Vous êtes sur la page 1sur 4

H AM S A

REVISI TAKSONOMI BLOOM


"TaksonomiBloomBaru"demikianlahsalahsatujudulMakalahyangmenjaditugassaya
waktukuliah,daninilahmungkinsalahsatutugasdarisekianbanyaktugasyangpernahsaya
kerjakanseadanya,hehe...kenapademikian?karenamendengardanmengetahuinyasajabaru
saat diberi tugas selain itu referensi terkait hal itu belum ada yang berbahasa Indonesia.
UntungnyaadaMasGOOGLEyangmenterjemahkandanmemberibeberapadata.
RevisiTaksonomiBloom,begitulahpenamaanatasrevisiyangdilakukanLorinAnderson
atasTaksonomiBloom.Bagaimanapersisnya?....berikutringkasannya...
BenjaminS.Bloom adalahseorangpsikologipendidikanberkebangsaanAmerikaSerikat
memberikan kontribusi besar di bidang pendidikan dengan menyusun klasifikasi objektif
kognitif kependidikan serta teori belajar tuntas (mastery learning). Konsep Taksonomi
Bloomdikembangkanpadatahun1956olehBenjaminS.Bloombersamadenganrekannya
Krathwohl.
Taksonomi Bloom membuat suatu klasifikasi berdasarkan urutan keterampilan berpikir
dalamsuatuprosesyangsemakinlamasemakintinggitingkatannya.Mulamulataksonomi
bloomterdiriatasduabagianyaituranahkognitifdanranahafektif(cognitivedomainand
affective domain). Bloom tidak menambahkan ranah psikomotor. Akhirnya tahun 1966
SimpsonmenambahkanranahpsikomotormelengkapiapayangtekahdibuatolehBloom.
Dengan demikian menjadi tiga ranah yaitu ranah kognitif, ranah afektif dan ranah
psikomotor. (Ketiga ranah tersebut tidak diuraikan karena merupakan taksonomi bloom
yanglama,telahbanyakreferensiterkaithalitu).
Salah seorang murid Bloom yang bernamaLorin Anderson merevisi taksonomi
Bloompadatahun1990.Hasilperbaikannyadipublikasikanpadatahun2001dengannama
Revisi Taksonomi Bloom. Dalam revisi ini ada perubahan kata kunci, Masingmasing
kategorimasihdiurutkansecarahirarkisdariurutanterendahkeyanglebihtinggi.Padaranah
kognitifkemampuanberpikiranalisisdansintesisdiintegrasikanmenjadianalisissaja.Dari
jumlah enam kategori pada konsep terdahulu tidak berubah jumlahnya karena Lorin
memasukankategoribaruyaitucreatingyangsebelumnyatidakada.
TaksonomiHasilrevisiAndersonpadaRanahKognitifadalah:
Mengingat,Katakataoperasionalyangdigunakanadalahmengurutkan,
menjelaskan,mengidentifikasi,menamai,menempatkan,mengulangi,menemukankembali.
Memahami,Katakataoperasionalyangdigunakanadalahmenafsirkan,
meringkasmengklasifikasikan,membandingkan,menjelaskan,membeberkan.
Menerapkan,Katakataoperasionalyangdigunakanadalahmelaksanakan,
menggunakan,menjalankan,melakukan,mempraktekan,memilih,menyusun,memulai,
menyelesaikan,mendeteksi.

Menganalisis,Katakataoperasionalyangdigunakanadalahmenguraikan,
membandingkan,mengorganisir,menyusunulang,mengubahstruktur,mengkerangkakan,
menyusunoutline,mengintegrasikan,membedakan,menyamakan,membandingkan,
mengintegrasikan.
Mengevaluasi,Katakataoperasionalyangdigunakanadalahmenyusunhipotesi,
mengkritik,memprediksi,menilai,menguji,membenarkan,menyalahkan.
Berkreasi,Katakataoperasionalyangdigunakanadalahmerancang,membangun,
merencanakan,memproduksi,menemukan,membaharui,menyempurnakan,memperkuat,
memperindah,menggubah.
Dalam berbagai aspek dan setelah melalui revisi, taksonomi Bloom tetap
menggambarkansuatuprosespembelajaran,carakitamemprosessuatuinformasisehingga
dapat dimanfaat dalam kehidupan seharihari. Beberapa prinsip didalamnya adalah
(1) Sebelumkitamemahamisebuahkonsepmakakitaharusmengingatnyaterlebihdahulu,
(2)Sebelumkitamenerapkanmakakitaharusmemahaminyaterlebihdahulu,(3)Sebelum
kita mengevaluasi dampaknya maka kita harus mengukur atau menilai, (4)Sebelum kita
berkreasisesuatumakakitaharusmengingat,memahami,mengaplikasikan,menganalisis
danmengevaluasi,sertamemperbaharui.
Pentahapanberpikirsepertiitubisajadimendapatsanggahandarisebagianorang.
Alasannya, dalam beberapa jenis kegiatan, tidak semua tahap seperti itu diperlukan.
Contohnyadalammenciptakansesuatutidakharusmelaluipentahapanitu.Halitukembali
padakreativitasindividu.Prosespembelajarandapatdimulaidaritahapmanasaja.Namun,
model pentahapan itu sebenarnya melekat pada setiap proses pembelajaran secara
terintegrasi.Sebagian orang juga menyanggah pembagian pentahapan berpikir seperti itu
karenadalamkenyataannyasiswaseharusnyaberpikirsecaraholistik.Ketikakemampuanitu
dipisahpisah maka siswa dapat kehilangan kemampuannya untuk menyatukan kembali
komponenkomponen yang sudah terpisah. Model penciptaaan suatu produk baru atau
menyelesaiansuatuproyektertentulebihbaikdalammemberikantantanganterpaduyang
mendorongsiswauntukberpikirsecarakritis.
PerbandinganTaksonomiBloomdanHasilrevisinyauntukranahkognitifdapatdilihatpada
tabelberikutini.

Daritabeltersebutmakadapatdikemukakanbeberapakesimpulansebagaiberikut:
(1)Tingkatantingkahlakupadataksonomibloomyanglamamenggunakankatasifat
sedangkanAndersonmengubahnyadenganmenggunakankatakerja.(2)Tingkatanterendah
(C1)PengetahuandigantidenganMengingat.(3)TingkatanC5SintesadantingkatanC6
EvaluasidileburmenjadiMengevaluasiyangberkedudukanpadatingkatanC5.
(4)TingkatanC6digantikanmenjadiBerkreasi.

Semoga bermanfaat, file Asli makalah dapat didownload pada link berikutDownload
Makalah

Posting Lebih Baru Beranda