoreRequirements(15hours)
RLG6035TheoryandMethodsinReligiousStudies 3
Six(6)hoursofcoursesinWesternReligions(Christianity,Judaism,orIslam) 6
Six(6)hoursofcoursesinEasternReligions(Hinduism,Buddhism,Daoism,orConfucianism) 6

Electives(1521hours)
Nomorethansix(6)hoursmaycomefromindependentstudy/directedreading.
Nomorethansix(6)hoursmaycomefromclassesbelow6000level.
Nomorethansix(6)hoursmaycomefromdepartmentsotherthanReligiousStudies.

Thesis/NonThesis
Thesis
ThestudentwishingtoreceiveanM.A.degreewithathesisisrequiredtotakeaminimumof36credits.Theywill
completethecorerequirementsandfifteen(15)hoursofelectivecredits.Theywillalsocompleteaminimumof
six(6)creditsofREL6971.Thestudentwillpassacomprehensiveexampriortodefendingthemastersthesis.
Theywillresearch,write,andsuccessfullydefendthemastersthesisbeforeacommitteeofthreeprofessors.

NonThesis
ThestudentwishingtoreceiveanM.A.degreewithoutathesisisrequiredtotakeaminimumof36credits.The
willcompletethecorerequirementsandtwentyone(21)hoursofelectivecredits.Thestudentwillalsopassa
comprehensiveexam.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 ReligiousStudies/Education(M.A.)


259
http://www.cas.usf.edu/
RELIGIOUSSTUDIES/EDUCATIONPROGRAM

DualDegreeProgram
MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Closedfornewadmissions

MinimumTotalHours: n/a
ProgramLevel: Masters
CIPCodes: 38.0201
Dept.Code: REL
Program(Major/College): RELAS
CONTACTINFORMATION

Colleges: ArtsandSciencesand
Education
Departments: ReligiousStudies

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

Currently,nostudentsarebeingadmittedtothisprogram.
USFTampaGraduateCatalog20132014 SecondLanguageAcquisitionandInstructionalTechnology
(SLAIT)(Ph.D.)


260
http://www.cas.usf.edu/
SECONDLANGUAGEACQUISITIONAND
INSTRUCTIONALTECHNOLOGY(SLAIT)PROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Falladmissiononly

InternationalapplicantsnotintheU.S.:
Fall: February1
Falladmissiononly

InternationalapplicantscurrentlyintheU.S.:
Fall: February15
FallAdmissionOnly

MinimumTotalHours: 74
ProgramLevel: Doctoral
CIPCode: 13.401
Dept.Code: EDI
Program(Major/College): DLTEJ

CrosslistedundertheCollegeofArtsandSciences,the
CollegeofEducation,andtheInterdisciplinaryPrograms
Sections.

CONTACTINFORMATION

Colleges: Educationand
ArtsandSciences
Department: SecondaryEducation

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

This is an interdisciplinary program between the College of Education and the College of Arts and Sciences and
combines the expertise of both faculties to provide a curriculum in pedagogy, world language education, second
language acquisition, sociolinguistics, sociocultural theory, instructional technology, statistics, and research design.
Thegoaloftheprogramistopreparestudentsforcareersinacademia.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
SecondLanguageAcquisition,InstructionalTechnology,ForeignLanguageEducation,ESOL,DistanceLearning.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

AdmissionRequirements
Inadditiontothegeneraladmissionrequirementsundertheadvancedgraduateeducationprograms,applicantsmust:

Submit a Statement of Purpose relating their career goals specifically to this doctoral program and
describingtheirexperiencewithinstructionaltechnologyandlanguageteaching;
Supplyacurrentcurriculumvitae;
Provide3lettersofrecommendationfromprofessorsorotherindividualswhocanattesttotheapplicants
experienceandbackground;
USFTampaGraduateCatalog20132014 SecondLanguageAcquisitionandInstructionalTechnology
(SLAIT)(Ph.D.)


261
http://www.cas.usf.edu/
Offerevidenceofresearchexperienceorscholarlypromise;
Meetwiththegraduatefacultyforapersonalinterview;
Take a twohour background assessment to assist faculty in planning the prospective students program of
studies.

Moststudentsadmittedtothisprogramwill:

PossessaMastersdegree(orequivalentacademiclevel)fromaregionallyaccreditedinstitutionorits
internationalequivalent;
presentaminimumGPAof3.50(orinternationalequivalent);
scoreatorabove500ontheGREverbalreasoningand4ontheGREanalyticalwritingsection;

SubmitaTOEFLscoreofminimum550(paperbased),213(computerbased),or80(internetbased),ifapplicable.

Programevaluateseachapplicantsdossierbasedonacompositeofvariablesandappropriatenessoffitwiththe
program

Forinternationalapplicants
ApplicantswhosenativelanguageisnotEnglishorwhohavenotearnedadegreeinthe
United States must also submit TOEFL scores earned within two (2) years of the desired term of entry. A minimum
totalscoreof79ontheinternetbasedtest,or550onthepaperbasedtest,arerequired.Applicationssubmittedwith
TOEFL scores that do not meet the minimum requirements will be denied. TheTOEFL requirement may be waived if
theapplicantmeetsoneofthefollowingconditions:

TheapplicantsnativelanguageisEnglish,or
Hasscored500orhigherontheGREVerbalTest,or
HasearnedacollegedegreeataU.S.institutionofhigherlearning,or
HasearnedacollegedegreefromaninstitutionwhoselanguageofinstructionisEnglish(mustbenotedon
thetranscript),or
Hasscored6.5onInternationalEnglishLanguageTestingSystem(IELTS)http://www.ielts.org/.

In addition to these university requirements, applicants to the College of Education must provide the
following:
Anexternal,coursebycourseevaluationoftheforeigndegreebyanapprovedexternalagency,
andbasedonofficialtranscripts;
Asocialsecuritynumberindegreeprogramsrequiringpracticaorinternships;
Otherinformationasrequiredbytheprogramofinterest(e.g.GraduateRecordExamscores,
etc.).

DEGREEPROGRAMREQUIREMENTS

Prerequisites:
(Theprerequisitecoursesarebasedontheneedsoftheindividualstudent;theyarenotcountedtowardsthe44
hours of required core course work. No minimum or maximum number of prerequisites must be taken. Their
selection quantity is reviewed by the student in consultation with his/her SLA/IT supervisory committee chair
prior to the students first semester of study, and is begun during the first year. Please refer to the Program of
Studyat:
http://www.coedu.usf.edu/slait/programStudy.htm

PrerequisiteCoursework
LIN5700AppliedLinguistics 3
FLE6665CurrentTrendsinForeignLanguageEducation 3
LIN6720SecondLanguageAcquisition 3
LIN6081IntroductiontoGraduateStudies 3
TSL5371MethodsofTESOL 3
TSL5372ESOLCurriculumandInstruction 3
USFTampaGraduateCatalog20132014 SecondLanguageAcquisitionandInstructionalTechnology
(SLAIT)(Ph.D.)


262
http://www.cas.usf.edu/
EME5403ComputersinEducation 3
TSL5471LanguageTesting 3
FLE4314/5313orFLE4333/5331MethodsofTeachingForeignLanguages 3

ProgramofStudy: 74hoursminimum
44hoursofcorerequirements(withsuggestedcredithoursfordifferentsubcategories);
12credithoursofelectives;
18hoursofdissertationwork.
Seeeachsection(immediatelybelow)forspecificinformationandcoursesuggestions.

CoreRequirements: 44hours

Statistics/Measurement/ResearchDesign: 14hoursminimum
EDF6407StatisticalAnalysisofEducationI 4
EDF7408StatisticalAnalysisofEducationII 4

andeither
EDF7477QualitativeResearchIand 4
EDF7478QualitativeResearchII 4
or
EDF7410DesignforSystematicStudiesinEducationand 4
EEX7743PhilosophiesofInquiryor 3
EDG7931IntroductiontoQualitativeResearch 3

SecondLanguageAcquisition: 18hours
SLA7776ResearchLab1 2
SLA7776ResearchLab2 2
SLA7776ResearchLab3 14
SLA7776ResearchLab4 14
SLA7776ResearchLab5 12
SLA7776ResearchLab6 12
SLA7938AdvancedSeminarinSLA 3
SLA7939AdvancedSeminarinFLE 3
EDG7931SocioculturalTheoryinSLA 3

InstructionalTechnology: 12hours
EME6936ACETInteractiveMedia 3
FLE6932ApplicationsofTechnologytoSLA/FLE 3
EDF6284ProblemsinInstructionalDesign(prerequisiteforEME6613) 3
EME7938ComputerAugmentedInstructionalParadigms 3
(Surveyofresearchininstructionaltechnology)

Electives: 12hours
Courses(notinclusiveofthese)areselectedwiththeapprovalofthestudentsprogramadvisororcommittee.
Electivecourseworkmustbetakenatthegraduateand/oradvancedgraduatelevel.Selectatotalof12hoursof
electivesfromthefollowingthreegroups(A,B,andC).

GroupA:SecondLanguageAcquisition(69hoursarerequiredfromGroupA)
LIN6018TopicsinTheoreticalLinguistics 3
LIN6117HistoryofLinguisticThought 3
LIN6601Sociolinguistics 3
LIN6748ContrastiveAnalysis 3
LIN6931WritingProcessesinSLA 3
EDG6931HeritageLanguageTeaching&Learning 3
LIN6932DiscourseAnalysis 3
FLE6932DualLanguageinEducation 3
USFTampaGraduateCatalog20132014 SecondLanguageAcquisitionandInstructionalTechnology
(SLAIT)(Ph.D.)


263
http://www.cas.usf.edu/
EDG7931AdvancedSeminarinHeritageLanguageTeaching&Learning 3

GroupB:Technology
EME6613DevelopmentofTechnologyBasedInstruction 3
EME6930PLE:FLASH 3
EME6930PLE:WebProgrammingI 3
EME6936ACET:DigitalVideo 3
EME6936ACET:InstructionalGraphics 3
EME6936ACET:CurrentTrendsinEdTechnology 3
EME6936ACET:WebDesign 3
EME7939ResearchMethodsinTechnologyBasedEducation 3
(EDF7410asprerequisite)
EME7458ResearchinDistanceLearning 3
EME7631ResearchinTechnologyProjectManagement 3
EME6936InternetinEducation 3

GroupC:Education,Anthropology,Psychology
EXP6643PsychologyofLanguage 3
EDF7145EducationalPsychology 3
EDF6883IssuesinMulticulturalEducation 4
EDF7586ClassicsinEducationalResearch 4
EDF7934SeminarinSocialFoundationsofEducation 4
EDF7692IssuesinCurriculumandInstruction 3
EDG7931PracticuminTeacherEducation 3
EDG7931CurriculumFrameworksinTeacherEducation 3
ANG6766SeminarinAnthropologicalLinguistics 3

Dissertation: 18hours
SLA7980SLAITDissertation 18

QualifyingExamination:
All students will be required to pass a written qualifying examination (QE). The QE integrates work in the specialization,
cognate, and foundations areas, in this case, in Second Language Acquisition, Instructional Technology, and Teacher
Education.

Residencyrequirements:
Students must enroll in a minimum of 9 hours for each of two semesters in a 12 month period to fulfill the residency
requirements. Students in the Ph.D. program should be engaged in no more than halftime employment during the
residencyperiod.

Please be advised that program and/or course requirements are subject to change, per state legislative mandates of the
FloridaDepartmentofEducationprogramapprovalstandardsandaccreditationcriteria.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Sociology(M.A.)


264
http://www.cas.usf.edu/
SOCIOLOGYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 45.1101
Dept.Code: SOC
Program(Major/College): SOCAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Sociology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheSociologyM.A.programprovidesafoundationinabroadrangeofsociologicaltheoriesandresearchmethodsand
an opportunity for pursuing specialized interests in elective Sociology courses, courses in other departments, and
thesisresearch.ManyofourM.A.recipientscontinueinsociologyPh.D.programs.Othersteachinsecondaryschools
and junior colleges, are employed in mental health services and research, in human resources management, and
governmentorganizations,orworkasresearchconsultantsandmarketanalysts.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:
Community and Identity Studies, Cultural Sociology, Social Psychology, Emotions, Family, Sex and Gender,
Race/Ethnic/MinorityRelations,Religion,DeviantBehavior/SocialDisorganization,ScienceandTechnology,Qualitative
Methodology

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus:

threelettersofrecommendation
personalstatement
awritingsamplethatdemonstratesstrongscholarlyresearch
GRErequiredpreferredscoresof153V(500V),144Q(500Q)
OfficialTranscripts
TOEFL.ApplicantswhosefirstlanguageisnotEnglishmustalsosubmitascoreofatleast600ontheTestsof
EnglishasaForeignLanguage(TOEFL).
USFTampaGraduateCatalog20132014 Sociology(M.A.)


265
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 36

TheSociologyDepartmentrequiresathesisforthecapstonecourse.Sixoftherequired36hoursaretakenasthesishours.

CoreRequirements(9hours)

SYA6126ContemporarySociologicalTheory 3
SYA6305MethodsofResearch 3
SYA6405SociologicalStatistics 3

Electives(21hours)
The21hoursofelectivesmustincludeatleast12hoursinscheduledgraduatecoursesinSociology).Withapprovalof
theGraduateDirector,astudentmaytransferuptosix(6)hoursofcreditfromanotheruniversityorupto12hoursof
credit taken as a nondegree seeking student at USF. With Graduate Directors approval, up to nine (9) hours of
electivecreditmaybetakeninadepartmentotherthanSociology.

Thesis(6hours)
SYA6971 6credithours

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Sociology(Ph.D.)


266
http://www.cas.usf.edu/
SOCIOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15

MinimumTotalHours: 60(postmasters)
ProgramLevel: Doctoral
CIPCode: 45.1101
Dept.Code: SOC
Program(Major/College): SOCAS

CONTACTINFORMATION

College: ArtsandSciences
Department: Sociology

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Note:meetingtheseminimumrequirementsdoesnotguaranteeadmissionintotheprogram.
Applicantsmusthave:

GRE.Apreferredminimumscoreof600verbaland500quantitative
Threelettersofreference
PersonalStatement
ExampleofWrittenWork
GRERequiredpreferredscores150V(600V),144Q(500Q)

DEGREEPROGRAMREQUIREMENTS

The60credithourminimumpostM.A.programisasfollows:

PreRequisites/M.A.Requirement 36hours
ResearchMethods
Statistics
SociologicalTheory
ElectiveCourses(21hours)
Thesis(6hours)

InterdisciplinaryCore 6hours
InterdisciplinaryProfessionalSeminar(requiredasafirstcourseforallstudents)
CapstoneInterdisciplinarySeminar(Requiredasafinalcourseforallstudents)

DisciplinaryRequirements 6hours*
SYA7515AdvancedResearchMethodsandStudyDesign 3
SYA7019AdvancedSociologicalTheory 3
USFTampaGraduateCatalog20132014 Sociology(Ph.D.)


267
http://www.cas.usf.edu/

SpecialtyResearchMethodscourse 3hours
Aresearchmethodscourseinanydisciplinechoseninconsultationwithadvisor

ElectiveswithinSociology 9hours
Sociologygraduatecourseschoseninconsultationwithadvisor

InterdisciplinaryElectives 12hours
CoursesinatleasttwodepartmentsoutsideSociologychoseninconsultationwithfacultyadvisor.

DissertationProposalPreparation 6hours

Dissertation 18hours
SYA7980Dissertation

TotalCreditHours(beyondtheM.A.) 60hours

OtherRequirements

ComprehensiveExam
*Note: Students also are required to complete a comprehensive exam upon completion of the 9credit core
requirements.Theexamwillmeasuretheoreticalandmethodologicalknowledge,preparationforfurthercoursework,
andabilitytosuccessfullydefendadissertationproposal.Dissertationproposaldefensewilloccuraftertheremaining
electiverequirementsanddissertationproposalpreparationrequirementshavebeencompleted.

GraduateRequirements
AminimumcumulativegraduateGPAatUSFof3.00andsuccessfulcompletionanddefenseofaPh.D.comprehensive
exam,dissertationproposal,anddissertation.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Spanish(M.A.)


268
http://www.cas.usf.edu/
SPANISHPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 16.0905
Dept.Code: WLE
Program(Major/College): SPAAS

CONTACTINFORMATION

College: ArtsandSciences
Department: WorldLanguages

ContactInformation:www.grad.usf.edu
OtherResources: www.usf4you.usf.edu
www.cas.usf.edu/languages/

PROGRAMINFORMATION

TheHispanic/LatinoareaoftheDepartmentofWorldLanguagessupportsabroad,intellectuallydrivenapproachto
teachinglanguage,cultureandliteratureinhighereducation.Languagesandculturesarecomplex,multifunctional
phenomenathatlinkanindividualtootherindividuals,tocommunitiesandtonationalcultures.Thegraduateprogram
inSpanishoffersstudentsacademicandpracticaltraininginthelanguages,literaturesandculturesoftheSpanish
speakingcommunitiesofSpain,LatinAmerica,andtheUnitedStates.StudentswhoreceiveaMastersofArtsin
SpanishfromtheDepartmentofWorldLanguageEducationatUSFbecomewelleducatedcommunicatorswithdeep
translingualandtransculturalcompetence.Thus,theyareexceptionallypreparedtoeithercontinuestudiesleadingto
thePh.D.,orfindcareersinrelatedfieldssuchastheteachingprofession,translation,governmentandcivilserviceand
agencies,legalandparalegalservices,orforeignanddomesticbusinessenterprises.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Studentsmusthave,submit,andcompletethefollowing:

Anundergraduate3.0GPA
23lettersofrecommendation,
AtwopagestatementofpurposesinSpanish.
AnoralinterviewinSpanish(canbedonebyphone)
IfdegreeisfromabroadstudentmustpassTOFEL.Ascoreof213forcomputerbasedtest,or79forinternet
basedtest,or550forpaperbasedtest.
Approvalfromtheprogramdirectorincaseofdegreefromanotherdiscipline

USFTampaGraduateCatalog20132014 Spanish(M.A.)


269
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS
TotalMinimumHours 36

CoreRequirements

FOW6085,Bibliography 1

Students must have taken, or plan to take, an Introduction to Hispanic Linguistics course, or equivalent, prior to or
duringtheirMAstudiesinSpanish.ThisrequirementmustbefulfilledbeforetakingtheMAcomprehensiveexam.

Courses35hours
Selectcoursesfrom
SPW5135ColonialSpanishAmericanLiterature 3
SPW5355SpanishAmericanDramaandPoetry 3
SPW5387SpanishAmericanProse 3
SPW5388GoldenAgePoetryandDrama 3
SPW5405MedievalLiterature 3
SPW546519
th
CenturyLiterature 3
SPW5605Cervantes 3
SPW5725Generationof1898 3
SPW5726VanguardLiterature19181936 3
SPW5934SelectedTopics 3
SPW6427GoldenAgeNovel 3
SPW6485PostCivilWarLiterature 3
SPW6775CaribbeanLiterature 3
SPW6910DirectedResearch 119

OrStudentsmayalsotake2730semesterhoursinSpanishand69semesterhoursinanotherrelatedarea,asapproved
byGraduateDirector.Two4000levelcourses(BA)cancounttowardsthedegreeprovidedthestudentisenrolledintheMA
programorhadapriorarrangementwiththeGraduateDirector.

AreasofEmphasis
Selectoneoftheareasofemphasisbelow:

EmphasisOptionA: LanguagesandCultures
Refertocorerequirementsabove.
Nonthesisoption.

EmphasisOptionB: LiteraturesandCultures
Inadditiontocorerequirementsabove:

Proficiency in a second foreign language. The second foreign language requirement can be satisfied by having
completedthesecondsemesterofalanguageotherthanSpanishwithinthelasttwoyears,orbytakingaplacement
test and placing into level III of that language, or by taking the second semester of another language other than
SpanishwhilepursuingtheSpanishMasters.Inspecialcases,atranslationandbrieforalinterviewcanbearrangedin
placeoftheserequirements.

Thesis(6hours)
SPW6971
StudentsarestronglyencouragedtoundertakeMAthesiswork.Ifastudentselectsthisoption,he/shemustcomplete
27semesterhoursofSPN/SPW50006000levelcourses(or2124semestershoursinSpanishand69semesterhours
in another related area, as approved by the Graduate Director.) Two 4000 level courses (BA) can count towards the
degree,providedthestudentisenrolledintheMAprogram,orhadapriorarrangementwiththeGraduateDirector.In
addition,6semesterhours(SPW6971),towardscompletionofMAthesis,mustbecompleted

ComprehensiveExam
USFTampaGraduateCatalog20132014 Spanish(M.A.)


270
http://www.cas.usf.edu/
Successful completion of a Comprehensive Exam at the end of coursework (typically in the second semester of the
secondyear).ThisexamisbasedontheMAreadinglist.

OTHERINFORMATION

The Summer M.A. program: Students may also receive the M.A. in Spanish by enrolling in courses at the Tampa
campusduringthesummer,whenevercoursesareavailable..Generallythedegreeisreceivedafterthreesummersof
study.ContacttheGraduateProgramDirectorfordetails.

SpecialSummerProgramsOverseas
TheDivisionofLanguagesandLinguistics,incooperationwiththeInternationalAffairsCenter,offersseveralsummer
study programs overseas. These include study in Argentina, Spain, and Costa Rica. For complete details, contact the
programadvisorsortheInternationalAffairsCenter.

ToobtainacopyoftheMastersofArtsinSpanishhandbook,pleasevisittheWorldLanguageDepartmentinCPR419.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 Statistics(M.A.)


271
http://www.cas.usf.edu/
STATISTICSPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
ForTeachingAssistants,InternationalandFinancialAid
Applicants:
Fall: February1
Spring: August1

For Domestic applicants (US citizens or permanent


residents) without financial aid or Teaching Assistant
applicants:
Fall: February15
Spring: October1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 27.0501
Dept.Code: MTH
Program(Major/College): STCAS

CONTACTINFORMATION

College: ArtsandSciences
Department: MathematicsandStatistics

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
TobeadmittedforgraduatestudyintheStatisticsprogram,

Studentsshouldhaveatleast3.50GPAaverageincoursestakenduringthelasttwoyearsoftheir
undergraduateorgraduatestudies.
StudentsmusthaveaBAorBSinoneofthefollowingareas:Statistics,Mathematics,PhysicalSciences,
Engineering,orBusiness.
Studentswhoexpecttospecializeingraduateworkinstatisticsareadvisedtostudyasmuchmathematicsas
possibleduringtheirundergraduateyears.Someinterdisciplinaryexperienceinnaturalsciences,
engineering,economics,orpsychologyisalsohighlydesirable.Studentswhodonothaveatleastthree
semestersofsuccessfulcourseworkincalculuswillberequiredtocompleteadditionalcoursesin
mathematicsbeforebeingadmitted.Priorcourseworkinadvancedcalculusandinstatisticsispreferable,
butnotmandatory.
GREisrequiredwithaquantitativescoreofatleast650requiredforadmission.Studentswhosenative
languageisnotEnglishmustscoreatleast550(paperbased)oratleast79(internetbased)ontheTestof
EnglishasaForeignLanguage(TOEFL)exam.However,forstudentswhohaveaBAorhigherdegreefroman
accreditedU.S.institutionthatrequirementiswaived.
USFTampaGraduateCatalog20132014 Statistics(M.A.)


272
http://www.cas.usf.edu/
InternationalstudentswhosenativelanguageisnotEnglishmustsubmitsatisfactoryscoresontheTestof
SpokenEnglish(TSE)ortheSPEAKtesttobeeligibleforteachingassignments.Studentswhoscore50or
aboveontheSpeakTestareallowedtoteachintheclassroom.Thosewhoscore45to50areallowedto
teachontheconditionthattheyenrollconcurrentlyinENS4502.(SeetheGraduateCatalogformore
details.)
The University of South Florida and the Department of Mathematics and Statistics encourage applications from
qualified individuals with disabilities and qualified individuals from all cultural, racial, religious, ethnic, and gender
groups,andsexualorientationsinaccordancewithalluniversityregulations.
OTHERINFORMATION
The most recent supplementarydocuments for Statistics graduate students, THE HANDBOOKS FOR BOTH M.A. AND
Ph.D. GRADUATE STUDENTS IN STATISTICS/PROBABILITY PROGRAMS, at the Department of Mathematics and
Statistics,UniversityofSouthFlorida,Tampa,Florida,USA,datedOctober2007(revisedOctober2009)areavailableat
thefollowingwebsites:
http://math.usf.edu/grad/stats/ma/
http://math.usf.edu.grad.stats.phd/
ProspectivegraduatestudentsinStatisticsarewelcometoreadtheinformationintheHandbooks.Inaddition,aHARD
COPY OF THESE HANDBOOKS will be provided to graduate students at the time of their FIRST time academic
advisementprocess.
DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 30hours

CoreRequirements

Sequences:
STA5166StatisticalMethods 3
STA6167StatisticalMethodsII 3
STA5326MathematicalStatisticsI 3
MAT6932MathematicalStatisticsII 3
STA6208LinearStatisticalModels 3

Electives:
STA5446ProbabilityTheoryI 3
STA6447ProbabilityTheoryII 3
STA5526NonparametricStatistics 3
STA6746MultivariateAnalysis 3
STA6876TimeSeriesAnalysis 3
MAT6932SurvivalAnalysis 3
MAT6932StochasticProcesses 3
MAT6932StochasticDynamicModeling 3
STA6877TimeSeriesAnalysisII 3
MAT6932NonlinearTimeSeriesAnalysis 3
MAT6908IndependentStudy(asindicatedbyprofessor)
Mat6932SpecialTopicsCourses 3
A candidate must complete at least 30 credit hours for a MA. At least twenty hours must be in formal regularly
scheduled course work, ten of which must be at the 6000 level. Up to 6 credit hours at the 4000 level or graduate
courses from other departments at USF can be counted upon approval. A student who elects the thesis option must
USFTampaGraduateCatalog20132014 Statistics(M.A.)


273
http://www.cas.usf.edu/
register for a minimum of 6 credit hours in MAT 6971, only 6 hours of which may be applied toward the 30hour
degreerequirement.Thestudentmustmaintaina3.00averagetoremainacandidateforadegree.Failuretodothis
will result in being placed on probation. A letter from the major professor is required to remove a student from
probationafterhe/sheregainsa3.00average.
Departmentmaywaivesomeofthecourserequirementsforthosestudentswhohavetakenequivalentcoursework
atanotherinstitution.
ComprehensiveExamination
Graduation from the Masters program also requires the completion of both written and oral examinations. For the
nonthesisoption,thereisnolanguageorthesisrequirementfortheM.A.degree.
Written Comprehensive Examination The written exam is designed to cover material presented during the first
yearofgraduatework.Thepurposeoftheexamistomakesurethestudentshavereviewedtheirfirstyear'swork
beforestartingthesecondyearandtopointoutweaknesseswhichshouldbeovercomeduringtheirsecondyear
in order to graduate. Students are expected to pass this exam in at most two attempts. More specifically, the
materialfortheaboveexaminationwillbetakenprimarilyfromthefollowingsequencesofcourses Semester1:
STA5166StatisticalMethodsIandSTA5326MathematicalStatisticsI;Semester2:STA6167StatisticalMethodsII
andMAT6326MathematicalStatisticsII,andSTA6208LinearStatisticalModels.
A.NonthesisOption
Atleast30hoursofStatisticsandMathematicsgraduatecourses.Specifically:
(A) The Statistics and Mathematics graduate courses of 5000 level or higher, offered regularly for statistics and
mathematicsmajorsfromourdepartmentarecountedtowardsthe30hoursrequirement.
(B)Upto6hoursof4000levelorhighercourses,takenfromourdepartmentorotherdepartmentsatUSF,may
becountedtowardsthe30hoursrequirementwithapprovalbytheStatisticsFaculty.
(C) Completing at least 3 hours of Research Project work which is counted towards the 30 credithours
requirement.
TakingthecourseMAT5912ResearchProject(NonThesisOption)andpresentingapaper
exemplifyingthecreativecomponentofthedegreeprogram..Thismaybe,butisnotrestrictedto,a
literaturereview,areportofindependentresearch,designand(or)analysisofasamplesurveyor
experiment,areportonconsultingwithresearchworkersoutsidethedepartment,orareportonthe
constructionofacomputerprogramrequiringstatisticalnumericalanalysis.
TakingthesequencesStatisticalMethodsandMathematicalStatisticswithatleastaBaveragefor
eachsequence.
PassingoneQualifyingExamonStatisticalMethodsorMathStatisticsatmaster'slevel.
Underthisdegreeoption,thestudentisrequiredtopresentapaperrepresentingthecreativecomponentofthe
degreeprogram.Thismaybe,butisnotrestrictedto,aliteraturereview,areportofindependentresearch,the
designand(or)analysisofasamplesurveyorexperiment,areportonconsultingwithresearchworkersoutside
thedepartment,orareportontheconstructionofacomputerprogramrequiringstatisticalnumericalanalysis.
B.ThesisOption

StudentsGraduateCommittee
Students working toward a thesis degree will have the benefit of a committee of members of the graduate faculty,
appointed by the program director/departmental chairperson and approved by the Dean of Graduate Studies. The
committee will approve the course of study for the student and plan for research, supervise the research and any
comprehensivequalifyingexams,andreadandapprovethethesisforcontentandformat.
USFTampaGraduateCatalog20132014 Statistics(M.A.)


274
http://www.cas.usf.edu/
Atleast30hoursofstatandmathgraduatecourses(seeabovefordetails).
TakingthesequencesStatisticsMethodsandMathematicalStatisticswithatleastaBaveragefor
eachsequence.
Atleast6hoursinMAT6971,Master'sThesis,only6hoursofwhicharecountedinthe30hours
requirement.
OralDefenseoftheThesis
FinalSubmissionofApprovedThesis.
Underthisdegreeoption,six(6)researchcreditsmaybeappliedtothetotalof30requiredonthestudent'sprogram
of study. These reductions are made to allow the student sufficient time to complete a formal master's thesis. A
master'sthesisisascholarlycompositionthatdemonstratestheabilityoftheauthortodoindependentandcreative
work.Itexploresinsomedepthaproblemorissuerelatedtothemajorfieldofstudy.Althoughconsiderablevariations
in format and style are acceptable, precise expression, logical construction, and meticulous attention to detail are
essential.Athesisinstatisticsshoulddealwithsomeaspectofstatisticalmethodologyortheory,orthedevelopment
ofstatisticalmodelsforaclassofproblemsrelatedtoascientificquestion.Whilemosttheseswillincludeacasestudy
or example that involves scientific data, the analysis of a particular data set does not, alone, constitute the level of
scholarlyaccomplishmentrequiredforathesis.
COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 UrbanandRegionalPlanning(MURP)


275
http://www.cas.usf.edu/
URBANANDREGIONALPLANNINGPROGRAM

MasterofUrbanandRegionalPlanning(M.U.R.P.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 48
ProgramLevel: Masters
CIPCode: 04.0301
Dept.Code: SPF
Program(Major/College): URPAS

CONTACTINFORMATION

College: ArtsandSciences
Department: SchoolofPublicAffairs

ContactInformation: www.grad.usf.edu
www.spa.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

The goal of theprogram is to train students tobecome planning practitioners able to work in a variety of public and
private sector environments in a number of different fields. Graduates of this program will go on to play a vital role
addressingtheplanningandpublicpolicychallengesinourregionandbeyond.

The program recognizes the need for effective planners to possess diverse skills in the planning and management of
human settlements. Accordingly, the MURP core coursework includes thematicallyrelated courses in land use
planning, research methods, quantitative analysis, planning theory and history, planning politics and policies, and
geographicinformationsystems(GIS).Studentshavetheoptionofspecializinginhousing&communitydevelopment,
land use planning, local economic development, GIS, international development and transportation planning. These
areasofspecializationbuildonthestrengthsofexistingfacultyinoursisterprograminPublicAdministrationaswellas
colleagues and facilities across the university. The program is therefore distinct for its flexibility. Graduates of the
programwillbeableto:

1. Engageinpolicyrelatedresearchrelevanttourbanandregionalissues
2. Assumepositionsofleadershippublic,privateandnonprofitorganizationsengagedinplanning,landuse,and
publicpolicy
3. Furtherpublicdiscourseontheproblemsconfrontingcitiesandregions
4. Utilizecommunicationsandtechnicalskillstobecomesuccessfulatalllevelsoftheplanningprofession.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Studentsmusthave/submitthefollowing:

BA/BSinanyfieldwithaGPAof3.00ona4pointscale(overalloronlast60hoursofundergraduatework);
Twolettersofrecommendation(onefromafacultymemberifBS/BA,inlast5years);
AletterofintentexplainingyourbackgroundandinterestinUrbanandRegionalPlanning
USFTampaGraduateCatalog20132014 UrbanandRegionalPlanning(MURP)


276
http://www.cas.usf.edu/
havetakentheGREexamwithaminimumscoreofatleast500Vand500Q,takenwithinthelastfiveyears
precedingtheapplicationandthescoresubmittedregardlessoftheGPA.
Either
GRE Scores no more than 5 years old with preferred scores of Q:144, V:153 (500 + 500 prior to August 1,
2011),andAnalyticalWriting:3.5orbetter.
Or
Submitforevaluation,awritingsample(professionalreportorpublishedarticle)&proofofatleast5years
ofrelevanturbanplanningorplanningrelatedexperience;
Or
12credithoursofpriorgraduateworkwithgradesofBorbetterinallcourses.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 48hours

CoreRequirement 21hours

FoundationalCoreCourses 9credithours
URP6100 Planning,Theory,andHistory 3
URP6111 Planning,Policy,andPolitics 3
URP6316 LandUsePlanning 3

AnalyticalMethodsCoreCourses 6credithours
URP6232 ResearchMethodsforUrbanandRegionalPlanning 3
URP6236 Quant.AnalysisinURP 3

PlanningPractice&TechniquesCoreCourses 3credithours
GIS5049 GISfornonmajors 3
URP6930 UrbanPlanningInternship 3*
*requiredforstudentswithout5ormoreyearsofrelevantplanningexperience

Electives 2127hoursminimum
(27hoursrequiredfornonthesisoption;21hoursforthesisoption)

TherestoftherequiredcourseworkallowstheURPstudentanopportunitytospecializeinoneofthesubstantive
fieldsofurban&regionalplanning.Presently,theprogramisequippedtoofferoptionalspecializationsinthefollowing
areas:

Housing&CommunityDevelopment;
Environmental&NaturalResourcePolicy;
GeographicInformationSciences;
Globalization&InternationalDevelopmentPlanning;
TransportationPlanning.

StudentsenrolledintheMURPProgramarerequiredtoselectandspecializeinoneoftheareasidentifiedabove.The
coursesrequiredforspecializationarelistedundereachoftheareasofconcentrationasfollows.Typically,thestudent
willneedtocomplete9coursestofulfillthe27credithourrequirement..

Housing&CommunityDevelopment
URP6812:CommunityDevelopmentPlanning(3cr.);
URP6313:Urban&MetropolitanEconomicDev.Strategies(3cr.);
URP6538:Zoning&LocalEconomicDevelopment(3cr.).
PAD6336CommunityDev.ProgramsandStrategies(3cr.);
POS5159:UrbanPolicyAnalysis(3cr.);
PAD6339:Housing&PublicPolicy(3cr.);
PAD5807:Urban&LocalGovernmentAdministration(3cr.);
USFTampaGraduateCatalog20132014 UrbanandRegionalPlanning(MURP)


277
http://www.cas.usf.edu/
PAD6355:UrbanGrowthManagement(3cr.);
SYD6605:CommunityAnalysis(3cr.);
SYP7111:Communities&Identities(3cr.);
GEO6566:SiteFeasibilityAnalysis(3cr.);
ARC6311:IntroductiontoCommunityUrbanDesign(3cr.);
CGN6933:GreenInfrastructure&SustainableCommunity(3cr.);
SOW6235:FoundationsofSocialWelfarePolicy(3cr.);
SOW6236:SocialWelfarePolicyAnalysis(3cr.).

Environmental&NaturalResourcePolicy
URP6313:Urban&MetropolitanEconomicDev.Strategies(3cr.);
URP6538:Zoning&LocalEconomicDevelopment(3cr.).
GEO6166:PerspectivesonEnvironmentalThought(3cr.);
GEO6178:EnvironmentalApplicationsofGIS(3cr.);
GEO6345:TechnologicalHazards&EnvironmentalJustice(3cr.);
GEO7605:SeminarinUrbanEnvironments(3cr.);
GEO6258/MET6140:Weather,Climate&Society(3cr.);
GIS6306:EnvironmentalApplications(3cr.);
GEO6288:HydrologicalSystems(3cr.);
GEO6286:WaterResources(3cr.);
GIS6306:EnvironmentalApplications(3cr.);
EVR6937:SeminarinEnvironmentalPolicy(3cr.);

GeographicInformationSciences(GIS)
GIS6100:AdvancedGeographicInformationSystems(3cr.);
STA5166ComputationalStatistics(3cr.);
GIS6112:SpatialDatabaseDevelopment(3cr.);
GIS6306:EnvironmentalApplications(3cr.);
GEO6408:Geography&Globalization:RemappingtheWorld(3cr.);
GEO5057:GlobalPositioningSystem;
GEO6119:GeographicalTechniques&Methodology(3cr.);
GEO6566:SiteFeasibilityAnalysis(3cr.);
GEO6159:SeminarinGIS(3cr.);
GEO7605:SeminarinUrbanEnvironments(3cr.);
GIS6038CAdvancedRemoteSensing(3cr.);
GIS6039:ReadingsinRemoteSensing(3cr.)

Globalization&InternationalDevelopmentPlanning
INR5012:Globalization(3cr.);
URP6313:Urban&MetropolitanEconomicDev.Strategies(3cr.);
CPO6036:PoliticsinDevelopingAreas(3cr.);
GEO6209C:GlobalSustainabilityDevelopment(3cr.);
SYA6933:SocialInequalityinaGlobalSociety(3cr.);
ANG6448:RegionalProblemsUrbanAnthropology(3cr.);
GEO6408:GeographyandGlobalization(3cr.);
HIS6939:ColonialismandCulture(3cr.);
SYA7930:Globalization&Cities(3cr.);
SYD6706:GlobalPerspectivesonRace&Ethnicities(3cr.);
SYA6933:SocialInequalityinGlobalSociety(3cr.);
INR6690:ResearchMethodsinGlobalization(3cr.).

TransportationPlanning
URP6313:Urban&MetropolitanEconomicDev.Strategies(3cr.);
TTE5501:TransportationPlanningandEconomics(3cr.);
TTE6651:PublicTransportation(3cr.);
TTE6655:TransportationandLandUse(3cr.);
USFTampaGraduateCatalog20132014 UrbanandRegionalPlanning(MURP)


278
http://www.cas.usf.edu/
CGN6933:LandUseandTransportation(3cr.);
GEO6704:TransportationGeography(3cr.);
GIS6100:AdvancedGeographicInformationSystem(3cr.);
GEO5075:GlobalPositioningSystem(3cr.);
GEO6545:EconomicGeographySeminar(3cr.);
GEO6119GeographicalTechniques&Methodology(3cr.);
ANG6448:RegionalProblemsinUrbanAnthropology(3cr.);
GEO5605:ContemporaryUrbanIssues(3cr.);
GIS6112:SpatialDatabaseDevelopment(3cr.)

ComprehensiveExam
ThisisthedefaultoptionfortheMURPprogram.AllMURPStudentsarerequiredtotakethisexaminationattheend
of, or during, the last semester of the program coursework. The examination is waived for students who elect, and
withtheapprovaloftheprogramdirector,topursuethethesisoption.(seebelowformoreonthethesisoption)

Nonthesis
Nonthesisstudentsmustcompleteallofthe21hourcore,27electivecredits.

Thesis 6hoursminimum
GEO6971Thesis(6hours)
Studentsapprovedtopursuethisoptionmustcompleteallofthe21corecredits,21electivecredits,andaminimum
of6credithoursofthesis.Thethesismustbecompletedandapprovedforthecredittobereceived.

Internship 3hours
URP6940InternshipinUrbanandRegionalPlanning(3)
AllMURPstudentsarerequiredtocompleteatleast180hoursofworkinaplanningagencytoearnthe3credithours
stipulated as part of the core requirements above. . This requirement is waived for students with at least 5 years of
relevantplanningexperience.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 WomensandGenderStudies(M.A.)


279
http://www.cas.usf.edu/
WOMENSANDGENDERSTUDIESPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 05.0207
Dept.Code: WGS
Program(Major/College): WSTAS

CONTACTINFORMATION

College: ArtsandSciences
Department: WomensandGenderStudies
(WST)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you.usf.edu

PROGRAMINFORMATION

TheM.A.inWomensandGenderStudiesrequiresthecompletionof36credithours.Theprogramhasthreetracks:1)
a research option that requires a thesis, 2) an applied option that requires an internship and subsequent analytic
reportontheinternshipexperience,and3)anonthesisoption.Thisformatisdesignedtoservetheneedsofavariety
of different categories of students desiring a graduate degree in Womens and Gender Studies. The thesis option is
recommended for students who intend eventually to pursue a doctoral degree. Either the nonthesis option or the
internshipoptionisrecommendedforstudentswhoseektheM.A.asaterminaldegree.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
SameasgeneraluniversityrequirementswiththeexceptionthatthoseapplicantswithouttraininginWomensStudies
areadmittedonaconditionalbasis.Inaddition,applicantsmustsubmitthefollowingrequirements:

GREscoresarerequired
Apersonalnarrativestatementofpurpose
Awritingsample(appropriateexamplesincludeatermpaperorresearchpaper)
Threelettersofrecommendation

USFTampaGraduateCatalog20132014 WomensandGenderStudies(M.A.)


280
http://www.cas.usf.edu/
DEGREEPROGRAMREQUIREMENTS

TheM.A.inWomensandGenderStudiesrequiresthecompletionofthirtysixcredithours.Thesehoursaredividedas
follows:

ProgramMinimumHours: 36credithours

CoreRequirements 12credithours
WST6001 FeministResearchandMethodology 3
WST6560 AdvancedFeministTheory 3
WST6003 FeministScholarshipandPedagogy 3
WST6936 SelectedTopicsinWomensStudies 3

Electives 18credithours
Tobeselectedfrom
CoursesofferedbytheDepartmentofWomensandGenderStudies,uptosixcr.hrs.ofwhichmaybe4000
levelcourses;
Graduatecoursesonwomenandissuessurroundingtheintersectionofgender/class/race/sexualityoffered
byotherdepartments;
Nomorethanoneothergraduatelevelcourseapprovedbythegraduatedirector.

ComprehensiveExaminations
Eachstudentmustpassawrittencomprehensiveexamination.Itisexpectedthatastudentwillsuccessfullycomplete
thecomprehensiveexaminationpriortobeginningthesisorinternshipwork.StudentselectingtheNonThesisoption
shouldsuccessfullycompletethecomprehensiveexamintheirlastsemesterofcoursework.

TrackRequirements 6credithours
StudentsshouldchoosetheirM.A.trackattheendof18hoursofcoursework.
Sixcredithoursarerequiredoneachtrack.TrackOptionsinclude:

ThesisTrack(6credithours)
WST6971Thesis:Masters
StudentsmustenrollinsixcredithoursofWST6971Thesis:Masters.Takenovertwosemesters,thestudentwill
develop a thesis proposal approved by the students thesis committee and complete a Masters thesis on the
approvedtopic.ThecompletedThesismustbedefendedatanoraldefense.

InternshipTrack(6credithours)
WST5825InternshipinWomensStudies
Students must enroll in six credit hours of WST 5825 Internship in Womens Studies. The internship experience,
typicallyovertwosemesters,shouldtakeplaceinahumanserviceagencyorotherorganizationwhichfocuseson
women,sexualities,orgenderissues.Theinternshipwillbeapprovedbythestudentsinternshipcommittee.The
studentwillberequiredtowriteanarrativereportdescribingtheinternshipindetailandanalyzingtheexperience
intermsofappropriatetheoreticalframeworks.Thecompletednarrativemustbedefendedasanoraldefense.

NonThesisTrackOption (6credithours)
Inlieuofthesisorinternshiphours,studentsmusttaketwoadditionalelectivestocompletethetotal36hoursfor
theM.A.degree.

ComprehensiveExamRequirements
Eachstudentmustpassawrittencomprehensiveexamination.Itisexpectedthatastudentwillsuccessfullycomplete
thecomprehensiveexaminationpriortobeginningthesisorinternshipwork.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014

281
SECTION13
C
C
O
O
L
L
L
L
E
E
G
G
E
E
O
O
F
F
B
B
E
E
H
H
A
A
V
V
I
I
O
O
R
R
A
A
L
L
A
A
N
N
D
D

C
C
O
O
M
M
M
M
U
U
N
N
I
I
T
T
Y
Y
S
S
C
C
I
I
E
E
N
N
C
C
E
E
S
S



USFTampaGraduateCatalog20132014

282
ChangestoNote

ThefollowingcurricularchangesfortheCollegeofBehavioralandCommunityScienceswereapprovedbytheUSFTampa
GraduateCouncilonthedatenoted.Insomeinstancesmultiplechangeswereapprovedthemostrecentdateof
approvalislisted.

NewPrograms
AppliedBehaviorAnalysis(Ph.D.) NewDoctoralProgram 9/19/11
ProgramChanges
Audiology(Au.D.) Changecurriculum,courserequirements 2/6/12
CommunicationSciencesandDis.(Ph.D.)Changecurriculum,updateGRE 5/20/13
CriminalJusticeAdmin.(M.A.) Changecurriculum,addnewcourses 5/6/13
Gerontology(M.A.) Changecurriculum,courserequirements 2/6/12
SocialWork(M.S.W.) Changecurriculum,removeGRE 5/21/12
SocialWork(Ph.D.) Changecurriculum,reopenforadmission,updatedeadline 8/21/12

DualDegreeProgramChanges
Audiology(Au.D.)/Communication
SciencesandDisorders(Ph.D.)

Changestosharedrequirements 11/7/11
SocialWork(MSW)/
PublicHealth(MPH)
Changestosharedrequirements 5/21/12

NewGraduateCertificates
BRIDGE:BehavioralResearchImmersiontoDevelopGraduateExcellence 11/7/11

GraduateCertificateChanges
BehavioralHealthCounseling ChangetitlefromBehavioralHealthCounselingtoIntegrativeMentalHealthCare 11/5/11
PositiveBehaviorSupport ChangeHoursfrom15totalto12total 2/6/12

USFTampaGraduateCatalog20132014

283

UniversityofSouthFlorida
CollegeofBehavioralandCommunitySciences
4202EFowlerAveMHC1110
Tampa,FL33620

Webaddress: http://www.bcs.usf.edu
Email: Seedepartmentallistings
Phone: 8139742365
Fax: 8139744699

CollegeDean: JulianneSerovich,Ph.D.
AssociateDean: CatherineBatsche,Ph.D.
AssistantDean: CynthiaStark

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools (SACS). Contact the
Collegeforotheraccreditationinformation.

MissionStatement:
The College of Behavioral and Community Sciences prepares students, scholars, human service providers,
policymakers,andotherprofessionalstoimprovethequalityoflife,health,andsafetyofdiversepopulations
and to promote positive change in individuals, groups, communities, organizations and systems. Through
multidisciplinary teaching and research, service, and engagement with community partners, the College
focuses on the rigorous development, dissemination/implementation, and analysis of innovative solutions to
the complex challenges that affect the behavior and wellbeing of individuals, families, populations, and the
communitiesinwhichwelive.

The College offers eight programs at the masters level and seven programs at the doctoral level. Masters
programs are available in Applied Behavior Analysis, Audiology (PostBaccalaureate), Aural Rehabilitation,
Criminal Justice Administration, Criminology, Gerontology, Rehabilitation & Mental Health Counseling, Social
Work, and SpeechLanguage Pathology. Doctoral programs are offered in Aging Studies, Audiology,
Communication Sciences & Disorders, Criminology, and Social Work. Dual degrees are offered in Social
Work/PublicHealthatthemasterslevelandAudiology/CommunicationSciencesandDisordersatthedoctoral
level.

TheCollegeisalsohometotheLouisdelaParteFloridaMentalHealthInstitute whosemissionistoimprove
the lives of individuals with mental, addictive, and developmental disorders. Graduate studies in Behavioral
Health are offered in collaboration with the College of Public Health at both the masters and doctoral levels
andincollaborationwiththeCollegeofEducationatthedoctorallevel.TheInstitutehousesaResearchLibrary,
a Behavioral Health Research Data Center, and a Survey Research Unit that can support the research theses
anddissertationsofgraduatestudents.

USFTampaGraduateCatalog20132014

284
Thefollowingaredegreeprogramsofferedacrossprogramsand/orcolleges.

Degrees,Programs,andConcentrations:
MasterofArts(M.A.)
AppliedBehaviorAnalysis(ABY)
CriminalJusticeAdministration(CJA)
Criminology(CCJ)
Gerontology(GEY)
RehabilitationandMentalHealthCounseling(REH)
AddictionsandSubstanceAbuseCounseling(ASA)
MarriageandFamilyTherapy(MFL)

MasterofScienceM.S.
Audiology(PostBacc)(AUD)
Aural(Re)Habilitation(PostBac)(ARH)
SpeechLanguagePathology(PostBacc)(SPP)

MasterofSocialWorkM.S.W.
SocialWork(SOK)

DoctorofAudiologyAu.D.
Audiology(AYD)

DoctorofPhilosophyPh.D.
AppliedBehaviorAnalysis(APB)
AgingStudies(AGE)
CommunicationSciencesandDisorders(CSD)
HearingSciencesandAudiology(HAS)
NeurocommunicativeSciences(NSC)
SpeechLanguageSciences(SLS)
Criminology(CCJ)
SocialWork(SOK)

DualDegreePrograms:
MasterofSocialWorkM.S.W.
SocialWork/PublicHealthDualDegreeMSW/MPH(MaternalandChildHealth)(BehavioralHealth)

DoctorofAudiologyAu.D.
Audiology/CommunicationSciencesandDisorders(AUD/CSD)DualProgram

DoctorofPhilosophyPh.D.
Audiology/CommunicationSciencesandDisorders(AUD/CSD)DualProgram

GraduateCertificatesOffered:
SeeGraduateCertificatesSection

InterdisciplinaryOpportunities
TheCollegeofBehavioralandCommunitySciences(BCS)workswithothercollegesininterdisciplinaryefforts,
such as the jointly offered specialty concentration in Behavioral Health as part of the masters and doctoral
programs in the Department of Community and Family Health (DCFH) in the College of Public Health (COPH).
Forinformationaboutthis,andotheropportunities,contacteitherBCSorCOPHforinformation.

USFTampaGraduateCatalog20132014

285
COLLEGEREQUIREMENTS

ThesisEnrollment
Upon successful completionof all M.A./M.S. degree requirements except for thesis, Behavioral & Community
Sciencesgraduatestudentsmustenrollinaminimumoftwo(2)credithoursofThesiseachsemester(except
Summers)untilthecompletionofthemastersdegree.

DissertationEnrollment
Doctoral students who have been admitted to candidacy, are required to accumulate a minimum of six (6)
credit hours of Dissertation during each previous 12month period (previous three 3 terms, e.g., Fall, Spring,
Summer)untilthedegreeisgranted.
USFTampaGraduateCatalog20132014

286
AbouttheCatalog

The University of South Florida Graduate Catalog is organized with the degree programs offered listed in the
section of the College that offers them. For example, the Master of Science degree with a program (also
known as major) in Biology is listed in the College of Arts and Sciences section. Some colleges offer areas of
specialization,orconcentrationswithinadegreeprogram.

PROGRAMS

AGINGSTUDIESPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

CONCENTRATIONS

ConcentrationRequirementsarelistedseparatelyundereachProgram.

TheProgramandConcentrationarelistedontheofficialtranscript.Otherareas,suchasapplicationtracks,are
notlistedonthetranscript.

Example:
DoctorofPhilosophyinCommunicationSciencesandDisorders
withaConcentrationinSpeechLanguageSciences
Green denotes
Program (or Major)
Black denotes degree
USFTampaGraduateCatalog20132014 AgingStudies(Ph.D.)


287
AGINGSTUDIESPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Falladmissionsonly

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 30.1101
DeptCode: GEY
Program(Major/College): AGEBC
CONTACTINFORMATION

College: Behavioral&CommunitySciences
Department: SchoolofAgingStudies(GEY)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

TheInterdisciplinaryPh.D.inAgingStudiesisthefirstofitskindintheUnitedStates,andtothebestofourknowledge,
theworld.Whatmakesthisprogramuniqueisthecombinedemphasisonprovidingabroadbasedfoundationinthe
interdisciplinaryaspectsofagingwithafocusondevelopingindepthexpertiseinaresearcharea.Theprogramdraws
on the expertise of faculty from multiple colleges, departments, and centers at the University of South Florida to
providestudentswithexposuretootherdisciplinesandtheirdifferentapproachestoscientificandscholarlyinquiry.

The Ph.D. in Aging Studies is hosted by the School of Aging Studies, which is the organizational focal point for
interdisciplinary research, educational, clinical and community service activities in aging for faculty and students. An
interdisciplinarycommitteeoffacultygovernstheprogram,allowingstudentstodevelopresearchprogramsthatfocus
ontheirparticularinterestsandcapitalizeonthebreadthofopportunitiesthroughouttheuniversity.

The Ph.D. in Aging Studies is a researchoriented program designed to train future leaders in the field of aging. The
program admits students who show exceptional promise to become strong academic, public sector, and corporate
researchers.Studentsshouldexpecttoenrollintheprogramfulltime(9creditsinfall,9creditsinspring,and6credits
in summer). First year students are generally supported with an $18,000 fellowship, tuition waiver, and health
insurance. Fellowship or assistantship support and tuition waivers are generally available during subsequent years of
doctoraltraining.StudentswhowishtoapplyasparttimestudentsmustcontactDr.McEvoybeforeapplying.

FacultyOrganization
The interdisciplinary nature of the program is exemplified by the number of core faculty who teach and serve on
dissertation committees in the program and the range of academic departments they represent. Over forty faculty
frommultiplecollegesandresearchcentershavebeenidentifiedasthecorefacultyintheprogram.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

USFGraduateCatalog20132014 AgingStudies(Ph.D.)


288
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

ABachelorsDegree
GPAof3.25and
acurrentGRE;tobecompetitive,580V,620Q,5.0A.W.
ApplicantswhereEnglishisnotthelanguageofinstructionmustalsosubmitaTOEFLscoreofatleast600.
Inaddition,studentsmustsubmittheirbestexampleofasingleauthoredwritingsample
andasummaryoftheircareergoalsandpastpreparationforaresearchcareerplus
threelettersofrecommendationfromindividualsfamiliarwiththestudentsworkand/orresearch.

DEGREEPROGRAMREQUIREMENTS

MinimumHours: 90credithoursbeyondthebaccalaureate
Dir.Research/Dissertation: 56credits*
*Atleast2creditsofDissertationeverysemesterafteradmissiontocandidacy;ifmorethanminimumofrequired
coursecreditistaken,thenfewercreditsofDirectedResearcharerequired.

COREREQUIREMENTS
Courses(12hours)
GEY7610PsychologicalAging:InterdisciplinaryPerspectives 3
GEY7604BiomedicalAging 3
GEY7649PopulationAging 3
GET7623SocialandHealthAspectsofAging 3

Each core course is taught from an interdisciplinary perspective with faculty from different fields addressing issues
fromtheirdisciplinaryperspectives.

MethodsCourses(6hoursminimum)
GEY6402Statistical&QualitativeMethodsinAgingResearch 3
GEY6403MultivariateStatisticalAnalysisforAgingResearch 3

Students must also enroll in a sequence of at least two methods/statistics courses and are encouraged to obtain
additionaltraininginmethodsrelevanttotheirdissertation.

ProseminarandContentSeminar(16creditsminimum)
GEY7936AgingStudiesProseminar 4
GEY7602Ph.D.SeminarinHealthandAging 3
GEY7611Ph.D.SeminarinMentalHealth 3
GEY7622Ph.D.SeminarinPolicyandElderly 3
GEY7651Ph.D.SeminarinCognition 3

StudentsarerequiredtoenrollintheGEY7936AgingStudiesProseminar(2credits)eachfalloftheirfirst2yearsin
the program. They must also enroll for at least four Content Seminars (GEY 7602, GEY 7611, GEY 7622, Gey7651) (3
credits). TheProseminarsinvestigatedifferentresearchtopics,allowstudentstopracticepresentingtheirresearch,
andprovidestudentswithexposuretodistinguishedlecturersfromthroughouttheU.S.Thecontentseminarscover
differenttopicsrelevanttoagingeachspringsemester.

ElectiveRequirement
There are no requirements, other than the total minimum credit hours mentioned above. Each Ph.D. student, in
consultation with his/her major advisor, designs an appropriate curriculum to obtain content and skills that match
theirresearchinterests.

USFGraduateCatalog20132014 AgingStudies(Ph.D.)


289
Project
All students complete a First Year Research Project, designed to be presented at a national conference in the fall of
their second year. Students develop individualized courses of study, allowing specialization in a wide variety of
content areas and research methods. Supervised research experience is available from a number of faculty with
diverseresearchexpertise.StudentsenrollforGEY7911(DirectedResearchinAgingStudies)for1credithourfora
gradeofS/U.

Comprehensive/Qualifyingexam
The qualifying examination is usually taken during the end of the second year of course work, or the following Fall
semester.

Dissertation(56hoursminimumseesectionMinimumHours)

GEY7911DirectedResearch
GEY7980Dissertation

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFGraduateCatalog20132014 AppliedBehaviorAnalysis(M.A.)


290
APPLIEDBEHAVIORANALYSISPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15

MinimumTotalHours: 44
ProgramLevel: Masters
CIPCode: 42.9999
DeptCode: CFS
Program(Major/College): ABYBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: ChildandFamilyStudies(CFS)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

The master's degree program in applied behavior analysis (ABA) is designed to meet growing needs in Florida and
nationallyforpractitionerswhocanworkeffectivelyinthefieldsofdevelopmentaldisabilities,autism,education,child
protectiveservices,childbehaviordisorders,rehabilitation,mentalhealth,andbusinessandtechnology.ABAprovides
an approach for developing, implementing, and evaluating practical strategies to produce changes in socially
significant behaviors of individuals in the context of community settings. Three important features characterize the
scientificbasisuponwhichABAisbuilt:a)itfocusesuponobjectivelymeasurablebehaviorofindividuals;b)itstudies
environmental influences upon the targeted behaviors; and c) it places a premium upon singlesubject research
designstoanalyzetheeffectsofdifferentenvironmentalvariables.

The44credithourmaster'sdegreeinABAisinthedepartmentofChildandFamilyStudiesintheCollegeofBehavioral
and Community Sciences. Students demonstrate knowledge of behavioral principles and procedures in courses that
constitute a core curriculum, demonstrate applied behavior analysis skills through supervised practicum experiences,
andcompleteadatabasedthesis.Themaster'sdegreeprogramisdesignedtopreparestudentstomeetthestandards
tobeBoardCertifiedBehaviorAnalysts(BCBAs).Itwillpreparethemforemploymentinavarietyoffieldswherethere
aregrowingdemandsforcompetentprofessionalswithexpertiseinappliedbehavioranalysis.

Philosophy
Thesystematicanalysisandapplicationofbehavioralprinciplesisanextensiverepertoireofprofessionalbehaviors.In
the USF ABA program, these skills are acquired as students move through the sequenced curriculum of coursework
andpracticumexperiences.Thecurriculumrequiresapplicationofbehavioranalyticprinciples,withdirectsupervision
by faculty and BCBA supervisors. Students participate in practicum training in community agencies under the
supervision of BCBAs. In addition to the 1025 hours of behavior analysis practice they complete in their practicum
sites each week, students also participate in practicum seminars each semester. In these seminars, the Practicum
Coordinator discusses important practice issues and facilitates student discussion of their applied work. The
supervision of the students research theses rests in the hands of designated core faculty members (i.e., major
professors). Major professors serve as mentors for the students by closely supervising their research and their
progressthroughtheprogram.Therefore,asstudentsarementoredbytheirmajorprofessorsduringtheprogram, a
meaningfulmajorprofessorstudentrelationshipisessential.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.
USFGraduateCatalog20132014 AppliedBehaviorAnalysis(M.A.)

291
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Threelettersofreferencefromprofessorsand/oremployerswhoknowtheapplicantwell

Currentresumeorcurriculumvitae

Onepagenarrativedescribingtheapplicantsexperiences,training,andinterestinAppliedBehaviorAnalysis
andintheMaster'sPrograminAppliedBehaviorAnalysisatUSF.

GREScoresonthegeneralsubtests

SpecificProcedures
The primary assumption underlying admission to the M.A. program is that every student accepted is capable (a) of
successfully completing his or her respective program and (b) of performing competently in the field as an Applied
BehaviorAnalyst.Applicantsareselectedbasedontheirpotentialtobenefitfromtheprogramandtheirpotentialto
contributebothtotheProgramandthefieldofAppliedBehaviorAnalysis.

Withintheadmissionsprocess,aculturallydiversestudentbodyisactivelyrecruited,andapplicantsofacademicand
professionalpromisearenotsystematicallyexcludedonthebasisofrace,ethnicorigin,gender,age,religion,lifestyle,
sexualorientation,orphysicalhandicap.Theadmissionsprocessisselective,butflexibleallpertinentdatasubmitted
forconsiderationwillbeevaluatedasanentirepackage.Theevaluationprocess,however,doesinvolvebothacademic
and interpersonal considerations. The profession of Applied Behavior Analysis requires that the practitioner possess
personal characteristics as well as academic and technical competencies, and the admissions process attempts to
evaluateboththeseareas.

Admission to the program is based on past academic work; coursework in ABA, a CV outlining relevant work,
volunteer,andextracurricularexperienceinappliedbehavioranalysis;lettersofrecommendation;andastatementof
ABA interests, and professionalgoals. Studentsmay apply, after conferral or anticipated conferral of their Bachelor's
degree. Applications should be submitted by February 15 to be considered for application in the following fall term.
Lateapplicationswillbeconsideredifspaceintheprogramisavailable.

ForfurtherAdmissionsInformation,pleasevisitGraduateAdmissions.

Adecisionabouteachapplicant'scandidacyismadebytheProgramDirectorbasedonthestrengthoftheapplicants
recordandhis/her:

Academicrecordandexperiencesasanundergraduate

Careergoalsandtheircompatibilitywiththoseoftheprogram

Potentialforsuccessfulcompletionoftheprogram

Sensitivitytotheneedsofpotentialclientpopulations

Interpersonalskills

Communicationskills,bothoralandwritten

NOTE:TheProgramDirectorreservestherighttocontactallreferencesidentifiedbythecandidate.

USFGraduateCatalog20132014 AppliedBehaviorAnalysis(M.A.)

292
DEGREEPROGRAMREQUIREMENTS

Corerequirement
EDF6215ABABasicPrinciples 4
EDF6217BehaviorTheory 4
EDG6931ObservationalMethodsandFunctionalAssessment 3
EDG6931EthicsinABA 1
MHS6100ABAinComplexCommunityEnvironments 3
PSY6217SingleSubjectDesign 3

Electives
MHS6900(ABAApplications) 3
MHS6900(BehaviorAnalysisandDevelopmentalDisabilities) 3

ComprehensiveExam

PracticumSeminar
MHS6940 10

Thesis
MHS6971 10

Totalminimumhours: 44

BelowistheprogramofstudyfortheAppliedBehaviorAnalysisprogram.Formoreinformationonprogramrequirements,
contacttheprogram.

Fallsemesteryear1
EDF6215ABABasicPrinciples 4
EDG6931ObservationalMethodsandFunctionalAssessment 3
PSY6217SingleSubjectDesign 3
MHS6940ABAPracticum 2

Springsemesteryear1
EDF6217BehaviorTheory 4
EDG6931EthicsinABA 1
MHS6100ABAinComplexCommunityEnvironments 3
MHS6940ABAPracticum 2

Summeryear1
MHS6940ABAPracticum 2
MHS6971Thesis 2

Fallsemesteryear2
MHS6900Elective(ABAApplications) 3
MHS6940ABAPracticum 2
MHS6971Thesis 4

Springsemesteryear2
MHS6900Elective(BehaviorAnalandDevelopmentalDisabilities) 3
MHS6940ABAPracticum 2
MHS6971Thesis 4

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFGraduateCatalog20132014 AppliedBehaviorAnalysis(Ph.D.)

293
APPLIEDBEHAVIORANALYSISPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Domestic:
Fall: January15

International:
Fall: January15

MinimumTotalHours: 54
ProgramLevel: Doctoral
CIPCode: 42.2814
DeptCode: CFS
Program(Major/College): APBBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: ChildandFamilyStudies(CFS)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

Applied Behavior Analysis (ABA) is widely regarded as the most researchbased intervention for individuals with
autism. ABA is an applied science and a profession that provides services to meet the diverse needs of individuals.
TheemphasisoftheABAdoctoralprogramisonthedevelopmentofbehavioranalystswhoarescientistpractitioners.
Students graduating from the program will receive training through coursework and research and practice activities
withcommunitypartners.

MajorResearchAreas:
ABA, Applied Behavior Analysis, autism, behavior, behavior analysis, behavior management, behavioral intervention,
children, developmental disabilities, experimental analysis of behavior, functional assessment, and positive behavior
support.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.
USFGraduateCatalog20132014 AppliedBehaviorAnalysis(Ph.D.)

294
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Mastersdegreeinbehavioranalysisorrelatedfieldwithstrongbehavioranalysiscontent
Minimum3.50GPAinamastersprogram
GRErequired,preferredscoresof:
o Verbal40%orabove
o Quantitative40%orabove
o Analytical40%orabove
Researchexperiencesandexpertise
Threestronglettersofrecommendation
CampusvisitandinterviewwithABAfacultymembers
Personal statement describing experience and accomplishments in ABA, future goals, and reasons for
applying
CV

Studentsenteringthedoctoralprogramwiththeirmastersdegreeareexpectedtohavecompleted:
18credithoursofdidacticcourseworkinbehavioranalysisinthefollowingareas:Basicbehavioralprinciples
(3 credits), research methods (3 credits), conceptual foundation s(3 credits), applied behavior analysis (6
credits),andethics(3credits)
Anacceptedmastersthesis,and
10hoursofpracticumseminar.

Students lacking in any of these prerequisites will be required to take classes in the doctoral program to cover the
missingprerequisites.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours: 54(PostMasters)

Corerequirements 15credithours
ExperimentalAnalysisofBehaviorI 3
ExperimentalAnalysisofBehaviorII 3
ResearchMethodsII 3
CollegeTeachingSeminar 3
ConceptualFoundationschosefrom: 3
6xxxBehaviorTheory
7xxxVerbalBehavior
7xxxSeminaronSkinnersWritings
7xxxRelationalFrameTheory

Electives 6credithours
Electivecoursesintwoareasofappliedbehavioranalysisorotherareasthatcomplementthestudentsinterests.
7xxxAppliedBehaviorAnalysis
Unrestrictedcontent

IndependentResearch 15credithours
15credithoursofindependentresearcharerequired.

QualifyingExam
Successfulcompletionoftwoliteraturereviewpapers(approvedbythestudentsadvisorandtheprogram
director)
PassingscoreontheBehaviorAnalystCertificationBoardCertificationExam(Studentswhodonotpassthe
exammaytaketheexamasecondtime)
USFTampaGraduateCatalog20132014 AppliedBehaviorAnalysis(Ph.D.)

295
Dissertation 18credithours
MHS7980 18
Thedissertationwillconsistoforiginalresearchdesignedandconductedbythestudentunderthesupervisionof
afacultyadviser.Thestudentwillassembleadissertationcommitteeconsistingoftheadviserandthreeother
facultymembers(seeGraduateSchoolpolicyonDoctoralCommitteesformoredetails).

Completionofadissertationproposalacceptedbythedissertationcommittee
Successfuldefenseofthedissertationproposalbeforethecommittee
Successfulcompletionoftheresearch
Successfulcompletionofadissertationmanuscriptacceptedbythedissertationcommittee
Successfuldefenseofthedissertationresearchbeforethecommittee

Totalminimumhours: 54credithours

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Audiology(PostBacc)(MS)

296
AUDIOLOGYPROGRAM(POSTBACC)

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
FallDeadlines: February1
Currentlyclosedfornewadmissions

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 51.0204
DeptCode: CSD
Program(Major/College): AUDBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationScienceand
Disorders(CSD)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

Currently,studentsarenotbeingadmittedtothisprogram

PROGRAMINFORMATION

TheMastersofScienceDegreeinAudiologyisdesignedtoprovidestudentswithbasicacademicknowledgerelatedto
hearingandAudiology.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Three3lettersofrecommendation
A12pageletterofintent
GREscoreswithpreferredscoresatorabovethe33
rd
percentileonbothVerbalandQuantitativesections.
GREwritingwithapreferredscoreof4.0orbetter
GPAgreaterthanorequalto3.0forlast60credithoursofbaccalaureatedegree
Demonstrationofcompetencyincommunicationskillsasdeterminedbythechairpersonordelegate.

DEGREEPROGRAMREQUIREMENTS

Aminimumof36creditsmustbecompletedfromthefollowing:

Course Hours
SPA5120 Psychoacoustics 3
SPA5132 AudiologyInstrumentation 3
SPA5303 AuditoryAnatomy&Physiology 3
SPA5506 Math&PhysicsforSpeech&Hearing 3
SPA5506 ClinicLabI 3
SPA5506 ClinicLabII 3
SPA5328 RehabilitativeAudiologyforAdults 3
SPA6305 PediatricAudiology 3
SPA6311 MedicalAudiology 3
USFTampaGraduateCatalog20132014 Audiology(PostBacc)(MS)

297
SPA6314 Electrophysiology 3
SPA6316 VestibularEval&Treatment 3
SPA6340 PrinciplesofAmplificationI 3
SPA6341 PrinciplesofAmplificationII 3
SPA6571 ClinicalPract.Issues 2
SPA6676 SpeechPercep&HearingLoss 3
SPA6805 ResearchProcedures 3
SPA6906 IndependentStudy (variable)
SPA6910 DirectedResearch (variable)

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Audiology(Au.D.)

298
AUDIOLOGYPROGRAM

DoctorofAudiology(Au.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1
FallAdmissionOnly

MinimumTotalHours: 120
ProgramLevel: Doctoral/Professional
CIPCode: 51.0202
DeptCode: CSD
Program(Major/College): AYDBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationScienceand
Disorders(CSD)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

TheAu.D.isafouryearpostbaccalaureateprofessionaldegree.Theprimaryobjectiveistoproduceaudiologistswho
are competent to perform the wide array of diagnostic, remedial, and other services associated with the practice of
AudiologyandwhomeetthestandardsmandatedbytheCouncilonAcademicAccreditationoftheAmericanSpeech
LanguageHearingAssociation.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools; the Council on
AcademicAccreditationoftheAmericanSpeechLanguageHearingAssociation.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Three3lettersofrecommendation
A12pageletterofintent
GREscoreswithpreferredscoresatorabovethe33
rd
percentileonbothVerbalandQuantitativesections.
GREwritingwithapreferredscoreof4.0orbetter
GPAgreaterthanorequalto3.0forlast60credithoursofbaccalaureatedegree
Demonstrationofcompetencyincommunicationskillsasdeterminedbythechairpersonordelegate.

DEGREEPROGRAMREQUIREMENTS

General University requirements for graduate work must be fulfilled and a minimum of 120 hours of regularly
scheduledacademiccourseworkandclinicalpracticaatthegraduateleveldesignedtomeetcompetenciessetbythe
AmericanSpeechLanguageHearingAssociation.AlsorequiredforgraduationaretheattainmentofaBorbetterin
each graduate Audiology course, the attainment of clinical competence determined by a GPA of 3.0 in all clinical
practica and academic coursework, satisfactory passage of annual comprehensive didactic and clinical oral
examinationsandanationalexaminationinthespecialityofAudiology,andsuccessfulcompletionofanaudiology

doctoralproject.Astudentwithabachelorsdegreeinanyfieldmayenterthefouryearpostbaccalaureateprogram.
However,studentswholackundergraduatecourseworkinCommunicationSciencesandDisordersmayberequiredto
USFTampaGraduateCatalog20132014 Audiology(Au.D.)

299
addseveralcoursestotheirgraduateprogram.AstudentwithamastersdegreeandStateLicenseinAudiologyorthe
CertificateofClinicalCompetenceinAudiology(CCCA)maybeadmittedintoanindividualizedprogramofstudy.

COREREQUIREMENTS

TotalMinimumHours: 120

AudiologyScienceCore(17)
SPA6571ProfessionofAudiology 2
SPA5303AuditoryAnatomy&Physiology 3
SPA5120Psychoacoustics 3
SPA5132AudiologyInstrumentation 3
SPA5153QuantitativeProblemSolving 3
SPA6805ResearchProcedures 3

AudiologyPracticeCore(48)
SPA5328RehabilitativeAudiologyforAdults 3
SPA6311MedicalAudiology 3
SPA6340PrinciplesofAmplificationI 3
SPA6341PrinciplesofAmplificationII 3
SPA6307SpeechPerception&HearingLoss 3
SPA6305PediatricAudiology 3
SPA6314Electrophysiology 3
SPA6316VestibularEval&Treatment 3
SPA6393AudiologyPracticeMngmnt 3
SPA6354HearingConservation 3
SPA7346CochlearImplants 3
SPA7931AdvancedSensoryAids 3
SPA7332AdvancedElectrophysiology 3
SPA6324AuralRehabilitation:Children 3
SPA7330AdvancedVestibular 3
SPA7331AdvancedMedicalAudiology 3

PracticalExperience(49)
SPA6535LAudiologyClinicalLabI 3
SPA6536LAudiologyClinicalLabII 3
SPA6505ClinicI 4
SPA6505ClinicII 6
SPA6505ClinicIII 6
SPAxxxClerkshipI 3
SPA6xxxClerkshipII 3
SPA6xxxClerkshipIII 3
SPA6xxxExternshipI 6
SPA6xxxExternshipII 6
SPA6xxxExternshipIII 6
DoctoralProject(6minimum)
SPA6910DirectedResearch 3minimum
SPA7834AudiologyDoctoralProjectSeminar 3minimum

AnnualExamination
StudentsinAudiologywillbeevaluatedattheendofeachyearofcoursework.Thepurposeoftheseexaminationsis
twofold:1)Determineeligibilityforcontinuationinacademiccourseworkandpracticalexperiences;and2)Determine
areasofweaknessthatwillrequireremediation.Individualizedremediationprogramswillbedesigned,ifneeded,by
the student under the supervision of the Audiology faculty and may include the completion of additional written
papers,projects,and/oradditionalcoursework.

USFTampaGraduateCatalog20132014 Audiology(Au.D.)

300
AudiologyDoctoralProject
ThegoaloftheAudiologyDoctoralProject(ADP)istoprovideanexperienceinbasicorappliedresearchorevidence
basedpractice. Upon completion of the ADP, students areexpected to continue to be critical consumers of research
and be able to apply current research findings to their practice of audiology. It is expected that all students will
complete the ADP experience before the end of the third year of study. The ADP must be completed and defended
priortograduation.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Audiology(Au.D.)/CommunicationSciencesandDisorders(Ph.D.)
DualDegreeProgram

301
AUDIOLOGY/COMMUNICATIONSCIENCESANDDISORDERS
DUALDEGREEPROGRAM

DoctorofAudiology(Au.D.)Degree
DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1
FallAdmissionOnly

MinimumTotalHours: 120+
ProgramLevel: Doctoral
CIPCode: 51.0202
DeptCode: CSD
Program(Major/College): AYDBC/CSDBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationScienceand
Disorders(CSD)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

TheAu.D./Ph.D.ProgramisdesignedtoofferapathforthoseinterestedinClinicalResearchtoearnbothdoctoral
degreeswithinapproximatelysixyears.Theprimaryobjectiveistoproduceresearchaudiologistscompetentto
performthewidearrayofdiagnostic,remedialandotherservicesassociatedwiththepracticeofaudiologyaswellas
conductindependentresearchintheareaofhearingandbalancedisorders.

Accreditation:
The Au.D./Ph.D. programs are accredited by the Commission on Colleges of the Southern Association of College and
Schools. The Au.D. program is also accredited by the Council on Academic Accreditation of the American Speech
languageHearingAssociation.

MajorResearchareas:
Audiology, Hearing and Vestibular Science, Audiological Rehabilitation, Cochlear Implants, Auditory Processing, and
SpeechPerception

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

AdmissiontotheAu.D.Program.
DemonstrationofsuccessintheAu.D.Programforaminimumofthreeconsecutive,fulltimesemesters.
One(1)letterofrecommendationfromamemberoftheUSFAudiologyresearchfaculty.
A12pageletterofintent.
Demonstrationofcompetencyincommunicationskillsasdeterminedbythechairpersonordelegate.

USFTampaGraduateCatalog20132014 Audiology(Au.D.)/CommunicationSciencesandDisorders(Ph.D.)
DualDegreeProgram

302
DEGREEPROGRAMREQUIREMENTS

Requirements for the Au.D. /Ph.D. program are the same as the requirements for the individual degree programs
(Au.D.andPh.D.)withthefollowingexceptions:

1. TheAudiologyDoctoralProject(ADP)mustbesuccessfullycompletedpriortoenrollmentinthefinal
semesterofExternship(SPA6506ExternshipIII).TheSPA6910DirectedResearchcredithoursrequiredfor
theADPmaymeet,uponapproval,therequirementsofResearchRotationI(SPA6910DirectedResearch).
TherelatedADPSeminarsequence(SPA7834),requiredfortheAu.D.Programiswaived.Thisrequirementis
metbytheSPA5560DoctoralSeminarsequencethatisrequiredforPh.D.students.

2. TheAu.D.Coursefocusedonbusinessaspectsofmanagingaprivatepractice(SPA6393AudiologyBusiness
andPracticeManagement)isnotrequiredforAu.D./Ph.D.students.

3. Threecoursesaresharedbythetwoprograms:SPA5120Psychoacoustics(Au.D.course)isacceptedinplace
ofSPA7931AdvancedHearingScienceSeminar(Ph.D.course),andtwoPh.D.coursesselectedfromamong
theCoreContentorthestatisticscoursesareacceptedinplaceoftwoadvancedAu.D.seminars.

4. TheConcentrationCognateArea(12credits)andCoreContent(12credits)requirementsofthePh.D.
programaremetbycourseworkincludedintheAu.D.programSeecourselistingsfortheDoctorof
Audiology(Au.D.)andDoctorofPhilosophy(Ph.D.)programsofferedbytheDepartmentofCommunications
SciencesandDisorders.ThecreditsrequiredfortheAu.D./Ph.D.programwillconstitutenolessthan120
hoursbeyondtheBachelorsDegreeirrespectiveofwaivedcoursesorcoursesubmissions.

CourseRequirements
See course listings for the Doctor of Audiology (Au.D.) and Doctor of Philosophy (Ph.D.) programs offered by the
Department of Communication Sciences and Disorders. The credits required for the Au.D./Ph.D. program will
constitutenolessthan120hoursbeyondtheBachelorsDegreeirrespectiveofwaivedcoursesorcoursesubstitutions.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Aural(Re)Habilitation(M.S.)

303
AURAL(RE)HABILITATIONPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1

MinimumTotalHours: 44
ProgramLevel: Masters
CIPCode: 51.0204
DeptCode: CSD
Program(Major/College): ARHBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationSciencesand
Disorders(CSD)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

Currently,studentsarenotbeingadmittedtothisprogram.

PROGRAMINFORMATION

TheMastersofScienceDegreeinAuralRehabilitationisdesignedtoenablestudentstomeetminimalrequirementsfor
certificationasaTeacheroftheHearingImpaired(K12)intheStateofFlorida.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Threelettersofrecommendation
GREwithpreferredscoresof52
nd
percentileinVerbalora52
nd
percentileonWritinganda32
nd
percentileon
quantitative.
GPAof3.20orhigherinthelast60hoursofundergraduatecoursework
Aletterofintent,and
Applicantmustalsodemonstratecompetencyincommunicationskillsasdeterminedbythechairpersonor
delegate.

DEGREEPROGRAMREQUIREMENTS

AllARHmajorsmustcompletethefollowing:

CourseRequirements Hours
SPA5204 PhonologicalDevelopment&Disorders 3
SPA5403 LanguageLearningintheSchoolAgeChild 3
SPA6324 AuralRehabilitation:Children 3
SPA6645 LanguageforHearingImpaired 3
SPA6674 CurriculumProcedures&MaterialsforHearingImpaired 3
SPA6675 ReadingfortheHearingImpaired 3
SPA6930 ST:SpeechPerception&ProductionintheHI 3
SPA6930 ST:FamilyCenteredDeafEducation 3
SPA6930 ST:FoundationsofDeafEducation 3
SPA6930 ST:IntroductiontoCuedSpeech 3
SPA6930 ST:ClassroomApplicationsofSignLanguage 3
EEX6025 Trends&IssuesinSpecialEducation 3
USFTampaGraduateCatalog20132014 Aural(Re)Habilitation(M.S.)

304
PracticumRequirements
SPA6505 Practicum:IntrotoClinicalAR 1
SPA6505 Practicum:ARH 2
SPA6505 Practicum:Classroom 2

Electives(one3creditcourseinSpecialEducation)
Examples:
EEC6269 EC:Play&Learning 3
MAE6117 TeachingElementaryMath 3

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 CommunicationSciencesandDisorders(Ph.D.)

305
COMMUNICATIONSCIENCESANDDISORDERSPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: December1forfull
consideration;however
applicationsareaccepted
untilFebruary15

Spring: October15

MinimumTotalHours: 90(w/omasters)
53(wmasters)
ProgramLevel: Doctoral
CIPCode: 51.0204
DeptCode: CSD
Program(Major/College): CSDBC

Concentrations:
HearingSciencesandAudiology(HAS)
NeurocommunicativeSciences(NCS)
SpeechLanguageSciences(SLS)

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationSciencesand
Disorders(CSD)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Department of Communication Sciences and Disorders provides disciplinary and interdisciplinary education to
prepare research scientists capable of addressing both theoretical and applied issues in laboratory, clinical, and
classroom settings. Academic preparation emphasizes basic and advanced study in the communicative sciences,
interdisciplinarystudy,andextensiveresearchpreparation.Theprogramofstudyistailoredtomeetindividualinterest
areas.Theoverallaimofthedoctoralprogramistoproducegraduateswhoexcelinmeetingtherigorousdemandsof
anacademic/researchcareer.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:

SpeechLanguageSciences:
Speech perception and production processes, speech perception by normal hearing listeners and listeners with
hearingloss,nonnativespeech,languagedevelopmentinatriskpopulations,linguisticanddiscoursecorrelates
for reading, writing, and spelling, second language learning and literacy learning, and language variation and
multiculturalism;

HearingSciencesandAudiology:
Aural rehabilitation, psychoacoustics, aging, temporal processing, speech perception by impaired listeners,
auditoryevokedpotentials,andotoacousticemissions;

NeurocommunicativeSciences:
Aphasia, cognitive/linguistic processing in normal aging and adults with neurological disorders, cognitive
neuroscience.

USFTampaGraduateCatalog20132014 CommunicationSciencesandDisorders(Ph.D.)

306
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Threelettersofrecommendation
Aletterofintent
AbachelorsdegreefromaregionallyaccreditedinstitutionandaGPAofatleast3.50;oramastersdegree
from a regionally accredited institution and a GPA of 3.50.00 or better (on a 4.00 scale) during graduate
study. Students with a nonCSD background may be required to take prerequisite coursework in the basic
speech,language,andhearingsciencesdependingoncareerplansanddesiredareaoffocus.
GPAof3.50orabovefrompreviousgraduatestudy.
GREwithpreferredscoresatthe33rdpercentileforVerbaland,Quantitativesubtests,anda3.50orbetter
ontheWritingsubtest,takenwithin5yearsprecedingtheapplication.Studentswithlowerscoresmaybe
offeredadmissiononaconditionalbasisiftheletterofintentandlettersofrecommendationareparticularly
strong.

DEGREEPROGRAMREQUIREMENTS

The specific coursework to be completed for research and tools of research, core content, and concentration/specialized
studyaredeterminedindividuallytocreateacourseofstudyappropriatetothestudentsdesiredspecialization.Thecore
contentnormallyconsistsoffouradvancedseminars(SPA7931)coveringthefourmajorcontentareasofthefield(speech,
language, hearing, and neurocommunicative science). In certain cases, with approval of the Major Advisor and Program
Director, previously completed graduate level coursework may be applied towards requirements in the Core content or
Specialized Study areas. Completion of the Ph.D. in Communication Sciences and Disorders after the Masters normally
requiresaminimumoffouryearsofstudy;aminimumoffiveyearsafterthebachelors.

TotalMinimumhours: 90(postbacc)
53(postmasters)

AllStudentsmustcompletethefollowingrequirements

COREREQUIREMENTS

Researchandtoolsofresearch 20credithoursminimum
Twocoursesequenceinstatisticalanalysis 6credithoursminimum
EDF6407StatisticalAnalysisforEd.ResearchI 4
EDF7408StatisticalAnalysisforEd.ResearchII 4
OR
GEY6934ResearchMethodsI 3
GEY6934ResearchMethodsII 3

ResearchDesign 3credithoursminimum
SPA7806AdvancedResearchDesigninCSD 3

Researchrotation 11credithoursminimum
Tworesearchrotations,asdescribedbelow.

CoreContent 12credithours
SPA7811ResearchFoundationsinSpeechScience 3
SPA7812ResearchFoundationsinHearingScience 3
SPA7826ResearchFoundationsinNeurocommunicativeSciences3
SPA7841ResearchFoundationsinLanguageScience 3

USFTampaGraduateCatalog20132014 CommunicationSciencesandDisorders(Ph.D.)

307
CONCENTRATIONREQUIREMENTS
HearingSciencesandAudiology(HAS)
NeurocommunicativeSciences(NCS)
SpeechLanguageSciences(SLS)

Foundationalknowledge 36credithoursminimum
Masters and Au.D. level students will be credited with 36 hours from their previous degree. Bachelors level students, in
consultationwiththeiracademicadvisor,willdesignanappropriatecurriculumtoobtainfoundationalcontentandskillsin
theirareaofinterestthatwillpreparethemforAdvancedStudy..Thiscurriculumisrequiredtoincludeaminimumofeight
(8)hoursofstructuredcourseworkatthe6000levelorabove,eitherwithinthedepartmentorinrelateddepartments.The
remainder of credits may take the form of additional structured coursework, directed research, or independent study.
CoursesintheDepartmentfrequentlyusedtosatisfythisrequirementarelistedbelow.

Note:StudentsadmittedtotheprogramfromanonCSDbackgroundmayberequiredtotakeprerequisitecourseworkat
the undergraduate level in the basic speech, language, and hearing sciences, depending on their career plans and desired
area of focus. For these students, up to six (6) hours of 4000level courses can be applied to the Foundational Knowledge
requirement.

SpeechLanguagePathologyCourses:
SPA5403LanguageLearningintheSchoolAgeYears 3
SPA5204AdvancedClinicalPhonology 3
SPA5552DiagPrin&Pratice 3
SPA6401PediatricLangDis 3
SPA6404LanguageLearningDis 3
SPA6473MulticulturalDifferencesinLangUse 3
SPA6413AugmentativeandAlternativeComm 3
SPA6571EthicalPracticeIssuesinComm.Dis 12
SPA7150AdvancedSpeechScience 3
SPA6211AdvVocalDis 3
SPA6225AdvFluency 3
SPA6232Neuromotor 3
SPA6417CommunicationandCognitioninTB 3
SPA6564SeminarinAging,Cognition,andComm. 3
SPA6410Aphasia 3
SPA6565Dysphagia 3
SPA6805ResearchProceduresinCSD 3

AudiologyCourses
SPA6571ProfessionofAudiology 12
SPA5153QuantProvSolving 3
SPA5120Psychoacoustics 3
SPA5132AudiologyInstrumentation 3
SPA5303AuditoryA&P 3
SPA5328RehabilitativeAudiologyforAdults 3
SPA6305PediatricAudiology 3
SPA6307SpeechPerception&HearingLoss 3
SPA6311MedicalAudiology 3
SPA6314Electrophys 3
SPA6316VestibularEval&Treatment 3
SPA6324AuralRehab:Children 3
SPA6340PrinciplesofAmplificationI 3
SPA6341PrinciplesofAmplificationII 3
SPA6354HearingConservation 3
SPA7346CochlearImplants 3
SPA7330AdvVestibularEval&Treatment 3
SPA7331AdvMedicalAudiology 3
SPA7332AdvElectrophysiology 3
SPA6393AudiologyPracticeManagement 3
SPA6805ResearchProceduresinCSD 3
USFTampaGraduateCatalog20132014 CommunicationSciencesandDisorders(Ph.D.)

308
AdvancedStudy 9credithours
AdvancedtopicsinCommunicationSciencesandDisorders 3
SPA7931AdvancedSeminarinCommunicationSciencesandDisorders

Remainingcoursework requiredforAdvancedStudy(beyondatleastoneSPA7931course)maytaketheformofelective
coursework, either within the department or in related departments), directed resesarch, or independent study. The
studentsacademicadvisor,majorprofessorandDissertationCommitteewilladvisestudentsontheselectionoftheproper
mix of coursework and other study to support knowledge development in the students area of specialization and/or to
facilitate development of a research tool or methodology thatmay be neededfor the students dissertation research. As
partoftheadvancedstudyrequirement,itislikelythatstudentswillalsobeadvisedtotakedirectedresearchcreditswith
DissertationCommitteemembers,astheybegindirectedreadingstopreparefortheQualifyingExamination.

Dissertation 12credithoursminimum
SPA7980Dissertation

Other

Inadditiontospecificdegreerequirements,astudentmustcompletethefollowingtoqualifyforgraduation:

1. Satisfactorycompletionoftworesearchrotations,withonerotationinthestudentsprimaryareaofinterest
andasecondrotationinadifferentresearcharea.Thedepthresearchrotationinthestudentsprimary
areaofinterestisrequiredtobeaminimumof3 9cre dithours(typicallyspreadover34semesters)andto
resultinacompletedprojectthatgeneratespublishabledata.Thebreadthresearchrotation,whichmust
beconductedinadifferentresearcharea,isanexperimentfocusedlaboratoryexperience.Itisrequiredto
beaminimumoftwo(2)credithours(typicallycompletedinonesemester),andthestudentscontribution
neednot(onitsown)resultinapublishablework.

2. Withthesupervisionofaqualifyingcommittee,passawrittenqualifyingexaminationthatevaluatesthe
studentsspecialityknowledgeandmethodologicalcompetence.Atthediscretionofthequalifying
committeeanoralexaminationmayfollowthewrittenexamination.

3. Establishadoctoralcommitteepriortoadmissionintodoctoralcandidacy.

4. Prepareanddefendadissertationproposal.

5. Followingcompletionofthedissertationresearch,successfullydefendtheworkbeforethedissertation
committeee.

6. DepartmentalpolicyspecifiesthatanystudentearningaC+orbelowintwocourseswillberecommended
fordismissalfromthePh.D.program.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 CriminalJusticeAdministration(M.A.)

309
CRIMINALJUSTICEADMINISTRATIONPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall:February15forfullconsideration.
*RollingAdmissions:
Applicationsacceptedonanongoingbasis.

*Rollingadmissions;applicationscontinuallyaccepted
forFallcohortprogram.

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 43.0103
DeptCode: CJP
Program(Major/College): CJABC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: Criminology(CJP)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

TheM.A.inCriminalJusticeAdministrationisaspecializedandconcentratedprogramofstudydesignedspecificallyfor
practitioners and those whose desire is to complete an M.A. with a special emphasis on administration and
managementwithinthecriminaljusticesystem.Generallyittargetsindividualswhodonotanticipatecontinuingonto
the doctoral studies. It is a concentrated weekend, cohortbased program leading to the M.A. in five consecutive
semesters.Uptotwoclassesmaybeofferedviatheinternet.Classesareheldonweekends,meetforoneday,and
run seven weeks backtoback. The program is modeled after a typical executive MBA program for working
professionals.

This is a cohort based model. This degree concentrates on issues related to the organization and operation of
criminaljusticeagenciesandrelatedorganizations.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Studentsarerequiredtohave:

Abachelorsdegreefromaregionallyaccrediteduniversityorcollege
AminimumundergraduateGPAof3.00
Twolettersofrecommendationattestingtotheapplicantsabilitiestosucceedatthegraduatelevel
Astatementofpurposeaddressingthemotivationstoattainagraduatediplomaandtheintentiontoapply
thediplomatoaspecificsetofpurposes

USFTampaGraduateCatalog20132014 CriminalJusticeAdministration(M.A.)

310
DEGREEPROGRAMREQUIREMENTS

COREREQUIREMENTS
CourseworkRequirements(33hrs.total)

CCJ6936CurrentIssuesinLawEnforcement 3
CCJ6605TheoreticalApproachestoCriminalBehavior 4
CCJ6705ResearchMethodsinCriminology 4
CJE6025PolicyOrganization,Behavior,andAdministration 3
CJE6029AdvSeminarinLawEnforcement 3
CJE6712CriminalJusticeGraduateCapstoneSeminar 3
CCJ6706QuantitativeAnalysisI 4
CCJ6406 Theory,Practice,andResearchinLawEnforcement 3

Additionally,twocoursesinpublicadministrationatthe6000levelarerequired. 6
ThedepartmentrecommendsPAD6041(3),PAD6934(3)orsimilarcoursesinPAD
approvedbytheCJAProgramDirectorincoordinationwiththePublicAdministration
Program.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Criminology(M.A.)

311
CRIMINOLOGYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15
Spring: September30

MinimumTotalHours: 33
ProgramLevel: Masters
CIPCode: 45.0401
DeptCode: CJP
Program(Major/College): CCJBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: Criminology(CJP)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

TheM.A.inCriminologyisatwoyearprogramdesignedtoprovidethestudentwithanindepthunderstandingofthe
majorideas,issues,theories,andresearchcomprisingthefieldofCriminologyandCriminalJustice.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Abachelorsdegreefromaregionallyaccrediteduniversityorcollege
AnupperdivisionGPAof3.00orpreferredscoresof500V,500Q,4.0A.W.orhigheronthe
GraduateRecordExam(GRE).AllapplicantsmustsubmitGREscores.
AstatementofpurposedetailingreasonsforseekingagraduatedegreeinCriminology,future
careerplans,andresearchinterests
Awritingsampleprovidingevidenceofcandidatesscholarlyabilities
Threelettersofreferencespeakingtotheapplicantsacademiccapabilities

DEGREEPROGRAMREQUIREMENTS

All course work counted toward the degree must have the prior approval of the Graduate Program Director of the
DepartmentofCriminology.Suchworkmayincludeuptosix(6)hoursoutsidethedepartment.

COREREQUIREMENTS

ThesisOption
33hoursofCCJcoursework,whichmustinclude:

USFTampaGraduateCatalog20132014 Criminology(M.A.)

312

CCJ6605TheoreticalApproachestoCriminalBehavior 4
CCJ6705ResearchMethodsinCriminology 4
CCJ6706QuantitativeAnalysisI 4
CCJ6707QuantitativeAnalysisII 4
CCJ6050ProSeminarinCriminology
(takentwicefor1houreachduringthefirsttwosemesters) 2

Electives 9

Thesis 6
CCJ6971Thesis:Masters 6

Thethesiswillconsistofresearchthatmakesanoriginalcontributiontothescholarlyliteratureandmaybeofeithera
quantitativeorqualitativenature.Anoraldefenseofthethesisisrequiredafterthefinaldraftofthethesishasbeen
acceptedbythecandidate'ssupervisorycommittee.

NonThesisOption
33hoursofcoursework,whichmustinclude:

CCJ6605TheoreticalApproachestoCriminalBehavior 4
CCJ6705ResearchMethodsinCriminology 4
CCJ6706QuantitativeAnalysisI 4
CCJ6707QuantitativeAnalysisII 4
CCJ6050ProSeminarinCriminology
(takentwicefor1houreachduringthefirsttwosemesters) 2
CCJ6905DirectedIndependentStudy 3

Electives 12

Anonthesiscomprehensiveexaminationoptionisavailableandintendedprimarilyforstudentswhodonotintendto
continuetheirgraduateeducationbeyondtheM.A.degree.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
Seehttp://criminology.cbcs.usf.edu/masterCriminology/
USFTampaGraduateCatalog20132014 Criminology(Ph.D.)

313
CRIMINOLOGYPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January15

MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 45.0401
DeptCode: CJP
Program(Major/College): CCJBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: Criminology(CJP)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Ph.D. is a research degree granted in recognition of high achievement in criminology. This achievement requires
accomplishments beyond the completion of coursework that demonstrate the ability to work independently and
contributetocriminologicalknowledge.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

AbachelorsdegreefromaregionallyaccreditedinstitutionandaGPAofatleast3.00;oramastersdegree
fromaregionallyaccreditedinstitutionandaGPAofatleast3.40orbetter(ona4.00scale)duringgraduate
study.

Apreferredscoreof500V,500Q,4.0A.W.orhigherontheGraduateRecordExam(GRE)withinthe
precedingfive(5)years

Three3lettersofrecommendationspeakingtotheapplicantsacademiccapabilities

Acandidatesstatementdetailing
o reasonsforseekingaPh.D.degreeincriminology
o futurecareerplansand
o researchinterests

Awritingsampleprovidingevidenceofthecandidatesscholarlyabilities

StudentsareadmittedtothePh.D.programonceeachyearandbegintheircourseofstudywiththestartof
theregularacademicyeareachAugust(fallsemester).

USFTampaGraduateCatalog20132014 Criminology(Ph.D.)

314
DEGREEPROGRAMREQUIREMENTS

Atotalof90hoursbeyondtheB.A./B.S.,ofwhichaminimumof57*hoursmustbecompletedatUSF.The90hours
requiredforthePh.D.areasfollows:

CoreRequirements(18Hours)

CCJ6050ProSeminarinCriminology 2
CCJ6605TheoreticalApproachestoCriminalBehavior 4
CCJ6705ResearchMethodsinCriminology 4
CCJ6706QuantitativeAnalysisinCriminologyI 4
CCJ6707QuantitativeAnalysisinCriminologyII 4

Electives(912hours)

9to12electivehours,9ofwhichmaybeinanareaoutsidethedepartment

ToolsofResearch(6hours)

CCJ6708QuantitativeAnalysisinCriminologyIII 3
CCJ6709QualitativeResearchMethodsinCriminology,or 3
CCJ6716EvaluationMethodsinCriminology 3

Dissertation(24hours)

CCJ7980 24

MastersDegree(30or33hoursaretransferredfromM.A./M.S.)

*TheGraduateProgramDirectorcandeterminetheminimumnumberofhoursneededbyeachstudent.

In addition to successfully completing these requirements, students are required to pass a doctoral comprehensive
examination, complete residency requirements (nine [9] hours each in the fall and spring), and write and defend a
dissertationprospectusanddissertation.

ComprehensiveExaminations
The takehome comprehensive examination assesses the student's ability to employ theory, research methods, and
statisticalanalysis.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Gerontology(M.A.)

315
GERONTOLOGYPROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15
Summer: February15

MinimumTotalHours: 36
ProgramLevel: Masters
CIPCode: 30.1101
DeptCode: GEY
Program(Major/College): GEYBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: SchoolofAgingStudies(GEY)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

Gerontology is the study of the process of human aging in all its aspects: physical, psychological, and social. In the
School of Aging Studies, particular emphasis is placed on educating Gerontology students who, in their professional
careers, will work to sustain or improve the quality of life of older people. Many of our program graduates are
employed in agencies providing services for older adults. For information about the interdisciplinary Ph.D., see the
separatelistingforAgingStudiesPh.D.

The School offers the M.A. in Gerontology, with either a thesis or nonthesis option. In addition to completing a
required core curriculum, students may select gerontology courses suited to their particular career goals. These
includecoursesfocusedonsuchdiverseconcentrationsasresearch,programadministration,directservice,andcase
management. While the M.A. program does not have separate tracks, students are advised to select courses in the
concentration(s) that match their intended career. Students should meet with their advisors toselect concentrations
appropriatetotheirprofessionalgoals.

Internshipsarerecommendedandavailableforstudentswhoneedpracticalexperienceinthefieldofaging.Students
interested in internships should see the schools internship director. Following completion of the necessary
coursework there is a comprehensive examination designed to test the students knowledge of, and ability to
integrate,keyconceptsandinformationinthefieldofgerontology.Thisexaminationmustbetakenandpassedbyall
students in the M.A. program. Students electing the thesis option must successfully pass an oral examination on the
thesis.Therearenolanguagerequirements.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Universityrequirementsand
aGPAof3.00orgreaterand
apreferredGREscoreofatleast430V,470Q,4.0A.W.
USFTampaGraduateCatalog20132014 Gerontology(M.A.)

316
DEGREEPROGRAMREQUIREMENTS

TheM.A.degreerequires36creditsofgraduatestudy.

COREREQUIREMENTS
Requiredcourses(15credits)include:

GEY5620SociologicalAspectsofAging 3
GEY5630EconomicsandAging 3
GEY6600HumanDevelopment 3
GEY6613PhysicalChangeandAging 3
GEY6450GerontologicalResearchandPlanning 3

Comprehensiveexam
Followingcompletionoftherequired15creditcoursework,thereisacomprehensiveexaminationdesignedto
testthestudent'sknowledgeof,andabilitytointegrate,keyconceptsandinformationinthefieldofgerontology.
ThisexaminationmustbetakenandpassedbyallstudentsintheM.A.programtomeetrequirements.

Internship
Internshipsareavailableforstudentswhoneedpracticalexperienceinthefieldofaging.

Thesis

Students electing the thesis option must successfully pass an oral examination on the thesis. There are no
languagerequirements

Electives(21credits)

The remaining 21 hours of coursework must be selected from other graduate courses in gerontology. The
followingcoursesaresuggestedforfourareasofstudy:

FurtherEducational/ResearchGoals
GEY6402StatisticalMethodsinAgingResearch 3
GEY6403MultivariateStatisticalAnalysisforAgingResearch 3
GEY6901DirectedReadinginGerontology 3
GEY6910DirectedResearchinGerontology 3
GEY6971Thesis:Masters 219

AdministrativeGoals
GEY4327UnderstandingPrinciplesandPracticesinLongTermCare 3
GEY5501HealthCareOperationsinLongTermCare3
GEY5476ProgramEvaluationinanAgingSociety 3
GEY6325SocialPolicyandPlanningforGerontologists 3
GEY6500SeminarinPrinciplesofAdministation 3
GEY6626Health,Ethnicity,andAging 3
GEY6647EthicalandLegalIssuesinAging 3

ClinicalServicesGoals
GEY6607AlzheimersDiseaseManagement 3
GEY6614AgingandMentalDisorders 3
GEY6615TopicsinPsychopathologyandAging 3
GEY6616MentalHealthAssessmentandInterventionwithOlderAdults 3
GEY6617GerontologicalCounselingTheoryandPractice 3
GEY6618GerontologicalGroup&FamilyCounseling 3

USFTampaGraduateCatalog20132014 Gerontology(M.A.)

317
CaseManagementGoals
GEY6206FamilyCargivinginAgingandChronicIllness 3
GEY6321GerontologicalCasemanagement 3
GEY6326GeriatricInterdisciplinaryTeamTraining 3
GEY6614AgingandMentalDisorders 3
GEY6616MentalHealthAssessmentandInterventionwithOlderAdults 3
GEY6617GerontologicalCounselingTheoryandPractice 3

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 RehabilitationandMentalHealthCounseling(PostBacc)(M.A.)

318
REHABILITATIONANDMENTALHEALTHCOUNSELING
(POSTBACC)PROGRAM

MasterofArts(M.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February15
Spring: October15

MinimumTotalHours: 60
ProgramLevel: Masters
CIPCode: 51.2310
DeptCode: REH
Program(Major/College): REHBC

Concentrations:
AddictionsandSubstanceAbuseCounseling(ASA)
MarriageandFamilyTherapy(MFL)

Alsoofferedasa5yearprogram:
5yearprogramiscurrentlyunderadministrative
review;nonewapplicationsarebeingacceptedat
thistime.
CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: Rehabilitationand
MentalHealthCounseling(REH)

ContactInformation www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

The Department of Rehabilitation and Mental Health Counseling trains counselors to work with physically, mentally,
emotionally, and chemically disabled individuals. Training emphasizes psychological, social, medical, and vocational
aspects of disability, and also the development and refinement of personal adjustment counseling skills. Graduates
withthisM.A.arepreparedforcareersasbothrehabilitationspecialistsandmentalhealthcounselors.

TheDepartmentoffersonlytheM.A.degree.Moststudentsareadmittedafterearningabaccalaureatedegreeinone
ofthebehavioral,social,healthrelated,oreducationaldisciplines(REH).AFiveYearProgram(REF)FiveYearProgram
(REF)isavailabletoundergraduateswithstrongacademiccredentials,andundergraduatesinterestedinthisprogram
shouldcontactthedepartmentduringtheirsophomoreyear.TheDepartmentofferstwoareasofconcentrationthat
mayalsoleadtoacertificate:(1)AddictionsandSubstanceAbuseCounseling;(2)MarriageandFamilyTherapy.Each
student may elect to pursue a program of specialization in any of these areas. The Addictions and Substance Abuse
counseling program is approved by the Certification Board for Addictions Professionals of Florida (CBAPF Approved
Provider#179A).

Uponcompletionofatleast75%oftheprogram,studentsareeligibletositforthenationalexaminationtobecomea
CertifiedRehabilitationCounselor(CRC).Upongraduation,individualsarealsoeligibletotaketheexaminationforthe
state licensure as a Mental Health Counselor. Upon completion of 1500 hours of postgraduate clinical supervision
graduatesreceivetheirstatelicenseasaMentalHealthCounselor.Foracompletedescriptionofthedepartmentand
itsprogram,visitthedepartmentsWebpageat:
http://rmhc.bcs.usf.edu

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools,andtheCommissionon
RehabilitationEducation(CORE).

USFTampaGraduateCatalog20132014 RehabilitationandMentalHealthCounseling(PostBacc)(M.A.)

319
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityrequirementsplus:

Threelettersofrecommendation
Onlinedepartmentapplication(whichincludesapersonalstatementofintent)
GRE
Interview(oncampus)
Undergraduatestatisticsorresearchmethodscourse

DEGREEPROGRAMREQUIREMENTS

The department offers both a thesis and a nonthesis program. There is no language requirement; however, a
comprehensive examination is required of all students. The following 54hour core curriculum is consistent with
national certification standards for rehabilitation counselors and must be taken by all students (postbaccalaureate,
thesis,andnonthesis).

CoreRequirements 54hours
MHS5020 FoundationsofMentalHealthCounseling 3
MHS5480 HumanGrowth&Development 3
RCS5780 Legal&EthicalIssues&ProfessionalStandards 3
RCS5035 RehabilitationCounseling:Concepts&Applications 3
RCS5080 MedicalAspectsofDisability 3
RCS5450 FundamentalsofSubstanceAbuseCounseling 3
RCS6220 IndividualEvaluation&Assessment 3
RCS6476 HumanSexuality 3
RCS6301 Career&LifestyleAssessment 3
RCS6408 Diagnosis&TreatmentPsychopathology 3
RCS6409 Counseling&CommunitySettings 3
RCS6440 Social&CulturalFoundations 3
RCS6510 GroupTheoriesandPractice 3
RCS6407 CounselingTheoriesandPractice 3
RCS6740 Research&ProgramEvaluation 3
RCS6803 PracticumInCounseling 6
RCS6825 Internship 3

ConcentrationRequirements: 15hours

AddictionsandSubstanceAbuseCounseling 15credithours
RCS5450 FundamentalsofSubstanceAbuseCounseling 3
RCS6459 ProfessionalSkillsforAddictionsCounselors 3
RCS6930 ST:EmployeeAssistancePrograms3orapprovedelective 3
RCS6803 Practicum(SubstanceAbuse) 3
RCS6456 CounselingApproachesforSubstanceAbusers 3

MarriageandFamilyTherapy 15hours
RCS6476 HumanSexuality 3
RCS6930 Seminar:DynamicsofMarriageandFamilyTherapy 3
RCS6930 Seminar:MaritalTherapy,Theory,andTechniques 3
RCS6930 Seminar:FamilyTherapy,Theory,andTechniques 3
RCS6803 PracticuminMarriageandFamilyTherapy 3
USFTampaGraduateCatalog20132014 RehabilitationandMentalHealthCounseling(PostBacc)(M.A.)

320
NonThesis 6hours
Students in the nonthesis program must complete a minimum of 60 hours in the PostBaccalaureate Program
(REH). Two electives (6 credits) may be taken from Rehabilitation and Mental Health Counseling offerings or
fromofferingsoutsidethedepartmentwiththeconsentofanadvisor.

Thesis 3hours
All students are initially admitted to the nonthesis program. Admitted students may subsequently apply to the
faculty for a thesis program. Students in a thesis program must complete a minimum of 60 hours in the Post
BaccalaureateProgram(54hr.)corecurriculumplusaminimumofthree3hoursofRCS6970.Anoraldefenseof
thethesisisrequired.

FiveYearProgram(including54hourcorecurriculum).
Additional hours to complete the minimum of 150 hours for students in the FiveYear Program may be elected from
otherRehabilitationandMentalHealthCounselingofferingsorfromrelatedprogramswiththeconsentoftheadvisor.

ComprehensiveExamination
The written comprehensive examination assesses the students understanding of the significant content and process
areasoftheprogramcurriculum.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 SocialWork(M.S.W.)

321
SOCIALWORKPROGRAM

MasterofSocialWork(M.S.W.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:

Fulltimetwoyearprogram:February15
FulltimeAdvStanding:
*Summer February15
*Spring: October15

Parttimeprogram: ContactSchoolforfurther
information.Pleasecall
8139742063regarding
deadlines

MinimumTotalHours: 38(withB.S.W.)
60(without.B.S.W.)
ProgramLevel: Masters
CIPCode: 44.0701
DeptCode: SOK
Program(Major/College): SOKBC

Alsoofferedas: DualDegree
M.S.W./M.P.H.

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: SchoolofSocialWork(SOK)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION
TheSchoolofSocialWork offersaprogramleadingtoaMasterofSocialWork(M.S.W.)degree.Theprogramisfully
accredited by the Council on Social Work Education. A dualdegree program is available with Public Health/Maternal
and Child Health or Behavioral Health. The primary objective of the program is preparation of the graduate for
professionalsocialworkpracticethroughacquisitionofspecializedknowledgeandskillsnecessaryforclinicalpractice
withindividuals,families,andgroups.ThesecondaryobjectivesoftheM.S.W.programare:

1. to prepare students academically for pursuit of doctoral education in social work or related human service
disciplinesorprofessions;

2. tocontributetotheneededsupplyofprofessionallyeducatedclinicalsocialworkersintheTampaBayarea,
thestate,theregion,andthenation.

TheM.S.W.programoffersaspecializedcourseofstudyindirectclinicalpractice.Theprogramoffersstudentsacore
curriculum,pluselectives,andasupervisedfieldexperiencedesignedtoproduceprofessionalswithindividual,family,
andgrouppracticeskills.M.S.W.graduatesarepreparedtoengageinadvancedclinicalsocialworkpractice.Assuch,
itisourgoalthatbycompletionoftheprogram,studentswillbeprepared:

1. Tobecomeadvancedsocialworkpractitionerswhointegratetheknowledge,skills,andvaluesofthe
professionsotheyareabletoconductevidenceinformedpracticeeffectivelyandethicallywithindividuals,
groups,families,organizations,andcommunitiesrangingfromlocaltogloballevels.

2. Toengageinaddressingtheneedsofvulnerable,oppressed,andunderservedpopulationsandtopromote
universitycommunitypartnershipsthatstrengthencommunitiesandfurthersocialandeconomicjustice.

3. Tofurtherthedevelopmentofsocialpoliciesandsocialservicedeliverysystemsthatareeffectiveinmeeting
theneedsofindividualsandcommunitiesatlocalgloballevelsandthatareinconcertwithvaluesofthe
socialworkprofession.

USFTampaGraduateCatalog20132014 SocialWork(M.S.W.)

322
4. Tocontributetothebodyofknowledgeregardingtheoryandskillsthatiscriticaltothepracticeofeffective
socialworkandthevitalityoftheprofession.

5. Toengageinthepursuitofprofessionalifelonglearning,whichmayincludeadvancededucation
preparationnecessarytosustainprofessionalcompetency.

The M.S.W. program placesgreat emphasis onstandards of professional behavior and ethics in thepractice of social
work.EntranceintotheM.S.W.programdoesnotguaranteegraduationfromtheprogram.Studentsadmittedtothe
M.S.W. program must maintain a minimum GPA of 3.0, in all social work courses, with no grade below B counting
toward graduation. Failure to maintain the specified GPA or to exhibit responsible professional behavior determined
by the School may result in suspension or dismissal from the program. Courses with grades below B must be
repeated before progressing to the next sequence. Students must pass the comprehensive paper during the last
semesterinordertograduatefromtheprogram.

Students may pursue the M.S.W. program on either a full or parttime basis. Both programs consist of 60 semester
hoursofstudy.StudentsshouldcheckdirectlywiththeSchoolofSocialWorkforapplicationsandtimelines.Thefull
time program takes four semesters to complete; the parttime program lasts for 7 consecutive semesters. Students
withrecentlyearnedB.S.W.degreesfromprogramsaccreditedbytheCouncilonSocialWorkEducationmayapplyfor
advanced standing and be exempt from up to 15 hours of foundation coursework, thus enabling them to graduate
with38credithours.Boththefullandparttimeprogramsareheavilysequencedandstudentsmuststayinsequence.
Allstudentsmustobtainprofessionalliabilityinsurancepriortoenrollmentinfield.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools and Council of Social
WorkEducation.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

SchoolofSocialWorkApplication
Threelettersofrecommendation
750wordbiographicalsketch
Liberalartsprerequisites
Interviewmayberequired;experienceinthefieldpreferred.

DEGREEPROGRAMREQUIREMENTS
TotalMinimumhours: 60(nonBSWstudents)
38(BSWstudents)

NonBSWStudents:
ProgramRequirements(nonB.S.W.students)60hoursminimum
Summary
FoundationsCourses 17hours
(ex:SOW6105,SOW6305,SOW6235,SOW6405,SOW6348,SOW6xxx)
AdvancedCourses 23hours
FieldCourses 13hours
Electives 6hours
CapstoneProject 1hour
Total 60hours

CoreRequirements 40hours
USFTampaGraduateCatalog20132014 SocialWork(M.S.W.)

323

. HumanBehaviorandSocialEnvironmentCourses 8hours
SOW6105FoundationsofHumanBehavior 3
SOW6124Psychopathology 3
SOW6126Health,Illness,andDisability 2

. SocialWorkPracticeCourses 20hours
SOW6342SocialWorkPracticeWithIndividuals 3
SOW6305FoundationsofSocialWorkMicroPractice 3
SOW6348DiversityandSocialJustice 3
SOW6362SocialWorkPracticeWithCouplesandFamilies 4
SOW6368SocialWorkPracticeWithGroups 3
SOW6375AdvancedSocialWorkMacroPractice 3
SOW6186FoundationsofSocialWorkMacroPractice 2

. PolicyandServicesCourses 6Hours
SOW6235FoundationsofSocialWelfarePolicy 3
SOW6236SocialWelfarePolicyDevelopmentandAnalysis 3

. SocialWorkResearchCourses 6hours
SOW6405FoundationsofSocialWorkResearchandStatistics 3
SOW6438EvaluationofClinicalPracticeinDiverseSettings 3

. SupervisedFieldExperience 13hours
Forfulltimestudents:
SOW6534FieldInstructionI 1
SOW6535FieldInstructionII 4
SOW6536FieldInstructionIII 4
SOW6539FieldInstructionIV 4

Forparttimestudents:
SOW6534FieldInstructionI 1
SOW6553FieldInstructionSequenceIIParttime 2
SOW6554FieldInstructionSequenceII:PartTime 2
SOW6555FieldInstructionSequenceIII:PartTime 2
SOW6556FieldInstructionSequenceIII:PartTime 2
SOW6557FieldInstructionSequenceIV:PartTime 2
SOW6558FieldInstructionSequenceIV:PartTime 2

F. Electives 6hours
Studentsmusttakeatleast3creditsofAdvancedSocialWorkelectives.Allelectivesoutsideoftheprogrammust
beapproved.Dualdegreemajorsmaytakebothelectivesoutsideoftheprogram.

G. ComprehensiveExam 1hour
Captstone Project In lieu of the Comprehensive exam, students wil complete a Capstone Project involving the
contentfromacrossthecurriculum.Itwillbecompletedinthefinalsemester.Itisworth1credithourandmeets
therequirementfortheComprehensiveExam.
SOW8907CapstoneProject(1)

BSWStudents
ProgramRequirements(B.S.W.studentseligibleforAdvancedStanding) 38hoursminimum
Studentsqualifyingforadmissionwithadvancedstandingwillbegincourseworkinthespringorsummersemester.

Summary
AdvancedCourses 23hours(fromsectionsA,B,C,andDabove)
FieldCourses 8hours
Electives 6hours
Compexam(Capstone) 1hour
Total 39hours
USFTampaGraduateCatalog20132014 SocialWork(M.S.W.)

324

Corerequirements 23hours

HumanBehaviorandSocialEnvironmentCourses 5hours
SOW6124Psychopathology 3
SOW6126Health,Illness,andDisability 2

SocialWorkPracticeCourses 12hours
SOW6342SocialWorkPracticeWithIndividuals 3
SOW6362SocialWorkPracticeWithCouplesandFamilies 3
SOW6368SocialWorkPracticewithGroups 3
SOW6375AdvancedSocialWorkMacroPractice 3

PolicyandServiceCourses 3hours
SOW6236SocialWelfarePolicyDevelopmentandAnalysis 3

SocialWorkResearchCourses 3hours
SOW6438EvaluationofClinicalPracticeinDirverseSetting 3

SupervisedFieldExperience 8hours
Forfulltimestudents):
SOW6536FieldInstructionIII 4
SOW6539FieldInstructionIV 4

Forparttimestudents:
SOW6555FieldInstructionSequenceII:PartTime 2
SOW6556FieldInstructionSequenceIII:PartTime 2
SOW6557FieldInstructionSequenceIV:PartTime 2
SOW6558FieldInstructionSequenceIIV:PartTime 2

Electives 6hours
Studentsmusttakeatleast3creditsofAdvancedSocialWorkelectives.Allelectivesoutsideoftheprogrammust
beapproved.Dualdegreemajorsmaytakebothelectivesoutsideoftheprogram.

ComprehensiveExam 1hour
Capstone Project In lieu of the Comprehensive exam, students complete a Capstone Project involving the
contentfromacrossthecurriculumwilbecompletedinthefinalsemester.Itisworth1credithourandmeetsthe
requirementfortheComprehensiveExam.
SOW8907CapstoneProject(1)

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 SocialWork(M.S.W.)andPublicHealth(M.P.H.)

325
SOCIALWORKANDPUBLICHEALTHDUALDEGREEPROGRAMS

DualDegreeProgram
MasterofSocialWork(M.S.W.)/MasterofPublicHealth(M.P.H.)Degrees

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Refertoindividualprogramlistings

MinimumTotalHours: SocialWork45(for
advancedstanding)
PublicHealth42
ProgramLevel: Masters
CIPCode: SocialWork:44.0701
PublicHealth:51.2201
DeptCodes: SOK,DEA
Program(Major/College): SOKBC/MPHPH

Concentrations: MaternalandChildHealth
BehavioralHealth
CONTACTINFORMATION

Colleges: BehavioralandCommunitySciences
PublicHealth

Contact: www.grad.usf.edu

PROGRAMINFORMATION

School of Social Work and the College of Public Health offer a dualdegree program with M.P.H. concentrations in either
MaternalandChildHealthorBehavioralHealth.
Forsocialworkstudentsseekingthedualdegree,expandedstudyinpublichealthencouragesawellbalancedmacromicro
orientation to clinical practice. Such expansion can provide the social work student with specific skills that result in
comprehensive and effective client interventions in health care settings. The fundamental methodological tools of public
health, such as biostatistics, epidemiology, and health management and evaluation, further assist the social worker in
targeting the needs of individuals and communities. The MSW/MPH dualdegree program is a two to three year fulltime
courseofstudy.
Accreditation:AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegesandSchools

ADMISSIONINFORMATION

Students may apply either simultaneously for the Dual Master's Degree Students (indicating this intention on their
application forms) or may add Social Work after admission to the Public Health Program, or add Public Health after
admission to the Social Work Program. Applications for the Dual Master's Degree may be obtained from the Admissions
OfficeattheSchoolofSocialWorkorattheCollegeofPublicHealth.TheapplicationshouldbesignedbytheChairofthe
SocialWorkGraduateSchoolandthenreturnedtheCollegeofPublicHealth.Admissionsareconductedindependentlyand
admissiontooneprograminnowayguaranteesadmissioninadifferentprogram.

DEGREEPROGRAMREQUIREMENTS

Refertotherequirementsforeachdegree.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 SocialWork(Ph.D.)

326
SOCIALWORKPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall February15

MinimumTotalHours: 60
ProgramLevel: Doctoral
CIPCode: 44.0701
DeptCode: SOK
Program(Major/College): SOKBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: SchoolofSocialWork(SOK)

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

TheSchoolofSocialWorkoffersaprogramleadingtoaPh.D.inSocialWork.ThePh.D.programprovidesacourseof
study to prepare graduates for academic and research careers, to provide leadership in research and education
committed to excellence in social work clinical practice and to provide leadership in the development of clinical
servicesfordiverse,vulnerableandunderservedpopulations.

ThePh.D.program,requiring60hoursofstudy,isofferedviaanontraditionalmodelofdelivery.Duringthefirstthree
years, students complete thirtysix hours of course work in nine semesters. These courses are offered in intensive
weekendsessionsduringthefallandspringsemestersandinconcentratedthreeweeksummersessions.Dissertation
work(24hours)istakenduringthecourseofyearsfourandfive.

Thisdoctoralprogramallowsstudentstoattendcourseworkwhilemaintainingfulltimeemploymentcommitments.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
Sameasuniversityplus:

Bachelorsdegreefromanaccrediteduniversityorcollege;undergraduateG.P.A.of3.0inlasttwo(2)yearsof
undergraduatework;
MastersdegreefromCSWEaccreditedsocialworkprogram;G.P.A.ofatleast3.5(ona4.0scale);
GRErequired,withpreferredscoresof500V,500Q;
SchoolofSocialWorkApplication;
Threerecommendationsaddressingapplicantsacademicandprofessionalcapabilities;
CandidatesstatementthatdescribesreasonsforseekingadmissiontothePh.D.inSocialWorkprogram,
careergoals,andresearchinterests;
Professionaloracademicwritingsampleprovidingevidenceofscholarlyabilitiessuchassingleauthored
journalarticle,bookchapter,technicalreport,thesis,grantapplication,orothercomparablework;and
Interview.

USFTampaGraduateCatalog20132014 SocialWork(Ph.D.)

327
DEGREEPROGRAMREQUIREMENTS

Thirtysixhours(36)ofcoursework

CoreRequirements
SOW7491 TheoreticalPerspectivesinSocialWorkResearch 3
SOW7490 FoundationsofSocialWorkResearchMethods 3
SOW7496 QualitativeMethodsInSocialWorkResearch 3
SOW7497 QuantitativeMethodsinSocialWorkResearch 3
SOW7417 AdvancedStatisticsinSocialWorkResearch 3
SOW7616 AdvancedClinicalPracticeWithComplexProblems 3
SOW7446 EvaluationofSocialWorkPractice/ProgramEvaluation 3
SOW7776 TheSocialWorkEducatorintheUniversity 3
SOW7775 CriticalIssuesinSocialwork 3
SOW7919 DirectedStudiesinSocialworkResearch 3
SOW7981 ProposalWritingI 3
SOW7982 ProposalWritingII 3

QualifyingExam
SuccessfulcompletionofqualifyingexaminationsattheendofSemetersevenpreparesthestudentforCandidacy.

OtherRequirements
Completion of remaining course work in semesters eight and nine, and successful defense of a dissertation proposal
admitsthestudentforCandidacy

Dissertation
SuccessfuldefenseofadissertationconsistingoforiginalSocialWorkresearch

SOW7980 DissertationHours 24

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 SpeechLanguagePathology(PostBacc)(M.S.)

328
SPEECHLANGUAGEPATHOLOGY(POSTBACC)PROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: February1

MinimumTotalHours: 62
ProgramLevel: Masters
CIPCode: 51.0204
DeptCode: CSD
Program(Major/College): SPPBC

CONTACTINFORMATION

College: Behavioral&Community
Sciences
Department: CommunicationSciencesand
Disorders(CSD)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

The Department of Communication Sciences and Disorders is devoted to the study of normal and disordered human
communication.Coursesandclinicalpracticeprovidethestudentwithprinciples,researchmethodsandapplicationof
knowledge about the spectrum of verbal and nonverbal communication skills. Diagnosis and remediation of
communicativeproblemsdominatetheclinicalcomponentofthiscourseofstudy.

The Master of Science in Speech Language Pathology is structured to meet the preparation requirements of the
AmericanSpeechLanguageHearingAssociationfortheCertificateofClinicalCompetence.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools. Council of Academic
AccreditationoftheAmericanSpeechLanguageHearingAssociation.

MajorResearchAreas:n/a

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

completionofasetofprerequisitecourses,alsorequiredforstatelicensureandnationalcertificationin
speechlanguagepathology,Theseprerequisitecoursesinclude:
o SPA3004IntroductiontoLanguageDevelopmentandDisorders
o SPA3011IntroductiontoSpeechScience
o SPA3030IntroductiontoHearingSciences
o SPA3101AnatomyandPhysiologyoftheSpeechandHearingMechanism
o SPA3112AppliedPhoneticsinCommunicationDisorders
o SPA3310IntroductiontoDisordersofHearing
o SPA4104Neuroanatomy

atleasta3.20averageona4.00scaleinallworkattemptedwhileregisteredasaupperdivisionstudent
workingforabaccalaureatedegree,
GREwithpreferredscoresof:52
nd
percentile(approx.151)ontheverbalportionORthe52
nd
percentile
(approx.4)onthewritingsectionANDthe32
nd
percentile(approx.145)onthequantitativesection,taken
withinfiveyearsprecedingapplication
threelettersofrecommendation
USFTampaGraduateCatalog20132014 SpeechLanguagePathology(PostBacc)(M.S.)

329
aletterofintentandresume,and
applicantmustalsodemonstratecompetencyincommunicationskillsasdeterminedbythechairpersonor
delegate.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumhours: 62hours

Allspeechlanguagepathologymajorsmustcompletethefollowing:

CoreRequirements 29hours

SPA5204 AdvancedClinicalPhonology 3
SPA5403 LanguageLearningintheSchoolAgeyears 3
SPA5552 DiagnosticPrinciplesandPractices 3
SPA6211 AdvancedVocalDisorders 3
SPA6225 AdvancedFluencyDisorders 3
SPA6410 Aphasia 3
SPA6559 AugmentativeandAlternativeCommunication 3
SPA6571 EthicalPracticeIssuesinComm.Disorders 2
SPA6805 ResearchProceduresinComm.Sci.&Disorders 3
SPA6565 SeminarinDysphagia 3

Practicum 24hours
Also,studentswillenrollinsufficientgraduateclinicalpracticum(24credits)tomeetaminimumof400clockhoursto
fulfill the requirements of the American SpeechLanguageHearing Association. Of these hours, 25 hours must be in
observationandatleast250clockhoursmustbeinspeechlanguagepathology.

Thesisoption 9hours
SPA6910DirectedResearch 1hourmin
SPA6971Thesis 8hoursmin

Thenumberofpracticumhoursisadjustedfrom24hoursto21hourstoallowthethesisstudenttotakeoneelective.
Thiselectivewillbeselectedwiththeassistanceofthethesisadvisor.

Nonthesisoption
Each student must complete an additional nine (9) hours of coursework selected with the assistance of an advisor
fromtheelectiveslist.

Electives

SPA5133C SpeechScienceInstrumentation 3
SPA6232 NeuromotorDisordersofSpeech 3
SPA6245 CraniofacialCommunicationDisorders 3
SPA6324 AuralRehabilitation:Children* 3
SPA6401 PediatricLanguageDisorders 3
SPA6404 LanguageLearningDisabilities 3
SPA6417 Communication&CognitioninTraumaticBrainInjury 3
SPA6473 MulticulturalDifferencesinLanguageUse 3
SPA6564 SeminarinAging,Cognition,andCommunication 3
SPA6910 DirectedResearch varies
*requiredforstudentswhohavenothadacourseinauralrehabilitationattheundergraduatelevel

GPAandComprehensiveExamRequirements
AlsorequiredforgraduationaretheattainmentofaBorbetterineachgraduateSpeechLanguagePathologycourse,
theattainmentofclinicalcompetenceandaGPAof3.0inallcourseworkandclinicalpractica,andsatisfactorypassage
ofacomprehensiveexamination.
USFTampaGraduateCatalog20132014 SpeechLanguagePathology(PostBacc)(M.S.)

330
OnlineOption
Forindividualswhohaveabachelorsdegreeinspeechlanguagepathologyandarecurrentlyworkinginthepublic
schoolsystemasaspeechlanguagepathologyassistant,weofferaparttimeonlinegraduateprogram,whichcanbe
completedin9semesters.Theadmissionanddegreerequirementsarethesameasthoselistedfortheresidential
program.Allacademiccourseworkisofferedonline.Thethreeelectivesforthenonthesisoptionareselectedbythe
programandaredesignedtomeettheuniqueneedsoftheclinicianpracticinginaschoolsetting.Thethesisoptionis
notavailableforthistrack.Outofthesixrequiredclinicalpracticum(atotalof24credits),fourarecompletedonthe
jobduringtheschoolyear,oneiscompletedontheTampacampusduringthesecondsummer,andthethirdsummer
isdevotedtoaccruingclinicalhoursatalocalexternshipsite.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

331
www.coba.usf.edu
Section14

C
C
O
O
L
L
L
L
E
E
G
G
E
E
O
O
F
F
B
B
U
U
S
S
I
I
N
N
E
E
S
S
S
S

USFTampaGraduateCatalog20132014 Section14:CollegeofBusiness

332
www.coba.usf.edu
ChangestoNote

ThefollowcurricularchangesfortheCollegeofBusinesswereapprovedbytheUSFTampaGraduateCouncil
onthedatenoted.

NewPrograms
SportandEntertainment
Management(M.S.)
NewDegreeProgram

GCApproved1/14/13
BOTapproved3/21/13
PendingadditiontoSUS
inventory

NewCollaborativeProgram
ManagementInformation
Systems(M.S.)
ProposedprogramtoInfosysemployeesinIndia 3/5/12

NewDualDegreeProgram
Business(MBA):SportBusinessConcentration/SportsandEntertainmentManagement(MS) 5/6/13

DualDegreeProgramChanges
EntrepreneurshipinApplied
Technologies(MS)
andBiotechnology(MSB)
ChangecurriculuminBiotechnology 5/21/12

ProgramChanges
BusinessAdministration
(M.B.A.)
ChangeCurriculum:
TerminationofECNconcentration.AddREEandENTcoursesasoptionsfor
breadthrequirements.Increaserequiredcoursefrom10creditsto17credits
NewConcentration:SportBusiness.TheCoreCoursesidentifiedrequiredwill
equaltocore.

11/7/11,12/5/11,
1/19/12,3/5/12,
4/2/12,6/8/12,
12/7/12,1/14/13
BusinessAdministration
(Ph.D.)
Changecurriculum;confirmcore 5/6/13

EntrepreneurshipinApplied
Technologies(M.S.)

Changecurriculum 5/6/13
Finance(M.S.) Changecurriculum;replacecourserequirements;Reviseduetocoursechanges

11/7/11,9/10/12
Management(M.S.) Reducehoursfrom32to30;changeadmissions

1/9/12
ManagementInformation
Systems(M.S.)
ChangeCurriculum:addnewtrackinBusinessIntelligence;addSAS
AddlanguageforBusinessIntelligencetracktoMSMIScatalogcopy

11/7/11,12/5/11,
2/6/12,2/4/13

GraduateCertificates
BusinessFoundations NewGraduateCertificate

3/5/12
PrograminNationaland
CompetitiveIntelligence

NewGraduateCertificate 11/5/12
AnalyticsandBusiness
Intelligence
NewGraduateCertificate 2/4/13

USFTampaGraduateCatalog20132014 Section14:CollegeofBusiness

333
www.coba.usf.edu

UniversityofSouthFlorida
CollegeofBusiness
4202E.FowlerAve.,BSN3403(locBSN103)
Tampa,FL33620

Webaddress: http://business.usf.edu.
Email: mba@coba.usf.edu
Phone: 8139743335
Fax: 8139744518

CollegeDean: MoezLimayem
AssociateDeans: KaushalChariandJacquelineReck
FacultyDirector: RosannCollins
GraduateCoordinator: IreneHurst

Accreditation:
The Ph.D., M.B.A., M.S. in Management Information Systems, M.S. in Management, M.S. in Finance, Master of
Accountancy,M.S.inMarketing,M.S.inEntrepreneurship,M.S.inSportandEntertainmentManagementandM.S.inReal
Estate programs in the College of Business are accredited by the AACSB International The Association to Advance
CollegiateSchoolsofBusiness.TheCollegealsoisamemberoftheGraduateManagementAdmissionCouncil(GMAC).

MissionStatement:
The USF College of Business will provide a highquality, diverse learning environment preparing students to
contributetoandtakeleadingpositionsinbusinessandsociety.Ourteaching,scholarship,andservicewilllink
theoryandpracticetobenefittheUniversityandthecommunitiesitserves.

Degrees,Programs,andConcentrations:

MasterofAccountancy(M.Acc.)
Accountancy(MAC)
Audit/Systems(AUS)
Tax(TAX)

MasterofBusinessAdministration(M.B.A.)
BusinessAdministration(fulltimeorparttime)(BUS)
SportBusiness(SEM)
ExecutiveM.B.A.(MBA)

MasterofScience(M.S.)
EntrepreneurshipinAppliedTechnologies(EAT)
Finance(FIN)
Management(MAN)
ManagementInformationSystems(MIF)
SportandEntertainmentManagement(SMG)

MasterofScienceinMarketing(M.S.M.)
Marketing(MKT)

MasterofScienceinRealEstate(M.S.R.E.)
RealEstate(RST)

USFTampaGraduateCatalog20132014 Section14:CollegeofBusiness

334
www.coba.usf.edu
DoctorofPhilosophy(Ph.D.)
BusinessAdministration(BUD)
Accounting(ACC)
Economics(ECO)
Finance(FIN)
InformationSystems(IST)
Marketing(MKT)
Alsoseeapplicationareasinprogramdescriptions.

DualDegreePrograms
BiomedicalEngineering(MSBE)/EntrepreneurshipinAppliedTechnologies(M.S.)

BusinessAdministration(MBA):SportBusinessConcentration/
SportsandEntertainmentManagement(M.S.)

GraduateCertificatesOffered:
SeeGraduateCertificatewebsitehttp://www.gradcerts

COLLEGEREQUIREMENTS

NonDegreeSeekingStudents
The College of Business will approve, on a space available basis, nondegree seeking student status for
transientstudents(degreeseekingstudentsatanotherAACSBaccreditedinstitution)orforstudentswith
valid reasons to register in this status and who meet all admission requirements. Contact the college for
additionalrequirements.
USFTampaGraduateCatalog20132014 Section14:CollegeofBusiness

335
www.coba.usf.edu
AbouttheCatalog

The University of South Florida Graduate Catalog is organized with the degree programs offered listed in the
section of the College that offers them. For example, the Master of Science degree with a program (also
known as major) in Biology is listed in the College of Arts and Sciences section. Some colleges offer areas of
specialization,orconcentrationswithinadegreeprogram.

PROGRAMS

BUSINESSADMINISTRATIONPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

CONCENTRATIONS

ConcentrationRequirementsarelistedseparatelyundereachProgram.

TheProgramandConcentrationarelistedontheofficialtranscript.Otherareas,suchasapplicationtracks,are
notlistedonthetranscript.

Example:
DoctorofPhilosophyinBusinessAdministration
withaConcentrationinFinance
Green denotes
Program (or Major)
Black denotes degree
USFTampaGraduateCatalog20132014 Accountancy(M.Acc.)

336
www.coba.usf.edu
ACCOUNTANCYPROGRAM

MasterofAccountancy(M.Acc.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: March1
Spring: October1
Summer: March1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 52.0301
Dept.Code: ACC
Program(Major/College): MACBA
Concentrations:
Audit/Systems(AUS)
Tax(TAX)

Alsoofferedas:
ConcentrationunderBusinessAdministration(Ph.D.)
CONTACTINFORMATION

College: Business
Department: SchoolofAccountancy(ACC)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

TheobjectiveoftheMasterofAccountancy(M.Acc.)Programistoprovidecandidateswithgreaterbreadthanddepth
of knowledge in accountancy than is possible in the baccalaureate program. The program is designed to meet the
increasingneedsofbusiness,government,andpublicaccounting.StudentsenteringTheM.Acc.Programmustalready
have the equivalent of an undergraduate degree in accounting from an AACSB accredited school. The program may
alsobestructuredtosatisfytherequirementstositfortheCPAExaminationinFlorida.

Accreditation:
AccreditedbyboththeCommissiononCollegesoftheSouthernAssociationofCollegeandSchools(SACS)andAACSB
International(TheAssociationtoAdvanceCollegiateSchoolsofBusiness).

MajorResearchAreas:
Contactdepartment.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Atleasta3.00upperlevelaccountingGPA(minimumof21hoursataU.S.AACSBaccreditedprogram
withinthepast5years
A3.00overallupperlevelGPA
A500orhigherGMATscore
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550orhigher
onwrittenversion,a213orhigheronthecomputerbasedtest,ora79ontheInternetbasedtest.

AdmissiontotheM.Acc.programiscompetitive.Forfullconsideration,pleasesubmityourapplicationbythe
deadlinesshownabove.

USFTampaGraduateCatalog20132014 Accountancy(M.Acc.)

337
www.coba.usf.edu
DEGREEPROGRAMREQUIREMENTS

For the student who has the equivalent of an undergraduate major in accounting at USF (including 2124 hours of
upperlevelaccountingcourseworktakenwithinthelast5years),theprogramconsistsof30hours.Most(24hours)of
theprogramisdevotedtothestudyofaccounting.Theremainingsix(6)hoursconsistofstudyinotherbusinessareas
including economics, entrepreneurship, finance, and information systems/decision sciences. These six 6) hours are
elected by the student in consultation with the M.Acc. Advisor. At least 70% of the coursework must be at the 6000
level.

The M.Acc. curriculum has a set of three required common core accounting courses. Students may elect a
concentration(12hours)ineitherTaxorAudit/systems.Ifastudentdoesnotwishtoelectaconcentration,astudent
may follow the Generalist Track below. The sequencing of courses will be determined in consultation with the
M.Acc.Advisor.

TotalMinimumhours: 30
Atleast21hoursmustbein6000levelcourses

CoreRequirements

RequiredCoreAccountingCourses 6hours
ACG6875 FinancialReportingandProfessionalIssues 3
ACG6932 IntegrativeAccountingSeminar 3

GENERALISTTRACK
AccountingElectives 18hours
Selectfrom:
ACG6476 ContemporaryIssuesinAccountingInformationSystems 3
ACG6636 ContemporaryIssuesinAuditing 3
TAX6065 ContemporaryIssuesinTaxation 3
ACG6346 ContemporaryIssuesinManagerialAccounting 3
ACG6936 SelectedTopicsinAccounting 3
TAX6445 EstatePlanning 3
ACG5205 AdvancedFinancialAccounting 3
ACG5675 InternalandOperationalAuditing 3
ACG5505 Governmental/NotforProfitAccounting 3
TAX5015 FederalTaxationforBusinessEntities 3
ACG6457 AccountingSystemsAudit,Control&Security 3
TAX6134 AdvancedCorporateTaxation 3
TAX6005 AdvancedPartnershipTaxation 3

NonaccountingElectives 6hours
ElectivesmustbeapprovedinadvancebyM.Acc.Advisor 6

TAXCONCENTRATION
TaxCourses 12hours
Selectfrom:
TAX5015 TaxationofBusinessEntities* 3
TAX6134 AdvancedCorporateTaxation 3
TAX6005 AdvancedPartnershipTaxation 3
TAX6445 EstatePlanning 3
TAX6065 ContemporaryIssuesinTaxation 3
(*Note:TAX5015maycountintheM.Acc.programonlyifitisnotcountedtowardstheBachelorsDegree)

AccountingElectives 6hours
Selectfrom:
ACG6476 ContemporaryIssuesinAccountingInformationSystems 3
ACG6636 ContemporaryIssuesinAuditing 3
TAX6065 ContemporaryIssuesinTaxation 3
USFTampaGraduateCatalog20132014 Accountancy(M.Acc.)

338
www.coba.usf.edu
ACG6346 ContemporaryIssuesinManagerialAccounting 3
ACG6936 SelectedTopicsinAccounting 3
TAX6445 EstatePlanning 3
ACG5205 AdvancedFinancialAccounting 3
ACG5675 InternalandOperationalAuditing 3
ACG5505 Governmental/NotforProfitAccounting 3
TAX5015 FederalTaxationforBusinessEntities 3
ACG6457 AccountingSystemsAudit,Control&Security 3
TAX6134 AdvancedCorporateTaxation 3
TAX6005 AdvancedPartnershipTaxation 3

NonaccountingElectives 6hours
ElectivesmustbeapprovedinadvancebyM.Acc.Advisor 6

AUDIT/SYSTEMSCONCENTRATION

Audit/SystemsCourses 12hours
Selecttwo(2)coursesfrom:
ACG6405 AdvancedAccountingInformationSystems 3
OR
ACG6457 AccountingSystemsAudit,Control&Security 3

ACG6636 ContemporaryIssuesinAudit 3
OR
ACG5675 InternalandOperationalAudit 3

Theremainingtwo(2)coursesshouldbeselectedfrom:
ACG6405 AdvancedAccountingInformationSystems 3
ACG6457 AccountingSystemsAudit,Control&Security 3
ACG6636 ContemporaryIssuesinAudit 3
ACG5675 InternalandOperationalAudit 3
ISM6930 EnterpriseResourcePlanning&BusinessProc.Mgmt. 3
ISM6930 InformationSecurity&RiskManagement 3

AccountingElectives 6hours
Selectfrom:
ACG6476 ContemporaryIssuesinAccountingInformationSystems 3
ACG6636 ContemporaryIssuesinAuditing 3
TAX6065 ContemporaryIssuesinTaxation 3
ACG6346 ContemporaryIssuesinManagerialAccounting 3
ACG6936 SelectedTopicsinAccounting 3
TAX6445 EstatePlanning 3
ACG5205 AdvancedFinancialAccounting 3
ACG5675 InternalandOperationalAuditing 3
ACG5505 Governmental/NotforProfitAccounting 3
TAX5015 FederalTaxationforBusinessEntities 3
ACG6457 AccountingSystemsAudit,Control&Security 3
TAX6134 AdvancedCorporateTaxation 3
TAX6005 AdvancedPartnershipTaxation 3

NonaccountingElectives 6hours
ElectivesmustbeapprovedinadvancebyM.Acc.Advisor 6

TotalMinimumHours:30
Atleast21hoursmustbein6000levelcourses

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 BusinessAdministration(M.B.A.)

339
www.coba.usf.edu
BUSINESSADMINISTRATIONPROGRAM

MasterofBusinessAdministration(M.B.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: July1
Spring: November1
Summer: NoAdmit

International:
Fall: February1
Spring: July1
Summer: NoAdmit

MinimumTotalHours: 32
ProgramLevel: Masters
CIPCode: 52.0101
Dept.Code: DEA
Program(Major/College): BUSBA

Concentrations:
SportBusiness(SEM)

CONTACTINFORMATION

College: Business

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you
www.mba.usf.edu

PROGRAMINFORMATION

TheMasterofBusinessAdministration(M.B.A.)isaprofessionaldegreedesignedtopreparegraduatesformanagerial
roles in business and notforprofit organizations. Graduates will develop the necessary skills and problemsolving
techniques that will permit them to make an early contribution to management and eventually to move into broad,
generalmanagementresponsibilitiesattheexecutivelevel.
Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools (SACS); AACSB
International.(TheAssociationtoAdvanceCollegiateSchoolsofBusiness).

MajorResearchAreas:
Contactcoordinatorfordepartment

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements
The USF MBA admission committee will consider the strength of each applicant based on the entire completed
application. The Admission committee will consider the following: prior collegelevel academic performance
(bachelorsdegreefromaregionallyaccreditedinstitutionrequired);GMAT(preferred),GREorMCATscores;relevant
professionalworkexperience;recommendationletters;astatementofpurpose;communityorvolunteerservice;and
anyotherinformationthathelpsinensuringthepotentialsuccessoftheapplicantintheprogram.Applicantswhose
native language is not English or who have not earned a degree in the United States must also submit TOEFL scores
earnedwithintwo(2)yearsofthedesiredtermofentry.Aminimumtotalscoreof79ontheInternetbasedtest,213
onthecomputerbasedtest,or550onthepaperbasedtestisrequired.Studentspersonalcharacteristicsthataddto
thediversityoftheclassmayalsobeconsidered.

USFTampaGraduateCatalog20132014 BusinessAdministration(M.B.A.)

340
www.coba.usf.edu
DEGREEPROGRAMREQUIREMENTS

TotalMinimumhours: 32

TheM.B.A.degreeisa3235hourprogram.AllM.B.A.candidatesmustcompletealldegreerequirementswithinfive
(5)yearsofbeginningtheprogram.Thefulltimestudentgenerallywillneed34semesterstocompletetheprogram.
Parttimestudentscancompleteallworkwithinareasonabletimeapproximatelythreeyears.Parttimestudentsare
encouraged to take two courses per semester and must complete 12 hours per calendar year to remain on active
statusasadegreeseekingstudent.Coursesarescheduledtoaccommodatebothfulltimeandparttimestudents.All
courses are at the graduate level. Students entering the program are expected to have sufficient competency in
mathematics (college algebra), communication skills (written and verbal), basic computer skills, highspeed internet
acccess,andabusinessfoundation.

BUSINESSFOUNDATION

IndividualsacceptedintotheMBAprogramareexpectedtohaveacommonbodyofbusinessknowledge,as
evidencedbyadegreeinabusinessdisciplinefromanaccreditedinstitution.Ifastudenthasanundergraduate
degreefromanAACSBaccreditedinstitutionthestudentmayrequesttowaivefoundationcoursestakenwithin
thelast7years.StudentswithdegreesfromaU.S.regionallyaccreditedinstitutionsorinternationalinstitutions
alsomayrequestawaiverofoneormorefoundationcoursesbyprovidingasyllabusforeachcourse.
Studentswhodonotwaivefoundationcourserequirementswilltaketheprerequisitebusinessfoundation
coursesatthestartoftheprogram.

StudentsmaywishtocompletefoundationcourseworkbeforeapplyingtotheMBAprogramortheymaywishto
completeonlythefoundationcourseswithoutapplyingtotheMBAprogram.ForsuchstudentstheCertificatein
BusinessFoundationsisavailable.InformationaboutandadmissionrequirementsfortheCertificateinBusiness
FoundationsisavailableattheCollegeofBusinessWebsitehttp://business.usf.edu/.

StudentswhoarenotrequiredtotakethebusinessfoundationcoursesarerequiredtotakeanMBABootCamp
course(noncredit)inthefirstsemesterofenrollment.

StudentspursuingageneralMBAmaychooseelectivesfromamongnonfoundationgraduatelevelcourses
offeredinthecollege,orothercollegesifanapprovedpartoftheirprogramofstudy.

BusinessFoundationCourses: 16Credits

BusinessDecisionMaking
MAN6147 Leadership/ManagementConcepts 2
ISM6021 ManagementInformationSystems 2

BusinessMeasurement
ACG6026 AccountingConceptsforManagers 3
QMB6305 ManagerialDecisionAnalysis 2
FIN6406 FinancialManagement 2

MarketOrientation
MAR6815 MarketingManagement 2
ECO6005 IntroductiontoEconomicConcepts
ForManagers 3

USFTampaGraduateCatalog20132014 BusinessAdministration(M.B.A.)

341
www.coba.usf.edu
M.B.A.COURSESTRUCTURE

RequiredCourses: 17Credits
GEB6445 Social,Ethical,LegalSystems 2
MAN6055 OrganizationalBehaviorandLeadership 2
QMB6603 OperationsManagementandQualityEnhancement 2
FIN6466 FinancialAnalysis 2
MAN6726 StrategicBusinessAnalysis 2
GEB6226LeadershipSpeakerSeries 1
GEB6215 CommunicationSkillsforManagers 2
GEB6895 IntegratedBusinessApplications 4

Electives 15creditsminimum
NOTE:Someelectivecoursesmaynotbeofferedeachyear

TotalSemesterCreditsRequired 3235Credits

IntegratedBusinessApplications
TheMBAcapstonecourse,IntegratedBusinessApplications,affordsstudentstheopportunitytointegrateandapply
knowledge,skillsandexperienceastheydevelopacohesive,comprehensivebusinessplanthatservesasthefocal
pointoftheirlearningforthesemester.Workinginteams,studentsdevelopandpresentastrategic/marketingplan,
animplementationplansupportedbyfinancialstrategiesandproformafinancialstatements,andabalanced
scorecarddesignedtoprovidemultiplemeasuresofstrategic,operating,andfinancialperformance.

Constraints
1. Themaximumcreditsrequiredisthirtyfive(35);theminimumisthirtytwo(32).
2. StudentswithanundergraduatedegreeinbusinessfromanAACSBaccreditedprogramarerequiredtotakeMBA
Bootcamp(noncredit)inthefirstsemesterofenrollment.
3. Students who are required to take the foundation courses are required to take 15 hours of elective courses.
StudentswhoarerequiredtotakeBootcamparerequiredtotake18credithoursofelectivecourses.

NOTE:Foundationcoursesmaynotbecountedaselectives.

Thesis
Studentsmayelecta6hourthesisinanyoftheareasofthebusinessdisciplinessubjecttodepartmentalapproval.

MBA/CONCENTRATIONINSPORTBUSINESS
TheMBAwithaConcentrationinSportBusinesspreparesgraduatestocontributetoandtakeleadingpositionsinthe
globalsportandentertainmentindustry.Itcomplementsthesolidgroundingintheappliedfundamentalsof
accounting,finance,informationsystems,managementandmarketingprovidedbyarecognized,highqualityMBA
withcourseworkfocusedonthebusinessofsporthumancapital,organizationresourcesanddevelopment,
innovationandtechnologyinsport,cultureandbusinessrelationships,sportandlawandemergingissuesinglobal
sport.Academiccourseworkissupportedbyinternships,mentorships,professionalseminars,guestspeakers,and
networkingopportunitiestoprovidegraduatesthetoolsandskillstofunctioneffectivelyinthecompetitiveglobal
environmentofsportandentertainmentmanagement.

Theidealdegreecandidatewillhaveapassionforthebusinessandindustryratherthansimplybealoverofsports.
TheMBAwithaConcentrationinSportBusinessisadirectadmitprogram:applicantsshouldapplyviatheprogram
Website:http://business.usf.edu/programs/graduate/sportentertainment/ratherthantotheCollegesMBAOffice.
Studentscomplete17hoursofrequiredMBAcourseworkand15hoursofsportandentertainmentcoursework.

RequiredCourses: Credits:
GEB6445 Social,Ethical,LegalSystems 2
QMB6603 OperationsManagementandQualityEnhancement 2
FIN6466 FinancialAnalysis 2
USFTampaGraduateCatalog20132014 BusinessAdministration(M.B.A.)

342
www.coba.usf.edu
GEB6215 CommunicationSkillsforManagers 2
MAN6726 StrategicBusinessAnalysis 2
MAN6055 OrganizationalBehaviorandLeadership 2
GEB6226 LeadershipSpeakerSeries 1
GEB6895 IntegratedBusinessAnalysis 4

SportBusinessConcentrationcoursesare:

SPB6719 SportandEntertainmentMarketingStrategy 3
SPB6406 SportandEntertainmentLaw 3
SPB6816 ContemporaryIssuesinSport&EntertainmentManagement 3
SPB6706 SportBusinessAnalytics 3
SPB6946 InternshipinSportandEntertainmentManagement 3

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 BusinessAdm:SportBusiness(MBA)and
SportandEntertainmentManagement(M.S.).

343
www.coba.usf.edu
BUSINESSADMINISTRATION:SPORTBUSINESSCONCENTRATIONAND
SPORTANDENTERTAINMENTMANAGEMENTDUALDEGREEPROGRAM

MasterofBusinessAdministration(M.B.A.)and
MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Refertospecificindividualprogramlistingfordeadlines

MinimumTotalHours: 32/30
ProgramLevel: Masters
CIPCode: 52.0101/31.0504
Dept.Codes: DEA
Program(Major/College): BUS/BA,SEM/BA

CONTACTINFORMATION

College: Business

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Dual Degree prepares graduates to contribute to and take leadership positions in the global sport and
entertainmentindustry.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementsforeachprogram.
TobeadmittedtotheMSinSportandEntertainmentManagement,studentsmustbeconcurrentlyenrolledinthe
MBAwithaConcentrationinSportBusiness.Refertoindividualprogramlistingsforspecificrequirements.

DEGREEPROGRAMREQUIREMENTS

Refertoindividualprogramlistingsforspecificrequirements.

TheMBAwithaConcentrationinSportBusinessisa32credithourprogramcomprising17hoursofadvancedtools
and15hoursofsportandentertainmentfocusedcoursework.TheMSinSportandEntertainmentManagementisa
30credithourprogram.Theschedulebelowshowsthesequenceofcoursesrequiredtoearnbothdegrees.All53
hoursofcourseworkinbothprogramsarerequiredtoearnbothdegrees;therearenoelectives.

CoursesrequiredfortheMBA/SBareindicatedintehcurricularsequencebelowasMBA;coursesrequiredforthe
MS/SEmareindicatedasMS;theninecommoncredithoursareindicatedasMBA/MS.

USFTampaGraduateCatalog20132014 BusinessAdm:SportBusiness(MBA)and
SportandEntertainmentManagement(M.S.).

344
www.coba.usf.edu
SEQUENCE

FirstFallSemester
1
st
EightWeeks
GEB6445 Social,Legal,EthicalSystems MBA 2
QMB6603 OperationsManagement MBA 2
MAN6055 OrganizationalBehaviorandLeadership MBA 2

2
nd
EightWeeks
FIN6466 FinancialAnalysis MBA 2
MAN6726 StrategicBusinessAnalysis MBA 2
GEB6215 CommunicationSkillsforManagers MBA 2

SpringSemester
4WeekSession
GEB6226 LeadershipSpeakerSeries MBA 1

12WeekSession
SPB6719 SportandEntertainmentMarketingStrategy MBA/MS 3
SPB6406 SportandEntertainmentLaw MBA/MS 3
SPB6706 SportBusinessAnalyitics MBA/MS 3
SPB6816 ContemporaryIssuesinSportandEntertainment
Management MBA/MS 3

SummerSession
SummerC
SPB6946 InternshipinSportandEntertainment
ManagementI MBA 3
GEB6895 IntegratedBusinessApplications MBA 3

TotalMBA/SPB:32credithours
SecondFallSemester
12weeksession
SPB6605 SportandSocialIssues MS 3
SPB6116 SportandEntertainmentFinance MS 3
SPB6735 GlobalEnvironmentofSport MS 3

SecondSpringSemester
12weeksession
SPB6807 SocialMediainSport MS 3
SPB6608 IssuesintheAmeriacnSportIndustry MS 3
SPB6715 SalesandFundraisingintheSportIndustry MS 3

SummerSemester
SummerC
SPB6946 InternshipinSportandEntertainmentManagementIIMS 3

IncrementalMS/SEM:21credithours

TotalMBA+MS/SEM:53credithours

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

345
www.coba.usf.edu
BUSINESSADMINISTRATIONPROGRAM

DoctorofPhilosophy(Ph.D.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: January2
Falladmissiononly
MinimumTotalHours: 90
ProgramLevel: Doctoral
CIPCode: 52.0201
Dept.Code: DEA
Program(Major/College): BUDBA

Concentrations:
Accounting
Economicsbeingterminated
Finance
InformationSystems
Marketing

CONTACTINFORMATION

College: Business

ContactInformation: www.grad.usf.edu

PROGRAMINFORMATION

The Ph.D. program offered by the College of Business provides its graduates with preparation for careers as college
and university professors and as research and staff personnel in industry and government. The doctoral program
provides for intellectual growth as students work closely with faculty in seminars, research projects, and other
assignments which develop their teaching and research skills. The curriculum offers breadth of understanding of the
integralcomponentsofbusinessadministrationaswellasdepthoffieldspecializationsufficienttopermitthestudent
tomakeameaningfulcontributiontotheirdiscipline.Theprogramissufficientlyflexibletoalloweachstudenttobuild
uponhisorherstrengthsandtoaccommodatestudentswithvariouslevelsofpreparationinawidevarietyoffields,
andinareasoutsidethecollege.However,thedegreeconferredisPhDinBusinesswithaconcentrationinoneofthe
departmentalareas.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools;AACSBInternational
TheAssociationtoAdvanceCollegiateSchoolsofBusiness.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

CompetitivebasedonGPA,GMATorGRE
personalstatement
recommendations
interview
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550orhigher
on the written version, a minimum score of 213 on the computerbased test or a 79 on the internetbased
test.
USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

346
www.coba.usf.edu
DEGREEPROGRAMREQUIREMENTS

A minimum of 90 semester hours beyond the bachelor's degree is required. This includes 21 hours of dissertation. A
minimumof45hoursofcourseworkmustbecompletedattheUniversityofSouthFlorida.

FoundationCourses
These courses are designed to develop an appreciation of the institution of business and to help students see how
their areas of specialization fit into this general picture. With the approval of the student's program committee, a
studentmaysatisfytheserequirementsinanyofthefollowingways:

A. By completing an undergraduate degree in business at an AACSB accredited institution, with an average of


"B"orbetterinthelast60hours,nomorethan5yearspriortoadmissiontothePh.D.program.

B. BycompletinganM.B.A.degreeatanAACSBaccreditedinstitution,nomorethan5yearspriortoadmission
tothePh.D.program

C. Bycompletingoneapprovedcoursewithagradeof"B"orbetterineachofthefunctionalareas:Accounting,
Finance, Information Systems, Management, and Marketing. All graduatelevel courses at the 6000 level or
above,withtheexceptionofspecific"tool"courses(e.g.statistics),willcounttowardthisrequirement.

D. By successfully petitioning the doctoral Program Committee to accept previous academic work (e.g.,
specializedMastersprogramsinbusiness,degreesgrantedmorethan5yearsago,etc.)infulfillmentofallor
partofthisrequirement.Suchapetitionmustbeinitiatedduringthefirstsemesteroftheprogram.

COREREQUIREMENTS
ThecorecoursesaredesignedtoprovideastrongbackgroundinEconomicsandtodevelopthestudent'squantitative
andstatisticalresearchskills.Thesecoursesarerequiredofallstudentsintheprogram.TheCollegewillwaiveacourse
only if the student has passed the same or equivalent course with a grade of "B" or better within the preceding five
years.

TheEconomicsrequirementcanbemetbycompletingtwograduateleveleconomicscoursesthathavebeenapproved
bythestudentsprogramcommittee.

Students are required to take a one credit hour research skills course, QMB 7555, Research and Writing Wkills for
Doctoral students, in the first semester of the Program. Following this introductory course, the quantitative and
statistical coursework is to be determined by the student's program committee in consultation with the student. A
threecourseseriesisrequired.Anappropriatesequenceshouldbechosenfromthefollowing:

ECO6424 EconometricsI 3
ECO6425 EconometricsII 3
ECO7426 EconometricsIII 3
ECO7427 EconometricsIV 3
QMB6375 AppliedLinearStatisticalModels 3
QMB7565 IntroductiontoResearchMethods 3
QMB7566 AppliedMultivariateStatisticalMethods 3

Any substitution of appropriate mathematics, statistical and quantitative coursework must be approved by the
DoctoralProgramCommittee,preferablyatthetimeofacceptance,ordefinitelybeforethestudenttakesasubstitute
course. In addition, students are required to take an additional research elective approved by their advisory
committee. Should a student earn a grade of "C" or lower in the core courses, the case will be brought before the
DoctoralProgramCommitteeforreview.Afterreviewingthecase,theCommitteewilltakeoneofthefollowingsteps:

a. Requirethestudenttopassanexaminationthatcoversthematerialrelevanttothesubject.Astudent
whofailstheexamonthefirstattemptmayretakeitwithinoneyear.Astudentwhofailstheexamon
thesecondattemptwillbesubjecttodismissal.
b.Requirethestudenttoretakethecourse.Ifthestudentretakesthecourseandfailstoreceiveagradeof
Borbetter,thestudentissubjecttodismissal.

USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

347
www.coba.usf.edu
ConcentrationField
All students will take at least five (5) courses at the 6000 or 7000 level in an area designated as the student's
Concentration.Studentsareencouragedtoidentifycoursesintheconcentrationfieldthatwillprovideexperiencein
applying current research techniques to problems in that field. To accomplish this, the student may propose a
combinationofformalclassroomcoursesandindependentdirectedresearchcourses.Thiscombinationmayincludea
yearlong research seminar in which the groundwork is laid for the student's dissertation. The specific agenda of
courses will be determined by the student's program committee. The following fields are offered: Accounting,
Economics, Finance, Information Systems, Management (inactive) and Marketing. Courses taken as part of the
FoundationorCoresectionsmaynotbecountedaspartofthehoursrequiredforaconcentrationfield.

SupportField (9hours)
Thesupportareawillconsistofaminimumofthreecourses(9hours)fromoneormoreofthefieldslistedunderthe
concentration field, or elsewhere in the university. The support field and the concentration field cannot be taken in
thesamedepartment.Courseswithinthesupportfieldcanbeselectedtocomplementtheconcentrationfieldandin
special cases may include courses outside the College of Business. The nature and number of the support area
courses will be determined by the Student's Program Committee in consultation with the Ph.D. coordinator of the
supportfielddepartment.CoursestakenaspartoftheFoundationorCorecoursesmaynotbecountedaspartofthe9
hoursrequiredforsupportfields.

CONCENTRATIONS
Studentsselectoneofthefollowingconcentrations:

AccountingConcentrationRequirements

TheAccountingconcentrationemphasizes:
Themasteryofoneormorespecializedareasofaccounting,suchasaccountinginformationsystems,
auditing,orfinancialaccounting
Thedevelopmentofrequisiteskillstoengageinrespectedapplied,practicalandscholarlyresearch
Thedevelopmentofeffectiveteachingskills
TheconcentrationrequiresmeetingtheCollegeofBusinessfoundationcourserequirementsandcompleting41
hoursofcoursework.The41hoursofcourseworkinclude:
17credithoursofcorerequirementsrelatedtoeconomicsandresearchmethods
15credithoursofaccountingcourses
9credithoursinasupportfield

EconomicsConcentrationBeingterminated.

FinanceConcentrationRequirements

Inadditiontotherequiredcoreandfoundationcourses,thecurriculumwillnormallyincludethefollowing
courses:

FIN6804TheoryofFinance 3
FIN7808AdvancedMicroFinance 3
FIN7817FinancialMarkets 3
FIN7930SelectedTopicsinFinance 3,3(TwoSemesters)
FIN7935FinanceResearchSeminar 3

CoursestakenaspartoftheFoundationorCoresectionsmaynotbecountedaspartofthehoursrequiredforthe
concentration.

USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

348
www.coba.usf.edu
SupportField(9hours):
ThosewhoelectFinanceasasupportfieldwill establishtheirsupportfieldcurriculum inconsultationwiththeir
major advisors and a representative from the Finance department. Normally, a support field in Finance would
requirethefollowingthreecourses:

FIN6804TheoryofFinance 3
FIN7817FinancialMarkets 3
FIN7808AdvancedMicroFinance 3

ComprehensiveQualifyingExam:
Upon completion of all coursework, students must pass a comprehensive written examination. The students
performance on this exam should reflect familiarity with the literature, current issues and problems related to
these fields. Astudent who fails the field exam may retake it within one year. A second failure disqualifies the
student from continuing in the Ph.D. program. If the degree is not conferred within 5 calendar years of the
comprehensivequalifyingexamination,asecondanddifferentexaminationmustbetaken.Studentspassingthe
comprehensivequalifyingexaminationareeligibleforadmissiontocandidacyforthePh.D.program.

Dissertation:
21credithoursofdissertationarerequiredforthedegree.

ResidencyRequirements:
Ph.D.studentsintheCollegearerequiredtocompleteaminimumof15credithourspercalendaryear.Failureto
meetthisrequirementwillresultinthestudentbeingplacedonconditionalstatus.

InformationSystemsConcentrationRequirements

ISM6124AdvancedSystemsAnalysisandDesign*
ISM6218AdvancedDatabasesManagement*
ISM6225DistributedInformationSystems*
ISM6930ComputationalMethodsinBusiness
ISM7910MISResearchSeminarI
ISM7911SeminarinTechnicalISResearch
ISM7912SeminarinMISOrganizationalResearch
OneadditionalISMcourseatthe6000levelorhigher.**

*Note: This requirement can be waived if a student has taken these or equivalent graduate courses in a prior
programandearnedaBorhigher.Waiverrequestsforanyofthecourseslistedaboveshouldincludeacopyof
thecoursesyllabusandshouldbesubmittedtothedepartmentsPh.D.Coordinator.

**NotethatanyofthethreecoursestakentosatisfythefoundationalcourserequirementinInformationSystems
canalsosatisfythisrequirement.

SupportField(9hours):
Studentstake3graduatecoursesoutsideoftheconcentrationarea.CoursesmaybetakenoutsideoftheCollege
ofBusiness,butshouldcomplementtheconcentrationsubjectarea.

ComprehensiveQualifyingExam:
Uponcompletionofallcoursework,studentsmustpassacomprehensiveexaminationintheconcentrationarea.
Thestudentsperformanceonthisexamshouldreflectfamiliaritywiththeliterature,currentissues,andproblems
relatedtothesefields.

Therearetwopartstothecomprehensiveexaminationsfollowingthecompletionofcoursework:
Awrittenexaminationand
Anoralpresentationandsuccessfuldefenseofthestudentssecondyearresearchpaper.
Students will be considered to have passed the comprehensive exam if they pass the written exam and
successfullypresentanddefendthesecondyearresearchpaper.
USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

349
www.coba.usf.edu
MarketingConcentrationRequirements

Studentswillberequiredtosuccessfullycompleteaminimumof6doctorallevelMarketingseminars.Typically,
onedoctoralseminarwillbeofferedintheFallsemesterandtwoseminarswillbeofferedintheSpringsemester.
Thesixrequiredcoursesmaybeselectedfromthefollowinglist:

MAR7555ConsumerBehaviorTheory
MAR7635AdvancedMarketingResearch:DesignandTechnique
MAR7667MarketingModelsandStrategyApplications
MAR7787MarketingTheoryandHistory
MAR7910IndependentStudyinMarketing(S/Uonly)
MAR7930AdvancedSeminarinMarketing
MAR7931SeminarinSelectedMarketingTopicsincluding:
BuyerSellerInteraction
MarketingChannels,LogisticsandSupplyChainManagement
MarketingManagement
MarketingStrategy
ReadingsinMarketing
SalesManagement
MAR7980DissertationResearch(S/Uonly)

Inaddition,studentswillcompleteaProSeminareveryFallsemesterforthefirsttwoyearsofstudy.
Note:TheProfessionalSeminarsdonotcountasoneofthesixrequiredPh.D.seminars.

ComprehensiveQualifyingExaminations:
Upon completion of all coursework, students must pass the equivalent of a comprehensive examination in the
concentrationarea.Thestudent'sperformanceontheseexamsshouldreflectfamiliaritywiththeliterature,aswell
as with current issues and problems related to these fields. A student who fails either of the examss may retake it
within one year. A second failure disqualifies the student from continuing the Ph.D. program. If the degree is not
conferred within 5 calendar years of the comprehensive qualifying examination, a second and different examination
must be taken. Students passing the qualifying examination are eligible for admission to candidacy for the Ph.D.
program.

The decision to administer a separate comprehensive exam for a support area will be made by the department in
which the support area is taken. In the event that an interdisciplinary support area is selected, any department
represented by six (6) or more semester hours may require a qualifying examination. In the event that no single
departmentrepresentssixsemesterhoursormore,thestudent'sprogramcommitteewillsolicitinputfromthefaculty
teachingthecoursesinthesupportarea.Ifamajorityofthosepolledtakethepositionthataseparatecomprehensive
examination in the support area is not appropriate, the exam will not be administered. If a separate comprehensive
examination is not administered in a support area, material from the support area will be integrated into the
comprehensiveexamintheconcentrationarea.

Dissertation:
21hoursofdissertationarerequiredforthedegree.

ResidencyRequirement:
Ph.D.studentsintheCollegearerequiredtocompleteaminimumof15hourspercalendaryear.Failuretomeetthis
requirementwillresultinthestudentbeingplacedonconditionalstatus.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFTampaGraduateCatalog20132014 BusinessAdministration(Ph.D.)

350
www.coba.usf.edu
BUSINESSADMINISTRATION(SATURDAYMBA)PROGRAM

MasterofBusinessAdministration(M.B.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Closedfornewadmissions

MinimumTotalHours: 48
ProgramLevel: Masters
CIPCode: 52.0201
Dept.Code: DEA
Program(Major/College): MBSBA

Alsoofferedas: SeelistingunderMBAProgram

CONTACTINFORMATION

College: Business

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

THISPROGRAMISBEINGDISCONTINUED
USFTampaGraduateCatalog2013201420132014EntrepreneurshipinApplied
Technologies(M.S.)

351
www.coba.usf.edu
ENTREPRENEURSHIPINAPPLIEDTECHNOLOGIESPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: July1
Spring: November1

InternationalAdmissionDeadlines:
Fall: February1
Spring: July1
Summer: NoAdmit

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 51.0701
Dept.Code: DEA
Program(Major/College): EATBA

CONTACTINFORMATION

College: Business
Department: CenterforEntrepreneurship(DEA)

ContactInformation:
OtherResources:

PROGRAMINFORMATION

TheCenterforEntrepreneurshipattheUniversityofSouthFlorida,inconjunctionwiththeCollegesofBusiness
Administration,Engineering,andMedicineandtheGraduateSchool,hasestablishedanovel,innovative,andunique
programininterdisciplinaryEntrepreneurshipinAppliedTechnologies.TheMastersofScienceDegreeProgramin
EntrepreneurshipinAppliedTechnologiesisa30credithourprogramandconsistsoften(10)coursesthatwillconsolidate
theEntrepreneurshipeducationandtrainingforsuccessfulopportunityrecognitionanddevelopment,technologyand
marketassessment,technologycommercialization,newventureformation,andnewventurefinancingintoasingleinter
disciplinaryprogramcurriculumutilizingfacultyandcoursesintheCollegesofBusinessAdministration,Engineering,and
MedicineundertheauspicesoftheGraduateSchool.

Theprogramisdesignedsuchthatastudentmaycompleteitinaconcentrated12monthperiodofstudyorinan18
monthperiod.Inaddition,theMastersofScienceDegreeinEntrepreneurshipisdesignedsothatitcanbecompletedas
partofadualdegreeprograminconjunctionwithatraditionalM.A.,M.S.,M.B.A.,M.D.,orPh.D.program.Dualdegrees
includethefollowing:Biotechnology(M.S.),InformationSystems(M.S.),PublicHealth(MPH),EnvironmentalScience(M.S.),
CivilEngineering(M.S.andPh.D.),andBiomedicalEngineering(Ph.D).Theprogrammustbecompletedbythestudent
withina5yearperiodfollowinginitiation.

Accreditation:
AccreditedbythetheAssociationtoAdvanceCollegiateSchoolsofBusinessandCommissiononCollegesoftheSouthern
AssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

Bachelorsdegreeorequivalentfromaregionallyaccrediteduniversity
B(3.0ona4.0scale)averageinallupperdivisionwork
Two(2)lettersofrecommendation
Letterofinterest
USFTampaGraduateCatalog2013201420132014EntrepreneurshipinApplied
Technologies(M.S.)

352
www.coba.usf.edu
Statementofpurpose
Personalinterview
GRE,GMATmayberequiredonindividualbasis;MCATorLSATmaybesubstituted
CompetenceinStatistics,Accounting,andFinancemustbedemonstrated

DEGREEPROGRAMREQUIREMENTS

ProgramofStudy
CourseRequirementsGraduationwillrequiresuccessfulcompletionofthe30hourcurriculum,withaminimumGPAof
3.00(nogradesbelowC),withinafive(5)yearperiod.

StipendsN/A

RequiredEntrepreneurshipCourses

CoreRequirements
GMS6092 Princ iplesofIntellectualProperty (3)
GMS6094 BiomedicalEthicsinTech.Entrepreneurship(3)
EIN6430 OverviewofRegulatedIndustries (3)
GMS7930 MedicalEthics&Humanities (13)
ENT6947 AdvancedTopicsinEntrepreneurship (3)

Electives
ENT6016 NewVentureFormation(3) or EIN6935TechnologyVentureStrategies (3)
ENT6116 BusinessPlanDevelopment(3) or EIN6324TechnicalEntrepreneurship (3)
ENT6126 StrategicEntrepreneurship(3) or EIN6936 StrategiesinEntrepreneurshipTech (3)
ENT6186 StrategicMarketAssessment(3) or EIN6935 StrategicMarketAssessments (3)
ENT6606 ProductDevelopment (3) or EIN6934NewProductDevelopment (3)
ENT6415 VentureCapital&PrivateEquity(3)or EIN6934VentureCapital&PrivateEquity (3)

TotalHours:30

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfmorhttp://ce.usf.eduorhttp://www.entrepreneurship.usf.edu
USFTampaGraduateCatalog20132014 BiomedicalEngineering(M.S.B.E.)and
EntrepreneurshipinAppliedTechnologies(M.S.)

353
www.coba.usf.edu
ENTREPRENEURSHIPINAPPLIEDTECHNOLOGIESANDBIOMEDICAL
ENGINEERINGDUALDEGREEPROGRAM

MasterofScience(M.S.)and
MasterofScienceinBiomedicalEngineering(M.S.B.E.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: October15
Spring: June1
Summer: February15

MinimumTotalHours: 30/33
ProgramLevel: Masters
CIPCode: 14.0501/51.0701
Dept.Codes: ECH/DEA
Program(Major/College): EBIEN/EATBA

CONTACTINFORMATION

Colleges: Engineeringand
Business
Departments: ChemicalEngineering
CenterforEntrepreneurship

ContactInformation:
OtherResources:

PROGRAMINFORMATION

The M.S. Biomedical Engineering (BME) And M.S. Entrepreneurship In Applied Technologies (EAT) Dual Degree
Program is designed to prepare students who can effectively function in the complex world of Biotechnology
companies(Biotechs).TheprogramsobjectivesaretoprovideastrongBiomedicalfoundationfortechnicalproduct
developmentandresearchanddevelopmentalongwiththeskillsettoeffectivelyparticipateintheentrepreneurship,
venturecapital, business,andfinancialaspectsofBiotechs.Studentswillpursueappropriatecourseworkwithinboth
TheCollegeofEngineeringandTheCenterForEntrepreneurship,doublecountingatotalofninecredithours.

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementsforeachprogram.
Studentsmustsatisfytherequirementsforthetwodegreesseparately.NoLettersOfRecommendationarerequired.
Refertotheindividualprogramlistingsforthespecificrequirementsforeachdegree.

DEGREEPROGRAMREQUIREMENTS

Courserequirements:

CommonCourses(countedtowardsboththeBMEandEATdegrees)
BME6000 BiomedicalEngineering (3)
GMS7930 PrinciplesofIntellectualProperty (3)
EIN6934 NewProductDevelopment (3)
9hrstotal

USFGraduateCatalog20132014 BiomedicalEngineering(M.S.B.E.)and
EntrepreneurshipinAppliedTechnologies(M.S.)

354
www.coba.usf.edu
BiomedicalEngineering(30hrsrequired)
GMS7930 Anatomy&PhysiologyforBioengineers (3)
PHC6051 BiostatisticsII (3)
ECH6971 MastersThesis (6)
ApprovedBMEelectives (9)
CommonBME/EATcourses (9)
30hourstotal

EntrepreneurshipinAppliedTechnologies(30hrsrequired)
EIN6154TechnicalEntrepreneurship (3)
EIN6934 TechnologyVentureStrategies (3)
EIN6935 StrategicMarketingAssessments (3)
EIN6936 VentureCap&PrivateEquity (3)
GMS7930 BioMedicalEthics (3)
EIN6430 OverviewofRegulatedIndustries (3)
EIN6936 StrategiesinEntrepTechnology (3)
CommonBME/EATcourses (9)
30hrstotal

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfmorhttp://ce.usf.eduorhttp://www.entrepreneurship.usf.edu
USFTampaGraduateCatalog20132014 Biotechnology(M.S.)and
EntrepreneurshipinAppliedTechnologies(M.S.)

355
www.coba.usf.edu
ENTREPRENEURSHIPINAPPLIEDTECHNOLOGIESANDBIOTECHNOLOGYDUAL
DEGREEPROGRAM

MasterofScience(M.S.)Degreeand
MasterofScienceinBiotechology(M.S.)

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Refertoindividualprogramlistingsfordeadlines

MinimumTotalHours: 30/33
ProgramLevel: Masters
CIPCode: 14.0501/52.0701
Dept.Codes: ECH/DEA
Program(Major/College): EBIEN/EATBA

CONTACTINFORMATION

Colleges:Medicineand
Business
Department: Biotechnology
CenterforEntrepreneurship

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

ContactProgramforinformation

Accreditation:
AccreditedbytheCommissiononCollegesoftheSouthernAssociationofCollegeandSchools.

ADMISSIONINFORMATION

Must meet University requirements (see Graduate Admissions) as well as requirements for each program. Students
mustsatisfytherequirementsforthetwodegreesseparately.Refertotheindividualprogramlistingsforthespecific
requirementsforeachdegree.

DEGREEPROGRAMREQUIREMENTS
Refertotheindividualprogramlistingsforthespecificrequirementsforeachdegree.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfmorhttp://ce.usf.eduorhttp://www.entrepreneurship.usf.edu
USFTampaGraduateCatalog20132014 ExecutiveM.B.A.(M.B.A.)

356
www.coba.usf.edu
EXECUTIVEM.B.A.PROGRAM

MasterofBusinessAdministration(M.B.A.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: June1

MinimumTotalHours: 48
ProgramLevel: Masters
CIPCode: 52.0201
Dept.Code: DEA
Program(Major/College): MBABA
Applicationtracks: Management
Finance
Alsoofferedas:
BusinessAdministration(M.B.A.)

CONTACTINFORMATION

College: Business

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

The weekend Executive M.B.A. is a lockstep, 20month, AACSB accredited program designed to meet the unique
needsofbothmidcareermanagerswhohavedemonstratedthepotentialtoreachseniormanagementpositions,and
senior managers who desire to significantly increase their personal and organizational effectiveness. The program
provides an opportunity to broaden and enrich management skills, to extend knowledge of modern business
techniques,andtofurtherdevelopunderstandingofthesocial,political,andeconomicforcesthatshapethebusiness
environmentandinfluencedecisionmaking.ClassesarescheduledalldayontwoSaturdaysandoneFridayamonth
for four semesters. The weekend format allows participants to continue carrying their careers while they master a
rangeofmanagerialskills.

Accreditation:
The Commission on Colleges of the Southern Association of College and Schools (SACS), AACSB International The
AssociationtoAdvanceCollegiateSchoolsofBusiness.

ADMISSIONINFORMATION

Must meet University requirements (see Graduate Admissions) as well as requirements listed below. The weekend
Executive MBA Program requires the submission of a preliminary application and personal interview prior to official
graduateschoolapplication.Pleaseseetheprogramwebsiteforapplicationformsorcontacttheprogramoffice.

ProgramAdmissionRequirements

Musthavea3.0upperlevelGPA
GMAT(maybewaived)
5yearsofmanagement/professionalexperience
Interview
Statementofcorporateapproval
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550orhigheron
thewrittenversion,aminimumscoreof213onthecomputerbasedtestora79ontheinternetbasedtest.

USFTampaGraduateCatalog20132014 ExecutiveM.B.A.(M.B.A.)

357
www.coba.usf.edu
DEGREEPROGRAMREQUIREMENTS

ExecutiveMBAProgramCurriculum*
ACG6025 FinancialAccountingforManagers 2
MAN6055 HumanBehaviorandOrganization 2
GEB6445 Social,Ethical,LegalSystems 2
QMB6305 ManagerialDecisionAnalysis 2
ECP6702 ManagerialEconomics 2
ACG6075 ManagerialAccounting&Control 2
ECO6708 GlobalEconomicEnvironmentofBusiness 2
FIN6406 FinancialManagement 2
MAR6158 InternationalMarketing 3
MAR6815 MarketingManagement 2
MAN6911 DirectResearch 2
FIN6605 InternationalFinancialManagement 3
GEB6930 Elective(chosenbyprogram) 13varies
MAN6448 NegotiatingAgreementandResolvingConflict 3
QMB6603 OperationsManagement 2
ISM6021 ManagementInformationSystems 2
FIN6515 Investments 3
GEB6865BusinessProblemsAnalysis 3
MAN6305 HumanResourceManagement 3
MAN6930 ExecutiveLeadership 3
*Specificcoursessubjecttochange

Totalhours: 48

During the interim summer session, each student participates in the annual tenday Overseas Study Module, which
involves onsite study of international business practices. A different country/region is selected each year. Past
modules have included visits to such cities as Moscow, London, Zurich, Geneva, Brussels, Tokyo, Beijing, Shanghai,
MexicoCity,BuenosAires,RiodeJaneiro,HongKong,Milan,andParis.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm

USFGraduateCatalog20132014 Finance(M.S.)

358
www.coba.usf.edu
FINANCEPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

ProgramAdmissionDeadlines:
Fall: July1
Spring: November1
Summer: March1

International:
Fall: February1
Spring: July1
Summer: January1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 52.0801
Dept.Code: FIN
Program(Major/College): FINBA

CONTACTINFORMATION

College: Business
Department: Finance(FIN)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

M.S.inFinance
The M.S. in Finance offers a curriculum that concentrates on both finance and economics concepts. Students who
completetheM.S.inFinancewillbebetterpreparedtosucceedincareersinthefinancialworld,especiallyinpositions
thatrequirespecializedknowledgeaboutvariousfinancetopics.

Accreditation
Accredited by the Commission on Colleges of the Southern Association of College and Schools (SACS). AACSB
InternationalTheAssociationtoAdvanceCollegiateSchoolsofBusiness.

MajorResearchAreas
Finance

ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

GMATscoreof550orhigher
UndergraduateupperlevelGPAof3.00orhigher
InternationalapplicantsfromnonEnglishspeakingcountriesmustalsohaveaTOEFLscoreof550orhigher
onthewrittenversion,aminimumscoreof213onthecomputerbasedtestora79ontheinternetbased
test.

USFGraduateCatalog20132014 Finance(M.S.)

359
www.coba.usf.edu
DEGREEPROGRAMREQUIREMENTS

TotalMinimumProgramHours 30hours

Astudentwhodoesnothaveanundergraduatedegreeinbusinessmustcompletethefollowingtoolsbeforetaking
coursesforwhichtheyareprerequisites(Semesterhoursareshowinintherightcolumn):
ToolsCourses 10hours
ACG6026 AccountingConceptsforManagers 3*
ECO6005 EconomicsConceptsforManagers 3*
FIN6406 FinancialManagement 2
QMB6305 ManagerialDecisionAnalysis 2


Studentsmustsuccessfully(agradeofAorB)completeequivalentcoursesineachoftheseareaspriortotakingMSF
courses.Toolscoursecanbewaived,withthepermissionoftheprogramdirector,ifthestudentearnedanAorBin
thesecoursesorequivalentcoursesatanAACSBaccreditedinstitutionwithinfiveyearsofenteringtheMSFprogram.

CourseRequirements:

CoreEconomicsandStatistics 9hours
ECO6115Microeconomics 3
ECO6936MathematicalEconomics 3
ECO6424EconometricsI 3

CoreFinance 15hours
FIN6416AdvancedFinancialMgmt 3
FIN6465FinancialStatementAnalysis 3
FIN6515Investments 3
FIN6804TheoryofFinance 3
FIN6445FinancialPolicy 3
(FIN6445mustbetakenattheendoftheprogramaftertheothercorecoursesarecompleted.)

Core finance courses may be waived for students who graduated with finance majors from AACSB accredited
programswithinfiveyearsofenteringtheM.S.inFinanceprogram.Onlycourseswiththesamecontent asthe
core finance courses can be used to satisfy the M.S. in Finance course requirements, and students must have
earnedgradesofAorBtohavesuchcourseswaived.Advancedfinancecoursesmustbesubstitutedforwaived
courses.

AdvancedFinanceElectives 6hours
Studentscanselectanytwoofthefollowingcourses:

FIN6246AdvancedMoneyandCapitalMarkets 3
FIN6326BankManagement 3
FIN6418WorkingCapitalManagement 3
FIN6605InternationalFinance 3
FIN6537FinancialOptionsandFutures 3
FIN6934SelectedTopicsinFinance 3

AdditionalInformationRegardingCurriculum
Leadership, teamwork, communication skills and organizational change are emphasized. Much of the curriculum is
delivered through case studies, class discussion, exercises, group projects, video taped roleplaying, simulations, and
prominent guest speakers from the local business and nonprofit community. Emphasis is placed on student
participationandteamwork.Allcoursesincludewriting,presentation,andcriticalthinkingskills.

COURSES
Seehttp://www.ugs.usf.edu/sab/sabs.cfm
USFTampaGraduateCatalog20132014 Management(M.S.)

360
www.coba.usf.edu
MANAGEMENTPROGRAM

MasterofScience(M.S.)Degree

DEGREEINFORMATION

DomesticAdmissionDeadlines:
FallDeadline: July1
SpringDeadline: November1

InternationalDeadlines:
Fall: February1
Spring: July1

MinimumTotalHours: 30
ProgramLevel: Masters
CIPCode: 52.0101
Dept.Code: MAN
Program(Major/College): MANBA

CONTACTINFORMATION

College: Business
Department: ManagementandOrganization
(MAN)

ContactInformation: www.grad.usf.edu
OtherResources: www.usf4you

PROGRAMINFORMATION

Thisprogramdevelopstheskilltolead21stcenturyorganizations.Thefuturerequiresaverydifferenttypeofleader
thanthepast.Thehierarchicalmodelofscientificmanagementisnolongerwidelyaccepted.Theleadersofthefuture
must be able to empower others and to facilitate teamwork in diverse groups, to recognize and adapt to the
constraints and opportunities of a global economy, and to accommodate the ethical and societal needs of the
environmentwithinwhichtheorganizationfunctions.

Both the profit and notforprofit communities have recognized these changes and have demanded that business
schools provide a modified and improved manager for the future a manager who succeeds by facilitating the
performance of others. Ethical and virtuous behavior as well as technical skills are promoted.These values lead to
organizational behavior that is both effective and ethical. Intrapersonal, interpersonal, and organizational
competenciesareenhanced.TheM.S.inManagementfacultymembersblendscholarlyactivityandappliedskills.Itis
thegoalofthefacultytopreparegraduatesforsuccessfulcareersasleadersintherealworld.

Thisisanextremelyprogressive,dynamic,wellfocusedprogram.Itisdesignedtohelpyoureachcareergoals.The
M.S.inManagementcurriculumproceedsthroughunderstandingofinterpersonalandorganizationaldynamics,to
plannedchangeandimplementation.Leadership,teamwork,communicationsskillsandorganizationalchangeare
emphasized.Muchofthecurriculumisdeliveredthroughcasestudies,classdiscussion,exercises,groupprojects,
videotapedroleplaying,simulations,andprominentguestspeakersfromthelocalbusinessandnonprofit
community.Emphasisisplacedonstudentparticipationandteamwork.Allcoursesincludewriting,presentation,and
criticalthinkingskills.

Accreditation:
Accredited by the Commission on Colleges of the Southern Association of College and Schools (SACS). AACSB
InternationalTheAssociationtoAdvanceCollegiateSchoolsofBusiness.

USFTampaGraduateCatalog20132014 Management(M.S.)

361
www.coba.usf.edu
ADMISSIONINFORMATION

MustmeetUniversityrequirements(seeGraduateAdmissions)aswellasrequirementslistedbelow.

ProgramAdmissionRequirements

StudentsareadmittedtotheM.S.inManagementprogrambasedontheevaluationoftheirapplicationinitsentirety,
including prior college level academic grades earned, GMAT or GRE scores, TOEFL scores (for international students
only),lettersofrecommendation,resume,statementofpurpose,andrelevantworkexperience.

DEGREEPROGRAMREQUIREMENTS

TotalMinimumHours 30

The program requires a minimum of 30 hours of coursework and may be takeneither fulltime or parttime. Early in
thefirstsemester,astudentandtheprogramadvisorwillworktogethertocompleteaformalProgramofStudythat
willdefineacoherentsequentofcoursestosatisfythestudentsobjectives.
Thefollowingfourcoursesprovideasolidunderstandingofstatoftheartresearchandpracticecoveringtheprimary
areasinthedomainofManagement.

ManagementCore 9credithours
GEB6445 Social,Ethical,LegalSystems 2
MAN6055 HumanBehaviorandOrganizations 2
MAN6140 DecisionMakaing&ProblemSolving 2
MAN6289 OrganizationalChangeandDevelopment 3

CapstoneCourse 3credithours
MAN6950CapstoneExperienceinLeadingOrganizations
ThiscourseisconsideredtobethecapstoneoftheM.S.inManagementprogramandassuchitmustbetakenduring
one of the last two semesters of the students program and integrates the topics covered in the four other core
courses. Students will conduct an applied analysis of an organization, identifying areas needing improvement, and
definingrecommendations.ThefourothercorecoursesareprerequisitesforMAN6950.<