Vous êtes sur la page 1sur 368

ANTIQUIT TARDIVE

Antigedad Tarda Late Antiquity


Sptantike Tarda Antichit
Revue internationale dhistoire et darchologie (e-e s.)
publie par lAssociation pour lAntiquit Tardive

La revue internationale Antiquit Tardive (sigle : AnTard)

est dite dans les langues scientifiques usuelles par les ditions Brepols
sous le patronage de l Association pour lAntiquit Tardive

Brepols Publishers Begijnhof 67, B-2300 Turnhout

Tl. +32 14 44 80 35 Fax +32 14 42 89 19 e-mail <info@brepols.net>


Site Web : www.brepols.net
Association pour lAntiquit Tardive : c/o Bibliothque dHistoire des Religions de lUniversit Paris-Sorbonne
Maison de la Recherche 28 rue Serpente F-75006 Paris
tl : 33/1/53 10 58 77 / fax : 33/1/53 10 58 76 Site Web : www.antiquite-tardive.com.
Secrtariat de rdaction de la Revue : F. Dugast CNRS, UMR 8167 27 rue Paul Bert F-94200 Ivry-s/Seine
e-mail : <fabienne.dugast@cnrs.fr>
Envoi des comptes rendus : S. Janniard <sylvain.janniard@univ-tours.fr>
Envoi des ouvrages pour compte rendu lAssociation.
Toute correspondance commerciale (commandes, abonnements
autres que ceux des membres de lAssociation) est adresser aux ditions Brepols
Ne pas envoyer manuscrits et livres pour comptes rendus lditeur

Fondateurs de la Revue : Nol Duval, professeur lUniversit Paris-Sorbonne, prsident ; Paul-Albert Fvrier,
professeur lUniversit de Provence, prsident du Comit ditorial ( 1991) ;
Jean-Charles Picard, professeur lUniversit Paris-Ouest, secrtaire ( 1992).
&
Prsident : Franois Baratte
Directeur : Jean-Pierre Caillet
Comit de rdaction : Fabienne Dugast, CNRS, UMR Orient & Mditerrane, Secrtaire de rdaction ; Sylvain Janniard,
Universit Franois-Rabelais de Tours, Responsable des comptes rendus.
&RQVHLOOHUVVFLHQWLTXHV : Gisella Cantino Wataghin ; Jean-Michel Carri ; Simon Corcoran ; Jutta Dresken-Weiland ;
Denis Feissel ; Herv Inglebert ; Gisela Ripoll ; Jean-Pierre Sodini.
Comit de lecture : M. Bonifay, P. Chevalier, A.S. Esmonde Cleary, B. Flusin, A. Giardina, G. Greatrex, M. Heijmans,
H. Hellenkemper, Cl. Lepelley, P. Maraval, P. Prin, St. Ratti, P. Reynolds, Ch. Rouech, J.-M. Salamito,
J.-M. Spieser, J. Terrier, P. Van Ossel, I. Velzquez Soriano, V. Zarini.
& 
Prsident : F. Baratte, professeur darchologie de lAntiquit tardive, Universit Paris-Sorbonne.
Vice-prsidente : G. Cantino Wataghin, professoressa di Archeologia Cristiana e Medievale, Universit del Piemonte
Orientale, Vercelli.
Secrtaire : Th. Rechniewski.
Trsorier : M. Heijmans, ingnieur de recherches au CNRS, Centre Camille Jullian (Aix-en-Provence).
Membres : J.-P. Caillet, professeur dhistoire de lart du Moyen ge, Universit Paris Ouest-Nanterre ; J.-M. Carri,
directeur dtudes, cole des Hautes tudes en Sciences Sociales, Paris ; E. Destefanis, docente allUniversit del
Piemonte Orientale, Vercelli ; J. Dresken-Weiland, Priv. Doz., Universit de Gttingen ; A. S. Esmonde Cleary,
professor, Department of Archaeology, University of Birmingham ; S. Janniard, matre de confrences l'Universit
Franois-Rabelais, Tours ; M. Jurkovic, professeur l'Universit de Zagreb ; G. Ripoll, profesora titular de arqueologa,
Universitat de Barcelona ; J. Terrier, archologue cantonal, Genve.

Ladhsion de 25 lAssociation donne droit un Bulletin annuel et une rduction de 20% sur la Revue
ainsi que sur les autres publications de Brepols / paiement possible pour trois annes : 55 ;
cotisation familiale (couple, par personne) ou tudiant : 15 .
La souscription la Revue nest pas comprise dans la cotisation.
La souscription 2011 la Revue papier est de 67 ; avec ldition lectronique, 94 ,
payable par chque au nom de lAssociation adresser au trsorier.
Ne pas envoyer dargent, le paiement se fait rception de la facture de Brepols
If you pay directly in France with a foreign cheque or Eurocheque (better to avoid), add 8 for charges.
If you pay in your country, please send the subscription to your national correspondant:
Canada (33 $) : G. Greatrex, Ottawa. Deutschland : J. Dresken-Weiland, Regensburg.
Espaa : G. Ripoll Lopez, Barcelona. Italia : G. Cantino Wataghin, Torino.

ANTIQUIT TARDIVE
Antigedad Tarda Late Antiquity
Sptantike Tarda Antichit
Revue internationale dhistoire et darchologie (e-e s.)
publie par lAssociation pour lAntiquit Tardive

Tome 22 - 2014
LORIENT CHRTIEN
DE CONSTANTIN ET DEUSBE DE CSARE

H
F

PRINCIPALES ABRVIATIONS*
AA
AA.SS.
AAAd
AE
AEArq
AJA
AnBoll
ANRW
AntAfr
Ath. Mitt.

= Archologischer Anzeiger
= Acta Sanctorum
= Antichit altoadriatiche
= L'Ann pigraphique
= Archivo espaol de Arqueologa
= American Journal of Archaeology
= Analecta Bollandiana
= Aufstieg und Niedergang der Rmischen Welt
= Antiquits africaines
= Mitteilungen des deutschen archologischen
Instituts, Athenische Abteilung
BAR
= British Archaeological Reports
BCH
= Bulletin de correspondance hellnique
BCTH
= Bulletin archologique du Comit des Travaux
historiques et scientifiques
BFAR = Bibliothque des coles franaises d'Athnes et
de Rome
BJ
= Bonner Jahrbcher des Rheinischen Landesmuseums in Bonn
BM
= Bulletin Monumental
BMGS
= Byzantine and Modern Greek Studies
ByzSlav = Byzantinoslavica
BSNAF = Bulletin de la Socit nationale des antiquaires
de France
BSS
= Bibliotheca Sanctorum
Byz.
= Byzantion. Revue internationale des tudes byzantines
ByzZ
= Byzantinische Zeitschrift
C&M
= Classica et Mediaevalia
CA
= Cahiers archologiques
CCSG
= Corpus Christianorum. Series graeca
CCSL
= Corpus Christianorum. Series latina
CFR
= Collection de l'cole franaise de Rome
CIAC
= Congresso internazionale di Archeologia Cristiana
CIG
= Corpus Inscriptionum Graecarum
CIL
= Corpus Inscriptionum Latinarum
CJ
= Codex Iustinianus
CMGR
= Colloque de la mosaque grecque et romaine
CorsiRav = Corsi di cultura sull'Arte Bizantina e Ravennate
CPL
= Clavis patrum latinorum
CRAI
= Comptes rendus de l'Acadmie des Inscriptions et
Belles Lettres
CSCO
= Corpus scriptorum christianorum orientalium
CSEL
= Corpus scriptorum ecclesiasticorum latinorum
CTh
= Codex Theodosianus
CUF
= Collection des Universits de France (Association
Guillaume Bud)
DACL
= Dictionnaire d'Archologie chrtienne et de Liturgie
Dam. Mitt. = Damaszener Mitteilungen des deutschen archologischen Instituts
Dessau = H. Dessau, Inscriptiones latinae selectae, Berlin,
1892-1916
DHGE
= Dictionnaire d'histoire et de gographie ecclsiastiques, Paris
Dig.
= Digesta
DOP
= Dumbarton Oaks Papers
EAA
= Enciclopedia dell'Arte antica classica e orientale
EAM
= Enciclopedia dell'Arte medievale

EPRO

= tudes prliminaires aux religions orientales


dans l'Empire romain
FIRA
= Fontes Iuris Romani Anteiustiniani, 2e d.
Florence, 1940-1943
ICVR
= Inscriptiones christianae urbis Romae septimo
saeculo antiquiores
IG
= Inscriptiones graecae
IGLS
= Inscriptions grecques et latines de la Syrie
ILAlg
= Inscriptions latines de l'Algrie
ILCV
= E. Diehl, Inscriptiones latinae christianae
veteres, Berlin / Dublin / Zurich, 1925-1967
JAChr
= Jahrbuch fr Antike und Christentum
JDAI
= Jahrbuch des deutschen archologischen
Instituts
JAI
= Jahreshefte des sterreichischen archologischen Instituts
JRA
= Journal of Roman Archaeology
JRS
= The Journal of Roman Studies
Kair. Mitt. = Mitteilungen des deutschen archologischen
Instituts (Abteilung Kairo)
LIMC
= Lexicon Iconographicum Mythologiae Classicae
MAMA
= Monumenta Asiae Minoris Antiqua
MFRA = Mlanges de l'cole franaise de Rome. Antiquit
MGH AA = Monumenta Germaniae Historica. Auctores
Antiquissimi
Monuments Piot = Monuments et mmoires publis par l'Acadmie
des Inscriptions et Belles Lettres (Fondation Piot)
ND
= Notitia Dignitatum
Nov. Iust. = Novellae Iustiniani
PBSR
= Papers of the British School at Rome
PG
= Patrologiae cursus completus, series graeca
PL
= Patrologiae cursus completus, series latina
PLRE
= Prosopography of the Later Roman Empire
PO
= Patrologia orientalis
RA
= Revue Archologique
RAC
= Rivista di archeologia cristiana
RAChr
= Reallexikon fr Antike und Christentum
RbK
= Reallexikon zur byzantinischen Kunst
RE
= Real-Encyclopdie der klassichen Altertumswissenschaft
= Revue des tudes anciennes
RA
RAug
= Revue des tudes augustiniennes
RByz
= Revue des tudes byzantines
RG
= Revue des tudes grecques
RIC
= Roman Imperial Coinage
RIDA
= Revue internationale des droits de l'antiquit
Rm. Mitt. = Mitteilungen des deutschen archologischen
Instituts, Rmische Abteilung
RmQ
= Rmische Quartalschrift fr christliche Altertumskunde und fr Kirchengeschichte
SB
= Sammelbuch griechischer Urkunden aus
gypten.
SC
= Sources chrtiennes
Settimane CISAM = Settimane del Centro italiano di studi
sull'alto medioevo
SHA
= Scriptores Historiae Augustae
T&Mbyz = Travaux et mmoires du Centre de recherches d'histoire et civilisation de Byzance (Collge de France)
ZPE
= Zeitschrift fr Papyrologie und Epigraphik
ZRG
= Zeitschrift fr Rechtsgeschichte

* Pour les titres moins courants, viter les abrviations ou donner la liste des abrviations propres l'article.
Pour les abrviations d'usage en papyrologie, voir J. F. Oates, R. S. Bagnall, W. H. Willis, K. A. Worp, Checlist of editions of greek and latin papyri,
ostraca and tablets, BASP Suppl. 7, Atlanta, 4e d., 1992, continue sur : http://scriptorium.lib.duke.edu/papyrus/texts/clist.html.

ANTIQUIT TARDIVE TOME 22


LORIENT CHRTIEN DE CONSTANTIN ET DEUSBE DE CSARE

ditorial ..................................................................................................................................................................................

LOrient chrtien de Constantin


et dEusbe de Csare

R. Lizzi Testa, I centenarii costantiniani e il peso della contemporaneit ...........................................................................


Constantinians centenaries and the influence of the contemporary

13

1 LEmpereur Constantin et lglise : contexte historico-religieux


J. Vilella, Constantino y Osio: la ltima etapa del conflicto arriano preniceno ...................................................................
Constantine and Ossius: the last phase of the pre-Nicene Arian conflict
A. Martin, La rception du concile de Nice et son impact sur lvolution des courants thologiques en Orient
(325-381) ...........................................................................................................................................................
The receipt of the Council of Nicaea and its impact on the evolution of theological trends in eastern
Churches (325-381)
H. A. Drake, Nicaea to Tyre (325-335): the bumpy road to a Christian Empire ................................................................
De Nice Tyr (325-335) : le chemin chaotique vers un Empire chrtien

27

35

43

2 Aspects de lHistoire ecclsiastique dEusbe de Csare


S. Morlet, Introduction ........................................................................................................................................................
Introduction

53

M.-Fr. Baslez, Rflexions sur la notion dHistoire ecclsiastique partir des dossiers de correspondances piscopales .....
Some thoughts on Eusebius concept of Ecclesiastical History based on a study of the episcopal letters

55

E. Norelli, Quelques remarques sur la manire dont Eusbe construit la littrature chrtienne dans son Histoire
ecclsiastique......................................................................................................................................................
Some comments on the way Eusebius constructed the Christian literature in his Ecclesiastical History

61

R. Gounelle, LHistoire ecclsiastique dEusbe ou la prsence des uvres perdues .......................................................


The Ecclesiastical History of Eusebius or the presence of lost works

71

J. Gascou, Pourquoi Eusbe ne mentionne-t-il pas le martyre de Pirios ?.....................................................................................


Why Eusebius does not mention the martyrdom of Pierus?

79

3 Les textes au regard des donnes archologiques


R. Van Dam, Constantines Beautiful City: the symbolic value of Constantinople ........................................................
La merveilleuse cit de Constantin : la valeur symbolique de Constantinople

83

J.-M. Spieser, En suivant Eusbe au Saint-Spulcre ...........................................................................................................


Following Eusebius to the Holy Sepulchre

95

W. Weber, berlegungen zur Rekonstruktion der konstantinischen Geburtskirche in Bethlehem ....................................


Reflections on the reconstruction of the Constantine Church of the Nativity in Bethlehem

105

S. Garreau Forrest, Ali Khalil Badawi, La cathdrale de Paulin de Tyr dcrite par Eusbe de Csare : mythe ou ralit ? ....
The Cathedral of Paulinus of Tyre described by Eusebius of Caesarea: myth or reality?

111

C. Saliou, Antioche sur lOronte, lglise de Constantin entre histoire et mmoire .......................................................
Constantines church at Antioch, between history and memory

125

J.-P. Caillet, Eusbe de Csare face aux images : vers une interprtation plus positive et moins incertaine de ses
attitudes ? ...........................................................................................................................................................
Eusebius of Caesarea and the images: toward a more positive and less uncertain interpretation of his views?

137

AnTard , 22, 2014

Varia
J.-F. Nardelli, St. Ratti, Historia Augusta contra christianos. Recherches sur lambiance antichrtienne de lHistoire
Auguste ..................................................................................................................................................................
Historia Augusta contra christianos. An overview of the anti-Christian atmosphere in the Historia Augusta

143

D. Piay Augusto, At tum Instantius, Salvianus et Priscillianus Romam profecti: El viaje de los priscilianistas hacia la
Ciudad Eterna.........................................................................................................................................................
At tum Instantius, Salvianus et Priscillianus Romam profecti: the Priscillianists itineraries to the Eternal City

156

I. Tantillo, Praesides, comites, duces. La Tripolitania e lamministrazione dellAfrica tardoromana ..................................


Praesides, comites, duces. Tripolitania and the administration of late Roman Africa

177

M. Landelle, La titulature des magistri militum au e sicle .................................................................................................


The title magister militum in the 4th century AD

195

St. Del Lungo, Provincia LucaniaWRSRJUDDHDJULPHQVXUDLQXQSDHVDJJLRFKHFDPELDGDOOD7DUGD$QWLFKLWjDOO$OWR


Medioevo (seconda parte) ..........................................................................................................................
Provincia Lucania: topography and land survey in a changing landscape, from Late Antiquity to the Early
Middle Ages (part 2)

223

H. Mnard, Violences polysmiques et construction mmorielle : la Passion de sainte Salsa de Tipasa ............................
Polysemous violence and the construction of memory: the Passion of Salsa of Tipasa

235

W. Liebeschuetz, How God made the world in seven days: The commentaries on genesis of John Chrysostom
(Homilies 1-12) and of Eusebius of Emesa (1-10) and the school of Antioch .....................................................
Comment Dieu cra le monde en sept jours : les commentaires de la Gense de Jean Chrysostome
(Homlies 1-12) et dEusbe dmse (1-10), deux reprsentants distincts de lcole d'Antioche

244

M. Petitjean, Classicisme, barbarie et guerre romaine : limage du cavalier dans lEmpire romain tardif ..............................
Classicism, barbarism and Roman warfare: the figure of the cavalryman in the Late Roman Empire

255

I. Jacobs, Ecclesiastical dominance and urban setting. Colonnaded streets as back-drop for Christian display ..................
Domination ecclsiastique et espaces urbains. La rue colonnade comme toile de fond de laffirmation
chrtienne

263

Chronique
J. Dresken Weiland, Laien, Kleriker, Mrtyrer und die unterirdischen Friedhfe Roms im 3. Jahrhundert ...........................
Laymen, clerks, martyrs and the subterranean cemeteries of Rome in the 3rd century

287

J.-M. Spieser, propos de trois livres rcents sur des monuments de Thessalonique ..........................................................
About three recent books on the monuments of Thessaloniki

297

Bulletin critiques
Histoire et archologie de lAntiquit tardive
G. ', Ides byzantines (Michael Whitby) ; P.-G. ' (dir.), Les Pres de lglise et la chair (Mark
Edwards) ; H. ', E. ) (dir.), Western Monasticism ante litteram (Jean-Pierre Caillet) ; J. N. ', The
Justice of Constantine (Vincent Puech) ; P. 0, Constantin le Grand (Franois Paschoud) ; U. 5,
Roma Capta. Il Sacco della citt dai Galli ai Lanzichenecchi (Michal Vannesse) ; W. 3, G. + (dir.),
6WUDWHJLHVRI,GHQWLFDWLRQ(WKQLFLW\DQG5HOLJLRQLQ(DUO\0HGLHYDO(XURSH ; W. 3, G. + (dir.),
Postroman Transitions. Christian and Barbarian Identities in the Early Medieval West (Alain Chauvot) ...........

307

Rgions
T.M. +, Wine, Wealth, and the State in Late Antique Egypt. The House of Apion at Oxyrhynchos (Christel Freu) ;
M. J. -, The Byzantine Churches of Sardinia (Franois Baratte) ; S. /6, M. P. 5,
M. 6(dir.), Labitato, la necropoli, il monastero. Evoluzione di un comparto del suburbio milanese alla
luce degli scavi nei cortili dellUniversit Cattolica (Eleonora Destefanis) ; N. 0, G. 5 (dir.), Arqueologia
funerari al nord-est peninsular (segles VI-XII) (Claude Reynaud) ; P. 3, Linsediamento degli Ostrogoti in
Italia (Valrie Fauvinet-Ranson) ; Ch. 6 (dir.), Les stucs de lAntiquit tardive de Vouneuil-sous-Biard (Vienne)
(Eleonora Destefanis) ; M. 9, The Early Christian Monuments of Ravenna (Jean-Pierre Caillet) .........
Philologie et sources
J.  %, J. W. ', D.  +, H. C. 7, Philological and Historical Commentary on
Ammianus Marcellinus XXVIII ; J. %, J. W. ', D. +, H. C. 7, Philological and

325

AnTa rd , 2 2 , 2 0 1 4

Historical Commentary on Ammianus Marcellinus XXIX (Franois Paschoud) ; G. *, Syntaktische Untersuchungen zu Jordanes. Beitrge zu den Romana (Franois Paschoud) ; L. * (dir.), Le Phnix et son autre.
Potique dun mythe des origines au e sicle (Laury-Nuria Andr) ; P. 91, Orosius and the Rhetoric
of History (Marie-Pierre Arnaud Lindet) ...................................................................................................................

345

Publications reues par la Revue en 2013 ...............................................................................................................................

361

Comit de rdaction de la Revue et Conseil dadministration de lAssociation pour lAntiquit tardive .............................
Principales abrviations de la Revue ......................................................................................................................................
Instructions aux auteurs ..........................................................................................................................................................
Recommendations to authors ...................................................................................................................................................
Volumes de la Bibliothque de lAntiquit Tardive .................................................................................................................

2
4
365
366
367

Couverture : Constantin au concile de Nice,


feuillet dun manuscrit mdival
(Fondazione Museo del Tesoro del Duomo
e Archivio Capitolare di Vercelli, Cod. CLXV).

2014 Brepols Publishers n.v., Turnhout, Belgium


All rights reserved. No part of this publication may be reproduced,
stored in a retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, photocopying, recording, or otherwise,
without the prior permission of the publisher.
D/2014/0095/197
ISBN 978-2-503-55359-7
Printed in the E.U. on acid-free paper

AnTard , 22, 2014

DITORIAL

Le phnomne des commmorations de centenaires ayant, de nos jours, acquis lampleur que lon sait, il tait
naturellement invitable que lanne 2013 connaisse une prolifration de colloques et manifestations diverses refocalisant lattention sur lvnement de non minime importance, au demeurant que constitua la promulgation du
IDPHX[pGLWGHWROpUDQFHRIFLHOOHGXFKULVWLDQLVPHHWSDUFRQWUHFRXSVXUODJXUHGH&RQVWDQWLQ2QSRXYDLW
alors lgitimement sinterroger sur lopportunit dajouter encore, dans le cadre mme de notre revue, un dossier de
SOXVjFHORWGHFRQWULEXWLRQVGpMjWUqVIRXUQLHWGDLOOHXUVDXVHLQGHQRWUHFRPLWpVFLHQWLTXHODGLVFXVVLRQjFH
sujet na pas manqu dtre serre
Il a toutefois t dcid de sengager dans la voie ayant abouti ce que nous prsentons ici. Une circonstance
sest, en ce sens, avre assez dcisive. Notre collgue Sbastien Morlet venait en effet dorganiser une table ronde
consacre lexamen de certains aspects de lHistoire ecclsiastique dEusbe et nous sollicitait pour publier les
articles issus de cette entreprise. Lintrt de ceux-ci tait vident et cest bien volontiers que nous en avons aussitt
accept le principe. Cela revenait donc, en soi, endosser une thmatique de nature orienter le dossier tout entier qui,
VXLYDQWQRWUHXVDJHFRQIqUHVDVSpFLFLWpjFKDFXQGHQRVQXPpURV,OFRQYHQDLWDORUVGDPSOLHUODSHUVSHFWLYHWRXW
en restant dans le contexte rgional et chronologique de la composition de lopus magnum de lvque de Csare.
Ltroitesse des liens dEusbe avec lempereur et, en particulier, lexaltation de la politique et de la personne de ce
dernier imposaient donc driger Constantin en autre ple et en ple majeur, mme de linvestigation dvelopper.
Et comme cest partir de ltablissement de la nouvelle capitale, puis surtout de la tenue du premier grand concile
non loin de celle-ci, que staient tisss les liens en question entre le souverain et lvque, ce sont trs prcisment
les vnements et ralisations touchant la propagation du christianisme dans la Pars Orientis durant les treize
GHUQLqUHVDQQpHVGXUqJQHGH&RQVWDQWLQTXLRQWGpQLQRWUHFKDPS&HODVDQVH[FHVVLYHULJLGLWpELHQHQWHQGXFDU
on nignore pas que les conceptions dEusbe (et la rdaction mme de son Histoire ecclsiastique) ont pris forme ds
les dcennies prcdentes et que leur impact a t sensible bien aprs 337 ; paralllement, certains projets dilitaires
tendant une premire christianisation du paysage bti ne devaient connatre lachvement que sensiblement plus tard
(et loccasion, ainsi quon le constatera ci-aprs avec, notamment, le cas de la basilique de Tyr, la claire distinction
entre ce qui relve vraiment de la priode ici prise en compte et des ralits trs postrieures ncessitait le rexamen
dtaill de ces dernires).
(QIRQFWLRQGHWRXWHVFHVGRQQpHVQRXVDYRQVWkFKpGHFRQIpUHUXQPD[LPXPGHFRKpUHQFHHWGHIFDFLWpjFH
GRVVLHU$LQVLDQGHPLHX[IDLUHUHVVRUWLUFHTXLQRXVOHVSpURQVFRQVWLWXHUDODSSRUWGHQRWUHDSSURFKHLOQRXVD
sembl impossible de faire lconomie, en tout premier lieu, dun retour sur le produit des rcentes commmorations constantiniennes. Cest ce quoi a bien voulu se livrer Rita Lizzi Testa, en allant dailleurs fort au-del de notre
souhait initial : car en jetant un pont vers lhistoriographie du dbut du e sicle, elle a pu cerner avec la plus grande
pertinence ce qui caractrisait vraiment les regards actuels.
Puis, dans une premire section, nous avons voulu retracer les principaux axes de la politique religieuse de
lempereur et des attitudes de la hirarchie clricale. Le concile de Nice, travers sa prparation et sa tenue mme,
puis sa rsonance thologique relativement longue porte, sy taille videmment une place de choix. Mais cest
aussi, dans une optique plus concrte, tout le jeu des relations entre Constantin et les vques reprsentant les divers
courants qui se trouve ici abord.
La deuxime section rassemble les contributions rsultant de la table ronde organise linitiative de Sbastien
Morlet, dont nous indiquions plus haut quelle avait donn limpulsion premire dans la mise en uvre de ce dossier.
2QWURXYHUDOjGHVUpH[LRQVGRUGUHFRQFHSWXHOTXDQWjOpODERUDWLRQGHVRQHistoire par Eusbe lui-mme, mais

10

DITORIAL

AnTard , 22, 2014

galement des mises au point sur les informations que renferme cet ouvrage sur des crits qui, par ailleurs, ne nous
ont pas t directement transmis ; ou encore, des prcisions sur lune des options assumes par lvque de Csare
dans le cours de sa composition.
Les textes de lpoque, et au premier chef ceux dEusbe, font mention de lrection de sanctuaires ou de monuments
incorporant une iconographie chrtienne en divers lieux de lOrient mditerranen. Il tait par consquent tout aussi
indispensable de consacrer le troisime volet de ce triptyque une confrontation entre les donnes de ces textes et les
apports de larchologie. Il sagissait donc, dune part de revisiter les plus illustres complexes lis la vie du Christ
en Terre Sainte, et ensuite dapporter de nouveaux clairages sur dautres ralisations dans le cadre de plusieurs sites
GHSOXVRXPRLQVFRQVLGpUDEOHLPSRUWDQFH&pWDLWHQQORFFDVLRQGHURXYULUHWVLSRVVLEOHGHFODULHUTXHOTXH
peu le dbat sur la vritable nature de certaines images et sur les positions dEusbe lui-mme leur gard.
Comme dordinaire, au dossier principal font suite des varia. Le poids de lensemble et la richesse de la teneur
en sont pour le moins notables, comme on sen convaincra sans doute aisment. Indpendamment du second volet
dune contribution de fond sur la transformation du paysage lucanien entre Antiquit tardive et Moyen ge, et de
FRQVLGpUDWLRQVVXUOLPSDFWGXQDVSHFWGHODUFKLWHFWXUHFLYLOHGDQVODFRQJXUDWLRQGHVJUDQGVFRPSOH[HVHFFOpVLDX[
les articles orientation proprement historique administrative, religieuse, militaire dominent ici trs largement.
Toutefois, lquilibre avec larchologie, auquel nous tendons toujours, nest pas trop compromis grce aux substantielles chroniques de Jutta Dresken-Weiland et de Jean-Michel Spieser, revenant sur de rcents travaux traitant,
respectivement, des implantations cimtriales romaines antrieures la Paix de lglise et des monuments de
Thessalonique. La srie des comptes rendus, qui ferme le numro, mnage dailleurs aussi leur place aux divers
champs de la recherche.
Il est dusage de clore cet ditorial par un aperu des publications nouvelles dans le cadre de notre Bibliothque.
Nous observions, lan pass, que se marquait un temps de pause , conscutivement une srie de non moins dune
douzaine de parutions entre 2010 et 2012 ; mais nous annoncions aussi quau vu des manuscrits dont la mise au point
QDOHpWDLWHQFRXUVXQERQU\WKPHQHPDQTXHUDLWSDVGrWUHUHSULVjEUqYHpFKpDQFH&HODHVWVXUOHSRLQWGDGYHQLUDX
moment mme o nous crivons ces lignes : la fabrication des ouvrages de Brigitte Boissavit-Camus (sur le baptistre
de Poitiers) et de Yumi Narasawa (sur les autels palochrtiens et haut-mdivaux du Sud de la Gaule) est en effet
SDUYHQXH DX VWDGH GHV GHUQLqUHV pSUHXYHV HW QRWUH FROOHFWLRQ YD GRQF VHQULFKLU GH FHV GHX[ XQLWpV HQ FHWWH Q GH
lanne 2014. Dautres ne devraient gure tarder suivre
Jean-Pierre Caillet

LORIENT CHRTIEN
DE CONSTANTIN ET DEUSBE DE CSARE

AnTard , 22, 2014, p. 13- 26


DOI 10.1484/J.AT.5.103169

I CENTENARII COSTANTINIANI
E IL PESO DELLA CONTEMPORANEIT
5/7

Constantinians centenaries
and the influence of the contemporary
This contribution is a report of the day seminars, conferences, meetings and exhibitions that have been organized in the years 2011-2013 to celebrate the seventeenth anniversary not only of the proclamation of the legitimacy
of Christianity with the protocol in Milan in early 313 and the rise to power of the West of Constantine on 28th of
October 312 with the victory over Maxentius at the Milvian bridge but also the issue of the Edict of Galerius at
the end of April 311. Three exhibitions were held in Milan, Rome and Spello (Perugia); ten conferences have been
organized in many cities of Western Europe (Cardiff, Perugia, Rome, Barcelona-Tarragona, Oxford, London, Milan,
Aquileia, Fribourgh); nine in the Eastern Orthodox part of the old continent (Bucarest, Minsk, Novi Sad, Istanbul,
Ni, Belgrado, St. Peterburgh, Yaroslav, Thessaloniki).The report, however, opens with the celebrations of the sixteenth centenary of Constantine in 1912-1913, in order to verify which different themes the historical research has
been urged to address in response to the problems of contemporaneity. [Author]

Ogni storia storia contemporanea sostenne


Benedetto Croce, convinto che per remoti e remotissimi
che sembrino cronologicamente i fatti che vi entrano,
essa , in realt, storia riferita sempre al bisogno e alla
situazione presente, nella quale quei fatti propagano le
loro vibrazioni1. Le ricerche sullantico, realizzate in
occasione delle celebrazioni anniversarie di eventi o
personaggi del passato confermano, pi di altre, la validit
del noto aforisma crociano. A volte, essendo fortemente
LQXHQ]DWH GDOOH SUREOHPDWLFKH GHO SUHVHQWH UHVWDQR
circoscritte agli unici aspetti che la contemporaneit
sollecita e, nellanalisi di questioni antiche, impiegano
categorie moderne senza discrezione. Aveva pertanto
ragione Eric J. Hobsbawm ad affermare che nuotiamo
nel passato come pesci nellacqua e non possiamo farne
a meno, ma i vantaggi di questa sorta di determinismo
andrebbero valutati sui rischi che spesso comporta2. Ne

1. B. Croce, La storia come pensiero e come azione, Bari, 1938, p. 5.


2. E. J. Hobsbawm, The social function of the Past, in Past & Present, 55,
1972, pp. 3-17, in part. p. 17.

sono prova le celebrazioni del XVI centenario costantiniano del 1913, che qui si richiamano per avere pi
articolati termini di confronto con le iniziative intraprese
SHULO;9,,OHTXDOLFRVWLWXLVFRQRORJJHWWRVSHFLFRGL
questa rassegna.
Il XVI centenario costantiniano,
tra miti e realt
Presentato nellAppello-programma diramato nel 1912
dal Consiglio Superiore per le Feste Centenarie della
Proclamazione della Pace della Chiesa o anche per
le Feste Centenarie del Trionfo della Chiesa per il
XVI Centenario (313-1913), il centenario prevedeva
un ciclo di conferenze di tipo storico e archeologico
(da tenersi nel corso del biennio 1912-1913), pontiFDOL QHOOH EDVLOLFKH FRVWDQWLQLDQH H QHJOL DQWLFKL
cimiteri cristiani, audizioni musicali e commemorazioni
liturgiche. Negli scritti apparsi in vari numeri del 1913
de LOsservatore Romano RUJDQRXIFLRVRGHOODVDQWD
Sede) e nel periodico dei Gesuiti La Civilt Cattolica,

14

RITTA LIZZI TESTA

AnTard , 22, 2014

largo interesse fu riservato allEditto di Milano e alla


grandezza di Costantino3.
Pio X aveva chiesto di festeggiare lEditto come un
IDWWR SDFLFR FKH DYHYD GDWR QDOPHQWH SDFH H OLEHUWj
a tutto il mondo, ed esso fu presentato come levento
che concludeva un mondo pagano gi tramontato, la base
GHOODSDFLFD]LRQHWUDLFULVWLDQLHO,PSHUR$OGLEDWWLWR
sollevato un ventennio prima da Otto Seeck, per il quale
nessun editto era stato emanato a Milano nel 313, semmai
un decreto (Erlass) a Nicomedia, si concesse poco spazio.
La maggior parte dei contributi ospitati in uno dei primi
numeri del 1913 sul periodico La Scuola cattolica, quasi
interamente dedicato allEditto, si opponevano a quella
tesi senza entrare nel merito (E. Galli); quelli pubblicati
nello stesso anno su La Rassegna Nazionale, a parte rare
eccezioni (Adolfo Giobbio), mostravano di non conoscere
neppure la questione (Filippo Meda, Ren Pichon)4.
Quanto a Costantino, fu esaltato nella stampa cattolica
essenzialmente per alcuni fatti che dimostravano la sua
conversione certa alla fede cristiana. In reazione alla
posizione assunta da ampie parti del Protestantesimo
culturale tedesco che rovesciava il paradigma storico
VDOYLFRGHOODVYROWDFRVWDQWLQLDQDLQPRGHOORGLGHJHQHrazione da una Chiesa di amore in una Chiesa di diritto
e potere (dopo Edwaerd Gibbon e Jacob Burckhardt,
le critiche erano state riaccese da Rudolf Sohm,
1841-1917)5 Pio X (1835-1914) ricord che quellimSHUDWRUHDYHYDSRVWRQHDOODFUXGHOLVVLPDSHUVHFX]LRQH
contro i cristiani, aveva proibito i giochi gladiatori nel

circo ed aveva emanato il primo editto contro la schiavit,


TXDOLFDQGRVL SHUFLz FRPH SULPR &HVDUH DQWLVFKLDYLVWD
della storia6. Egli era, dunque, il Grande, colui che
aveva permesso il realizzarsi di una civilt nuova, di cui
tutte le nazioni cattoliche e specialmente lItalia e, fra
tutte le citt dItalia, soprattutto Roma erano chiamate
DUDOOHJUDUVLSHULOEHQHFRLQXVVRGHOODQXRYDFLYLOWj
portata dal Cristianesimo nel culto, nei costumi, nelle
scienze nella letteratura e nellarte7.
La storia romana era attualizzata, isolando il momento
dellincontro tra Impero romano e cristianesimo. A tale
incontro era dato il valore di fondamento di una civilt,
che si era sviluppata grazie alla potenza acquisita
dalla Roma cattolica e apostolica: una Roma, sede dei
successori di Pietro, che effuse con nuova gloria i suoi
raggi di supremazia, di fede, di giustizia e di carit su
tutto il mondo civile8. La Chiesa cattolica era dunque
celebrata quale unica, vera erede dellImpero romano. Per
quanto concessole nel 313 da Costantino, era divenuta
libera e sovrana. Limperatore stesso alla sua autorit si
era sottomesso9.
La selezione di simili motivi, in tale consequenzialit,
assunse rilevanza per lincontro di varie esigenze concomitanti: il desiderio dei cattolici di superare limpasse del
non expedit di Pio IX10 e la preoccupazione dei liberali
di trovare nei cattolici un argine allavanzata socialista.
Nel 1913, infatti, il liberale Giovanni Giolitti al governo,
con brevi interruzioni, dal 1903 stipul un patto elettorale
(il cosiddetto Patto Gentiloni) con i membri dellappena

3. Lista delle pubblicazioni in E. Calvi (dir.), %ROOHWWLQRELEOLRJUDFRGHOOH


pubblicazioni italiane e straniere edite su Roma: libri, opuscoli, articoli
di riviste, di atti accademici, di giornali, ecc., Anno 5 (Pubblicazioni
HGLWH QHO  FRQ DJJLXQWH SHU LO  FRQ VSHFLDOH ELEOLRJUDD GHO
16. centenario costantiniano), Roma, 1914: si tratta dellultimo fascicolo
apparso del Bollettino  RJJL XQD UDULWj ELEOLRJUDFD  SULPD GL XQD
sporadica ripresa nel 1926-1928 e poi di nuovo dal 1939. Un rapido cenno
alle pubblicazioni e ai drammi storici messi in scena nello stesso anno,
in G. Crif, Su alcuni abusi del Costantinianesimo, in G. Bonamente,
F. Fusco (dir.), Costantino il Grande dallAntichit allUmanesimo
(colloquio sul Cristianesimo nel mondo antico, Macerata, 1820 dicembre 1990), 1, Macerata, 1992, pp. 347-356, in part. p. 347.
4. O. Seeck, Das sogenannte Edikt von Mailand, in Zeitschrift fr
Kirchengeschichte, 12, 1891, pp. 381-386. La tesi esposta in questo breve
saggio ebbe immediata risonanza anche in Italia: cfr. A. Crivellucci,
Leditto di Milano, in Studi storici, 1, 1892, pp. 239-250, e Idem,
Intorno alleditto di Milano, in Studi storici, 4, 1895, pp. 267-273.
Per unanalisi pi approfondita del dibattito sviluppatosi tra il 1913 e
il 1914, si veda P. Siniscalco, Leditto di Milano. Origine e sviluppo
di un dibattito, in A. Melloni et al. (dir.), Costantino I. Enciclopedia
&RVWDQWLQLDQDVXOODJXUDHOLPPDJLQHGHOOLPSHUDWRUHGHOFRVLGGHWWR
editto di Milano 313-2013, Roma, Istituto dellEnciclopedia italiana,
2013 [http://www.treccani.it/enciclopedia/l-editto-di-milano-origine-esviluppo-di-un-dibattito_(Enciclopedia-Costantiniana)/].
5. Sugli sviluppi della problematica relativa alla cosiddetta era
costantiniana, a partire dalle polemiche sollevate nel II sinodo
evangelico di Barmen nel 1934, attraverso le posizioni di M. D. Chenu
e la controversia tra E. Peterson e C. Schmitt, si veda G. Zamagni,
Fine dellera costantiniana. Retrospettiva genealogica di un concetto
critico, Bologna, 2012, in part. pp. 51-83, 153-181.

6. D. Virga, Le celebrazioni dellanno costantiniano del 1912 negli articoli


pubblicati da LOsservatore Romano (1 gennaio-31 dicembre 1912)
[http://www.santiurbanoelorenzo.org/wp-content/uploads/2010/01/
Costantino.pdf], pp. 2-3.
7. Per lanniversario costantiniano, peraltro, fu deposta nella Basilica
di Santa Croce sulla via Flaminia la riproduzione di un labarum e
3LR ; IHFH DIJJHUH DL Saxa Rubra (oggi Prima Porta) una targa
commemorativa con la scritta Con la vittoria di Costantino divinitus
e la sua conversione alla fede cristiana stata inaugurata unepoca
felice per lumanit: H. Sproll, 1700 anni dopo la svolta costantiniana
(312/13): passato e presente di un evento storico mondiale [http://
www.vatican.va/roman_curia/pont_committees/.../it/.../1700anni.pdf].
8. Appello-programma diramato nel 1912 dal Consiglio superiore per
le feste centenarie della proclamazione della pace della Chiesa per il
XVI centenario, presieduto dal principe D. Mario Chigi, in D. Virga,
Le celebrazioni, cit. (n. 6), p. 3.
9. S. De Nardis, 1913. LItalia e il XVI centenario delleditto di Milano,
in A. Melloni et al. (dir.), Costantino I, cit. (n. 4) [http://www.
treccani.it/enciclopedia/1913-l-italia-e-il-xvi-centenario-dell-editto-di
milano_%28Enciclopedia-Costantiniana%29/]
 'RSR OXQLFD]LRQH G,WDOLD ODXWRULWj HFFOHVLDVWLFD VL HVSUHVVH
ripetutamente a favore dellastensionismo dei cattolici; nel 1868,
ai vescovi piemontesi che chiedevano se fosse lecito per i cattolici
partecipare alle elezioni politiche, la Sacra Congregazione per
gli Affari Ecclesiastici Straordinari rispose con il non expedit;
dopo la Presa di Roma in concomitanza con le elezioni politiche
del dicembre 1870, la Sacra Penitenzieria utilizz analoghi toni,
ribadendo il non expedit in una comunicazione ai vescovi italiani
del 1874 e Pio IX pi volte nel corso del 1874 espresse lo stesso
FRQFHWWR/DGLVSRVL]LRQHIXXIFLDOPHQWHDEURJDWDGD%HQHGHWWR;9
nel 1919: G. Martina, Pio IX (1867-1878), Roma, 1990, pp. 273-277.

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

sorta Unione Elettorale Cattolica Italiana11, riuscendo


nellimmediato a contrastare lavanzata delle correnti
estremistiche di sinistra12. Limmagine di Costantino,
pertanto, si confuse con quella della nuova civilt romanocristiana, di cui era creduto ideatore con la donazione del
Laterano a Milziade nel 313: un imperatore cristiano, non
un sovrano onnipotente di diritto divino, che aveva privilegiato la propria fede ma tollerato le altre religioni, ed aveva
trasformato in senso cristiano il diritto pubblico e internazionale romano circondandosi di un consilium di vescovi e
giuristi. In sostanza, il tono delle celebrazioni costantiniane
del 1913 funse da fermento per quellinsieme di luoghi
comuni, in molti casi basati su errori e travisamenti, di cui
si nutr il Constantin le Grand di Jule Maurice. Consegnato
alle stampe nel 1925, con il sottotitolo Lorigine de la
civilisation chrtienne, suscit qualche perplessit persino
in Biondo Biondi per leccessiva approssimazione con cui
riconduceva al cristianesimo dellimperatore anche lordinamento dei pubblici funzionari13.
Erano, tuttavia, passati venticinque anni dalla pubblicazione. Nel 1929, il libro di Jule Maurice e la sua
immagine di un Costantino prono alla superiorit dellautorit morale del capo della Chiesa e dellepiscopato
fu utilizzato dalla stampa cattolica per ridicolizzare il
recentissimo volume su Costantino il Grande di Luigi
Salvatorelli, che metteva a punto una serie di studi sulla
religiosit dellImpero romano e il cristianesimo di
Costantino. Li aveva iniziati nel 1913, probabilmente
non a caso bens in reazione alla vulgata che si andava
affermando sui rapporti tra Costantino, il cristianesimo
e la Chiesa14. Anche la maggior parte delle conferenze

11. UECISURPRVVDQHOGDOSDSD3LR;IXUDWLFDWDQHOFRQ
la presidenza di Vincenzo Ottorino Gentiloni.
12. La guerra in Libia che aveva fruttato la conquista di uno scatolone di
VDEELDFRPH6DOYHPLQLODYHYDGHQLWDDQ]LFKpULQVDOGDUHLOVLVWHPD
politico ideato da Giolitti, aveva fatto crescere lopposizione conservatrice
e resa aggressiva lopposizione di sinistra: nel congresso socialista di
Reggio Emilia del 1912, il gruppo della destra riformista fu espulso, la
corrente turatiana fu messa in minoranza e la direzione dellAvanti! fu
DIGDWDD%HQLWR0XVVROLQLSHULOVXRDFFHVRPDVVLPDOLVPR59LOODUL
Storia contemporanea, Roma / Bari, 1977, p. 365.
13. G. Crif, Su alcuni abusi, cit. (n. 3), p. 350, n. 22 (Il diritto romano
cristiano, Milano, 2 vol., stato edito nel 1952).
14. 6DOYDWRUHOOLYLVRVWHQHYDODWHVLFKHLOFULVWLDQHVLPRGL&RVWDQWLQRULHWWHYD
XQD FRQFH]LRQH HFXPHQLFD IUXWWR GL VHFROL GL ULHVVLRQH ORVRFD
destinata, tuttavia, a non durare. In tale ottica, leditto di Milano esprimeva
un sincretismo ugualitario che svan nella nebbia di un passato che
era un decennio e sembrava gi un secolo, cosicch Costantino rimane
il fondatore della religione di stato, del cesaropapismo, e dellimpero
bizantino: L. Salvatorelli, Costantino il Grande, Roma, 1928, pp. 69,
86. Vedi le critiche avanzate allopera nellarticolo La politica religiosa
di Costantino Magno, in La Civilt Cattolica, 3, 7 settembre 1929,
pp. 412-422. Gli studi di Salvatorelli sulla religiosit di Costantino erano
iniziati nel 1913 con pagine giovanili, apparse originariamente nel suo
Saggi di storiaSSHSRLFRQXLWHQHOFRQWULEXWRLa religiosit
dellImpero romano e il cristianesimo di Costantino, in Miti e storia,
Torino, 1964, pp. 75-105. Cfr. A. Saitta, 0RPHQWLHJXUHGHOODFLYLOWj
HXURSHDVDJJLVWRULFLHVWRULRJUDFL, 5 (Storia e Letteratura. Raccolta di
Studi e Tesi, 198), Roma, 1997, pp. 227-228.

15

tenute quellanno nel Palazzo della Cancelleria, infatti,


avevano avallato la convinzione propagandata dagli
organi della Santa Sede, che lEditto avesse suffragato la
riconciliazione tra uno Stato, che si riconosceva colpevole
di oltraggio, e una Chiesa, romana cattolica e apostolica,
resa libera dal primo imperatore cristiano15.
Intorno allEditto di Milano e allimmagine di
Costantino si cre dunque una sorta di divaricazione
interpretativa, cui corrispose un forte iato allinterno
del mondo accademico, cos come tra una parte degli
studiosi e quanti furono inclini a cedere alle pressioni
di una pi larga divulgazione. Mentre dunque, nella
FRPXQLWj VFLHQWLFD DOFXQL FRQWLQXDURQR OH LQGDJLQL
confrontandosi sullesegesi delle fonti, furono i messaggi
di chi leggeva le vicende antiche per dare risposte alle
questioni contemporanee ad essere pi facilmente capiti
e divulgati. Nel corso del 1912-1913, dunque, non erano
mancati contributi di rigorosa impostazione storica, come
quelli raccolti nel Rmische Quartalschrift del 191316 e
vari studiosi, anche in Italia, continuarono le loro ricerche
su Costantino, sulla Chiesa e sullImpero romano,
abbastanza liberi da condizionamenti. Lo stesso articolo
su Costantino pubblicato nellEnciclopedia Treccani da
Roberto Cessi, per esempio, si distingue per notevole
equilibrio. Gli interventi in vari settori di quellimperatore
sono documentati facendo ricorso a tutte le fonti allora
disponibili e la politica religiosa tiene conto del dibattito
internazionale17. Di Norman H. Baynes, che nel 1929
DYHYD ULXWDWR GL YHGHUH LQ &RVWDQWLQR XQ XRPR HVFOXsivamente mosso dallambizione e dalla sete di potere,
come riproposto invece da Eduard Schwartz nel 191318,
Roberto Cessi condivide le conclusioni, pur non citandolo
LQELEOLRJUDDHJOLLQROWUHVHPEUDDYHUVHQWRUHGHOODWtacco allautenticit eusebiana della Vita di Costantino
che qualche anno dopo (pubblicamente solo nel 1938) fu
sferrato da Henri Grgoire19: senza escludere la testimonianza eusebiana, infatti, Roberto Cessi dichiaratamente
LQFOLQHDSUHVWDUHPDJJLRUGXFLDD/DWWDQ]LRLQTXDQWR

15. Il volume Letture costantiniane, che le raccoglieva, fu pubblicato


QHO  FRQ FRQWULEXWL GL TXDOLFDWL VWXGLRVL FRPH )HOLFH *URVVL
Gondi, Orazio Marucchi e Bartolomeo Nogara: vd. S. Roda, Leredit
del mondo antico, in N. Tranfaglia, M. Firpo (dir.), La Storia. I grandi
problemi dal Medioevo allEt contemporanea, I/1, Torino, 1988,
pp. 479-502.
16. AA.VV., Konstantin der Grosse und seine Zeit, in Rmische
Quartalschrift, 19, 1913.
17. R. Cessi, Costantino I imperatore, detto il Grande (Flavius Valerius
Constantinus Magnus) Imperatore romano dal 306 al 337, Enciclopedia
Treccani, 1931, pp. 601-607.
18. E. Schwartz, Kaiser Constantin und die christliche Kirche, Leipzig,
1913; N. Baynes, Constantine the Great and the Christian Church
(The Raleigh Lecture on History), in Proceedings of the British
Academy, 15, 1929, pp. 341-442.
19. H. Grgoire, Eusbe nest pas lauteur de la Vita Constantini dans
sa forme actuelle et Constantin ne sest pas converti en 312, in
Byzantion, 13, 1938, pp. 561-583.

16

RITTA LIZZI TESTA

osservatore diretto dellevoluzione religiosa dellimpeUDWRUH ,Q GHQLWLYD LO &RVWDQWLQR GL 5REHUWR &HVVL QRQ
il primo imperatore cristiano, convinto assertore della
nuova fede gi nel periodo dellascesa al trono, bens un
sovrano che, ancora negli ultimi anni, lasci convivere
pi religioni: pur allora, il paganesimo continu ad essere
tollerato e non perseguitato, per quanto Eusebio parli
a pi riprese di leggi dellimperatore che ordinavano la
FKLXVXUDGHLWHPSOLHODSURLEL]LRQHGHLVDFULFL20.
Dato lanno di pubblicazione il 1931 , davvero
degno di nota che lo studioso riuscisse a rimanere
indenne dalla montante propaganda che, coniugando
gli entusiasmi di parte dei cattolici e parte dei fascisti,
accentuava i caratteri di provvidenzialit del duce, paragonandolo a Costantino. $OOLQGRPDQLGHOODUPDGHL3DWWL
Lateranensi, nel discorso del 13 febbraio 1929, Pio XI
aveva indicato in Mussolini luomo che la Provvidenza
FLKDIDWWRLQFRQWUDUHSUREDELOPHQWHVRWWROLQXVVRGL
alcuni volumetti celebrativi dellevento come quello di
F. Paoloni, allora un semplice giornalista ma ben presto
senatore del Regno, il cui solo titolo indicativo delloperazione mediatica in atto21. Del resto, gi nel 1920
Benito Mussolini aveva maturato la convinzione (con
occhi rivolti allelettorato cattolico), che luniversalit del
cristianesimo avrebbe giovato alle glorie dellItalia e (con
le note di cinico pragmatismo, benamate dal ribellismo
anticlericale fascista), in primisDOODFUHVFLWDGHOOHODGHO
suo partito, se non altro per i 400 milioni di cristiani
sparsi in tutto il mondo che il Vaticano rappresenta22.
Le celebrazioni del XVI centenario costantiniano
si erano concluse da neppure un decennio, cosicch si
ha limpressione che lopinione del giovane maestro
elementare si fosse formata sui luoghi comuni che
la pubblicistica del 1913 aveva diffuso. Nel primo
discorso alla Camera del 1921, infatti, il neodeputato
aveva tributato solenni onori alla Roma cattolica e
apostolica, cui erano dovute le altissime glorie anche
civili dellItalia, citando quasi verbatim alcuni passi del
messaggio centrale dellAppello-programma diramato
nel 1912 dal Consiglio Superiore per le Feste Centenarie

20. R. Cessi, Costantino I imperatore, cit. (n. 15), p. 605.


21. Ai professori ed alunni dellUniversit Cattolica del Sacro Cuore, in
V. Bertetto (dir.), Discorsi di Pio XI, Torino, 1960, 2, pp. 17-18; F. Paoloni,
Da Costantino a Mussolini. Note di un fascista sulla Conciliazione,
Napoli, 1929. Non tutti i cattolici naturalmente condividevano quegli
entusiasmi, ma la retorica trionfalistica degli anni successivi ebbe la
meglio. Sulla complessit degli orientamenti di personaggi come Luigi
Sturzo e Alcide De Gasperi, vedi A. Guasco, Il Nuovo Costantino
Fascista. Immagini e utilizzi dellimperatore tra Chiesa cattolica e
regime, in A. Melloni et al. (dir.), Costantino I, cit. (n. 4), pp. 34-43,
in part. p. 38, nn. 29-30 [http://www.treccani.it/enciclopedia/il-nuovocostantino-fascista-immagini-e-utilizzi-dell-imperatore-tra-chiesacattolica-e-regime_(Enciclopedia-Costantiniana)/].
22. B. Mussolini, Discorso inaugurale al secondo congresso dei fasci,
23 maggio 1920, in E. e D. Susmel (dir.), Opera omnia di Benito
Mussolini, Firenze, 1951-1981, 14, p. 471.

AnTard , 22, 2014

costantiniane23. Non sembrerebbe pertanto una mera


coincidenza che la marcia su Roma degli squadristi, da
alcuni considerata una sorta di gita improvvisata, fosse
stata ideata nellagosto24VVDQGRFRPHGDWDLORWWREUH
(1922) e, come accesso principale allUrbe, quello stesso
ponte Milvio da cui Costantino era entrato vittorioso in
Roma nel 312. Nel 1912 la memorabile giornata era stata
celebrata con una solenne commemorazione nel Palazzo
/DWHUDQHQVH H GD RULWH UHOD]LRQL WUD FXL VL HUD GLVWLQWD
quella (che celebrava il trionfo della Croce come simbolo
di vittoria e di nuova civilt) del Conte Carlo Santucci.
Levento del 1922, pertanto, torn ad essere esaltato
dalla propaganda fascista quindici anni dopo, ricordando
come la vittoria su Massenzio, che segn lavvento
della Cristianit, fosse avvenuta presso quello stesso
Ponte Milvio, che il 28 ottobre del 1922 le camicie nere
varcarono iniziando lEra dei Fasci25.
Lassimilazione tra Mussolini e Costantino forn, come
noto, alcune note caratterizzanti alla retorica del nuovo
impero romano fascista creato con la conquista dellEtiopia
nel 1936. La campagna militare italiana del 1935-1936
DYHYD VHJQDWR XQD SURJUHVVLRQH SHU DOFXQL QDOORUD
impensabile, nel rapporto tra cattolicesimo e nazionalismo
allinsegna del mito di Roma. Nonostante un giudizio
negativo sul regime fosse condiviso da molti degli alti
diplomatici vaticani (anche in conseguenza della contrariet
di Pio XI verso quella guerra), manc una dichiarazione
XIFLDOHGLFRQGDQQDHFLzIXLQWHUSUHWDWRFRPHXQWDFLWR
avallo allimpresa, cui molti cattolici anche tra le gerarchie
vescovili diedero un sostegno massiccio ed entusiasta26.
Si aggiunse dunque, nel 1937, il richiamo ad Augusto di
cui si celebrava il bimillenario della nascita. Nel discorso
pronunciato il 26 febbraio 1937, il cardinale Ildefonso
Schuster, arcivescovo di Milano, si dichiar certo che Dio
ha voluto dare anche al Duce un premio che riavvicina la

23. Stralci del discorso sono citati da C. Galassi Paluzzi, Prefazione,


in Roma onde Cristo Romano, 1, Roma, 1937, p. IX. Il titolo
del volume (in sostanza un saggio-conferenza dellallora cardinale
Pacelli), riprende il noto verso dantesco (Purg. XXXII, 100-102) ma
SLHJDQGRODPHWDIRUDGHOODFLWWDGLQDQ]DFHOHVWHDOODQJXVWRVLJQLFDWR
dellappartenenza di Cristo alla nuova romanit propagandata dal
fascismo: A. Giardina, A. Vauchez, Il mito di Roma. Da Carlo Magno
a Mussolini, Roma / Bari, 2000, pp. 257-258.
24. E. Gentile, Mussolini, Benito (Benito Amilcare Andrea), in Dizionario
%LRJUDFRGHJOL,WDOLDQL 77, 2012 [http://www.treccani.it/enciclopedia/
EHQLWRPXVVROLQLB 'L]LRQDULR%LRJUDFR ]; cfr. anche E. Gentile, E fu
subito regime: il fascismo e la marcia su Roma, Roma / Bari, 2012.
25. G.Q. Giglioli (cur.), Mostra augustea della Romanit, 1937-1938
(Catalogo), Roma, 1937, p. 364, nella sezione dedicata allImmortalit
dellidea di Roma: L. Braccesi, Costantino e i Patti Lateranensi,
in G. Bonamente, F. Fusco (dir.), Costantino il Grande, cit. (n. 3),
pp. 210-211, parla di sovrapporsi di una ricorrenza anniversaria e
XQD FRLQFLGHQ]D WRSRJUDFD ,YL DQFKH SHU OXVR GL GHVLJQDUH JOL
stendardi fascisti anche con la parola, che documentata solo a partire
da autori contemporanei a Costantino: H. Grgoire, Ltymologie de
Labarum, in Byzantion, 4, 1929, pp. 477-82. Cfr. anche L. Braccesi,
Roma bimillenaria: Pietro e Cesare, Roma 1999, pp. 175-176.
26. A. Guasco, Il Nuovo Costantino Fascista, cit. (n. 21).

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

VXDJXUDVWRULFDDJOLVSLULWLPDJQLGL&RVWDQWLQRH$XJXVWR
recingendo, per opera di Benito Mussolini, Roma e il Re di
un nuovo rigoglioso lauro imperiale27. Il princeps romano
e il primo imperatore cristiano furono rivisitati nella vita e
nelle opere per trovare quanti pi possibili paralleli con la
JXUDGHO'XFH1HVRUWuXQLPPDJLQDULRWULRQIDOLVWLFRFKH
ebbe modo di dispiegarsi pienamente in occasione delle
celebrazioni augustee.
Nella Mostra augustea della Romanit, inaugurata il 23
settembre 1937 al Palazzo delle Esposizioni di Roma, si
esalt la provvidenzialit del princeps, voluto da Dio perch
OLPSHURXQLFDWRVRWWRLOFRPDQGRGLXQRVRORDFFRJOLHVVH
il Verbo28, ricorrendo alla leggenda medievale che lo
collegava alla chiesa capitolina dellAracoeli. Secondo i
Mirabilia Urbis Romae, infatti, quella chiesa sarebbe sorta
l ove Augusto aveva avuto la visione di una donna con un
bambino in braccio, mentre una voce dallalto la indicava
FRPH ODUD GHO JOLR GL 'LR29. Egli, dunque, era stato
reso consapevole della sua missione provvidenziale, non
diversamente da Costantino che, per Lattanzio ed Eusebio,
aveva ricevuto in sogno (o visto in cielo) la croce prima di
Ponte Milvio e aveva espresso tale consapevolezza ricollegandosi ad Augusto, attraverso il vaticinio della Quarta
Ecloga virgiliana, nellOratio ad sanctorum coetum30.

27. La via trionfale da Augusto a Costantino, in Il Popolo dItalia,


27 febbraio 1937, riportato in D. Marchesini, La scuola dei gerarchi.
Mistica fascista: storia, problemi, istituzioni, Milano, 1976, pp. 207-208,
e P. Beltrame Quattrocchi, Al di sopra dei gagliardetti. Larcivescovo
Schuster: un asceta benedettino nella Milano fascista, Casale Monferrato,
1985, pp. 213-216. Si ricordi pure che il 3 maggio 1938 Hitler pass, in
parata, sotto lArco di Costantino: R. Quednau, Costantino il Grande
a Roma. Forme e funzioni della memoria nelle testimonianze visive da
Ponte Milvio a Mussolini, in G. Bonamente, G. Cracco, Kl. Rosen (dir.),
Costantino il Grande tra medioevo ed et moderna (Atti del Convegno
italo-tedesco, Trento 22-23 aprile 2004) (Quaderni, 75), Bologna, 2008,
pp. 319-386, in part. p. 384.
28. Nella sala della Mostra augustea della Romanit dedicata ad
Augusto, la statua di Primaporta dialogava con una grande croce di
vetro composta con le parole del Vangelo di Luca che ricordavano
il censimento dellimpero voluto da Augusto e la nascita di Ges
Cristo, con evidente riferimento al puer virgiliano della quarta ecloga
(...iam nova progenies caelo demittitur alto): A. Giardina, Augusto tra
due bimillenari, in E. La Rocca et al. (dir.), Augusto (Catalogo della
Mostra, Scuderie del Quirinale, 18 ottobre 2013-9 febbraio 2014),
Milano, 2013, pp. 57-72, in part. p. 60.
29. La leggenda era citata nella sezione della Mostra dedicata
allImmortalit dellidea di Roma: G. Q. Giglioli (dir.), Mostra
augustea, cit. (n. 25), p. 371.
 /D FXOWXUD ORORJLFD JLj XQ GHFHQQLR SULPD GHOOD PRVWUD VXO
bimillenario della nascita di Augusto, aveva rintracciato sottili trame
di raccordo tra Costantino e Augusto. La valorizzazione dei legami tra
Costantino e i vaticini messianici di et augustea, in particolare, era stata
in parte supportata dalla riaffermata paternit costantiniana dellOratio
ad sanctorum coetum (P. Fabbri, Lecloga quarta e Costantino il
Grande, in Historia, 4, 1930, pp. 228-235), ove il vaticinio della quarta
Ecloga (Virg., Buc. IV, 6-10) interpretato come unallusione alla
venuta del Messia (Const., Oratio ad sanctorum coetum 18-21). Sui
complessi legami tra lOratio e il VII libro delle Divinae Institutiones
di Lattanzio, che rimandano alla ricca tradizione allegorica cristiana del
III secolo, si veda ora R. Cristofoli, Costantino e lOratio ad sanctorum
coetum, Napoli, 2005, pp. 121-141, in part. p. 125.

17

Nessun riferimento era fatto alle fonti pi antiche ove


il processo di cristianizzazione di Augusto era gi in atto,
a partire dallo stesso Eusebio di Cesarea, che probabilmente per primo lo aveva collegato al princeps31. Ci
che interessava propagandare nel 1937 era, infatti, il
messaggio che correva nelle grandi iscrizioni sovrastanti i
pannelli ove la leggenda medievale era illustrata. In quelle
memorie dellantichit romana, il Duce scorgeva la mano
infallibile della Provvidenza nel destino dellItalia e di
Roma; al mito di Roma augustea strettamente connesso
con quello della Roma cattolica e apostolica costantiniana,
per la capacit di questultima di consolidare il dominio
sullImpero creato da Augusto , era dato il massimo
risalto non come culto del passato ma come incitamento
alla conquista di una nuova grandezza imperiale italiana32.
Erano quelli i lunghi epiloghi di un processo, che
affondava le sue radici nelle celebrazioni del 1913, nel
modo in cui la Chiesa aveva allora accentuato la sua
VLRQRPLD GL &KLHVD 5RPDQD &DWWROLFD H $SRVWROLFD
portatrice di una missione civilizzatrice universale, e
di Costantino il Grande era stata data unimmagine,
che ne selezionava solo alcuni tratti attraverso un
uso sciatto delle fonti, forzate sulla scorta di luoghi
comuni. Entrambi i miti avevano giovato allavvio
di quelle lunghe e tortuose trattative diplomatiche tra
6WDWR LWDOLDQR H &KLHVD VIRFLDWH LQQH QHO &RQFRUGDWR
Nuotiamo nel passato come pesci nellacqua e non
possiamo farne a meno ma muoversi scompostamente
in siffatto elemento pu avere conseguenze impensabili
non solo per gli studiosi dellet antica.

31. Cedreno, Malalas e Niceforo Callisto citano un testo perduto di


Eusebio di Cesarea secondo cui la Pizia stessa aveva rivelato ad
$XJXVWRUHFDWRVLD'HOSHUFRQRVFHUHLOQRPHGHOVXRVXFFHVVRUH
di essere stata privata del suo potere profetico dal momento della
nascita di Cristo. Al ritorno a Roma, allora Augusto avrebbe
elevato un altare in Campidoglio al dio primogenito (Eus., Apud
Cedrenum, PG 121, coll. 355-358). Anche Orosio celebr Augusto
come limperatore voluto dalla Provvidenza perch i christiana
tempora coincidessero con linizio dellimpero romano: Oros.
VI, 18, 34 e 20, 40-45: sulla fonte dolio sgorgata al momento
dellingresso di Augusto in Roma nel 36 a.C.; VI, 20, 1-4: sul ritorno
di Augusto dallOriente il giorno dellepifania. Cfr. R. Teja, Augusto,
Constantino, Roma y el papado entre el mito y la historia (Roma,
Reale Accademia di Spagna, 22 gen. 2014), che ingrazio per avermi
inviato il testo non ancora edito.
32. Sullorganizzazione di tale propaganda ebbe molto peso
OLQXHQ]DGL0DUJKHULWD6DUIDWWLXQDGRQQDGLRULJLQHHEUHDYLFLQD
a Mussolini gi allepoca della dirigenza del Partito Socialista
Italiano e della direzione dellAvanti!. La sua ampia cultura anche
antichistica ben documentata nei suoi interventi su Il Popolo
dItalia (fondato e diretto dal futuro dittatore), di cui la scrittrice
fu redattrice a partire dal 1918. Si veda M. Torelli, Archeologia e
fascismo: Creazione e diffusione di un mito attraverso i francobolli
del regime, in R. Olmos, T. Tortosa, J.P. Belln (dir.), Repensar la
escuela del CSIC en Roma. Cien anos de memoria, Madrid, 2010,
pp. 385-405, in part. pp. 394-396.

18

RITTA LIZZI TESTA

Lanno costantiniano del 2013:


in realt un biennio, o meglio un triennio
Lanno costantiniano si concluso nel dicembre 2013
mentre si apriva in cadenza cronologica il bimillenario della
morte di Augusto (14 d.C.-2014): una continuit che in altre
occasioni, per quanto si detto, sarebbe parsa tuttaltro
che casuale. A dare il segno dei tempi, invece, alcuni dati
VRQR VLJQLFDWLYL 1HOOD PRVWUD VX Augusto organizzata a
Roma (Scuderie del Quirinale, 18 ottobre 2013-9 febbraio
2014), il princeps brillava per la sua assenza, nonostante
unimmensa sala fosse occupata dalle sue statue: il curatore
ha preferito illustrare i linguaggi artistici della nuova cultura
augustea essendo espressione di forme e gusti maturati nel
corso di un regno durato mezzo secolo (44 a.C.-14 d.C) e
che tuttora dominano la civilt occidentale piuttosto che i
segni politici della rivoluzione istituzionale con cui Augusto
trasform la res publica in Principato. Dallaltro, in una
conferenza tenuta per le nuove celebrazioni augustee si
parlato dellassimilazione Augusto / Costantino, non tuttavia
per esaltare la provvidenzialit del fondatore dellimpero
romano e del fondatore dellimpero romano-cristiano, bens
per studiare nelle fonti come si realizz il processo di cristianizzazione di Augusto e i modi in cui la Chiesa dOccidente
ha perpetuato, anche con i simboli del potere papale desunti
da quelli dellimperatore romano, la grande anomalia
politica di uno Stato della Chiesa rivendicato in base a una
SUHVXQWDGRQD]LRQHGL&RVWDQWLQRFKHQGDO/RUHQ]R
Valla aveva dimostrato essere un falso33.
Le iniziative dellAnno Costantiniano 2013 promosse
dallArcidiocesi di Milano sono state molto diverse da
quelle annunciate dalla Santa Sede nel 1913, almeno per il
tema intorno al quale cattolici e laici sono stati chiamati a
confrontarsi: non tanto lEditto di Milano, bens la libert
di fede, il dialogo con le Chiese dOriente, la realt
multiculturale e interreligiosa dei nostri tempi. Liberi per
credere stato il titolo allinsegna del quale il calendario
di eventi milanesi, che hanno avuto il signum crucis come
logo, si svolto. Ed essi sono stati molteplici e di vario
genere. A prescindere da un convegno storico-culturale,
organizzato dalle principali istituzioni accademiche nel
maggio 2013, di cui si dir, H XQ FRQYHJQR ORVRFR
teologico in ottobre, sul tema Religioni, libert, potere,
articolato intorno al concetto odierno di libert religiosa e
sul rapporto tra religioni e istituzioni pubbliche, tra libert
religiosa e cultura civile, su cristianesimo e libert di
credere34, allinterno di una serie di iniziative ecumeniche,

33. R. Teja, Augusto, Constantino, cit. (n. 31). Si confrontino le relazioni


di S. Benoist e E. Galindo al convegno di Barcelona / Tarragona, di
cui oltre, p. 22-23.
34. Religioni, libert, potere (Universit Cattolica del Sacro Cuore,
Universit degli Studi, 16-18 ottobre 2013). Al Convegno hanno
collaborato, oltre alla Diocesi di Milano, la Facolt teologica dellItalia

AnTard , 22, 2014

il cardinale Scola ha invitato a Milano il patriarca di


Costantinopoli Bartolomeo I (20-21 marzo)35 e il Forum
delle religioniXIFLDOL]]DWRQHOTXDQGRIXUPDWD
una Carta dintenti ha organizzato una festa (il 25 marzo
2013) con 24 gruppi di 5 aree religiose comprendenti ebrei,
buddhisti, induisti, musulmani e cristiani.
Le celebrazioni organizzate dallArcidiocesi di
Milano, peraltro, erano parte di un progetto concepito dal
3RQWLFLR&RPLWDWRGL6FLHQ]H6WRULFKHFKHKDSUHYLVWR
anche lorganizzazione di un convegno storico nella Citt
GHO 9DWLFDQR H DOOD 3RQWLFLD 8QLYHUVLWj /DWHUDQHQVH VX
Costantino. Il centenario costantiniano del 2013, dunque,
stato in realt un biennio, volendosi celebrare non solo
la proclamazione della liceit del cristianesimo con il
protocollo di Milano nei primi mesi del 31336, ma pure
lascesa al potere dellOccidente di Costantino il 28
ottobre 312, con la vittoria di ponte Milvio su Massenzio37.
Mentre M. Dominique Chenu, alla vigilia del Vaticano
II, riteneva indispensabile la QGHOpUHFRQVWDQWLQLHQQH
perch la Chiesa, deposte le sue rivendicazioni di potere,
potesse svolgere al meglio il suo compito evangelico38, le
iniziative promosse dalla diocesi milanese e dal Vaticano
hanno confermato che il mondo cattolico riconosce tuttora
DOODVYROWDFRVWDQWLQLDQDXQSURIRQGRVLJQLFDWRGLFHVXUD
e, dunque, di periodizzazione e ad alcuni aspetti dellazione di Costantino un indubbio valore simbolico di avvio
di una nuova fase nei rapporti sociali e politici in virt
della scelta cristiana.

settentrionale, lUniversit Cattolica del Sacro Cuore, il Progetto


culturale della Chiesa italiana e lUniversit degli Studi di Milano.
35. La visita ha un precedente perch gi nel maggio del 1997, in
occasione dellAnno Santambrosiano, Bartolomeo I incontr a
Milano lallora arcivescovo, il cardinale Carlo Maria Martini.
36. Del cosiddetto Editto di Milano, conservato nel De mortibus
persecutorum di Lattanzio (48, 1-3) e nella Storia ecclesiastica di
Eusebio (10, 5, 2) come lettera inviata al governatore di Nicomedia da
Licinio dopo gli accordi presi a Milano con Costantino, non nota la
data di emanazione. Il periodo, tuttavia, lo si evince dalla permanenza dei
due Augusti a Milano, ove Licinio prese in sposa la sorella di Costantino
Costanza. Costantino, infatti, rimase a Roma per circa due mesi (Pan.
Lat. 10 (4), 33, 6); era ancora in citt il 6 gennaio 313 (CTh 15, 14, 3S),
ma dovette partirne quasi subito dopo. Da Milano emanava leggi ancora
il 10 marzo 313 (CTh 10, 8, 1), ma era a Treviri il 28 maggio (Frag. Vat.
291S): Licinio, a sua volta, lasci Carnuntum alla volta dellItalia agli
inizi di febbraio: Lact., De mort. pers. 45, 1: cfr. T.D. Barnes, Constantine
and Eusebius, Cambridge (MA), 1981, pp. 62-65.
37. Le fonti convergono sulla data dello scontro il 28 ottobre 312, il sesto
anniversario dellassunzione della porpora di Massenzio : Pan. Lat. IX
(12), 2; Lact., De Mort. Pers. 44, 3; Eus., HE IX, 9, 1. Quanto al luogo,
unico autore antico che ponga la fase decisiva della battaglia ad Saxa rubra
(una stazione sulla Via Flaminia a 9 miglia da Roma dalle rocce di tufo
rossastro, oggi Prima Porta) Aurelio Vittore (Caes. 40, 23); altre fonti
non fanno nomi, ma Lattanzio (De mort. persec., 44, 3) esplicitamente
colloca la fase principale della battaglia nei pressi del Ponte Milvio. Gi
E. Gibbon prefer il racconto di Aurelio Vittore (ai Saxa rubra lo scontro
GHFLVLYR DO SRQWH 0LOYLR OHSLVRGLR QDOH FRQ OD PRUWH GL 0DVVHQ]LR 
considerando come teatro della vera battaglia la pianura che si apre
nellansa del Tevere a destra delle colline di Prima Porta.
38. G. Zamagni, Fine dellera costantiniana, cit. (n. 5), pp. 20-27.

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

La necessit pastorale, nel celebrare eventi o


personaggi storici, di selezionare i temi di maggiore
attualit continua, tuttavia, a presentare il rischio di
ricadere nella tendenza monotematica, che caratterizz
le celebrazioni del 1913 (anche se su temi diversi), e di
leggere i provvedimenti di Costantino in una dimensione
totalizzante. Cos, per esempio, la grande mostra milanese
aperta a palazzo Reale dal 25 ottobre 2012 al 17 marzo
2013 e trasferita a Roma dall11 aprile al 15 settembre
2013 nelle sedi del Colosseo e della Curia Iulia dove
stata arricchita di una sezione interamente dedicata a
Roma (curata da Mariarosa Barbera) , nel sottotitolo
del catalogo (Costantino 313 d.C. Leditto di Milano
e il tempo della tolleranza) e in alcuni suoi saggi ha
celebrato Costantino come il protagonista del tempo
della tolleranza, quasi ad assolutizzare un evento e un
provvedimento che, come ogni fatto storico, invece, si
pu comprendere solo se declinato nel tempo: lo stesso
LPSHUDWRUHIXDUWHFHGLSURYYHGLPHQWLPROWRWROOHUDQWL
e ne var altri gravemente intolleranti. Tolleranza e
intolleranza, inoltre, non avevano al tempo di Costantino
LO VLJQLFDWR FKH DVVXPRQR RJJL39. Tutto ci, peraltro,
stato approfondito in seminari, piccoli convegni, giornate
di studio tenuti nel corso del 2013 che, seppur non legati
in modo esplicito alle celebrazioni costantiniane, hanno
richiamato in vario modo i problemi connessi con le
conseguenze, in termini di tolleranza/intolleranza, delleditto di Galerio e del provvedimento elaborato a Milano.
Merita, in particolare, ricordare quello tenuto a Basilea
nellagosto40, quello organizzato dalle Universit di Roma
Tre e Universit Europea di Roma in settembre41, allUniYHUVLWjGL3DUPDDQHQRYHPEUH42.
Indipendentemente dal titolo, tuttavia, la mostra di
Palazzo Reale43 ha inteso offrire allo spettatore un insieme
di manufatti e creazioni artistiche, che documentassero
lo sviluppo di Milano capitale imperiale nel corso del

39. A. Giardina, Lepoca di Costantino, in G. Bonamente, N. Lenski,


R. Lizzi Testa (dir.), Costantino prima e dopo Costantino. Constantine
before and after Constantine, Bari, 2012, pp. XXIX-XLVIII, in part.
p. XXXVIII-XXXIX.
40. Religise Toleranz: Moderne Ideale im Spiegel antiker Realien
(Landgut Castelen, 28-31 August 2013), organizzato da M. Wallraff
che ha aperto i lavori come XIV Colloquium Rauricum, ha inteso
chiarire la differenza tra il concetto moderno di tolleranza rispetto a
quello maturato in et tardoantica.
41. Tolleranza religiosa in et tardoantica, IV-V secolo (Roma, 2627 settembre 2013), a cura di A. Marcone, U. Roberto, I. Tantillo,
quale prima di una serie annunciata di Giornate di studio sullet
tardoantica.
42. Oltre lintolleranza: levoluzione della politica religiosa imperiale
e lincontro di Milano del 313. Premesse storiche ed ideologiche e
DOWHUQL VYLOXSSL QR D *LXOLDQR O$SRVWDWD (28-29 novembre 2013),
organizzato da V. Gheller e S. Puliatti come uno dei seminari della
sezione parmense dellAssociazione di Studi Tardoantichi.
43. Progettata e ideata dal Museo Diocesano di Milano e curata da Paolo
Biscottini e Gemma Sena Chiesa; il Catalogo a cura di G. Sena
Chiesa, Milano, 2012.

19

III-IV secolo e gli effetti della conversione di Costantino


attraverso i repertori simbolici e gli strumenti del suo
trionfo: articolata in sei sezioni esponeva pi di 160 oggetti
darcheologia e darte. Non sono mancati reperti relativi
agli armamenti dellesercito e della vita a Corte, come i
preziosi oggetti darte e di lusso, che la svolta costantiniana permise di possedere ed esibire ai ceti alti resi pi
ricchi dalle sue riforme e ad alcune chiese cattoliche.
Una sezione della mostra stata dedicata a Elena, madre
di Costantino, imperatrice e santa, mettendo in risalto
ODVLQJRODULWjGLTXHVWDJXUDIHPPLQLOHDOOLQWHUQRGHOOD
Corte imperiale e della storia della Chiesa.
Molta attenzione ai risultati delle pi recenti ricerche
VFLHQWLFKH q VWDWD SUHVWDWD QHL GXH FRQYHJQL VWRULFL
RUJDQL]]DWL HR SDWURFLQDWL GDO 3RQWLFLR &RPLWDWR GL
Scienze Storiche. Laccortezza si nota nella scelta stessa
dei termini intorno a cui il dibattito stato sollecitato: il
convegno di Roma nel 2012, Costantino il Grande. Alle
radici dellEuropa FRQ QH VHQVLELOLWj VWRULRJUDFD KD
evitato di connettere Costantino con le radici dellEuropa
cristiana o anche con le radici cristiane dEuropa44;
quello del 2013, Costantino a Milano. LEditto e la sua
storia (313-2013)45, ha suggerito unopzione intorno alla
vexata quaestio delleditto, eliminando la consueta virgolettatura, senza tuttavia precludere ai relatori di esaminare,
con approcci diversi, come il problema sia stato affrontato
negli ultimi due secoli e quali novit la ricerca recente sia in
grado di offrire per una sua migliore comprensione. Le loro
sessioni sono state caratterizzate da ricchezza di tematiche
e seriet di contributi, che potranno essere meglio valutate
non appena saranno pubblicati gli Atti.
$5RPDGRSRXQELODQFLRVWRULRJUDFR *%RQDPHQWH 
sui raggiungimenti della ricerca degli ultimi decenni grazie
anche ai dibattiti intercorsi tra gli studiosi durante gli eventi
(mostre, cataloghi, convegni) che dal 2005 al 2007 hanno
permesso di approfondire le circostanze della proclamazione ad Augusto di Costantino nel 30646, contributi di
varia importanza sono stati incardinati intorno a tre temi
centrali: i rapporti tra Chiesa e Impero prima della battaglia
di ponte Milvio; la battaglia tra Massenzio e Costantino;
la conversione e il battesimo di questultimo, nonch
i provvedimenti da lui presi in favore delle comunit
cattoliche dOccidente. Sono stati esaminati, pertanto,

44. Costantino il Grande. Alle radici dellEuropa. 1700o anniversario


della Battaglia di Ponte Milvio e della conversione di Costantino.
Convegno Internazionale di studio (Citt del Vaticano, 18-21 aprile
2012). Gli Atti non sono ancora editi.
45. Costantino a Milano. LEditto e la sua storia (313-2013) (Universit
Cattolica, Biblioteca Ambrosiana e Universit degli Studi di Milano,
8-11 maggio 2013), i cui Atti non sono ancora editi.
46. Un buon resoconto, con elenco delle pubblicazioni, dato anche da
N. Lenski, Preface, in Bonamente, N. Lenski, R. Lizzi Testa (dir.),
Costantino, cit. (n. 39), pp. VII-XIV, in part. pp. VIII-IX, nn. 3-6, e da
L. Cracco Ruggini, Le date dei centenar di Costantino e il personaggio,
in ibidem, pp. XV-XXVII, in part. p. XV, n. 2.

20

RITTA LIZZI TESTA

latteggiamento dei cristiani prima e di fronte alla grande


persecuzione (M. Rizzi; I.-A. Tudorie); lorganizzazione
precostantiniana delle comunit cristiane cittadine e il
disomogeneo costituirsi delle metropoli ecclesiastiche dopo
Nicea (A. Di Berardino); la formazione di Costantino nel
quadro di una teologia politica ispirata al tardo neoplatonismo e imbevuta di spirito cristiano (E. de Palma Digeser);
LOVLJQLFDWR SHUVLQRDUFKHWLSLFR GHOODEDWWDJOLDGL3RQWH
Milvio (R. de Mattei); il ruolo del Senato nellideazione
GHOO$UFR H QHO SURJUDPPD LFRQRJUDFR H LGHRORJLFR D
FXLIXLVSLUDWR 1/HQVNL OLFRQRJUDDGL&RVWDQWLQRGDO
Tardoantico al Medioevo (M. Andaloro); lapporto delle
testimonianze numismatiche (B. Bleckmann, G. Alteri),
nonch di quelle legislative utili a capire che Costantino
concep il battesimo quale manifestazione del proprio credo
religioso (G.L. Falchi). Linterpretazione in chiave mistica,
proposta nella Vita Constantini, di conversione e battesimo
dellimperatore indica che Eusebio intendeva creare una
continuit tra battesimo e cerimonia funebre (A. Marcone),
mentre lo studio della simbologia funeraria del 337 ha
rivelato lintreccio ancora forte di elementi del culto solare
H GL TXHOOR FULVWLDQR DOOD QH GHO UHJQR 0:DOUDII  GHL
provvedimenti presi da Costantino in favore della comunit
cattolica di Cartagine e subito estesi allItalia e allOccidente stata precisata la cronologia, essendo essi stati
emanati immediatamente dopo la battaglia di Ponte Milvio
(R. Lizzi Testa); un bilancio conclusivo stato tirato da
3 %HUQDUG$UGXUD 3UHVLGHQWH GHO 3RQWLFLR &RPLWDWR GL
Scienze Storiche.
Del convegno milanese di maggio47, impossibile
accennare al contenuto di tutti gli interventi, essendosi
prolungato per tre giornate e mezza per un totale di
trenta contributi. Nella prima giornata, le relazioni si
sono concentrate sul provvedimento preso a Milano nella
primavera del 313. La relazione di apertura (N. Lenski) ha
insistito sul valore che si deve attribuire al provvedimento
scaturito dai colloqui tra Costantino e Licinio: sebbene ci
che abbiamo sia una lettera di Licinio al governatore di
Nicomedia, resta salda la validit normativa di quel testo,
dal momento che allepoca gli editti stessi potevano essere
trasmessi sotto forma di sacrae litterae tantoch quella
conservata da Lattanzio ed Eusebio mostra i tratti sia di
lettera sia di editto, come molti altri documenti tardoantichi.
A. Marcone ha proposto una ricostruzione del dibattito
VWRULRJUDFRFKHLOGRFXPHQWRKDDFFHVRDWWUDYHUVRLVHFROL
nelle posizioni pi estreme, se documento ci fu non fu
editto, non fu promulgato a Milano, lautore non ne fu
Costantino e un editto di tolleranza verso i cristiani era stato
gi emanato da Galerio nel 311 , sulla scia del precoce
scetticismo di E. Gibbon (V.M. Minale); del testo riportato
da Eusebio e Lattanzio sono stati condotti un nuovo studio

47. Supra, n. 34.

AnTard , 22, 2014

ORORJLFROHWWHUDULR &00D]]XFFKL HXQDQDOLVLGHOVXR


vocabolario legislativo (B. Stolte) ed stato esaminato lo
VSHFLFRFRQWHVWRLQFXLJOLDFFRUGLPLODQHVLVLFROORFDURQR
tra i concili riuniti da Costantino a Roma nel 313 e ad Arles
nel 314, essendo ormai accertata lautenticit della Lettera
ai padri conciliari inviata dallimperatore ai vescovi alla
QHGHOVHFRQGRFRQFLOLR *=HFFKLQL 48.
Sar interessante confrontare le ipotesi proposte
in queste relazioni con i risultati della Journe dtude
su ldit de Milan organizzata a Fribourg nel giugno
201349, con interventi mirati allesegesi letteraria dei
testi di Lattanzio ed Eusebio (P. Bruggisser, T. Schmidt),
ripercorrendo la storia delledizione critica del testo di
Lattanzio (L. Holtz), la posizione che la lettera di Licinio
a Nicomedia occupa nellopera (F. Mali), la tradizione
diretta del capitolo 10,5 della Historia Ecclesiastica di
Eusebio e la sua presenza in una sola delle due recensioni
manoscritte (P. Andrist), la valenza legislativa di un
provvedimento (lettera o editto), che comunque non
fu ripreso n nel Codice Teodosiano, n da quello di
Giustiniano (P. Pichonnaz)50.
Le altre giornate del convegno milanese hanno
richiamato lattenzione su alcune novit offerte al dibattito
GDOOHWHVWLPRQLDQ]HHSLJUDFKHFKHDWWHVWDQRODSUHFRFH
adozione del cristogramma (per alcuni simbolo cristiano,
per altri segno militare) non solo in unepigrafe funeraria
DIULFDQDGHOPDSHUVLQRLQLVFUL]LRQLXIFLDOLYROXWH
da unautorit pubblica che seguiva dunque indicazioni
imperiali, databile nel 31351 (I. Tantillo). Gli effetti del
protocollo milanese sono stati esaminati nella teologia
politica e nella costruzione dellimpero cristiano con
VSHFLFLULIHULPHQWLDOOHRSHUHHDOODWWLYLWjGL$PEURJLR
QHOOD OHWWHUDWXUD QHOOLFRQRJUDD QHOOH IRUPH FXOWXDOL H
negli sviluppi rituali. Si sono indagate le articolazioni
dellimmagine di Costantino in un quadro cronologico
H JHRJUDFR PROWR DPSLR GDOOH Passiones dei martiri
milanesi alle enciclopedie medievali, dal biasimo di
Dante alla denuncia del falso costantiniano di Lorenzo
Valla, nonch nel pensiero della Slavia ortodossa e in
TXHOORORVRFRHWHRORJLFRUXVVR DQFKHWHQHQGRFRQWR
della prospettiva comparativa), nellEuropa luterana del
500 e attraverso le riforme religiose in Inghilterra, senza
tralasciare la leggenda dellinvenzione della croce e licoQRJUDDGLVDQ&RVWDQWLQRHVDQWD(OHQDQHL%DOFDQL

48. Esame delle fonti che consentono di studiare lorganizzazione di


entrambi i concili nel contributo di R. Lizzi Testa al convegno di
Aquileia, di cui oltre p. 22.
49. Ldit de Milan (313). Enjeux et dbats (13 Juin 2013), inedito.
50. Si segnala anche il contributo di C. Raschle sui messaggi religiosi
che i vari tetrarchi lanciarono attraverso le monete, con immagini
GL VSHFLFKH GLYLQLWj LO Sol Invictus (Costantino), la dea Roma
(Massenzio), Serapide (Massimino Daia), Iuppiter (Licinio).
51. AE 2000, nn. 1799 e 1801, pp. 682-683.

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

Per lampiezza delle prospettive tematiche in un quadro


FURQRORJLFR H JHRJUDFR DPSOLVVLPR DQFKH VH VSHVVR
sotto forma di spunti e suggestioni anzich di approfondimenti, gli interventi delle ultime giornate del convegno
milanese andranno confrontati con i contributi raccolti
nei tre volumi della grande impresa editoriale realizzata
nel 2013 dallEnciclopedia Italiana, su progetto della
Fondazione per le Scienze Religiose Giovanni XXIII:
&RVWDQWLQR , (QFLFORSHGLD &RVWDQWLQLDQD VXOOD JXUD H
limmagine dellimperatore del cosiddetto Editto di Milano
313-2013, a cura di Alberto Melloni et alii. Proponendosi
FRPHXQDULHVVLRQHDYDVWRUDJJLRVXLWHPLGHOODOLEHUWj
UHOLJLRVD>@HDQFRUSLVXOODJXUDGL&RVWDQWLQRWDQWR
nella sua dimensione storica quanto nella sua rifrazione
liturgico-politica dei miti che lo circondano e che giungono
a lambire il secolo XXI, i 150 saggi sono stati articolati
in sei grandi aree tematiche52, coinvolgendo la lettura di
fonti di ogni tipo, da quelle tradizionali antiche e moderne
D TXHOOH SURSULH GHOODUWH GHOOD FLQHPDWRJUDD GHOODUchitettura contemporanea. Il tema della libert religiosa e
delle sue connessioni con lopera di Costantino che aveva
appassionato il giovane e colto prete bergamasco, il quale
nel 1913 minut la lettera pastorale dei vescovi lombardi,
divenendo poi papa (e oggi santo) ha rappresentato,
almeno dal 1959, uno dei vari cantieri di studio attivati
dalla Fondazione Giovanni XXIII, che ha accolto negli
anni Sessanta i seminari del benedettino Marie-Dominique
Chenu e numerosi convegni, molti dei quali editi nelle
PRQRJUDHHQHJOLDUWLFROLGHOODULYLVWDCristianesimo nella
Storia. Il progetto, condiviso con la Enciclopedia Treccani,
comunque, stato avviato dallagosto 2011, utilizzando
anche le competenze di una solida quipe di studiosi che,
nel corso di quellanno, erano stati invitati a fornire una
VROLGD EDVH VFLHQWLFD DOOH FHOHEUD]LRQL FRVWDQWLQLDQH FKH
sarebbero seguite nel 2012 e nel 2013.
Nel gennaio 2011 lUniversit di Cardiff e, qualche
mese dopo, lUniversit di Perugia, infatti, avevano gi
allargato il biennio costantiniano in triennio, organizzando rispettivamente in Inghilterra un seminario su Sons
of Constantine53 e a Perugia un Convegno internazionale
QDQ]LDWR GDOOD ORFDOH )RQGD]LRQH &DVVD GL 5LVSDUPLR L
cui Atti sono stati pubblicati da Edipuglia nel 2012 con il
titolo Costantino prima e dopo Costantino. Constantine

$OOLQWHUQRGLRJQXQDGLWDOLDUHHODJXUDGL&RVWDQWLQRORVIRQGR
storico costantiniano; la costruzione dellimmagine di Costantino
(dal IV al VI secolo); la trasmissione e la funzione del mito (VIIXV secolo): il destino moderno di Costantino (XV-XIX) Costantino
e il Novecento gli approfondimenti sono a soggetto e seguendo un
ordine cronologico.
53. Lincontro ha previsto gli interventi di S.Tougher (Imperial Blood:
Family Relationships in the Dynasty of Constantine the Great), M. Saxby
(The Coinage of Constantine I and his Sons: Symbols of Power), J. Harries
(Constans the Hunter: A Late Roman Murder Mystery), N. Baker-Brian
(Rehabilitating Constantius II: Ancient and Modern Views), Al. Skinner,
Constantius II and the Senate of Constantinople).

21

before and after Constantin54. Lincontro si tenuto dal


27 al 30 aprile 2011 s da includere la data della promulgazione delleditto di Galerio il giorno prima delle calende
di Maggio 31155 , non tanto per sottolineare la priorit
di questa emissione legislativa rispetto al provvedimento
deciso a Milano nel 313, quanto piuttosto nella convinzione
che la scelta politico-religiosa di Costantino, i suoi provvedimenti istituzionali, economici e le loro conseguenze non
si capirebbero senza conoscere meglio il mondo prima e
dopo Costantino. Da qui il titolo (suggerito amichevolmente
da P. Brown) del volume, curato oltrech dagli organizzatori del convegno (G. Bonamente e R. Lizzi Testa), pure
da N. Lenski. Dopo la Preface di N. Lenski, una rapida
rassegna dei centenari costantiniani di L. Cracco Ruggini e
XQDPHGLWDWDULHVVLRQHVXHUHHGHSRFKHGHOODVWRULDDQWLFD
di A. Giardina, i contributi sono stati organizzati in tre
larghe sezioni in ordine cronologico Prima di Costantino:
tetrarchia, tolleranza, evoluzione; Il mondo di Costantino;
Dopo Costantino e in alcune sottosezioni, spaziando essi
dallorganizzazione tetrarchica e dal ruolo svolto in essa
da Costantino (S. Corcoran; F. Carl) a Galerio e il suo
editto (H. Brandt; A. Marcone), alla luce degli interventi
LPSHULDOLFKHQHOFRUVRGHO,,,VHFRORDYHYDQRJLjSRVWRQH
ad altre persecuzioni (R. %UDWR); dalla cronologia della
conversione (G. Bonamente) al rapporto di Costantino con
il cristianesimo nel 311 (K.M. Girardet) e con il culto del
Sole (M. Wallraff); dalle relazioni con il mondo pagano
(G. Zecchini, J.B. Rives, B. Bleckmann) a quello con i
vescovi cristiani (V. Aiello, R. Teja). Le forme assunte dalla
legislazione prima e dopo Costantino sono state oggetto
GL SDUWLFRODUH ULHVVLRQH / 'H *LRYDQQL 6 *LJOLR
G.A. Cecconi), cos come alcuni aspetti peculiari della
politica (G. Clemente), dellamministrazione (P. Porena)
e delleconomia tardoantica (D. Vera, P.C. Diaz). Dei testi
di Lattanzio (F. Paschoud), Eusebio (D. Dainese; V. Neri),
2SWD]LDQR3RUULR -:LHQDQG HGHOODUFRGL&RVWDQWLQR
(A. Bravi) sono state offerte letture inedite, mentre in
unampia retrospettiva si esaminata limmagine di

54. Supra n. 39.


55. Discussione sul luogo e il giorno di emanazione dellEditto di Galerio in
base ai dati forniti da Lact., De Mort. Pers. 33-35 (che lo riporta citando il
luogo di emissione senza, per, lintitulatio con i nomi e le titolature degli
imperatori data da Eus., HE VIII, 17) in P. Siniscalco, Leditto di Galerio
del 311. Qualche osservazione storica alla luce della terminologia,
in Atti dellAccademia Romanistica Costantiniana (X Convegno
internazionale in onore di Arnaldo Biscardi), Napoli, 1995, pp. 41-53 e
RUDFRQDPSLDGRFXPHQWD]LRQHELEOLRJUDFD-6]LGDWIl 311: leditto di
Serdica, A. Melloni et al. (dir.), Costantino I, cit. (n. 4), 1, pp. 153-166,
nonch M. Novkirishka-Stoyanova, Legal Aspects of the Serdica Edict
of Emperor Galerius DD. 30 April, 311 AD, in Serdica Edict (311 AD).
Concepts and Realizations of the Idea of Religious Toleration 6RD
2014, pp. 29-50. Leditto, promulgato a Serdica dove Galerio risiedeva
(Anon. Vales. I, 3, 8), fu pubblicato a Nicomedia (una delle residenze
imperiali della parte orientale dellImpero), il giorno prima delle calende
di Maggio (30 aprile 311) e reso noto alle idi di maggio (15 Maggio),
forse con lannuncio della morte dellimperatore.

22

RITTA LIZZI TESTA

Costantino in Atanasio e Firmico Materno (N. Lenski),


nelle fonti legislative di V secolo (R. Lizzi Testa), in quelle
ariane dellItalia ostrogota (G. Marconi), in alcuni passi
di Zosimo (S. Margutti), in Agostino (J.-M. Salamito),
nel /LEHU3RQWLFDOLV %&DVHDX QHLGRFXPHQWLDSRFUL
GHOORVFLVPDODXUHQ]LDQRQHJOLDWWLSRQWLFDOLHQHOODFRUUL
spondenza papale di V-VI secolo (D. Moreau).
Il convegno si chiuso a nel Palazzo comunale di Spello,
ove per loccasione stata preparata una installazione del
famoso Rescritto costantiniano allinterno della splendida
biblioteca comunale con scaffalature in legno dipinto e in
stile veneziano del XVII secolo dal convento di santAndrea,
il cui fondo antico possiede oltre 4000 volumi, tra cui un
incunabolo stampato a Venezia nel 1474: la malandata
stele del Rescritto ha acquisito nuova vita, cooperando
a riscoprire un ambiente di grande pregio, solitamente
chiuso ai visitatori56. Oltre agli studiosi invitati a dare i
loro contributi (provenienti da nove differenti paesi e due
FRQWLQHQWL  OLQFRQWUR VFLHQWLFR KD YLVWR OD SDUWHFLSDzione di larghe rappresentanze di docenti dal mondo della
scuola, che durante lanno sono stati coinvolti in un Corso
di Formazione QDQ]LDWR GDOOD SURYLQFLD GL 3HUXJLD57. La
mostra Aurea Umbria. Una regione dellImpero nellera
di Costantino, allestita nei locali del Palazzo Comunale di
Spello dal 29 luglio al 6 gennaio 2013, avrebbe dovuto aprirsi
in connessione con il Convegno, essendo non tanto legata
alle celebrazioni costantiniane quanto piuttosto progettata per
RIIULUHWHVWLPRQLDQ]HVLJQLFDWLYHGLVWRULDORFDOHFKHDUWLFRODVVHUR OH ULHVVLRQL GHOOLQFRQWUR VFLHQWLFR 1RQRVWDQWH L
pezzi fossero nel complesso poco numerosi (70 reperti, di
contro agli oltre 160 individuati dalloriginale comitato scienWLFR HVHEEHQHVRORDOFXQLIRVVHURYHUDPHQWHVLJQLFDWLYL
la mostra ha comunque aperto il sipario su vari aspetti della
vita pubblica e privata, come pure della cultura materiale e
spirituale dellUmbria tra III e VI secolo, esibendo tra laltro
anche il tesoretto di Canoscio58.
Un buon complemento ai contributi sullEditto di
Galerio e sul protocollo di Milano pubblicati nel volume
perugino ora costituito da quello che raccoglie gli
Atti dellInternational Interdisciplinary Conference,
RUJDQL]]DWDD6RDGDODODSULOHGD9HVVHOLQD

56. La installazione, a cura di Marco Testa, ha offerto un esempio della


possibile rifunzionalizzazione, anche quali pezzi di arte, dei testi
HSLJUDFL DQWLFKL DFFDQWR DOOD VWHOH LQFLVD LQVWDOODWD VX VXSSRUWL
artistici, scorrevano su uno schermo illuminato le parole del testo
originale e la loro traduzione nelle principali lingue moderne [http://
tuttoggi.info/costantino-prima-e-dopo-costantino-oggi-a-spellolanteprima-dellattesa-mostra-archeologica-aurea-umbria/95808/].
57. La Storia come ricerca e come insegnamento: Let tardoantica tra
civilt classica e mondo moderno (21 febbraio-16 settembre 2011):
lezioni e testi, messi a disposizione dai relatori provenienti da tutta
lItalia e da professori degli Istituti di Istruzione secondaria superiore,
sono consultabili online nel sito www.constantinusmagnus.unipg.it
58. Il catalogo, a cura di A. Bravi, ancora in corso di stampa al momento
dellesposizione, pubblicato nel Bollettino dei Beni Culturali, 6,
Perugia, 2012.

AnTard , 22, 2014

Vachkova59. In larga parte dedicato allo studio dellEditto


di Galerio (E. De Palma Digeser; C. Ando), nei suoi alterni
GHVWLQLVWRULRJUDFLULVSHWWRDOWHVWRSURGRWWRGDJOLDFFRUGL
di Milano (H.A. Drake), nonch ai suoi aspetti legali
(M. Novkirishka-Stoyanova) e religiosi (N. Nikolova), il
volume include anche saggi sul panorama religioso della
QHGHO,,,HODSULPDPHWjGHO,9VHFRORFRQDWWHQ]LRQH
ai primi stadii dello scisma donatista (V. Vachkova) e alla
politica costantiniana verso pagani, donatisti e cattolici
(R. Lizzi Testa), nonch con ottica di storia locale verso
il problema delle persistenze dei culti pagani (V. LozanovaStantcheva; V. Fol), della politica religiosa tetrarchica
(H. Gracanin), degli effetti delle persecuzioni nella regione
(A. Madgearn; D. Dimitrov). N sono mancati contributi
sullimpulso dato negli ultimi anni agli scavi archeologici
GLWHDWURHDQWHDWURURPDQL =9HOLFKNRY GHOWHPSLRGL
Serapide (G. Mavrov, K. Saltirova Pavlova) e della chiesa
che potrebbe aver ospitato il concilio di Serdica del 343
(M. Ivanov). Sono stati presentati anche pezzi ancora non
pubblicati, come un piatto di marmo frammentario con
cristogramma, parte dellapparato murario della presunta
fase costantiniana della residenza imperiale di Sirmium
e un archivolto con la rappresentazione a rilievo del
medesimo motivo, trovato incidentalmente nelle vicinanze
GHO3DOD]]RLPSHULDOH ,3RSRYL 
Un taglio analogo, che ha privilegiato lapprofondimento di certe vicende costantiniane coniungandolo con
lanalisi della facies WDUGRDQWLFD GL XQD VSHFLFD UHJLRQH
stato dato al convegno organizzato ad Aquileia per la
XLIV Settimana di Studi Aquileiesi e quello tenuto allAccademia di Romania in Roma: nelluno e nellaltro sono
stati discussi aspetti che, per essere maggiormente legati a
un territorio, sono per lo pi sfuggiti ai convegni maggiori.
Nel primo60 VRQR VWDWL HVDPLQDWL L ULHVVL DTXLOHLHVL GHOOD
vocazione cristiana di Costantino (G. Cuscito); la cristianizzazione dellItalia settentrionale tra il concilio di
Roma e quello di Serdica (R. Lizzi Testa); la celebrazione
dellanno costantiniano del 1913 tra Aquileia e Vienna
(S. Tavano); la permanenza di Costantino ad Aquileia e
nellIllirico (R. %UDWR, C. Zaccaria); i rapporti della citt
con Massenzio (U. Roberto) e le sue truppe (A. Buonopane,
C. Ricci); le tappe della discesa di Costantino in Italia
settentrionale, tra battaglia di Verona e assedio aquileiese
(G. Bonamente); le costituzioni emanate da Costantino in
TXHOODFLWWj 32&XQHR ODQHGL&ULVSRQHLSUHVVLGL3ROD
50DWLMDL $QFKHQHOORVWXGLRGHOOHIRQWLOHWWHUDULHFRPH
5XQR )7KHODPRQ HLSDQHJLULFL $3HOOL]]DUL GLTXHOOH
QXPLVPDWLFKH 0$VRODWL HGHSLJUDFKH $6DUWRUL VLq

59. Serdica Edict (311 AD). Concepts and Realizations of the Idea of
Religious Toleration6RD
60. G.Cuscito, Costantino il Grande a 1700 anni dall Editto di Milano
(Atti della XLIV Settimana di Studi Anquileiesi, 30 maggio-1 giugnon
2013), Trieste, 2014.

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

privilegiato lapproccio locale, con precisazioni sullurbanistica (C. Tiussi, L. Villa) e ledilizia (M. Bueno, V. Centola)
di Aquileia e dellIstria (K. Dzin) in et costantiniana, la
produzione musiva (M. Salvadori, C. Boschetti) e la ritrattistica (E. Gagetti) stimolata dalla presenza della corte tra
Milano e Aquileia, citt divenute complementari nel corso
del IV secolo, come ha sottolineato G. Sena Chiesa nel
richiamare la mostra costantiniana organizzata a Milano.
A. Marcone ha tirato le conclusioni di questo convegno,
come pure di quello, dimpostazione simile, a cura di
M. Barbulescu, L. De Salvo, I. M. Damian allAccademia
di Romania.
Anche in questultimo, che dal 6 al 7 dicembre 2013 ha
in certo senso chiuso lanno costantiniano, stata vagliata
lazione politica di Costantino tetrarca (G. Bonamente),
anche attraverso i riferimenti a Massenzio nellOratio
ad Sanctorum Coetum (R. Cristofoli); le trasformazioni
indotte nelle lites sociali dalle sue riforme (R. Lizzi
Testa); linteresse per le strutture difensive di Roma
(E. Silverio); il rapporto tra ordo clericorum e dignitates
civili nella sua et (L. Di Paola); la creazione di un
paradigma Costantino (C. Alzati) tra polemiche antiche
(in Aurelio Vittore: N. Zgravu; per la contrapposizione
tra Costantino e Giuliano: M. Casella); le varie interpretazioni date in Italia, tra Novecento e i nostri giorni, allra
costantiniana. Attenzione speciale stata, per, riservata
a situazioni locali, alle relazioni tra impero romano e
Barbari a nord del Danubio, e al foedus con i Goti del 332
(M. Zahariade), ai livelli di cristianizzazione della regione
al tempo di Costantino, quando le persistenze pagane erano
varie (E. Popescu; D. Benea) e le persecuzioni favorirono
esperienze martiriali come in Dobrugia (A. Barnea),
mentre la diffusione del cristianesimo a Nord del Danubio
(S. Nemeti) sollecit la cristianizzazione dei Goti (per le
fonti linguistiche: C. Falluomini) ma pure la diffusione
dalla Scizia della setta degli Audiani (M. Catoi).
Altri convegni di ampio respiro, nel frattempo, si
erano tenuti nel corso del 2012 a Barcellona-Tarragona
e nel 2013 e allUniversit di Roma La Sapienza, mentre
per le celebrazioni costantiniane sono state organizzate
anche singole conferenze o piccoli seminari monotematici61. Imperniato sui rapporti tra religione e politica
nel IV secolo stato il convegno Constantinus,el

61. Si segnalano, tra molti, il seminario organizzato al British Museum


dalla Roman Society e dallAssociation of Roman Archeology intorno
al tema AD 312 Constantines Victory at the Battle of the Milvian Bridge
(3 novembre 2012); la giornata di studio organizzata da Le Monde de la
Bible et le muse de Cluny 313, dal titolo Constantin et ldit de Milan
3DULVIpYULHU DPLRVDSHUHXQLFRHYHQWRVFLHQWLFRGHGLFDWR
in Francia alle celebrazioni costantiniane; la conferenza di P. Brown su
Constantine, Eusebius of Caesarea and the future of Christianity, tenuta
in pi luoghi nel corso del 2012 e del 2013 e allAmerican Academy
di Roma il 5 Dicembre 2013; la lecture di J. Harries, Constantine
Augustus 1700: Power, Faith and the Re-formation of Christianity
(CLARC, University of Cardiff, 14 Novembre 2012).

23

primer emperador cristiano? Religin y poltica en el


siglo IV | Constantinus. The First Chirstian Emperor?
Religion and Politics in the Fourth Century (Barcelona Tarragona, 20-24 marzo 2012). Ben cinquanta contributi,
compresa la lettura inaugurale di Roberto Farina e quella
di chiusura di Ramon Teja, hanno riletto passi delle fonti
antiche maggiormente coinvolte nella vicenda religiosa
costantiniana: Lattanzio (A. Marcone), lEusebio della
Vita Constantini (S. Guilln; L. Pietri) e dellEditto ai
provinciali (G. Bonamente), i panegiristi (S. Castellanos),
Atanasio (M.C. Chiriati), Orosio e Zosimo (G. Bravo),
Agostino (R. Villegas), gli storici ecclesiastici (R. Franchi)
Gregorio Magno (P. Maym), alcuni autori latini del
V-VI secolo (M. Di Marco), Giovanni Lido (M. Vallejo).
Altre relazioni hanno affrontato temi in parte comuni
agli altri convegni considerati, ma con approcci originali:
Costantino e la successione imperiale (T.D. Barnes), il culto
apollineo di Costantino (P. A. Barcel), la cultura onirica e
i santuari iatromantici nel IV secolo (L. Canetti), il cristogramma (J. Janssens), lapporto delle emissioni monetali
al tema della religiosit di Costantino (C. Buenacasa),
TXHOOR GHOOHSLJUDD DXOLFD , 5RGj  H GHOOD LFRQRJUDD
7 1RJDOHV  &RQWULEXWL VSHFLFL VRQR VWDWL GHGLFDWL DJOL
effetti della grande persecuzione sulla stessa legislazione
costantiniana (M. Marcos), alla crisi donatista (M. Perrin)
H D TXHOOD DULDQD SXUH DWWUDYHUVR L VXRL ULHVVL QHL WHVWL
monastici e nelle normative canonistiche (D. Abadias,
P. Maraval, C.M. Pifarr, M. Prez), alla legislazione
antieretica (V. Escribano), a quella contro la magia
(E. Moreno, S. Montero), ai provvedimenti di Costantino
FRQWURJOLVSHWWDFROLGHOODQWHDWUR -$-LPpQH] HYHUVR
i giudei (R. Gonzles, C. Lillo). Della presunta abolizione
LQ HWj FRVWDQWLQLDQD GHOOD SHQD GHOOD FURFLVVLRQH62 ha
parlato A. Di Berardino; J.F. Ubina ha esaminato levoOX]LRQH GHOOXIFLR HSLVFRSDOH QHO ,9 VHFROR - 9LOHOOD
ha considerato lapporto di Ossio alla politica religiosa
costantiniana, anticipando un ampio convegno tenuto a
Cordoba nellottobre 2013 sul vescovo che potrebbe aver
ispirato alcuni importanti provvedimenti cristiani dellimperatore63; A. Alba ha visto nel sinodo di Tiro del 335 un
modello di politica religiosa imperiale; J. A. Molina ha
ricostruito i tratti di politica universalistica costantiniana
nelle operazioni militari compiute contro la Persia e i
barbari. Lutilizzo del modello augusteo nelle fonti che

62. Si veda anche la recente pubblicazione di M.G. Castello, Modi


GL HVHFX]LRQH FDSLWDOH LQ HWj WDUGRDQWLFD DOFXQH ULHVVLRQL VXOOD
cristianizzazione del diritto penale, in F. Carl, M.G. Castello,
Questioni tardoantiche. Storia e mito della svolta costantiniana,
(Aio, 659), Roma, 2010, pp. 145326.
63. El siglo de Osio de Crdoba (Crdoba, 28-31 ottobre 2013),
organizzato dallepiscopato di Cordoba nel saln de Actos del
Palacio Episcopal della citt (ancora inedito). Per loccasione stato
pubblicato una pregevole raccolta delle fonti storiche relative ad
Ossio (in testo originale e traduzione): D. J. J. Ayn Calvo, Osio de
Crdoba, un siglo de la historia del cristianismo, Cordoba, 2013.

24

RITTA LIZZI TESTA

celebrarono il nuovo principe cristiano stato oggetto delle


relazioni di S. Benoist ed E. Galindo, mentre D. Vera si
RFFXSDWRGLSROLWLFDVFDOHFRVWDQWLQLDQD LQSDUWLFRODUHLQ
relazione allAfrica), R. Lizzi Testa di Costantino e laristocrazia senatoria, P. C. Diaz del mito dellaeternitas Romae.
Altri contributi hanno avuto un taglio prettamente archeologico (P. Pensabene, sullarco di Constatino; C. Panella,
sugli interventi massenziani nellUrbe) con analisi delle
costruzioni basilicali in Campania (J. Desmulliez) e delle
sedi episcopali nella Tarraconense (J. Sales, R. Bar et alii),
mentre la sessione tenuta allIstituto Superiore di Scienze
Religiose di Tarragona ha dibattuto la cronologia costantiniana del sito di Centcelles a pochi chilometri dalla citt (J.
A. Remol, A. Arbeiter). Il tema dei rapporti tra religione
e politica nel IV secolo, di per s complesso e vastissimo,
q GLIFLOH GD ULGXUUH D DOFXQH OLQHH SRUWDQWL FRVLFFKp VL
aspettano gli Atti di questo importante incontro di studio
SHUYHULFDUHTXDQWRHVVLDWWUDYHUVRXQDVDSLHQWHRUJDQL]zazione del materiale versato nella discussione, riusciranno
a rispondere alla domanda posta dal titolo se Costantino
sia stato davvero il primo imperatore cristiano della storia.
Limpero costantiniano e i luoghi sacri (Roma,
2-4 dicembre 2013), con sede nei locali dellUniversit di
Roma La Sapienza e presso la Sala Igea dellIstituto della
Enciclopedia Italiana Treccani, stato organizzato da Tessa
Canella grazie a un Progetto FIRB e ha incluso la presentazione della gi citata Enciclopedia Costantiniana64 come
pure di un recente volume di P. Blaudeau sui rapporti tra la
Chiesa romana e i seggi orientali attraverso lo studio delle
collezioni canoniche di V-VI secolo65. La buona articolazione del convegno ha permesso di approfondire varii
aspetti della politica religiosa di Costantino. T.D. Barnes
ha affrontato in termini generali la questione antipagana e
altri ricercatori hanno declinato il problema esaminando
FDVLVSHFLFLFRPHTXHOORGHLWHPSOLSDJDQLOLPSHUDWRUH
lo affront con adeguata considerazione dei vantaggi e
GHJOL VYDQWDJJL HFRQRPLFRVFDOL FKH DEEDWWHUQH DOFXQL
o conservarne e restaurarne altri poteva venire allImpero
5 /L]]L 7HVWD  WHVWLPRQLDQ]H HSLJUDFKH LQ ,WDOLD H LQ
altre province (G. Gregori), quelle relative agli ultimi
curatores / consulares aedium sacrarum (I. Grossi), la
tradizione letteraria copta (P. Buzi), la continuit di certi
santuari incubatori (L. Canetti), nonch le compresenze
religiose e di spazi sacri nella Sicilia tardoantica (D. Patti,
E. Vitale) sono giunte quali altrettante conferme di una
politica imperiale economicamente accorta. Ovviamente
la gran parte dei contributi ha affrontato la questione
degli spazi cristiani, della loro riorganizzazione dopo la
grande persecuzione (U. Roberto), dellenfasi posta sulla
loro sacralit anche simbolica (C. Carletti, sul cristo-

64. Supra, n. 53.


65. P. Blaudeau, Le sige de Rome et lOrient (448-536) : tude goecclsiologique (CFR, 460), Roma, 2012.

AnTard , 22, 2014

gramma; P. Blaudeau, sulle reliquie nel palazzo imperiale;


O. Amore, sul Palatium tra spazio e retorica), in seguito
alla scelta religiosa di Costantino (M. Perrin; G. Lettieri)
e allimpegno architettonico dellimperatore e della madre
Elena (A. Maiuri, M.C. Carile), tanto a Roma (S. Orlandi,
R. Westall sulla basilica di San Pietro tra Costantino e
Costanzo II), quanto in Palestina (D. Dainese). Linteresse
imperiale, infatti, produsse una sagace promozione dei
luoghi santi (M. Marcos, A. Monaci), che ebbe ripercussione nelle contese tra cattolici ed eretici (M. Escribano)
ma soprattutto nei viaggi e nella liturgia del viaggio
(E. Giannarelli), favorendo una selezione di santuari di
memoria costantiniana nel V-VI secolo (T. Canella). Altri
interventi hanno articolato la discussione con affondi nel
contemporaneo (cos A. M. Bruni sulla creazione degli
spazi sacri in Russia), considerando gli effetti del centenario
costantiniano del 1913 (T. Cali) sul restauro delle
basiliche costantiniane promosso da Pio IX (G. Capitelli),
nella liturgia realizzata in quellanno nelle chiese romane
(M. Nuzzo), persino nella presenza dei luoghi costantiniani
nella letteratura contemporanea e nel cinema (S. Cracolici).
,O ;9,, FHQWHQDULR FRVWDQWLQLDQR LQQH QRQ q VWDWR
celebrato solo nellEuropa occidentale cattolica. Molti
sono stati i convegni organizzati anche nellarea orientale
europea dalle chiese ortodosse: tutti tenuti nel corso del
201366 e tutti concentrati sul cosiddetto editto di Milano
e i suoi effetti. Dopo un incontro di studio a Minsk (la
capitale della Bielorussia)67 e a Novi Sad (a nord della
Serbia, sulle rive del Danubio)68, il convegno ad Instabul
sotto il patronato del patriarca ecumenico Bartolomeo
di Costantinopoli69 secondo gli osservatori locali stato
ULOHYDQWHQRQSHUSDUWLFRODULQRYLWjVFLHQWLFKHPDSHUFKp
stato organizzato dal Theoretical Center of the Eastern
2UWKRGR[:RUOGGDFXLVRQRVWDWHXIFLDOPHQWHDQQXQFLDWH
le iniziative ecumeniche ortodosse che si sarebbero svolte in
Serbia (a Ni, Belgrado, Podgorica) in nome di Costantino
il Grande. Subito dopo la sua conclusione, il 19 maggio,
il patriarca ecumenico ha emanato una lettera enciclica
sullEditto di Milano, che sottolineava limportanza della
celebrazione di un evento la cui unicit a tutti sempre
stata nota70. La Chiesa ortodossa orientale, che da secoli
celebra San Costantino in quanto imperatore guerriero e

66. The Orthodox Christian Studies Center insieme al the Interdisciplinary


Center for Hellenic Studies at Fordham University ha organizzato anche
al The Richard Stockton College of New Jersey (4-5 ottobre 2013) un
convegno per celebrare il 1700 anniversario dellEditto di Milano, con
la partecipazione di studiosi come H.A. Drake e N. Lenski.
67. The Edict of Milan in the History of Civilization. Problems of Interaction
between Church and State in Modern Conditions (5 Aprile 2013).
68. Edict of Milan (313-2013): The Basics for freedom and evidence?,
,QWHUQDWLRQDO6FLHQWLF&RQIHUHQFH 1RYL6DG0D\ 
69. Religious Freedom Today. Emperor Constantines Edict of Milan:
1700 years later (Istanbul, Turkey, 17-18 May 2013).
70. Ringrazio la collega e amica Vesselina Vachkova per le informazioni
relative a questi convegni.

AnTa rd , 2 2 , 2 0 1 4

I CENTENARII COSTANTINIANI E IL PESO DELLA CONTEMPORANEIT

santo rivelatore della croce, con la convinzione tuttavia


che leditto milanese fosse una pura creazione del cattolico
Cesare Baronio, nel centenario che ricorre nel XXI secolo
VHPEUDLQQHULFRQRVFHUQHODVWRULFLWjHGDFFRUGRFRQOD
Chiesa cattolica, considerarla una tappa fondamentale nel
riconoscimento della libert religiosa.
Diplomazia vaticana e ambrosiana, pi delle discusVLRQL VFLHQWLFKH DWWLYDWH QHO FRUVR GHOODQQR KDQQR
giocato una parte rilevante. Dopoch il patriarca serbo
Irinej si era pubblicamente dichiarato a favore della
SUHVHQ]DGHOSRQWHFHURPDQRDOJUDQGHPHHWLQJFRVWDQtiniano di Ni71, nel corso del 2012 il Santo Sinodo della
&KLHVDVHUEDDYHYDRSSRVWRXQQHWWRULXWRcreando non
SRFKH GLIFolt al primate72. Ha superato limpasse la
delegazione guidata dallarcivescovo di Milano, Angelo
Scola, che ha visitato la Serbia per celebrare leditto
costantiniano dal 20 al 22 settembre, incontrando il
patriarca ecumenico Irinej73 nella sede del Patriarcato.
Nella citt natale del primo imperatore cristiano,
tuttavia, non si svolta solo la Divina Liturgia davanti
alla nuova chiesa dei Santi Costantino ed Elena. Dopo
i convegni di Belgrado74 e S. Pietroburgo75, il grande
convegno ortodosso Saint Emperor Constantine and
Christianity (31 maggio-2 giugno) stato tenuto alla
Faculty of Philosophy di Ni. Lincontro, molto affollato,
ha sollecitato gli studiosi su temi disparati anche di tipo
amministrativo, ma per lo pi sullEditto di Serdica e
sul protocollo di Milano, che T.D. Barnes ha svuotato
di contenuti di fronte a un uditorio, ora probabilmente
desideroso di accordargliene. Sebbene le sessioni fossero
molto eterogenee, perch sugli stessi argomenti si
tornati spesso in giornate diverse, non tutte organizzate
o cronologicamente o in modo tematico, i materiali
messi a disposizione sono stati moltissimi: Constitutum
Constantini e letteratura liturgica slava delle festivit
costantinopolitane; dibattiti ariani della seconda met del
,9VHFRORHULHVVLRQLVXOGRJPDFDOFHGRQHVHULWUDWWLVWLFD
H DUWL PLQRUL LQ HWj FRVWDQWLQLDQD H VWRULRJUDD VODYD VX

71. Patriarchi e vescovi delle Chiese ortodosse si sono incontrati


dopo decenni dal 4 al 9 ottobre 2013 per commemorare i 1700 anni
dellEditto di Milano: http://italintermedia.globalist.it/Detail_News_
Display?ID=59087.
72. /D PRWLYD]LRQH XIFLDOH HUD OD SUHJKLHUD VXOOD WRPED GHO FDUGLQDOH
Alojzije Stepinac, che Benedetto XVI aveva annunciato di voler celebrare
in occasione della sua andata in Serbia. Alojzije Stepinac, arcivescovo di
Zagabria, stato considerato un martire del regime comunista iugoslavo
HSHUTXHVWRKDULFHYXWRODEHDWLFD]LRQHGL*LRYDQQL3DROR,,QHO
ma da altri ritenuto colpevole di collusione con il regime ustascia di
$QWH3DYHOLLOTXDOHDFDSRGHOORVWDWRLQGLSHQGHQWHGL&URD]LDGDO
KDLQHULWRFRQWUROHDOWUHQD]LRQDOLWjLXJRVODYH.
73. Supra, n. 35.
74. The Church in the Time of St. Emperor Constantine the Great
(Beograd, 24 May 2013).
75. Truth and Dialogue. International Conference dedicated to the
1700th anniversary of the Edict of Milan (St. Petersburg, Russian
Christian Humanitarian Academy, 27-30 May 2013).

25

Costantino; santit di Costantino ed Elena attraverso i


VHFROL H SHU DUHH JHRJUDFKH Na Rom in Gregorio di
1D]LDQ]RODORVRDGHLSDGUL&DSSDGRFLODVDJJH]]DGL
Costantino e la saggezza di Dio, ma anche la saggezza e il
concetto di gerarchia in Massimo il Confessore; la chiesa
di Alessandria e la situazione politica, sociale e interreligiosa in Alessandria nel IV secolo; lo scisma donatista
D1LFHDHODSURFHGXUDGHLFRQFLOLHFXPHQLFLLYLVVDWD
la venerazione di San Costantino nella Mongolia russa e
lo zar russo come Nuovo Costantino; il paradigma reale
FRVWDQWLQLDQRHODVXDLQXHQ]DVXOODFXOWXUDPHGLHYDOH
Costantino idolatra o Costantino Cristo.
Solo sugli Atti, ancora in corso di stampa, si potr
vagliare la qualit di tanti contributi, che rivelano uno
sforzo notevole nel mettere a fuoco le tematiche pi a
cuore alla Chiesa ortodossa. Dal programma comunque
evidente che la chiesa di Ni ha aperto le porte anche a
qualche studioso milanese, come prova la presenza tra
i relatori di don Francesco Braschi, Direttore (oltrech
cofondatore) dellAccademia Ambrosiana (oggi Classe di
Studi ambrosiani della medesima), invitato al convegno
in quanto studioso dellExplanatio Psalmorum XII e del
de obitu ambrosiani: nonostante premesse non buone,
dunque, il dialogo tra patriarchi e il cardinale Angelo
Scola non si interrotto.
3L FLUFRVFULWWL PD SXUH SL VHUUDWL VFLHQWLFDPHQWH
sono stati i convegni a Yaroslav e Tessalonica76, non diversamente da quello tenuto a Bucarest dal 17 al 19 settembre
201277, i cui Atti (a cura di E. Popescu e M. Ovidiu
&RL hanno il pregio di offrire anche una traduzione
in rumeno dei numerosi interventi in inglese e tedesco
degli studiosi ivi invitati: di A.M. Ritter (su Costantino
e Cristo alla luce delle nuove ricerche), di K.M. Girardet
(Dalla persecuzione al riconoscimento: Roma e Cristo in
et dioclezianea-costantiniana), di F. Maly (Il cosiddetto
editto di Milano e il DMP di Lattanzio), di A. Di
%HUDUGLQR VXOOD JHRJUDD UHOLJLRVD H ORUJDQL]]D]LRQH
ecclesiastica nel IV secolo), di H. Brennecke (Costantino
e la Chiesa al concilio di Nicea GL67RUEDWRY VXOODQH
del paganesimo nei Balcani orientali attraverso le testimonianze archeologiche). Numerosi, tuttavia, sono anche gli
interventi in rumeno, non tradotti, su aspetti che potrebbero
essere di vario interesse per un lettore occidentale (dalla
presenza romana nel Nord del Danubio alle operazioni
ivi condotte da Costantino; come pure alcuni sulla vita

76. The Edict of Milan: Church, State and Society. 1700 Years Later.
Orthodox Conference (Yaroslavl Theological School, 5 December 2013);
Constantine the Great and his Age. International Conference Dedicated
to Constantine the Great on the Occasion of the 1700th Anniversary of
the Edict of Milan (313-2013) (Thessaloniki, 4-6 December 2013).
77. &UXFHLPLVLXQH6QLLPSUDL&RQVWDQWLQL(OHQD promotori ai
OLEHUWLLUHOLJLRDVHLDSUWRULDL%LVHULFLL, I-II vol., Bucuresti, 2013.

26

RITTA LIZZI TESTA

economica della regione o anche sui santi Costantino ed


Elena nella spiritualit e la cultura alta e popolare). Da
ricordare, peraltro, che il patriarca della Chiesa ortodossa
di Romania, Daniele, non stato invitato alle celebrazioni costantiniane di Ni, sebbene il 28 marzo 2012 la
Romania avesse tolto il suo veto allingresso nellUnione
Europea della Serbia, accusata in passato di violare i diritti
civili delle due minoranze valacca e romena (41 mila e
 PLOD FLWWDGLQL ULVSHWWLYDPHQWH  DGGRVVDWH DO FRQQH
con la Romania, perch Belgrado continua ad accusare
%XFDUHVWGLVFRQQDUHLQWHUULWRULGRYHYLYRQRFLWWDGLQLGL
etnia serba. Se da un punto di vista politico la questione
dunque sembrerebbe risolta, non lo dal punto di vista
ecclesiastico: lOrtodossia che ha celebrato i 1700 anni
dellEditto di Milano, riconoscendo in Costantino colui
che ha proclamato il tempo della tolleranza, resta divisa
HFRQLWWXDOH
Le celebrazioni del triennio costantiniano hanno
VHJQDWR DOFXQL UDJJLXQJLPHQWL VFLHQWLFL GL LQGXEELR
valore: chiunque in futuro vorr occuparsi di Costantino
dovr fronteggiare i risultati di una ricerca vastissima, che
ha tentato di restituire limmagine di un imperatore ricco
pi di contraddizioni e ambiguit che non di certezze,
forse pi aderente alla realt della sua epoca, senzaltro
SL FRHUHQWH FRQ OXIFLR ULYHVWLWR $ SDUWH UDULVVLPH
eccezioni, peraltro, convegni, seminari, giornate di studio,
lezioni e conferenze tenuti in questo ultimo triennio
di un numero inaspettatamente imponente anche per
chi ne abbia frequentati alcuni hanno insistito sulla
tolleranza religiosa che le disposizioni imperiali del
IV secolo avrebbero garantito per ripristinare la pace e
lunit dellImpero, scosso dalle ultime persecuzioni
dioclezianee. Di nuovo, come nel 1913, inevitabilmente,
la storia antica storia riferita sempre al bisogno e alla

AnTard , 22, 2014

situazione presente. Lo spettro di una nuova guerra


santa, allimprovviso di nuovo incombente per lesplodere
dei fondamentalismi, in un mondo che considerava
marginale il problema della tolleranza religiosa rispetto
a quello della tolleranza ideologica, ha determinato in
modo perentorio i temi della ricerca. Nella lettura delle
fonti, tuttavia, la maggior parte degli studiosi invitati a
SDUODUHGL&RVWDQWLQRVHPEUDDYHULQQHIDWWRSURSULRTXHO
principio ermeneutico, per cui sensus non est inferendus
sed efferendus, non sempre accolto e applicato quando la
contemporaneit si fa urgente nellesegesi dellantico78.
forte tuttavia la sensazione che le celebrazioni del
centenario costantiniano abbiano lasciato in secondo
piano lindagine sistematica delle strutture politiche e
legislative, come pure delle istituzioni amministrative ed
economiche dellet costantiniana, nonostante lavvio in
tal senso del convegno perugino, che aveva indicato come
gli studi sullet tardoantica abbiano fatto passi notevoli
in tale direzione.
Paradossalmente, lepoca costantiniana resta pertanto
un grande tema ancora da affrontare e discutere. Se infatti
essa ha coinciso con i processi importanti di trasformazione, che molti relatori hanno evocato, allora essa non
GHQLELOHQpSHULRGL]]DELOHFRQODQDOLVLGLVLQJROLDVSHWWL
tanto meno attraverso quelli che solo la tirannia della
contemporaneit induce a ritenere allora dominanti, bens
considerando attentamente tutti i fattori che produssero la
QHROWUHFKpOLQL]LRGLXQDQXRYDqUD
Universit di Perugia

78. G. Crif, Su alcuni abusi, cit. (n. 5), p. 349, n. 17, citando E. Betti,
Teoria generale della interpretazione, Milano, 19902 (a cura di
G. Crif), pp. 102, 305, 581, 833.

AnTard , 22, 2014, p. 27- 33


DOI 10.1484/J.AT.5.103170

1 LEMPEREUR CONSTANTIN ET LGLISE :


CONTEXTE HISTORICO RELIGIEUX
CONSTANTINO Y OSIO: LA LTIMA ETAPA
DEL CONFLICTO ARRIANO PRENICENO
-9

Constantine and Ossius: the last phase of the pre-Nicene Arian conflict
After Licinius defeat, Constantine resumed his policy based on the interweaving connexions between the religious and the political peace. It is in this context where we should place Constantines letter on the Arian conflict
which, apparently due to the influence of Eusebius of Nicomedia, remained equidistant between the parties while
urging them to reconcile. A copy of this missive, carried by Ossius, the imperial commissioner, caused the convening
of an Egyptian synod and the (QRVZYPDWR (Alexanders outraged reply to Eusebius actions). Like Alexander,
Arius, perhaps also through the mediation of the Hispanic bishop, was also ordered to attend the Court. In any case,
Ossius, who by then had already sided with Alexander, went to Antioch, where he acted against the Arian supporters
and called another council. Constantine had dealt with Ossius, unsuccessfully interviewed the two Egyptian churchmen and decided to summon a great ecumenical synod, when the assembly of Antioch was held. The synodal letter
drawn up in Antioch expressed its full support of Alexander, who thereby obtained, thanks to Ossius, an important
victory just before Nicaea took place. [Author]

Entre las quince cartas que la Vita Constantini


reproduce de este emperador se encuentra su primera
intervencin atestiguada en el enfrentamiento arriano,
HIHFWXDGD SRFR GHVSXpV GH OD GHQLWLYD YLFWRULD VREUH
Licinio (18 de septiembre del 324). Autntico punto de
LQH[LyQ HQ OD GLFRVWDVLYD, esta epstola1 inaugura una
nueva fase, en la cual ocupa un lugar axial quien la port a
Alejandra, el hispano Osio2. Junto con la de aquellos que

* Grup de Recerques en Antiguitat Tardana (Universitat de Barcelona). Este


estudio se ha realizado en el marco del proyecto de investigacin HAR201015183/HIST del MICINN. Las ediciones de las fuentes aparecen indicadas,
entre corchetes, en su primera cita. Cuando corresponden a grandes
colecciones con volmenes numerados, remitimos a ellas mediante las
abreviaturas usuales. En los dems casos, mencionamos el nombre del
editor, junto con la ciudad y el ao de publicacin.
1. Reproducida, al parecer ntegramente, en Eus. Caes., Vita Const. 2,
64-72, pp. 74-79 [GCS, 7]. Socr., Hist. eccl. 1, 7, 2-20, pp. 13-17
[GCS NF, 1], y Anon., Hist. eccl. 2, 4, 1-13, pp. 30-32 [GCS NF, 9],
recogen los captulos 69-72 de Eusebio. Siguiendo igualmente al
bigrafo, Soz., Hist. eccl. 1, 16, 2-3, p. 35 [GCS NF, 4] cf. 1, 16, 4,
pp. 35-36 , ofrece un resumen de la carta.
2. Hemos efectuado una aproximacin a la biografa prenicena de Osio
en J. Vilella, El perodo preniceno del obispo Osio: estudio histrico-

entonces ya eran protagonistas del drama, su actuacin,


fortalecida por la misin que le haba encomendado el
PRQDUFD ORFULVWLDQR DGTXLHUH JUDQ UHOHYDQFLD HQ HO
decurso que acaba conduciendo a Nicea. A continuacin,
abordamos el carcter y el contenido de la misiva, la ida
del cordobs a Egipto y sus consecuencias (una de las
cuales es la redaccin de la (QRVZYPDWR ODSULPHUD
estancia del emisario imperial en Antioqua, su regreso a
ODFRUWHFRQVWDQWLQLDQD\QDOPHQWHHOVtQRGRDQWLRTXHQR
presidido por Osio.
Una circular constantiniana
Las tres transmisiones de la epstola presentan la misma
directio: 1LNKWK .ZQVWDQWLCQC R 0HYJLVWR 6HEDVWR

SURVRSRJUiFR, en St. Benoist, Cr. Hot-van Cauwenberghe (dir.), La


vie des autres. Histoire, prosopographie, biographie dans lEmpire
romain, Villeneuve dAscq, 2013, pp. 193-218.

28

AnTard , 22, 2014

JOSEP VILELLA

$OH[DYQGUZ NDL $UHLYZ3. Sin embargo, esta precisa


referencia a dos nicos destinatarios no se muestra acorde con
algunas frases y expresiones de su texto4. St. G. Hall5 indic
acertadamente que sobrepasa a los dos alejandrinos el plural
HMQLYRX X-PZCQC 6 del pasaje relativo a la supuesta embajada
eclesistica oriental que, segn Constantino, ste planeaba
enviar al frica escindida entre cecilianistas y donatistas7.
As se colige tambin de WDLCC L-HUDLCC X-PZCQC VXQRYGRL8 o
de la locucin WLQD DMUFKJRX WKCC WZCQC HMTQZCQC VZWKULYD9,
atinente a los receptores de la carta: resulta imposible que
slo incumba a Alejandro y Arrio. Una nueva evidencia de
que estamos ante una circular (como las otras tres expedidas
a los orientales en el mismo 324 y transcritas por Eusebio10)
la proporciona la alusin genrica NDT X-PDCC 11, la cual no se
circunscribe nicamente al mbito alejandrino. El prncipe,
quien saba que sus consiervos (WZCQC VXQTHUDSRYQWZQ OHYJZ
WZCQC HMPZCQC ) estaban divididos por la cuestin arriana12, apela,
pues, a los clrigos de su pars Orientis13.
Pensando, al parecer, que la reconciliacin entre
$OHMDQGUR \ $UULR LPSOLFDUtD HO Q GHO FRQLFWR14,

3. Eus. Caes., Vita Const. 2, 64, p. 74; Socr., Hist. eccl. 1, 7, 2, p. 13;
Anon., Hist. eccl. 2, 4, 1, p. 30.
4. En lo sucesivo, para esta epstola nicamente citamos el texto de la
Vita Constantini.
5. St. G. Hall, Some Constantinian documents in the Vita Constantini, en
S. N. C. Lieu, D. Montserrat (dir.), Constantine: History, Historiography
and Legend, London / New York, 1998, pp. 86-103.
6. Eus. Caes., Vita Const. 2, 66, p. 74. Aparece un determinativo junto
al pronombre personal.
7. Ver n. 24.
8. Eus. Caes., Vita Const. 2, 66, p. 74.
9. Eus. Caes., Vita Const. 2, 67, p. 74.
10. Se hallan en: Eus. Caes., Vita Const. 2, 24-42, pp. 58-66 (a los habitantes
de Palestina); 2, 46, pp. 67-68 (a los obispos; Eusebio reproduce el
ejemplar que recibi); 2, 48-60, pp. 68-72 (a todos los orientales).
Ch. Pietri, Constantin en 324. Propagande et thologie impriales
daprs les documents de la Vita Constantini, en E. Frzouls (dir.),
Crise et redressement dans les provinces europennes de lEmpire
(milieu du e au e sicle apr. J.-C.), Strasbourg, 1983, pp. 71-73,
considera que, a diferencia de estas tres, la dirigida a Alejandro y Arrio
es nicamente una carta personal.
11. Eus. Caes., Vita Const. 2, 68, 1, p. 75. V. Aiello, Ossio e la politica
religiosa di Costantino, en A. Melloni et al. (dir.), Costantino I.
(QFLFORSHGLDFRVWDQWLQLDQDVXOODJXUDHOLPPDJLQHGHOOLPSHUDWRUH
del cosiddetto Editto di Milano (313-2013), 1, Roma, 2013, p. 267,
QRWLHQHQLQJ~QUHSDURHQDUPDUTXH(JLSWRHUDODWHUUDGDOODTXDOH
Costantino sperava che altri potessero ottenere la guarigione.
12. Eus. Caes., Vita Const. 2, 72, 1, p. 78. El mismo Constantino se
autodenomina, con una humildad slo aparente, R- VXQTHUDYSZQ X-PZCQC :
Eus. Caes., Vita Const. 2, 69, 2, p. 76. Cf. 3, 12, 5, p. 88; Ath. Alex.,
De decr. Nic. syn. 38, 3, p. 37 [Const., Ep. ad eccl. Alex.] [H.-G. Opitz,
Berlin / Leipzig, 1935-1936]; Eus. Caes., Vita Const. 3, 17, 2, p. 90
[Const., Ep. ad omn. eccl.]. Ver H. Kraft, Kaiser Konstantin und das
Bischofsamt, en Saeculum, 8, 1957, pp. 32-42.
13. Respecto a la poltica religiosa de Licinio durante la ltima parte
de su reinado, ver E. Moreno, La poltica religiosa y la legislacin
sobre los cultos tradicionales del emperador Licinio (307-324), en
Polis, 20, 2008, especialmente pp. 195-206.
14. La va conciliadora propugnada por el monarca muestra proximidad
con las peticiones que, anteriormente, los partidarios de Arrio haban
trasladado a Alejandro para que revocara la excomunin a Arrio. Ello
SDUHFHLQGLFDUTXHHQWRQFHV&RQVWDQWLQRHVWDEDLQXLGRSRU(XVHELR
de Nicomedia.

Constantino se dirige, formalmente y en primer lugar,


a ellos15 y, a la vez, con intencionada ambigedad, a
los obispos orientales16, entonces implicados en la gran
querella, cuya amplitud no oculta17, a pesar de intentar
minimizar sus causas en aras de su conclusin18. La
habran recibido, por lo menos, los titulares de las sedes
ms importantes o metropolitanas, caso de Eusebio de
Cesarea19. Carece, en cambio, de fundamento suponer
que fue remitida al concilio de Antioqua, a partir, bsicamente, de las referencias genricas al episcopado y del
vocablo VXYQRGR20.
El contenido de la epstola
,QLFLDOPHQWH&RQVWDQWLQRPDQLHVWDFXiOHVKDQVLGR
y son los dos objetivos necesarios a los cuales se ha
VRPHWLGRVHJ~QDUPDFRQHODX[LOLRGHO7RGRSRGHURVR
SULPHURXQLFDUORTXHWRGRVORVSXHEORVH[SRQtDQDFHUFD
de lo divino para encaminarlos hacia una nica formulacin conceptual21 y, segundo, restaurar y conexionar el
maltrecho cuerpo del Imperio (metas que se ha propuesto
alcanzar, respectivamente, con el ojo secreto de la razn22
y el poder de la mano militar), consciente de que, con
el establecimiento de una concordia D^SDVL WRLCC WRXCC
THRXCC THUDYSRXVLQ, la gestin de los asuntos pblicos

15. Eus. Caes., Vita Const. 69, 1, p. 75. Los nombres de los dos
alejandrinos son asimismo mencionados en el cuerpo de la carta.
16. Cf. Eus. Caes., Vita Const. 2, 68, 3, p. 75: eij WR FUKViPZYWeURQ
e^NDVWRQ PeWDVWKCCVDi; 2, 71, 1, p. 76: R`Q X-SR WDiCC X-PeWeYUDi
IUeViQ eXjTXYQeVTDi SURVKYNei; 2, 71, 3, p. 77: DjGeOIRX DjGeOIRiCC
DjQWiNeiCCVTDi; 2, 71, 3, p. 77: Ri` SUR DjOOKYORX    S 
FZUiVPRYQ WiQD NDi VWDYViQ X-PiCCQ PKGDPZCC ejPSRieiYWZ; 2, 71, 6, p. 77:
NDi PiYD NDi K- DXjWK NDWD SDYQWZQ NRiQZQiYD WKUeiCCVTDi; 2, 71, 6,
p. 77: SUR DjOOKYORX X-PiCCQ; 2, 71, 7, p. 78: D` G j X-SeU WZCCQ ejODFiYVWZQ
WRXYWZQ ]KWKYVeZQ ejQ DjOOKYORi DjNUiERORJeiCCVTe; 2, 72, 3, p. 78:
DjQRiY[DWe GKY PRi ORiSRQ ejQ WKCC NDT X-PDCC R-PRQRiYD WKCC e-ZYD WKQ
R-GRYQ K`Q WDiCCSUR DjOOKYORX IiORQeiNiYDi DjSeNOeiYVDWe.
17. Eus. Caes., Vita Const. 2, 68, 1, p. 75; 2, 68, 3, p. 75; 2, 69, 1, p. 75;
2, 71, 1, pp. 76-77; 2, 71, 3, p. 77; 2, 71, 7, p. 78; 2, 72, 1, p. 78.
18. Ver n. 32.
19. B. H. Warmington, The sources of some Constantinian documents
in Eusebius Ecclesiastical History and Life of Constantine, en
E. A. Livingstone (dir.), Papers of the Ninth International Conference
on Patristic Studies, 1, Kalamazoo, 1985 [StP, 18, 1], pp. 95-96,
considera que Eusebio consigui el texto epistolar a travs de algn
funcionario de la administracin imperial, probablemente el notarius
Mariniano (ver n. 53).
20. As lo ha sostenido St. G. Hall, Some Constantinian documents, cit.
(n. 5), pp. 86-97. Esta propuesta ha tenido una considerable acogida
entre los estudiosos. Si exceptuamos la referencia a la prohibicin de
los concilios por Licinio (2, 66, p. 74), en esta epstola VXYQRGRWLHQH
HOVLJQLFDGRGHXQLGDG SS
p. 77; 2, 71, 6, p. 77) y reunin (2, 69, 2, p. 76).
 6HJ~Q &RQVWDQWLQR OD UHXQLFDFLyQ GH WRGRV ORV SXHEORV HQ XQD
~QLFDFRQFHSFLyQUHOLJLRVDUHVXOWDEDPX\EHQHFLRVDSDUDORVDVXQWRV
pblicos. En tal ideario, no tenan cabida las divisiones eclesisticas.
22. Ver n. 43.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINO Y OSIO: LA LTIMA ETAPA DEL CONFLICTO ARRIANO PRENICENO

29

sera provechosa para todos los creyentes23. En relacin


con tal poltica, indica a los eclesisticos orientales
que, cuando, a causa de la insensata ligereza de quienes
haban osado escindir a la poblacin en diferentes bandos
religiosos, una intolerable locura (la pugna donatista) se
apoder de frica, consider que la mejor cura para tal
enfermedad consista en aniquilar a Licinio (WRQ NRiQRQ
WKCC RijNRXPeYQK ejFTURQ) y en enviar a algunos de ellos
all para contribuir a restituir la unidad24, razn por la
cual, creyendo que seran los adalides de la salvacin,
intent encontrarlos25.
7UDV MXVWLFDU PHGLDQWH HVWD LQH[WULFDEOH WUDED]yQ
religioso-militar, la actuacin contra el rival, con el
consiguiente halago a la clereca oriental, el monarca
UHHUHTXHVXSULQFLSDO\PiVYDOLRVRREMHWLYRODXQLGDG
religiosa, para cuya consecucin tanto esperaba de
Oriente (donde fueron otorgadas la potencia de la luz y
la Ley26 del sagrado culto que iluminan a toda la ecmene
por igual), ha sufrido un gran contratiempo al conocer que
la disensin existente en sus regiones (en las cuales haba
esperado encontrar el remedio para las otras) revesta
mayor gravedad que la africana27$O UHH[LRQDU DFHUFD
de su origen y fundamento y percibir que, a pesar de tener
tanta envergadura, se trata de algo balad, el emperador
ha considerado necesario dirigirles esta epstola con
urgencia y, consecuente con su ideario poltico, situarse
en medio de la controversia como SUXYWDQiFRQYHQFLGR
de que, con la ayuda del Todopoderoso, podr enderezar
fcilmente este asunto28. Pide a sus destinatarios que le

permitan elevar a sus pueblos hacia la comunin de la


unidad mediante su alocucin, servicio y admonicin29.
0DQLHVWDTXHVHWUDWDGHXQDGLVSXWDVREUHSDODEUDV
(U-KPDYWZQ)30 FX\R RULJHQ DUPD FRQRFHU31, muy irreleYDQWHHLQVLJQLFDQWHSHTXHxDQLPLDLQ~WLOLQQHFHVDULD
injusta, nociva, impa, pueblerina, ms propia de insensateces infantiles que adecuada al raciocinio de hombres
santos y juiciosos32, pero que se yergue en obstculo de
todo33. Siempre segn Constantino, tales indagaciones,
no prescritas en ninguna norma, suscitadas por una estril
ociosidad34 y que carecen de fuerza para afectar al valor
de la Ley35, deben restringirse al mbito del pensamiento,
VLQ VHU WUDVODGDGDV D UHXQLRQHV S~EOLFDV QL FRQDGDV
imprudentemente a los odos del pueblo, pues, al tratarse
de cuestiones tan grandes y difciles, pueden comportar
la blasfemia o el cisma36: lamenta la ruptura de la unin
y que el pueblo, alejado de la armona del cuerpo comn,
ya se haya escindido en dos37. Puesto que su disputa no
fue desatada a causa de los preceptos basilares ni implica
una nueva posicin sobre el culto divino38, comparten el
mismo fundamento de fe y la Ley encierra, en sus partes,
una nica unidad de espritu39, les incita a seguir el ejemplo
GHORVOyVRIRVTXHFRQYLHQHQHQXQDPLVPDGRFWULQDORV
cuales, a pesar de discrepar en alguna parte de sus explicaciones, concuerdan entre s sobre su unidad40.
/HV H[KRUWD D XQD PD\RU UHH[LyQ \ VHQVDWH] D
perdonarse recprocamente, a recuperar la amistad,
D PDQWHQHU HO PLVPR SHQVDPLHQWR D FRQXLU EDMR HO
estandarte de la misma comunin, a tener fe en la verdad

23. Eus. Caes., Vita Const. 2, 64-65, p. 74. Constantino expresa reiteradamente,
en el 324, que la paz y la prosperidad civil dependen de la paz y concordia
religiosa. Ver Ch. Pietri, Constantin, cit. (n. 10), pp. 80-82.
24. En este punto, el texto griego presenta una construccin bastante
singular: a la prtasis constituida por eij WRQ NRiQRQ WKCC RijNRXPeYQK
ejFTURQ ej[eOZYQ (con un participio aoristo, en lugar de un tiempo
indicativo) sigue una apdosis formada por un optativo aoristo que no
va precedido, como cabra esperar, de D>Q. De esta oracin hipottica de
tercer tipo, difcilmente puede colegirse que Constantin songea une
QRXYHOOHIRLVjPRGLHUVRQDWWLWXGHHQYHUVOHVGLVVLGHQWVDIULFDLQV
(J.-L. Maier, Le dossier du Donatisme, 1, Berlin, 1987, p. 242).
Suscribimos, en cambio, las palabras de M.-Y. Perrin, Costantino e
la crisi donatista, en A. Melloni et al. (dir.), Costantino I, cit. (n. 11),
p. 281: e nel momento stesso in cui scopre lampiezza della crisi
ariana, che non pu che ricordargli quella donatista, Costantino evoca
il progetto, per arginare la malattia diffusasi in Africa, di inviare
qualche vescovo orientale in soccorso per ristabilire la concordia tra
le opposte fazioni.
25. Eus. Caes., Vita Const. 2, 65-67, p. 74.
26. En esta epstola constantiniana, el trmino QRYPR SDUHFH UHIHULUVH
siempre a los textos escritursticos cristianos (ver n. 31).
27. Eus. Caes., Vita Const. 2, 67-68, pp. 74-75. Para comprender el alcance
GHHVWDDUPDFLyQUHVXOWDVLJQLFDWLYRTXH&RQVWDQWLQRHQODPLVPD
carta, ya hubiera expuesto que, en frica, se haba desencadenado una
locura que no poda tolerarse, de la cual responsabilizaba a quienes
KDEtDQDFWXDGRDOOtFRQLQVHQVDWH]HLUUHH[LyQ YHUQ 
28. Eus. Caes., Vita Const. 2, 68, 2-3, p. 75. Constantino deja entrever
que puede tomar otras medidas, ms drsticas.

29. Eus. Caes., Vita Const. 2, 71, 4, p. 77.


30. Eus. Caes., Vita Const. 2, 71, 3, p. 77.
31. Eus. Caes., Vita Const. 2, 69, 1, p. 75. Dice que el actual ]KYWKPD
empez al preguntar Alejandro a los presbteros cmo interpretaban,
cada uno de ellos, un pasaje de la Ley (indagacin considerada
insensata por el emperador) y al responder improvisadamente Arrio
lo que era conveniente o no ser pensado o entregar al silencio.
Culpabiliza a ambos por igual, al estimar que el obispo plante una
ejUZYWKVi DjSURIXYODNWR\HOSUHVEtWHURXQDDjSRYNUiVi DjSURQRYKWR
(2, 70, p. 76), y que se trata de una pesquisa totalmente imprudente
(2, 71, 6, p. 77; cf. 2, 71, 2, p. 77). Ver n. 27. De 2, 69, 1, tambin
se colige que este interrogatorio tuvo lugar en el presbyterium
alejandrino. Cf. Soz., Hist. eccl. 1, 15, 4-5, p. 33; Epiph. Const., Adu.
haer. 69, 3, 7, p. 155 [GCS, 37]. La cuestin abordada probablemente
era la exgesis de Prou. 8, 22.
32. Eus. Caes., Vita Const. 2, 68, 2-3, p. 75; 2, 71, 1, p. 76; 2, 71, 3, p. 77;
2, 71, 5-7, pp. 77-78; 2, 72, 1, p. 78.
33. Eus. Caes., Vita Const. 2, 68, 3, p. 75.
34. Eus. Caes., Vita Const. 2, 69, 2, p. 76.
35. Eus. Caes., Vita Const. 2, 71, 5, p. 77.
36. Eus. Caes., Vita Const. 2, 69, 2, p. 76; 2, 71, 7, p. 78.
37. Eus. Caes., Vita Const. 2, 69, 1, p. 68. Cf. 2, 71, 1, pp. 76-77; 2, 71,
3, p. 77; 2, 72, 1, p. 78.
38. Eus. Caes., Vita Const. 2, 70, p. 76. Respecto al vocabulario
teolgico-religioso de los textos constantinianos escritos en el 324,
ver Ch. Pietri, Constantin, cit. (n. 10), pp. 82-90.
39. Eus. Caes., Vita Const. 2, 71, 5, p. 77.
40. Eus. Caes., Vita Const. 2, 71, 2, p. 77. Cf. 2, 71, 6-7, pp. 77-78.

30

JOSEP VILELLA

y a respetar la Ley de Dios41. Expresa, con gran patetismo,


su desasosiego por la divisin de sus VXQTeUDYSRQWe D
causa de esta disputa42 y, para explicitar la inmensidad
de su dolor, dice a los destinatarios de la epstola que,
poco despus de haber llegado a Nicomedia, su JQZYPK43
le inst sbitamente hacia Oriente, pero que, cuando
ya se apresuraba a ir hasta ellos y estaba en la mayor
parte con ellos, la noticia de este asunto ech para atrs
su propsito44. Finalmente, Constantino estipula que,
mediante su conciliacin, le abran el camino de Oriente
y, as, le concedan, lo antes posible, la alegra de poder
visitarlos y de reconocer al Todopoderoso el favor que le
es debido por la concordia y la libertad comn de todos
obtenidas gracias a piadosos acuerdos sobre palabras45.
Osio y Alejandro de Alejandra
Esta reiterativa carta concluye con otro requerimiento
D ORV HFOHVLiVWLFRV GH 2ULHQWH SDUD TXH SRQJDQ Q DO
FRQLFWR'HOKHFKRGHTXHDWULEX\DVXLQLFLRDODSUHJXQWD
de Alejandro46, podemos colegir que Constantino haba
recibido esta informacin de Eusebio de Nicomedia47: en el

41. Eus. Caes., Vita Const. 2, 69, 2, pp. 75-76; 2, 70, p. 76; 2, 71, 3, p. 77;
2, 71, 6-8, pp. 77-78. Cf. 2, 68, 3, p. 75.
42. Eus. Caes., Vita Const. 2, 72, 1.
43. De acuerdo con lo manifestado al inicio de la epstola (ver n. 21),
Constantino persegua alcanzar mediante la razn su primer gran
REMHWLYRODXQLFDFLyQRFRQFRUGLDUHOLJLRVDRUJiQLFDPHQWHYLQFXODGR
con el restablecimiento, mediante la accin militar, del Imperio. A
partir de tales premisas, tras haber vencido a Licinio, su raciocinio
OH LQVWDED SRU WDQWR D DFWXDU HQ HO SODQR HFOHVLiVWLFR DVt VH DUPD
en 2, 67), a encontrarse con los clrigos orientales para, segn la astuta
DUJXPHQWDFLyQGHOPRQDUFDVROXFLRQDUHOFRQLFWRGRQDWLVWD
44. Eus. Caes., Vita Const. 2, 72, 2, p. 78: SUZYKQ ejSiVWD WKCC 1iNRPKGeYZQ
SRYOei SDUDFUKCP
C D SUR WKQ e-ZD
Y Q KjSeiJRYPKQ WKC JQZYPK 6SeXYGRQWi GKY
PRi K>GK SUR X-PDCC NDi WZCC SOeiYRQi PeYUei VXQ X-PiCQC R>QWi K- WRXCGC e WRXCC
[SUDYJPDWR@ DjJJeOiYD SUR WR e>PSDOiQ WRQ ORJiVPRQ DjQeFDiYWiVeQ.
Interpretamos que, con la locucin NDi WZCC SOeiYRQi PeYUei VXQ X-PiCQC R>QWi
estando en la mayor parte con vosotros, el emperador quiere indicar
que, para cumplir su objetivo de encontrar a los obispos orientales,
concebido, segn dice, cuando todava estaba en Occidente (PDQiYD
JDU GKYSRXTeQ RX-N DjQeNWKCC D^SDVDQ WKQ $IUiNKQ ejSiODERXYVK>
66, p. 74]), ya haba recorrido ms de la mitad del camino. Este sentido
encuentra, adems, pleno acomodo con la frase DjQRiY[DWe GKY PRi
ORiSRQ ejQ WKC NDT X-PDCC R-PRQRiYD WKCC e-ZD
Y WKQ R-GRYQ (2, 72, 3, p. 78).
De tales pasajes en absoluto puede, pues, colegirse que Constantino
viajara a Siria o a las regiones del Levante mediterrneo (ver n. 20).
45. Eus. Caes., Vita Const. 2, 72, 3, pp. 78-79.
46. Segn Epifanio y Sozmeno, tuvieron lugar dos interrogatorios a
Arrio: Epiph. Const., Adu. haer. 69, 3, 5-7, p. 155; Soz., Hist. eccl. 1,
15, 4-5, p. 33. Ver W. Lhr, Arius reconsidered (Part 1), en Zeitschrift
fr antikes Christentum, 9/3, 2005, p. 541.
47. R. Williams, Arius: Heresy and Tradition, London, 2001, p. 57,
probablemente acierta cuando, concediendo mayor credibilidad a
Epifanio que a Sozmeno, cree que Eusebio de Nicomedia dise
y reuni un snodo bitinio (que establece la ortodoxia de Arrio y lo
acoge en comunin) para atraerse a Constantino, el reciente vencedor,
y potenciar as el apoyo al crculo de Arrio, a quien presentara como
una vctima ms de Licinio, durante cuyo reinado haba sido exiliado.
Socr., Hist. ecclSGLFHVLQDPEDJHVTXHODLQXHQFLD
de Eusebio derivaba de su acceso al emperador. Ver D. M. Gwynn,

AnTard , 22, 2014

mismo sentido apunta la equidistancia (ciertamente vejatoria


para Alejandro) mostrada en relacin con los dos alejandrinos48. Junto con un llamamiento general a la avenencia,
el monarca decide actuar directamente en el epicentro del
enfrentamiento49, en Alejandra, ciudad en la cual entonces
no se hallaba el exiliado Arrio50. A diferencia de los dems
ejemplares emitidos por la cancillera imperial, el asignado
a la metrpoli egipcia fue entregado, segn Eusebio,
en mano por un juez de paz. El bigrafo indica que este
EUDEeXWKY ELHQFRQRFLGRSRU&RQVWDQWLQR GHVWDFDEDSRU
su sabia vida de fe y virtud y por haber confesado su fe51.
Aunque el docto palestino no explicite su nombre, Scrates
y la annima Historia ecclesiastica FRLQFLGHQ HQ DUPDU
que era Osio de Crdoba52, quien pertenecera al crculo del
emperador desde haca tiempo53.
A partir de esta intervencin de Constantino54 y de la
consiguiente actuacin de su comisionado (quien, segn
Eusebio, prest sus servicios no slo con la carta55), en

Constantine and the other Eusebius, en Prudentia, 31/2, 1999, pp. 94(OKHFKRGHTXH(XVHELRSUHWHQGLHUDVHJXLUWHQLHQGRLQXHQFLDHQ
la nueva corte no debi favorecer su relacin con Osio.
48. En realidad, el posicionamiento inicial de Constantino (quien
conoca los respectivos rangos eclesisticos de Alejandro y Arrio) no
dista mucho de los reiterados intentos que los supporters de Arrio
realizaban para que Alejandro revocara su excomunin.
49. Eus. Caes., Vita Const. 2, 63, p. 73; Socr., Hist. eccl. 3, 7, 12, p. 198
cf. 1, 8, 1, p. 17; Theod., Hist. eccl. 1, 7, 1, p. 30 [GCS NF, 5].
50. De Eus. Caes., Vita Const. 2, 63, p. 73, puede inferirse que, a
QDOHV GHO  $UULR YROYtD D HVWDU HQ $OHMDQGUtD SHUR HQ FRQWUD
de este supuesto regreso abogan la celebracin del concilio bitinio
organizado por Eusebio de Nicomedia (ver n. 47), la (QR VZYPDWR
(Ath. Alex., De decr. Nic. syn. 35, 16, p. 33: GiR NDi DjSeNKUXYFTKVDQ
NDi DjQeTePDWiYVTKVDQ DjSR WKCC ejNNOKViYD FI   S   OD
estancia y actividad de Osio en Antioqua (ver n. 80, 87-88, 94 y
99-103) y, asimismo, el viaje de Arrio a Nicomedia por va terrestre,
mientras que Alejandro va a esta capital por mar (ver n. 90). Cuando
redacta la Vita, Eusebio querra silenciar las acciones y estancias de
Arrio fuera de Egipto, en la cuales se haba involucrado notoriamente.
51. Eus. Caes., Vita Const. 2, 63, p. 73; 2, 73, p. 79.
52. Socr., Hist. eccl. 1, 7, 1, p. 13 cf. 3, 7, 12, p. 198 ; Anon., Hist.
eccl. 2, 3, 22, p. 30.
53. Ver J. Vilella, El perodo, cit. (n. 2), pp. 198-200. B. H. Warmington, The
sources, cit Q SSKDVXSXHVWRVLQVXFLHQWHIXQGDPHQWR
que el comisionado imperial enviado a Alejandra no era Osio, sino
el notarius Mariano. Incluso si prescindimos del taxativo testimonio
facilitado por Scrates, esta hiptesis queda invalidada por la estancia
del hispano en Alejandra. El hecho de que en Eus. Caes., Vita Const. 2,
63 y 73 (para el portador de la carta a Alejandra) y 4, 44 (para el notario
TXHDFW~DHQODDVDPEOHDGHO JXUHODSiYVWi\VHUHSLWDODPLVPD
frase (WDiCC X-SeU eXjVeEeiYD R-PRORJiYDi QRLPSOLFDTXHDPERVSDVDMHV
VHUHHUDQDOPLVPRSHUVRQDMH'HVGHODSHUVSHFWLYDGH&RQVWDQWLQROD
SHUVRQDPiVLGyQHDSDUDODPLVLyQSDFLFDGRUDVHUtD2VLRXQRELVSRGH
VXFRQDQ]D\HQWRUQRTXLHQVLQHPEDUJRQRJR]DEDGHODHVWLPDGH
Eusebio cuando escribe la Vita: ello explicara que la caracterizacin de
Mariano incida ms en su religiosidad. Cf. Th. G. Elliott, Constantines
preparations for the council of Nicaea, en Journal of Religious History,
17/2, 1992, pp. 127-128.
54. B. H. Warmington, The sources, cit Q SDUPDTXH
la epstola constantiniana a Alejandro y Arrio (a la cual considera
SULYDGD QRWXYRQLQJXQDUHSHUFXVLyQHQHOFRQLFWRDUULDQR
55. 'iKNRQeiCCWR Ge RXj WKCC JUDIKC PRYQRQ VXPSUDYWWZQ (Eus. Caes.,
Vita Const. 2, 73, p. 79). Evidentemente, Osio deba llevar a cabo
actuaciones que no estaban explicitadas en la carta imperial.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINO Y OSIO: LA LTIMA ETAPA DEL CONFLICTO ARRIANO PRENICENO

Alejandra se rene un snodo56, sin duda presidido por


Osio57, en el cual la epstola imperial tiene gran protagonismo58. Esta asamblea trat, lgicamente, la discordia
HQWUH $OHMDQGUR \ $UULR DVt OR SRQH GH PDQLHVWR HO
hecho de que los sinodales debatieran, a instancia de
Osio, la cuestin de la RXjViYD y de la X-SRYVWDVi59. Fue,
adems, tratado el cisma relativo a Coluto, en el cual s
se alcanzan acuerdos: su status episcopal es anulado (al
igual que los rdenes eclesisticos por l conferidos);
no, en cambio, su rango presbiteral60.
La (QR VZYPDWR61 fue escrita, segn defendi
R. Williams62, durante la estancia alejandrina de Osio
o muy poco despus de ella? Los recientes pronunciamientos63 a favor de mantener, siguiendo a E. Schwartz64

56. Ath. Alex., Apol. c. Ar. 74, 4, p. 154 [Ep. presb. et diac. qui in
Mareote sunt ad syn. Tyr.] [H.-G. Opitz, Berlin, 1938-1940]; 76,
3, p. 156 [Ep. presb. et diac. qui in Mareote sunt ad Phil. praef.].
De la celebracin de este snodo, puede inferirse que Alejandro fue
avisado de la prxima llegada del hispano; en cualquier caso, la
piramidal organizacin del episcopado egipcio permita realizar un
concilio rpidamente. En Antioqua, un evento similar requerira
ms tiempo (ver n. 88).
57. As se colige de las epstolas del clero maretico (ver n. 56).
58. Osio leera la misiva en esta asamblea. Ver V. C. De Clercq, Ossius of
Cordova: A Contribution to the History of the Constantinian Period,
Washington, 1954, p. 201.
59. Socr., Hist. eccl. 3, 7, 11-12, p. 198.
60. Ath. Alex., Apol. c. Ar. 76, 3, p. 156 [Ep. presb. et diac. qui in Mareote
sunt ad Phil. praef.]. Respecto a Coluto, ver A. Martin, Athanase
dAlexandrie et lglise dgypte au e sicle (328-373), Roma, 1996,
pp. 178-183, 350.
61. Esta epstola de Alejandro se halla en: Ath. Alex., De decr. Nic.
syn. 35, pp. 31-35; Socr., Hist. eccl. 1, 6, 4-30, pp. 6-10 (sin las
suscripciones); Anon., Hist. eccl. 2, 3, 1-21, pp. 25-29. Citamos el
texto facilitado por Atanasio.
62. R. Williams, Arius, cit. (n. 47), pp. 55-58. En el appendix 1 de su
segunda edicin, responde a las objeciones efectuadas en relacin
con sus propuestas cronolgicas atinentes a algunos documentos de
la disputa arriana prenicena, publicadas en 1987; evidentemente, el
arzobispo de Canterbury no acert en todo. Antes de R. Williams,
otros eruditos ya haban defendido que la (QR VZYPDWR HUD
posterior a la + IiYODUFRYHU+&KU%UHQQHFNHet al., Dokumente
zur Geschichte des arianischen Streites, Berlin / New York, 2007
[Athanasius Werke 3, 1, 3], pp. xx-xxv.
63. U. Loose, Zur Chronologie des arianischen Streites, en Zeitschrift
fr Kirchengeschichte, 101/1, 1990, pp. 88-92; W. Lhr, Arius, cit.
(n. 46), especialmente pp. 543-553: the result of our discussion
of the relative chronology of Urkunde 4a/4b and Urkunde 13/15 is
clear: a closer reading of both documents reveals that the case for
placing Urkunde 4b before Urkunde 14 is much stronger than the
case for inverting this order (p. 553); H. Chr. Brennecke et al.,
Dokumente, cit. (n. 62), pp. xxv-xxxiii: ist also entgegen Williams
Dok. 2.2. = Urk. 4b doch in die Frhzeit zu setzen (p. xxxi). Estos
HVWXGLRVRVKDQPRGLFDGRODVHFXHQFLDWHPSRUDO \ODQXPHUDFLyQ 
de H.-G. Opitz, pero siguen manteniendo que 4b es anterior a 14. Ver
p. xix, n. 2, para la mayoritaria aceptacin del orden cronolgico dado
a los Urkunden por H.-G. Opitz.
64. E. Schwartz, Die Dokumente des arianischen Streits bis 325, en
Gesammelte Schriften, 3, Berlin, 1959 [reimpresin del artculo
publicado en 1905], pp. 117-168.

31

y H.-G. Opitz65, que sta es posterior a la + IiYODUFR66


(encclica de Alejandro tambin conservada, al parecer,
ntegramente) no han debilitado las evidencias que
muestran la anterioridad de + IiYODUFR UHVSHFWR D
(QR VZYPDWR 'DGR TXH$SLV DSDUHFH HQ ODV VXVFULSFLRQHVGHHVWD~OWLPDFRPRSUHVEtWHUR\HQFDPELRJXUD
como dicono en la otra67UHVXOWDFODURTXHSDUDMDUOD
secuencia de ambas epstolas, adquiere asimismo plena
UHOHYDQFLDHOKHFKRGHTXHWDOHVUPDVHVWpQHQFDEH]DGDV
por el SUeVEXYWeUR&ROXWRDTXLHQOD+ IiYODUFRWDFKD
de cismtico68. Apoya igualmente la cronologa ms tarda
de la (QR VZYPDWRVXPiVTXHSUREDEOHHODERUDFLyQSRU
el joven dicono Atanasio en nombre de Alejandro69.
No podemos detenernos aqu en cada uno de los
puntos que convergen en datar la (QR VZYPDWRDQDOHV
del 32470SHURDHVWHUHVSHFWRVRQHVSHFLDOPHQWHVLJQLcativos los loci similes existentes entre ambas circulares71:
los alejandrinos conocan la carta trada por Osio cuando
se redacta la (QR VZYPDWRUPDGDSRUHOpresbyterium
de Alejandra y la Maretide72, del cual Coluto volva a

65. H.-G. Opitz, Die Zeitfolge des arianischen Streites von den Anfngen
bis zum Jahre 328, en Zeitschrift fr die neutestamentliche Wissenschaft
und die Kunde der lteren Kirche, 33/2, 1934, pp. 146-150.
66. Esta epstola de Alejandro est en Theod., Hist. eccl. 1, 4, 1-60,
pp. 8-25.
67. Ver la nota de A. Martin, en Thodoret de Cyr. Histoire ecclsiastique, 1,
(SC, 501), Paris, 2006, p. 188, n. 2.
68. A partir de la evidencia aportada por la promocin de Apis a
presbtero, no puede aducirse (en contra de R. Williams, Arius,
cit. [n. 47], pp. 50-51, 55-58, 252-253) que la separacin de Coluto
habra tenido lugar en un fase tarda de la querella, tras un supuesto
regreso del exiliado Arrio a Alejandra (ver n. 50). As lo estima,
siguiendo a H.-G. Opitz, U. Loose, Zur Chronologie, cit. (n. 63),
pp. 89-91: einfacher und wahrscheinlicher bleibt die Lsung, dass
Kolluthus in der frh zu datierenden Urk. 4b noch unterschrieb, da sie
vor dem in Urk. 14 beschriebenen Schisma abgesandt wurde (p. 91).
En el mismo sentido, W. Lhr, Arius, cit. (n. 46), p. 543: U. Loose
has defended the priority of Urkunde 4b against R. Williams. In the
following I argue for the priority of Urkunde 4b (p. 543). Tambin
H. Chr. Brennecke et al., Dokumente, cit. (n. 62), p. xxxiii.
69. As lo mostr Chr. Stead, Athanasius earliest written work, en Journal
of Theological Studies, 39/1, 1938, pp. 76-91. Respecto a la estrecha
colaboracin existente entonces entre Alejandro y su dicono Atanasio,
ver T. D. Barnes, Athanasius and Constantius. Theology and Politics in
the Constantinian Empire, Cambridge (Mass.), 1993, pp. 10-18.
 7DO GDWDFLyQ LPSOLFD PRGLFDU QRWDEOHPHQWH OD XVXDO MDFLyQ H
interpretacin de la polmica arriana prenicena, tambin en el plano
teolgico-doctrinal. Por ejemplo, R. P. Cr. Hanson, The Search for the
Christian Doctrine of God. The Arian Controversy 318-381, Edinburgh,
1988, especialmente pp. 129-138, sigue la cronologa de H.-G. Opitz.
71. Comprese WRY We WRXCC QRYPRX SDUDYJJeOPD WRiCC Gi e-DXWRXCC PeYUeViQ
eijj PiYDQ \XFKCC SURYTeViQ (Eus. Caes., Vita Const. 2, 71, 5, p. 77) con
ejQWROKCC We RX>VK ejQ WDiCC TeiYDi JUDIDiCC WKUeiCQC WRQ VXYQGeVPRQ WKCC 
R-PRQRiYD NDi eijUKYQK (Ath. Alex., De decr. Nic. syn. 35, 2, p. 31);
ViZSKCC SDUDGRXCQC Di SURVKCNC RQ K?Q (Eus. Caes., Vita Const. 2, 69, 1,
p. 75) con ejERXORYPKQ PeQ ViZSKCC SDUDGRXCQC Di WR WRiRXCWC RQ (Ath. Alex.,
De decr. Nic. syn. 35, 4, p. 32). Esta ltima frase no puede, pues, ser
aducida para ubicar la (QR VZYPDWRHQORVLQLFLRVGHOFRQLFWR
72. Alejandro haba excomulgado a Arrio y a sus partidarios, sancin
SRVWHULRUPHQWH UDWLFDGD D FDXVD GH ODV SUHVLRQHV HSLVFRSDOHV
externas) por el concilio de unos cien obispos egipcios y libios. Ver la
nota de A. Martin, en Thodoret, cit. (n. 67), pp. 158-159, n. 1.

32

JOSEP VILELLA

formar parte73. Esta encclica constituye, ciertamente, una


reaccin del indignado Alejandro (y su clero) al requerimiento de Constantino74, pero, sobre todo, la intencin
de cercenar la actuacin y estrategia de Eusebio de
Nicomedia, quien, gracias a su proximidad con el QiNKWK
se habra adelantado75 ante la coyuntura generada por la
svolta constantiniana76.
Antioqua y Nicomedia
Tambin Arrio recibi, al igual que Alejandro, la
orden de presentarse ante el emperador77. No puede, sin
embargo, precisarse dnde el presbtero ley la misiva
a l asimismo dirigida ni quin se la entreg junto con
el mandato de acudir a la corte. Quizs el mediador
entre Constantino y Arrio volvi a ser Osio, el cual, tras
abandonar Alejandra, fue a Antioqua78, ida de nuevo
motivada por la querella arriana y posiblemente planeada
antes de que el hispano viajara a Alejandra. Cuando llega
a la capital siria, ste, a diferencia del monarca, haba
tomado partido a favor de Alejandro, con quien entabl
amistad y coincida en las cuestiones cristolgicas que
subyacan en la disputa79.

73. La (QRVZYPDWRIXHSXHVUHGDFWDGDPX\SRFRGHVSXpVGHOVtQRGR
presidido por Osio y seguramente cuando el cordobs todava estaba en
Alejandra. Resulta evidente que esta asamblea no poda involucrarse
directamente en una circular enviada en nombre de Alejandro.
74. Lo que, segn el monarca, era una cuestin menor y originada por la
insensatez de ambas partes, para los alejandrinos constitua una Di^UeVi
a cuyos responsables el cumplimiento de la Ley obligaba, precisamente
y al igual que en casos anteriores, a anatematizar y expulsar de la Iglesia,
tal como ya haban hecho los egipcios (a diferencia de los eusebianos):
no poda, pues, alcanzarse la concordia en los trminos que pretenda
el SUXYWDQi$SDUHFH PDQLHVWD OD SURJUHVLyQ GHO FRQLFWR UHVSHFWR
a la + IiYODUFRHQODFXDOHORELVSRGH$OHMDQGUtDWRGDYtDQRGDED
por cerrada la puerta de la reconciliacin. La informacin de Epifanio
permite suponer que la epstola de Alejandro a Constantino sera
coetnea de la (QRVZYPDWRRSRFRDQWHULRUDpVWD (SLSK&RQVW
Adu. haer. 69, 9, 1-2, p. 159).
75. Una vez concluido el concilio de Bitinia, a los alejandrinos tambin
les llegaran cartas de Eusebio de Nicomedia (Soz., Hist. eccl. 1, 15,
10-12, p. 34). Respecto a las ltimas acciones de los eusebianos, sera,
sin embargo, Osio quien les proporcionara una informacin mayor y
ms plural.
76. En trminos generales, suscribimos la interpretacin que realiza
R. Williams, Arius, cit. (n. 47), pp. 55-58. La reconciliacin de
Coluto se insera en la direccin que pretenda el emperador, pero no
cuestionaba ni la autoridad ni la actuacin de Alejandro.
77. Ver n. 90.
78. Siguiendo la senda de otros estudiosos, H. Strutwolf, Die
Trinittstheologie und Christologie des Euseb von Caesarea. Eine
dogmengeschichtliche Untersuchung seiner Platonismusrezeption und
Wirkungsgeschichte, Gttingen, 1999, pp. 39-44, ha vuelto a defender la
IDOVLFDFLyQRDOWHUDFLyQGHODHStVWRODGHOVtQRGRDQWLRTXHQRSUHVLGLGR
por Osio (ver n. 95). Al respecto, suscribimos las consideraciones de
H. Chr. Brennecke et al., Dokumente, cit. (n. 62), pp. xxxiv-xxxvi.
5HVXOWDVLJQLFDWLYDODGHVFULSFLyQTXHGH$OHMDQGURKDFHODVLQRGDO
antioquena (ver n. 98). En el mismo sentido apunta el hecho de que
Osio sea denominado SDWKYU por los presbteros y diconos de la

AnTard , 22, 2014

6HJ~Q UHHUH pO PLVPR 2VLR HQFRQWUy OD ,JOHVLD GH


Antioqua muy perturbada y agitada por luchas internas80,
VLQ GXGD DYLYDGDV WUDV OD UHFLHQWH PXHUWH GHO ORDUriano Paulino81, quien haba dejado el obispado de Tiro
para suceder al antiorigenista Filogonio82, cuyo bito
aconteci el 20 de diciembre del 32383. La relevante
intervencin del comisionado imperial debi ser decisiva
para que Eustacio, otro adversario del racionalismo
teolgico arriano84, cambiara, a su vez, la sede de Berea
(Alepo) por la antioquena85: as, la apostlica Antioqua
volva a estar en la rbita de los no subordinacionistas.
Su titularidad resultaba estratgica y esencial para el
partido de Alejandro (en el cual, de hecho, ya militaba
2VLR SHURLJXDOPHQWHSDUDORVORDUULDQRV7RGRVHUDQ
conscientes de que, como haba sucedido en el enfrentamiento donatista, la actitud constantiniana probablemente
volvera a comportar un Reichskonzil86.

Maretide (Ath. Alex., Apol. c. Ar. 74, 4, p. 154 [Ep. presb. et diac.
qui in Mareote sunt ad syn. Tyr.]).
80. Conc. Ant. (325) [ep. syn.], pp. 137-138 [E. Schwartz, Berlin, 1959
(con retroversin griega)]. Los traslados de Paulino y Eustacio a
$QWLRTXtDHMHPSOLFDQODDPSOLWXGTXHHQWRQFHVKDEtDQDGTXLULGRORV
enfrentamientos eclesisticos en la zona sirio-palestina.
3DXOLQRGH7LUR(XVHELRGH&HVDUHD\3DWUyORGH(VFLWySROLVKDEUtDQ
sido los adalides del concilio palestino que apoy a Arrio y a sus
partidarios: Theod., Hist. eccl. 1, 4, 37, p. 18 [+ IiYODUFR@6R]Hist.
eccl. 1, 15, 11, pp. 34-35. Respecto a la vinculacin de Paulino con el
partido arriano, cf. Theod., Hist. eccl. 1, 6, 1-8, pp. 27-29 [Eus. Nic.,
Ep. ad Paul. Tyr.]; Eus. Caes., C. Marc. 1, 4, 18-20, p. 21 [Paul. Tyr.,
Ep. ad Alex. Alex. (frag.)] [GCS, 14]; Epiph. Const., Adu. haer. 69, 6,
2, p. 156 [Arius, Ep. ad Eus. Nic.]; Theod., Hist. eccl. 1, 5, 5-6, p. 27.
Ver M. Vinzent, Origenes als subscriptum. Paulinus von Tyrus und
die origenistische Diadoche, en W. A. Bienert, U. Khneweg (dir.),
Origeniana septima. Origenes in den Auseinandersetzungen des
4. Jahrhunderts, Leuven, 1999, pp. 149-157.
82. Filogonio y los obispos sirios haban suscrito el WRYPRGH$OHMDQGUR
as lo evidencia el Urkunde 15 (en siraco). Cf. Epiph. Const., Adu.
haer. 69, 6, 2, p. 156 [Arius, Ep. ad Eus. Nic.]; Theod., Hist. eccl. 1,
4, 62, p. 25.
83. Ver R. W. Burgess, Studies in Eusebian and post-Eusebian
Chronography, Stuttgart, 1999, pp. 183-191. Cf. M. Vinzent, Origenes,
cit. (n. 81), pp. 149-151.
84. Cf. Theod., Hist. eccl. 1, 4, 62, p. 25. Respecto a la teologa
monarquiana de Eustacio, ver R. P. Cr. Hanson, The Search, cit. (n. 70),
pp. 211-217.
85. Del hecho de que, en la (QR VZYPDWR $WK$OH[De decr. Nic.
syn. 35, 4, p. 32), Alejandro repruebe el cambio de sede efectuado por
Eusebio (de Beirut a Nicomedia) parece desprenderse que entonces
Eustacio todava no ocupaba la ctedra de Antioqua.
86. Era sta la nica salida si, a pesar del inicial intento imperial, segua
persistiendo la intransigencia de los dos principales protagonistas del
FRQLFWR FRQ VXV DPSOLDV \ HQDUGHFLGDV UDPLFDFLRQHV  D UDt] GHO
cual se haban realizado diferentes reuniones eclesisticas regionales.
Aunque Constantino no parece decidirse por un gran snodo ecumnico
hasta despus de entrevistarse con Alejandro y Arrio, este recurso ya
deba haberse planteado previamente; el mismo obispo alejandrino
podra haberlo solicitado tanto a Osio como al emperador (ver n. 74).
P. Just, Imperator et Episcopus. Zum Verhltnis von Staatsgewalt und
christlicher Kirche zwischen dem 1. Konzil von Nicaea (325) und dem
1. Konzil von Konstantinopel (381), Wiesbaden, 2003, p. 145, considera
que Constantino tena planeado un gran snodo desde antes de la ida de
Osio a Alejandra.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINO Y OSIO: LA LTIMA ETAPA DEL CONFLICTO ARRIANO PRENICENO

Con visin de futuro y el claro propsito de fortalecer


D$OHMDQGUR2VLRTXLHQSRVHtDXQDPDQLHVWDFDSDFLGDG
organizativa87, debi convocar un concilio en Antioqua
MXVWR GHVSXpV GH LQLFLDUVH HO VHJXQGR SRQWLFDGR GH
Eustacio. Sera entonces cuando concluira su primera
estancia siria y regresara a la corte88, donde dara cuenta
de su misin a Constantino y ste, al parecer asesorado
por el cordobs89, instara personalmente a Alejandro y
Arrio a reconciliarse90. Tras despachar con Osio y constatar
tanto el pertinaz encono existente entre las dos partes
FRPR OD DPSOLWXG HFOHVLiVWLFD \ JHRJUiFD GHO FRQLFWR
el emperador, al haber fracasado su primer exhorto a la
R-PRYQRiD, acabara convocando una VXYQRGRRijNRXPeQiNKY91.
Ya conocan esta nueva disposicin de Constantino92 los
cincuenta y nueve obispos reunidos93, durante los primeros
meses del 325, en Antioqua bajo la presidencia de Osio94.
Adems, al igual que ste, tendran la circular de Alejandro
que arremeta duramente contra las recientes acciones proarrianas de Eusebio de Nicomedia. La sinodal antioquena95,
LQLFLDGDFRQODVPLVPDSDODEUDVTXHJXUDEDQDOFRPLHQ]R
de la (QR VZYPDWR96 y coincidente con sus indicaciones97,
describe al prelado alejandrino como hermano, colega en el
ministerio, honorable y querido98. Dice explcitamente que,

87. La autoridad que tena Osio como agente del prncipe queda bien
plasmada en la epstola sinodal antioquena. El hispano contempla la
posibilidad de arreglar l solo la situacin existente en la metrpoli
siria: Conc. Ant. (325) [ep. syn.], p. 137.
88. De la epstola sindica, se colige el intervalo temporal transcurrido
entre la convocatoria y la celebracin del concilio antioqueno: Conc.
Ant. (325) [ep. syn.], pp. 137-138.
89. Quizs tambin por Eusebio de Nicomedia y otros.
90. Cf. Epiph. Const., Adu. haer. 69, 9, 1-2, p. 159; Phil., Hist. eccl. 1,
7, p. 8 [GCS, 21]; 1, 7a [Vita Const. cod. Angel. A], p. 8. Filostorgio
indica que, en Nicomedia, Osio se entrevist con el obispo alejandrino.
Evidentemente, Alejandro y Arrio llegaron, con sus respectivas
comitivas, por separado a la capital imperial (ver n. 50).
91. As lo denomina, por ejemplo, Eus. Caes., Vita Const. 3, 6, 1, p. 83.
92. Conc. Ant. (325) [ep. syn@S(XVHELRVLW~DODQRWLFDFLyQGHO
snodo ecumnico justo despus de que hubiera fracasado la misin
SDFLFDGRUDHQFRPHQGDGDD2VLR(XV&DHVVita Const. 3, 6, 1, p. 83.
93. Las procedencias indicadas de los sinodales corresponden a Palestina,
Arabia, Fenicia, Celesiria, Cilicia y Capadocia. Ver E. Schwartz, Die
Dokumente, cit. (n. 64), pp. 150-154.
94. Es Osio quien encabeza la lista de asistentes. Ver H. Chadwick,
Ossius of Cordova and the presidency of the council of Antioch, 325,
en Journal of Theological Studies, 9/2, 1958, pp. 294-298. Eustacio,
WLWXODUGHODVHGHDQWULRQDHVPHQFLRQDGRHQVHJXQGROXJDU
95. Slo se ha conservado, en versin siraca, el ejemplar dirigido a
Alejandro de Bizancio. Nos servimos de la retroversin griega efectuada
por E. Schwartz.
96. En la (QR VZYPDWRJXUDe-QR VZYPDWR R>QWR WKCC NDTROiNKCC ejNNOKViYD
(Ath. Alex., De decr. Nic. syn. 35, 2, p. 31) y, segn la retroversin griega,
en la sinodal antioquena e-QR VZYPDWR R>QWRth NDTROiNhCC NDtD SDYQtD
tRYSRQ ejNNOhViYD Conc. Ant. [325] [ep. syn.], p. 137).
97. Tambin se alude a la excomunin de Arrio y de sus seguidores, a la
necesidad de evitar que las enseanzas de stos hagan mella entre los
cristianos y a la peticin de no estar en comunin con ellos.
98. Conc. Ant. (325) [ep. syn.], p. 138. La doctrina de Arrio es
denominada EODVIhPiYD.

33

impelidos por las expulsiones de los arrianos realizadas


por Alejandro y por la comunin que posteriormente stos
haban recibido de otros99, los conciliares deciden abordar
ante todo la cuestin cristolgica. Tras un extenso debate,
los sinodales redactan y aprueban una profesin de fe
ntidamente antiarriana y muy cercana a la concepcin
trinitaria de Alejandro100. Ahora su actuacin recibe un
aval multitudinario y sin ambages de los orientales congregados, quienes se dirigen asimismo a los colegas ausentes
SDUDTXHGLIXQGDQVXVGHFLVLRQHV\FLHUUHQODVFRQHOORV101.
Slo tres asistentes (Teodoto de Laodicea, Narciso de
Neronas y Eusebio de Cesarea) discrepan al respecto102
y, en consecuencia, son provisionalmente excomulgados
hasta la prxima celebracin del gran snodo103. Gracias al
enorme apoyo del agente imperial, en Antioqua Alejandro
obtuvo una rotunda victoria, la cual le permita acudir
con mucha ventaja a la prxima asamblea ecumnica,
QDOPHQWHQRMDGDHQ$QFLUDVLQRHQ1LFHD104, cambio
que Osio conocera al regresar a Nicomedia. Presidido
por Constantino e inaugurado el 20 de mayo del 325,
el concilio niceno tambin tuvo a Osio como principal
SURYeGUR105. El resultado de la entente fraguada entre
el cordobs y el alejandrino alcanz su cnit cuando
Eusebio de Cesarea106\(XVHELRGH1LFRPHGLDUPDURQ
la profesin de fe antiarriana, el credo niceno, probablemente en un documento preparado por Osio y Alejandro107.
Universitat de Barcelona

99. Conc. Ant. (325) [ep. syn@SS(VWDLQGLFDFLyQVHUHHUH


principalmente, a Eusebio de Nicomedia, quien tambin sera uno de
los hombres mundanos recriminados por el snodo.
100. Conc. Ant. (325) [ep. syn.], pp. 139-141. Ver L. Abramowski, Die
Synode von Antiochien 324/25 und ihr Symbol, en Zeitschrift fr
Kirchengeschichte, 86/3, 1975, pp. 356-360.
101. Conc. Ant. (325) [ep. syn.], pp. 137, 142. Los reunidos en Antioqua
determinan que nadie deba acoger a quienes acababan de excomulgar
(ver n. 103).
102. Conc. Ant. (325) [ep. syn.], pp. 141-142. Los sinodales declaran que
estos tres obispos pensaban como los partidarios de Arrio. Cf. Eus.
Caes., C. Marc. 1, 4, 39, p. 26 [Marc. Anc., Fragm. e Libro c. Asterium].
103. Conc. Ant. (325) [ep. syn.], pp. 141-142. De tal disposicin, parece
colegirse que Arrio exageraba cuando deca a Eusebio de Nicomedia que
su tocayo de Cesarea y otros proarrianos haban sido anatematizados por
Alejandro: Epiph. Const., Adu. haer. 69, 6, 2, p. 156 [Arius, Ep. ad Eus.
Nic.]. Ver W. Lhr, Arius, cit. (n. 46), p. 553. Segn la sinodal, deban ser
excomulgados quienes estuvieran de acuerdo con las exgesis de Arrio,
GHFLVLyQTXHWDPELpQLUtDGLULJLGDDORVORDUULDQRVGH$QWLRTXtD
104. Const., Ep. ad episc., pp. 41-42 [H.-G. Opitz, Berlin-Leipzig, 1935
(con retroversin griega)].
105. Cf. Eus. Caes., Vita Const. 3, 13, 1, p. 88.
106. Ath. Alex., De dec. Nic. syn. 33, 7, pp. 28-31 [Eus. Caes., Ep. ad eccl.
Caes.]. Ver H. Fr. Campenhausen, Das Bekenntnis Eusebs von Caesarea
(Nicaea 325), en Zeitschrift fr die neutestamentliche Wissenschaft und
die Kunde der lteren Kirche, 67, 1/2, 1976, pp. 123-139.
107. As se colige de Phil., Hist. eccl. 1, 9a [Vita Const. cod. Angel. A],
pp. 9-10 [GCS, 21]. Cf. Ath. Alex., Hist. Ar. 42, 3, p. 206 [H.-G. Opitz,
Berlin, 1940].

AnTard , 22, 2014, p. 35- 42


DOI 10.1484/J.AT.5.103171

LA RCEPTION DU CONCILE DE NICE


ET SON IMPACT SUR LVOLUTION DES COURANTS
THOLOGIQUES EN ORIENT (325-381)
$0

The receipt of the Council of Nicaea and its impact on the evolution
of theological trends in eastern Churches (325-381)
In 325, Constantine, the sole emperor, convened a general council in Nicaea in order to put an end to the dissensions that had split the Eastern Church for several years, and establish religious unity. Against Arius, a priest
of Alexandria, who declared that the Son had been made by Fathers will and was subordinate to Him, the council
declared the Son begotten, not made, that is consubstantial (homoousios) with the Father. The unanimity
obtained by imperial pressure hid a deep discomfort because this non-scriptural term was understood as a monarchian term by the great majority of the bishops. Very soon, the struggle began again, and the monarchians were
pushed aside, though the Creed of Nicaea was respected as long as Constantine lived. The disagreements continued
under Constantius on the basis of a theology of conciliation, anti-homoousian and anti-arian. The second Creed
of Antioch (341), founded on Scriptures, would be the point of reference in matters of creed for over ten years. But,
with the Neo-Arians, the stance became more unbending as far as to declare that the Son be of a different substance
(heteroousios) from the Father, resulting in a break of the consensus and the reaction of the homoioousians. A
new current, denying all relation with ousia, gathered around the formula of the Son like the Father (homoios)
in everything, formula adopted by the Council of Constantinople (360) in presence of Constantius, as the official
Creed more suited to achieve unity. After his death, several homoians and homoioousians gathered to face radical
Arianism. These Neo-Niceans succeeded in the Council of Constantinople (381), convened by emperor Theodosius,
adopting a final Creed interpreted the Nicean homoousios in a new sense. [Author]

En septembre 324, Chrysopolis en Asie Mineure,


&RQVWDQWLQPHWWDLWQjODJXHUUHTXLORSSRVDLWj/LFLQLXV
et devenait lunique souverain de lempire. Ds les mois
qui suivirent, commenait la prparation du grand concile
cens rsoudre les dissensions qui dchiraient les glises
dOrient depuis plusieurs annes. La querelle thologique
qui avait mis aux prises Arius, prtre dAlexandrie, son
vque au sujet de la relation du Pre et du Fils au sein de
la Trinit avait en effet embras lOrient, et les dmarches
entreprises par Ossius de Cordoue, le conseiller ecclsias-

Abrviations : Opitz 2 = H. G. Opitz, Athanasius Werke 2, 1, Berlin,


1934. Opitz 3 = H. G. Opitz, Athanasius Werke, 3, Berlin, 1935.

tique de Constantin, staient soldes par un chec1. Or


lunit religieuse savrait ncessaire lunit politique
de lempire que Constantin avait su imposer, comme il
lexprime lui-mme2. Lempereur convoqua donc un
concile gnral et mit le cursus publicus la disposition
des vques3. Ancyre en Anatolie, la ville dont Marcel

1. Eusbe, Vita Constantini 2, 61, 2 ; 62 ; 64-72, lettre de Constantin


Alexandre et Arius, crite de Nicomdie (72, 2). Sous-valuant
OLPSRUWDQFHGXFRQLWODOHWWUHHVWUHVWpHVDQVHIIHW
2. Eusbe, Vita Constantini 2, 65, 2, SC, 559, p. 335.
3. Eusbe, Vita Constantini 3, 6, 1 ; Eusbe emploie, pour la premire
fois, le terme cumnique au sens d universel ; il est repris par
Socrate 1, 8, 4 ; H. Chadwick, The origin of the title Oecumenical
Council, dans Journal of Theological Studies, 23, 1972, p. 132-135.

36

ANNICK MARTIN

tait lvque, dabord choisie, fut rapidement remplace


par Nice en Bithynie, proche de la rsidence impriale,
plus facile daccs4 et moins connote thologiquement.
Le concile, runissant quelque 270 participants 5 dont
seulement quelques Occidentaux, souvrit avec tout le
faste imprial, en juin 3256, en prsence de lempereur.
Il devait sachever deux mois plus tard avant les ftes
des Vicennalia, le 25 juillet, auxquelles tous les vques
taient convis Nicomdie7.
Constantin et lhomoousios nicen
Laissant de ct ce qui concerne les questions disciplinaires8, nous nous intresserons essentiellement
aux rsultats des dbats thologiques et aux dcisions
auxquelles ils ont donn lieu9. Dans sa lettre aux glises,
destine aux vques absents, Constantin estime que,
conformment ses vux, le concile a russi rtablir
laccord unanime entre les vques de lglise
catholique , accord exprim dans la souscription
lunanimit des vques une seule foi , et dans
la reconnaissance d une seule date de Pques 10.
Lempereur insiste sur cette unanimit, obtenue aprs
un examen trs attentif , et mentionne la condamnation
du seul Arius dans sa lettre lglise catholique des
Alexandrins11. La synodale lglise des Alexandrins
ajoute les noms de deux vques libyens, Thonas de
Marmarique et Sekoundos de Ptolmais, ainsi que les
anathmes condamnant la doctrine dArius disant que le
Fils de Dieu est partir du non tre, quil ntait pas
avant davoir t engendr, quil y eut un temps o il
ntait pas, et que par libre arbitre le Fils de Dieu est
capable du bien et du mal 12. Une formule de foi fut
promulgue13, dclarant le Fils engendr du Pre, cest-dire de la substance du Pre, ek ts ousias, [], vrai Dieu

4. Fragment de la lettre de Constantin au synode des Pres, conserve en


syriaque, Opitz 3, Urk. 20, p. 41-42.
5. Selon Eustathe dAntioche, prsent Nice, ap. Thodoret, HE 1, 8,
1 (= Fragm. 32) ; plus de 250 , selon Eusbe, Vita Constantini 3,
8, lui aussi prsent ; plus de 300 selon la lettre de Constantin
lglise des Alexandrins, dans Athanase, De Decretis 37, 1 ; 38, 5
(= Socrate 1, 9, 21) ; Opitz 2, Urk. 24 et 25, p. 36-37 ; prs de 300
selon Athanase, Apol. c. Ar. 23, 2, voir SC, 501, p. 201-202, n. 3.
6. Selon Socrate 1, 13, 13, le 20 mai, mais voir SC, 477, p. 164, n. 2.
7. Eusbe, Vita Contantini 3, 15, 1.
8. Le schisme mlitien qui concerne lgypte, et les canons disciplinaires.
9. Les Actes du Concile nont pas t conservs. Conciliorum
Oecumenicorum Generaliumque Decreta 1, The Oecumenical Councils
from Nicaea I to Nicaea II, 325-787, d. G. Alberigo, A. M. Ritter,
L. Abramowski, Turnhout, 2006, p. 3-15.
10. Ibidem, 3, 17-20, 2 ; cf. Socrate 1, 9, 32-46 (= Opitz 3, Urk. 26, p. 5457) ; Thodoret 1, 10.
11.Athanase, De Decretis 38 ; Socrate 1, 9, 17-25 (= Opitz 2, Urk. 25, p. 37).
12. Thodoret 1, 9, 4-5 ; voir SC, 501, p. 221, n. 2, pour les autres versions.
13. Le 19 juin, M. Simonetti, La crisi ariana nel IV secolo, Roma, 1975,
p. 79, n. 7.

AnTard , 22, 2014

issu du vrai Dieu, engendr, non pas cr, consubstantiel,


homoousios, au Pre , ce dernier terme, repris de la philosophie grecque et non scripturaire14, ayant t introduit
pour contrer le subordinatianisme radical dfendu par
Arius et ses amis. Or, la belle unanimit dont se flicite
lempereur dans ses lettres et discours est contredite par
OHV IRUWHV UpWLFHQFHV VRXOHYpHV SDU FH WHUPH QDOHPHQW
retenu. En ralit, elle tait le rsultat de fortes pressions,
voire de menaces. Eusbe de Nicomdie, Thognis
de Nice et Maris de Chalcdoine, qui, avec quelques
autres15, refusaient de signer, furent contraints de le faire
sous la menace de lexil16. Seuls les deux vques libyens
dj mentionns maintinrent leur refus et furent exils la
suite dArius et de quelques prtres en Illyricum. Eusbe
de Csare avait lui aussi prouv quelque rpugnance
signer, mais il dut sy rsoudre et crivit une lettre
VHV GqOHV SRXU VHQ MXVWLHU17. Il sy abrite derrire
lempereur qui lui demanda, crit-il, dajouter le terme
consubstantiel , homoousios, sa profession de foi
MXJpHSDUDLOOHXUVUHFHYDEOHWHUPHTXLOMXVWLDOXLPrPH
par la glose suivante : il est dit consubstantiel non pas
selon les affects des corps, ni parce quil tirerait son
existence du Pre par division ou sparation du Pre []
et il convient de penser de telles ralits en termes divins
et mystrieux 18. Et, aprs avoir cit la formule de foi
de Nice, Eusbe donne son tour son interprtation
GHV WHUPHV IDLVDQW GLIFXOWp WHOV TXH  GH OD VXEVWDQFH
du Pre , engendr et non cr , consubstantiel au
3qUHDQGpFDUWHUWRXWHDFFXVDWLRQGHPRGDOLVPHRX
darianisme. Il sabrite cette fois derrire lautorit des
Anciens qui ont utilis le mot consubstantiel 19.
(W SRXU QLU OpYrTXH GH &pVDUpH VH GLW GDFFRUG DYHF

14. Eusbe de Nicomdie sen serait gauss dans une lettre lue au
concile, Ambroise de Milan, 'H GH 3, 15, 125, CSEL, 78, p. 150
(= Opitz 3, Urk. 21, p. 42) ; voir le rcit dEustathe dAntioche cit
par Thodoret 1, 8, 1-2.
15. Parmi lesquels on compte un certain nombre de disciples de Lucien
dAntioche, appels collucianistes par Arius dans sa lettre
Eusbe de Nicomdie, Thodoret 1, 5, 4, SC, 501, p. 194, n. 1.
16. Philostorge 1, 8a ; Thodoret, HE 1, 7, 14-16 ; 8, 1-3 (version
antiochienne), SC, 501, p. 208, n. 1, p. 211, n. 4. Eusbe, Vita
Constantini, Codex Angelicus, daprs Philostorge 1, 9a ; le matre
GHVRIFHV3KLORXPHQRVHVWFKDUJpGHIDLUHVLJQHUOHVpYrTXHV
17. Athanase, De Decretis 33, repris par Socrate 1, 8, 35-54,
Thodoret 1, 12 (= Opitz 3, p. 42-47). Athanase, Ep. ad Afros 6, 4
FLWpSDU7KpRGRUHW XWLOLVHFHWWHOHWWUHFRPPHMXVWLFDWLRQ
dune tradition de lhomoousios. Noublions pas qu Nice, Eusbe
tait en tat dinfriorit car il venait de se faire condamner par le
synode dAntioche de 325 prsid par Ossius.
18. Thodoret 1, 12, 7 ; cf. la profession de foi dAlexandre dAlexandrie
dans sa lettre Alexandre de Constantinople : 1, 4, 46. Sur le rle
effectif de Constantin, gnralement contest, tort, voir P. F. Beatrice,
The world homoousios from Hellenism to Christianity, dans Church
History, 71, 2, 2002, p. 243-272.
19. Thodoret 1, 12, 9-13, renvoyant implicitement Origne et Denys
dAlexandrie, voir SC, 501, p. 218, n. 3. C. Luibheid, Eusebius of
Caesarea and the Nicene Creed, dans Irish Theological Quaterly, 39,
1972, p. 299-305.

AnTa rd , 2 2 , 2 0 1 4

LA RCEPTION DU CONCILE DE NICE ET SON IMPACT EN ORIENT

lanathme qui clt la formule de foi parce quil exclut


lusage des termes non scripturaires lorigine de toute
la confusion et de lagitation de lglise , comme cest
le cas des expressions tir du non-tre et il y eut un
temps o il ntait pas 20. Cest aussi largument de la
tradition des Pres que reprendra Athanase dAlexandrie
dans sa lettre aux Africains prs de cinquante ans plus
tard, contre ceux qui nacceptent pas lhomoousios parce
que non scripturaire21 : Quand ceux-l vont marmonnant
que ces termes ne sont pas scripturaires, ce reproche
dans leur bouche apparat dnu de sens, car, aprs avoir
blasphm avec des termes non scripturaires comme
partir du non tre et il y eut un temps o il ntait pas
qui ne sont pas dans lcriture, ils se plaignent davoir
t condamns au nom de ces expressions non scripturaires [] eux-mmes en effet se sont exprims de faon
vraiment terrestre, au contraire des vques qui nont pas
trouv leurs expressions par eux-mmes mais dtiennent
le tmoignage des Pres.
(QHVVD\DQWGHGpQLUOHWHUPHhomoousios contest
par Arius et ses partisans, Eusbe avait bien mis le doigt
VXU OD GLIFXOWp PDMHXUH GH OD IRUPXOH GH IRL TXL YHQDLW
dtre adopte lunanimit par le concile, en ralit
sous la pression impriale. Lempereur avait besoin de
paix, de concorde, dharmonie, comme ses discours le
rptent satit. Lvque, quant lui, sut esquiver.
Peu aprs le concile, Eusbe de Nicomdie et Thognis
de Nice, qui avaient accueilli quelques prtres ariens,
sont leur tour exils par lempereur en Gaule22. Mais,
trois ans plus tard, grce ses appuis la cour, Eusbe
de Nicomdie revint dexil ainsi que Thognis, non sans
avoir assur lempereur de leur orthodoxie 23.
Les premires ractions
Les vques, repartis dans leurs provinces, continurent utiliser la formule de foi de leur glise pour
baptiser leurs ouailles. Lambigut du terme homoousios
RIFLHOOHPHQW FRQVDFUp ODLVVDLW j WRXV XQH LQVDWLVIDFWLRQ
latente qui allait autoriser trs tt la reprise du dbat
thologique24. Athanase lui-mme, ardent dfenseur de
Nice o, jeune diacre, il avait assist son vque, nutilisera pas le terme avant la rdaction de son ouvrage Sur

20. Thodoret 1, 12, 15-17.


21. Athanase, Ep. ad Afros 6, 2-3 (cit par Thodoret 1, 8, 14).
22. Athanase, De Decretis 41, lettre de Constantin lglise de Nicomdie
(= Opitz 2, p. 43-45) ; cf. Thodoret 1, 20, 1-10 (en partie), SC, 501,
p. 276, n. 1.
23. Philostorge 2, 7 ; Socrate 1, 23, 1 ; Sozomne 2, 16, 2.
24. Cf. Socrate 1, 23, 6-7 ; R. P. C. Hanson, The Search for the Christian
Doctrine of God. The Arian Controversy 318-381, Edimbourg, 1988,
p. 181-207, sur la Semantic Confusion ainsi introduite.

37

les dcrets du synode de Nice aujourdhui dat de 35725.


En insistant sur engendr, non pas cr , les vques
pensaient bien contrer lide que le Fils puisse tre une
crature comme les autres, ft-elle la premire ; en disant
le Fils de la mme substance que le Pre , ils tablissaient lidentit de substance et lgale divinit du Pre et
du Fils, et annulaient la hirarchie des personnes divines,
avec le risque de voir supprimer toute distinction entre eux.
Et en allant jusqu assimiler substance et hypostase dans
ODQDWKqPH QDO SRXU FRQWUHU OH VXERUGLQDWLDQLVPH DULHQ
ne tombaient-ils pas, en nadmettant plus quune seule
hypostase, dans le modalisme qui rapporte lindividualit
des personnes de simples modes de Dieu, niant ainsi les
personnes (hypostases) divines26 ? Le texte de la formule
de foi est un compromis, lourd de consquence, entre les
partisans dAlexandre dAlexandrie, orignien modr, et
les asiates Marcel et Eustathe, de tendance monarchienne27,
compromis accept par une majorit indcise28.
La lutte reprit donc contre les monarchiens : Eustathe
dAntioche, ladversaire le plus combatif contre les tenants
des trois hypostases, accus entre autres de sabellianisme,
fut dpos puis exil en Thrace en 32829. partir de ce
moment le sige dAntioche sera occup par des anti-nicens
modrs, et la rsistance des eustathiens occasionnera un
schisme qui durera plus dun sicle30. Eusbe de Csare,
qui avait prsid le synode, fait tat des troubles qui perdurrent dans la ville et du soutien de lempereur son
gard31/HPSHUHXUDYDLWFRQUPpODIRLGH1LFpHFRPPH
UpIpUHQFHRIFLHOOHSRXUWRXWO(PSLUHHWLOHQWHQGDLWELHQ
la faire respecter, au nom de lordre et de lunit, ce qui
fut le cas jusqu sa mort en 337, contrairement ce qua
SXpFULUHOHSUrWUH-pU{PHUHVWpGqOHj(XVWDWKH32. Ainsi,

25. X. Morales, La thologie trinitaire dAthanase dAlexandrie, Paris,


2006, p. 285-286.
26. Ibidem, p. 21-31.
27. Ibid., p. 93-94, sappuyant sur les travaux de G. C. Stead sur
lhomoousiosFRQUPpVSDU-=DFKKXEHU
28. M. Simonetti, Il Concilio, dans A. Melloni et alii (dir.), Costantino I.
(QFLFORSHGLD&RVWDQWLQLDQDVXOODJXUDHOLPPDJLQHGHOOLPSHUDWRUH
del cosiddetto editto di Milano 313-2013, Rome, Istituto dell
Enciclopedia italiana, 2013, p. 222-226, estime que le sens fondamental
du credo nicen est monarchien, et lexpression dune minorit.
29. Synode dAntioche contre Eustathe, prsid par Eusbe de Csare,
Athanase, Histoire arienne 4, Socrate 1, 24, Thodoret 1, 21, 4-9 ; 22,
1 ; SC, 501, p. 286, n. 1, p. 287, n. 2 ; Jrme, De viris 85. X. Morales,
La thologie, cit. (n. 25), p. 243-248.
30. Thodoret 1, 22, 1-2 ; A. Martin, $QWLRFKHRXODGLIFLOHXQLWp/HV
enjeux dun schisme, dans Les Pres de lglise et les dissidents
(Actes du IVe colloque de La Rochelle, 25-27 septembre 2009),
CaritasPatrum, 2010, p 65-86, tableau p. 86.
31. Eusbe, Vita Constantini 59, 2-5, SC, 559, p. 434-435 ; suivi
de la lettre de Constantin au peuple dAntioche : Eusbe, Vita
Constantini 60 ; pressenti pour remplacer Eustathe, Eusbe stait
rcus et reut une lettre de flicitations de Constantin : 61.
32. Jrme, Chronique an. 337, Constantin a t baptis par Eusbe
de Nicomdie in arrianum dogma. Sur la soi-disant palinodie de
Constantin, voir P. Maraval, Constantin est-il devenu arien ? Le
tmoignage des historiens du e sicle, dans Theophilyon, 10, 2005,
p. 371-384 ; Id. Constantin Le Grand, Paris, 2011, p. 298-306.

38

ANNICK MARTIN

en 333, un dit aux vques et aux peuples ordonnait


quon jett au feu les crits dArius, avec menace de mort
pour ceux qui les conserveraient33. Et quand, en 335, il
convoqua Arius au palais, ce fut pour lui demander sil se
FRQIRUPDLWDX[GpQLWLRQVGH1LFpH 34. Aprs llimination
de lvque dAntioche, cest contre Marcel dAncyre, plus
radical encore, que se concentre la raction anti-nicenne.
'pSRVpGDQVXQV\QRGHUpXQLj&RQVWDQWLQRSOHQRX
dbut 336, et exil par lempereur, il avait crit un ouvrage
contre Astrius le Sophiste, lui-mme auteur dun syntagmation35. Eusbe de Csare stait employ longuement
le rfuter36. Remplac par Basile Ancyre, Marcel se
retrouva, avec Athanase dpos pralablement pour motifs
disciplinaires au synode de Tyr et exil une premire fois par
Constantin Trves en 335 puis par Constance en 339, au
concile de Rome qui devait les dfendre, lhiver 339/34037.
Marcel restera le point de mire des Orientaux antinicens
pendant encore longtemps38.
La reprise du dbat thologique sous Constance
Les extrmes carts, les thologiens des trois
hypostases, majoritaires en Orient, se retrouvent sur
la base dune thologie de conciliation, anti-nicenne
et anti-arienne, dont Eusbe de Csare et Astrius de
Cappadoce avaient t jusque-l les meilleurs reprsentants. Ce front ainsi constitu regroupait des tendances
thologiques pouvant aller de lacceptation de Nice sans
lhomoousios un arianisme modr. Sous lempereur
Constance, la discussion thologique reprit ses droits,
et plusieurs synodes se succdrent, dabord Antioche
en 341, loccasion de la Ddicace de la Grande glise,
puis Sardique en 343, convoqu par Constant pour
lOccident et Constance pour lOrient, nouveau
Antioche en 344, puis Sirmium en 35139, aprs la mort
de Constant et la victoire de Mursa sur lusurpateur
0D[HQFH TXL W GH &RQVWDQFH OH VHXO HPSHUHXU /HV
formules de foi qui y sont mises traduisent limportance

M. Simonetti, Eresia, arianesimo e dottrina trinitaria, dans A. Melloni


et alii (dir.), Costantino I, cit. (n. 28), p. 937-940.
33. Athanasius, De Decretis 39, cf. Socrate 1, 9, 30 (= Opitz 3, Urk. 33,
p. 37-38), dat de 333.
34. Socrate 1, 38, 1-5.
35. Athanase, Sur les synodes 18, 4-6 ; 19, 1-3, en cite des fragments.
M. Vincentz, Asterius von Kappadokien. Die theologischen
Fragmente, Leiden / New York / Kln, 1993.
36. Socrate 1, 36, allusion la rfutation du livre de Marcel dans la Thologie
ecclsiastique ; 2, 21, 6-21, longues citations du Contre Marcel.
37. Sur ces vnements, voir A. Martin, Athanase dAlexandrie et
lglise dgypte au e sicle (328-373) (CFR, 216), Rome, 1996,
p. 341-419. Athanase est accus de maltraiter les mlitiens, des
opposants au pouvoir alexandrin.
38. X. Morales, La thologie, cit. (n. 25), p. 248-257.
39. Cette succession de synodes destins rtablir lunit de lglise est
rappele au dbut de la synodale dAncyre de 358, 2-3, SC, 563, p. 64-67.

AnTard , 22, 2014

du dbat thologique ouvert par la controverse arienne


et expriment le consensus oriental contre lhomoousios
face aux Occidentaux replis sur Nice. En rponse aux
attaques de Jules de Rome qui prtendait rintgrer les
plaignants, Marcel et Athanase, malgr leur condamnation
par les Orientaux quil avait trait dariens, les vques,
au nombre de 90, runis Antioche loccasion des
Encnies, rejetrent cette appellation en se dmarquant
dArius, simple prtre, et envoyrent leur profession
de foi, celle transmise depuis le commencement ,
omettant toute rfrence Nice40. Ctait une nouveaut
rendue possible par la mort de Constantin qui sen tenait
la foi de Nice. Ils avaient rdig une formule plus
consquente appele la deuxime dAntioche 41 ,
appuye sur lcriture, destine carter lhomoousios
QLFpHQ/H)LOV\HVWGpQLFRPPHLPDJHH[DFWHGHOD
divinit, de la substance, de la volont, de la puissance et
de la gloire du Pre . LEsprit saint, que Nice navait
fait que citer, se voit accorder un premier dveloppement
en relation avec le baptme. Nettement anti-sabellienne,
HOOHDIUPHTXH3qUH)LOVHW(VSULWVDLQWVRQWWURLVSDU
lhypostase, mais un par la concorde 42. Antisabellienne
tait galement la foi personnelle prsente au dbut du
synode par Thophronius de Tyane, accus de marcellianisme, avec un dveloppement sur lEsprit saint, pour
bien le distinguer du Fils ; elle se clt sur un anathme
contre Marcel dAncyre, Sabellius et Paul de Samosate43.
Reprenant la tradition subordinatianiste inspire
dOrigne, la deuxime dAntioche devait tre plus
tard honore du nom de foi des Pres et constituer la
formule de rfrence, voue un grand avenir44. Elle avait
reu lappui de lempereur Constance, mais elle largissait
le foss entre les deux glises. Hilaire de Poitiers, qui en a

40. Athanase, Sur les synodes 22, 3-7 ; Sozomne 3, 5, 5-7, la rsume. Arius
pWDLWPRUWj&RQVWDQWLQRSOHDSUqVVrWUHMXVWLpDXSUqVGH&RQVWDQWLQ
tandis quil devait tre reu par le synode de Jrusalem en 335.
41. Il y en eut trois, transcrites par Athanase ; sur leur ordre chronologique,
Sur les synodes 22, 3-7 (= 3e) ; 23, 2-10 (= 2e) ; 24, 2-5 (= 1re), SC, 563,
p. 248-259, et lIntroduction, p. 16-18. Une dernire formule, Sur les
synodes 25, 2-5, compose aprs le synode (25, 1), est appele tort
la quatrime dAntioche . R. P. C. Hanson, The Search, cit. (n. 24),
p. 284-292 ; M. Simonetti, La crisi, cit. (n. 13), p. 153-160 ; Ch. Pietri
La querelle arienne et le premier csaropapisme , dans Ch. Pietri,
L. Pietri, A. Vauchez, M. Venard (dir.), Histoire du Christianisme,
2. Naissance dune chrtient (250-430), Paris, 1995, p. 297-299.
42. Sur les synodes 23, 3, 5-6. Cf. Socrate 2, 10, 10-18, SC, 493, p. 4445, n. 1. A. H. B. Logan, Marcellus of Ancyra and anti-Arian polemic,
dans Studia Patristica, 19, 1989, p. 189-197.
43. Athanase est le seul lavoir conserve, Sur les synodes 24, 2-5 ;
cette formule, appele la troisime dAntioche , est en ralit la
premire. Thophronius nest pas autrement connu. X. Morales, La
thologie, cit. (n. 25), p. 112-113.
44. Sozomne, qui la rsume (3, 5, 8), lestime compatible avec la foi de
Nice ; elle fut mise sous le nom du martyr Lucien dAntioche, lancien
matre dEusbe de Nicomdie et de bien dautres, cause de ses
nombreuses rfrences aux critures (Sozomne 9). Les homousiens
la considreront comme celle des Pres , Sozomne 6, 12, 4). On la
dit inspire par Astrius, prsent su synode.

AnTa rd , 2 2 , 2 0 1 4

LA RCEPTION DU CONCILE DE NICE ET SON IMPACT EN ORIENT

donn plus tard une version latine dans son ouvrage Sur les
synodes, en a aussi fait un commentaire positif. Il est alors
un des rares Occidentaux avoir compris la rticence des
Orientaux lhomoousios nicen, cause de son relent
modaliste45. La quatrime formule , rdige aprs le
synode, tait destine, avec laccord de Constance,
tre remise lempereur dOccident, Constant, par une
dlgation dvques, pour le rassurer sur lorthodoxie
des Orientaux, ce qui fut fait Trves au dbut de 342 ;
PDLV FHOD QH VXIW SDV j FDOPHU OHV HVSULWV /DQDWKqPH
QDOUHSUHQDLWSRXUWDQWFHOXLGH1LFpHFRQWUHOHVSURSRVLtions dArius, mais en omettant le terme litigieux ousia46.
Se plaant ainsi entre les deux extrmes, cette thologie
conciliante fut soutenue pendant plus de dix ans par
lensemble des Orientaux ; elle exprimait une via media
TXLDOODLWDXOGXWHPSVVDYpUHUGLIFLOHjWHQLU
Le grand concile cumnique convoqu Sardique
en Illyrie par les deux empereurs47, Constant et Constance,
devait rgler les diffrends tant disciplinaires que doctrinaux
entre les vques dOrient et ceux dOccident. Ce fut un
chec. Les Orientaux nacceptaient pas la remise en cause
par les Occidentaux des dcisions conciliaires prises, entre
autres, contre Athanase dAlexandrie, Marcel dAncyre
et Paul de Constantinople. Ils refusrent de siger et se
rendirent Philippopolis o ils rdigrent une profession
de foi qui reprenait la quatrime formule dAntioche ;
de nouveaux anathmatismes y taient formuls contre
Marcel et contre larianisme radical48. De leur ct les
Occidentaux, rests Sardique, en composrent une, de
tendance marcellienne, qui ne reconnaissait qu une seule
hypostase 49. Athanase dAlexandrie, prsent au concile,
prfra la passer sous silence, lui refusant ainsi lautorit
GXQGRFXPHQWRIFLHO,OVHQH[SOLTXHUDSOXVWDUGHQ
face aux eustathiens, pourtant ses amis, quand il cherchera
faire lunit avec lglise dAntioche50. partir de ce
moment, il prit ses distances avec Marcel dAncyre51. La
chrtient se trouvait divise en deux blocs opposs, la
majorit des Orientaux, antinicens parce quantisabel-

45. Hilaire, Sur les synodes 29-30, traduction PL, 10, col. 502A-504A ;
32-33, commentaire, col. 504B-506B.
46. Athanase, Sur les synodes 25, 5.
47. Socrate 2, 20, 3, avec une erreur sur la date. A. Martin, Athanase, cit.
(n. 37), p. 422-436.
48. La profession de foi na t conserve que dans la traduction latine
dHilaire, Collect. Series A IV, 2 (= Frg. hist. III, 29), CSEL, 65,
p. 69-73. M. Simonetti, La crisi, cit. (n. 13), p. 167-180.
49. La profession a t conserve dans une version grecque, la suite
de la synodale par Thodoret 2, 8, 39-52, qui la tient des eustathiens
dAntioche, et dans une traduction latine dans la Collection du diacre
Thodose, Codex Veronensis 60, fol. 80b-81a ; SC, 501, p. 368-369,
n. 1, donne la bibliographie affrente.
50. Athanase, Tome aux Antiochiens 5, 1. X. Morales, La thologie, cit.
(n. 25), p. 259-265.
51. Hilaire, Frg. hist. II, 22. J. T. Lienhardt, Did Athanasius reject
Marcellus?, dans M. R. Barnes, D. H. Williams (dir.), Arianism after
Arius. Essays on the Development of the Fourth Century Trinitarian
&RQLFWV, Edimbourg, 1993, p. 65-79, spc. 71-74.

39

liens, et hostiles larianisme radical, les Occidentaux,


rejoints par quelques vques dOrient, nicens, voire, pour
certains, marcelliens. Les positions thologiques navaient
jamais t aussi loignes.
loccasion dun nouveau synode runi Antioche
par Constance un an plus tard, en 344, un expos de la
foi reprenait la quatrime formule dAntioche , en y
ajoutant une longue explication des anathmatismes contre
la doctrine arienne et contre le sabellianisme. Il y mettait
en garde les Occidentaux contre le modalisme de Marcel
dAncyre et de son disciple, Photin de Sirmium, cit pour la
premire fois. Plutt que trois hypostases, terme qui heurtait
les nicens, il confesse trois personnes, qui sont trois
ralits, et un Dieu unique, et insiste sur la relation troite
entre le Pre et le Fils ; comme dans la profession de 341,
le Fils est image du Pre. Au consubstantiel, homoousios,
nicen, est substitu le semblable en toutes choses ,
homoios kata panta, ce qui reprsente un net progrs dans
la formulation thologique traditionnelle des Orientaux52.
La formule annonait lhomisme qui allait devenir le
courant thologique le plus important durant les trente
annes venir. La nouvelle foi fut remise lempereur
Constant par une dlgation dvques orientaux la cour
de Milan au dbut de lanne 345. Runis en concile
Milan les Occidentaux acceptrent de condamner Photin,
mais exigrent des Orientaux quils condamnent la doctrine
des trois hypostases, ce quils refusrent de faire53. Aprs
la mort de Constant et sa victoire sur Maxence Mursa
en septembre 351, devenu lunique empereur de Rome,
Constance, comme son pre Constantin, a les mains libres
pour imposer lunit religieuse tout lEmpire. Sitt aprs sa
victoire, il runit un synode Sirmium en Pannonie, son lieu
de rsidence. Parmi les vques prsents, outre danciens
eusbiens prsents au synode de Tyr de 335 qui avait
FRQGDPQp$WKDQDVHJXUHQWGHQRXYHOOHVWrWHVWHOV(XGR[H
de Germanie, Acace de Csare, le successeur dEusbe
disparu dix ans plus tt, et Basile dAncyre, le remplaant
de Marcel. Photin, lvque de la ville, qui navait pas quitt
son sige malgr sa condamnation, fut nouveau condamn
aprs une vive discussion conduite par Basile54, et exil
par lempereur prsent. Une nouvelle profession de foi fut
promulgue. Elle reprenait la quatrime dAntioche ,
prcise par vingt-sept anathmatismes. Ctait lacm de la
politique de la via media prne depuis maintenant dix ans
par les thologiens orientaux conservateurs. Cette position
moyenne fut une fois encore reconnue positivement, comme

52. Athanase, Sur les synodes 26, I-X, SC, 563, p. 258-271. Sur cette
volution thologique, M. Simonetti, La crisi, cit. (n. 13), p. 190-198 ;
Ch. Pietri, dans Histoire du Christianisme, cit. (n. 41), p. 306-307.
53. Hilaire, Frg. hist. II, 19 ; V, 4. M. Simonetti, La crisi, cit. (n. 13),
p. 189-190.
54. Socrate 2, 29, 1, 3-5 ; la liste des participants fournie au 2 nest pas
celle de 351 (Sirmium I) mais celle de Sirmium IV (359). Sozomne 4,
6, 1-6 (mme erreur), fournit des lments sur la doctrine de Photin (2).

40

ANNICK MARTIN

lavait t celle des Encnies, par Hilaire556RXVOLQXHQFH


de ses conseillers ecclsiastiques, Ursace de Singidunum
et Valens de Mursa, en accord avec le nouvel vque de
Sirmium, Germinius, Constance crut pouvoir raliser
lunit religieuse de lempire en mettant au pas lpiscopat
occidental qui refusait toujours dentriner la condamnation
dAthanase dsormais seul obstacle la paix. Les conciles
dArles en 353 et de Milan en 355 y mirent bon ordre en
exilant les rcalcitrants. En t 356, Libre de Rome fut
exil Bre en Thrace, suivi de peu par Ossius de Cordoue
envoy Sirmium56. Hilaire de Poitiers les avait prcds,
exil en Phrygie au printemps 356, tandis que depuis le
8 fvrier, Athanase dAlexandrie tait en fuite en gypte.
Lclatement du consensus oriental
/D Q GHV DQQpHV  YRLW OD UXSWXUH GX FRQVHQVXV
oriental. Une nouvelle gnration de thologiens, dont
Ace, un diacre dAntioche, et son disciple Eunome sont
OHVFKHIVGHOHUDGLFDOLVHODGRFWULQHG$ULXVHQDIUPDQW
que le Fils est radicalement dissemblable, anomoios, du
Pre, et dune autre substance, htroousios, raison pour
laquelle leurs adversaires les appelrent anomens57. ce
nouveau courant thologique, lhistoriographie moderne
a donn le nom de no-arianisme58. Laffrontement avec
le courant encore largement majoritaire en Orient, celui
des anciens eusbiens dfendant la thologie conservatrice des Encnies, tait invitable. Ces derniers,
privs de leader depuis la disparition des deux Eusbe,
YRQW GHYRLU UHGpQLU OHXU WKpRORJLH WULQLWDLUH IDFH DX[
nouveaux arrivs forts de la philosophie dialecticienne
quils manient brillamment en plus des critures. On
assiste alors la recomposition du panorama thologique59. Durant lt 357, un synode se runit Sirmium

55. Hilaire, Sur les synodes 62, PL, 10, col. 522. Le texte de la
profession se trouve dans Athanase, Sur les synodes 27, 2-3,
I-XXVII (cf. Socrate 2, 30, 5-30) ; version latine dans Hilaire, Sur les
synodes 38, col. 509B-512C, ainsi que 22 souscriptions la suite de la
lettre de Libre, 3URGHLFR, Collect. Series B VII, 9, p. 170. Lvque
de Rome, Libre, en exil en Thrace depuis 356, la signera, Pro
GHLFR, Collect. Series B VII, 8, p. 169, M. Simonetti, La crisi, cit.
(n. 13), p. 236, n. 56. Sur la discussion entre Basile et Photin (avant
ou pendant le concile ?), piphane, Panarion 71, 1, 4-6 ; Socrate 2,
30, 42-46 ; Sozomne 4, 6, 14-16 ; des stnographes en assurrent
le compte rendu ; cette forme de dbat nest pas sans voquer ceux
auxquels tait convoqu Origne par les vques pour confondre des
monarchiens.
56. A. Martin, Athanase dAlexandrie, cit. (n. 35), p. 490, n. 143.
57. Athanase, Sur les synodes 31, 3, SC, 563, p. 290-291 et n. 3.
58. T. A. Kopecek, A History of Neo-Arianism (Patristic Monograph
Series, 8), 1, Cambridge (Mass.), 1979, p. 133-198. Le nologisme a
t repris par R. P. C. Hanson, The Search, cit. (n. 24), qui en fait le
titre de son chapitre 19, p. 598.
59. A. Martin, Athanase et les no-ariens, dans D. Mayer (dir.), Philostorge
et lhistoriographie de lAntiquit tardive / Philostorg im Kontext der
sptantiken Geschichtsschreibung (Collegium Beatus Rhenanus, 3),
Stuttgart, 2011, p. 275-288, 276-278.

AnTard , 22, 2014

(= Sirmium II), en ralit une runion restreinte, compose


dvques, tous anti-nicens, mens par Valens de Mursa,
Ursace de Singidunum et Germinius de Sirmium, les
conseillers ecclsiastiques de Constance. Une formule de
foi nettement subordinatianiste est mise au point60. Nul
ne doute que le Pre est plus grand [] tandis que le Fils
est subordonn au Pre . Elle rend caduque la formule
nicenne par la suppression explicite de lousia et des
termes drivs homoousios et homoioousios, non scripturaires, au nom dune thologie rsolument apophatique61.
Elle marque la naissance dun parti homen 62, mme
si le terme homoios, semblable, utilis de manire prmoQLWRLUH HQ  QHVW SDV H[SUHVVpPHQW IRUPXOp (OOH W
leffet dun coup de tonnerre thologique. Hilaire, qui la
publie en latin, la intitule : Exemplum blasphemiae
apud Sirmium per Osium et Potamium conscriptae63. Les
UpDFWLRQVQHVHUHQWSDVDWWHQGUH&RQWUHFHUHMHWDEVROX
de Nice, Athanase, cach dans Alexandrie, rdigea son
ouvrage Sur les dcrets de Nice pour en dfendre la
formule et, plus prcisment, les expressions issu de la
substance et consubstantiel contre ceux qui accusent
ces expressions de ntre pas scripturaires 64. Du ct
des anti-nicens, Georges de Laodice, qui a immdiatement peru le danger de collusion avec le no-arianisme
dnona Ace et Eudoxe, le nouvel vque dAntioche65.
La nouvelle formule de foi, charte de lhomisme, pouvait
en effet devenir le cheval de Troie du no-arianisme66.
Le danger dsormais ne vient plus du modalisme mais
de lanomisme. Dment avertis, les vques runis
Ancyre autour de Basile avant la Pque 358 en prirent

60. Athanase, Sur les synodes 28, 2-12, SC, 563, p. 278-281 ;
cf. Socrate 2, 30, 31-4 ; on en trouve un rsum lintrieur dun
passage trs confus sur les formules de Sirmium de Sozomne 4, 6,
9-10. Le texte latin transmis par Hilaire, Sur les synodes 11, 487-489,
nest pas loriginal mais la rtroversion dun texte grec.
61. X. Morales, La thologie, cit. (n. 25), p. 272-273. Le terme
homoioousios est utilis ici pour la premire fois (28, 6). Constatant
labsence de ce terme sous la plume des homousiens eux-mmes,
T. D. Barnes, A note on the term homoioousios, dans Zeitschrift fr
Antikes Christentum, 10, 2006, p. 276-285, a mis en question son
occurrence dans la formule de 357 et ni lexistence dun tel courant
(voir infra).
62. H. C. Brennecke, s.u. Homens, dans le Dictionnaire dHistoire et
de Gographie ecclsiastique, 24, 1993, col. 932-960 ; et la critique
de M. Simonetti, Alla ricerca dei cosidetti omei, dans Cassiodorus, 2,
1996, p. 41-49 : une dnomination moderne utilise pour dsigner
ceux que les Histoires ecclsiastiques appellent acaciens (du nom
dAcace de Csare, le successeur dEusbe), puis ariens tout
court, pour les distinguer des ariens radicaux.
63. Le vieil Ossius de Cordoue en exil, prsent Sirmium, a souscrit
cette formule, ce qui lui sera reproch, malgr la dfense dAthanase,
Histoire arienne 45. Le cas de Potamius de Lisbonne est diffrent :
peut-tre a-t-il particip aux discussions en plus davoir souscrit, voir
M. Simonetti, La crisi, cit. (n. 13), p. 229, n. 40.
64. De decretis 1, 1 ; X. Morales, La thologie, cit. (n. 25), p. 286-288.
65. La lettre de dnonciation de Georges de Laodice envoye Basile
dAncyre et aux vques runis pour le synode dAncyre en 358 a t
conserve par Sozomne 4, 13, 2-3 ; Thodoret 2, 25, 3, y fait allusion.
66. Voir la remarque de M. Simonetti, La crisi, cit. (n. 13), p. 233, n. 47.

AnTa rd , 2 2 , 2 0 1 4

LA RCEPTION DU CONCILE DE NICE ET SON IMPACT EN ORIENT

acte. La synodale en appelle la formule dAntioche


de 341 (la deuxime dAntioche )67, et rdige une
longue argumentation contre lanomisme, qui marque
lacte de naissance dun nouveau parti thologique autour
GHODGpQLWLRQFKULVWRORJLTXHVHPEODEOHMXVTXHVHORQ
la substance , homoios katousian, le parti des homousiens, en latin homoeusiani68. Elle nen rejette pas moins
dans son dernier anathme lhomoousios nicen, interprt
comme autoousios, cest--dire professant une identit
entre le Pre et le Fils proche du modalisme marcellien.
Basile se rendit en dlgation Sirmium auprs de
Constance pour lui dnoncer Eudoxe et le no-arianisme.
Lempereur, hostile larianisme radical dont il sait que,
tout comme le nicisme, il ne peut faire lunit recherche,
ragit en envoyant une lettre lglise dAntioche
dsavouant Eudoxe qui venait de semparer du sige et
GH UpLQWpJUHU $qFH ,O \ UpDIUPH  OD IRL GHV 3qUHV 
celle de 341 renouvele plusieurs reprises, et accepte
la formule homousienne dAncyre69. Lt 358 les
vques prsents Sirmium, homens (Ursace et Valens),
homousiens (Basile et ses amis) et quelques Occidentaux
(Libre et des Africains), se runirent sur la base de
lhomoios katousian kai kata panta, contre les marcelliens et les ariens radicaux. Tous souscrivirent au dossier
documentaire constitu pour loccasion (= Simium III)70.
Laccord entre eux nallait pas durer. Basile russit faire
condamner les ariens radicaux dont Eudoxe et ses amis
Ace et Eunome, avec soixante-dix vques71.
Lempereur, la formule homenne et lunit religieuse
Voulant imposer lunit la plus large, lempereur
dcide de convoquer un concile cumnique Nice72,
comme lavait fait son pre Constantin pour rtablir la paix
religieuse dans tout lempire. Aprs quelques avatars, le
synode est convoqu pour lt 359. En mai, une runion
restreinte quelques vques, dont les homens proches
de lempereur auxquels se joint Basile, se tint nouveau

67. Ce document a t dit, traduit et annot par X. Morales, dans


SC, 563, p. 49-105.
68. Le terme ne se trouve que dans laire latine, utilis par les philo-ariens ;
il circulait dj Rome depuis quelque temps selon Marius Victorinus,
Traits thologiques sur la Trinit 1, SC, 68, p. 266. En grec, les
homousiens sont appels de manire tendancieuse semi-ariens par
piphane, Panarion 73. W. A. Lhr, Die Entstehung der homoschen und
homusianischen Kirchenparteien: Studien zur Synodalgeschichte des
4. Jahrhunderts, Bonn, 1986 ; Id., A Sense of tradition: the homoiousian
church party, dans Arianisme after Arius, Edinburgh, 1993, p. 81-100.
69. La lettre est cite intgralement par Sozomne 4, 14.
70. Sozomne 4, 15, 1-3. La synodale, qui ne comportait pas de nouvelle
formule de foi, na pas t conserve ; Hilaire en donne seulement
un rsum sous le nom dEpistula sirmiensis. Voir notre Introduction
dans SC, 563, p. 23-24.
71. Philostorge 4, 8.
72. Socrate 2, 37, 1.

41

Sirmium. Les homens obtinrent de Constance que le


synode soit scind en deux. La formule de foi rdige
FHWWH RFFDVLRQ RIFLHOOHPHQW GDWpH GX  PDL  FH
qui lui valut dtre appele par drision le Credo dat
par ses adversaires), une formule de compromis plus
politique que doctrinale (= Sirmium IV), serait prsente
aux Occidentaux Rimini, et aux Orientaux Sleucie
G,VDXULH(OOHGpQLVVDLWOHVUDSSRUWVGX3qUHHWGX)LOVSDU
le semblable en toutes choses et proscrivait lemploi du
terme ousia, contre les nicens et les anomens73. Basile,
qui la signa, rdigea cependant un trait pour dnoncer la
complicit des homens avec les anomens74.
Le 27 mai 359 souvrait le concile de Rimini, prsid
par le prfet du prtoire Taurus, charg de faire souscrire
la formule de foi par les quelque trois quatre cents
Occidentaux prsents dont quatre-vingt homens. Une
OHWWUH GH OHPSHUHXU &RQVWDQFH HQ DYDLW [p ORULHQtation75. Majoritairement homoousiens, les vques
UHIXVqUHQW GH VLJQHU HW UpDIUPqUHQW OD IRL GH 1LFpH  OH
21 juillet, ils votaient une damnatio hereticorum contre
les chefs homens Ursace, Valens, Germinius et quelques
autres, et, conformment lordre imprial, ils envoyaient
dix lgats Constantinople pour informer lempereur de
lissue du synode76. De leur ct, les vques condamns
envoyrent leurs propres lgats Constantinople pour
informer lempereur du refus de la majorit de signer la
formule du Credo dat. Constance ne reut pas les dlgus
RIFLHOVTXLGXUHQWDWWHQGUHOHERQYRXORLULPSpULDOGDERUG
Hadrianopolis en Thrace, puis, un peu plus au sud, Nik,
une petite station postale. Mais l, le 10 octobre 359, aprs
avoir t manipuls par Ursace et Valens, les lgats nicens
signrent sous la contrainte une formule de foi proche du
Credo dat, dans laquelle le Fils est semblable au Pre
selon les critures 77. Aprs quoi, ils retournrent Rimini,
o, sous la pression du prfet Taurus, lassemble dut
souscrire la formule de Nik dans une forme abrge et
VLPSOLpH78. Une dlgation conduite par Ursace et Valens
partit Constantinople o elle rencontra celle de Sleucie.
De leur ct, les Orientaux, runis Sleucie du 27 au
30 septembre, staient diviss entre homousiens tenant
de la formule dAntioche de 341, largement majoritaires,

73. Texte dans Athanase, Sur les synodes 8, 3-7.


74. Trait sur la foi, dition, traduction et notes par X. Morales, dans
SC, 563, p. 107-149 ; le texte a t conserv par piphane, ibidem 12-22.
75. Ep. Continent priora statuta, Hilaire, Collect. Series A VIII (= Frg.
hist. VII, 1-2), CSEL, 65, p. 93-94.
76. Athanase, Lettre sur les synodes 8-11, SC, 563, p. 196-211.
77. Hilaire, Collect. Series A V, 3 (= Frg. hist. VIII), p. 85-86.
Thodoret 2, 21, 3-7, est le seul avoir conserv cette formule de
Nik. Y.-M. Duval, La manuvre frauduleuse de Rimini. la
recherche du Liber aduersus Ursacium et Valentem, dans Hilaire et
son temps (XVIe centenaire de la mort dHilaire de Poitiers, actes du
colloque de Poitiers, 29 septembre-3 octobre 1968) (Coll. des tudes
augustiniennes. Srie Antiquit, 35), Paris 1969, p. 51-103.
78. Athanase, Sur les synodes 30, 2-10.

42

ANNICK MARTIN

et homens auxquels staient joints des ariens radicaux,


groups derrire Acace de Csare. La formule homenne
prsente par Acace lemporta ; elle reprenait celle de
Sirmium IV sans le kata panta, excluant tout rapport
lousia, et condamnait lanomoios dont cest la premire
occurrence dans une profession79. Constantinople, le
31 dcembre, sous la pression de Constance qui voulait
fter son dixime consulat dans la paix et lunit, les
dlgations occidentales et orientales signrent une formule
proche de celle de Nik confessant le Fils semblable au
Pre conformment aux critures 80. Elle fut entrine
FRPPH IRL RIFLHOOH SRXU WRXW OHPSLUH SDU OH FRQFLOH
de Constantinople runi par Acace dbut janvier 360, en
prsence de lempereur81 ; Ace y fut condamn et les chefs
homousiens dposs et exils sur motifs disciplinaires.
Lensemble des vques tait invit souscrire la foi
homenne. L o Constantin avait chou, Constance tait
convaincu, par ce simple mot dhomoios, semblable, trs
gnral et par l susceptible de satisfaire aux interprtations
OHVSOXVGLYHUVHVGDYRLUPLVXQWHUPHGpQLWLIjSOXVGH
trente ans de querelles. Ctait de bonne politique (sans
oublier la contrainte), mais la recherche thologique qui
stait approfondie depuis les annes cinquante pouvaitelle sen satisfaire ? Faute dune doctrine religieuse plus
consistante, les homens ne pourront se maintenir quen
sappuyant sur lautorit du souverain.
La rinterprtation de Nice :
convergence no-nicenne contre les anomens
Constance meurt le 3 novembre 361. La controverse reprit. La formule homenne tait considre
comme dangereuse ; ds 361, Antioche, quelques
ariens radicaux, dont Euzoios le nouvel vque, avaient
GpMj WHQWp GLQpFKLU OD IRUPXOH RIFLHOOH GDQV OH VHQV
htroousien, mais la tentative avait chou larrive
de lempereur, attach la formule homenne82. Cest
face au danger anomen que les groupes se dterminent
dsormais. Celui des homousiens, le plus avanc dans la
UpH[LRQWKpRORJLTXHVHGLYLVDVXUODTXHVWLRQGHO(VSULW
saint dont la divinit ntait pas acquise certains en
UHQWPrPHXQHFUpDWXUHjOLQVWDUGHVDULHQV83 , et sur
le rapport lhomoousios nicen. Une partie dentre eux

79. Athanase, Sur les synodes 29, 2-9, SC, 563, p. 282, n. 3.
80. Athanase, Sur les synodes 30, 2-10, ajoutant lexclusion dousia
celle dhypostasis contre les homousiens, les homoousiens et
ceux qui dfendent lunique hypostase-substance (cest dire les
Occidentaux, les marcelliens et les eustathiens).
81. Voir linterprtation de Jrme, Altercatio luciferiani et orthodoxi 19,
Le monde entier gmit et stonna dtre arien .
82. Athanase, Sur les synodes 31, 1-2, SC, 563, p. 288-291 et
Introduction, p. 32.
83. M. Simonetti, Macdonius, macdoniens, dans A. Di Berardino (dir.)
Dictionnaire encyclopdique du christianisme ancien, II, p. 1515.

AnTard , 22, 2014

FRQWLQXDGHOHUHMHWHUSDUGpOLWpDXV\PEROHG$QWLRFKH
de 341, tandis quune autre linterprta la manire de
lhomoioousios, rejoignant ainsi lentreprise de Mlce
dAntioche qui, de retour dexil, runit un synode en 363,
mlant anciens homens (comme Acace, et lui-mme) et
homousiens84. Il sagissait, tout en satisfaisant le nouvel
empereur Jovien qui, comme ses prdcesseurs, recherchait la paix fond sur lunit de lglise, de faire front
larianisme radical. Ce synode marquait la naissance
dun nouveau courant thologique, appel no-nicen par
lhistoriographie moderne85, qui russira prs de vingt
ans plus tard le rapprochement entre Orient et Occident
GDQV XQH IRUPXOH QDOH 'X F{Wp GHV DQFLHQV QLFpHQV
Athanase, encore en exil, avait commenc de nouer un
dialogue avec les homousiens dans sa lettre Sur les
synodes86. De retour Alexandrie, il runit un synode au
SULQWHPSVDQGHFRQVWLWXHUXQIURQWQLFpHQXQLIDFH
la menace anomenne. lissue du synode, sadressant
aux Antiochiens, il tenta de convaincre ses amis eustathiens de renoncer dfendre lunique hypostase et
dengager le dialogue avec les homousiens87. Ce fut un
chec88. Aprs 363, Mlce est devenu le seul pouvoir
faire lunit de lglise dAntioche. partir de 370,
Basile de Csare, lui-mme homousien, va semployer
rapprocher les positions doctrinales entre Orient, autour
de lvque dAntioche, et Occident, avec Damase de
Rome. Les mots cl sont lunit de la Trinit consubstantielle, la pleine humanit du Fils et lgalit dhonneur de
lEsprit saint. Aprs le rgne de Valens89, les homens,
ayant perdu le soutien imprial, sont remplacs par les
no-nicens qui ont lappui de Thodose. Le concile
quil convoque Constantinople en 381 reconnat la foi
QLFpHQQHUpLQWHUSUpWpHjODOXPLqUHGHODUpH[LRQWKpRORgique engage depuis prs de trente ans90.
Universit Rennes 2

84. Socrate 3, 25, 10-18, profession avec les souscriptions, daprs


Sabinos dHracle. A. Martin, Les tmoignages dpiphane de
Salamine et de Thodoret de Cyr propos de Mlce dAntioche,
dans E. Oudot, F. Poli (dir.), Epiphania. tudes orientales, grecques et
latines offertes Aline Pourkier, Nancy, 2008, p. 147-171, 164-167.
85. J. Zachhuber, The Antiochene synod of AD 363 and the beginnings
of neo-nicenism, dans Zeitschrift fr antikes Christentum, 4, 2000,
p. 83-101.
86. Athanase, Sur les synodes 41-54 ; il a lu le Trait sur la foi de Basile
dAncyre dont il parle ici comme dun frre.
87. Tome aux Antiochiens, dans H. G. Opitz, Athanasius Werke, 2, 8,
Berlin, p. 340-351.
88. Sur cette pineuse question, voir A. Martin, Les tmoignages
dpiphane, cit. (n. 84), p. 161-169 ; Ead., $QWLRFKH RX OD GLIFLOH
unit, cit. (n. 30), p. 65-86.
89. Valens (365-378) avait reproduit la politique de Constance.
90. M. Simonetti, La crisi, p. 538-542 ; L. Ayres, Nicaea and its Legacy.
An Approach to Fourth-Century Trinitarian Theology, Oxford, 2004,
p. 236-240, 433.

AnTard , 22, 2014, p. 43- 52


DOI 10.1484/J.AT.5.103172

NICAEA TO TYRE (325-335):


THE BUMPY ROAD TO A CHRISTIAN EMPIRE
+$'

De Nice Tyr (325-335) : le chemin chaotique vers un Empire chrtien


Depuis que le vieux dbat sur la sincrit de la conversion de Constantin a t rsolu, la question importante reste de savoir vers quel type de christianisme celui-ci sest tourn. Mme sil y a peu de raison de douter de
la sincrit de sa conversion, on ne peut affirmer que sa politique lgard de lglise ait t identique celle des
vques. La confrontation entre Constantin et Athanase en 335 qui a entran lexil de lvque montre que cest
lidologie impriale qui a guid Constantin dans sa manire de traiter le clerg, autant que sa conversion. Une
lecture attentive de sa lettre aux principaux acteurs de la controverse arienne et son oraison aux saints suggrent
que Constantin chercha crer un christianisme public moins strict du point de vue de lorthodoxie que ce
que les vques devaient considrer comme acceptable. Cette diffrence sous-tend le comportement en apparence
excentrique de lempereur durant les dernires annes de son rgne. [Trad. de la Rdaction]

This story begins at the end. The setting is Constantines


palace in Constantinople, and the occasion a confrontation between the emperor and Athanasius, the feisty
young bishop of Alexandria. According to Epiphanius
of Salamis, an ardent admirer of Athanasius who wrote
about forty years after the event, this is what happened:
Pope Athanasius, when he was in Tyre, seeing the
dangerous plot then being woven on all sides, before the
moment came to enter the court or confront the calumnie
face to face, left by night and went up to the imperial
court, to Constantine, to make his report about himself to
him. But he [Constantine], still unhappy and suspecting
that the accusers were telling the truth and the defendant
was lying, persisted in his anger. Angry as the emperor
was, Pope Athanasius spoke painful words to him:
The Lord will judge between me and you, since you
yourself agree with those who calumniate your humble
VHUYDQW 
      
 1

1. Epiphanius, Panarion 68.4-5. ed. K. Holl, J. Dummer, Berlin, 1985,


3, pp. 149-150; trans. P. Amidon, Oxford, 1990. The most complete

Hearing these words, Epiphanius writes, Constantine


exploded. Within hours, Athanasius was unceremoniously
EXQGOHGDERDUGDVKLSDQGVHQWLQWRWKHUVWRIWKHVHYHUDO
exiles he would endure during his long episcopate.
The scene Epiphanius described was the culmination
of a series of dramatic reversals. Although Constantine
VHW SUHFHGHQWV GXULQJ WKLV SHULRG WKDW ZRXOG LQXHQFH
all future emperors, his handling of the Arian controversy that dominated those years has generated no small
amount of confusion. In the decade between the epochal
Council of Nicaea in 325, where Arius was decisively
condemned, and the Councils of Tyre and Jerusalem in
335, where Athanasius was deposed and Arius readmitted
to communion, Constantine bounced back and forth in
his support for one or the other of the antagonists. These
reversals have understandably led scholars to see the
emperor as erratic; an oft-repeated conclusion is that he
was a little soft in the head easily swayed by whichever

ancient account of these events is in Sozomens 5th c. Historia


ecclesiastica, 2.25.

44

HAROLD A. DRAKE

dominant personality had most recently gained access.2


But much if not all of this impression is the result of
looking at the emperors behavior from the standpoint of
church history assuming, in short, that his own agenda
and that of the church were identical.3 Hence the reason for
beginning with this incident: it serves to isolate a fundamental difference between the emperor and the clergy
Epiphanius account of the exile of Athanasius is
not the only one to survive, and it might not be the most
accurate. Athanasius himself placed the blame for his exile
on his ecclesiastical opponents, who, he says, invented a
charge that he had threatened to block the grain shipments
from Egypt that were essential to keeping peace in the
capital.4 Given Athanasiuss propensity for what today
would be called power politics, the charge is plausible,
but scholars are now fully aware that Athanasius writings
had a polemical purpose that must be taken into account
when evaluating the information they contain: the bishop
had an equally well-known propensity to use such stories
to divert attention from other, more central, charges that
he could not so easily dismiss.5 In this case, that would
be the fact that he had been legitimately deposed by a
synod of bishops, whose decision is what brought him
into Constantines presence.6 An Apology Athanasius
addressed some two decades after this event to
Constantines son Constantius II, in which he also raises
the specter of appeal to a higher power,7 cautions against
dismissing Epiphanius account out of hand.
But if Epiphanius story is credible, then Constantines
reaction needs to be explained. The bishops behavior
certainly was egregious; but the emperor had been
able to control his famous temper in the past when the
situation warranted. Eusebius of Caesarea, in his essay
on Constantines life published after the emperors

2. Un pauvre homme qui ttonnait in the famous judgment of


A. Piganiol, lEmpereur Constantin, Paris, 1932, p. 226.
3. A noteworthy exception is O. Norderval, The Emperor Constantine
and Arius: Unity in the Church and Unity in the Empire, in Studia
Theologica, 42, 1988, pp. 113-150, who discusses problems with
earlier scholarship.
4. Athanasius, Apologia contra Arianos, 9; ed. H.G. Opitz, Athanasius
Werke, II, 4, Berlin, 1935-1940. The account is in a letter from bishops
at the Synod of Alexandria of 338. For the composition and date of
this work, see D. Gwynn, The Eusebians: The Polemic of Athanasius
of Alexandria and the Construction of the Arian Controversy,
Oxford, 1997, pp. 16-19; for this letter, ibidem, pp. 158-159.
5. Cf. D. Gwynn, The Eusebians, cit. (n. 4), p. 78: In the polemics of
Athanasius the true issue at stake is not his own behaviour, correct or
otherwise, but the greater theological controversy against which he
has set his trial.
6. For the circumstances, see H.A. Drake, Athanasius First Exile, in
Greek, Roman, and Byzantine Studies, 27, 1987, pp. 193-204.
7. Apologia ad Constantium Imperator, 12: (    
        


  ,Q - 0 6]\PXVLDN HG  Athanase dAlexandrie,
Deux apologies (SC, 56), Paris, 1987, p. 110.

AnTard , 22, 2014

death in 337, tells us of his mild reaction when imperial


statues were defaced by an angry mob an overt act of
lse majest8 and we will see below the conciliatory
overtures he made even to the heresiarch Arius. Eusebius
also tells us that Constantine prided himself on being a
PHUH VHUYDQW RI *RG DQG FRQVLVWHQWO\ GHHFWHG SUDLVH
of himself to the working of a higher power. According
to Eusebius, Constantine even blew up at a cleric who
went too far by predicting he would share rule over
the heavenly kingdom.9 Why, then, should Athanasius
assertion that both he and the emperor faced judgment by
a higher power have sent Constantine into a rage?
The answer lies in imperial ideology. It is easy to
forget that, although history remembers him as a Christian
emperor, as this incident shows Constantine thought of
himself as a Roman emperor who was also a Christian.
The difference is small, but profound. However commonplace it is to claim that Romans considered their emperors
to be gods, few other than a Caligula or a Nero actually
asserted such a claim. But Romans did consider their
HPSHURUV WR EH VDFURVDQFW  KRO\ JXUHV ZKR PHGLDWHG
for them with divine forces.10 For the better part of a
century before Constantine, emperors had asserted their
close ties to a powerful divinity as a proof of their right
to rule,11VRIRU&RQVWDQWLQHWRGHHFWSUDLVHIURPKLPVHOI
to a patron god in public meetings was not particularly
revolutionary. But it was one thing for Constantine to
describe himself as the subordinate of a higher authority,
quite another for Athanasius or anyone else to claim
equal standing before that authority. In legal matters, the

8. VC 3.4. Half a century later, both John Chrysostom (de statuis XXI, 11)
and Libanius (Or. XIX, 19) cited Constantines restraint in the aftermath
of Antiochs Riot of the Statues, on which see E. Soler, vque et
pasteurs Antioche sous lempereur Thodose : lengagement chrtien
dans la dfense de la cit aprs la sdition des statues (387), in Vescovi
e pastori in epoca teodosiana (Studia ephemeridis Augustinianum,
58), Roma, 1997, 2, pp. 461-467. On the symbolic meaning of statues,
P. Steward, The Destruction of Statues in Late Antiquity, in R. Miles
(ed.), Constructing Identities in Late Antiquity, New York, 1999,
pp. 159-189; H. Saradi-Mendelovici, Christian attitudes toward Pagan
monuments in Late Antiquity and their legacy in later Byzantine
centuries, in DOP, 44, 1990, pp. 47-61.
9. VC 4.29, 4.48.
10. F. Millar questioned the role imperial divinity played in The Imperial
Cult and the Persecutions, in W. den Boer (ed.), Le culte des souverains
dans lEmpire romain (Fond. Hardt, Entretiens, 19), Genve,
1972, pp. 143-165. See also A. Wallace-Hadrill, Civilis princeps:
between citizen and King, in JRS, 72, 1982, pp. 32-48; F. Kolb,
Herrscherideologie in der Sptantike, Berlin, 2000; C. Norea,
Imperial Ideals in the Roman West: Representation, Circulation, Power,
Cambridge, 2011; P. van Nuffelen, Rethinking the Gods. Philosophical
Readings of Religion in the Post-Hellenic Period, Cambridge, 2011.
11. See A. D. Nock, A Diis Electa: A Chapter in the Religious History of
the Third Century, in Harvard Theological Review, 23, 1930, pp. 251274; Idem, The Emperors Divine Comes, in JRS, 37, 1947, pp. 102-116;
J. B. Rives, The Decrees of Decius and the Religion of Empire, in JRS,
89, 1999, pp. 135-154; M. Meier, Gttlicher Kaiser und christlicher
Herrscher? Die christlichen Kaiser der Sptantike und ihre Stellung zu
Gott, in Das Altertum, 48, 2003, pp. 129-160.

AnTa rd , 2 2 , 2 0 1 4

NICAEA TO TYRE (325-335): THE BUMPY ROAD TO A CHRISTIAN EMPIRE

emperor was not just the highest authority; he was also the
QDO authority. Therefore, when Athanasius asserted that
there was a power that would judge between himself and
Constantine, he was not merely committing a breach of
court etiquette; in a very real sense, he was undermining
centuries of Roman legal tradition.
There is another aspect to this imperial ideology that
must be taken into account when assessing the relationship
between Constantine and the Church in these years. For
the divine connection mediated by the emperor to be fully
effective, it was essential that everyone in Romes vast
empire validate the emperors efforts through universal
recognition of his prerogatives. This requirement goes a
long way toward explaining the persecutions Christians
began to endure in the middle of the third century. Given
the importance assigned to divine support by Christians
and pagans alike during this period, insuring this
consensus amounted to what today we would call a matter
of national security.12
We can be sure that Constantine was not unaware
of the importance of both divine support and universal
consent. In a letter that he wrote shortly after seizing
control of the eastern half of the emperor from his brotherin-law Licinius, Constantine states that he had two goals
LQ XQGHUWDNLQJ WKLV FDPSDLJQ7KH UVW ZDV WR XQLWH WKH
SURSHQVLW\  RI DOO SHRSOHV  
WRDVLQJOHXQGHUVWDQGLQJ ZLWKUHJDUG
WRGLYLQLW\  WKHVHFRQGWREULQJKHDOLQJWRWKH
FRPPRQZHDOWK  13 I will return
to this letter in section III below. First, another question
needs to be addressed: why have the wider meanings
that this study will bring to Constantines intentions with
regard to the Christian church been so hard to perceive in
documents wherein he explains his plans and intentions?

I
There was another participant in the confrontation
between Constantine and Athanasius, albeit one who
we can only see, as usual, in the shadows. Eusebius of
Caesarea was part of the delegation of bishops from
the Council of Tyre that travelled to Constantinople
WR SUHVHQW LWV QGLQJV WR WKH HPSHURU$V WKH DXWKRU RI
DQ LQXHQWLDO HVVD\ On the Life of the Blessed Emperor
Constantine (de vita Constantini, hereafter VC), Eusebius
holds priority of place in the history of Constantine schol-

12. H. A. Drake, The Church, Society and Political Power, in F. Norris,


F. Cassaday (eds), The Cambridge History of Christianity, 2, Cambridge,
2007, pp. 403-428.
13. VC 2.65.1 (see next note).

45

arship.14 Although this November encounter is the most


likely time for him to have delivered one of the speeches
to Constantine that he appended to the VC,15 Eusebius
KDV QRWKLQJ VSHFLF WR VD\ DERXW WKH FRQWURYHUV\ WKDW
brought him to the court, and he takes no notice of the
circumstances of Athanasius exile. Nevertheless, his VC
remains an important witness to the events of this era,
both for the documents it contains and even more for
WKHLQXHQFHKLVSUHVHQWDWLRQRI&RQVWDQWLQHKDVKDGRQ
subsequent scholarship. Eusebius is in large part responsible for the premise that Constantines interests and those
of the Church were perfectly aligned. His writings created
the impression of an emperor whose every action was
devoted to what Norman Baynes once called the triumph
of Christianity and the union of the Roman state with the
Christian Church.16
Just as with Athanasius, scholars have learned to
look more critically at Eusebius writings, for it is now
evident that Eusebius had motives of his own that need to
be taken into account before using either the documents
his work contains or the hermeneutic shell in which he
encased them. For present purposes, two traits are particuODUO\ LPSRUWDQW 7KH UVW LV WKH SRZHUIXO XQLI\LQJ YLVLRQ

14. For the text, see F. Winkelmann (ed.), ber das Leben des Kaisers
Konstantins, Eusebius Werke 1, 1, 2d ed., Berlin, 1975; P. Drger
(ed. and German trans.), ber das Leben des glckseligen Kaisers
Konstantin, 2d ed., Oberhaid, 2007. A French translation by L. Pietri,
M. J. Rondeau, Eusbe de Csare, Vie de Constantin (SC, textes grecs,
559), Paris, 2013, and another German translation by B. Bleckmann,
H. Schneider, ber das Leben Konstantins (Fontes Christiani, 83),
Turnhout, 2007, both provide the Winkelmann text. For an English
translation and commentary: A. Cameron, S. Hall, Life of Constantine,
2[IRUG  2Q (XVHELXV LQXHQFH $ 0RPLJOLDQR Pagan and
Christian Historiography in the Fourth Century A.D., in Idem (ed.),
7KH &RQLFW %HWZHHQ 3DJDQLVP DQG &KULVWLDQLW\ LQ WKH )RXUWK
Century, Oxford,1963, pp. 79-99; M. Amerise, (XVHELRIUDVWRULRJUDD
e teologia politica: limperatore cristiano dalla Storia Ecclesiastica
agli scritti costantiniani, in Adamantius, 16, 2010, pp. 52-62. See also
A. Johnson, J. Schott (eds), Eusebius of Caesarea: Traditions and
Innovations, Washington (D.C.), 2013.
15. At VC 4.33, Eusebius writes of a speech on the Saviors tomb that he
delivered in Constantines presence; the most likely circumstances are
when he traveled to Constantinople with other bishops from the Council
of Tyre. A speech that survives as chs. 11-18 of another speech Eusebius
appended, which he delivered in Constantinople on the occasion of
Constantines Tricennial celebration, seems to be this one, but there is
some disagreement over its origin and circumstances. P. Maraval, Sur
un discours dEusbe de Csare (Louange de Constantin, XI-XVIII),
in RAug, 43, 1997, pp. 239-246, at 244, thinks it a speech written
for the Tricennalia and delivered at about the same time as Eusebius
other speech. T.D. Barnes, Two Speeches by Eusebius, in Greek, Roman
and Byzantine Studies, 18, 1977, pp. 341-345, concluded that it is
one of the speeches Eusebius delivered at the Council of Jerusalem,
appended in error by Eusebius posthumous editor. In The Orations of
Constantine and Eusebius, Eusebius Werke I, 2, Berlin, forthcoming
2015, I agree that it originated as a Jerusalem speech but conclude that
LWZDVPRGLHGE\(XVHELXVKLPVHOIIRUGHOLYHU\EHIRUH&RQVWDQWLQHLQ
November and then again for the VC.
16. In Constantine the Great and the Christian Church, 2d ed., London,
1972, p. 83, n. 57. Originally published as The Raleigh Lecture of 1929,
in Proceedings of the British Academy, 15, London, 1929, pp. 341-442.

46

AnTard , 22, 2014

HAROLD A. DRAKE

with which he organized his subjects. In the case of his


pathbreaking Ecclesiastical History, this was his image
of an orthodox church that, from the beginning, could be
clearly distinguished from others that were always known
to be heretical. This image was not seriously questioned
until the past century, but scholars are now inclined instead
to see a number of equally valid local traditions out of
which a more dogmatic orthodoxy only slowly emerged.17
The implications of this shift have not yet percolated
through to Constantine studies. When Baynes wrote, the
important question that he addressed was the sincerity
of Constantines conversion. But this question has been
largely resolved,18 and in light of this newer scholarship
LW LV QR ORQJHU VXIFLHQW WR SRVLW WKDW WKH RQO\ W\SH RI
Christianity available to Constantine was a single, revolutionary faith, implacably opposed to traditional religion and
wholeheartedly devoted to its extermination by whatever
means available. Now, the important task is to identify the
type of Christianity to which Constantine converted.
7KH VHFRQG ZD\ LQ ZKLFK (XVHELXV LQXHQFHG
Constantine studies has been, if anything, even more
VLJQLFDQW ,Q KLV VHOISUHVHQWDWLRQ (XVHELXV SRVHG LQ
the VC as a virtual alter ego for the emperor, and for
generations scholars took him at his word. The effect
on scholarship was to homogenize Constantine and
Eusebius, with little attention paid to ways in which the
emperors own agenda might have deviated from what
(XVHELXV VDLG LW ZDV %XW LQ  7' %DUQHV VLJQLcantly downplayed Eusebius role, arguing for instance
that there are only four known occasions when Eusebius
and the emperor met. While this number should be taken
as a safe minimum rather than an absolute maximum, it
still means that Eusebius no longer can be considered a
chief architect of Constantines religious policy, and that
his assertions about that policy need to be scrutinized
more closely, especially when Constantines own writings
contradict them.19

17. The pathbreaking study was W. Bauer, Rechtglubigkeit und Ketzerei


im ltesten Christentum, Tbingen, 1934. For a useful discussion, see
K. L. King, Which Early Christianity?, in S. Harvey, D. Hunter (eds),
The Oxford Handbook of Early Christian Studies, Oxford, 2008, pp. 667KHFKDQJHLVUHHFWHGLQWKHRUJDQL]DWLRQRI00LWFKHOO)<RXQJ
(eds), The Cambridge History of Christianity, 1, Cambridge, 2006,
with sections devoted to The Jesus Movements and Community
7UDGLWLRQVDQG6HOIGHQLWLRQ
18. Viz. K. Piepenbrink, Konstantin der Groe wendet sich nicht dem
Christentum zu, in K. Brodersen (ed.), Virtuelle Antike, 2000, pp. 133149. Repr. in H. Schlange-Schningen (ed.), Konstantin und das
Christentum, Neue Wege der Forschung, Darmstadt, 2007, pp. 245-261.
19. T.D. Barnes, Constantine and Eusebius, Cambridge (Mass.), 1981, p. 266.
7KHHDUOLHUYLHZLVUHHFWHGLQWKHth c. writer Reginald Pecock, who
described Eusebius as being as privy with Constantine in the councils
of his heart and of his conscience, as a confessor, quoted in D. Webb,
The truth about Constantine: history, hagiography and confusion, in
K. Robbins (ed.), Religion and Humanism (Studies in Church History,
17), Oxford, 1981, pp. 85-102, at p. 97 (I have modernized the spelling).
Av. Cameron has observed that claims to special knowledge are typical

II
Efforts to unravel the tight bond Eusebius wove
between himself and the emperor in the VC have periodically led to accusations of forgery and fraud, but these have
usually failed to convince.20 A more nuanced approach has
been to pay closer attention to omissions and silences in
Eusebius account: as the Abb Duchesne observed long
ago, the VC represents le triomphe de la rticence et de
la circonlocution.21 Eusebius silence extends back to the
beginning of this last period of Constantines reign. The
bishop avoided mention of his own provisional ban from
the proceedings at the Council of Nicaea, and instead of
discussing the theological issue that led Constantine to
summon the synod focused on ceremonial aspects of the
occasion and what he portrayed as Constantines conciliatory manner. Eusebius does, however, include a letter
that Constantine wrote to the two principals, Arius and
his bishop, Alexander of Alexandria, in an early effort to
bring an end to the dispute.22
The letter has long been derided for its apparent
ignorance of the theological implications underlying
the controversy.23 Among other things, Constantine
LV UHSHDWHGO\ GLVPLVVLYH RI WKH VLJQLFDQFH RI WKH
disagreement over the relationship of the Son to the
)DWKHU FDOOLQJ LW ZRUWKOHVV  9&   D
PHUH YHUEDO YDQLW\    
9&   WULYLDO DQG HQWLUHO\ XQLPSRUWDQW 
   9&   UHDOO\ VLOO\ 

in panegyrical writing. See Eusebius of Caesarea and the rethinking


of History, in E. Gabba (ed.), Tria Corda: Scritti in onore di Arnaldo
Momigliano, Como, 1983, pp. 71-88, at 83-84.
20. Most memorably by Jacob Burckhardt in Die Zeit Constantins
des Grossen, Basel, 1853, p. 346: durch und durch verflscht;
H. Grgoire questioned the authenticity of the VC in Eusbe nest pas
lauteur de la Vita Constantini dans sa forme actuelle, et Constantin
ne sest pas converti en 312, in Byzantion, 13, 1938, pp. 561-583.
The argument for fraud in this case, perpetrated by Eusebius
himself was revived by T.G. Elliott, Eusebian frauds in the Vita
Constantini, in Phoenix, 45, 1991, pp. 162-171; see also Idem, The
Christianity of Constantine the Great, Scranton, PA, 1997.
21. Histoire ancienne de lglise, 4th ed., Paris, 1910, p. 191. M. Walraff,
Constantines Devotion to the Sun after 324, in Studia Patristica, 34, 2001,
SLGHQWLHGWKUHHZD\VLQZKLFK(XVHELXVGHDOWZLWK&RQVWDQWLQHV
XVHRIVRODUV\PEROLVPUVWWRJLYHD&KULVWLDQLQWHUSUHWDWLRQZKHUHYHU
possible; second, to imply a connection by description without further
comment; third, where even a mere description was too offensive for
Christian readers, he passed over it in silence.
22. VC 2.64-72. For his account of the Council of Nicaea, see VC 3.622. S. G. Hall, Some Constantinian documents in the vita Constantini,
in S. Lieu, D. Montserrat (eds), Constantine: History, Historiography
and Legend, London 1998, pp. 86-103, argues that the letter actually
was sent to a council and not the two addressees.
23. Gibbon has a typically acerbic comment: As he was yet ignorant of
WKHGLIFXOW\RIDSSHDVLQJWKHTXDUUHOVRIWKHRORJLDQVKHDGGUHVVHG
to the contending parties, to Alexander and to Arius, a moderating
epistle; which may be ascribed, with far greater reason, to the
untutored sense of a soldier and statesman than to the dictates of any
of his episcopal counsellors. In J. Bury (ed.), The Decline and Fall
of the Roman Empire, 2, London, 1909, p. 376.

AnTa rd , 2 2 , 2 0 1 4

NICAEA TO TYRE (325-335): THE BUMPY ROAD TO A CHRISTIAN EMPIRE

 9&   D FRPSOHWH ZDVWH RI UHVRXUFHV


9& %XWLQGLIference rather than ignorance might be the better way to
understand these comments, since the emperor knows
(and uses as part of his argument) that the topic in dispute
LVRQHWKDWIHZDUHFDSDEOHRIXQGHUVWDQGLQJ 
       
9& 
Instead, these comments should serve as an
indication that Constantine had a different set of
priorities. A hint of what those priorities were comes
at VC 2.69.2, where the emperor explains to Alexander
and Arius that their dispute is not important because no
ODZUHTXLUHVLW  
As Ramsay MacMullen has observed, the statement
reveals the cultural gulf that divided the empire into
west and east, symbolized by emphasis of legal over
philosophical training in Latin education.24 But the
statement has an even broader intent: it indicates that
Constantine was trying to make a distinction between
what today we would call the public role of the state
religion he intended Christianity to be and a private
Christianity that its adherents could continue to pursue
on their own.25 That is to say, he wanted the disputants
to understand that the new role their religion was going
WRSOD\LQWKHVWDWHGLGQRWUHTXLUHWKHNLQGRIVSHFLF
GLVWLQFWLRQVDQGGHQLWLRQVWKDWWKH\ZHUHDUJXLQJRYHU
For this reason, he points out, he has no intention of
IRUFLQJWKHPWRDJUHHRQDOOSRLQWV 
   9&   $ VWDQGDUG &KXUFK
history account would take this promise to respect
private thought as merely a further sign of the navet
of which he would be disabused by the Council of
Nicaea. But such a church-oriented standard also makes
the emperors shifting loyalties in the years subsequent
to the Council of Nicaea, culminating in the exile of
Athanasius, appear to reveal an erratic temperament
and a gullible nature. By taking this sentence instead
as an expression of Constantines goal for a public
Christianity, those shifts appear much more consistent.
One important characteristic of this letter should not
be overlooked. This is the collegial tone Constantine
adopts. Absent is any of the scolding characteristic of
OHWWHUV GHDOLQJ ZLWK WKLV FRQLFW WKDW KH ZRXOG ODWHU
write; instead, he appeals to the clerics sense of duty,
urging them keep their dispute out of public hearing
  9&   ZKHUH LW ZRXOG VLPSO\

24. Voting About God in Early Church Councils, New Haven, 2006, p. 28.
25. Such a distinction is not as impossible as it once might have seemed.
See K. Bowes, Private Worship, Public Values, and Religious Change
in Late Antiquity, Cambridge, 2008, who, however, does not distinguish
between Constantines creation of a public religion and his expectation
that a private religion would continue.

47

create confusion.26 Repeatedly, Constantine refers to


KLPVHOIDVDIHOORZVHUYDQW ZLWKWKHWZR
clerics.27 It is a pose that Constantine frequently adopts,
perhaps most famously when he claimed to a group of
bishops that he, too, was a bishop of those outside.28
Scholars have fretted over this phrase, and the amount
of power it conceded to bishops.29 The confrontation
between Constantine and Athanasius with which this
study began cautions against such a conclusion. His
reaction to Athanasius challenge shows that Constantine
did not think he was surrendering any of his prerogatives as emperor when he made such assertions. There
is a better way to understand his meaning. As Ramsay
MacMullen concluded when he surveyed decisionmaking in church councils, bishops relied on the Senate as
a model for how they should conduct their proceedings.30
Similarly, we should understand Constantines gestures
as a way to establish with bishops something akin to the
relationship emperors had had with the Roman Senate
during the Principate a time when emperors enjoyed
FDVWLQJ WKHPVHOYHV DV PHUHO\ UVW DPRQJ HTXDOV LQ WKDW
governing body. Thus, the tone of this letter suggests the
role Constantine projected for clergy in this new settlement.31 Far from being a nave and careless response,
Constantines letter to Alexander and Arius proves to be
one of the most important documents for understanding
this last decade of his rule.

26. For the novelty of taking this controversy to the streets see C. GalvoSobrinho, Doctrine and Power: Theological Controversy and Christian
Leadership in the Later Roman Empire, Berkeley, 2013.
27. Viz. VC 2.69.2, 2.72.1, 2.72.2.
9&FI
(XVHELXVRZQFRPPHQWDW9&WKDW&RQVWDQWLQHDFWHG

29. On the phrase: W. Seston, Constantine as a Bishop, in JRS, 37,
1947, pp. 127-131; H. Kraft, Kaiser Konstantin und das Bischofsamt,
in Saeculum, 8, 1957, pp. 32-42; J. Straub, Constantine as 
: Tradition and innovation in the representation of the
UVW &KULVWLDQ (PSHURUV 0DMHVW\, in DOP, 21, 1967, pp. 39-55;
P. G. Caron, Constantin le Grand    de lglise
romaine, in RIDA, 22, 1975, pp. 179-188; D. de Decker, G. DupuisMasay, Lpiscopat de lempereur Constantin, in Byzantion, 50,
1980, pp. 118-157; K. M. Girardet, Das christliche Priestertum
Konstantins d. Gr. Ein Aspekt der Herrscheridee des Eusebius von
Caesarea, in Chiron, 10, 1980, pp. 569-592; P. Athanassiadi, Vers la
pense unique : la mont de lintolrance dans lAntiquit tardive,
Paris, 2010, p. 74.
30. Voting About God, cit. (n. 24), p. 18.
31. Constantines controversial grant of judicial powers to bishops could
SURWDEO\EHUHDGLQWKHVDPHOLJKW2QWKLVSUREOHPVHH-*DXGHPHW
Lglise dans lEmpire romain (e-e s.), Paris, 1958, pp. 231-287;
J. Lamoreaux, Episcopal Courts in Late Antiquity, in Journal of
Early Christian Studies, 3, 1995, pp. 143-167; N. Lenski, Evidence
for the audientia episcopalis in the New Letters of Augustine, in
R. Mathisen (ed.), Law, Society, and Authority in Late Antiquity, New
York, 2001, pp. 83-97. I argue for a social purpose underlying these
actions in Constantine and the Bishops: The Politics of Intolerance,
Baltimore, 2000, pp. 309-352.

48

HAROLD A. DRAKE

III
Given the importance of Constantines letter to
Alexander and Arius for identifying the contours of the
relationship he was building with the Christian clergy, one
part of the appeal he makes to the two clerics deserves
special notice. As part of his argument, the emperor points
out that it is impossible for all of us to think the same
about everything or that a single nature or opinion
rule among us.32 Instead, he asks the clerics to exercise
IRUEHDUDQFH 9& LQWKHLUGHDOLQJVZLWK
each other. This argument is an indication of the type of
Christianity Constantine wished to foster. The ancients
had no word that equates exactly with our modern notion
of toleration as a legal suffrance formally granted by
the state, or (with rare exception) as a principle to be
embraced for its own sake,33 and Constantine scholars
have often assumed, to the contrary, that his conversion, if
it was sincere, must have determined him to eradicate the
traditional religions of the state.34 Yet it stands to reason
that an argument for diversity and forbearance must entail
a willingness to put up with views and practices that differ
from ones own.
How far did Constantines belief in forbearance
extend? As already noted (above, p. 45), Constantine
told the clerics at the start of his letter that he had set
WZRJRDOVIRUKLPVHOIUVWWRHVWDEOLVKDVLQJOHXQGHUstanding regarding divinity; second, to heal a stricken
commonwealth. He went on to say that he prayed to meet
these goals by establishing a common agreement among
all the servants of god so that the conduct of public
affairs would enjoy a change concurrent with the pious
sentiments of all.35 Since he was writing to Christian
clerics, scholars have typically limited the force of these
words to his co-religionists. If so, then his advice to the
two clerics to recognize diversity and practice forbearance
must also be understood as a further indication that the
public role he envisioned for Christianity entailed a much
wider range of acceptable thought and behavior than

9&

33. L. Field Jr., Liberty, Dominion, and the Two Swords: On the
Origins of Western Political Theology (180-398), Notre Dame (Ind.),
1998, p. 66, refers to the application of terms such as toleration
RU SOXUDOLVP WR WKLV SHULRG DV DQ DQDFKURQLVP >@ GHQHG E\
modern presuppositions. For contemporary terminology, M. Kahlos,
Forbearance and Compulsion: The Rhetoric of Religious Tolerance
and Intolerance in Late Antiquity, London, 2009.
34. Viz. N. H. Baynes, Constantine, in S.A. Cook et al. (eds),
The Cambridge Ancient History, 12, Cambridge, 1939, p. 686:
Constantines ideal State would be hampered by no fetters of
toleration. The most vigorous contemporary exponent of this position
is T.D. Barnes. From his numerous writings, see, e.g., Constantine:
Dynasty, Religion and Power in the later Roman Empire, Chichester,
2011, p. 210.
35. VC 2.65.1.

AnTard , 22, 2014

subsequently became the norm. Hence his assurance that,


so long as the limited needs of his public Christianity
were met, he believed that religious specialists like
Alexander and Arius should be free to pursue their more
theoretical speculations in private. But an as-yet underutilized source suggests that Constantines forbearance
extended to non-Christians as well.
As an appendix to the VC, Eusebius of Caesarea
included a speech that has been given the title Oration
to the Saints (Oratio Constantini ad coetum sanctorum,
hereafter OC).36 It is a seemingly rambling discourse that
may be analyzed into three parts loosely termed philosophical or theological (chs. 1-15), exegetical (16-21),
and historical (22-26). According to one estimate, it would
have taken about two hours to deliver.37 Its audience
appears to have included both clergy and laity.38
Doubts about the speechs authenticity prevented
scholars from making much use of it until relatively
recently, and there continues to be much disagreement
about its genre and purpose. Attempts to assign it a date
have varied widely between 312 and 328; I have myself
expressed a preference for a date around 325, which
would make the speech roughly contemporaneous with
the emperors letter to Alexander and Arius, but it is
worthwhile to bear in mind that Eusebius appended it as
an example of the emperors constant efforts to conduct
a rational discourse on the value of Christian belief.39
The speech presents a number of novelties, including
WKH UVW VXUYLYLQJ &KULVWLDQ UHDGLQJ RI 9HUJLOV )RXUWK
Eclogue.40 For present purposes, two chapters are particularly important.
In chapter 13, Constantine makes a mocking response
to certain critics who believe God should have made one
and the same nature for all, rather than the different
customs and principles that characterize humanity.

36. Text with German translation: K. M. Girardet, Konstantin, Oratio ad


Sanctorum Coetum, Rede an Die Versammlung der Heiligen, Freiburg
im Breisgau, 2013. French trans.: P. Maraval, Constantin, Lettres
et discours, Paris, 2010; Eng. trans.: M. Edwards, Constantine and
Christendom: The Oration to the Saints, the Greek and Latin Accounts
of the Discovery of the Cross, the Edict of Constantine to Pope
Silvester (Translated Texts for Historians, 39), Liverpool, 2003. On
Constantines intent, see also J. Schott, Christianity, Empire, and the
Making of Religion in Late Antiquity, Philadelphia, 2008, pp. 134-135.
37. R. Lane Fox, Pagans and Christians: Religion and the Religious Life
from the Second to the Fourth Century A.D., New York, 1987, p. 628.
 $W 2&  &RQVWDQWLQH UHIHUV WR    
       
     )RU WKH VLJQLFDQFH RI WKLV SKUDVH
see T.D. Barnes, Constantines Speech to the Assembly of the Saints:
Place and Date of Delivery, in Journal of Theological Studies, 52,
2001, pp. 26-36, at p. 34.
 9&        $W
VC 4.29, Eusebius writes of Constantines desire to base his rule on
rational arguments.
40. OC 19-21. See P. Courcelle, Les exgses chrtiennes de la quatrime
Eclogue, in REA, 59, 1957, pp. 294-319.

AnTa rd , 2 2 , 2 0 1 4

NICAEA TO TYRE (325-335): THE BUMPY ROAD TO A CHRISTIAN EMPIRE

49

People who think this way, he says, are immature


 WKHLU FULWLFLVPV HQWLUHO\ ODXJKDEOH
  6XFK SHRSOH PLJKW MXVW DV ZHOO
complain about the arrangement of the universe and refuse
to accept the nocturnal succession, wanting daylight to last
forever or be annoyed at the limits of land and ocean.
Instead of uniformity, he continues, God gave humans the
ability to reason, and with it the responsibility to choose
between good and evil, and to anticipate an afterlife of
rewards and punishments. Constantine does not identify
the critics to whom he addresses these remarks, but given
the diversity that he encouraged Alexander and Arius to
accept, it would be a mistake to think only non-Christians
were his target. A generation later, the philosopher-orator
Themistius would use the same argument in a speech to
the emperor Jovian.41
In chapter 23, Constantine addresses another unnamed
opponent, this one being one of the persecuting emperors,
whom he challenges to Measure our religion against
yours. Here he aims to draw a contrast between Christian
behavior and that of the persecutors, calling attention to
&KULVWLDQLW\V LQQDWH FRQFRUG   DQG
benevolence, which he contrasts with the cruelty of the
persecutors. Christians do not execute those who err, he
observes, but admonish them to lead a virtuous life so as
to receive their eternal reward. For surely, he adds, he
who confesses God does not become subject to violence or
anger, but considers nobly bearing the trial of his patience
a necessary provision for Gods favor (OC 23.2).
In itself this argument is unexceptional, but the
FRQWH[W PDNHV LW VLJQLFDQW ,I &RQVWDQWLQH ZHUH RQH RI
those Christian voices memorably described by Arnaldo
Momigliano as shrill with implacable hatred,42 he might
have devoted his comparison to the greater power of the
Christian god or the resistance of the martyrs. Instead, by
emphasizing Christianitys nurturing nature and capacity
for forgiveness, Constantine promoted those aspects of
the religion that were most compatible with his goal of
uniting and healing the empire. Other parts of the oration
point in the same direction. In ch. 15, for instance, he
praises as heavenly wisdom the way Christians suffer
EXW GR QRW LQLFW LQMXU\ DQG LQ D SDUWLFXODUO\ WHOOLQJ
comment he praises Christ for his innate benevolence
  DQG KLV FKRLFH WR IRUJLYH PHQ
their foolish notions rather than abuse his power to
SXQLVK 2&   *LYHQ WKH FORVH LGHQWLFDWLRQ LQ
Constantines thinking between himself and his deity, it

would be virtually impossible to make such an assertion


if he did not intend to do the same himself.43
Taken together with his Christian reading of Vergil and
favorable remarks about Plato (OC 9.5-7), this emphasis
on forbearance and diversity provides a clear answer to
the question of the type of Christianity that Constantine
wanted to promote as a public religion. It would be a
religion that met the security needs of the state by emphasizing similarities rather than differences, forgiveness
rather than punishment, and compromise rather than
resistance. As Eusebius wrote in the VC, However many
he saw responsive to a superior sentiment and endowed
with a sound and like-minded character he received
eagerly, showing that he himself rejoiced in the mutual
agreement of all. But those who stayed unyielding he
turned away from (1.44.3). Eusebius was referring to
disagreement among Christians but his observation has
wider implications.
There was one drawback to Constantines plan for
a Christian public religion: it required him to speak in
generalities. Then as now, this was the best way to secure
agreement among the largest possible number, but it also
DOORZHGIRUVLJQLFDQWPLVXQGHUVWDQGLQJEHWZHHQSHRSOH
using the same words to mean different things.

Imperial ideology, especially the need for


universal consent, explains Constantines seemingly
erratic behavior in the tug-of-war between Arius and
Athanasius that occupied the decade between Nicaea
and Tyre. Almost immediately after sending Arius into
exile, the emperor began encouraging the presbyter to
purge himself of heresy and return to the Christian fold.
After personally interviewing Arius in 328, Constantine
SURQRXQFHG KLPVHOI VDWLVHG DQG ZURWH %LVKRS
Alexander, urging him to reinstate the prodigal priest.44
Yet only a handful of years later the emperor shifted
ground, publicly excoriating Arius while praising to the
skies Athanasius, who had succeeded to the episcopate
of Alexandria following Alexanders death in 328. The
year 333 produced another shift. Despite his praise of
Athanasius only a year earlier, Constantine reversed
himself once again, authorizing a synod to look into the
charges against Athanasius and opening the door for

41. H. A. Drake, Constantinian Echoes in Themistius, in Studia


Patristica, 34, 2001, pp. 44-50.
42. A. Momigliano, Pagan and Christian Historiography, cit. (n. 14),
p. 79 (referring to Lactantius De mortibus persecutorum).

43. On this point, see further H.A. Drake, Policy and Belief in
Constantines Oration to the Saints, in Studia Patristica, 19, 1989,
pp. 43-51.
44. Gelasius, Historia ecclesiastica. 3.15, ed. H.G. Opitz, Urkunden zur
Geschichte des Arianischen Streites, 318-328, Athanasius Werke, III,
1, Berlin, 1934, Urk. 32.

IV

50

HAROLD A. DRAKE

Arius to be readmitted to communion, a decision that


ZDV UDWLHG LQ  E\ ELVKRSV ZKR KDG DVVHPEOHG LQ
Jerusalem to dedicate Constantines Church of the Holy
Sepulchre. Months later, he sent Athanasius into exile
following the episode with which this study began.45
Constantines plan for a public Christianity underlies
these apparent shifts. Arius himself triggered the
emperors volte-face on Athanasius. Still not restored to
communion, the presbyter sought to force Constantines
hand by taking his case back to the streets of Alexandria,
thereby provoking a diatribe from the emperor and an edict
ordering his works burned.46 But Constantine continued to
urge Arius to return to the fold, and probably in 333 Arius
and his fellow exile Euzoius produced a statement of
their faith that once again put him in Constantines good
graces.47 It reads, in part:

AnTard , 22, 2014

This confession of faith is one further indication


of Constantines priorities. It completely sidestepped
the issues raised at Nicaea, not once mentioning the
lightning-rod term homoousios, for instance. But the
QDO VHQWHQFH ZKLFK , KDYH LWDOLFL]HG VKRZV WKDW
$ULXV KDG QDOO\ OHDUQHG WKH IRUPXOD IRU JDLQLQJ
Constantines support. By claiming that their only wish

ZDVWRDYRLGVXSHUXRXV TXHVWLRQV
and participate in universal prayers for the empire
and Constantines dynasty, Arius and Euzoius adopted
precisely the program Constantine urged in his letter
RI  7KHLU VWDWHPHQW PD\ EH SURWDEO\ FRPSDUHG
with the prayer Eusebius tells us Constantine ordered
non-Christians in his army to recite every Sunday, as
well as with those that were offered up in 335 at the
dedication of the Holy Sepulchre in Jerusalem. In both,
emphasis was placed on common prayers for the empire
and Constantines dynasty.49
This language explains Constantines reaction.
But Arius alone could not have been responsible for
Constantines shifting sentiment for Athanasius. What
probably allowed the bishop to negotiate successive
interviews with the emperor was Constantines strong
penchant for a religious vocabulary that stuck to generalities and platitudes. As his account of the activities
RI WKH JURXS KH FDPH WR FDOO WKH (XVHELXV FURZG 
  DW 1LFDHD VKRZV$WKDQDVLXV NQHZ WKDW
imprecise words were capable of more than one meaning.50
Such conditions would explain how Constantine could
believe Athanasius had agreed to accept people like Arius
into communion, and how the bishop could agree with
the emperor and yet pick up exactly where he left off
upon his return to Alexandria. In other words, we need to
think that, to the emperor, the charges against Athanasius
were never more than a means to an end: whenever he
believed the bishop, like Arius, had come to understand
the difference between public and private criteria, he was
quite willing to let the charges against him go away, and
just as willing to reinstate them when Athanasius failed to
carry through on his promises.
In order to maintain pressure on Athanasius,
Constantine also had to negotiate with those bishops
who believed Arius should be re-instated and the
Alexandrian bishop put on trial. The substance of those
negotiations can be teased out of a letter Constantine
sent to the bishops at Tyre, included by Athanasius in

45. For a full treatment of these events, see R. P. C. Hanson, The Search
for the Christian Doctrine of God: The Arian Controversy, 318-381,
Edinburgh, 1988; T.D. Barnes, Athanasius and Constantius: Theology
and Politics in the Constantinian Empire, Cambridge (Mass.), 1993,
pp. 19-33; D. Gwynn, The Eusebians, cit. (n. 4); C. Galvo-Sobrinho,
Doctrine and Power, cit. (n. 26).
46. Constantines edict is in Socrates, H. E. 1.9, ed. Opitz, cit. (n. 44),
Urk. 33. His letter is in Gelasius, H.E. 3.19, ed. Opitz, Urk. 34.
47. Socrates, Historia ecclesiastica 1.26, ed. Opitz, cit. (n. 44), Urk. 30.
Opitz placed the letter in late 327 but more recent scholars have
preferred 333. See D. Gwynn, The Eusebians, cit. (n. 4), p. 187.
Socrates precedes this letter with one from the emperor urging Arius
to purge himself of the heresy that led to his exile: H.E. 1.25, ed.
Opitz, Urk. 29.
48. Trans. A. C. Zenos, Socrates Scholasticus, Church History, A.D. 205439, in P. Schaff, H. Wace (eds), Nicene and Post-Nicene Fathers,
2d ser., II, New York, 1890, pp. 28-29.

49. At VC 4.19, Eusebius gives the prayer Constantines non-Christian


soldiers recited in which they thanked the only God for their victories
and blessings, at the end of which they prayed: To you we all come to
supplicate for our Emperor Constantine and for his Godbeloved Sons:
That he may be kept safe and victorious for us in long, long life. At
VC 4.45.2, he writes that bishops celebrating the dedication of the
Holy Sepulchre offered up prayers for the general peace and for the
Church of God, for the Emperor himself, who was responsible for
such great things, and for his Godbeloved sons. Trans. A. Cameron,
S. Hall, Life of Constantine, cit. (n. 14), pp. 160, 170-171.
50. In De decr. 20, 1, ed. Opitz, cit. (n. 4), p. 16, Athanasius describes
the way the Eusebians signalled to each other at Nicaea to indicate
which terms they found acceptable. For the gradual development
of Athanasius language for his opponents, see D. Gwynn, The
Eusebians, cit. (n. 4), pp. 53-54, 114-115. On p. 82, Gwynn traces
WKHRULJLQRIWKHSKUDVHWRHYHQWVVXUURXQGLQJWKH
Council of Tyre.

We believe in one God the Father Almighty [they wrote]:


and in the Lord Jesus Christ his Son, who was begotten
of him before all ages, God the Word through whom all
things were made, both those which are in the heavens
and those upon the earth; who descended, and became
incarnate, and suffered, and rose again, ascended into
the heavens, and will again come to judge the living and
the dead...
Wherefore we beseech your piety, most devout emperor,
that we who are persons consecrated to the ministry, and
holding the faith and sentiments of the church and of the
KRO\6FULSWXUHVPD\E\\RXUSDFLFDQGGHYRWHGSLHW\
be reunited to our mother, the Church, DOO VXSHUXRXV
questions and disputings being avoided: that so both we
and the whole church being at peace, may in common
offer our accustomed prayers for your tranquil reign,
and on behalf of your whole family.48

AnTa rd , 2 2 , 2 0 1 4

NICAEA TO TYRE (325-335): THE BUMPY ROAD TO A CHRISTIAN EMPIRE

his account of the events with which this article began.51


Athanasius included the letter as proof that the emperor
believed the Council of Tyre had acted improperly, and
WKH UVW VHQWHQFHV RI &RQVWDQWLQHV OHWWHU GR LQGHHG
seem to support such a position: Constantine takes
H[FHSWLRQ WR WKH WXUEXOHQW GLVRUGHU  
RIWKHSURFHHGLQJVDQGTXHVWLRQVZKHWKHU
the bishops had acted impartially. But after these
sentences, the tone of the letter changes abruptly. Now
he appears to be taking pains to assure the bishops that
he had agreed to no more than to hear Athanasius in
the presence of his accusers. Making allowance for
Constantines by now familiar carrot-and-stick (or,
better, stick-and-carrot) style,52 the letter is curiously
defensive. It suggests that Constantine wanted to assure
the bishops that he had not violated a previous understanding he had reached with them. The terms of that
agreement must have been that he would not, this time,
attempt to broker a resolution by meeting privately with
Athanasius.53 After the reversals of the previous years,
it would have been prudent of the other bishops to seek
such assurances before agreeing to participate in a new
synod. Thus, far from validating Athanasius claim of
imperial support, the letter explains the circumstances
that led to his confrontation and exile.
Conclusion
A recent study of Constantines involvement in the
solar cult concluded with the observation that We can
probably assume correctly that he considered himself
a Christian, but what he understood by Christianity
was quite different from what we understand, and from
what even the contemporary theologians understood

51. Apologia contra Arianos, 86, ed. Opitz, cit. (n. 4), pp. 164-166.
For Constantines letter, see p. 86, 2-12. See further H.A. Drake,
Athanasius First Exile, cit. (n. 6).
52. Cf. Hanson, Christian Doctrine, cit. (n. 45), p. 258, regarding the
imperial bluster and abuse that preceded the distinctly conciliatory
attitude Constantine adopted in a letter to Arius and his companions.
For that letter, see Opitz, cit. (n. 4), Urk. 34. Constantines letters
have been conveniently collected in French translation in P. Maraval,
Constantin, Lettres et discours, cit. (n. 36).
53. There are problems reconciling this letter with the chronological
context in which Athanasius presents it; there is simply not enough
time, for instance, for it to have been dispatched and received by the
bishops in Tyre, and for them then to have travelled to Constantinople,
EHWZHHQ WKH GDWH &RQVWDQWLQH UVW HQFRXQWHUHG $WKDQDVLXV RQ
30 October and his exile seven days later. According to the ORBIS
website, the fastest journey between Tyre and Constantinople at this
time of year would have been by sea and taken 15 days; overland
travel by fast carriage would have taken about 22 days, by horse
relay about 7 days. See W. Scheidel, E. Meeks, ORBIS: The Stanford
Geospatial Network Model of the Roman World, retrieved 15 March
2014 from http://orbis.stanford.edu.

51

by Christianity.54 This statement shows just how far


the study of Constantines religiosity has moved since
1RUPDQ %D\QHV LQXHQWLDO 5DOHLJK OHFWXUH $W RQH
time, the emperors devotion to solar imagery was the
bte noir of the controversy over the sincerity of
his conversion: it had to be denied at all cost.55 Now,
there is little value in arguing that Constantines aim
during the last decade of his rule was the triumph of
Christianity without also looking into the type of
Christianity he sponsored.
Hence the value of the clash between Constantine and
Athanasius with which this study began. It is a reminder
that Constantine continued to think of himself as a Roman
emperor, and that imperial ideology must be taken into
account when assessing his religious objectives. It is
also a reminder not to take the emperors professions of
humility too seriously. To pursue the analogy with the
relationship between emperor and Senate (above, p. 47),
in this incident Athanasius, like the occasional senator
during the Principate, forgot that this gesture toward
equality was merely a pose.
0RUHVLJQLFDQWO\WKLVHSLVRGHGHPRQVWUDWHVLQYHU\
real terms that theology is a poor guide for understanding
Constantines objectives; however much these may
have overlapped with those of the bishops, there were
distinct differences, governed primarily by Constantines
understanding that the public religion of Rome had to
be all-inclusive; this in turn required a minimalist set of
conditions for membership, along the lines of those that
won Arius back into Constantines good graces: prayer to a
Supreme God and Savior Son for the empire and emperor.
It would appear that even supporters like Eusebius of
Caesarea found the standard Constantine wished to
apply unacceptably low. In one of the rare criticisms the
bishop allowed himself in the VC, Eusebius lamented
the emperors willingness to trust false Christians
 EHFDXVHWKH\SURIHVVHG
loyalty to him.56
While the confrontation between Constantine and
Athanasius in 335 allows us to see the advantage of
separating the emperors objectives from those of the
Church, it also helps us understand why Constantines
vision of a broadly inclusive church ultimately failed.
7KH EDVLV RI WKLV FRQLFW ZDV QRW WKHRORJ\ EXW ULYDO
understandings of the relative position of emperor
DQG ELVKRS LQ WKH GLYLQH FRXUW RI QDO DSSHDO ,Q WKLV

54. M. Wallraff, Constantines Devotion to the Sun after 324, in Studia


Patristica, 34, 2001, pp. 256-269, at p. 267. Cf. Idem, Konstantins
Sonne und ihre christlichen Kontexte, in K. Ehling, G. Weber (eds.),
Konstantin der Groe: Zwischen Sol und Christus, 2011, pp. 42-52.
55. For a recent example, see the heroic effort by T.D. Barnes to deny
the connection between Constantines statue in Constantinople and
the sun god Apollo in Constantine, cit. (n. 34), p. 23.
56. VC 4.54.3.

52

HAROLD A. DRAKE

sense, Athanasius represents the subversive power of


a religious hierarchy that would not surrender its own,
independent right of access to divinity.57 Hence, despite

57. I develop this problem in Intolerance, Religious Violence and


Political Legitimacy in Late Antiquity, in Journal of the American
Academy of Religion, 79, 2011, pp. 193-235.

AnTard , 22, 2014

the sincerity of Constantines conversion, at the end


of his reign the road to a Christian empire remained a
bumpy one. Nevertheless, by separating his priorities
from those of theologians his own road begins to look
a little straighter.
University of California, Santa Barbara

AnTard , 22, 201 4, p. 53


DOI 10.1484/J.AT.5.103173

2 ASPECTS DE LHISTOIRE ECCLSIASTIQUE


DEUSBE DE CSARE

La petite section monographique qui suit contient


le texte des quatre confrences qui furent prononces le
13 septembre 2012, la Maison de la recherche de ParisSorbonne, pour marquer la sortie du premier volume de
commentaire de lHistoire ecclsiastique dEusbe de
Csare aux Belles Lettres : S. Morlet, L. Perrone (dir.),
Eusbe de Csare. Histoire ecclsiastique. Commentaire,
1. tudes dintroduction (Anagg, 6), Paris, 2012.
Lide dcrire un commentaire de cette uvre
LPSRUWDQWHUHPRQWHjXQHUHQFRQWUHVFLHQWLTXHRUJDQLVpH
Pise le 10 juin 2004 pour clbrer les dix ans de formation
du Gruppo Italiano di Ricerca su Origene et la Tradizione
Alessandrina. Une quipe internationale sest constitue
SHXjSHXjSDUWLUGHHWDHQJDJpXQHUpH[LRQSUpSDUDWRLUHDXWUDYDLOGHFRPPHQWDLUH&HWWHUpH[LRQDGRQQp
lieu des publications sous forme darticles1.
Les chercheurs regroups autour du projet sont franais
(Sbastien Morlet, Olivier Munnich, Michel-Yves Perrin,
Jean-Marie Salamito), italiens (Osvalda Andrei, Antonio
Cacciari, Adele Monaci, Valerio Neri, Lorenzo Perrone,
Emanuela Prinzivalli) et suisse (ric Junod). Ont collabor
au volume introductif, en outre, Anne Boudhors, Matthieu
Cassin, Laetitia Ciccolini, Muriel Debi, Jean-Pierre Mah,
Giusto Traina. Il est prvu de faire paratre une version en
italien du commentaire, paralllement la version franaise.
La coordination du projet est assure par Sbastien Morlet
du ct franais, par Lorenzo Perrone du ct italien.

1. M. Amerise, Note sulla datazione del panegirico per linaugurazione


della basilica di Tiro (HE X, 4), dans Adamantius, 14, 2008, p. 229234 ; O. Andrei, Per un commento alla Historia Ecclesiastica di
Eusebio di Cesarea: i Chronici Canones quale philosophia ex oraculis
DQWLSRUULDQD, dans Adamantius, 14, 2008, p. 151-190 ; A. Cacciari,
Larchetipo latente. La notizia eusebiana su Quadrato (HE IV, 3), dans
Adamantius, 14, 2008, p. 199-206 ; S. Morlet, Entre histoire et exgse.
5pH[LRQVVXUODORJLTXHQDUUDWLYHGXOLYUH,GHOHistoire ecclsiastique
dEusbe, dans Adamantius, 14, 2008, p. 191-198 ; V. Neri, Massenzio
e Massimino coppia di tiranni (Eus., HE VIII,14), dans Adamantius, 14,
2008, p. 207-217 ; Id., Documenti e narrazione storica nel libro IX
dellHistoria ecclesiastica di Eusebio di Cesarea, dans Adamantius, 14,
2008, p. 218-228 ; L. Perrone, Eusbe de Csare face lessor de la
littrature chrtienne au e sicle : propos pour un commentaire du
IVe Livre de lHistoire ecclsiastique, dans ZAC, 11, 2007, p. 311-333 ;
Note per un commento a Eusebio di Cesarea, Storia Ecclesiastica IV,
7, dans P. Arduini et al. (d.), Studi offerti a Alessandro Perutelli, 2,
Roma, 2008, p. 341-357 ; M.-Y. Perrin, Le dossier du donatisme dans
lHistoire ecclsiastique dEusbe de Csare, dans Annuaire de lPH
Ve section, 117 (2008-2009), 2011, p. 225-230.

La srie est en bonne voie et le prochain volume,


consacr aux tomes I III de lHistoire ecclsiastique,
doit sortir bientt.
Les contributions qui suivent jettent toutes un clairage
intressant sur la manire dont on peut lire et exploiter
lHistoire ecclsiastique. De manires trs diffrentes,
HOOHV HQJDJHQW XQH UpH[LRQ VXU OD YDOHXU GRFXPHQtaire de luvre. Marie-Franoise Baslez situe le travail
dEusbe dans le cadre de l histoire documentaire .
Elle montre lintrt que peut prsenter aujourdhui le
tmoignage dEusbe pour lhistoire de la communication
et des rseaux. Mais Enrico Norelli et Rmi Gounelle
nous rappellent quEusbe a opr des choix. Le premier
se demande dans quelle mesure la collecte dEusbe
ne serait pas dicte par une conception particulire de la
vrit. La place massive des textes chrtiens sexpliquerait,
dans cette hypothse, parce quEusbe considre que la
vrit sur le christianisme ne peut tre illustre que par des
textes chrtiens. Rmi Gounelle montre que, rebours de
limage traditionnelle du compilateur scrupuleux attache
Eusbe, lvque de Csare ne donne pas ncessairement
XQH LPDJH GqOH GH OD GRFXPHQWDWLRQ GLVSRQLEOH GH VRQ
temps. Sa prsentation des textes est elle-mme parfois
fausse et appelle, de la part du commentateur, la plus
grande prudence. Cest justement sur un silence dEusbe
TXHVDUUrWHHQQ-HDQ*DVFRXTXLVHGHPDQGHSRXUTXRL
lvque de Csare a pass sous silence lapostasie de
Pirios, matre de son propre matre Pamphile. Partant
du principe quEusbe ne pouvait ignorer cette apostasie,
documente par ailleurs, il estime quEusbe aurait dlibrment censur un vnement gnant et pense que ce
silence donne de la substance laccusation selon laquelle
Eusbe aurait lui-mme apostasi pendant la Perscution.
En cachant lapostasie de Pirius, Eusbe aurait cherch
aussi occulter la sienne.
Nous remercions la revue Antiquit tardive davoir
accept de publier ces quatre textes.
Sbastien Morlet
Universit Paris-Sorbonne
Institut universitaire de France
UMR 8167 Orient et Mditerrane ,
Antiquit classique et tardive
Laboratoire dexcellence RESMED

AnTard , 22, 2014, p. 55- 60


DOI 10.1484/J.AT.5.103174

RFLEXIONS SUR LA NOTION DHISTOIRE ECCLSIASTIQUE


PARTIR DES DOSSIERS DE CORRESPONDANCES PISCOPALES
0)%

Some thoughts on Eusebius concept of Ecclesiastical History


based on a study of the episcopal letters
Long after Harnack criticized the Eusebian paradigm retracing the formation processes of the Great Church,
todays historians call attention to Eusebius special interest in documents, local events and the concrete daily life of
the first Christian communities. Recent research has highlighted the importance of the records and letters that are
contaiend in the Ecclesiastical History.
This paper studies the letters of bishop Dionysios of Corinth (c. 170) and the letters concerning the case of
Paulus of Samosata (168-172). We can appreciate the precise typology and many details about ecclesiastical procedures, epistolary communication and the formation processes of private or clerical networks. In Eusebius history,
bishops appear as networkers who eventually created an episcopal network in spite of the impetuous burgeoning of
Early Christianity. [Author]

Lhistoire du christianisme aux trois premiers sicles


na longtemps t tudie que dans une perspective
diachronique et unitaire, dont lHistoire ecclsiastique
dEusbe fournissait les cadres et les trajectoires :
H[SDQVLRQ FRQWLQXH pGLFDWLRQ GXQ DSSDUHLO HFFOpVLDO
FRQVWUXFWLRQ GXQH RUWKRGR[LH LGHQWLFDWLRQ GXQH
tradition. Pourtant, y regarder de plus prs, lHistoire
ecclsiastique met aussi en vidence le pluralisme
du christianisme des origines, ainsi que la soulign
Emanuela Prinzivalli1, en particulier parce quEusbe
emploie rarement le concept dglise au singulier,
manifestant ainsi son souci de laspect concret des
communauts . Autre effet dune relecture rcente,
lHistoire ecclsiastique nest pas plus linaire quelle
est globalisante : Emanuela Prinzivalli veut reconnatre une structure apologtique en triptyque, tandis
TXH 'RURQ 0HQGHOV LGHQWLH DVVH] MXVWHPHQW HQ GpSLW

1. E. Prinzivalli, Le genre historiographique de lHistoire ecclsiastique,


dans S. Morlet, L. Perrone (dir.), Eusbe de Csare. Histoire
ecclsiastique. Commentaire, 1. tudes dintroduction (Anagg, 6),
Paris, Les Belles Lettres, 2012, p. 83-112.

dexpressions peut-tre outrancires, des squences


vnementielles de crise2, qui rvlent la prise en
compte de la conjoncture et de la synchronie, cette autre
dimension de lhistoire.
Eusbe ne peut donc tre nglig comme source
documentaire par les historiens daujourdhui, alors
mme que leur angle dapproche et leur vise densemble
ont considrablement volu durant les dernires
dcennies. On est en effet pass pour la priode dite de
lEarly Christianity dune problmatique dhistoire de
la religion chrtienne une problmatique dhistoire
de la christianisation3, en sintressant dabord la
manire dont les chrtiens sinscrivaient dans le temps
et dans lespace, l o lon peut les saisir. Cela valorise

2. D. Mendels, The Media Revolution of Early Christianity. An Essay on


Eusebius Ecclesiastical History, Grand Rapids (Mich.) / Cambridge
(UK), 1999. Id., The sources of the Ecclesiastical History of Eusebius. The
case of Josephus, dans B. Pouderon, Y-M. Duval (dir.), Lhistoriographie
de lglise des premiers sicles (Thologie historique, 114), Paris, 2001,
p. 195-205 (notamment p. 195-201).
3. H. Inglebert et al. (dir.), Le problme de la christianisation du monde
antique, Paris, 2010.

56

MARIE-FRANOISE BASLEZ

la notion de conjoncture locale , par rapport celle


de structure ecclsiale et incite donc des approches
synchroniques faisant intervenir des interactions. Il
apparat dautre part que, pour lAntiquit, la mise en
vidence de dynamiques spatio-politiques, conomiques
ou culturelles, la matrise mme de lespace dans un
systme unitaire, ne peuvent gure tre analyses quen
utilisant les mthodes et les grilles de lhistoire des
rseaux, inities par la sociologie depuis une trentaine
dannes. Pour ce faire, lhistorien de lAntiquit
travaille sur des prosopographies tablies partir des
textes, des papyrus et surtout des inscriptions, mais il
utilise aussi et surtout lettres et correspondances pistolaires, dont limportance na cess de crotre lpoque
romaine, de Cicron Augustin. Ce matriel et ces
mthodes sont dj largement utiliss pour analyser
la christianisation dans lAntiquit tardive4, de mme
que la communication pistolaire a t bien tudie
lpoque notestamentaire, de Paul Polycarpe5. Reste
lentre-deux. Pourquoi ne pas tendre ce type denqute
aux lettres et dossiers de correspondance piscopale
conservs ou cits par Eusbe ? Le premier les avoir
pris en compte est Pierre Nautin ds 19616, mais il nen a
retenu que le contenu doctrinal et la thmatique unitaire,
sans sattacher aux aspects fonctionnels.
Bien sr, lusage massif de la citation dans lHistoire
ecclsiastique a dj retenu lattention des commentateurs7, mais dans une perspective de philosophie (ou de
thologie) de lhistoire plutt que dhistoire documenWDLUHHQFRUHTXHODSSOLFDWLRQGXTXDOLFDWLIGKLVWRLUH
documentaire lHistoire ecclsiastique ait t
discut plusieurs reprises dans le volume de 2001 sur
Lhistoriographie de lglise des premiers sicles8. Mais
on na pas distingu les citations littraires des documents
protocolaires ou pistolaires et lon ne sest intress
quaux citations littraires dont on a surtout tudi les

4. Voir Social networks in the early Christian environment: Issues and


methods for social history, dans Semeia, 36, 1991 et, comme exemple
dapplication, lutilisation de la correspondance de Thodoret de Cyr
par A.M. Schor, Theodorets People. Social Networks and Religious
&RQLFWVLQ/DWH5RPDQ6\ULD, University of California Press, 2011.
5. R. Burnet, ptres et lettres, er et e sicle : de Paul de Tarse
Polycarpe de Smyrne, Paris, 2003.
6. P. Nautin, Denys de Corinthe et ses correspondants, dans Id., Lettres
et crivains chrtiens des e et e sicles, Paris, 1961, p. 13-31.
7. Voir en particulier E. Prinzivalli, Le genre historiographique, cit. (n. 1)
et O. Andrei, Canons chronologiques et Histoire ecclsiastique, dans
S. Morlet, L. Perrone (dir.), Eusbe de Csare, cit. (n. 1), Paris, 2012,
p. 33-40.
 &HVW XQH KLVWRLUH TXL  VDSSURFKH GH OKLVWRLUH VFLHQWLTXH 
pour D. Gonnet, Lart de citer dans lHistoire ecclsiastique, dans
B. Pouderon, Y-M. Duval (dir.), Lhistoriographie, cit. (n. 2), p. 193,
une histoire bien documente , mais non strictement documentaire
pour Fr. Thlamon, crire lhistoire de lglise : dEusbe de Csare
j5XQG$TXLOpH, dans ibidem, p. 209.

AnTard , 22, 2014

modes de rappropriation9, alors que lhistorien tablit


une diffrence fondamentale entre les citations constitutives dune tradition littraire et lintroduction de
sources archivistiques, qui renvoient directement une
conjoncture et des pratiques. Conventionnellement,
on explique ce mode dcriture comme un recours
largument dautorit, la citation dune pice darchives
fonctionnant lgal du tmoignage oculaire comme
une attestation faite par des contemporains de lauthenticit des faits relats, outre quelle donne de lpaisseur
historique au rcit10. Cette interprtation a t renouvele
HW HQULFKLH SDU OHVVDL GH GpQLWLRQ GXQH  KLVWRULRgraphie apologtique destine construire une identit
ethnique ou religieuse, dont la caractristique serait de
fonctionner en circuit ferm en ne recourant qu ses
propres crits, abondamment cits, au lieu de procder
aux croisements documentaires ordinaires dans lhistoriographie grco-romaine11. Ce mode dcriture
signalerait les histoires indignes de lOrient
hellnis, telles que les Antiquits juives de Flavius
Josphe et les Actes des aptres. Lcriture de lhistoire
selon Eusbe et sa technique de la citation sinscriventelles donc dans la continuit de lhistoriographie juive ?
Cest peut-tre un peu court. Arnaldo Momigliano, dont
on se rclame toujours, ne sest pas content dtablir
un lien entre lHistoire ecclsiastique et les Antiquits
juives12 ; LOVHVWLQWpUHVVpSOXVODUJHPHQWHWSOXVVSpFLTXHPHQWjOLQVHUWLRQGHOHWWUHVRIFLHOOHVHWGRFXPHQWV
administratifs, quil considre comme une caractristique de lhistoriographie orientale depuis lpoque
achmnide et comme le tmoignage dune pratique
archivistique plutt que comme un motif littraire13. Il
sagit donc daborder les dossiers pistolaires conservs
par Eusbe en faisant la part des choses entre histoire
apologtique et histoire documentaire.

9. Ainsi S. Inowlocki, Eusebius and the Jewish Authors. His Citation Technique
in an Apologetic Context, Leyde, 2006, qui se limite aux citations dauteurs
juifs pour analyser comment Eusbe se rapproprie le judasme au prix de
coupures, daltrations, de rinterprtations et sous couvert danonymat.
E. Prinzivali, Le genre historiographique, cit. (n. 1), p. 88.
10. D. Gonnet, Lart de citer, cit. (n. 8).
11. G. Sterling,+LVWRULRJUDSK\ VHOIGHQLWLRQ-RVHSKXV/XNH$FWV
and apologetic historiography, dans Society of Biblical Literature
1995 Seminar Papers, 1995, p. 595-616.
12. Pagan and Christian Historiography in the Fourth Century
AD (1963), et aussi Persian, Greek and Jewish Historiography (19621963), lments orientaux dans lhistoriographie juive postrieure
lExil, tudes reprises dans Problmes dhistoriographie ancienne et
moderne, Paris, 1983 et dans The Classical Foundation of Modern
Historiography, Berkeley, University of California Press, 1990.
13. Voir aussi, propos des documents darchives cits par Flavius
Josphe, qui proviennent certainement du fond darchives constitu
par les Hasmonens, M. Pucci Ben Zeev, Jewish Rights in the Roman
World. The Greek and Roman Documents Quoted by Josephus Flavius,
Tbingen, 1998 et sur cette caractristique de lhistoriographie juive,
M.-F. Baslez, Les conditions dexercice du mtier dhistorien
lpoque du Second Temple dans D. Dor, J.-M. Poffet (dir.), Comment
la Bible saisit-elle lhistoire, Paris, 2007.

AnTa rd , 2 2 , 2 0 1 4

RFLEXIONS SUR LA NOTION DHISTOIRE ECCLSIASTIQUE ET LES CORRESPONDANCES PISCOPALES

Le dossier que jai slectionn est celui de la correspondance de lvque Denys de Corinthe14, contemporain
de lvque Ster de Rome (167-174), bien que ce dossier
puisse paratre ingrat, puisque, sur les neuf lettres cites,
sept le sont seulement sous forme de rsums parfois
trs succincts. Deux raisons ont prvalu.
La premire, cest que la citation dune de ses lettres,
dont on ignore le destinataire, le contenu et lobjectif,
QH VH MXVWLH TXH SDU GHV SUpRFFXSDWLRQV VWULFWHPHQW
documentaires, quEusbe partage avec le scripteur et
qui nous font entrer dans des problmes concrets de
circulation de lcrit et dinterfrences de rseaux15 : Il
y a en effet crit Denys des lettres que jai crites
aprs que des frres maient demand dcrire ; et
celles-ci, des aptres du diable y ont mle de livraie,
tantt par des suppressions, tantt par des ajouts . Deux
gnrations plus tard, les lettres de Cyprien dnoncent
GDQV OHV PrPHV WHUPHV XQ WUDF pSLVWRODLUH TXL SDUDvW
tre rvlateur dune conjoncture de crise16, alors que
rien nassure le contrle piscopal de loutil pistolaire. Cyprien se montre en avance sur son temps, car
il tente de grer la totalit de ses crits en circulation
( treize en tout 17) : il diffuse des copies autorises et
FRQVHUYH XQ RULJLQDO j RSSRVHU DX[ FRSLHV IDOVLpHV18 ;
il semble mme avoir prpar de son vivant ldition,
le tri et le classement de sa correspondance19. Comme
Cyprien20, Denys souligne dans sa lettre aux Romains
limportance et la ncessit de la lecture publique des
lettres devant lassemble liturgique, seul moyen de les
YDOLGHU HW DXVVL GHQ [HU OH FRQWHQX21. Eusbe partage
FH VRXFL GDXWKHQWLHU HW GH JDUDQWLU OHV GRFXPHQWV HW
fait ainsi son mtier dhistorien, indpendamment de la
vise apologtique de son uvre. La concordance entre
les citations des lettres de Denys et la correspondance
de Cyprien prouve quEusbe na pas slectionn
DUELWUDLUHPHQW XQH JXUH pSLVFRSDOH PDLV TXLO GpFULW
des pratiques reprsentatives dune pastorale.
Il semble quEusbe ait dispos de la correspondance
de Denys dj classe et organise en dossier. Sans doute
par lvque de Corinthe lui-mme, ainsi quon le postule
depuis Adolf von Harnack, en relevant que la collection
comprend au milieu de lettres crites par Denys une

14. HE IV, 23, 11-13.


15. HE IV, 23, 12. Il nest pas assur, comme le pense P. Nautin, Denys
de Corinthe, cit. (n. 6), p. 14, que lextrait fasse partie de lptre aux
Romains.
16. Lettre 9, consulter dans la traduction commente de S. Delani, Saint
Cyprien, Lettres 1-20, Turnhout, 2007, outre ldition de rfrence de
G.W. Clarke, The Letters of St Cyprian of Carthage (Ancient Christian
Writers, 43-44, 46-47), New York, 1984-1989.
17. Cyprien, Lettres 20.
18. Cyprien, Lettres 9, 32.
19. Cyprien, Lettres 9, 45.
20. Cyprien, Lettres 45.
21. HE IV, 23, 11.

57

autre qui lui est adresse22. Il y a aussi, sans doute, un


classement typologique. Eusbe introduit le dossier en
soulignant lintrt des lettres catholiques de Denys,
qui participent bien sr de la vise universaliste de
son histoire de lglise. Ce sont videmment les trois
premires cites, par ordre de dignit et dimportance,
que lvque de Corinthe a envoyes Lacdmone,
Athnes et Nicomdie23 ; elles ont un contenu
doctrinal, soit quelles contribuent la construction de
lorthodoxie, soit quelles posent les fondements dune
religion thique ( vivre selon lvangile ) ou encore
quelles combattent lhrsie de Marcion. Elles devaient
prendre la forme de petits traits comme la lettre de
Polycarpe aux Philippiens. linverse, la dernire lettre
cite relve de la direction de conscience et de la correspondance personnelle24. Entre les deux, les lettres 4,
5, 6 et 7 sont adresses des glises et font intervenir
leurs vques25 : on peut parler, sans abus de termes, de
correspondance piscopale , ce qui pose la question
dun rseau piscopal. Cette dernire catgorie de lettres
traite de questions disciplinaires et pastorales.
Denys apparat donc comme un homme de rseaux
et ne peut tre tudi que comme cela puisquon ne le
connat que par ses lettres. Cest la deuxime raison qui
ma fait privilgier ce dossier. Denys est au centre de
plusieurs rseaux, ce qui se dduit de la varit de sa
correspondance : les lettres catholiques , destines
tous, attestent de sa stature internationale, souligne par
Eusbe dans la prsentation du dossier ; les changes
pistolaires entre vques suggrent danalyser lmergence dun rseau piscopal ; la lettre de direction
VSLULWXHOOHSRVHODTXHVWLRQGHVOLHQVGDIQLWp
Le plus facile analyser parat tre de prime abord
ltendue et linscription spatiale de ces rseaux. Denys
est en relation avec des communauts chrtiennes du
voisinage, lintrieur de la province dAchae, mais
aussi avec des glises de la rgion du Pont-Bithynie,
DYHF GHV eJOLVHV FUpWRLVHV HW HQQ DYHF OeJOLVH GH
Rome. La situation gographique de Corinthe et ses
DFWLYLWpV SRUWXDLUHV VXIVHQW j UHQGUH FRPSWH GHV D[HV
de relations ainsi dessins. Les traditions apostoliques sont moins videntes : les liens entre Rome et
le Pont-Bithynie en passant par Corinthe pourraient
trouver leur origine dans une mission ptrinienne, ce
TXH VHPEOH FRQUPHU OHPSORL SDU 'HQ\V GH &RULQWKH
du terme et du concept de paroikia (dclin aussi en
paroikousa), que lon trouve dans la premire ptre

22. HE IV, 23, 8 (lettre de Pinytos vque de Cnossos).


23. HE IV, 23, 2-4.
24. HE IV, 23, 13 (lettre Chrysophora).
25. HE IV, 23, 5 ( lglise de Gortyne et lvque Philippe), 6 (
OeJOLVHG$PDVWULVHWjOpYrTXH3DOPDV HW DX[GqOHVGH&QRVVRV
et lvque Denys).

58

MARIE-FRANOISE BASLEZ

de Pierre, adresse depuis Rome aux communauts du


Pont, de la Bithynie et des autres provinces anatoliennes,
et qui tait utilise Rome et Smyrne26, mais le mme
Denys, dans un autre extrait de lettre aux Romains, cit
ailleurs dans lHistoire ecclsiastique27, revendique une
double fondation et une double tradition, ptrinienne
et paulinienne, pour lglise de Corinthe. Les glises
de Crte, avec lesquelles il est en relation, continuent
dailleurs de manifester explicitement leur enracinement
dans la tradition paulinienne28.
Le fait davoir gard une lettre familire est
intressant, dautant que la correspondance de Cyprien
nen a conserv aucune29 : le dossier de Denys de Corinthe
tablit ainsi que lautorit de lvque ne se fonde pas
seulement sur le principe lectif et sur sa reprsentativit
communautaire30, mais aussi sur un rseau personnel.
2QHQWURXYHFRQUPDWLRQGDQVGDXWUHVFROOHFWLRQVGH
lettres cites par Eusbe, o le style pistolaire volue
GH PDQLqUH VLJQLFDWLYH VHORQ ORFFDVLRQ HW OH GHVWLQDtaire. Par exemple, dans le dossier de correspondance de
lvque Denys dAlexandrie, on peut comparer les deux
OHWWUHV TXLO pFULYLW j OD Q GH OD SHUVpFXWLRQ GH 'qFH
en 251, lune pour informer lvque Fabius dAntioche,
lautre en rponse deux prtres dgypte, Dometius
et Didyme, connus autrement comme ses sympresbuteroi, faisant partie du mme rseau sacerdotal31. La
SUHPLqUHTXLFRQVWLWXHOHUpFLWRIFLHOGHVWLQpjFLUFXOHU
dans le rseau piscopal, fournit des lments inforPDWLIV YDULpV HW YpULDEOHV GHV pYpQHPHQWV GHV QRPV
et des chiffres, assortis dune interprtation thologique
du martyre. La seconde tmoigne de limportance des
ractions corporatistes lintrieur dune glise locale,
puisquelle ne sintresse quaux prtres, aux diacres et
lentourage de lvque, aux gens connus de vous ,
un rseau clrical peut-tre issu du Didascale. Ces
rseaux personnels peuvent court-circuiter lautorit des
vques : Denys de Corinthe est sollicit dintervenir

26. HE IV, 23, 5-6 : la dsignation ekklesia paroikousa est applique


aux communauts de Gortyne et dAmastris ; comparer IP 1, 1 et 17,
Clment de Rome, Premire ptre aux Corinthiens, adresse que
Denys connaissait bien (HE IV, 23, 11) ainsi que Polycarpe, Lettre
aux Philippiens 1, 1.
27. HE II, 25, 8.
28. Cela ressort de la terminologie de la lettre de lvque de Cnossos
(HE IV, 23, 8) renvoyant 1 Co 3, 1-2 (mais aussi He 5, 12-14). Sur
les origines pauliniennes des glises crtoises, voir Tt 1, 5.
29. S. Delani, La correspondance de saint Cyprien et lunit de lglise,
dans Revue de la socit Ernest Renan, 2004-2007, p. 110.
30. 1 Tm 3, 1-7.
31. HE 9,   HW    9,,   /H TXDOLFDWLI GH
sumpresbuteroi est utilis pour les destinataires des lettres festales
(HE VII, 20), dont font partie Dometius et Didyme ; voir C.L. Feltoe,
The Letters and Other Remains of Dionysius of Alexandria,
Cambridge, 1904, p. 64-66 et, sur la chronologie et le contexte de
ces lettres, Y. Tissot, Le rapt de Denys dAlexandrie et la chronologie
de ses lettres festales, dans Revue dhistoire et de philosophie
religieuses, 77, 1997, p. 51-65.

AnTard , 22, 2014

Amastris par Bacchylide et Elpistos, qui peuvent tre


VRLWGHV$QFLHQVRXGHVGqOHVGHODFRPPXQDXWpVRLW
GHVpYrTXHVGDXWUHVFLWpVGX3RQWHQFRQLWDYHFFHOXL
dAmastris32.
lchelle de lhistoire de lglise, cest videmment
ltablissement et le fonctionnement dun rseau piscopal
quil est le plus intressant dtudier travers ces
changes pistolaires. Denys intervient soit pour rtablir
lautorit dun vque contest, soit sur des questions
GLVFLSOLQDLUHV /H SUHPLHU FDV GH JXUH HVW GRFXPHQWp
par la lettre envoye Athnes33 : une perscution locale
et la vacance de la charge piscopale ont provoqu une
vague d apostasies , une poque o lpiscopat est
HQFRUH PDO GpQL OD OHWWUH SDUOH GH  SUpVLGHQW   OH
nouvel vque est mal accept, peut-tre parce quil a t
nomm et non lu ou parce quil est latinophone ; Denys
le lgitime en lintgrant dans la succession apostolique.
Les questions disciplinaires relvent, de manire banale,
de la rintgration des pcheurs34, quelle quait t leur
faute, ou dun rigorisme excessif35, ce qui pose peut-tre
HQ OLJUDQH OD TXHVWLRQ GXQH PDVVLFDWLRQ GX FKULVWLDnisme ds cette date.
Le principal intrt de ces lettres piscopales ne
rside donc pas dans leur contenu mais dans la manire
dont elles tissent un rseau : il sagit, trois reprises,
dun change de correspondance ; on alimente et on
prolonge le dbat ; on sencourage scrire ; les vques
se donnent quitus (apodechesthai en grec36), soit de
leur lutte contre les dviances doctrinales, soit de leur
action pastorale, soit mme, quand il sagit de lvque
de Rome, de leur action sociale, ce qui suggre dautres
formes de mise en rseau des communauts chrtiennes,
pFRQRPLTXHV HW QDQFLqUHV FHOOHVOj GDQV OD WUDGLWLRQ
paulinienne. Les lettres de Denys dautres vques
entrent dans la catgorie de ce que Cyprien appellera
plus tard des lettres de communion , changes entre
collgues dans lpiscopat qui apportent flicitations,
loges et vux37. On constate que, mme si Eusbe ne
donne que des rsums, sa terminologie et les donnes
TXLOSUpVHUYHUHVWHQWGXQHSUpFLVLRQVXIVDQWH2QHQ
conclut que le rseau piscopal se construit dans des
situations de crise interne, en dbattant de questions
doctrinales et surtout disciplinaires.
&HTXHORQSHUoRLWHQJHUPHjODQGXe sicle
travers la correspondance de Denys de Corinthe apparat
encore plus vident au milieu du e sicle, quand on

32. HE IV, 23, 6.


33. HE IV, 23, 2.
34. HE IV, 23, 3 (lettre Athnes) et 6 (lettre aux glises du Pont).
35. HE IV, 23, 7-8 (correspondance avec Pinytos, vque de Cnossos).
36. HE IV, 23, 5 (de Denys lvque de Gortyne), 8 (de lvque de
Cnossos Denys) et 9 (de Denys lvque de Rome).
37. Lettres 55 ; 61 : voir S. Delani, La correspondance, cit. (n. 29),
p. 115-116.

AnTa rd , 2 2 , 2 0 1 4

RFLEXIONS SUR LA NOTION DHISTOIRE ECCLSIASTIQUE ET LES CORRESPONDANCES PISCOPALES

considre la mise en place de rseaux dvques et


le rle fonctionnel quy jouent les correspondances
travers une affaire spectaculaire, celle de Paul de
Samosate, un vque dAntioche dchu de sa charge
HQ  HW QDOHPHQW H[SXOVp TXDWUH DQV SOXV WDUG38.
Ce rcit a t considr par Doron Mendels comme le
spcimen le plus russi du sensationnalisme et de
lcriture journalistique de lHistoire ecclsiastique39,
mais il simpose aussi comme un exemple incontestable
de rigueur et de prcision documentaires.
La lettre synodale de 268, trs largement cite
dans lHistoire ecclsiastique40, tablit concrtement
comment Paul de Samosate stait constitu un rseau
indpendant, qui tait fondamentalement un rseau
pistolaire : il disposait dun cabinet secret (sekreton,
terme transcrit du latin) comme tout membre de la Cour
impriale, mais il donnait une publicit spectaculaire
ses rseaux en lisant sa correspondance et en dictant
ses rponses tout en se promenant sur lAgora41. Quand
le synode eut mis en place un nouvel vque, il fallut
obtenir pour celui-ci des lettres de communion
(koinnika grammata)42  WHOOH HVW OLQYLWDWLRQ QDOH GH
la lettre synodale, aprs le long expos de toute laffaire
et des chefs daccusation retenus contre Paul. La lettre
synodale, largement diffuse, servait donc, entre autres,
intgrer le successeur dans le rseau piscopal. Dans
ce contexte particulier, koinonia, koinonika, koinonein
sont videmment entendre sur un double registre,
celui de la communion spirituelle dans le catholicisme et lorthodoxie, notions rcurrentes dans la lettre,
mais aussi celui du rseau . Ces rseaux pistolaires
VH FRQVWLWXDLHQW HQ SDUWLH SDU DIQLWpV WKpRORJLTXHV
puisque Paul de Samosate entretient une correspondance
avec lhrsiarque Artmas43, mais sont aussi perus
de lextrieur comme des lobbies politiques44. Quatre
ans aprs sa dposition, Paul de Samosate saccroche
et continue doccuper le local de lglise ; press de
PHWWUH Q j FHWWH VLWXDWLRQ TXDQG LO DUULYH j $QWLRFKH
en 272, lempereur Aurlien fait droit aux rclamations
des partisans du nouvel vque, parce que ctaient eux

38. HE VII, 29-30.


39. D. Mendels, The Media, cit. (n. 2), p. 31-50 : The case of Paul of
Samosata. /HTXDOLFDWLIGHMRXUQDOLVWLTXHHVWMXVWLpSDUOHFKRL[
d crire au prsent et par lusage, plus douteux, dune rhtorique
de lhystrie (p. 145).
40. HE VII, 30, 2-17.
41. HE VII, 30, 8-9.
42. HE VII, 30, 17.
43. HE VII, 30, 17, o la lettre conclut que seuls dornavant
communiqueront (kointeitsan) avec Paul de Samosate ceux
qui ont les ides dArtmas .
44. F. Millar, Paul of Samosata, Zenobia and Aurelian: The Church, local
culture and political allegeance in third-century Syria, dans JRS, 61,
1971, p. 10 a justement soulign quEusbe navait pas conserv de la
lettre synodale ni largumentation ni les condamnations thologiques,
mais seulement la conduite publique de lvque condamn.

59

qui taient en relations pistolaires (epistellein) avec


les vques de Rome et dItalie45. Dans la conjoncture
particulire de la guerre contre Palmyre, qui vient de
sachever, le raisonnement est videmment politique :
originaire de la Syrie intrieure, Paul de Samosate
pouvait apparatre comme un indigne et un partisan de
Znobie46, tandis que, pour le camp adversaire, participer
dun rseau romain fournissait un brevet de loyalisme.
Considrer que la koinnia sexprime sur deux
registres, en termes de communion et en ralits de
rseau, conduit revenir sur ce que Gustave Bardy a
traduit et interprt de faon certainement anachronique
comme l excommunication de Paul de Samosate. Le
lexique, dabord, est intressant, puisquil renvoie normalement des procdures publicitaires orales classiques
de proclamation (anakruttein), de dsaveu
(apokruttein) ou d exclusion (ekkruttein), mais
Eusbe le transpose dans le registre pistolaire. Dans un
autre pisode, celui de l excommunication (sic) des
Quartodcimans par Victor de Rome, le mme Gustave
Bardy rinterprte anakruttein et stliteuein ( inscrire
une condamnation sur une stle , autre forme de
publicit) en ajoutant par lettres (dia grammatn47).
La lettre synodale de 268 tmoigne de manire plus
concrte encore qu exclure de la communion , cest
expulser du rseau pistolaire : en effet, elle constate
TXH3DXOGH6DPRVDWHQHJXUHSOXVGDQVOHVVDOXWDWLRQV
des lettres adresses lglise dAntioche et quon ne
lui crit plus lui personnellement48.
Nicole Loraux nous a appris reconnatre que
Thucydide nest pas un collgue pour nous autres,
KLVWRULHQV PRGHUQHV  (XVqEH QRQ SOXV VDQV GRXWH
Mais luvre quil a ralise participe nanmoins de
OKLVWRLUH GRFXPHQWDLUH RX VFLHQWLTXH WHOOH TXH QRXV
la concevons aujourdhui et linsertion massive de
documents darchives, jusquici non tudie, y contribue
largement. Comme la crit Dominique Gonnet, Eusbe
a une notion juste, un sens inn du document 49, cest-dire quil le laisse parler mme sil linsre dans sa
vise apologtique. Cest dailleurs ce qui explique
GHV LQVHUWLRQV DSSDUHPPHQW LOORJLTXHV GDQV OH O GH
la narration. Il laisse assez de matire documentaire et
garde surtout assez de prcision terminologique pour

45. HE VII, 30, 19.


46. Cest lhypothse de F. Millar, Paul of Samosata, cit. (n. 44), p. 1-17.
Sur la complexit du dossier, tat de la question par L. Perrone,
Lenigma di Paolo di Samosata: Dogma, chiesa e societa nella
Siria dellIII Secolo: prospettive di uno ventennio di studi, dans
Cristianesimo nella storia, 13, 1992, p. 253-327.
47. HE V, 24, 9.
48. HE VII, 30, 3.
49. D. Gonnet, Lart de citer, cit. (n. 8), p. 193 a bien reconnu dans
lutilisation systmatique de documents une manire contemporaine
de pratiquer lhistoire .

60

MARIE-FRANOISE BASLEZ

que le regard changeant des historiens y trouve toujours


du grain moudre.
Les lettres piscopales et synodales, quil nous a
partiellement ou largement conserves, constituent
donc un matriau historique alors quon installe dans
lhistoire ancienne lhistoire de la communication et
celle des rseaux. Dans le cadre linaire dune histoire de
la construction et du triomphe de lglise, il nous donne
quand mme quelques moyens pour faire une histoire
spatiale et conjoncturelle des communauts chrtiennes

AnTard , 22, 2014

dans leurs interactions. La communaut ecclsiale, au


sens o lentend Eusbe, englobe la communication50.
Universit Paris-Sorbonne
UMR 8167 Orient et Mditerrane
Antiquit classique et tardive

50. A. Monaci Castagno, compte-rendu du livre de D. Mendels, Annali


di Storia dellEsegesi, 16, 1999, p. 270-272.

AnTard , 22, 2014, p. 61- 69


DOI 10.1484/J.AT.5.103175

QUELQUES REMARQUES SUR LA MANIRE


DONT EUSBE CONSTRUIT LA LITTRATURE CHRTIENNE
DANS SON HISTOIRE ECCLSIASTIQUE
(1

Some comments on the way Eusebius constructed the Christian literature


in his Ecclesiastical History
Eusebius never refers to non-Christian writers in his Ecclesiastical History, except for Porphyry on Origen
in book 6 and Josephus and Philo in the first books in order to confirm what he has already based on Christian
sources. In book 2, where the history of the Church proper begins, Eusebius writes a story based on what he holds
as Scripture and he confirms some elements of it by drawing on Jewish and Christian non-canonical texts. In the
following books, he draws on ecclesiastical writers, viz. the authors he considers as orthodox. In order to affirm
or to refute the testamentary authority of a text, Eusebius never appeals to oral tradition but only to the writings
of ecclesiastical authors. He places in the reign of Trajan the death of the last apostles and the beginning of heresies,
making that reign a crucial turning point in Church history. It is no coincidence that he assigns to the same period
the letters of Ignatius of Antioch, in which he is interested mainly because of their polemics against heresy. They
mark for him the beginning of Christian literature, which has to be faithful to apostolic writings and update their
teaching in the struggle against heresies. In this way Eusebius creates an intrinsic connection between ecclesiastical
history and ecclesiastical literature. [Author]

Pour une histoire ecclsiastique,


une littrature ecclsiastique
La question que jaimerais poser est trs limite1 :
lorsque nous lisons lHistoire ecclsiastique dEusbe,
pouvons-nous apprendre quelque chose sur la manire
dont Eusbe concevait les caractristiques principales
dune littrature chrtienne ? Comme il est bien connu,
lHistoire ecclsiastique a t dcrite par son grand
diteur comme tant plus une collection de matriel pour
une histoire de lglise quune histoire proprement dite,
tant donn quune large partie de cet ouvrage consiste en
citations de sources ; nous nallons pas discuter ici la thse,
fort contestable, quen tirait Eduard Schwartz, cest--dire

1. Dans ces pages, je garde le style de lexposition orale, en ajoutant


quelques rfrences.

quEusbe ne voulait pas vraiment crire un ouvrage


historique2, car ce qui nous intresse, cest labondance

2. Voir E. Schwartz, Eusebios 24. Eusebios von Caesarea, dans RE, VI,
FROVXUFHSRLQWFROLVW
hier von E. im allgemeinsten Sinne gebraucht []: es bedeutet die
6DPPOXQJYRQEHUOLHIHUWHP0DWHULDO>@(VSDW]XGLHVHU
aber nicht zu den festen Formen der Historiographie, [...] da E. in der
Kirchengeschichte so viele Exzerpte direkt mitteilt, wie er es auch in
der Praeparatio evangelica tut, und es entspricht der unbestimmten, den
$XWRUQLFKWELQGHQGHQ%HGHXWXQJYRQZHQQHULP3URRHPLXP
die Rahmen vorlegt, in die er sein Material hineinbringen will. Pour
une brve critique, D. Timpe, Che cos la storia della chiesa? La
Historia ecclesiastica di Eusebio. Caratteristiche di un genere, dans
G. Cambiano, L. Canfora, D. Lanza (dir.), Lo spazio letterario della
Grecia antica, 2. La ricezione e lattualizzazione del testo, Roma,
1995, p. 389-435, en particulier 403-404. Pour une caractrisation
de lHistoire ecclsiastique comme ouvrage historiographique, voir
maintenant E. Prinzivalli, Le genre historiographique de lHistoire
ecclsiastique, dans S. Morlet, L. Perrone (dir.), Eusbe de Csare.
Histoire ecclsiastique. Commentaire, 1. tudes dintroduction
(Anagg, 6), Paris, Les Belles Lettres, 2012, p. 83-111.

62

ENRICO NORELLI

des extraits en tant que telle. Il va sans dire que les citations
reproduites par Eusbe ou ses mentions de ses sources
dpendent aussi des livres quil avait sa disposition ; par
ailleurs, dans un certain nombre de cas, il est soit clair,
soit probable quil na pas vu personnellement les uvres
auxquelles il se rfre. Maintenant, comment choisit-il
les livres quil utilise ou mentionne ? Est-il possible
dindiquer quelques-unes de ses ides fondamentales au
sujet de la manire dont il faut considrer cette littrature ?
Il sagit l dune question mi-chemin entre une enqute
sur les livres de la bibliothque dEusbe et une enqute
sur lusage quEusbe a fait de ces livres3 ; pourtant, elle
est diffrente de lune et de lautre. Le matriel laide
duquel on peut chercher une rponse nest pas abondant,
mais il est peut-tre possible de rassembler quelques
lments et jaimerais ici faire une tentative partielle. Je
me limiterai quelques passages tirs des cinq premiers
livres, qui couvrent les deux premiers sicles chrtiens.
PuisquEusbe est le premier auteur chrtien qui non
seulement crit une histoire de lglise, mais rassemble
aussi, dans ce but, une quantit remarquable dextraits et
de rsums de livres et de documents, il y a probablement
un lien entre sa conception de lhistoire de lglise et,
plus gnralement, de lglise en tant que telle et ses
ides au sujet du genre de sources pertinentes une telle
entreprise ainsi que de la manire de les utiliser.
Comme Arnaldo Momigliano aimait le souligner, le
nouveau genre de lhistoire ecclsiastique envisag par
Eusbe tait fond sur une documentation qui aurait t
inconcevable pour lhistoriographie politique courante,
mais qui tait habituelle dans les uvres antiquaires,
biographiques et polmiques. Il pensait que lexemple
dAlexandre Polyhistor, qui avait soigneusement
rassembl des extraits de textes sur les juifs, avait probablement t important pour Eusbe4. Ceci est bien sr
exact, mais il faudrait en mme temps attirer lattention
sur une diffrence. Dans le cas de lHistoire ecclsiastique, les sources auxquelles Eusbe puisait ses extraits
ne venaient pas de nimporte quel auteur, mais avaient
t produites lintrieur de lentit qui reprsentait
lobjet de son uvre. Certes. il est possible quAlexandre
3RO\KLVWRUQDLWHXUHFRXUVGDQVVRQTXj

3. La manire dont Eusbe a cit ses sources a t bien tudie par


E. Carotenuto, Tradizione e innovazione nella Historia Ecclesiastica
di Eusebio di Cesarea, Bologna, 2001.
4. Par exemple A. Momigliano, 6WRULRJUDDJUHFD, premire publication
dans Rivista Storica Italiana, 87, 1975, p. 17-46 ; jen utilise la
rdition dans Idem, /D VWRULRJUDD JUHFD (Piccola biblioteca
Einaudi), Torino, 1982, p. 3-41, sur ce point p. 31. La plupart des
H[WUDLWV GX   G$OH[DQGUH 3RO\KLVWRU D pWp FRQVHUYpH
par Eusbe, Prparation vanglique IX, 17-39 ; on peut lire tous
les fragments avec un commentaire dans M. Stern, Greek and Latin
Authors on Jews and Judaism, 1. From Herodotus to Plutarch,
Jerusalem, 1974, p. 157-164 ; 3. Appendixes and Indexes, Jerusalem,
1984, p. 16-22.

AnTard , 22, 2014

des sources du judasme alexandrin, mais la diffrence


reste, car il ntait vraisemblablement pas juif, tandis
quEusbe se sert dcrits issus de la mme tradition
laquelle il appartient. Comme nous le verrons ce sera
la thse des pages qui suivent cela nest pas d essentiellement la conviction que ce sont ces sources qui,
son avis, renseignent le mieux sur son sujet, mais
la conviction que pour dire la vrit de cette entit qui
fait lobjet de son ouvrage, il faut se servir de sources
inspires par cette mme vrit.
Bien sr, Eusbe cite largement, dans ses premiers
livres, Flavius Josphe et aussi Philon dAlexandrie et il
se rfre des auteurs non chrtiens quil cite pourtant
UDUHPHQWPDLVLOOHIDLWWRXMRXUVGDQVOHEXWGHFRQUPHUFH
quil a dj tabli sur le fondement de sources chrtiennes.
Eusbe ne rassemble pas toutes sortes dinformations
sur les chrtiens, mais, pour lessentiel, des informations
chrtiennes sur les chrtiens. Des textes non chrtiens ne lui
paraissent pertinents que lorsquils conviennent au tableau
quil a bross partir de sources chrtiennes. Il est vrai quil
cite des dcrets impriaux, authentiques ou apocryphes,
concernant les chrtiens, mais, dans les sept premiers
livres, il na jamais recours aux documents originaux ni
mme seulement des auteurs paens qui les reproduisent :
il cite ces documents uniquement daprs des auteurs
chrtiens. Tel est le cas, par exemple, de la rponse de
Trajan Pline, quEusbe cite en III, 33 travers Tertullien,
Apologtique 2, 6 (quil lisait en grec, cf. II, 2, 4) ; ou du
rescriptum dHadrien Minucius Fundanus de 124, cit
par Eusbe en IV, 9 daprs la (Premire) Apologie de
Justin Martyr 68 ; ou encore du dcret dAntonin le Pieux
reproduit dans Histoire ecclsiastique IV, 13, qui est de
toute vidence apocryphe et chrtien et qui se trouve lui
aussi en appendice aux Apologies de Justin. Ce nest que
YHUVODQGHOHistoire ecclsiastique (X, 5-7 ; mais dans
OD SUHPLqUH pGLWLRQ LOV JXUDLHQW VDQV GRXWH j OD Q GX
livre IX) quEusbe cite des documents impriaux authentiques au sujet des chrtiens, mais ceci peut sexpliquer de
manire cohrente avec ce que nous venons de remarquer :
ces documents appartiennent un Empire quEusbe
considre dsormais comme chrtien, en sorte quils sont
dune certaine manire des documents chrtiens.
Dans lHistoire ecclsiastique, Eusbe ne cite pas
dauteurs ayant crit contre les chrtiens, comme laurait fait
un historien moderne, mais aussi un grec. Il aurait pu puiser
quelques informations dans Celse, ne serait-ce que pour le
UpIXWHU  PDLV LO VH OLPLWH j OH PHQWLRQQHU HQ OH TXDOLDQW
dpicurien, dans les quelques mots quil consacre luvre
dOrigne contre lui (VI, 36, 2). Nous ne savons pas sil avait
accs luvre de Celse indpendamment dOrigne ; en tout
cas, il ne le cite mme pas travers ce dernier. On pourrait se
dire quapparemment, Eusbe navait pas dintrt laisser
la parole un ennemi des chrtiens. Pourtant, ceci nest pas
entirement vrai au sujet dun autre ennemi, Porphyre. Dans
un chapitre de sa biographie dOrigne au sixime livre

AnTa rd , 2 2 , 2 0 1 4

COMMENT EUSBE CONSTRUIT LA LITTRATURE CHRTIENNE

de lHistoire ecclsiastique (VI, 19), Eusbe cite quelques


passages de Porphyre concernant Origne et Ammonius,
mais seulement comme tmoignages sur la vie dOrigne5.
Toutefois, Eusbe connaissait bien luvre de Porphyre : non
seulement il a cit un passage de lune de ses uvres dans
ses Khronikoi kanones6, mais il en a utilis les crits dans sa
Prparation vanglique et aurait compos un ouvrage en
plusieurs livres contre lui7$LQVLFHVWVSpFLTXHPHQWGDQV
lHistoire ecclsiastique quEusbe vite de le citer, une
H[FHSWLRQSUqVGHVWLQpHjPLHX[JORULHU2ULJqQH
Quant Flavius Josphe, il est cit en tant que tmoin
neutre et bien renseign au sujet dvnements mentionns
dans les vangiles canoniques et surtout dans le livre des
Actes. La premire occurrence concerne le recensement
de Quirinius en I, 5. Ici, Eusbe se rfre dabord la
mention du recensement en Lc 2, 2, ensuite celle de Judas
le Galilen en Ac 5, 37, parce que, dans les Antiquits
juives XVIII, 1-10, Josphe relie Quirinius au recensement et la rvolte de Judas (Eusbe ajoute la mention
de Judas en Guerre ,,   $LQVL -RVqSKH FRQUPH OH
recensement sous Quirinius. Immdiatement aprs (I, 6,
2), Eusbe cite Josphe au sujet dHrode comme idumen
et pas juif (Ant. XIV, 121 ; Guerre ,    DQ GH
FRQUPHU OD EpQpGLFWLRQ GH 0RwVH VXU -XGD 'W   
qui tait couramment interprte comme une prophtie
messianique. De manire analogue, en Histoire ecclsiastique I, 8, Eusbe reproduit le rcit de la mort dHrode par

5. Nous pouvons laisser ici de ct la question de savoir si lOrigne


mentionn par Porphyre dans le fragment cit par Eusbe tait
YUDLPHQW OH WKpRORJLHQ DOH[DQGULQ  FRQWUH FHWWH LGHQWLFDWLRQ YRLU
par exemple R. Goulet, Porphyre, Ammonius, les deux Origne, et les
autres, dans Revue dhistoire et de philosophie religieuses, 57, 1977,
p. 471-496, reproduit dans Idem, tudes sur les vies de philosophes
dans lAntiquit tardive. Diogne Larce, Porphyre de Tyr, Eunape de
Sardes, Paris, 2001, p. 267-290 ; F. M. Schroeder, Ammonius Saccas,
dans ANRW, II, 36.1, Berlin / New York, 1987, p. 493-526. En faveur
GH OLGHQWLFDWLRQ UpFHPPHQW & =DPDJQL Eusbe de Csare.
Questions vangliques (SC 523), Paris, 2008, p. 36-37, n. 2, avec la
bibliographie antrieure.
6. A. von Harnack, Porphyrius Gegen die Christen, 15 Bcher:
Zeugnisse, Fragmente und Referate, Abhandlungen der preussischen
Akademie der Wissenschaften, 1916, p. 3-115, sur ce point p. 3031 = A. von Harnack, Kleine Schriften zur alten Kirche. Berliner
Akademieschriften [II.] 1908-1930 (Opuscula, 9, 2), Leipzig, 1980,
p. 362-474, sur ce point p. 389-390.
7. A. von Harnack, Porphyrius, cit. (n. 6), p. 30 = p. 389 et fragment 8,
p. 48 = p. 407. Luvre aurait compt 25 livres selon Jrme, voir ses
tmoignages ibidem, p. 35-36 = p. 394-395. Sur luvre, entirement
perdue, voir aussi A. von Harnack, Geschichte der altchristlichen
Litteratur bis Eusebius. Erster Theil: Die berlieferung und der
Bestand, Leipzig, 1893, p. 564-565 ; Id., Geschichte der altchristlichen
Litteratur bis Eusebius. Zweiter Theil: Die Chronologie. Erster
Band: Die Chronologie der Litteratur bis Irenus nebst einleitenden
Untersuchungen, Leipzig, 1897, p. 118-119. Mais surtout, voir
maintenant limportante tude de S. Morlet, Eusebius Polemic against
Porphyry: A reassessment, dans S. Inowlocki, C. Zamagni (dir.),
Reconsidering Eusebius. Collected Papers on Literary, Historical,
and Theological Issues (Supplements to Vigiliae christianae, 107),
Leiden / Boston, 2011, p. 119-150 et Que savons-nous du Contre
Porphyre dEusbe ?, dans RG, 125, 2012, p. 473-514.

63

)ODYLXV-RVqSKHDQGLOOXVWUHUOHEUHIpQRQFpDXVXMHWGH
FHWWHPRUWHQ0WHWGHSURXYHUTXXQHQWHOOHPHQW
horrible tait le chtiment pour le massacre des innocents.
Le livre II de lHistoire est rempli dextraits de Josphe
YLVDQWjFRQUPHUHWjLOOXVWUHUOHUpFLWGHV$FWHVTXLIRUPH
OHOFRQGXFWHXUGHFHOLYUH/HVORQJVH[WUDLWVVXUODUpYROWH
MXLYHGHjODQGXPrPHOLYUHQHVRQWSDVUDWWDFKpV
un passage des Actes, bien sr, mais au rcit de la mort
de Jacques le Juste, qui est narre sur la base de Josphe et
dHgsippe (II, 23). Ce dernier auteur avait dj mis en
rapport ce meurtre avec la destruction de Jrusalem (II, 23,
18) ; Eusbe renforce ce lien laide des citations tires
de Josphe en II, 26 et surtout en III, 5-8. La transition
Josphe commence par lharmonisation entre deux sources
chrtiennes, Hgsippe et Clment dAlexandrie (II, 23,
19) et passe par une citation certainement apocryphe de
-RVqSKH ODTXHOOH DIUPDLW H[SOLFLWHPHQW TXH OD PRUW GH
Jacques avait t la cause de la catastrophe de Jrusalem
(II, 23, 20). Une autre source non chrtienne importante
du livre II est Philon sur les Thrapeutes, interprts par
Eusbe comme des asctes chrtiens (II, 17) : le lien avec
des textes chrtiens est ralis en combinant entre eux
1/ linformation, extraite de Clment, Papias de Hirapolis
et 1 Pierre, sur le rapport entre Marc et Pierre (II, 15) ; 2/ la
WUDGLWLRQ VXUODIRQGDWLRQGHOpJOLVHG$OH[DQGULH
SDU 0DUF ,,   HW  XQH pWUDQJH WUDGLWLRQ  
atteste par le seul Eusbe, sur la connaissance de Pierre
par Philon Rome lpoque de lempereur Claude (II,
17). Ici aussi, en tout cas, les tmoignages non chrtiens ne
VRQWLQVpUpVTXjWLWUHGHFRQUPDWLRQHWGHGpYHORSSHPHQW
de textes chrtiens.
En dautres termes, au livre II, Eusbe construit un
rcit fond sur des sources chrtiennes de deux sortes : en
premier lieu, ce quil considre comme criture, surtout
les Actes des aptres, mais aussi les vangiles et les
lettres ; il peut tre intressant de remarquer au passage
quEusbe ne se rfre pas directement lApocalypse
de Jean comme une source primaire pour construire
sa narration des premires dcennies chrtiennes, bien
quil soit trs intress par le problme de lauteur et de
lautorit canonique du livre et, par consquent, attentif
sa rception. Pour autant que je puisse voir, le passage de
lHistoire o il se rapproche le plus de linclusion, dans
son rcit, dune rfrence lApocalypse est III, 29, 1
au sujet de Nicolas et des Nicolates, mais la mention de
lApocalypse est dans une brve proposition subordonne
( qui est mentionn aussi dans lApocalypse de Jean ),
il ny a aucune allusion au contenu de la notice dans
lApocalypse et toute linformation sur la personne et le
groupe est tire de Clment dAlexandrie (III, 29, 2-4 =
Stromates III, 25, 6-26, 3 ; II, 20, 118, 3). ct des crits
canoniques et dune manire subordonne ceux-ci,
Eusbe a utilis, pour lpoque des disciples de Jsus,
des auteurs juifs et des crivains chrtiens postrieurs qui
pouvaient livrer des informations au sujet de ces temps.

64

ENRICO NORELLI

Anthony Grafton et Megan Williams ont signal


limportance de la perspective synoptique sur lhistoire
adopte par Eusbe dans ses Khronikoi kanones et inspire
des Hexaples dOrigne8. On pourrait se demander si une
pareille suggestion naiderait pas mieux comprendre le
deuxime livre de lHistoire ecclsiastique  OD Q GH
sa table des matires, Eusbe a list les sources quil a
utilises pour lcrire : Clment (dAlexandrie), Tertullien,
)ODYLXV-RVqSKHHW3KLORQ(QIDLWOHOFRQGXFWHXUHQHVW
fourni par les crits canoniques et en premier lieu par
les Actes des aptres ; en outre, Eusbe sest servi aussi
dautres sources, telles que Justin et Irne sur Simon le
Mage (chap. 13). Mais ce qui est intressant est que dune
certaine faon, Eusbe fait dans ce livre quelque chose
qui nest pas trs diffrent dune composition synoptique,
bien que ce ne soit pas sous une forme synoptique.
Prcisment comme dans ses Khronikoi kanones, il adopte
la Bible comme source principale et synchronise avec elle
les donnes puises dans dautres sources et traditions, de
mme, dans ce livre de lHistoire ecclsiastique, il adopte
les Actes des aptres et dautres crits canoniss comme
source principale et synchronise avec eux les auteurs juifs
dun ct et les auteurs chrtiens postrieurs de lautre.
Quoi quil en soit, les observations esquisses jusquici
nous permettent dj quelques remarques. Relisons le
programme bien connu qui ouvre lHistoire ecclsiastique :
[1] Les successions des saints aptres, ainsi que les
temps couls depuis notre Sauveur jusqu nous, toutes
les grandes choses que lon dit avoir t accomplies
le long de lhistoire ecclsiastique ; tous les personnages de cette histoire qui ont excellemment prsid
la conduite des plus illustres diocses ; ceux qui, dans
chaque gnration, ont t par la parole ou par les crits
les ambassadeurs de la parole divine ; les noms, la
qualit, les temps de ceux qui, entrans aux dernires
extrmits de lerreur par le charme de la nouveaut, se
sont faits les hrauts et les introducteurs dune science
mensongre et qui, tels des loups ravisseurs, ont cruellement ravag le troupeau du Christ ; [2] [...] voil ce
que jai entrepris de livrer lcriture. [...]
>@ 3DU VXLWH WRXW FH TXH MHVWLPHUDL SURWDEOH DX EXW
indiqu, je le choisirai parmi les choses quils rapportent
et l ; comme en des prairies spirituelles, je cueillerai
les passages utiles des crivains anciens ; et jessaierai
GHQIDLUHXQFRUSVGDQVXQUpFLWKLVWRULTXH 
  R  -H VHUDLV
heureux de sauver de loubli les successions sinon de
tous les aptres de notre Sauveur, du moins des plus
illustres dentre eux dans les glises qui sont encore
aujourdhui vivantes dans les mmoires9.

8. A. Grafton, M. Williams, Christianity and the Transformation of the


Book. Origen, Eusebius and the Library of Caesarea, Cambridge
(Mass.), Harvard UP, 2006, p. 133-177.
9. HE I, 1, 1-2,4 ; Eusbe de Csare, Histoire ecclsiastique. Livres I-IV,
trad. G. Bardy (SC, 31), Paris, 1952 (rimpr. 1978), p. 3-4.

AnTard , 22, 2014

7DQGLVTXDX(XVqEHVHPEOHDIUPHUTXLOXWLOLVHUD
les auteurs anciens sans distinction, nous avons vu quen
ralit, la structure principale de son rcit dans les livres I
et II est organise par des textes de lcriture. Dans les livres
XOWpULHXUVLOVHIRQGHVXUFHTXLODSSHOOH
 OHV pFULYDLQV RUWKRGR[HV &RPPH LO HVW ELHQ
connu, cest ce groupe idal quEusbe fait appel lorsquil
GRLWGpQLUODXWRULWpGHVOLYUHVTXLVHSUpWHQGHQW DSRVWRliques. Histoire ecclsiastique III, 25 est le locus classicus
avec sa distinction entre les critures vraies, authentiques
HW JpQpUDOHPHQW UHFRQQXHV  VHORQ OD
tradition ecclsiastique, celles qui, bien que non testaPHQWDLUHVPDLVGLVSXWpHV 
VRQWSRXUWDQWHQPrPHWHPSVFRQQXHVGH
la plus part des (auteurs) ecclsiastiques et celles que
personne appartenant la succession des auteurs ecclsiastiques na considres dignes de mention dans ses
crits et qui ont t composes par des hrtiques (III, 25,
 -HQHGLVFXWHUDLSDVLFLOHVSUREOqPHVGLIFLOHVSRVpV
par ce chapitre, mais me limiterai signaler quEusbe
LGHQWLH OD   DYHF OHV pFULWV GHV
DXWHXUV RUWKRGR[HV  FHFL QH VLJQLH SDV TXLO UHSRXVserait la tradition orale, mais seulement que nulle part dans
lHistoire ecclsiastique il ne se rclame de la tradition
RUDOH DQ GDIUPHU RX GH UHIXVHU ODXWRULWp GXQ WH[WH
&HFL HVW SOHLQHPHQW FRKpUHQW DYHF VRQ VRXFL GH YpULHU
quels textes sont cits ou utiliss par les diffrents auteurs
HFFOpVLDVWLTXHV FI pJDOHPHQW ODIUPDWLRQ SURJUDPPDtique en III, 3, 3).
Le tournant dEusbe : le rle central des crits
Une pareille attitude est bien diffrente de la manire
dont Papias de Hirapolis, dans les premires dcennies du
deuxime sicle, avait lgitim lvangile de Marc (et trs
SUREDEOHPHQWDXVVLFHOXLGH0DWWKLHX jODLGHGHODIUmation dun presbytre, cest--dire laide de la tradition
orale (Eusbe, Histoire ecclsiastique III, 39, 15-16). Mais
elle est aussi loigne de celle de Clment dAlexandrie
qui, dans les premires annes du troisime sicle, avait
remarqu, en discutant un agraphon de Jsus : nous
navons pas cette sentence dans les quatre vangiles qui
QRXVRQWpWpWUDQVPLV  PDLVGDQV
celui selon les gyptiens (Stromates III, 13, 93, 1). De
manire analogue, dans un passage de ses Hypotyposes
( esquisses ) perdues, rsum par Eusbe, Histoire
ecclsiastique VI, 14, 5-7, Clment discute la chronologie relative des vangiles et les raisons qui ont amen
jOHXUFRPSRVLWLRQDIUPDQWVXLYUHXQHWUDGLWLRQYHQDQW
des presbytres dantan , Clment dclare que les
vangiles contenant les gnalogies ont t composs
les premiers, aprs quoi il explique les origines des autres.
Ainsi, Clment ne commenait pas par les crits, cest-dire par le fait quil y a un groupe de quatre vangiles

AnTa rd , 2 2 , 2 0 1 4

COMMENT EUSBE CONSTRUIT LA LITTRATURE CHRTIENNE

faisant autorit, qui doit reprsenter la seule rfrence


valable. Sa raison pour attribuer ces quatre un rang
spcial est qu ils nous ont t transmis , sans doute
par ces presbytres quil apprciait tellement et quil considrait comme le chanon reliant les disciples immdiats
de Jsus aux glises. Ainsi, lattention se porte en premier
lieu sur le processus de transmission et sur les porteurs de
la tradition orale.
Mais mme Irne de Lyon, plus intress que Clment
SDUODGpQLWLRQGeFULWXUHVFKUpWLHQQHVGRWpHVGDXWRULWp
ainsi que par la composition prcoce des quatre vangiles,
ne se rclamait pas, en tout cas pas explicitement, de
WpPRLJQDJHV pFULWV DQ GLGHQWLHU FHV eFULWXUHV PDLV
de la tradition apostolique, qui, son avis, tait transmise
seulement travers la succession piscopale dans les
JOLVHV $LQVL LO DIUPDLW TXH 3RO\FDUSH GH 6P\UQH
avait transmis la vraie tradition quil avait entendue des
DS{WUHV  PDLV OH FRQWH[WH GDQV OHTXHO LO IDLW FHWWH DIUmation concerne le lien entre doctrine vraie et succession
des vques et, en fait, Irne mentionne Polycarpe ici
FRPPHXQWUDQVPHWWHXUGqOHGHOHQVHLJQHPHQWDSRVWRlique prcisment en sa qualit dvque et non en celle
de disciple daptres :
4. Mais on peut nommer galement Polycarpe. Non
seulement il fut disciple des aptres et vcut avec
beaucoup de gens qui avaient vu le Seigneur, mais
cest encore par des aptres quil fut tabli, pour lAsie,
comme vque dans lglise de Smyrne. Nous-mme
lavons vu dans notre prime jeunesse car il vcut
longtemps et cest dans une vieillesse avance que, aprs
avoir rendu un glorieux et trs clatant tmoignage, il
sortit de cette vie. Or il enseigna toujours la doctrine qui
est aussi celle que lglise transmet et qui est la seule
vraie. Cest ce dont tmoignent toutes les glises dAsie
et ceux qui jusqu ce jour ont succd Polycarpe,
qui tait un tmoin de la vrit autrement digne de foi
et sr que Valentin, Marcion et tous les autres tenants
dopinions fausses10.

Or le chapitre dEusbe sur Polycarpe cite en entier la


section dIrne qui le concerne, y compris la mention de
sa lettre aux Philippiens (Histoire ecclsiastique IV, 14,
  PDLV GH PDQLqUH VLJQLFDWLYH LO DMRXWH OHV OLJQHV
suivantes :
[9] Quant Polycarpe, dans sa lettre aux Philippiens
dont on vient de parler et qui est conserve jusqu
prsent, il se sert de tmoignages tirs de la premire
ptre de Pierre11.

Pour Eusbe, il est devenu important dasseoir lautorit


GXQ pFULW TXL VH SUpWHQG DSRVWROLTXH HQ YpULDQW VD
rception dans les uvres des crivains ecclsias-

10. Contre les hrsies III, 3, 4 ; Irne de Lyon, Contre les


hrsies. Dnonciation et rfutation de la gnose au nom menteur,
trad. A. Rousseau, 2e d., Paris, 1985, p. 281.
11. HE IV, 14, 9 ; HE trad. G. Bardy, cit. (n. 9), p. 180.

65

tiques. Ainsi, il y a une sorte de circularit : les auteurs


orthodoxes garantissent quun crit est authentiquement
DSRVWROLTXH HW SDU FRQVpTXHQW  PDLV LOV QH
sont orthodoxes que sils adhrent lenseignement
apostolique. Cependant, ce que je souhaite souligner est
le fait que cest un corpus littraire qui permet Eusbe
dvaluer et dorganiser une littrature prtendument
apostolique. Ceci a lieu travers la prsence et lexploitation de cette littrature dans les crits des [hommes]
HFFOpVLDVWLTXHVFRQIRUPHVDX[VXFFHVVLRQV 
   ,,,    R OHV VXFFHVVLRQVQHVLJQLHQWSDVVHXOHPHQWODVXFFHVVLRQpSLVFRSDOH
mme si les vques y sont bien sr inclus.
Si nous revenons la prface de lHistoire ecclsiastique, nous pouvons ajouter queffectivement, lhrsie
est souvent mentionne dans luvre, mais Eusbe
nutilise jamais la littrature originale de ceux quil
pWLTXHWWH FRPPH GHV KpUpWLTXHV DQ GH GpFULUH OHXUV
doctrines. Sous cet angle, il est trs diffrent des hrsioORJXHV GHV WURLVLqPH HW TXDWULqPH VLqFOHV LO VXIW GH
penser lElenchos dun ct, au Panarion dpiphane de
Salamine de lautre). Lorsquil fournit des renseignements
sur les ides des hrtiques, il puise cette information dans
les uvres des crivains orthodoxes . Il est de loin plus
intress par les auteurs qui ont combattu les hrtiques,
plus soucieux de lister les uvres et de les louer pour leurs
combats en dfense de lorthodoxie, que davoir recours
la documentation disponible dans le but de permettre ses
lecteurs de comprendre la pense et les pratiques de ces
hrtiques. En effet, les textes qui nappartiennent pas la
tradition apostolique ou ecclsiastique peuvent tre cits
dans dautres uvres dEusbe pour tre rfuts (comme
cest le cas de Porphyre ou de certains hrtiques), mais
ils ne lui apparaissent simplement pas pertinents dans une
histoire ecclsiastique. Selon Eusbe, ce quil semble,
celle-ci ne doit se fonder que sur des sources ecclsiastiques ou, tout au plus, elle peut avoir recours dautres
sources, comme Flavius Josphe ou Philon, dune manire
OLPLWpHHWVHXOHPHQWSRXUFRQUPHUFHTXLHVWpFULWGDQV
les textes chrtiens les plus anciens et par consquent
rares. Par un autre chemin, cette conclusion converge
avec le rsultat dun article dric Junod qui, en analysant
le programme propos par Eusbe dans la prface de
lHistoire ecclsiastique12, parvient conclure que cet
auteur ne sintresse lhrsie que dans la mesure o
ceci lui permet de montrer que lglise a toujours t et
reste veille, en protgeant ses membres contre le danger
de lhrsie et de la perdition quelle procure.

12. . Junod, Les hrtiques et lhrsie dans le programme de


lHistoire ecclsiastique dEusbe de Csare, dans Rivista di
storia del cristianesimo, 6, 2009, p. 417-434. Sur le traitement des
hrtiques chez Eusbe, voir M. Willing, Eusebius von Csareia als
Hreseograph (Patristische Texte und Studien, 63), Berlin, 2008.

66

ENRICO NORELLI

Ainsi, lHistoire ecclsiastique dEusbe est une


uvre thologique non seulement cause de sa comprhension thologique de lhistoire de lglise, mais
aussi parce quelle est fonde sur un corpus de sources
pralablement slectionn sur le fondement de critres
thologiques. Eusbe est persuad quune histoire de
lglise du Christ ne peut tre correcte que si elle se base
sur des textes chrtiens thologiquement corrects. Ainsi,
il est essentiel pour lui de sassurer que les textes quil
offre ses lecteurs contiennent lenseignement authentique du Christ et de ses aptres. Cest pourquoi, au
livre III, il consacre une attention spciale la transition
du texte oral au texte crit dans la premire et la deuxime
gnration chrtienne. En III, 24, il explique comment les
aptres ont prch et opr des miracles, mais nont pas
essay de mettre par crit lenseignement cause de leur
connaissance imparfaite de la langue et de la rhtorique ;
mme Paul, il nattribue que de trs courtes lettres
  ,,, &HFLH[SOLTXHj
ses yeux, la raison pour laquelle, parmi les douze aptres,
les soixante-dix disciples et beaucoup dautres qui avaient
entendu Jsus, deux seulement, Matthieu et Jean, ont crit
des mmoires du Seigneur, et uniquement par ncessit
(III, 24, 5-16).
La construction du temps de Trajan :
mort des aptres, naissance des hrsies
Mais cest immdiatement aprs les aptres que la
situation change, et cest l que nous avons, me semble-til, un exemple majeur de la manire dont la reprsentation
mise en place par Eusbe articule entre elles lhistoire de
lglise et lhistoire de sa littrature. En fait, des analyses
que je suis en train deffectuer sur les tmoignages externes
concernant Ignace dAntioche me persuadent que le
temps de Trajan reprsente une poque-cl dans lHistoire
ecclsiastique, telle quEusbe la construit. Avant de
conclure, jaimerais baucher quelques remarques ce
sujet, fondes sur des analyses que je dveloppe dans
une traduction commente des lettres dIgnace en cours
dachvement, o lon trouvera lexamen dtaill des
passages auxquels je me rfre ici.
Il est bien connu que dans ses Khronikoi kanones,
Eusbe a mis en place une perscution de Trajan la
troisime, aprs celles de Nron et de Domitien en
runissant trois pisodes dont il avait connaissance. Il
VXIUDLFLGHUDSSHOHUOHWH[WHGHODYHUVLRQGH-pU{PH13.

13. dition R. Helm, Eusebius Werke. Siebenter Band: Die Chronik


des Hieronymus. Hieronymi Chronicon (GCS), Berlin, 1956 (31984),
p. 194-195 : Traiano aduersum XPianos persecutionem mouente
6LPRQ OLXV &OHRSDH TXL LQ +LHURVRO\PLV HSLVFRSDWXP WHQHEDW
FUXFL JLWXU &XL VXFFHGLW ,XVWXV ;, ,JQDWLXV TXRTXH $QWLRFKHQDH

AnTard , 22, 2014

En correspondance de lanne 10 de Trajan, celui-ci a :


Trajan dchanant une perscution contre les chrtiens,
6LPRQ OV GH &OpRSDV TXL DYDLW OD FKDUJH GpYrTXH j
-pUXVDOHPHVWFUXFLp-XVWHOXLVXFFqGH,PPpGLDWHPHQW
aprs, lanne 11 : De mme, Ignace, vque de
lglise dAntioche, amen Rome est jet aux fauves.
Aprs lui est tabli, comme troisime vque, Hron.
Plinius Secundus, gouvernant une province et ayant mis
mort, dans sa fonction, un trs grand nombre de chrtiens,
affol par leur nombre demanda Trajan ce quil fallait
faire, en lui rapportant , etc. ; suit linformation sur la
correspondance entre Pline et Trajan, quEusbe tire du
chap. 2 de lApologtique de Tertullien. On sait que dans
la version armnienne, ces trois vnements sont runis
aprs lanne 2123 dAbraham = 10e de Trajan14, mais
on sait galement quen ltat actuel du dbat, on ne peut
tre nullement sr de lattribution dun vnement donn
une anne prcise dans loriginal des Canons chronologiques. Certainement, Eusbe a situ ces trois pisodes
sous le rgne de Trajan. Il est galement bien connu qu
lanne 2116 dAbraham, soit 3e de Trajan, Jrme a
Lvque Irne crit que laptre Jean resta [en vie]
jusquaux temps de Trajan. Aprs lui, furent clbres
ses auditeurs Papias vque de Hirapolis, Polycarpe de
Smyrne et Ignace dAntioche . Dans larmnien ainsi
que chez Syncelle, Ignace manque ; il a t reconnu
depuis longtemps15 quil a d tre ajout sur le fondement
dHistoire ecclsiastique III, 36, 12, o Polycarpe, Papias
et Ignace sont mentionns ensemble. En Histoire ecclsiastique ,,,  (XVqEH V\QFKURQLVH O G,JQDFH
deuxime vque dAntioche aprs vode, avec Simon,
deuxime vque de Jrusalem aprs Jacques.
Un peu plus loin dans le mme livre, Eusbe raconte
les trois pisodes quil avait voqus dans les Khronikoi
kanones comme tmoignages de la perscution sous
Trajan, mais pas dans le mme ordre. Dabord, en suivant
+pJpVLSSHLOpYRTXH ,,, ODPRUWGH6LPpRQOVGH
Clopas frre de Joseph, donc cousin de Jsus, qui avait
t plac la tte de lglise de Jrusalem aprs la mort
de Jacques, comme Eusbe lavait racont antrieurement
(III, 11) toujours en suivant Hgsippe, qui attribuait

ecclesiae episcopus Romam perductus bestiis traditur. Post quem


tertius constituitur episcopus Heron. Plinius Secundus cum quandam
prouinciam regeret et in magistratu suo plurimos XPianorum
interfecisset, multitudine eorum perterritus quaesisuit de Traiano,
quid facto opus esset, nuntians ei, etc.
14. J. Karst, Eusebius Werke. Fnfter Band: Die Chronik aus dem
Armenischen bersetzt mit textkritischem Kommentar (GCS, 20,
Eusebius Werke, 5), Leipzig, 1911, p. 218-219. Pour une excellente
mise au point sur ltat de la question concernant les Khronikoi kanones
et lvolution entre le projet quils reprsentent et celui de lHistoire
ecclsiastique, voir maintenant O. Andrei, Canons chronologiques et
Histoire ecclsiastique, dans S. Morlet, L. Perrone (dir.), Eusbe de
Csare, cit. (n. 2), p. 33-82.
15. T. Zahn, Ignatius von Antiochien, Gotha, 1873, p. 47.

AnTa rd , 2 2 , 2 0 1 4

COMMENT EUSBE CONSTRUIT LA LITTRATURE CHRTIENNE

la dnonciation de Simon certains hrtiques .


Eusbe ajoute que l, Hgsippe remarquait que jusqu
cette poque, lglise tait reste une vierge pure et non
corrompue ; ceux qui avaient essay de la corrompre,
lavaient fait dans lombre ; mais aprs que tous les
aptres eurent disparu en mme temps que la gnration
de ceux qui avaient pu couter directement Jsus, alors
lerreur athe commena apparatre par la tromperie des
matres de mensonges. Ceux-ci, puisquil ne restait plus
aucun des aptres, sefforcrent dopposer alors visage
dcouvert la gnose au nom trompeur la prdication de la
vrit (III, 32, 8, trad. Bardy). Suivent, chez Eusbe, les
pisodes de Pline le Jeune (III, 33), les courtes notices sur
la succession dvariste Clment Rome en la troisime
anne de Trajan (III, 34) et sur celle de Juste Simon
Jrusalem (III, 35), ensuite la longue notice sur Ignace
(III, 36) qui se termine par la succession de Hros lui.
Dans lHistoire, donc, la transition de la gnration
qui avait directement entendu Jsus celle qui na pu
entendre que les aptres (mais qui, la diffrence de celles
qui lont suivie, les a effectivement entendus), a lieu
lintrieur du rgne de Trajan et cette transition concide
chronologiquement avec la manifestation des hrsies.
Ici, Eusbe met contribution Hgsippe (III, 32, 7-8) :
ce dernier avait attribu certains des hrtiques linitiative qui avait provoqu la mort de Simon et en III, 19
(XVqEHDIUPHTXXQGLVFRXUVDQFLHQ  
attribue certains des hrtiques laccusation contre
les descendants de Jude, qui se situe avant lpisode de
Simon. La citation littrale dHgsippe ce sujet ne
parle pas dhrtiques, mais utilise la troisime personne
du pluriel : ils les accusrent comme appartenant la
famille de David (III, 20, 1), sans doute avec une valeur
impersonnelle. On peut donc hsiter sur lattribution
des hrtiques par Hgsippe de linitiative contre les
descendants de Jude. Toutefois, comme il est bien connu,
dans lpisode de la mort de Jacques le Juste, Hgsippe
mentionne parmi les adversaires de Jacques qui prparent
FHWWHPRUWFHUWDLQVYHQDQWGHVVHSWTXLpWDLHQW
dans le peuple, sur lesquelles jai crit antrieurement
(II, 23, 8). L, il se rfre certainement un passage
quEusbe rapportera ensuite (IV, 22, 4-6) concernant la
succession de Jacques, lorsque Thboutis, du par le fait
de ne pas avoir t choisi la place de Simon de Clopas,
commence la [= lglise] souiller parmi le peuple,
j SDUWLU GHV VHSW  GRQW LO pWDLW DXVVL PHPEUH 
de ces sectes sortirent Simon , etc (liste des hrsies
chrtiennes). Immdiatement aprs, Eusbe rapporte que
OH PrPH +pJpVLSSH LQIRUPDLW pJDOHPHQW VXU OHV 
 TXL DYDLHQW H[LVWp MDGLV SDUPL OHV MXLIV WRXWHV
opposes la tribu de Juda et son Christ (IV, 22, 7).
&HV SDVVDJHV PRQWUHQW TXH ODIUPDWLRQ TXH OeJOLVH
tait appele vierge tait applique par Hgsippe non pas
au temps de Trajan, comme linsinue Eusbe en III, 32, 7
(qui est une synthse et non une citation littrale dHg-

67

sippe, la diffrence de IV, 22, 4-6 et 7), mais bien au temps


de la nomination du successeur de Jacques, donc vers 62,
sous Nron. Cest ce moment quHgsippe situait
OLUUXSWLRQGHVGDQVOeJOLVHHOOHVVDSSHOOHQWDLQVL
parce quelles sont des groupes spars et bien distincts les
XQVGHVDXWUHVGHVTXLH[LVWDLHQWFKH]OHV
juifs et qui ne saccordaient que dans leur opposition la
tribu de Juda et son messie ; dans lpisode de la mort de
-DFTXHVFHVJURXSHVVRQWEHOHWELHQDSSHOpVGHV
le commencement des hrsies chrtiennes est constitu par
le fait que ces groupes pntrent, en changeant de nom,
lintrieur de cette glise du Christ qui tait la continuation
de la tribu de Juda. Cette opposition avait t externe lors de
la mort de Jacques, elle tait devenue interne par laction de
Thboutis lors de llection de Simon comme successeur
de Jacques et elle avait ensuite agi de lintrieur dans les
pisodes successifs de la dnonciation des descendants de
Jude sous Domitien, qui avait chou, et de celle de Simon,
laquelle avait eu succs car elle avait amen la mort de ce
GHUQLHU'DQVFHWWHSHUVSHFWLYHOHVQRQWHXGDXWUH
but, avant et aprs leur pntration dans lglise, que de
sopposer au clan du messie, qui a dabord eu la forme de la
tribu de Juda, ensuite celle de lglise de Jsus.
Il ne sagit pas ici dvaluer cette conception, mais
GH VRXOLJQHU TXH FH WRXUQDQW TXL VpWDLW YpULp VHORQ
Hgsippe au temps de Nron, Eusbe la transfr au
temps de Trajan : lanalyse lexicale du passage o Eusbe
se rfre Hgsippe dans ce but (III, 32, 7-8) montre
de manire clatante que la terminologie ici employe est
celle dEusbe, la diffrence de IV, 22, 4 o Eusbe cite
la lettre le mme passage dHgsippe auquel il avait
renvoy en III, 32. Il opre ce dplacement sans aucun
GRXWHSRXUVLWXHUODQDLVVDQFHGHVKpUpVLHVDSUqVODQGHOD
gnration des aptres qui, daprs lui, ne se termine qu
la mort de Jean de Zbde, quEusbe (Histoire ecclsiastique III, 23, 4) place sous Trajan la suite dIrne
(Contre les hrsies II, 22, 5). En effet, immdiatement
avant le rcit sur la mort de Simon, Eusbe voque
en III, 31 la mort et lenterrement de Jean et de Philippe
HWLOFRQFOXWFHFKDSLWUHHQDIUPDQWTXLODH[SRVpFH
qui est venu notre connaissance concernant les aptres
et les temps apostoliques (III, 31, 6), ce qui marque une
csure explicite par rapport la suite de la narration qui
commence justement en III, 32 par la mort de Simon et
lorigine des hrsies.
Eusbe effectue cette opration de dplacement en
synchronisant deux notices rattaches au temps de Trajan
par les traditions dont il dispose, savoir la mort de Jean
phse (quil tient dIrne) et la mort de Simon de
Clopas (quil tient dHgsippe) et en mettant en rapport
la naissance des hrsies avec cette dernire, transfrant
sur elle ce que la mme source, cest--dire Hgsippe,
rfrait la succession de Jacques, antrieure de plusieurs
dcennies la mort de son successeur Simon. Ainsi, il
bouleverse la conception gnrale des hrsies qui avait

68

ENRICO NORELLI

t celle dHgsippe, en faveur de celle qui stait


impose avec Justin et Irne.
Pourtant, il y a une analogie importante entre Eusbe
et Hgsippe. En effet, lun et lautre situent lorigine des
hrsies immdiatement aprs la disparition du sujet qui
occupait lgitimement la succession de Jsus, en crant,
entre la mort de Jsus et celle de son successeur lgitime,
un segment temporel encore libre de corruption et de
dviation. Seulement, ce successeur lgitime de Jsus
tait bien diffrent dans les deux cas, ce qui correspond
deux mmoires diffrentes des origines, bien entendu
labores dans des milieux diffrents et retenues respectivement par chacun de ces deux auteurs. Pour la tradition
accueillie par Hgsippe, le successeur de Jsus est son
frre Jacques : cest lui qui est le tmoin essentiel, linterprte vridique de sa personne (comme lillustre lpisode
de sa mort o lon sadresse lui pour connatre la vrit
VXU -pVXV TXHOOH TXH VRLW OD VLJQLFDWLRQ GX PRW 
en II, 23, 8. 13) et le porteur autoris de son message.
Pour la tradition accueillie par Eusbe, le successeur et
linterprte autoris de Jsus est le collge des aptres,
LGHQWLpVDYHFOHV'RX]H3RXUDXWDQWTXHQRXVSXLVVLRQV
le voir, les Douze ou les aptres ne sont pas essentiels
dans le complexe de traditions sur lesquelles Hgsippe a
construit sa thorie de lorigine des hrsies, en tout cas
ils napparaissent pas dans ses fragments (la situation sera
diffrente dans les Pseudoclmentines, o le rle central
de Jacques sera combin avec celui des Douze).
Naissance de lhrsie et naissance
de la littrature chrtienne
Or parmi les personnages traits par Eusbe aprs le
tournant que je viens de mentionner, il y a justement Ignace
dAntioche, dont Eusbe a lu les lettres dont il rapporte
des extraits (III, 36). La slection des informations et des
extraits concernant Ignace est bien entendu dtermine
par les sujets quEusbe lui-mme a mentionns comme
tant centraux dans son Histoire : les hrsies, la tradition
des aptres, les noms des vques, le martyre, le recours
GHVpFULWVTXLQDSSDUWLHQQHQWSDVjODOHVpFULWV
GX SHUVRQQDJH HQ TXHVWLRQ ,O PH VXIUD GH VRXOLJQHU
TXHODPHQWLRQQpHGHX[IRLVSDU,JQDFH eSK
2 ; Tr 6, 1 ; manque chez Ignace), toujours
DX VLQJXOLHU HW DYHF XQH VLJQLFDWLRQ TXL ELHQ TXHOOH
contienne laspect de la dviation doctrinale, retient
en premier lieu celui de la division interne aux glises,
SHUPHW j (XVqEH GDIUPHU TX,JQDFH PHWWDLW HQ JDUGH
FRQWUHOHVKpUpVLHVTXLFRPPHQoDLHQWjVDIUPHUDYHF
arrogance ; et ce quIgnace crit contre elles ne saurait
tre, pour Eusbe, autre chose que la tradition des
DS{WUHVDORUVTXHOHPRWVLLPSRUWDQWSRXU
Eusbe (40 occurrences dans lHistoire ecclsiastique),
est absent des lettres dIgnace. En fait, Eusbe propose

AnTard , 22, 2014

la lutte contre les hrsies comme le motif absolument


dominant dans les lettres dIgnace :
Et tandis quil faisait le voyage travers lAsie [], il
affermissait les glises par ses entretiens et ses exhortations dans toutes les villes o il passait. Et dabord,
LO OHV PHWWDLW VXUWRXW HQ JDUGH   
FRQWUHOHVKpUpVLHVTXLFRPPHQoDLHQW
alors abonder ; il les pressait de tenir fermement la
tradition des aptres que, pour plus de scurit, il estima
QpFHVVDLUHGH[HUHQFRUHSDUpFULWLOpWDLWGpMjHQWUDLQ
de rendre tmoignage (III, 36, 4 trad. G. Bardy).

Cest ici que la notice sur Ignace croise la perspective


densemble sur larticulation entre poque apostolique et
post-apostolique chez Eusbe.
Il est intressant dobserver comment Eusbe gre cette
perspective prcisment au dbut du chapitre sur Ignace
(III, 36, 1-2). Il introduit trois personnages, Polycarpe,
Papias et Ignace, mais, la diffrence de ce quoi on
pourrait sattendre vu quils sont parmi les premiers tre
nomms aprs la mention de la disparition des derniers
aptres (chap. 31), il ne prsente que Polycarpe comme
un disciple direct daptres. Par rapport aux Khronikoi
kanones, o il avait prsent Polycarpe et Papias comme
disciples de Jean, Eusbe, on le sait, semble avoir
chang davis en ce qui concerne Papias, dont il souligne
dsormais (III, 39) quil na pas t disciple daptres,
sans doute cause de son millnarisme16. Comme nous
lavons constat, certains dveloppements des Khronikoi
kanones sont alls dans la direction oppose, ajoutant
mme Ignace comme disciple de Jean. Il est remarquable
que dans lHistoire, Eusbe ne le prsente pas comme
tel, vraisemblablement parce quil navait pas dinformations ce sujet, alors quil se soucie en revanche de
lencadrer dans cette articulation cruciale qui se produit
DSUqV OD GLVSDULWLRQ GHV DS{WUHV (Q HIIHW DQ TXH OH
message de ces derniers ne soit pas perdu, il fallait que des
hommes la foi prouve le transmettent aux gnrations
ultrieures, par leur parole mais surtout par leurs crits.
Cest ce quEusbe explique :
III, 37, 4 : Il nous serait impossible dnumrer (et de
citer) par leurs noms tous ceux qui alors, du temps de la
premire succession des aptres, devinrent pasteurs ou
vanglistes dans les glises du monde. Nous navons
GRQF FRQp j OpFULWXUH HQ HQ FLWDQW OHV QRPV TXH OH
souvenir de ceux par les ouvrages desquels maintenant
encore est transmise jusqu nous la tradition de lenseignement apostolique. 38, 1 : Tels sont sans doute
Ignace, dans les lettres que nous avons indiques, et
Clment dans la lettre, reue de tous, quil adressa au
nom de lglise des Romains lglise des Corinthiens
(trad. G. Bardy).

16. On peut voir sur ce point E. Norelli, Papia di Hierapolis: Esposizione


degli oracoli del Signore. I frammenti (Letture cristiane del primo
millennio, 36), Milano, 2005, p. 222-229.

AnTa rd , 2 2 , 2 0 1 4

COMMENT EUSBE CONSTRUIT LA LITTRATURE CHRTIENNE

Il est important de se souvenir que pour Eusbe, les


aptres ont transmis lenseignement du Seigneur non
seulement par la parole orale, mais par des crits qui ont
t conservs, et quil attribue une grande importance ce
fait, comme le prouve son intrt pour les crits authentiquement apostoliques : ce nest pas par hasard que ce
soit en III, 25, cest--dire peu avant la conclusion de
cette poque apostolique idalise, encore libre de toute
FRUUXSWLRQ TX(XVqEH GLVFXWH OHV OLYUHV 
 HW IUDQFKHPHQW KpUpWLTXHV (Q GDXWUHV
termes, les aptres ont laiss leur enseignement par crit
de sorte quil puisse tre transmis sans altration aux
gnrations ultrieures des croyants. Et pourtant, Eusbe
considre comme fondamentale, pour cette priode
dcisive qui suit la mort des aptres, non seulement la
succession des vques aux aptres, mais aussi la composition, par des hommes illustres de la premire gnration
postapostolique, dcrits aptes transmettre la tradition
des aptres. Ladjectif saine ajout rgle de la
tradition des aptres en III, 32, 7 montre que limportance de ces crits rsidait dans leur but dopposer
explicitement la tradition apostolique aux hrsies, en
atteignant directement les glises touches par les hrsies
elles-mmes, ce que les crits apostoliques, antrieurs
la manifestation des hrsies, navaient bien sr pas pu
raliser. Cest l le rle attribu entre autres Ignace et
VHVOHWWUHVjODQGHODVHFWLRQVXU&OpPHQWGH5RPHOD
conclusion du chapitre 38 reprend les noms des crivains
qui viennent dtre prsents et dont les crits ont transmis
la tradition des aptres : Lcrit reconnu de Clment se
distingue donc avec vidence, et il a t parl galement
de ceux dIgnace et de Polycarpe ; 39, 1 de Papias,
quant lui, sont transmis cinq livres, qui sont intituls
[Livres] dexposition des oracles du Seigneur (III, 38,
4-39, 1 ; ma traduction). Ici, la constellation se dessine
un peu autrement : ce sont dsormais Clment, Ignace et
Polycarpe qui sont runis, alors que Papias est lgrement
pouss de ct et le chapitre qui lui est consacr sera
travers par la tension entre lintrt, pour Eusbe, de
certaines notices quil a transmises et lexigence de le
prsenter comme un homme lintelligence limite, qui
a compris de travers les crits apostoliques (il sagit bien
sr de lApocalypse) (III, 39, 11-13).
Le changement de perspective par rapport Papias est
FODLUFHGHUQLHUDYDLWpWpHUGrWUHUHPRQWpDX[GLVFLSOHV

69

de Jsus travers la tradition orale et ce quil dit des


vangiles de Marc et Matthieu sapplique les lgitimer,
mais en mme temps les relativiser en en signalant les
limites. Pour Eusbe, ce qui compte, cest, dfaut de
lcoute directe des aptres, ladhsion leurs livres : la
 WUDGLWLRQ QRQ pFULWH    D DSSRUWp
Papias certaines paraboles du Sauveur, et des enseignements de lui, qui sont tranges, ainsi que dautres
choses encore plus [ou : bien] fabuleuses (III, 39, 11) et
TXDQWjFHTXLODIUPHDYRLUUHoXG$ULVWLRQHWGH-HDQ
le Presbytre, encore que disciples du Seigneur, on peut
UHQYR\HUOHVjOHOLUHVLOVHQRQWHQYLH ,,,
39, 14) ; lessentiel est que Papias a compris de travers
 OHV H[SRVLWLRQV GHV DS{WUHV    
dans ce cas lApocalypse de Jean. Et sil a mal compris
les livres apostoliques, on ne peut pas compter sur lui. Qui
veut transmettre la tradition des aptres ds la premire
gnration aprs leur mort, doit avant tout comprendre
leurs crits, et surtout les transmettre : en III, 37, 2,
Eusbe dcrit les disciples de cette premire gnration
aprs les aptres en lacte de quitter leurs biens, aprs
quoi ils accomplissaient luvre dvanglistes, avec
lambition de prcher, ceux qui nen avaient encore rien
entendu, la parole de la foi et de transmettre les livres des
vangiles divins (III, 37, 2) : partir de cette poque,
transmettre lvangile est ncessairement aussi transmettre les vangiles. Et il faut galement que les crits de
ces successeurs des aptres soient leur tour reconnus.
,O HVW LQWpUHVVDQW GH UHPDUTXHU TXH GDQV FHWWH QDOH GX
chapitre 38 que je viens de citer, il est question de lcrit
UHFRQQX  GH&OpPHQWGH5RPH
TXLHVWFODLUHPHQWGLVWLQJXpGHVDXWUHVSRXU
les crits postapostoliques, on continue dappliquer le
PrPH FULWqUH FHOXL GrWUH  TX(XVqEH
avait appliqu peu avant aux crits apostoliques.
Nous voici la racine dune littrature chrtienne
GDSUqV (XVqEH  HOOH GRLW rWUH GqOH DX[ pFULWV DSRVWRliques et actualiser lenseignement de ces derniers dans le
cadre de la lutte contre les hrsies. Son commencement
se situe prcisment cette poque de Trajan qui marque
la charnire entre temps des aptres et temps postrieur.
Nous sommes ainsi renvoys la construction en miroir
de lhistoire de lglise et de la littrature de lglise.
Universit de Genve

AnTard , 22, 2014, p. 71- 77


DOI 10.1484/J.AT.5.103176

LHISTOIRE ECCLSIASTIQUE DEUSBE


OU LA PRSENCE DES UVRES PERDUES*
5*

The Ecclesiastical History of Eusebius or the presence of lost works


A commentary on the Ecclesiastical History of Eusebius requires a discussion of the text as a memorial work,
and its examination from the perspective of Cultural History, so dear to the Anglo-Saxons. Indeed, the Ecclesiastical
History goes beyond a mere collection of extant documentation: it skillfully interweaves quotations and allusions
so as to present them as meaningful literary / historical traces. The disposition of these traces, along with some
literary / historical grey areas that they tend to produce, has had unfortunate consequences on subsequent research,
which has tried to make the text into something that it is not. Thus, there is all the more reason to re-examine these
traces which this article can only outline while also heeding the silences in the text where Eusebius allowed his
Ecclesiastical History to resonate with the lack of certain documents that he could not access. [Author]

Pour les historiens du christianisme antique, lHistoire


ecclsiastique dEusbe de Csare constitue un gisement
inespr dvnements, de personnages et de textes, pour
lesquels cette uvre constitue souvent un accs privilgi,
sinon lunique accs. Il nest ds lors pas surprenant que
cette uvre soit utilise comme une source de matriaux
permettant de reconstruire la gense et lvolution du
christianisme antique, mais la tentation est grande en ce
cas dy recourir comme le sculpteur visitant une carrire :
de prendre un morceau de choix en ngligeant les autres
pices et en ne sintressant gure au contexte duquel il a
pWpH[WUDLWGHFXHLOOLUGHVHXUVGDQVGHVSUDLULHVSRXU
reprendre une image utilise par Eusbe lui-mme1.
Le projet dun commentaire de lHistoire ecclsiastique va heureusement contre-courant de cette tendance
trop frquente ; les tudes dintroduction rcemment

* Ce titre est un clin dil volontaire au livre stimulant de J. Schlanger,


Prsence des uvres perdues (Savoir. Lettres), Paris, 2010.
1. Eusbe de Csare, Histoire ecclsiastique I, 1, 4 : comme en des
SUDLULHV VSLULWXHOOHV MDL FXHLOOL WHOOHV GHV HXUV OHV SDVVDJHV XWLOHV
des crivains anciens (Eusbe de Csare, Histoire ecclsiastique,
trad. G. Bardy revue par L. Neyrand et une quipe [Sagesses
chrtiennes], Paris, 2003, p. 41).

parues en tmoignent amplement2 : loin de considrer


lHistoire ecclsiastique comme un simple rservoir de
documents et dinformations, elles tentent de comprendre
son histoire, son architecture et ses lignes de force. De
ce fait, elles refont de lHistoire ecclsiastique dEusbe
de Csare un document part entire, qui mrite en tant
que tel dtre exploit par lhistorien.
Cette uvre a, comme le rappelle Olivier Munnich,
lallure dune vritable bibliothque littraire 3, tant
les mentions de personnalits littraires et duvres y
abondent. Il est dautant plus tonnant que la faon dont
ces noms sont mis en scne par Eusbe dans son Histoire
ecclsiastique nait pas davantage t analyse4. Or,
commenter lHistoire ecclsiastique dEusbe de Csare

2. S. Morlet, L. Perrone (dir.), Eusbe de Csare. Histoire ecclsiastique.


Commentaire, 1. tudes dintroduction (Anagg, 6), Paris, 2012.
3. O. Munnich, Index des citations et allusions dans lHistoire ecclsiastique,
dans S. Morlet, L. Perrone (dir.), Eusbe de Csare, cit. (n. 2), p. 285.
4. Cf. toutefois B. Gustafsson, Eusebius Principles in Handling his
Sources, as Found in his Church History, Book I-VII, dans Studia
Patristica, 4, 1961, p. 429-441 ; D. Gonnet, Lacte de citer dans
lHistoire ecclsiastique dEusbe de Csare, dans B. Pouderon,
Y.-M. Duval (dir.), Lhistoriographie de lglise des premiers sicles
(Thologie historique, 114), Paris, 2001, p. 181-193.

72

RMI GOUNELLE

impose de sinterroger sur lacte mmorial accompli par


Eusbe et de ltudier dans une perspective dhistoire de
la culture, chre aux anglo-saxons. Par les citations et
allusions quelle propose5, lHistoire ecclsiastique fait
en effet plus que conserver des documents antrieurs : elle
les rend prsents aux chrtiens du e sicle et des temps
IXWXUV  HOOH OHV FRQVWLWXH FRPPH WUDFHV VLJQLDQWHV6 ;
lHistoire ecclsiastique FRQVWLWXH SDU Oj PrPH XQ OWUH
fondamental, qui contrle encore en grande partie laccs
au christianisme antique et ce mme si elle constitue
elle-mme un texte mouvant, dont lhistoire est complexe.
Comme le rappellent plusieurs auteurs de lintroduction
au commentaire de lHistoire ecclsiastique7, la composition de cette uvre sest en effet tale dans le temps ;
des traces de corrections et de retouches sont manifestes,
particulirement dans les livres VIII-X, qui mnent le
lecteur de la veille de la Grande perscution jusqu la
mort de Licinius et il semble clair que les premiers livres
ne sont pas rests indemnes au cours de ces rvisions. Pour
lhistorien qui cherche replacer prcisment les propos
G(XVqEH HQ OHXU WHPSV LO \ D Oj XQH UpHOOH GLIFXOWp
Lhistorien de la culture pourra, quant lui, se satisfaire
dun constat paradoxal, qui ne rsout bien videmment
rien : recueil duvres perdues, lHistoire ecclsiastique
est perdue dans sa forme originelle.

AnTard , 22, 2014

de Justin qu un trs grand nombre dautres travaux


du mme auteur subsistent chez de nombreux frres 8 ;
(XVqEH DIUPH LFL FODLUHPHQW OH FDUDFWqUH VpOHFWLI GH VD
dmarche, ce qui est tout fait cohrent avec louverture
de son uvre9. Dautre part, comme le rappelle Sbastien
Morlet10, Eusbe avait recueilli des documents dans ses
autres uvres, notamment dans les Questions vangliques, mal conserves, ou dans son Recueil des anciens
martyrs, perdu, auquel Eusbe renvoie explicitement son
lecteur dans lHistoire ecclsiastique : Le texte intgral
du rcit trs complet de ces vnements, nous lavons mis
en entier dans le Recueil des martyrs. [] Jai fait un
choix de ce qui peut convenir cet ouvrage-ci 11.
Eusbe est donc bien conscient de ne pas recueillir,
dans son Histoire ecclsiastique, lensemble du savoir ou
des crits de son poque et son uvre ne constituait pas, au
e sicle, une source aussi essentielle et unique quelle lest
devenue au cours du temps, ses lecteurs ayant la possibilit
de se tourner vers dautres pans de luvre eusbienne
pour ne pas parler dautres crits en circulation. uvre
singulire en son temps, lHistoire ecclsiastique est
devenue de plus en plus incontournable au fur et mesure
TXHOHVDXWUHVVRXUFHVGRFXPHQWDLUHVVHVRQWUDUppHV
Un processus de rarfaction dj avanc

LHistoire ecclsiastique : un prisme dform


Mais avant toutes choses, il est ncessaire de rappeler
une vidence : si lHistoire ecclsiastique constitue
aujourdhui une mine dinformations indites sur les
premiers sicles du christianisme, il nen tait pas de
mme au e sicle.
Une documentation moins originale
pour les contemporains
Une partie de la documentation runie par Eusbe
de Csare tait, en effet, assez largement accessible
ses contemporains ; cest, du moins, ce dont tmoigne
Eusbe en personne lorsquil crit, par exemple, propos

5. Cf. O. Munnich, Index, cit. (n. 3), p. 285-303. On notera lomission


des Actes de Pierre, cits dans lHistoire ecclsiastique III, 3, 2, dans
ce prcieux index. Cf. aussi infra (n. 69).
6. Le terme traces renvoie la conception de lhistoire comme
une connaissance par traces, que M. Bloch attribue Franois
Simiand dans son Apologie pour lhistoire ou Mtier dhistorien
3DULVS HQUDLVRQGXQODSVXVVLJQLFDWLIFRPPHOH
prcise G. Noiriel, Pour une approche subjectiviste du social, dans
Annales SC, 44/6, 1989, p. 1435-1459 (p. 1459, n. 69) ; cette notion
est en ralit de C. Seignobos, La mthode historique applique aux
sciences sociales, Paris, 1909, p. 3.
7. S. Morlet, L. Perrone (dir.), Eusbe de Csare, cit. (n. 2), p. 285.

Le processus de rarfaction de la mmoire chrtienne


avait commenc au e sicle et Eusbe en avait conscience.
Il prcise en effet : je serais heureux de sauver de loubli
les successions sinon de tous les aptres de notre Sauveur,
du moins des plus illustres dentre eux dans les glises
clbres qui sont encore aujourdhui vivantes dans les
mmoires 12. Eusbe est ici conscient que le patrimoine
ecclsiastique sest dj rduit et quun certain nombre
dinformations auxquelles lui-mme a accs sont en train
de disparatre. Mme si ces questions ne sont pas formellement thmatises dans lHistoire ecclsiastique, elles y
VRXUGHQWSDUIRLVFRPPHORUVTXH(XVqEHDIUPHjSURSRV
de Srapion : de lactivit littraire de Srapion dautres
documents sont vraisemblablement conservs par dautres,

8. HE IV.18.8 ; HE trad. G. Bardy, cit. (n. 1), p. 227. Cf. aussi les
exemples cits dans A. Carriker, The Library of Eusebius of Caesarea
(Supplements to Vigiliae Christianae, 67), Leide, 2003, p. 55.
9. HE I.1.4 ; HE trad. G Bardy cit. (n. 1), p. 41. Ce caractre slectif sera
encore plus explicitement exprim en VIII, 2-3, dans un passage o,
toutefois, Eusbe sappuie sur des tmoignages contemporains et non
sur des sources crites.
10. S. Morlet, (XVqEH GH &pVDUpH  ELRJUDSKLH FKURQRORJLH SURO
intellectuel, dans S. Morlet, L. Perrone (dir.), Eusbe de Csare,
cit. (n. 2), p. 17, n. 100, o il faut corriger V, 2, 5 par les rfrences
mentionnes ci-dessous.
11. HE V, prf., 2 ; HE trad. G. Bardy, cit. (n. 1), p. 246-247. Cf. aussi
HE IV, 15, 47 ; V, 4, 3 ; V, 21, 5.
12. HE I, 1, 4 ; HE trad. G. Bardy, cit. (n. 1), p. 41.

AnTa rd , 2 2 , 2 0 1 4

LHISTOIRE ECCLSIASTIQUE DEUSBE OU LA PRSENCE DES UVRES PERDUES

mais nous ne sont parvenus que les crits [...]13 ou,


propos dApollinaire dHirapolis : beaucoup dcrits ont
t conservs chez beaucoup de gens. Voici ceux qui sont
parvenus jusqu nous 14, ou encore lorsquil donne la
liste des ouvrages dont il a pu prendre connaissance personnellement, conscient quil est quil y en a dautres qui ont
d lui chapper15. On peut bien entendu sinterroger sur les
expressions utilises par Eusbe : a-t-il connaissance, dans
tous ces cas, dautres crits, auquel il na pu avoir accs,
ou suppose-t-il, vu le peu de documents en sa possession et
limportance quil octroie aux auteurs ecclsiastiques, que
dautres documents existent par ailleurs ? Sil est souvent
impossible de trancher cette question, des sources externes
SHUPHWWHQWGHYpULHUGDQVFHUWDLQVFDVOHVSURSRVG(XVqEH
Ainsi, pour ce qui concerne Apollinaire dHirapolis, le
Chronicon paschale transmet-il un fragment dun trait
Sur la Pque, absent de la liste des uvres de lHistoire
ecclsiastique16. Il faut donc admettre que non seulement
lauteur de lHistoire ecclsiastique sait quil na pas accs
lensemble de la documentation existante de son temps,
mais quil na pas non plus cherch runir cette dernire.
En ralit, les recueils pr-constitus auxquels Eusbe
a eu accs semblent avoir en grande partie conditionn
son accs la littrature chrtienne17. Ainsi, si Eusbe
mentionne Brylle de Bostra dans son Histoire ecclsiastique, cest dune part parce quil a t rfut par Origne18,
mais dautre part et peut-tre surtout en raison de la
prsence, Jrusalem, darchives19. Eusbe DIUPH HQ
effet explicitement que cest grce aux dossiers de lettres
runis par lvque Alexandre qu[il a] pu rassembler
en un seul corps la matire de [son] sujet 20. Cest dans
ces archives et probablement nulle part ailleurs quil a
trouv la trace de Brylle de Bostra.
Un rapport dcroissant la littrature
Si Eusbe avait peru la rarfaction de la mmoire
chrtienne et avait tent den sauver une partie (mais
non la totalit), il ntait en revanche probablement
pas conscient quun sort similaire attendait les uvres
composes de son temps. Cest, du moins, ce que lon

13. HE VI, 12, 1 ; HE trad. G. Bardy, cit. (n. 1), p. 330.


14. HE IV, 27 ; HE trad. G. Bardy, cit. (n. 1), p. 240. Cf. aussi HE VI, 22.
15. HE V, 27.
16. Cf. B. Pouderon, Les crits apologtiques, dans B. Pouderon,
E. Norelli (dir.), Histoire de la littrature grecque chrtienne, 2. De
Paul aptre Irne de Lyon (Initiation aux Pres de lglise), Paris,
2013, p. 729.
17. Cf. H. Gamble, Livres et lecteurs aux premiers temps du christianisme.
Usage et production des textes chrtiens antiques (Christianismes
antiques) (trad. P. Renaud-Grosbras), Genve, 2012, p. 214-216.
18. HE VI, 20, 2.
19. HE VI, 20, 1.
20. HE VI, 20, 1.

73

peut conclure de lintrt dcroissant dEusbe pour les


GRFXPHQWVQRQRIFLHOVGDQVVRQHistoire ecclsiastique.
partir du livre VII, qui souvre sur la mort de Dce, les
mentions duvres littraires deviennent en effet moins
nombreuses et se rduisent le plus souvent des renvois
j GHV OHWWUHV HW GDXWUHV GRFXPHQWV j FDUDFWqUH RIFLHO
De ce fait, les livres VII X ont beaucoup moins lallure
dune bibliothque littraire que les six premiers ; ce sont
eux qui inspireront dailleurs les continuateurs dEusbe,
notamment Sozomne et Thodoret de Cyr, qui citent
volontiers des documents, mais en se limitant le plus
VRXYHQWDX[VRXUFHVRIFLHOOHVHWpSLVWRODLUHV
LHistoire ecclsiastique : un prisme dformant
Limportance des informations recueillies dans
lHistoire ecclsiastique pour lhistorien ne correspond
pas ncessairement la faon dont Eusbe en a rendu
compte et inversement. Si une telle distinction va de soi,
sa dclinaison peut aboutir des rsultats pour le moins
surprenants, car, comme le rappelle Sbastien Morlet
au dbut du volume dintroduction au commentaire de
lHistoire ecclsiastique, Eusbe nest ni un citateur
passif , ni un compilateur totalement scrupuleux , sa
faon de citer [tant] rarement sans arrire-pense 21, et il
arrive que les historiens ne soient pas arrivs se distancer
VXIVDPPHQW GH FH SULVPH GpIRUPDQW &HVW FH TXH
montre le cas de Srapion, huitime vque dAntioche
de Syrie22. Mentionn plusieurs reprises dans lHistoire
ecclsiastique (V, 19, 1-3 ; V, 22 ; VI, 11, 4 ; VI, 12), il
ne joue quun rle trs mineur dans les patrologies, qui
se contentent la plupart du temps de signaler limportance de son trait Sur lvangile de Pierre, quEusbe
mentionne, aux ct de ses autres uvres, dans la notice
quil consacre luvre de lvque antiochien (VI, 12).
Lexemple de Srapion montre que la perception quont
les historiens dun crit dpend moins de limportance
quil a effectivement eue en son temps et mme du sort
qui lui a t accord dans lHistoire ecclsiastiqueVRUW
HQJUDQGHSDUWLHSUpGpQLSDUODUDUpIDFWLRQGHVVRXUFHV
GRQW(XVqEHOXLPrPHDVXELOHVFRQVpTXHQFHVTXHGH
son caractre singulier.
Une information lacunaire
Lpisode voqu au sixime livre de lHistoire
ecclsiastique met en scne Srapion et des chrtiens de
Rhossos, qui lui avaient demand son avis sur lvangile

21. S. Morlet, Eusbe de Csare, cit. (n. 11), p. 26.


22. Cf. HE V, 19, 1.

74

AnTard , 22, 2014

RMI GOUNELLE

de Pierre23. $\DQWQLSDUOHPSUXQWHUDXSUqVGHFKUpWLHQV
htrodoxes, Srapion lut ce texte et estima quil ne
pouvait tre de Pierre.
Sans lHistoire ecclsiastique, le trait de Srapion
aurait entirement sombr dans loubli24. Seules subsistent
en effet de ce trait les quelques lignes quEusbe en a
FLWpHV 0DLV OD Q GH OD FLWDWLRQ HVW SDUWLFXOLqUHPHQW
abrupte : Srapion crit que, dans lvangile de Pierre,
certains passages ont t ajouts par rapport la
vritable doctrine du Sauveur ; passages que nous
avons placs pour vous ci-dessous . Eusbe ou ses
aides naurait pas dcoup sa citation autrement sil
avait voulu attirer lattention du lecteur moderne sur
ce document : il indique la prsence, dans le trait de
Srapion, dune liste de citations, peut-tre commentes,
de lvangile de Pierre, tout en se gardant de la reproduire.
Ce nest pas le seul cas o Eusbe interrompt des
citations de faon surprenante. Emanuella Prinzivalli en
relve dautres exemples, soulignant que ces omissions
ont gnralement pour but de taire ce qui nest pas utile,
notamment tout ce qui touche aux dissensions internes
lglise25. Peut-tre le dtail de largumentation de
Srapion paraissait-il peu utile Eusbe qui navait pas
la mme perspective quun piphane de Salamine mais
le simple fait que lvangile de Pierre ait t suspect
GKpUpVLH VXIW j OXL VHXO j H[SOLTXHU SRXUTXRL (XVqEH
nen cite pas une ligne.
Il nen reste pas moins quil est possible de se demander
pourquoi lauteur de lHistoire ecclsiastique a gard cette
PHQWLRQQDOHTXLDWWLVHODFXULRVLWpGXOHFWHXUPRGHUQHHQ
raison du principe selon lequel cest quand on apprend
la fois lexistence pralable dune donne et labolition de
cette donne, que le sentiment du dommage ressort vif 26.
Il est certes possible dvoquer le nombre de citations
tonnamment dcoupes par Eusbe, comme tmoignage
possible du travail maladroit dassistants27. Mais une
explication plus satisfaisante est trouver dans la faon

23. Eusbe de Csare, Histoire ecclsiastique VI, 12. Sur ce passage de


lHistoire ecclsiastique, cf. . Junod, Eusbe de Csare. Srapion
dAntioche et lvangile de Pierre, dans Rivista di storia e letteratura
religiosa, 24/1, 1988, p. 3-16 ; Comment lvangile de Pierre sest trouv
cart des lectures de lglise dans les annes 200 ?, dans J.-D. Kaestli,
D. Marguerat (dir.), Le mystre apocryphe. Introduction une littrature
mconnue (Essais bibliques, 26), Genve, 1995, p. 43-46 (2e d., 2007,
p. 45-48) ; 3VHXGpSLJUDSKH FKH]'HQ\VG+DOLFDUQDVVH
et Srapion dAntioche. Les premiers emplois dun terme rare, dans
Warszawskie Studia Teologiczne, 20, 2007 [=Miscellanea patristica
reverendissimo domino Marco Starowieyski septuagenario professori
illustrissimo viro amplissimo ac doctissimo oblata], p. 177-184.
24. HE VI, 12, 6 ; HE trad. G. Bardy, cit. (n. 1), p. 331.
25. E. Prinzivalli, Le genre historiographique de lHistoire ecclsiastique,
dans S. Morlet, L. Perrone (dir.), Eusbe de Csare, cit. (n. 2), p. 107108.
26. J. Schlanger, Prsence des uvres perdues (Savoir. Lettres), Paris,
2010, p. 196.
27. Cf. ainsi par ex. T.D. Barnes, Constantine and Eusebius, Londres,
1981, p. 141.

avec laquelle Eusbe cherche donner lautorit requise


aux documents quil invoque : il atteste, comme il le fait
dans dautres cas28, que Srapion a mthodiquement rfut
lhrsie, sans pour autant donner corps cette dernire.
Une histoire ( tort ?) emblmatique
La citation du trait de Srapion Sur lvangile de
Pierre a eu un retentissement important dans la recherche,
lhistoire de Srapion tant devenue emblmatique du
processus de canonisation des vangiles. Pourtant, on ne
peut dterminer en aucune manire quel a t son impact
rel : si sa prsence dans la bibliothque de Csare laisse
entendre quil a t diffus29, a-t-il jou un rle vritable
dans les discussions sur les textes retenir ? Puisque Eusbe
est le seul en faire mention et que lvangile de Pierre na
cess de rayonner en Syrie jusqu une date relativement
tardive, il est possible que le trait de Srapion nait eu
quun impact trs local. Plus fondamentalement, lhistoire
rapporte par Eusbe est-elle exceptionnelle ou de telles
LQWHUSHOODWLRQVGHGqOHVpWDLHQWHOOHVPRQQDLHFRXUDQWH"
Et largumentation de Srapion tait-elle originale ?
ces questions, aucune rponse un tant soit peu
prcise ne peut tre apporte, puisque lhistorien na pas
de sources mettre en srie avec le rcit eusbien. On peut
toutefois exclure quEusbe ait cit cet pisode avec une
vise dexemplarit ; la citation quil a retenue du trait de
Srapion est en effet mettre en cho avec sa volont de
FODULHUOKpULWDJHSpWULQLHQ30 et est entirement contextualise dans la prsentation des uvres de Srapion, Eusbe
ne lui donnant aucune valeur particulire dans lhistoire du
canon ou de la diffusion de lvangile de Pierre31. Mais,
faute dautres documents similaires, la citation dEusbe,
motive par le souci quil avait de faire le tri dans la littrature circulant sous le nom de Pierre, a fait du trait de
Srapion un document fondamental pour les historiens et
lui a donn une importance probablement disproportionne
par rapport au rle quil a effectivement jou.
'HVWUDFHVVLJQLDQWHV
Bien quil commence par prciser quil ne connat probablement pas luvre de Srapion dans toute son tendue,
Eusbe de Csare note quil avait aussi connaissance dun

28. Cf. par ex. HE V, 18, 14. Cf. aussi, pour une ellipse similaire, HE V,
19, 4.
29. Cf. A. Carriker, The Library, cit. (n. 9), p. 257.
30. Cf. HE III, 3, 1-3, o Eusbe prcise que seule la premire lettre de
Pierre est authentique, que la seconde nest pas de Pierre mais est
utile et que les autres textes qui ont circul sous son nom sont
des faux.
31. Cf. HE VI, 12, 1-2.

AnTa rd , 2 2 , 2 0 1 4

LHISTOIRE ECCLSIASTIQUE DEUSBE OU LA PRSENCE DES UVRES PERDUES

trait adress Domnus, un chrtien qui stait converti au


judasme en temps de perscution, une lettre Pontius et
Carinus, KRPPHVHFFOpVLDVWLTXHVGRQWLODYDLWGpMj
donn quelques extraits au livre V de son Histoire ecclsiastique32, dans le cadre de son inventaire des ouvrages rfutant
le montanisme, car Srapion y fait mention dun courrier de
Claude Apollinaire dHirapolis rfutant lhrsie cataphrygienne33 et dautres lettres de Srapion34.
Les citations quEusbe retient de la lettre de Srapion
dans le livre V montrent que son contenu ne lintressait
pas : il ne retient que lintroduction que lvque dAntioche
donne la lettre de Claude Apollinaire et il reproduit la
signature de deux vques, tout en signalant quil y en avait
dautres. Ces citations ont pour seul but dattester lunanimit des vques dans la condamnation du montanisme.
En revanche, du contenu de la lettre dApollinaire, comme
du contenu de la missive attribue Srapion, rien nest
dit. Ces courriers ne sont l que pour attester de la lutte
de lorthodoxie contre lhrsie ; la simple mention de leur
H[LVWHQFHHWGHVQRPVTXLOVDWWHVWHQWVXIW
Comme souvent chez Eusbe, luvre littraire est par
OjPrPHUpGXLWHDXVWDWXWGHVLPSOHWUDFHVLJQLDQWHHOOH
na pas de valeur par elle-mme. De ce fait, comme dans
le cas du trait Sur lvangile de Pierre, lhistorien nest
plus mme dvaluer limportance de ces uvres, faute
davoir dautres informations sur elles35. Par contre, il ne
SHXWTXrWUHLQXHQFpSDUODGLVSRVLWLRQGHFHVWUDFHVGDQV
lHistoire ecclsiastique. La premire mention de Srapion
fait en effet de lui un opposant au montanisme, dont les
propos sont approuvs par dautres vques36 ; la deuxime
occurrence le mentionne parmi les vques orthodoxes37 ; la
troisime rappelle quil se situe dans la ligne piscopale38 ;
la liste de ses uvres est donne aprs coup et le lecteur qui
en prend connaissance a dj une solide pr-connaissance
de leur auteur39. Il en va de mme pour Gaius, dont Eusbe
prcise quil est orthodoxe40 et quil a crit un dialogue
avec le montaniste Proclus bien avant quune notice lui soit
consacre, luvre hrsiologique de cet crivain ecclsiastique tant plusieurs reprises utilise par lhistorien
pour asseoir son propos41.

32. HE V, 19.
33. HE V, 19, 1-2.
34. Cf. HE VI, 12, 1.
35. Sur les problmes poss par les indications fournies par Eusbe,
cf. C. Trevett, Montanism. Gender, Authority and the New Prophecy,
Cambridge, 1996, p. 51-52 ; W. Tabbernee, Fake Prophecy and
Polluted Sacraments. Ecclesiastical and Imperial Reactions to
Montanism (Supplements to Vigiliae Christianae, 84), Leiden /
Boston, 2007, p. 53-55.
36. HE V, 19.
37. HE V, 22.
38. HE VI, 11, 4.
39. HE VI, 12.
40. HE II, 25, 6 : un homme de notre glise .
41. La notice se trouve en HE VI, 20, 3, mais il a t question de Gaius
en II, 25, 6 ; III, 28, 1 et 31, 4.

75

Eusbe ou ses assistants ne semble pas entirement


matriser ces jeux de renvois ou du moins ne pas avoir veill
jRULHQWHUVXIVDPPHQWOHOHFWHXUVLOWLVVHXQOLHQHQWUH
les premires mentions de Srapion et de Gaius42, Eusbe
en parle ensuite comme sil nen avait pas t question
prcdemment43. On se gardera cependant trop de mpriser
le travail de construction de lHistoire ecclsiastique, ou
destimer quil sagisse du rsultat du processus rdactionnel de cette uvre : il nest pas innocent que Srapion
ou Gaius, qui se rangent parmi les hrauts de lorthodoxie,
soient nomms plusieurs reprises, alors quun Jude, dont
Eusbe estime quil avait lesprit troubl par les rpressions
quil attribue Septime Svre, napparat quune unique
fois44. Dautre part, le fait de mentionner un disciple alors
mme quil est question du matre, puis du matre quand il
sagit de parler du disciple permet Eusbe de construire
des lignes ecclsiastiques cohrentes et de donner corps
certains personnages. Ainsi Clment dAlexandrie fait-il
son apparition dans la notice consacre Pantne45 ; ce
dernier est nouveau mentionn, avec le mme renvoi aux
Hypotyposes, dans le dveloppement sur les ouvrages de
Clment46 ; entre ces deux notices, Pantne est invoqu
comme le prdcesseur de Clment la tte de la catchse
dAlexandrie47 ; Pantne et Clment sont nouveau
PHQWLRQQpVjODQGHODQRWLFHFRQVDFUpHj&OpPHQWDX
travers dune lettre dAlexandre Origne48. Ces jeux
de rptition semblent matriss puisquils permettent
(XVqEHGHGRQQHUGHODFRQVLVWDQFHjODJXUHGH3DQWqQH
qui, pour le reste, est bien vanescente : lhistorien ne
peut rapporter sur lui que des traditions indirectes et ne
dit rien de prcis sur ses uvres, rapidement mentionnes
DYDQWGLQWURGXLUHODJXUHGH&OpPHQW49. La mise en scne
GHV WUDFHV VLJQLDQWHV D SRXU HIIHW GH UHQIRUFHU FHUWDLQHV
JXUHV QpFHVVDLUHPHQW RUWKRGR[HV GDQV OD SHUVSHFWLYH
eusbienne) au dtriment dautres. Elle participe pleinement
la construction de lhistoire mise en uvre par Eusbe.
Une image instrumentalise
6L OHV WUDFHV VLJQLDQWHV UHOHYpHV SDU (XVqEH RQW
tendance ne plus tre exploitables lorsquelles ne
sont pas accompagnes dun commentaire substantiel
ou dune citation de quelque ampleur, les citations et
allusions conserves par Eusbe pour des raisons qui lui

42. Cf. pour Srapion : HE V, 22 (mais non VI, 11, 4) ; pour Gaius :
HE III, 28, 1 et 31, 4.
43. Cf. pour Srapion : HE VI, 12 ; pour Gaius : HE VI, 20, 3.
44. HE VI, 7.
45. HE V, 11, 1-5.
46. HE VI, 13, 2.
47. HE VI, 6.
48. HE VI, 14, 8-9.
49. HE V, 10, 4.

76

AnTard , 22, 2014

RMI GOUNELLE

sont propres ont t exploites par la recherche ultrieure,


sans quil ait toujours t possible pour les savants de se
GLVWDQFHUVXIVDPPHQWGHODFRQVWUXFWLRQHXVpELHQQH
$LQVL(XVqEHDIUPHWLOHQJXLVHGLQWURGXFWLRQjOD
citation quil donne du trait Sur lvangile de Pierre, que
Srapion a crit cette uvre pour rfuter les mensonges
FRQWHQXV GDQV FHW eYDQJLOH SDUFH TXH GHV GqOHV GH
la communaut de Rhossos staient gars dans des
enseignements htrodoxes, en tirant prtexte de cette
prtendue criture 50. Mais les quelques lignes cites
par Eusbe ne vont pas dans ce sens ; Srapion y estime
en effet que lensemble est bien la vraie doctrine du
Sauveur, mais [que] certains passages ont t ajouts 51,
ce qui est beaucoup plus nuanc.
Or, dans un passage de lHistoire ecclsiastique dans
lequel il discute du canon biblique52 passage clbre
aussi bien pour son contenu que pour ses ambiguts ,
Eusbe classe les vangiles attribus Pierre, Thomas et
Matthias parmi les livres diffuss par les hrtiques ,
des livres absurdes et impies , en totale contradiction avec lorthodoxie et dont le souvenir na jamais
t rappel par les crivains ecclsiastiques53. Eusbe
avait donc une trs mauvaise opinion de lvangile
selon Pierre. En homme de son temps, il attribue un
jugement similaire Srapion, sans pouvoir ou vouloir
percevoir que la citation quil transmet ne va pas dans
ce sens. Ici comme ailleurs, si Eusbe laisse parler ses
sources, ce nest pas pour leur donner une voix potentiellement dissonante, mais pour dmontrer une thse
TXLOVHVWDSSURSULpHSRXUUHSUHQGUHOHVWHUPHVGH
Sbastien Morlet, qui insiste juste titre sur limportance des commentaires par lesquels le narrateur oriente
la comprhension des documents quil invoque54.
De telles remarques permettent de saisir sur le vif le
processus de construction mmorielle du christianisme
primitif : des uvres de Srapion, Eusbe ne retient que
ce qui lintresse au premier chef pour son dessein dhistorien ecclsiastique le passage sur lvangile de Pierre
et celui sur le montanisme, qui sont tous deux relatifs
la notion de tradition , laissant le reste dans lombre
jamais. Il est probable que si dautres uvres de Srapion
avaient t conserves, limage qui en ressortirait serait
autre que celle quen donne lHistoire ecclsiastique,
tant sur le plan littraire que sur le plan doctrinal. Mais

50. HE VI, 12, 2.


51. HE VI, 12, 4.
52. HE III, 25. Sur ce texte, cf. en particulier A. Le Boulluec, crits
contests , inauthentiques ou impies ? (Eusbe de Csare,
Histoire ecclsiastique, III, XXV), dans S.-C. Mimouni (dir.), Apocryphit.
Histoire dun concept transversal aux religions du Livre. En hommage
Pierre Geoltrain (Bibliothque de lcole des hautes tudes. Sciences
religieuses, 113), Turnhout, 2002, p. 153-165. Cf. aussi HE III, 3, 2.
53. HE III, 25, 6-7.
54. S. Morlet, Eusbe de Csare, cit. (n. 11), p. 27.

de Srapion, la postrit na pu retenir que cette image


instrumentalise par Eusbe. Brylle de Bostra a connu un
sort encore plus dfavorable : tant donn ce que lauteur
de lHistoire ecclsiastique a retenu de ce quil a trouv
dans les archives hirosolymitaines55, la postrit sen
rappelle moins comme un auteur que comme un hrtique
et Brylle de Bostra est absent de la plupart des Claves et
patrologies ; les crits de Brylle font partie des uvres
qui ne sont plus et ne comptent pour ainsi dire plus. Il
faut dire quEusbe nen a conserv ni titre ni citation.
Peut-tre en est-ce la raison majeure.
Assumer les pertes
Face lampleur des pertes dont tmoigne lHistoire
ecclsiastique, notamment pour la littrature antenicenne, lhistorien peut avoir tendance combler les
lacunes. Une telle dmarche nest pas sans dangers.
Combler les lacunes ?
Dans ses Lettres et crivains chrtiens des e et
e sicles56, Pierre Nautin a ainsi tent dclaircir le
contenu de la notice du livre VI dans laquelle Eusbe fait
tat des changes pistolaires entre les hommes savants
et orthodoxes du e sicle57. Lhistorien ecclsiastique
\DIUPH3DUPLFHVKRPPHV%pU\OOHLOpWDLWpYrTXH
des Arabes de Bostra a laiss, avec des lettres, diffrents
recueils dcrits ; il poursuit ensuite, sans donner plus de
dtails, sur Hippolyte, vque dune glise non nomme,
avant de sattarder un peu plus sur Caius et son uvre
antimontaniste 58.
Pierre Nautin a conclu de ces quelques lignes que
Brylle a correspondu avec Alexandre de Jrusalem ce
TX(XVqEHQDIUPHSDVH[SOLFLWHPHQW,ODVXUWRXWYRXOX
dterminer quelles taient les uvres laisses par Brylle.
ses yeux, il serait bien tonnant quEusbe nait pas
cit aussi ses ouvrages, sil en avait connu au moins le
titre 59 et den conclure quil fait ici simplement allusion
aux passages des actes du synode de Bostra, dont il est
question plus loin dans lHistoire ecclsiastique (VI, 33).
Pierre Nautin ajoute que, si Eusbe na pas nomm le
sige piscopal dHippolyte, cest quil na pas russi
[le] dcouvrir 60.

55. Cf. supra.


56. HE VI, 20, 2-3.
57. HE VI, 20, 1 ; HE trad. G. Bardy, cit. (n. 1), p. 343.
58. HE VI, 20, 2 ; HE trad. G. Bardy, cit. (n. 1), p. 343.
59. P. Nautin, Lettres et crivains chrtiens des e et e sicles, Paris,
1961, p. 135-136.
60. Ibid., p. 135.

AnTa rd , 2 2 , 2 0 1 4

LHISTOIRE ECCLSIASTIQUE DEUSBE OU LA PRSENCE DES UVRES PERDUES

Largumentation de Pierre Nautin frappe par son


refus de la perte. Loin daccepter que lexpos dEusbe
soit intrinsquement lacuneux, il interprte lHistoire
ecclsiastique par elle-mme, comme daucuns le
font avec la Bible, tentant den combler les silences
par dautres passages plus explicites. Cest oublier
quEusbe lui-mme tait conscient de ne pas avoir
accs lensemble de la documentation disponible de
son temps61 et quil a t volontairement slectif. On
se contentera de rappeler ici ce quil crit propos des
lettres dIgnace, dont il ne cite que des passages, mme
trs brefs, pour dmontrer ce qui vient dtre dit 62 ou
dOrigne, dont la vie constitue le cur du livre VI de
lHistoire ecclsiastique : Les presbytres de notre
temps nous ont transmis de mme, au sujet dOrigne,
mille autres choses que je trouve bon domettre, comme
nappartenant pas louvrage prsent63 ; les multiples
endroits o Eusbe prcise quil lui fallait apporter une
prcision ou quil convenait de dire telle chose sont
galement la trace dun travail de slection conscient
et assum64.
Tout aussi problmatique est la tentative dextraire
des titres de dveloppements eusbiens souvent
imprcis. Ainsi, pour Gaius, dont il a dj t question,
la traduction franaise la plus rcente de lHistoire ecclsiastique LGHQWLH GHX[ XYUHV  XQ RXYUDJH LQWLWXOp
Dialogue65 et un autre, qui serait une Recherche66. Mais
lorsque Eusbe cite un extrait du dialogue de Gaius67,
il renvoie la citation quil a faite peu auparavant, cest-dire au passage o il parlait de recherche 68 ; les
deux ouvrages nen forment donc quun, dont le titre
nest pas certain69.
Combler les silences de lHistoire ecclsiastique est
dcidment un exercice extrmement risqu.

61. Cf. supra.


62. HE III, 36, 6.
63. HE VI, 33, 4.
64. Indpendamment de ces considrations gnrales, le De uiris
illustribus 60 contredit la reconstruction de P. Nautin, puisque Jrme
DIUPHFRQQDvWUHXQpFKDQJHGHFRUUHVSRQGDQFHHQWUH%pU\OOHHW2ULJqQH
(XVqEHSRXUUDLWGRQFDYRLUUDLVRQGDIUPHUGH%pU\OOHDODLVVpGHUULqUH
lui des crits, comme le pensait G. Bardy, Paul de Samosate. tude
historique (Spicilegium Sacrum Lovaniense. tudes et documents, 4),
Louvain, nouv. d. entirement refondue, 1929, p. 232 et comme lestime
A. Carriker, The Library, cit. (n. 9), p. 195, qui ne discute toutefois pas les
thses de P. Nautin sur le sujet.
65. HE III, 31, 4 ; HE trad. G. Bardy, cit. (n. 1), p. 175.
66. HE III, 28, 1 ; HE trad. G. Bardy, cit. (n. 1), p. 171.
67. HE III, 31, 4.
68. HE III, 28, 1.
69. On peut regretter ds lors que dans son Index, cit. (n. 3), p. 292,
O. Munnich ait distingu les deux uvres. De faon surprenante,
E. Norelli, qui a bien vu quil sagit dune seule et mme uvre, retient
le titre Ztsis, Recherche , sans le discuter ; cf. dans C. Moreschini,
E. Norelli, Histoire de la littrature chrtienne antique grecque et
latine, 1. De Paul lre de Constantin, Genve, 1995, p. 231.

77

couter les silences


Plutt que de tenter de combler les silences de
lHistoire ecclsiastique, il faut apprendre les couter70.
Revenons pour ce faire lvangile de Pierre. Dans
lextrait rapport par Eusbe, Srapion dit avoir eu accs
cet vangile par lintermdiaire de doctes 71. Il
QDIUPHSDVTXHFHWpYDQJLOHFRQWLHQWXQHQVHLJQHPHQW
docte, ni que ce sont des doctes qui ont commenc se
rfrer cet vangile, mais, lue la lumire de lintroduction dEusbe, ces propos ont pris une nouvelle
tonalit. Puisque, dans son introduction lextrait du
trait de Srapion, Eusbe prcise que lvangile de Pierre
contient des enseignements htrodoxes 72 et quil le
classe, au livre III de son Histoire ecclsiastique, parmi
les forgeries dhrtiques73LOpWDLWWHQWDQWGLGHQWLHUOHV
htrodoxes en question avec les doctes mentionns par
Srapion et de lire les fragments conservs de lvangile
de Pierre la lumire du doctisme.
Cest de fait ce qua largement fait la recherche
MXVTXH GDQV OHV DQQpHV  R HOOH D HQQ FRPPHQFp
se dgager des sous-entendus eusbiens pour lire les
fragments conservs de lvangile de Pierre et tenter de les
situer dans les divers courants du christianisme primitif,
sans plaquer sur eux la construction moderne labore sur
la base des sous-entendus eusbiens. Les questions que
pose le dveloppement eusbien nen ressortent que de
faon plus intense : qui sont les doctes en question ?
Quel est leur lien avec les chrtiens de Rhossos ? Ne
lisaient-ils que lvangile de Pierre ? taient-ils les seuls
lire cet vangile ? Sur toutes ces questions, Eusbe est
muet et ne donne pas la parole Srapion. Faute dautre
source, lhistorien se doit de les laisser ouvertes.
Ici comme ailleurs, ce quEusbe dit explicitement
dans son Histoire ecclsiastique ne fait que ressortir
davantage les zones dombre qui la cernent. Sil faut
smerveiller de tout ce quEusbe rapporte, il faut aussi
sans cesse couter les silences que rvle lHistoire ecclsiastique, comme Eusbe a laiss rsonner, dans son
uvre, les documents auxquels il na pas eu accs74. Car
aprs tout, la mmoire [ne] se nourrit[-elle pas] de la
possession fantme de ce quelle a perdu 75 ?
Facult de thologie protestante,
Universit de Strasbourg

70. Il sagit moins dcouter les silences dEusbe sur les crivains dItalie
et de Grce, et plus largement sur le christianisme occidental, mais bien
dcouter ses silences dans les domaines quil couvre dans son Histoire
ecclsiastique.
71. HE VI, 12, 6.
72. HE VI, 12, 2.
73. HE III, 25, 6-7.
74. Cf. supra.
75. J. Schlanger, Prsence, cit. (n. 27), p. 45.

AnTard , 22, 2014, p. 79- 82


DOI 10.1484/J.AT.5.103177

POURQUOI EUSBE NE MENTIONNE-T-IL PAS


LE MARTYRE DE PIRIOS ?
-*

Why Eusebius does not mention the martyrdom of Pierus?


Eusebius silence on the martyrdom of Pierius, documented by the Apology of Phileas, bishop of Thmouis,
may give some substance to allegations of weakness during the Tetrarchic prosecutions, launched against him in
a later period. [Author]

Une uvre hagiographique joue parfois garer notre


attention, quand elle traite dun sujet dclar, qui semble
occuper toute la composition, alors que le sujet rel ne
tient, sur le plan narratif, quune place trs restreinte.
Cest un enseignement de lApologie du martyr gyptien
Philas de Thmouis (P.Bodmer XX).
Philas tait un riche notable alexandrin, de haute
stature intellectuelle, fru de culture profane et de thologie
FKUpWLHQQH,OYLYDLWjODQGXe et au dbut du e sicle.
lu vque de la ville gyptienne de Thmouis, dans le
Delta, il fut ce titre jug, condamn mort par le prfet
dgypte Clodius Culcianus et martyris le 4 fvrier 3051.
Eusbe voque avec motion la mort de Philas et cite
une de ses lettres dcrivant les atrocits de la perscution
(HE VIII, 10, 1-10)2.
Quelques dcennies aprs le supplice de Philas,
circulaient dj des rcits de son procs. La papyrologie

1. Cette date na t tablie quen 2010 par P.Kln XII 492, contre celle
de 306 qui avait antrieurement cours. Pour un portrait moral,
intellectuel et religieux de Philas, voir Th. Baumeister, Der gyptische
Bischof und Mrtyrer Phileas, dans B. von Stritzky, Chr. Uhrig (dir.),
Garten des Lebens; Festschrift [] Wilfrid Cramer, Altenberge, 1999,
p. 33-41, repris dans Martyrium, Hagiographie und Heiligenverehrung
im christlichen Altertum, Rom / Freiburg / Wien, 2009, p. 107-112
(reproduction aimablement communique par Mme G. Schenke).
2. H. Musurillo, The Acts of the Christian Martyrs (introduction, texts
and translations), Oxford, 1972, p. 320-324. Lexactitude dEusbe,
quand il cite des documents, a t dmontre plusieurs reprises, si
bien que cette lettre doit tre tenue pour authentique.

nous a restitu trois de ces pices conserves Genve


(P.Bodmer XX), Dublin (P.Chester Beatty XV) et Cologne
(P.Kln XII 492). Les deux premires sont en grec. Elles
sont trs anciennes (pas plus tardives que le milieu du
e sicle) et donc trs proches des vnements de 305.
Le texte de Cologne, qui nous donne la vraie date du
martyre3, est en copte et son ditrice le date du e sicle.
Une version latine circulait en Occident, au plus tard avant
le e sicle.4 Ces textes se conforment la diplomatique
des procs-verbaux des sessions judiciaires du prfet
dgypte, mais elles comportent aussi des dveloppements
apologtiques et catchtiques, sous forme de discussions
sur la doctrine chrtienne entre Philas et le prfet perscuteur qui jettent aux yeux de certains un doute sur leur
authenticit. En effet, si ces passages saccordent avec le
souvenir qua laiss Philas, celui (peut-tre surestim5)

3. Voir supra (n. 1).


4. A. Pietersma, The Acts of Phileas, Bishop of Thmuis, Genve, 1984, et la
rdition de lensemble du dossier de Philas dans G.A.A. Kortekaas,
G. Lanata, Atti e passioni dei martiri, Milan, 1987, p. 247-337, avec
le commentaire des p. 498-581. Voir les remarques de T. D. Barnes,
Early Christian Hagiography and Roman History, Tbingen, 2010,
p. 143-146.
5. Voir A. (Emmett) Nobbs, Phileas, bishop of Thmouis, dans A. Woods
et al., Egyptian Culture and Society, Studies in Honour of Naguib
Kanawati (ASAE, Suppl. 38), 2, Le Caire, 2010, p. 93-97. Lauteur
tient (comme G.A.A. Kortekaas, G. Lanata, Atti e passioni, cit. [n. 4],
p. 261-265), que P.Bodmer XX est postrieur P.Chester Beatty XV.
&H GHUQLHU WH[WH GRQQH GH 3KLOpDV XQH LPDJH SOXV GqOH SOXW{W

80

JEAN GASCOU

GXQ LQWHOOHFWXHO HW GXQ WKpRORJLHQ LOV QH UHqWHQW SDV


la personnalit de Clodius Culcianus telle que la dcrit
Philas dans sa lettre. Culcianus tait un juge obtus,
appliquant la loi sans scrupule de conscience et sans
doute peu port aux discussions thologiques. En somme,
la personnalit de Philas disparat sous les strotypes
pGLDQWV/H3KLOpDVKLVWRULTXHQHVWGRQFSDVOHYUDLVXMHW
de ses Actes. Cest un Philas idalis. Cette idalisation se
marque surtout dans la version genevoise P.Bodmer XX,
qui sintitule justement Apologie, ou dfense de Philas,
et qui semble une laboration postrieure aux Acta de
Dublin. Presquau dbut de laudience, 2, 5-8, Culcianus
LQYLWH3KLOpDVjVDFULHUFHVWjGLUHjDSRVWDVLHUOHFKULVtianisme, en invoquant lexemple, ses yeux salutaire, de
Pirios : Tu as fait mourir beaucoup de monde en ne
VDFULDQWSDVDORUVTXH3LpULRVHQDVDXYpEHDXFRXSHQ
VHVRXPHWWDQW 
 
Ce Pirios, mentionn comme en passant dans
lApologie, nest pas un inconnu. Pirios tait un prtre
dAlexandrie dont le RUXLW VH VLWXH VRXV OH SRQWLFDW
de lvque alexandrin Thonas (ca. 282-300). Il fut le
matre du martyr Pamphile, matre dEusbe. Il fut pour sa
science compar Origne. Selon certaines traditions, il
dirigea lcole catchtique dAlexandrie. Eusbe exalte
ses vertus asctiques, son tude de la philosophie et ses
comptences de thologien et de prdicateur (HE VII, 32,
26-27). Il mourut au e sicle, mais les traditions sur la
QGHVDYLHWUDQVPLVHVSDU3KRWLXVHWVDLQW-pU{PHVRQW
contradictoires. Selon certains, Pirios subit le martyre
Alexandrie, avec son frre Isidore6, et, de fait, une
glise de Pirios atteste Alexandrie lpoque tardive
SRXUUDLW FRPPpPRUHU VD Q WUDJLTXH7. Selon dautres,
LODXUDLWTXLWWp$OH[DQGULHjODQGHVSHUVpFXWLRQVSRXU
QLU VD YLH j 5RPH8. Comme Eusbe connaissait mieux

dfavorable pour les capacits, la culture et la prsence desprit de


Philas, qui semble pris au dpourvu par les questions de Culcianus).
6. Cette tradition remonte au plus tard lavocat et pote Thodore, que
J.-L. Fournet situe au e sicle (Thodore, un pote alexandrin oubli.
Lhexamtre au service de la cause chrtienne, dans D. Accorinti,
P. Chuvin [dir.], Des Gants Dionysos. Mlanges de mythologie et de
posie grecques offerts Francis Vian, Alessandria, 2003, p. 521-539).
7. Outre Thodore, cit prcdemment, J.-L. Fournet rappelle piphane,
Pan. 69, 2 (Thodore, cit. [n. 6] p. 524), et ajoute une possible allusion
XQPRQXPHQWFRPPpPRUDWLIGH3LpULRV GDQVlIndex syriaque
des Lettres festales dAthanase, 39, daprs une correction apporte par
R. Lorenz, Eine Pierius-Memoria in Alexandria, dans ZKG, 99, 1998,
p. 87-92, ldition de A. Martin, M. Albert, Histoire acphale et Index
syriaque des Lettres festales dAthanase dAlexandrie (SC 317), Paris,
1985, p. 270-271. Voir aussi les remarques de A. Camplani, Atanasio di
Alessandria, Lettere festali, anonimo Indice delle Lettere festali, Milan,
2003, p. 586, n. 133. La transcription syriaque du toponyme (pyhrywn)
ouvre cependant la voie dautres conjectures, mais ce nest pas ici le lieu
de traiter de cette question.
8. Pour Pirios retir Rome aprs la perscution, voir Jrme, De
viris illustribus, ch. 76 ; Photius, Bibl. cod. 119 93b, enregistre la
tradition du martyre et celle du retrait Rome. Dans cod. 118 93a,
il sen tient au martyre.

AnTard , 22, 2014

que quiconque lhistoire des perscutions, il naurait pas


manqu de signaler le martyre de Pirios, si bien que la
deuxime tradition semble a priori la plus vraisemblable.
Grce lApologie de Philas, la biographie de Pirios
se prsente sous un jour plus clair. Nous savons prsent
que, non seulement Pirios na pas subi le martyre, mais
quil fut mme apostat. Cette brve allusion, que nont pas
les autres versions de ses Actes, est certainement, plus que
le portrait convenu de Philas, le vrai sujet de lApologie
de Genve.
Comme dautres lapsi, ainsi le sophiste Astrios,
sympathisant ultrieur de larianisme, Pirios put se
maintenir dans lglise et sut faire oublier sa chute.
Ctait assez facile Alexandrie grce lvque
Pierre I. Bien que Pierre ait subi le martyre en 311, avec
la dignit dun Cyprien de Carthage, il eut le temps
de promulguer des canons pnitentiels sur la rintgration des apostats lacs dans lglise, qui sont dune
extrme indulgence9. Mais Pirios tait prtre. Daprs
les canons de Pierre, lapostasie des clercs tait une
faute plus grave. En vertu du Xe canon, ils chappaient
lexcommunication, mais perdaient leur rang clrical.
Sans doute Pirios fut-il alors dmis de la prtrise. Il dut
perdre aussi la direction de lcole catchtique, car nous
savons que, sous lvque Pierre I, elle tait aux mains
dAchillas, qui fut le successeur de Pierre lpiscopat
en 312. En somme, la carrire de Pirios tait termine.
Il ne pouvait plus gagner sa vie Alexandrie et cela
donne de la vraisemblance la tradition sur son dpart
dAlexandrie et sa retraite Rome. Tout cela dut se faire
sans bruit pour viter un scandale o lglise dgypte
avait autant perdre que Pirios. Quant lglise alexandrine de Pirios, mentionne par piphane, il doit sagir
dune fondation de Pirios lui-mme, peut-tre pour se
racheter de sa faute. une poque avance, le nom de
cette glise fut compris, lavantage de la mmoire de
Pirios, comme faisant allusion un saint martyr. Les
Alexandrins croyaient mme savoir que les glises de
Pirios et dIsidore auraient t construite par des dvots
GXSVHXGRPDUW\UHWGHVRQIUqUH10.
Comme on la dit, les autres pices du dossier
de Philas ne parlent pas de Pirios. Peut-tre faut-il
voir-l un trait de censure dun fait historique gnant ou
GLIFLOH j DFFHSWHU j FDXVH GH OD QRWRULpWp LQWHOOHFWXHOOH
du personnage ou des amitis quil avait conserves en
gypte ; peut-tre encore le souvenir de Pirios stait-il
effac. Mais les milieux do mane lApologie de Genve
taient hostiles Pirios et cest autant son indignit que
la saintet de Philas quils voulaient montrer.

9. Sur les canons de Pierre, voir D. B. Spanel, T. Vivian, Peter I, dans


The Coptic Encyclopedia, VI, 1991, p. 1944-1945.
10. Photius, Bibl. cod. 118 93a. Voir supra (n. 6).

AnTa rd , 2 2 , 2 0 1 4

POURQUOI EUSBE NE MENTIONNE-T-IL PAS LE MARTYRE DE PIRIOS ?

81

Peut-tre avaient-ils contre lui des griefs plus profonds,


touchant sa doctrine ou ses opinions et qui auraient
MXVWLpTXRQUHVVRUWHFHWWHYLHLOOHDIIDLUHSRXUPLHX[OH
discrditer. Avoir t compar Origne ntait pas ncesVDLUHPHQWDWWHXU3KRWLXVHVWPDOjODLVHDYHFSOXVLHXUV
de ses thses et trouve hrtique sa doctrine du SaintEsprit11. Dautre part, Pirios avait compos un trait sur
la Pque o il soutenait que laptre Paul aurait eu une
femme, dont il se serait spar aprs lavoir consacre
la vie religieuse. Cette tradition est pour le moins controYHUVpH,OHVWVLJQLFDWLITXXQHSLqFHQRXYHOOHGXGRVVLHU
de Pirios, publie par J.-L. Fournet, qui la tire du
ms Vatopdi 290, et qui signale cette opinion, soit sous le
WLWUH12.
Cela nous amne voquer la conduite dEusbe
SHQGDQWOHVDQQpHVGLIFLOHVGHODSHUVpFXWLRQ,OIXWGDQV
les annes 330, accus dincliner vers larianisme. ce
titre, malgr ses mrites intellectuels et son honntet
dhistorien, il nest pas considr dans la chrtient
comme un pre de lglise. De plus, un de ses adversaires
doctrinaux, lvque gyptien Potamon dHraclopolis
Parva, lana contre lui et en sa prsence, au synode de
Tyr (335), une accusation grave. Alors que Potamon fut
emprisonn pendant la perscution et maltrait au point
de perdre un il, Eusbe, qui tait dans la mme prison,
naurait souffert de rien. Potamon lui demande comment
il a fait pour sen sortir. Ne serait-ce pas cause dune
promesse dapostasie, ou mme dun acte dapostasie ?

La rponse dEusbe consista surtout en plaintes et


luda la question :

       




     
        



0U 9DORLV SRXU MXVWLHU (XVHEH GH &HVDUpH VXU ODSRVtasie dont S. Potamon la accus, dit que sil en eust est
coupable, il nauroit pas est elev lepiscopat, & que le
peuple dAntioche ne lauroit pas demand pour Evesque.
[Ce raisonnement est trs juste, si son apostasie avoit
est publique, mais elle peut avoir est secrette & peu
connue des Chrtiens. Les persecuteurs ne demandoient
pas toujours faire eclater la honte de ceux qui abandonnoient la foi. Dans la persecution de Dece ils donnoient
des attestations ceux mesmes qui declaroient ne pouvoir
pas renoncer. Ils ont pu se contenter aussi de quelque
declaration, ou de quelque promesse dEusebe en faveur
de lidolatrie, & lavoir laiss aller sur cela, soit de la
prison, soit des manieres o lon envoyait alors la pluspart
des Chrtiens, & Eusebe a pu se cacher ensuite jusquau
temps quon delivra les Confesseurs.
Que si lon demande pourquoi S. Potame a attendu si
longtemps reprocher cette faute Eusebe, ce nest pas
nous rendre raison de ces sortes de choses. S. Potamon
na peutestre point sceu ce quEusebe estoit devenu
quaprs quil eut est fait Evesque de Cesare, & on ne
sengage pas si aisment entreprendre de faire deposer

Tu siges, Eusbe, et Athanase, qui est innocent, est jug


par toi ? Qui pourrait supporter de telles choses. Mais
dis-moi. Ntais-tu pas avec moi en prison pendant la
perscution ? Et alors que moi, jai perdu un il pour
la vrit, toi, ce quil semble, tu nas au corps aucune
mutilation et nas pas tmoign, mais te voici debout,
vivant, sans aucune lsion. Comment tes-tu vad de la
prison, si ce nest parce que tu as promis ceux qui nous
RQWLQLJpOpSUHXYHGHODSHUVpFXWLRQGHFRPPHWWUHOD
chose interdite, ou parce que tu las commise13 ?

11. Bibl. cod. 119 93a.


12. J.-L. Fournet, Thodore, cit. (n. 6), p. 524.
13. piphane, Pan. 68, 8, 2-5. Voir aussi la lettre synodale des vques
gyptiens, au concile de 338, rapporte par Athanase, Apol.
c. arianRODFFXVDWLRQGDYRLUVDFULpHVWH[SOLFLWH 


      
       
       
        

ces mots, Eusbe fut pris dindignation. Il se leva,
renvoya la cour et dit : Si vous tes venus ici pour
objecter contre nous de telles choses, vos accusateurs
ont donc raison, car si ici vous faites les matres, bien
plus forte raison chez vous .

Laccusation de Potamon nest pas prise au srieux


par la science moderne, qui y voit une calomnie 14 et
relve quun apostat notoire naurait pu tre lu vque de
&pVDUpHFRPPHOHIXW(XVqEHjODQGHODSHUVpFXWLRQ
Lenain de Tillemont, auquel il faut souvent revenir
sur des points dhistoire ecclsiastique, semble croire
la trahison dEusbe, sans doute par prjug et parce que
son orthodoxie lui paraissait suspecte. Il rappelle pourtant
quil tait alors facile, par divers subterfuges, dchapper
la honte dune abjuration publique. Il signale une autre
zone dombre dans la conduite dEusbe cette poque :
alors que son matre Pamphile a subi le martyre avec
dautres de ses disciples, Eusbe, qui avait t emprisonn,
a encore une fois chapp au danger.
Voici en effet comment il voit les choses dans son
Mmoires pour servir lhistoire ecclsiastique15 :

14. A. Martin, Athanase dAlexandrie et lglise dgypte au e sicle,


Rome, 1996, p. 374, n. 140.
15. http://books.google.fr/books?id=d10uAAAAYAAJ&pg=PA1104&l
pg=PA1104&dq=tillemont+potamon+eus%C3%A8be&source=bl
&ots=8kGHwgOS5U&sig=HA1-tkgvfUYgcanlAnfvhYIGm1U&h
l=fr#v=onepage&q&f=false

82

JEAN GASCOU

un Evesque. Quoy quil en soit, il est certain non seulement


par S. Epiphane] mais encore par le Concile dAlexandrie
en 339, quil a est accus par des Confesseurs davoir
VDFULp LOVHQHVWWUHVPDOGHIHQGXVLOQHODIDLWTXH
par des injures, au lieu dclaircir un fait si important
sa reputation. Le silence quil garde dans son histoire au
sujet de sa prison, dont il devait naturellement parler en
faisant lhistoire de celle de S. Pamphile, est assurement
une grande presomption quil nen estoit pas sorti comme
il devoit, & avec lhonneur dune confession glorieuse.
Les fautes quil a commises depuis & dans ses crits,
& dans sa conduite, donnent sujet croire quil avoit attir
sur luy la colere de Dieu par quelque faute considerable.]

AnTard , 22, 2014

Le cas de Pirios pourrait ajouter de la substance,


une substance psychologique laccusation contre
Eusbe, assez clairement endosse par Lenain de
Tillemont. Apostat par faiblesse, et sans doute apostat
discret, Eusbe pouvait songer lui-mme en cachant la
chute de Pirios, quil ne pouvait pas ignorer. En constituant le mmorial des martyrs de la perscution dans son
Histoire ecclsiastique, il a pu aussi vouloir se racheter
de sa faiblesse.
Universit Paris-Sorbonne

AnTard , 22, 2014, p. 83- 94


DOI 10.1484/J.AT.5.103178

3 LES TEXTES AU REGARD DES DONNES


ARCHOLOGIQUES
CONSTANTINES BEAUTIFUL CITY:
THE SYMBOLIC VALUE OF CONSTANTINOPLE
59'

La merveilleuse cit de Constantin : la valeur symbolique de Constantinople


Byzance navait gure vocation devenir la capitale de lEmpire. Elle posait dimportants problmes logistiques
quant lapprovisionnement et laccessibilit et navait que peu de valeur militaire, et dautres villes prsentaient
une signification historique plus importante. Pourquoi alors Constantin a-t-il choisi Byzance ? ce moment-l, il
sinquitait davantage du pass immdiat que de lavenir. En 324, sa principale priorit tait deffacer la mmoire
de son rival Licinius en refondant et en renommant la ville. Constantin amora galement la transformation de
Constantinople en une trs grande ville. Mais pourquoi les empereurs qui lui ont succd ont-ils continu de dvelopper ces infrastructures ? Sans doute comme Constantin ont-ils reconnu la ncessit de maintenir une telle ville
pour imposer leur autorit dans les provinces orientales et pour assurer la lgitimit de leur dynastie. La valeur
symbolique de Constantinople devait compenser les difficults dordre fonctionnel en matire de ressources et de
protection. [Trad. de la Rdaction]

By the mid-sixth century Constantinople had


become the largest city in the world, with a population
of 500,000 residents, perhaps even 600,000 residents. Its
amenities included the supply of grain from Egypt, wine
and other food from eastern provinces, and water over a
network of aqueducts that extended over 120 kilometers.
Its monumental landscape included a massive wall, a
sprawling imperial palace, a huge hippodrome, various
forums, and many churches, among them the vast Church
of Holy Wisdom as rebuilt by the emperor Justinian.
Constantinople was the capital of the eastern Roman
empire; but with the disappearance of Roman rule in
Italy and the western provinces, it was now the capital of
the only Roman empire. New Rome had surpassed and
replaced Old Rome.
Floating above the skyline of the city was a colossal
bronze statue of the emperor Constantine, perched on a
tall column in the center of an expansive forum on the
crown of one of the citys hills. Constantine had refounded
the city of Byzantium in November 324, about two
months after his victory over the rival emperor Licinius,
and on May 11, 330, he had presided over the citys
formal dedication. The renaming of cities throughout

the empire was not uncommon during his reign, and


several cities took new names, such as Constantina or
Constantia, that honored Constantine and his family. But
Constantine himself referred only to Constantinople as
my eponymous city. Constantines city clearly had a
special place in the emperors heart.1
,Q PRGHUQ VFKRODUVKLS LW LV GLIFXOW WR GLVWLQJXLVK
Constantines own hopes and plans from the subsequent
development of Constantinople into the enormous city
of Justinian. Already in late antiquity historians claimed
to have discovered ancient oracles that had long before
predicted the rise of Byzantium: An empire is quickly
being prepared for the men who inhabit the foundation of
Byzas.2 We modern scholars likewise know the future,

1. Eusebius, Vita Constantini      LQ D


letter sent to Eusebius after late 335, with R. Van Dam, The Roman
Revolution of Constantine, Cambridge, 2007, pp. 112-115, for the
renaming of cities. For the statue, see J. Bardill, Constantine: Divine
Emperor of the Christian Golden Age, Cambridge, 2012, pp. 28-36.
2. Zosimus, Historia nova 2.37.1. Excellent recent introductory surveys of
the development of Constantinople include C. Hennessy, Topography
of Constantinople, in E. Jeffreys, J. Haldon, R. Cormack (eds), The

84

AnTard , 22, 2014

RAYMOND VAN DAM

and it is all too easy to conclude that what did happen to


the city was what Constantine intended to happen. But
if we can avoid anticipating the future and concentrate
on the city only during Constantines lifetime, a much
different picture emerges.
Launching a new capital in the East or replacing
Rome was perhaps not Constantines top priority when
refounding Byzantium. Despite its scenic location,
Byzantium was not an obvious choice as a new imperial
residence. It had limited strategic value, and other cities
offered more advantages. The emperors reasons for
selecting Byzantium to become an eponymous city
were instead more personal and urgent. As he emerged
victorious from his most recent civil war, he was looking to
obliterate any recollection of his former rival (section 1).
Nor could Constantine have expected that
Constantinople would become so large. Fundamental
limits on the capacity of the Roman economy and its
DYDLODEOHVXUSOXVPDJQLHGWKHGLIFXOWLHVRIFRQVWUXFWLQJ
anything of great size, such as a long aqueduct, a massive
wall, an immense church, and, certainly, a very big city.
Expanding the population and the infrastructure of the
city was an enormous undertaking that required more than
one decade to accomplish (section 2).
No emperor could have guaranteed ongoing expansion
or the completion of large construction projects far into
the future. So Constantine presumably thought about the
EHQHWVRI&RQVWDQWLQRSOHGLIIHUHQWO\7KHSURPRWLRQRI
a new capital was important for establishing his authority
in the eastern provinces (section 3) and for promoting
his sons as his successors (section 4). But as the city
expanded, as its monuments became more prominent and
its infrastructure more elaborate, subsequent emperors too
could see the advantages of continuing to enhance this
large city.
Constantine founded the city, but only the
commitment of his successors could ensure its growth.
0DLQWDLQLQJ WKH VXSSO\ RI D JLDQW FLW\ ZDV D GLIFXOW
undertaking, however, and subsequent emperors had
to conclude that the symbolic value of Constantinople
RXWZHLJKHGWKHSUDFWLFDOGLIFXOWLHV7KHYLVLEOHDVSHFWV
of the city, including its large population, its monuments,
and its demands for food and other supplies, were the
infrastructure that nourished its symbolic meanings.
+LJKOLJKWLQJWKHV\PEROLFVLJQLFDQFHRIWKHFLW\KHQFH
helps us understand both Constantines immediate
pressing concerns and the commitment of subsequent
emperors. The city was a catalyst for the creation of a
distinctively eastern Roman empire and a guarantee for
the longevity of imperial dynasties. From the moment

Oxford Handbook of Byzantine Studies, Oxford, 2008, pp. 202-216,


and P. Magdalino, Byzantium = Constantinople, in L. James (ed.),
A Companion to Byzantium, Chichester, 2010, pp. 43-54.

of its foundation Constantinople was not only a physical


city, constructed and patronized by emperors, but also
a powerful symbolic force for shaping new ideas about
empire and emperorship.3
Why Byzantium?
During Constantines reign Eusebius of Caesarea
travelled to Constantinople at least twice. He visited in
autumn of 335 as one of a delegation of bishops from a
council that had met at Tyre; he returned in summer of 336
to participate in the celebration of the thirtieth anniversary
of Constantines reign. Eusebius was one of the few
contemporaries to record his favorable impressions. In
his Life of Constantine he characterized Constantinople
as Constantines beautiful city.4
Offsetting the splendor of the site of Byzantium,
however, were its many practical disadvantages. The
supply of fresh water was problematic, because there
were no adequate springs or a river. The supply of food
was problematic, because the agricultural hinterland
to the west was exposed to invaders from the Balkans.
Access by ships was problematic. Even though the city
was situated precisely at the nexus between the Black Sea
and the Aegean Sea, the prevailing winds hampered the
arrival of ships through the straits of the Hellespont and
across the Sea of Marmara, and the currents in the Sea of
Marmara anyway tended to steer ships toward Chalcedon,
opposite Byzantium.5
As a fortress Byzantium was also inadequate. During
the recent civil wars between rival emperors a garrison
had had limited impact. After the emperor Galerius died
in spring of 311, Licinius and his troops had confronted
Maximinus and his troops at the Strait of Chalcedon,
that is, the Bosphorus between Chalcedon and Byzantium.
In 313 Maximinus again marched from Syria to Bithynia
and this time crossed the Bosphorus. Licinius garrison
stationed at Byzantium held out long enough to send
messengers and letters before having to surrender; soon
afterward Licinius troops defeated Maximinus and
pushed his army back into Asia Minor. Byzantium had
marked the seam dividing rival emperors.6

3. For the larger context, see R. Van Dam, Rome and Constantinople:
Rewriting Roman History during Late Antiquity, Waco, 2010.
4. Eusebius, Vita Constantini     )RU
Eusebius visits, see T.D. Barnes, Constantine and Eusebius,
Cambridge (Mass.), 1981, p. 266, with H.A. Drake, What Eusebius
Knew: The Genesis of the Vita Constantini, in Classical Philology, 83,
1988, pp. 20-38, suggesting that Eusebius was also in Constantinople
in the spring of 337.
5. For sailing patterns, see I. Malkin and N. Shmueli, The City of the
Blind and the Founding of Byzantium, in Mediterranean Historical
Review, 3, 1988, pp. 21-36.
6. Lactantius, De mortibus persecutorum 36.1-2, 45.1-5.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINES BEAUTIFUL CITY: THE SYMBOLIC VALUE OF CONSTANTINOPLE

After his victory, because Licinius returned to


campaigning again on the Danube frontier, Byzantium
was buried inside his eastern half of the Roman empire. It
only became important again during the civil war between
Constantine and Licinius. In 316 Constantine invaded the
Balkans from northern Italy and advanced into Thrace.
According to the terms of a treaty in 317, Licinius surrendered most of his territory in the Balkans, but retained
control over Thrace. Thereafter Constantine resided
occasionally as far east as Serdica, while Licinius seems
to have resided at Byzantium. Now Byzantium was again
on an internal frontier between rival emperors.
In anticipation of another confrontation both emperors
DVVHPEOHGODUJHHHWV,Q&RQVWDQWLQHVQDY\GHIHDWHG
Licinius navy in the Hellespont off Callipolis. When
&RQVWDQWLQHV DUP\ EHVLHJHG %\]DQWLXP /LFLQLXV HG
UVWWR&KDOFHGRQWKHQDIWHUDQRWKHUPLOLWDU\GHIHDWWR
Nicomedia.
A garrison at Byzantium had been an obstacle during
the civil war between Licinius and Maximinus to an
emperor advancing from the east across Asia Minor,
during the civil war between Constantine and Licinius to
an emperor advancing from the west across the Balkans.
Whatever delay it posed, however, was only temporary,
because other crossings between Thrace and Asia Minor
were available. Licinius had sent reinforcements to
Lampsacus to prevent Constantines army from crossing
the Hellespont; Constantine instead moved his troops
north and crossed the Bosphorus closer to the Black Sea.7
Byzantium was even more exposed to a hostile naval
HHW,QIDFWDVVRRQDVKLVRZQHHWKDGEHHQGHIHDWHG
in the Hellespont, Licinius hope in [relying on] the sea
had been lost.8 So he abandoned Byzantium. Without
hegemony over the waterways, without supply ships to
bring provisions and warships to control the Bosphorus
and Hellespont, Byzantium was vulnerable.
A garrison at Byzantium hence had some military
YDOXH LQ LQWHUQDO FRQLFWV EHWZHHQ ULYDO HPSHURUV ,Q
&RQVWDQWLQHVUHXQLHGHPSLUHKRZHYHU%\]DQWLXPDJDLQ
lost that value, and it was again not an obvious selection
as a new base in the East. In addition, Constantine had
other options, and each alternative city offered important
strategic advantages or historical precedents.
In the Balkans Constantine had already been residing
in Serdica, which he thought important enough to classify
as my Rome.9 'XULQJ WKH QDO ZDU ZLWK /LFLQLXV
Constantine had expanded the harbor at Thessalonica
EHIRUHPRYLQJKLVHHWWR3HLUHXVWKHKDUERURI$WKHQV
The citizens of Athens apparently tried to sell Constantine

7. Zosimus, Historia nova 2.25.2-26.1.


8. Origo Constantini imperatoris 5.27.
9. Anonymus post Dionem (= Dio Continuatus), Frag. 15.1, ed. C. Mller,
Fragmenta historicorum graecorum, 4, Paris, 1851, p. 199.

85

on the advantages of their city. The historian Praxagoras,


a native son, supplemented his accounts about the
ancient kings of Athens and Alexander the Great with a
new history that commemorated Constantines military
successes and his imperial virtues. The people of
Athens erected a statue with an inscription that hailed
the emperor as their general. In return, Constantine
instituted an annual distribution of grain for Athens.10
Another possibility would be an imperial residence closer
to the Persian empire. As a central node for managing the
eastern frontier, Antioch was already a very big city with
extensive monuments and infrastructure.
A Balkan city offered better access to the Danube
frontier, and Antioch to the eastern frontier; or Constantine
could have developed a port on the Aegean. Even if he
had prioritized the establishment of an imperial residence
midway between the Danube frontier and the eastern
frontier, other cities were available. Later traditions
claimed that he had thought about founding a new base at
the mouth of the Hellespont near Troy.11 Constantine could
also have followed the lead of the emperor Diocletian, who
had favored Nicomedia in Bithynia. Diocletians building
projects had included a palace, a circus, a mint, and a
weapons factory. As a result, Nicomedia was imagined to
have become the equivalent of a suburb of Rome.12 As his
own imperial residence Constantine could have selected a
readymade city such as Nicomedia: prt--porter.
Despite the availability of these attractive options,
Constantine decided to promote a small, peripheral city.
,Q KLV UHXQLHG HPSLUH %\]DQWLXP ZDV QRW ORFDWHG
on a frontier, either internal or external, and therefore
KDG OLPLWHG PLOLWDU\ YDOXH ,W KDG VLJQLFDQW ORJLVWLFDO
problems of supply and accessibility. It had only a
small role in earlier Greek and Roman history, and it
KDG QR QRWDEOH P\WKRORJLFDO VLJQLFDQFH 6R ZK\ GLG
Constantine choose Byzantium?
One strong possibility is that Constantine was looking
not to the future, but to the immediate past. In late 324 one
pressing concern was to erase the memory of Licinius,
his defeated rival. Such suppression of memory would
have followed a consistent pattern, because after victories
in earlier civil wars Constantine and his supporters had
indulged in rewriting the past. During the early years
of his reign as emperor in the West he had been allied
with the emperor Maximian and his son Maxentius, and
he had even married Maximians daughter. Then his
relationship with Maximians dynasty had turned sour.

10. Harbors: Zosimus, Historia nova 2.22. Statue: Julian, Orat. 1.8.
On Praxagoras, see R. Van Dam, Remembering Constantine at the
Milvian Bridge, Cambridge, 2011, pp. 101-102.
11. Zosimus, Historia nova 2.30.1.
12. Lactantius, De mortibus persecutorum 7.9; Ammianus Marcellinus,
Res gestae 22.9.3.

86

AnTard , 22, 2014

RAYMOND VAN DAM

After Constantine defeated Maxentius outside Rome in


312, he had mementoes of his brother-in-law systematically erased at the old capital. He appropriated Maxentius
building projects, and he coopted Maxentius supporters
among the senatorial aristocracy. Maxentius lost his head,
literally when it served as an ornament on a pike that led
&RQVWDQWLQHV WULXPSKDQW DUP\ LQWR 5RPH JXUDWLYHO\
when the marble head of his colossal statue may have
been recut as Constantine.13
At Byzantium, Constantine may have wanted, even
needed, to indulge in another bout of forgetting. After
the initial civil war of 316-317, Licinius seems to have
begun developing Byzantium as a principal residence.
He may, for instance, have been responsible for initiating
construction of the hippodrome.14 Byzantium had become
associated with the imperial authority of Licinius. After
defeating Licinius, however, Constantine wanted to
expunge any memorials of his rivals reign. He soon
issued edicts that invalidated Licinius edicts. He ordered
the removal of images of Licinius and his son, so that
not even their name was remembered. In a letter to the
provincials in the eastern provinces he announced the
elimination of the evil that had previously subjected all
mankind.15 By appropriating Byzantium, Constantine
consigned any memories of Licinius to oblivion. In late
324 his refounding of Byzantium as Constantinople was
as much a technique for disgracing Licinius as a means of
glorifying himself.
This policy of eradication was successful. When
Eusebius had initially completed his Ecclesiastical
History almost ten years earlier, he had concluded with the
alliance between Constantine and Licinius in 313. Back
then he had thought that both emperors were advocates
of peace and piety.16 After 324, however, he rewrote the
QDOERRNRIEcclesiastical History to denigrate Licinius
DQGKLJKOLJKW&RQVWDQWLQHVQDOYLFWRU\,QKLVVWLOOODWHU
Life of Constantine he omitted any hint of their earlier
DOOLDQFH DQG YLOLHG /LFLQLXV DV WKH W\UDQW $IWHU WKH
tyrants defeat, the memory of the earlier iniquities
vanished. Licinius memory disappeared with the
renaming of Byzantium.17

Constantines victory became an important component


of the citys new legendary history. The Forum of the Ox
supposedly memorialized the site of his armys camp, and
the area of Ta Viglentiou (Biglentias) supposedly commemorated his watchtower. Even his famous vision of a
cross in the sky was associated with a site at Byzantium.
According to Gilbert Dagron, the war was integrated []
LQWRWKHFRQJXUDWLRQRIWKHFLW\7KHWUDQVIRUPDWLRQRI
Byzantium into Constantinople was another example of
rewriting Constantines history.18
At the time eliminating his rivals reputation may
have been reason enough to rename Byzantium as
Constantinople. But if Constantine also intended to
found a city that would eventually rival Rome in size,
monuments, and amenities, he could hardly have selected
a more unpromising site, and he could not have imagined
DPRUHGLIFXOWWDVN

Byzantium was a small city. By the beginning of the


fourth century its monumental infrastructure included a
bath, an amphitheater, a colonnaded street, a forum, some
temples, and an aqueduct. Modern scholars have estimated
its population as 20,000 residents, perhaps as high as
30,000 or even 50,000 residents.19 These estimates, even
the low ones, are most likely too high.
In the early fourth century the total population of the
empire was perhaps about 50 million people, with just
over 31 million people in the western provinces and just
under 19 million in the eastern provinces. In premodern
economies at least 75 percent, perhaps as many as
90 percent of the population lived in the countryside
and worked the land. Perhaps about 12 percent of the
population lived in cities, that is, about 2.3 million city
dwellers in the East. Even though the percentage of urban
population was low, the number of cities was quite high.
In the eastern provinces there were about one thousand
cities, which implied an average of only a few thousand
residents in each city. But of course, the urban population

13. On Maxentius at Rome, see R. Van Dam, Remembering Constantine,


cit. (n. 10), pp. 190-203, 224-252.
14. For Licinius possible role in the construction of the hippodrome, see
A. Berger, Streets and Public Spaces in Constantinople, in DOP, 54,
2000, p. 165, and Idem, Konstantinopel: Geschichte, Topographie,
Religion, Stuttgart, 2011, p. 4.
15. CTh 15.14.1-2, invalidation. Eusebius, HE 10.9.5, images, Vita
Constantini 2.42, the evil; with S. Corcoran, The Empire of the
Tetrarchs: Imperial Pronouncements and Government AD 284-324,
Oxford, 1996, pp. 274-292, and J. N. Dillon, The Justice of Constantine:
Law, Communication, and Control, Ann Arbor, 2012, pp. 91-104.
16. Eusebius, HE 9.9a.12.
17. Eusebius, Vita Constantini 2.19.1. For another example of erasing
the memory of an earlier emperor, note Maximianopolis in Osrhoene;

previously named after the emperor Galerius, this city was now
renamed Constantina: John Malalas, Chronographia 13.12.
18. Parastaseis syntomoi chronikai 52, 54, with R. Van Dam,
Remembering Constantine, cit. (n. 10), pp. 25-29. Quotation translated
from G. Dagron, Constantinople imaginaire : tudes sur le recueil des
Patria, Paris, 1984, p. 86.
19. Estimates: C. Mango, Le dveloppement urbain de Constantinople
(e-e sicles), Paris, 1985, p. 19, 20,000 residents; J. Durliat, De
la ville antique la ville byzantine : le problme des subsistances
(FR, 136), Paris / Rome, 1990, p. 269, 30,000 residents; Idem,
Lapprovisionnement de Constantinople, in C. Mango, G. Dagron
(eds), Constantinople and Its Hinterland (Papers from the TwentySeventh Spring Symposium of Byzantine Studies, Oxford, April 1993),
Aldershot, 1995, p. 24, 50,000 residents.

Constructing a City

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINES BEAUTIFUL CITY: THE SYMBOLIC VALUE OF CONSTANTINOPLE

was not distributed evenly among all of the cities. Some


regions were only thinly populated, and a considerable
percentage of the urban population in the East already
resided in very large cities such as Antioch and Alexandria
and in notable provincial cities such as Nicomedia and
Nicaea. Byzantium was not a notable city. Even with the
stationing of a garrison, its urban population would have
been very small, probably closer to the low average.20
Once refounded as Constantinople, however, the
population of the city certainly increased dramatically.
-HDQ'XUOLDWKDVVXJJHVWHGWKDWLQWKHHDUO\IWKFHQWXU\WKH
population had expanded to perhaps 300,000 residents.21
If correct, then in less than one century the population
had increased at least tenfold if it had started in 330 with
tens of thousands, but more likely almost one hundredfold, if it had started with only a few thousand residents.
The rapidity of this growth over the fourth century was
unparalleled in the ancient world.
If the population of Constantinople had increased in
a straight line at a constant rate from ca. 30,000 residents
in 330 to ca. 300,000 residents in 400, then its population
would have doubled approximately every twenty years.
If its population had started at ca. 3,000 residents in
330, however, then its population would have doubled
approximately every decade. Initially this population
growth might have been manageable, but by the middle
of the fourth century doubling the population about every
decade would have been an extraordinary burden.
It is more likely that if the citys population had started
out somewhat low, at a few thousands of residents, its
rate of population growth was explosively high during
the initial years, and then began tapering. Constantine
KLPVHOILQDOHWWHUVHQWWR(XVHELXVDIWHUWKHELVKRSVUVW
visit to Constantinople in late 335, remarked on the citys
sudden growth: In my eponymous citya great mass
of people has imposed itself on the most holy church.
Because everything there is increasing so rapidly, it is
appropriate to construct more churches in the city.22
In contrast, Eusebius seems to have registered no
surprise at the size of Constantinople, in terms of either
bigness or smallness. Through his travels he was already
familiar with cities in Egypt, Palestine, Syria, and Asia
Minor. He had already visited the giant city of Antioch,
which is estimated to have had a population of about

20. For discussion of these projected numbers and percentages, see


R. Van Dam, Bishops and Clerics: Numbers and Their Implications,
in J. Leemans et al. (eds), Episcopal Elections in Late Antiquity
(Arbeiten zur Kirchengeschichte, 119), Berlin, 2011, pp. 217-242. For
the size of cities in the early empire, see B. W. Frier, Demography, in
A. K. Bowman, P. Garnsey, D. Rathbone (eds), The Cambridge Ancient
History, Second Edition, Volume XI: The High Empire, A.D. 70-192,
Cambridge, 2000, p. 813: Most cities were much smaller, usually only
10-15,000 persons of whom many resided outside the city itself.
21. J. Durliat, De la ville antique, cit. (n. 19), p. 269.
22. Eusebius, Vita Constantini 4.36.1.

87

150,000 residents, and various notable cities in the


eastern provinces, such as Nicaea and Ancyra. Caesarea
in Palestine has been estimated to have had a population
of almost 30,000 residents. By the end of Constantines
reign, Constantinople was, at most, perhaps about the
same size as Eusebius own see.23
7KLV PDVVLYH LQX[ RI SHRSOH UDLVHG WZR SUDFWLFDO
problems. One was the source of the immigrants. Nearby
regions alone could not have produced a surplus of
hundreds, eventually thousands, of immigrants each year.
Thrace, for instance, was already empty enough that the
Roman administration was recently settling new residents
there. The emperor Probus had settled Bastarnae in
Thrace; Diocletian had moved people from Asia Minor
to Thrace; Constantine had settled Sarmatian prisoners
in the Balkans.24 The catchment area for immigrants to
Constantinople must have extended far more widely to
include all of the eastern provinces in the Roman empire,
if not some of the eastern-most western provinces too.
Romans from the provinces were most likely many,
perhaps most, of the immigrants.
In addition, non-Romans became residents. In the
early empire many of the migrants to Rome had been
slaves, captured on the frontiers. After a generation or two
the descendants of those slaves had been assimilated into
the free population of Rome. At Constantinople too some
new residents were presumably moved there involuntarily,
as slaves and captives from the outer frontiers. Other
non-Romans moved voluntarily. Eusebius mentioned the
exotic ambassadors who arrived at Constantines court.
According to his account, Constantine was so generous in
bestowing Roman titles that many of the envoys wanted
to remain at Constantinople.25
The second practical problem was coping with the new
immigrants at Constantinople. If more and more people
were now being imported, then arrangements also had
to be made to import food, water, and building supplies
and to export the waste. By the end of the fourth century
Constantinople was a mature city with an extensive supply
network for grain and water. Under Constantine, however,
none of that comprehensive infrastructure was in place.
Where did the supplies for Constantines Constantinople
come from?

23. Population of Caesarea estimated at 28,500 residents by K. G. Holum,


Caesarea Palestinae: A Paradigmatic Transition?, in K. G. Holum,
H. Lapin (eds), Shaping the Middle East: Jews, Christians, and
Muslims in an Age of Transition 400-800 C.E., Bethesda, 2011, p. 22.
24. Settlements: Zosimus, Historia nova 1.71.1, Panegyrici latini 8(5).
21.1, Origo Constantini imperatoris 6.32-33.
25. Eusebius, Vita Constantini 4.7. For slaves at Rome, see C. Holleran,
Migration and the Urban Economy of Rome, in C. Holleran, A. Pudsey
(eds), Demography and the Graeco-Roman World: New Insights and
Approaches, Cambridge, 2011, pp. 158-159.

88

RAYMOND VAN DAM

For Byzantium in the early empire, most of the food,


including the grain, would have come from local sources.
Presumably the Roman state had provisioned the soldiers
in the garrison with grain and other foodstuffs, most
likely from nearby regions such as Thrace. Supplying the
garrison had hence followed the standard imperial model
of primarily local supplies for troops.
Once he assumed control of the eastern empire,
Constantine was certainly interested in the surplus of
grain available from Egypt. He also worried that ecclesiastical rivalries might disrupt its availability. In the eastern
provinces many churchmen were opposed to bishop
Athanasius of Alexandria. In 335 his rivals claimed that
Athanasius had hinted at blocking the ships carrying grain
from Egypt.26 This accusation was successful, because
Constantine was alarmed enough to exile Athanasius to
Gaul. But it is not necessary, or even plausible, to assume
that all of the surplus grain from Egypt was already needed
for Constantinople, or even earmarked for Constantinople.
According to Eusebius, Constantine now favored
churches with both estates and grants of grain for feeding
poor men, orphaned children, and distressed women.
Although Eusebius of course interpreted these gifts as
indications of Christian generosity, in fact, Constantine
was following the lead of earlier emperors by using gifts
of grain to promote favorite groups.27 Acquiring control
over the surplus grain of Egypt now provided him with
considerably more resources to distribute, and he quickly
earned a reputation for lavishly feeding the mouths of
his close supporters.28 Constantinople, however, was not
yet big enough to swallow much of the grain from Egypt.
One model for thinking about the supply of grain
and other food to Constantines Constantinople is instead
the supply of grain to medieval Constantinople. Once it
became an enormous city, Constantinople was dependent
on Egyptian grain. But in the early seventh century Egypt
and its grain would be lost to the Arab conquests, and the
population of Constantinople soon declined considerably,
perhaps as low as 40,000 residents. Until its population began
increasing again, grain and other food for Constantinople
came primarily from nearby regions, including Thrace and
Macedonia. If Constantines Constantinople was smaller
than medieval Constantinople, then it too probably still
relied primarily on nearby food supplies.29
7KH VXSSO\ RI ZDWHU OLNHZLVH FUHDWHG GLIFXOWLHV IRU
an expanding city. One problem was the amount of water.
An older aqueduct, known as the Aqueduct of Hadrian,

26. Athanasius, Apologia contra Arianos 9.3, 87.1.


27. Eusebius, Vita Constantini 4.28; cf. Theophanes, Chronographia
a.m. 5824, for Constantines gift of grain to the church at Antioch.
28. Ammianus Marcellinus, Res gestae 16.8.12.
29. J. L. Teall, The Grain Supply of the Byzantine Empire, 330-1025, in
DOP, 13, 1959, pp. 87-139.

AnTard , 22, 2014

had supplied the old city, but an increasing population


required many additional amenities, such as public baths
and fountains. In the early 370s an orator noted that
Constantinople was still a thirsty city.30 A second problem
was the elevation of the water. The old aqueduct could
service areas of the city only up to an elevation of ca.
30 meters above sea level. Those lower areas included the
new imperial palace, built on the slopes at the eastern end
of the peninsula. Much of the new construction, however,
was to be on the higher ridges. For instance, Constantines
mausoleum, which subsequently became part of the precinct
around the Church of the Holy Apostles, was located at the
top of the so-called Fourth Hill. Eusebius noted that the
porticoes surrounding the mausoleum contained loutra,
small bathrooms or washrooms. At the time the water for
these washrooms presumably came from wells or cisterns
OOHGE\UDLQZDWHU7KHQHZ$TXHGXFWRI9DOHQVFRPSOHWHG
GXULQJWKHHDUO\VQDOO\EURXJKWZDWHUWRWKHEXLOGLQJV
and cisterns on the high ridge.31
The construction of so many buildings, monuments,
DQGKRXVHVSRVHGDGGLWLRQDOGLIFXOWLHV2QHZDVSUHSDULQJ
WKHJURXQG(XVHELXVZRXOGFRPPHQWRQWKHGLIFXOWLHV
RIEXLOGLQJRQWKHVLWHRI-HVXVFUXFL[LRQDQGWRPEDW
Jerusalem. For some projects workmen had excavated
and removed dirt, for others they brought in dirt to level
the site. Building at Constantinople likewise required the
initial construction of many terraces, retaining walls, and
hidden foundations, before the subsequent construction of
streets, forums, public buildings, and churches.32
A second problem was the supply of construction
materials. Eusebius was able to report on the constuction
of churches that Constantine initiated in some provincial
cities. The funding came from the imperial treasuries, and
imperial magistrates, including the prefect, were instructed
to supply marble, columns, and even gold for gilding the
vaults. Presumably the emperor likewise ordered magistrates to supply construction materials at Constantinople,
including bricks, tiles, stone blocks, mortar, and wood.33
Some building supplies were recycled. The emperors
agents also removed doors and roofs from temples in the
SURYLQFHVDQGWKH\FRQVFDWHGEURQ]HVWDWXHVLQFOXGLQJ
statues of pagan deities. In a comment that was both
scornful and gleeful, Eusebius noted that once their

30. Themistius, Orat. 11.151a-c.


31. Eusebius, Vita Constantini 4.59, with J. Crow, J. Bardill, R. Bayliss,
The Water Supply of Byzantine Constantinople, London, 2008, pp. 9-14,
on the sources of water.
32. Eusebius, Vita Constantini 3.26-27; also Zosimus, Historia nova
IRUODQGOODORQJWKHVKRUHOLQHZLWK-&URZThe Infrastructure
of a Great City: Earth, Walls and Water in Late Antique Constantinople,
in L. Lavan, E. Zanini, A. Sarantis (eds), Technology in Transition
A.D. 300-650, Leiden, 2007, pp. 253-261, on terraces.
33. Eusebius, Vita Constantini 2.46.3, 3.1.4-5, 3.29-40, with J. Bardill,
Brickstamps of Constantinople I: Text, Oxford, 2004, on the brickmaking
industry.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINES BEAUTIFUL CITY: THE SYMBOLIC VALUE OF CONSTANTINOPLE

P\WKVEHFDPHLQUPWKHJRGVZHUHOHGDZD\LQFKDLQV
6WDWXHV WKDW KDG RQFH KDG UHOLJLRXV VLJQLFDQFH ZKHQ
located in the precincts of provincial temples now became
pieces of art at Constantinople.34
$ QDO SUREOHP IRU FRQVWUXFWLRQ ZDV WKH DYDLODbility of labor, both skilled and unskilled. Specialist
craftsmen, such as masons, carpenters, sculptors, and
painters, probably moved with the other migrants from
the provinces. Big projects would have required many
artisans. As a comparative example, for the restoration
of the aqueducts of Constantinople in the mid-eighth
century the emperor Constantine V summoned one
thousand masons and two hundred plasterers from Asia
DQG3RQWXVYHKXQGUHGFOD\ZRUNHUVIURP$WKHQVDQG
the islands, and two hundred brickmakers from Thrace.35
Perhaps Constantine likewise had to attract craftsmen
to Constantinople, through compulsion or by offering
incentives to work on special projects. Toward the end
of his reign in 334 he conferred special exemptions upon
artisans. By then the search for skilled craftsmen had been
extended even to North Africa: as many architects as
possible are needed.36
But without modern machines and tools, most
construction in antiquity also required a large deployment
of unskilled manual labor. For his repairs of the aqueducts
&RQVWDQWLQH9ZRXOGLQDGGLWLRQUHTXLVLWLRQYHWKRXVDQG
laborers from Thrace. In the later 320s when Constantine
announced his plan for new construction at Jerusalem, he
mentioned that the vicar and the provincial governor would
be expected to provide both craftsmen and laborers. At
pagan shrines Eusebius noted that soldiers performed the
work of destruction. A detachment of soldiers levelled
the site of a pagan shrine at Aphaca in Phoenicia, and a
military force demolished a temple in Cilicia. Soldiers
might likewise have supplied some of the musclepower
for construction, in Palestine for the building of churches,
in Constantinople for the building of the terraces and other
new projects. Perhaps the soldiers in the garrison that had
defended Byzantium were now deployed as laborers for
the initial construction of Constantinople.37
Constantines Constantinople was hence a boom town,
with a remarkable monumental core but also suburbs that
may have resembled the shantytowns surrounding todays
giant cities. The imperial palace was lavish; during one
of his visits Eusebius was especially impressed to view a
glittering depiction of a golden cross on a ceiling panel in

34. Eusebius, Vita Constantini 3.54.7, with S. Bassett, The Urban Image
of Late Antique Constantinople, Cambridge, 2004, on collections of
antiquities.
35. Theophanes, Chronographia a.m. 6258.
36. CTh 13.4.1; also 13.4.2, issued in Constantines name in August 337.
37. Eusebius, Vita Constantini      
55.5, Aphaca, 56.2, Cilicia.

89

the emperors quarters.38 But the lodgings of most of the


QHZUHVLGHQWVZHUHLPV\$ODWHUFULWLFFRPSODLQHGWKDW
some of the early shoddy buildings had collapsed soon
afterward: because of the haste, these buildings were not
solid. Under Constantine, much of Constantinople was
still a makeshift, ramshackle city.39
Constantine had a vested interest in a city named after
himself, he was obviously committed to its development,
and perhaps he even dreamed that someday it would
become a very large city with a large population. In 332
KHLQLWLDWHGDGROHRIEUHDGVXIFLHQWIRURUPRUH
residents.40 His new wall on the west side of the city more
that tripled the size of Byzantium, so that the area of his
Constantinople was about one-half the size of the walled
DUHDRI5RPH,QRUGHUIRUKLVGUHDPRIPDJQLFHQFHWREH
realized, he presumably assumed that his sons, or at least
Constantius II, the son who ruled in the East, would share
the same commitment to a namesake city and continue to
support its enlargement.
But subsequent emperors who were not Constantines
descendants would have needed more incentives to
remain loyal to the supply of a city that was increasingly
a strain on resources. They might have readily neglected
Constantinople, in the same way that Constantius had
stopped promoting Diocletians Nicomedia. Constantine
had continued to patronize Nicomedia, and his generosity
had included an impressively large church.41 But after
his reign Nicomedia soon became a backwater city.
During the later 340s, for instance, the sophist Libanius
left his teaching post at Constantinople in order to enjoy
the tranquillity of Nicomedia. By the time the emperor
Julian visited in 362, Nicomedia had become a city that
was merely famous in the past.42
In contrast, rather than being snubbed, Constantinople
ZRXOG RXULVK :K\ GLG VXEVHTXHQW HPSHURUV UHPDLQ
committed to Constantinople?
Constructing an Eastern Roman Empire
By 324 the emperor Licinius had ruled the eastern
provinces for over a decade. After defeating the emperor
Maximinus in 313, he had pursued his rival through
Asia Minor. Along the way he had announced his new

38. Eusebius, Vita Constantini 3.49, with R. Ousterhout, Master


Builders of Byzantium, Princeton, 1999, for an excellent discussion of
Byzantine builders and construction.
39. Zosimus, Historia nova 2.32.1.
40. Chronicon Paschale s.a. 332; also Socrates, HE 2.13, mentioning
that Constantius reduced the allotment from 80,000 to less than
40,000 rations.
41. Eusebius, Vita Constantini 3.50.1. Constantine also celebrated the
twentieth anniversary of his reign at Nicomedia: Jerome, Chronicon
s.a. 326.
42. Libanius, Orat. 18.13; Ammianus Marcellinus, Res gestae 22.9.3.

90

RAYMOND VAN DAM

authority in the eastern provinces. At Nicomedia he had


published the edict on religious toleration that he had
previously agreed upon with Constantine; most likely
he, or his provincial governors, also published the edict
DWRWKHUSURYLQFLDOFDSLWDOVDVKHDGYDQFHG2WKHURIFLDO
announcements described Maximinus as a tyrant, and
his portraits were defaced and statues overturned. Even
after Maximinus committed suicide at Tarsus, Licinius
continued on to Antioch. During his trip he had some
of Maximinus supporters executed. These disgraced
supporters included the prefect in charge of imperial
QDQFHVDIRUPHUSUHIHFWRI(J\SWDSURYLQFLDOJRYHUQRU
and not a few others. In their place Licinius appointed
his own supporters. The most notable was Julius Julianus,
who had previously served as a governor in Egypt and
who now became prefect of Egypt. Through this one
quick trip Licinius had strengthened his hold over the
HDVWHUQSURYLQFHVVRWKDWE\KHZDVFRQGHQWHQRXJK
to move back to the Balkans.43
Licinius never returned to the eastern frontier. Instead,
he seems to have relied upon Julius Julianus, who served
as praetorian prefect from 315 to the end of the emperors
reign. Over the next decade Licinius, probably through
Julius Julianus, would have appointed all the imperial
magistrates for the eastern provinces. Control over Egypt
also gave Licinius substantial leverage in western affairs.
Upon taking control of Rome in 312 Constantine had had
to assume responsibility for its grain supply. If Rome was
to remain a giant city, it required supplies from regions
around the entire Mediterranean, including grain from
Egypt. In 316 Constantine attacked Licinius and acquired
more territory in the Balkans; in 324 he attacked again.
Perhaps it is possible to wonder whether anxiety over the
supply of Egyptian grain to Rome was another motive for
Constantines aggression against Licinius.
After his victory over Licinius in later 324,
&RQVWDQWLQHV UVW FRQFHUQ ZDV WR HQVXUH KLV RZQ
authority in the eastern provinces. As a youngish military
RIFHUKHKDGRQFHWUDYHOHGZLWK'LRFOHWLDQWKURXJKWKH
eastern provinces to Egypt and back. After Diocletians
abdication in 305, however, he had joined his fathers
court in Gaul. By 324 even he was describing himself as
an emperor who had arrived from the West.44 After almost
twenty years away, Constantine needed to reintroduce
himself and his rule in the eastern provinces.
One tactic was to travel. Just as Licinius had marched
to Antioch after defeating Maximinus, so Constantine
traveled through Asia Minor to Syria after defeating
Licinius. Along the way he imposed his new authority.
He executed some of Licinius supporters, including the

43. Eusebius, HE 9.11.1-6; PLRE 1:478-79, Iulius Iulianus 35.


44. Eusebius, Vita Constantini 2.28-29.

AnTard , 22, 2014

PDJLVWHU RIFLRUXP ZKR KDG EULH\ VHUYHG DV /LFLQLXV


Caesar.45 Others he replaced. New imperial magistrates
now appeared in eastern provinces, including a new
governor of Syria.46 Although Julius Julianus lost his
prefecture, he successfully switched his allegiance to the
new emperor. In 325 he held a consulship; Constantine also
praised him as a model of proper administration. Perhaps
it is possible to surmise that the emperor was grateful that
in the past, when he was serving under Licinius, Julius
Julianus had continued to allow the shipping of Egyptian
grain to Rome. Eventually Constantine even blended him
and his family into his own family, when Julius Julianus
daughter married one of the emperors half-brothers.
During his trip to Antioch Constantine executed, replaced,
or reconciled with Licinius supporters in the East.
Constantine continued to travel almost nonstop.
In 325 he participated in the council of Nicaea and
celebrated the beginning of the twentieth anniversary of
his accession at Nicomedia. In the next year he traveled
to Italy and celebrated the end of the anniversary year
at Rome. He then returned to the Balkans and Bithynia,
EHIRUH PDUFKLQJ WR 7ULHU LQ  IRU D QDO PLOLWDU\
campaign on the Rhine. During the years immediately
after 324 Constantine was hence asserting his authority
and promoting his supporters, in particular in the great arc
of frontier provinces from Trier to Antioch. Appearing in
person required the emperor to travel thousands of miles.
During the later 320s Constantines primary seat of power
was his saddle.
Constantine returned for the dedication of
Constantinople in 330. Afterward he spent most of
his time at Constantinople or nearby, with occasional
military campaigns in the Balkans during the summers.
His residence at Constantinople during the 330s suggests
that Constantine had adopted a new tactic for imposing
his authority in the provinces. Rather than his constantly
traveling to the outer provinces and the frontiers,
the people of the provinces would come to him at
Constantinople. During the 330s those visitors included
envoys from eastern cities such as Orcistus in central Asia
Minor47 and western cities such as Bordeaux in Gaul,48 as
well as bishops like Eusebius of Caesarea and Athanasius
of Alexandria.49 At the same time the produce of the
provinces was shipped to Constantinople. As a result,
the supply of Constantinople would become a reminder

45. PLRE 1:563, Martinianus 2.


46. PLRE 1:707, Plutarchus 2.
47. For the appeal from Orcistus, see R. Van Dam, The Roman Revolution
of Constantine, cit. (n. 1), pp. 143-220, 368-372.
48. See the excellent discussion of the Bordeaux Pilgrim by B. Salway,
There but Not There: Constantinople in the Itinerarium Burdigalense,
in L. Grig, G. Kelly (eds), Two Romes: Rome and Constantinople in
Late Antiquity, Oxford, 2012, pp. 293-324.
49. Athanasius, Apologia contra Arianos 86.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINES BEAUTIFUL CITY: THE SYMBOLIC VALUE OF CONSTANTINOPLE

to provincials in the eastern half of the empire of their


loyalty to the emperor.
The model for this new role of Constantinople was
the role of Rome in the early empire. Supplying such an
HQRUPRXV FLW\ KDG UHTXLUHG WKH SROLWLFDO XQLFDWLRQ RI
the entire Mediterranean world, which in turn created
economic integration in the Mediterranean basin. In the
ODWH UVW FHQWXU\ %& WKH HPSHURU $XJXVWXV JHQHURVLW\
had considerably enhanced the amenities and privileges of
WKHFDSLWDO5RPHZDVKHQFHWKHUVWFLW\LQZRUOGKLVWRU\
to reach a population of one million residents. Over the
subsequent three centuries emperors remained committed to
supplying Rome with food (either free or subsidized), water,
monuments, and entertainments. Provincials paid for most
of these amenities, directly through the payment of taxes and
rents, but also indirectly through the delivery of race horses
or the capture of wild animals for the games. The supply
of Rome represented an implicit grand bargain between
emperors and provincials. On the one hand, the great size
and splendor of Rome provided emperors with a suitable
stage and a convenient audience for the performance of their
rulership. On the other hand, emperors stationed troops on
the frontiers to provide security for provincials. Supplying
Rome was hence a validation of emperors authority, a
guarantee of protection for provincials, and also a constant
reminder to provincials of their subservience.50
The expansion and supply of Constantinople could
now serve the same role among the eastern provinces.
$OUHDG\VRRQDIWHUKLVUVWYLVLWWR5RPH&RQVWDQWLQHKDG
had to issue instructions about shipmasters in Africa and
bread makers in Rome.51 By his third visit in 326 he and
KLVRIFLDOVKDGSUHVXPDEO\JXUHGRXWWKHPHFKDQLFVRI
supplying a giant city, and they could begin to institute
a similar arrangement for Constantinople. The entire
eastern empire would become a hinterland for the new
capital and imperial residence.
Contemporaries soon noticed that more and more
resources were being diverted to Constantinople.
Provincials of course complained. One grumbled that the
emperor oppressed taxpayers in order to enrich the useless
residents of Constantinople.52 But imposing a burden
was in fact the primary purpose of diverting resources.
Taxation and the extraction of resources reminded
provincials of their subordination and compelled them to
acknowledge the necessity of supporting the capital.
Constantines initial objective in founding
Constantinople had been quite limited, focused on obliterating the memory of Licinius. In the long run, however,
a new model for the identity of a distinctively eastern
empire emerged. In the early empire military conquest

50. R. Van Dam, Rome and Constantinople, cit. (n. 3), pp. 16-24.
51. CTh 11.30.4, 13.5.2-3, issued in 314.
52. Zosimus, Historia nova 2.38.1.

91

KDGOHGWRSROLWLFDOXQLFDWLRQDQGVXEVHTXHQWO\HFRQRPLF
integration around the supply of Rome. A similar
argument about military conquest could not be made
for Constantinople. So the relationship was reversed. In
the later empire the economic integration of the eastern
Mediterranean around the supply of Constantinople
SURGXFHG QRPLQDO SROLWLFDO XQLFDWLRQ 6XSSO\LQJ
Constantinople was a catalyst for creating the idea, and
the reality, of a distinctively eastern Roman empire. Most
likely it was not his overt intention, but by founding and
promoting Constantinople, Constantine was responsible
IRUGHQLQJDQHDVWHUQ5RPDQHPSLUH
In his Life of Constantine Eusebius was impressed
that Constantine was able to see problems in Phoenicia
from afar, while he was administering the imperial
household in his beautiful city. Eusebius compared the
HPSHURU WR DQ HDJOH ZLWK YHU\ VKDUS H\HVLJKW \LQJ
high in the sky.53 The eagle was a powerful symbol of
Roman rule, often seen in the provinces on legionary
standards. But now, according to Eusebius, the foundation
of Constantinople had made it possible for Constantine to
watch the provincials and his own imperial magistrates
from a distince. Subsequent emperors too understood
WKH EHQHWV RI PDLQWDLQLQJ DQG JURZLQJ WKH FLW\ 7R
enhance their control of the provinces, they would remain
committed to the supply of Constantinople.
Constructing a Dynasty
The foundation of Constantinople was associated
with an act of fratricide. Licinius had been not just a
rival emperor; he had also been a brother-in-law, the
husband since 313 of Constantines half-sister Constantia.
$OWKRXJK/LFLQLXVKDGLQLWLDOO\EHHQVSDUHGDIWHUKLVQDO
defeat, soon afterward he was executed, along with his
young son. Constantines detractors immediately censured
him for having broken an oath. Even the emperors close
advisers were aghast at his impulsiveness.54
The model for this sort of heartless extermination was,
again, Licinius. After he had defeated Maximinus in 313,
Licinius had eradicated any rival imperial dynasties in the
eastern provinces by hunting down Maximinus young
son and daughter, as well as Severus son, Galerius son,
and Diocletians widow and daughter. In the long run
WKLV SUXQLQJ RI LPSHULDO UHODWLYHV HQGHG XS EHQHWWLQJ
Constantine, because in 324 all he had to do was eliminate
Licinius family. Even the widow Constantia disappeared
into exile, apparently in Palestine.55

53. Eusebius, Vita Constantini 3.55.1.


54. Zosimus, Historia nova 2.28.2.
55. R. Van Dam, The Roman Revolution of Constantine, cit. (n. 1),
pp. 106-107.

92

RAYMOND VAN DAM

By now Constantine had become the patriarch of a


large family. Many earlier emperors, including famous
emperors such as Augustus, Nero, Trajan, and Hadrian,
had had no sons. Quite exceptionally, Constantine had
four sons who survived into adulthood. Of his sons in 324,
Crispus and Constantine II, the two oldest, had already
assumed the title of Caesar in March 317, and Constantius
II was a young boy. In the late 310s and early 320s Fausta,
Constantines wife, had given birth to three more children
(another son, Constans, and two daughters), and she might
well have been able to have more children. In addition,
Constantines half-brothers and half-sisters had more sons
of their own, and Crispus had already had a child. So many
sons and daughters, nephews and nieces, and eventually
their offspring would have seemingly ensured that well
into the future only members of the Constantinian dynasty
would rule as emperors.
In fact, imperial succession was not going to be that
straightforward. First, the precedent of the Tetrarchy
had not supported the promotion of sons. Diocletian, the
dominant emperor in the Tetrarchy, had not had a son
of his own, and when the moment had come to choose
successors in 305, adult sons (including Constantine) had
been rebuffed. Second, in 306 the army in Britain had
proclaimed only Constantine as emperor. His younger
half-brothers were rejected, even though one was thought
to have been more suitable for imperial rule. The army
had preferred primogeniture. Third, internal turmoil soon
fractured the family. Crispus was executed in 326, and
Fausta not long afterward; Constantine would have no
more sons. As a result, the succession of all of his sons, or
even the succession of any of his sons was not a foregone
conclusion.56
A top priority of any emperor, especially after a civil
war, was to ensure the loyalty of the soldiers. Immediately
after his victory over Licinius in 324, Constantine had
highlighted the role of his oldest son, Crispus. During the
military campaign Crispus had commanded Constantines
HHW 6RRQ DIWHUZDUG LQ KLV GHVFULSWLRQ RI WKH FLYLO ZDU
Eusebius praised Crispus, the most God-beloved
emperor, in virtually theological terms, as similar to
his father in all respects. After the mysterious execution
of Crispus, however, Eusebius simply erased him from
his writings about Constantine. The emperor likewise
now moved on to promote his other sons to the army. In
a prayer he composed for his soldiers to recite he included
his sons with himself in the appeal for safety. The decorations on the armys battle standard included a portrait of
the emperor and his sons.57

56. Ibidem, pp. 108-111.


57. Origo Constantini imperatoris 5.26-27. Eusebius, HE 10.9.6, Crispus,
Vita Constantini 1.31.2, portrait, 4.20.1, prayer.

AnTard , 22, 2014

Later traditions claimed that this battle standard was


kept in a storeroom in the palace at Constantinople.
Eusebius noted that he had been honored to view this
famous battle standard that had been constructed in the
shape of a cross. He had most likely seen it during one
of his visits to Constantinople, when he had also heard
Constantines stories about the importance of the symbol
of the cross in his earlier military victories. But the version
of this military standard that Eusebius saw was not the
original. In his stories Constantine associated the military
standard with his victory outside Rome in 312. Back then he
had had only one son, Crispus. Subsequently Constantine
had had more sons, and Crispus had disappeared from
the familys pedigree. So Constantine had clearly had the
portrait on the military standard updated over the years.
At Constantinople this military standard had become a
memento that simultaneously recalled an earlier victory
and promoted the emperors current heirs.58
Constantinople became a venue for advertising
Constantines sons. On November 8, 324, he refounded
Byzantium as Constantinople and promoted his third son,
Constantius, as Caesar. As a later orator described the
occasion, in the same place the father embraced the city
with a [new] perimeter and his son with a purple cloak.59
By giving birth to a new city as another offspring that
carried his name,60 Constantine could also highlight his
namesake sons. To celebrate the victory over Licinius
people composed hymns that commemorated the
triumphant [emperor] and his sons, the most decorous and
God-beloved Caesars. At Constantinople a painting over
the entrances to the palace depicted Constantine stabbing
a dragon that represented Licinius. It also depicted his
sons. The emperor displayed to everyone the dragon
beneath his feet and his sons feet. These entrances were
presumably the same gateways where foreign envoys
gathered. While waiting for an audience with the emperor,
these ambassadors could contemplate this painting of the
emperor and his sons stomping on their enemy.61
After 324 Constantine consistently promoted his
VRQV DV KLV KHLUV UVW KLV WKUHH ROGHVW VRQV &ULVSXV
Constantine II, and Constantius II; then, after Crispus
H[HFXWLRQKLVWZRROGHVWVXUYLYLQJVRQVDQGQDOO\ZLWK
the promotion of Constans as a Caesar in 333, all three

58. Storage of battle standard: Socrates, HE 1.2.7, and Vita Constantini,


ed. M. Guidi, 8Q  GL &RQVWDQWLQR, in Rendiconti della Reale
$FFDGHPLDGHL/LQFHL&ODVVHGLVFLHQ]HPRUDOLVWRULFKHHORORJLFKH,
serie quinta, 16, 1907, p. 323. Eusebius, Vita Constantini 1.30, seeing
the battle standard, with R. Van Dam, Remembering Constantine, cit.
(n. 10), pp. 29-30, 61-74.
59. Themistius, Orat. 4.58b.
60. Note Julian, Ep. 48.443: He [Constantius] loved the city as a sister,
but I as a mother. Julian had been born in Constantinople.
61. Eusebius, Vita Constantini 2.19.3, hymns, 3.3.1-2, painting, 4.7.1,
HQYR\V/DWHUWUDGLWLRQVLGHQWLHGYDULRXVVWDWXHVLQ&RQVWDQWLQRSOH
as Constantines sons: Parastaseis syntomoi chronikai 43, 58, 70.

AnTa rd , 2 2 , 2 0 1 4

CONSTANTINES BEAUTIFUL CITY: THE SYMBOLIC VALUE OF CONSTANTINOPLE

sons. In his Life of Constantine Eusebius endorsed this


plan for succession by directly implicating the sons in the
chronology of their fathers reign. He claimed (even if
mistakenly) that the promotion of each son had corresponded to a decennial anniversary of Constantines reign.
He furthermore emphasized the continuity of their names
RYHUWKHJHQHUDWLRQVZLWKWKHUVWVRQDVDKRPRQ\PRI
his father and the second as a homonym of his grandfather,
DQGQRWHGWKDWWKHQDPHRIWKHWKLUGVRQVLJQLHGFRQVLVWHQF\DQGUPQHVV*URZLQJXSWKHWZRROGHVWVRQVVHHP
to have accompanied their father on some of his travels,
before Constantine II was sent to Trier and Constantius
II to Antioch. But Constans seems to have grown up at
Constantinople, before being sent to northern Italy. In July
336 Constantine presided over another double celebration
at Constantinople, the thirtieth anniversary of his reign
and the marriage of his son Constantius. Constantines
city and Constantines sons had blended together.62
,Q KLV QDO DUUDQJHPHQWV IRU VXFFHVVLRQ &RQVWDQWLQH
added one of his nephews, Dalmatius, as a fourth Caesar.
But after Constantines death in May 337, soldiers
imposed a different succession. In 306 the army had
annointed Constantine alone as his fathers successor by
excluding his brothers; this time the army decided that
only Constantines three sons would become emperors.
The soldiers killed Constantines half-brothers and
most of their sons, including Dalmatius. Constantius
was implicated in the massacre; afterward he met with
his brothers to settle the division of the empire. Just as
Constantines foundation of Constantinople had been
associated with fratricide, now the succession of his
sons was associated with another culling of the family at
Constantinople.63
In a letter sent to the eastern provincials at about the
time he was founding Constantinople in 324, Constantine
noted that the civil wars between earlier emperors had
destroyed their legacies: they left behind neither their
name nor their family. In contrast, Eusebius thought that
the succession of his sons would guarantee the memory
of Constantine. Through the erection of portraits he is
honored with his sons in all the provinces. Even after the
end of his life his own name of Constantine survives.64
In fact, the sons would not be the reliable warranties of
their fathers legacy that Eusebius anticipated. Two sons
died in civil wars; Constantius had no son of his own;
by 350 his only surviving sibling was Constantinople.
Even though he spent almost all of his long reign in cities
on or near the frontiers, Constantius funded extensive

62. Eusebius, Vita Constantini 4.40.1-2, sons, 49, anniversary and marriage.
63. R. W. Burgess, The Summer of Blood: The Great Massacre of 337 and
the Promotion of the Sons of Constantine, in DOP, 62, 2008, pp. 5-51.
64. Eusebius, Vita Constantini 2.54, letter, 4.72, portraits.

93

construction at Constantinople.65 He also resented the


meddling of another emperor. When his cousin, the
emperor Gallus, presumed to preside over races at
Constantinople, Constantius was outraged.66 Afterward
Gallus trip to visit Constantius would become his death
march. Constantius seems to have thought of his fathers
city as his personal protectorate, to be defended even from
the infringement of relatives who were not Constantines
descendants.
In late 361 Julian arrived at Constantinople as the
VROH VXUYLYLQJ HPSHURU 2QH RI KLV UVW DFWLRQV ZDV
to help carry the sarcophagus of Constantius for burial
in Constantines mausoleum. Julian was a nephew of
Constantine, and even though he had once criticized his
uncle as a disturber of ancient laws and had initiated
a civil war against his cousin and former brother-in-law
Constantius, at Constantinople he acquired legitimacy by
behaving like a proper Constantinian emperor.67
But Julian was also a grandson of Julius Julianus,
Licinius prefect, and his long-term plans for reversing
Constantines policies might have included transitioning
Constantinople to the Julianic side of the dynasty.
Instead, his reign was not long enough to displace the
VLJQLFDQFHRI&RQVWDQWLQH,QSODFHRIWKHVRQVWKHPRVW
steadfast assurance of Constantines legacy would be his
namesake city. In 365 the usurper Procopius appeared
in public at Constantinople embracing Constantius
young daughter, who was also Constantines granddaughter. In the mid-370s the emperor Gratian married
that daughter; in 383 the emperor Theodosius buried that
daughter at Constantinople.68 Afterward, however, there
would be no more direct descendants of Constantine for
emperors of later dynasties to marry or to bury. Instead,
they took Constantines city as their consort. In later
times, during the annual ceremonies that celebrated the
anniversary of the foundation of Constantinople, soldiers
escorted a gilded statue of Constantine through the
hippodrome. When the statue arrived at the imperial box,
the current emperor was supposed to bow in honor.69 At
Constantinople subsequent emperors acknowledged they
were all imperial offspring of Constantine. Their support
for the maintenance of the city was proof that each had
become a New Constantine.

65. N. Henck, &RQVWDQWLXV", in DOP, 55, 2001, pp. 279-304.


66. Ammianus Marcellinus, Res gestae 14.11.12-13.
67. Criticism: Ammianus Marcellinus, Res gestae 21.10.8. Constantius
funeral: Libanius, Orat. 18.120.
68. Life of Constantia: Ammianus Marcellinus, Res gestae 26.7.10,
Procopius, 29.6.7, Gratians marriage; Chronicon paschale s.a. 383,
burial. For the possibility that Justina, wife of Valentinian I, was a
great-granddaughter of Constantine, see R. Van Dam, The Roman
Revolution of Constantine, cit. (n. 1), p. 121, and Idem, Remembering
Constantine, cit. (n. 10), pp. 51-52.
69. John Malalas, Chronographia 13.8; Chronicon Paschale s.a. 330.

94

RAYMOND VAN DAM

Emperors City and Imperial City


Constantinople became a giant city only because of
an ongoing commitment by emperors. Its size was not an
organic outcome of the political structure of the empire
or of its economy, nor was it even necessary. Instead,
encouraging the growth of the city and then maintaining
its great size for centuries was an enormous enterprise
that only emperors could ensure. For emperors to remain
committed to provisioning and expanding the city,
Constantinople had to mean something. Constantine had
emphasized the value of Constantinople for conferring
legitimacy on his emperorship and for imposing his
authority over the eastern provinces. In the long run the
FLW\VJUHDWVL]HFRQWLQXHGWRRIIHUWKHVDPHEHQHWVIRU
subsequent emperors. For them, the symbolic importance
RI D KXJH FDSLWDO KDG WUXPSHG WKH ORJLVWLFDO GLIFXOWLHV

AnTard , 22, 2014

of supplying a giant city. Even though Constantine could


not have foreseen these outcomes, the foundation of
Constantinople became the most consequential of his
many initiatives.
In his Life of Constantine Eusebius distinguished
Rome as the imperial city or the ruling city and
Constantinople as the emperors city. According to
this formulation, in the early fourth century Rome was
associated with the Roman empire, Constantinople with
a particular Roman emperor. In the long run, however,
Constantinople would likewise be associated with an
empire, that is, the eastern Roman empire, and with a long
sequence of emperors. Constantines foundation had been
vital for establishing Constantinople as a symbolic idiom
for imagining empire and emperorship.
University of Michigan

AnTard , 22, 2014, p . 95- 103


DOI 10.1484/J.AT.5.103179

EN SUIVANT EUSBE AU SAINT-SPULCRE


-06

Following Eusebius to the Holy Sepulchre


The text where Eusebius gives a description of the Holy Sepulchre is not clear in all its details. This article
addresses some of the open questions: was Constantine looking for the tomb of Christ, when he decided to build this
church in Jerusalem? Was the so-called Anastasis part of the Constantinian programme or was it a later addition?
Some details of the description of the martyrion, or the basilica, need also some further explanation. Finally, why
does Eusebius not say anything about the True Cross and the Rock of the Calvary? The proposed answers for the
main question are: Constantine was not looking for the tomb; the Anastasis was built at the same time, but may be
as the last part of the programme. The True Cross was not yet discovered and, in the course of the work, the Rock
of the Calvary was identified as such, but did not get an architectural frame. [Author]

Entre textes dont linterprtation pose problme


et recherches archologiques complexes et ncessairement incompltes en raison de la situation actuelle,
le Saint-Spulcre constantinien reste encore ouvert la
discussion. On essaiera ici de revoir encore une fois ce
quen dit Eusbe, en confrontant, l o cela paratra utile,
ce quil nous apprend avec les donnes de la publication
de V. Corbo (J)1. Malgr de nombreux commentaires,
toutes les questions ne paraissent pas encore rgles2.

1. V. Corbo, Il Santo Sepolcro di Gerusalemme, I-III (Studium Biblicum


Franciscanum, coll. major), Jrusalem, 1982.
2. Jai eu loccasion de mintresser une premire fois ce sujet dans
le cadre du sminaire de B. Flusin qui mavait invit en parler au
printemps 1997 et que je remercie encore une fois ici. Je le remercie
aussi pour sa relecture de mon texte et pour ses remarques. La
bibliographie sest considrablement enrichie depuis une quinzaine
dannes. En particulier, la parution du commentaire de la Vie de
Constantin par Av. Cameron et S. G. Hall, ainsi que, trs rcemment,
ldition et la traduction du mme texte dans les Sources chrtiennes
rendent inutile une reprise complte dun texte relativement long :
Av. Cameron, S. Hall, Eusebius Life of Constantine. Introduction,
translation and commentary, Oxford, 1999 ; Eusbe, Vie de Constantin
(SC, 559), texte de F. Winkelmann (GCS), intr. et notes L. Pitri,
M.-J. Rondeau, Paris, 2013. Il sera renvoy au texte dEusbe par
Vita Constantini suivi des subdivisions du texte qui sont les mmes

Quelques notes sur des points o linterprtation donne


dans les diffrents commentaires peut ventuellement tre
PRGLpHSDUDLVVHQWVLPSRVHU-HSDUVGHODSUpVRPSWLRQ
peut-tre nave, quen essayant de suivre pas pas ce que
dit Eusbe sur les constructions de Constantin, sans trop
se laisser entraner par des problmatiques rcurrentes,
TXHOTXHV GLIFXOWpV PDLV SDV WRXWHV SHXYHQW VLQRQ VH
rsoudre, en tout cas gagner en clart3.
Malgr labsence de nouvel argument, faut-il dbattre
ORQJXHPHQWGHODSUHPLqUHGLIFXOWpGXWH[WHG(XVqEHVXU
le Saint-Spulcre, lorsquil donne dabord limpression
que Constantin savait o il faisait creuser et tait la

dans le volume des Sources chrtiennes et dans ldition Winkelmann


(Griechische Christliche Schriftsteller).
3. Cest pour cette raison que je ne citerai pas un certain nombre de travaux
classiques peut-tre attendus dans ce contexte, dans la mesure o ils
essaient souvent de se servir de ce que lon croit pouvoir dire du SaintSpulcre pour soutenir une autre problmatique, par exemple lide de la
rivalit entre Eusbe et Macaire, vque de Jrusalem : cf. par exemple
P. W. L. Walker, Holy City, Holy Places?, Oxford, 1990. Pour une mise
au point sur la manire de lire Eusbe, voir Av. Cameron, Eusebius Vita
Constantini and the Construction of Constantine, dans N. J. Edwards,
S. Swain (dir.), Portraits, Biographical Representation in the Greek and
Latin Literature of the Roman Empire, Oxford, 1997, p. 145-174.

96

JEAN-MICHEL SPIESER

AnTard , 22, 2014

Fig. 1 Plan du Saint-Spulcre constantinien (daprs V. Corbo, Il Santo Sepolcro di Gerusalemme, III, Jrusalem, 1982, p. 3).

recherche de la tombe4, puis, en dcrivant les travaux,


semble parler dune dcouverte fortuite contre tout
espoir 52QSHXWFRQVLGpUHUOHG(XVqEH
comme rhtorique cest ce que font certains commentateurs6. Il est possible aussi de considrer que les travaux
dcrits par Eusbe, destruction du temple, dblaiement,
creusement une grande profondeur, taient des prliminaires ncessaires la construction dune glise, pour
des raisons pratiques et pas seulement pour carter la
VRXLOOXUH GHV VDFULFHV RX pYLWHU TXH OHV GpPRQV QH OD
contaminent. Si au cours de ces travaux, on dcouvre une
JURWWH LGHQWLpH FRPPH OD WRPEH GX &KULVW OH  FRQWUH
WRXW HVSRLU  VH MXVWLH IDFLOHPHQW HW FH VRQW OHV ORQJV
dveloppements dEusbe sur linspiration divine de
Constantin qui participent dune rhtorique chrtienne
destine masquer le caractre alatoire de la dcouverte.
Peut-on dcider ? Lattestation dune tradition chrtienne
antrieure Constantin sur le lieu de la spulture du Christ
aurait t un indice dcisif, mais, sur ce point aussi, il a t

4. Vita Constantini III, 25, et encore davantage III, 26,6.


5. Ibidem, III, 28.
6. Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 279 semblent
favoriser cette interprtation. Dans Vie de Constantin, cit. (n. 2),
les notes aux pages 385-390 donnent la mme impression, mais
nexplicitent pas linterprtation. L. Pitri, dans son introduction,
commente ces passages, p. 80-83, mais insiste surtout sur le fait que,
pour elle, comme pour dautres historiens, la dcouverte essentielle,
pour Constantin, est celle de la Croix.

argument dans les deux sens7. Jappliquerais volontiers


un schma semblable celui que je considre comme
plausible propos de lincendie de Saint-Dmtrius
de Thessalonique au dbut du e sicle : confront
deux notations contradictoires, une destruction totale de
lglise et un dblaiement qui na dur que deux heures,
cest le dtail concret du dblaiement en deux heures
qui ma sembl dcisif8. Par analogie, une description
concrte des travaux prliminaires entrans par la
dcision de construire une glise me semble lemporter
sur linsistance sur la prescience de Constantin. Le plus
vraisemblable est que le but de Constantin tait de christianiser ce qui tait alors le centre de la ville, de crer,
comme le dit aussi Eusbe, la Nouvelle Jrusalem en
face de lancienne, marque par le site du temple dtruit9.

7. Ibidem, p. 275-277, les rfrences cette question ; voir en particulier


lopposition entre J.E. Taylor, Christian and the Holy Places. The Myth
of Jewish Christian Origins, Oxford, 1993, p. 56-64, et M. Biddle, The
Tomb of Christ. Sources, Methods and a New Approach, dans K. Painter
(dir.), Churches Built in Ancien Times. Recent Studies in Early Christian
Archaeology, Londres, 1994, p. 73-147, voir p. 93-100 ; voir aussi
M. Biddle, Tomb of Christ, Stroud, 1999, p. 53-64. Les deux possibilits
ont t clairement exposes par M. Kchler, Jerusalem. Ein Handbuch
und Studienreisefhrer zur Heiligen Stadt, Gttingen, 2007, p. 418-420.
8. J.-M. Spieser, Thessalonique et ses monuments : contribution ltude
dune ville palochrtienne (BFAR, 250), Paris, 1984, p. 196-198 ;
voir aussi P. Lemerle, Les plus anciens recueils des Miracles de saint
Dmtrius, I. Le Texte, Paris, 1979, p. 192, n. 4.
9. Ce point de vue a t dvelopp par M. Bacci, Il Golgotha come simulacro,
dans M. De Giorgi et al. (dir.), Synergies in Visual Culture. Bildkulturen

AnTa rd , 2 2 , 2 0 1 4

Eusbe peut donc parler de lordre de construire un


sanctuaire donn par Constantin comme sil avait fait ce
projet de longue date 10.
Lempereur prend alors ses dispositions pour la
FRQVWUXFWLRQ GX VDQFWXDLUH   &HOXLFL
GRLW rWUH FRQVWUXLW DXWRXU GH OD JURWWH GX VDOXW  
 11/DWUDGXFWLRQGQHVWSDVLQGLIfrente : si on prend la prposition dans son sens fort,
autour , il faut conclure que Constantin fait allusion
un sanctuaire construit autour de la grotte du salut ;
il parlerait donc de ce que lon appellera lAnastasis, la
rotonde construite autour de la tombe12. On peut aussi
donner au mme mot une valeur plus faible, avec la
VLJQLFDWLRQ GH  SUqV GH 13. Constantin parlerait alors
plutt de lglise dsigne couramment au e sicle par
le vocable de Martyrion. Un des points de controverse
entre les rudits tant le fait de savoir ce que Constantin
a effectivement fait construire, il est de bonne mthode
de rserver provisoirement linterprtation pour ne pas
prjuger de la suite.
Cest dans le contexte de la dcouverte de la tombe
que lempereur crit Macaire, lvque de Jrusalem14.
'DQV OH GpWDLO FHWWH OHWWUH UHVWH GLIFLOH j LQWHUSUpWHU
Lempereur fait dabord allusion la beaut des btiments
  TXL GRLYHQW RUQHU OH OLHX VDFUp
dlivr des idoles15. Ce pluriel pourrait tre dcisif, mais
la phrase suivante empche une conclusion sre :

EN SUIVANT EUSBE AU SAINT-SPULCRE

97

le reste , est ambigu ; elle peut aussi bien dsigner


dautres btiments que la basilique, ou, au contraire, des
amnagements divers, par exemple le cadre monumental
et urbanistique dans lequel lensemble devait tre intgr.
/HPRWQHVWSDVQRQSOXVFODLUa priori il semble
dsigner un seul btiment, mais il pourrait aussi dsigner
un ensemble monumental17.
La mention dune basilique fait immdiatement penser
au martyrion, lglise construite lest de la tombe. Mais,
aprs quelques des indications gnrales sur la construction
(murs, colonnes, marbres) qui peuvent sappliquer
nimporte quel type de btiment, une expression fait
de nouveau problme18 : Constantin donne des instrucWLRQVSRXUODYRWHGHODEDVLOLTXH 
 &HWWH H[SUHVVLRQ PrPH VHPEOH FRQWUDGLFWRLUH
puisquune basilique vote nest gure possible lpoque
FRQVWDQWLQLHQQHHWTXHODEDVLOLTXHQDOHPHQWFRQVWUXLWHGH
toute vidence, ne ltait pas.
Parfois on a compris, en raison de lallusion une
vote et en voquant le Panthon et les faux caissons
de sa vote, que Constantin faisait ici allusion lAnastasis, ce qui impliquerait une utilisation qui nous parat
inattendue du mot basilique 19. Mais le sens de ce mot
nest pas aussi univoque que lusage des historiens de
larchitecture palochrtienne en fait. Deux fois, Egrie
utilise basilica pour parler de lAnastasis20. Constantin
HQYLVDJH OD SRVVLELOLWp TXH FHWWH  VRLW RUQpH GH

Il convient donc que ta Sagacit donne des instructions et


prvoie tout ce qui est ncessaire de manire ce quil y
ait une basilique plus belle que celles de partout ailleurs,
mais aussi que le reste soit tel que tout ce quil y a de plus
beau dans chaque cit soit vaincu par cette construction16.

Dans cette phrase, deux singuliers, la mention dune


EDVLOLTXH HQ GpEXW GH SKUDVH HW GXQ  HQ Q GH
SKUDVHVRSSRVHQWjXQSOXULHO&HWWHH[SUHVVLRQ

im Dialog. Festschrift fr Gerhahrd Wolf, Munich, 2013, p. 111-122 (voir


p. 112-115). Je remercie M. Bacci davoir mis cet article ma disposition.
10. Vita Constantini III, 29,1.
11. Ibidem.
12. Pour larchitecture de lAnastasis comme pour lensemble du dispositif
du Saint-Spulcre, il convient de se reporter V. Corbo, Santo Sepolcro,
cit. (n. 1). Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 134,
traduisent par around tout en se ralliant lopinion que lAnastasis
est postrieure Constantin : ibidem, p. 285.
2QQRWHUDVDQVTXHFHODVRLWXQDUJXPHQWGpQLWLITXHFHVWFHGHUQLHU
sens qui est le plus vraisemblable dans un autre passage de la Vie de
Constantin ,,, R(XVqEHGLWTXHFHGHUQLHUWFRQVWUXLUHXQ
VDQFWXDLUH SUqVGXFKrQHGH0DPEUp
14. Vita Constantini III, 30. Rien ne permet de supposer que Macaire,
loccasion du concile de Nice, tait lorigine de linitiative de
Constantin : cf. J.W. Drijvers, Helena Augusta, The Mother of
Constantine the Great and the Legend of the True Cross, Leyde, 1991,
p. 64, n. 45. Sur lide que cest la dcouverte de la Croix et non de
la Tombe qui a entran la dcision de Constantin, voir ci-dessus n. 6
et ci-dessous p. 102.
15. Vita Constantini III, 30, 4.
16. Vita Constantini,,,7UDGXFWLRQOpJqUHPHQWPRGLpH

17. Dans Vie de Constantin, cit. (n. 2), p. 421, le mot est traduit par
construction , ce qui fait penser un seul btiment, tandis que
Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 134, traduisent
par fondation , qui donne un sens plus large et plus souple.
18. Vita Constantini III, 32, 1. En ne tenant pas compte de ce passage dans
leur commentaire rapide, Sh. Gibson, J. E. Taylor, Beneath the Church of
the Holy Sepulchre Jerusalem (Palestine Exploration Fund Monograph,
6HULHV0DMRU /RQGUHVSVHVTXLYHQWODGLIFXOWp SLOV
traduisent le passage dEusbe en commenant III, 34).
19. H. Vincent, F.-M. Abel, Jrusalem. Recherches de topographie,
darchologie et dhistoire, II. Jrusalem Nouvelle, Paris, 1914, p. 169 3RXU OHPSORL GH  FKH] (XVqEH YRLU / 9RHONO Die
konstantinischen Kirchenbauten nach Eusebius, dans RAC, 29, 1953,
p. 49-66 et p. 187-206 (voir p. 58-60). Le mot nest utilis que cinq fois
chez Eusbe pour dsigner une glise, sans aucune indication sur sa
forme : Vita Constantini 3.31.1 ; ibid., 3.32.1 ; ibid. 3.53.2 (trois fois
dans ce paragraphe) ; L. Voelkl fait remarquer, juste titre, que toutes
ces occurrences se trouvent dans des textes de Constantin ; il suggre
G\YRLUjODIRLVOLQXHQFHGXODWLQHWXQHYRORQWpGHOHPSHUHXUGH
GRQQHUXQFDUDFWqUHRIFLHOjFHVIRQGDWLRQV6XUFHGHUQLHUSRLQWYRLU
Idem, Die konstantinischen Kirchenbauten nach den literarischen
Quellen des Okzidents, dans RAC, 30, 1954, p. 101-136 (voir p. 100105), o il essaie de montrer que basilica, dans le monde romain, est
XWLOLVpSRXUGpVLJQHUXQEkWLPHQWRIFLHO
20. Journal de Voyage, grie, 24, 10, d. P. Maraval (SC, 296),
p. 244-245 (des encensoirs remplissent la basilique de lAnastasis de
parfums) et, ibidem, 25, 2 (p. 246-247) ( on ouvre toutes les portes
de la basilique de lAnastasis ). Sh. Gibson, J. E. Taylor, Beneath
the Church, cit Q HVTXLYHQWODGLIFXOWpHQQHUHPDUTXDQWSDV
OHPSORLTXHIDLW(XVqEHLFLGXPRWEDVLOLTXH SLOVDIUPHQW
que ce mot nest pas utilis par Eusbe dans ce passage ).

98

JEAN-MICHEL SPIESER

FDLVVRQV 21), qui devraient alors tre dors.


Lutilisation de caissons convient mieux un plafond
[p j XQH FKDUSHQWH WHFKQLTXH ELHQ DWWHVWpH SRXU GHV
fondations impriales. Linterprtation la plus simple
FRQVLVWH j SHQVHU TXH OH PRW  D pWp XWLOLVp GH
manire approximative pour parler dun plafond22. Certes
un rapide sondage montre que, dans les textes grecs des
e-e VLqFOH  D ODLU GH WRXMRXUV VH UDSSRUWHU j
quelque chose de vot ou que lon peut assimiler
une vote. Il est le plus frquemment employ dans des
textes o ce mot dsigne la vote cleste23. Dans le rcit
du martyr de Polycarpe, dans un emploi diffrent, le feu
TXL GHYDLW EUOHU OH PDUW\U SULW OD IRUPH GXQH 
VHPEODEOHjODYRLOHGXQQDYLUHJRQpHSDUOHYHQW24.
Ces exemples peuvent faire penser, au contraire de
linterprtation gnralement reue, quil est tout fait
improbable quil puisse dsigner un plafond plat, ft-il
orn de caissons. Une piste supplmentaire redonne
pourtant du poids cette interprtation. Pour parler des
caissons, la lettre de Constantin utilise une expression
latine et non grecque25. Il reste donc possible que, pour
OH PRW  XWLOLVp GDQV OH PrPH FRQWH[WH LO IDLOOH
aussi penser au latin. En effet, en latin, camera/camara
peut tre employ dans un sens plus large et ne dsigne
pas ncessairement une vote26. On en reviendrait ainsi
linterprtation la plus largement retenue27. Il reste que la
lettre de Constantin nest pas une description, mais parle
dun projet, de possibilits, et cela de manire trs vague.
Il a fallu dautres instructions, dautres dcisions que nous

/DGMHFWLIVHPEOHrWUHXQPRWUDUHSOXW{WTXXQKDSD[
form en tout cas sur le latin lacunar : Av. Cameron, S. Hall, Life of
Constantine, cit. (n. 2), p. 284. En fait, les seules occurrences donnes
par le TLG se trouvent dans les Historia ecclesiastica de Socrate,
Thodoret de Cyr et Glase quand ils reprennent, pratiquement mot
pour mot, le texte dEusbe ou, plutt, celui de Constantin tel quil est
transmis par Eusbe.
22. Solution adopte par Av. Cameron, S. Hall, Life of Constantine, cit.
(n. 2), p. 284, par H.A. Drake, Eusebius and the True Cross, dans The
Journal of Ecclesiastical History, 36, 1985, p. 1-22, ainsi que dans
Vie de Constantin, cit Q SWUDGXLVDQWVDQVKpVLWHU
par plafond .
23. Par exemple, Hippolyte, Contra haeresin Noeti, 18, 3, 9 ; piphane,
Homilia in laudes Mariae Deiparae 43, 493, 56, Athanase, Expositio
in Psalmos 27, 436, 44, Basile de Csare, Homiliae in Hexameron 1,
18, 16, pour ne citer que quelques exemples auxquels on rajoutera
des emplois quon trouve chez Eusbe lui-mme : par exemple,
Praeparatio Evang. 7, 11, 6, 5 ; voir surtout Idem, Commentarius in
Isaiam 2, 18, 87 et 92.
24. Eusbe, Hist. Eccl. 4, 15, 37.
25. Il nest peut-tre pas inutile de rappeler que, si lauthenticit des
documents cits par Eusbe est gnralement reconnue, il nest pas
exclu quils aient t rdigs en latin avant dtre traduits en grec.
Voir ce sujet les remarques de L. Voelkl, Die konstantinischen
Kirchenbauten nach Eusebius, cit. (n. 19), p. 50.
26. Voir Thesaurus linguae latinae, s.v. camera.
27. Voir ci-dessus n. 22, ainsi que J. Wilkinson, dans son compte-rendu
de V. Corbo, dans Palestine Exploration Quarterly, 116, 1984, p. 151152. H.A. Drake, Eusebius, cit. (n. 22), essaie de montrer, p. 8 s.,
quEusbe dtourne la lettre de Constantin de manire faire croire
que le centre dintrt de Constantin ntait pas la tombe.

AnTard , 22, 2014

ne connaissons pas, pour mettre en uvre ce qui tait


souhait par lempereur28. Ce manque de prcision tend
donner raison ceux qui pensent que lempereur tait
plus intress par la richesse du dcor que par laspect
DUFKLWHFWXUDOTXLOVRXKDLWDLWYRLUGRQQpjOpGLFH29. Plus
simplement peut-tre, il faut penser quon ne peut tirer des
conclusions trop prcises dun texte de Constantin qui est
davantage une dclaration dintention quun projet prcis.
Eusbe passe alors au programme effectivement ralis
lemplacement de ce tmoin porteur du salut 30. Il
commence de nouveau la description par ce qui lui semble
le plus important, savoir linstallation autour de la tombe.
/HSUHPLHUWUDYDLOHIIHFWXpHVWORUQHPHQWDWLRQGHO
ODJURWWHFRQVLGpUpFRPPHODWrWHGHOHQVHPEOH 
31. La mention de lange annonant la rsurrection
rend inutile toute spculation sur le fait quEusbe sefforcerait ici de cacher que la lettre de Constantin concernait une
autre dcouverte, plus importante aux yeux de Constantin que
la tombe, la croix32. La description de cette ornementation

 /LQWHUSUpWDWLRQ GH FHV PRWV QHVW SDV VLPSOLpH SDU OH SDVVDJH
dans lequel Eusbe dcrit les Saints-Aptres de Constantinople (Vita
Constantini IV, 58-59). Sa description, si les quelques mots quil crit
au sujet de ce monument mritent cette appellation, ressemble trs
curieusement celle de la basilique ; en particulier, il voque nouveau
GHVFDLVVRQVHQHPSOR\DQWFHWWHIRLVOHPRWJUHF HWQRQ
le mot latin, qui ornent le plafond , pour lequel il utilise ici le mot
 DSUqV DYRLU GLW TXH &RQVWDQWLQ DYDLW UHYrWX OH PRQXPHQW GH
PDUEUH GHSXLVOHVROMXVTXDXIDvWHWUDGXFWLRQSURSRVpH
dans Vie de Constantin, cit Q SRXU&HVH[HPSOHVPRQWUHQW
encore une fois que la prcision du vocabulaire architectural nest pas
OH VRXFL SULQFLSDO G(XVqEH /D TXHVWLRQ GX SODQ GH FHW pGLFH UHVWH
discute : C. Mango, Constantines Mausoleum and the Translation of
Relics, dans ByzZ, 83, 1990, p. 51-62 (voir p. 57), pense quil sagit
dune rotonde, ce qui pourrait tre un argument pour dire que des
caissons pouvaient avoir t prvues aussi pour lAnastasis. On peut
encore faire remarquer quEusbe dit quau-dessus de ce quil appelle
 SRXU SURWpJHU OH EkWLPHQW FRQWUH OD SOXLH LO XWLOLVH GX EURQ]H
et non de la cramique, cest--dire des tuiles. Ceci, nouveau, fait
plutt penser une couverture en bronze au-dessus dune vote qu un
plafond accroch une charpente et un toit port par celle-ci. S. De
Blaauw, Konstantin als Kirchenstifter, dans A. Demandt, J. Engemann
(dir.), Konstantin der Grosse. Geschichte Archologie Rezeption,
Trves, 2006, p. 163-171 (voir p. 169), admet aussi quil est question
dun mausole en forme de rotonde.
29. P. Liverani, Progetto archittetonico e percezione comune in et
tardoantica, dans Bulletin Antieke Beschaving, 78, 2003, p. 205-219
(voir p. 205-207) ; S. De Blaauw, Konstantin, cit. (n. 28), p. 164.
30. Vita Constantini III, 33,1. Cette traduction, qui est celle de
Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 135 (voir aussi
OHXU FRPPHQWDLUH S   SRXU     
parat prfrable la traduction par martyrium qui va devenir
lappellation de la basilique.
31. Ibidem, p. 135, cette expression est traduite par the principal item .
Il me semble important de garder, ici aussi, limage qui est vocatrice de
la disposition topographique de lensemble du complexe, comme le fait
C. Mango, The Art of the Byzantine Empire 312-1453, 1972 (rimpr.
University of Toronto Press, 1986), p. 13. Dans Vie de Constantin, cit.
(n. 2), lexpression est traduite par lment capital , ce qui, certes,
correspond tymologiquement, mais reste moins vocateur.
32. H.A. Drake, In praise of Constantine: A Historical Study and
New Translation of Eusebius Tricennial Orations, Berkeley, 1976,
p. 171-172, n. 25-26, commentant lloge de Constantin IX, 16-17,
comprend quil est aussi fait allusion un monument lemplacement

AnTa rd , 2 2 , 2 0 1 4

HVWGHQRXYHDXVXIVDPPHQWLPSUpFLVHSRXUTXHORQDLWSX
se demander si elle concernait ce que, plus tard, on appellera
ldicule, cest--dire le dcor mme du rocher de la tombe
ou la construction de lensemble de lAnastasis. En effet, la
seule mention prcise de la description dEusbe concerne
la prsence de trs belles colonnes. Malgr les recherches
rcentes, nous ne sommes pas assurs de laspect constantinien de ldicule33VLELHQTXLOHVWGLIFLOHGHVDYRLUVLOHV
colonnes dEusbe sont des ornements de ldicule ou celles
de lAnastasis. Les commentaires les plus rcents considrent quEusbe mentionne ici uniquement ldicule34.
Pourtant, la manire dont est rdige la suite du texte donne,
au contraire, penser quEusbe passe dun lieu couvert un
lieu ouvert, malgr de nouveau, une certaine ambigut du
texte35/HYHUEHXWLOLVpHVWXQHWURLVLqPHSHUVRQQH
du singulier, sans que le sujet en soit clairement exprim. On
a traduit, en restant au plus prs du texte Il est alors pass
dans un espace dcouvert 36 ; dans la logique grammaticale
du texte, le pronom ne peut gure que dsigner lempereur,
ce qui na pas grand sens. On a aussi considr quil fallait
comprendre cette forme comme impersonnelle en traduisant
Ensuite, on a pass 37 ; cest alors lutilisation du pass
TXLHVWLQDWWHQGXH(QIDLWOHVXMHWGXYHUEHHVWODPXQLFHQFH GH OHPSHUHXU    2Q SRXUUDLW
DORUV WUDGXLUH   OD PXQLFHQFH GH OHPSHUHXU VRFFXSD
ensuite dun trs vaste espace 38, mais cette traduction
donne au verbe un sens qui nest gure attest, dautant plus
TXH GDXWUHV HPSORLV DYHF OD SUpSRVLWLRQ  FKH] (XVqEH
correspondent bien un vritable mouvement39. Pour rester
SURFKHGHFHWWHGHUQLqUHWUDGXFWLRQHWSRXUpYLWHUOHVGLIcults prcdemment signales, on pourrait revenir, en
FRQVLGpUDQWTXHODPXQLFHQFHGHOHPSHUHXUHVWXQH
manire emphatique de dsigner lempereur lui-mme, en
lexplicitant, la traduction dj propose : Il (Constantin)
passa ensuite (dans sa lettre ou dans ses instructions) un
WUqV YDVWH HVSDFH GpFRXYHUW  ,O SDUDvW GLIFLOH TXH FHWWH
formulation ne fasse pas penser une distinction entre les
deux lieux, ce qui suggre donc que le premier tait couvert.
Dailleurs, si ldicule stait aussi trouv lair libre, il

du Golgotha. Lauteur dveloppe ce thme dans Idem, Eusebius, cit.


(n. 22), mais il ne parat gure convaincant de spculer sur les raisons
pour lesquelles Eusbe aurait volontairement vit de parler clairement
de certains aspects de cet ensemble. Voir ci-dessous p. 102.
33. Voir M. Biddle, Tomb of Christ, 1999, cit. (n. 7), p. 68-69.
34. Vie de Constantin, cit. (n. 2), p. 397, n. 3 ; Av. Cameron, S. Hall, Life of
Constantine, cit. (n. 2), p. 289, note Vita Constantini III, 34.
35. Vita Constantini,,,

36. Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 135. Je
remercie B. Flusin pour ses remarques sur ce passage.
37. C. Mango, The Art, cit. (n. 31), p. 13.
38. Vie de Constantin, cit. (n. 2), p. 399.
39. Vita Constantini II, 11, 1 ; ibidem,,,SDUIRLVDXVHQVJXUp
mais toujours, avec une ide de passage, par exemple Praeparatio
Evangelica 11, 6, 40 (d. K. Mras, GCS 43) ou Commentaire sur
Isae, 1, 65 (d. J. Ziegler, Der Jesaikommentar, Berlin 1975).

EN SUIVANT EUSBE AU SAINT-SPULCRE

99

VHUDLWVLWXpGDQVOHPrPHOLHXGpQLSDUOHVWURLVSRUWLTXHV
quEusbe voque dans la suite de ce paragraphe40. Il
parat donc vraisemblable, contrairement une opinion
trs largement soutenue, que lAnastasis faisait bien partie
du programme constantinien. Cest aussi la conclusion
laquelle aboutit la plus rcente publication archologique41.
Il reste quon peut tre surpris que le plerin de Bordeaux
oppose simplement la grotte de la tombe la basilique
construite par Constantin42, tout comme Eusbe lui-mme,
immdiatement aprs le passage cit, situe lglise en face
de la grotte sans faire allusion la construction qui
ODEULWH0DLVSDUDLOOHXUVLODpWpSHXUppFKLVXUOHGpURXlement et sur les tapes de la construction de cet ensemble
dont le projet remonte 324/325, mais qui a t consacr
seulement en 33543. Ceci pourrait-il expliquer que le Plerin
de Bordeaux nait pas encore vu lAnastasis acheve ou,
comme peut-tre pour Eusbe, la grotte par elle-mme lui
paraissait-elle plus importante ?
Le deuxime lment dcrit par Eusbe, est par contre
bien attest par la situation archologique : entre lAnastasis et la basilique stendait une cour avec trois portiques
au nord, au sud et lest44.
(XVqEHGpFULWHQVXLWHOpJOLVHTXDOLpHGH
 WHPSOH  UR\DO 45. Cette description est plus
FODVVLTXHHWPrPHVLTXHOTXHVSRLQWVIRQWGLIFXOWpOHV
JUDQGHV OLJQHV GH ORUJDQLVDWLRQ GH OpGLFH SDUDLVVHQW
assures. Les notations dEusbe sur les revtements
de marbre lintrieur, sur lappareil soign des blocs
rgulirement taills lextrieur, sur la couverture de
plomb, sur les caissons dors qui constituent le plafond
ne font pas problme46. Quelques autres remarques sont
moins videntes comprendre.

9RLUDXVVLOHVUpH[LRQVjFHVXMHWGH(:HLJDQGZwei neue Hypothesen


ber die Konstantinische Bauten am heiligen Grab in Jerusalem, dans
ByzZ, 40, 1940, p. 78-88 (voir p. 80-82).
41. V. Corbo, Santo Sepolcro, cit. (n. 1), p. 51-79.
42. Itinerarium Burdigalense, dans O. Cuntz (dir.), Itineraria Romana,
I, Stuttgart, 1929, rd. 1990, 594, 1-2, p. 97.
43. Vita Constantini IV, 45.
44. V. Corbo, Santo Sepolcro, cit. (n. 1), p. 81-92. H. Vincent, F.-M. Abel,
Jrusalem, cit. (n. 19), p. 155, pensaient que les trois portiques formaient
louest, le sud et le nord de la cour, le quatrime ct tant occup par la
basilique, mais cette solution est exclue par les trouvailles de V. Corbo.
45. Cette traduction, adopte par Av. Cameron, S. Hall, Life of Constantine,
cit. (n. 2), p. 136, et dans Vie de Constantin, cit. (n. 2), nest pas sans
DPELJXwWpTXLYLHQWGDLOOHXUVGXWH[WHOXLPrPHSRXUUDLW
VH UpIpUHU j OD VSOHQGHXU GH OpGLFH GLJQH GXQ URL /H PRW SRXUUDLW
aussi faire allusion la fondation par Constantin, et il conviendrait alors
de le traduire plutt par imprial puisquaussi bien lusage sest
impos de rendre basileus par empereur devant limpossibilit vidente
dans les langues modernes de pouvoir rendre compte facilement du trio
&0DQJRThe Art, cit. (n. 31), p. 13, y
voit une notation architecturale et traduit par Basilique , ce qui semble
PRLQVYUDLVHPEODEOH3RXUOXWLOLVDWLRQGHSDU(XVqEHYRLU/9RHONO
Die konstantinischen Kirchenbauten nach Eusebius, cit. (n. 19), p. 52-54.
46. Pour les caissons du plafond, Eusbe emploie un vocabulaire diffrent
GHFHOXLTXLVHWURXYHGDQVODOHWWUHGH&RQVWDQWLQDXOLHX
GH

100

JEAN-MICHEL SPIESER

Eusbe parle dabord des nefs et des supports47. Son


texte montre une basilique cinq nefs avec des nefs
latrales surmontes de tribunes. Lutilisation de stoa pour
dsigner les nefs latrales dune glise est frquente48. Ce
mot peut mme tre employ pour les nefs qui enveloppent
lespace central dune rotonde49. Mais lensemble de la
phrase qui ouvre cette description pose problme. Citons
le passage en entier :

AnTard , 22, 2014

&HVWHQSDUWLFXOLHUOH[SUHVVLRQ
qui pose problme50. Ce mot dsigne habituellement les
jambages dune porte ; il peut aussi dsigner des pilastres
RXGHVFRORQQHVHQJDJpHVGpQLWLRQTXHORQWURXYHFKH]
Hsychius51. Il parat possible de passer un sens plus
gnral de support, mme si celui-ci ne parat gure attest
HWSRXUUDLWGpVLJQHUXQHGRXEOHUDQJpH
de supports52(XVqEHDXUDLWXWLOLVpSDUFHTXLO\
DjODIRLVGHVFRORQQHVHWGHVSLOLHUVFHTXHFRQUPHOD
suite du texte. Ce texte a parfois t compris ainsi, mais,
GDQVODPHVXUHROHJURXSH
QHSHXWTXHVHUDSSRUWHUjFHV
GpVLJQHUDLWOHKDXWGHFHVVXSSRUWV FKDSLWHDX[" 53,
interprtation qui nest gure possible. Il faut donc revenir
XQDXWUHVHQVGHTXLGpVLJQHDXVVLOHVSDFHHQWUH
les jambages dune porte et donc lespace entre les supports.
Une traduction, proche du sens, mais redondante dans sa
formulation, comme le texte dEusbe mme, serait : Des

deux cts, des espaces jumeaux de portiques doubles, avec


un niveau infrieur et un niveau suprieur, stendaient sur
toute la longueur de lglise et leurs plafonds aussi taient
dcors dor .
Ce sont ces mmes espaces, mais plus particulirement
les tribunes, qui sont les lments qui sont ports par des
colonnes et des piliers. Le fait que ces immenses colonnes
  VRLHQW SODFpHV   
   PRWjPRW  VXU OD IDFH GH Ooikos a fait
problme certains traducteurs, qui ont compris quoikos
dsignait lensemble du btiment. On a cru quil tait
question dlments proches de la face extrieure de
OpGLFH TXL VDSSX\DLHQWVXUGLPPHQVHVFRORQQHV54 ,
ce qui pourrait dsigner des tribunes au-dessus dun
narthex55. Mais la suite du texte, celles qui sont lintrieur de (donc derrire) celles qui sont devant sont portes
par des piliers 56, montre que nous passons dlments
qui bordent la nef centrale dautres qui sont derrire.
Il faut donc comprendre quoikos dsigne ici la nef
principale57. On trouve chez Eusbe lun ou lautre emploi
doikos qui se rapproche de ce qui est propos ici. Dans
un autre passage de la Vie de Constantin, le mot dsigne
une salle58. On retrouve sans doute le sens prcis de nef
centrale pour oikosGDQVXQSDVVDJHGLIFLOHGHOHistoire
Ecclsiastique dEusbe, o il dcrit la basilique de Tyr 59.
Les fentres dont il est question dans ce passage ne peuvent
qutre celles de la claire-voie. Cest donc la nef centrale
quelles remplissent de lumire. Mais ce parallle nest
pas absolument concluant, car, mme si elles clairent
directement la nef centrale, on peut aussi considrer que
cest lensemble de lespace qui est clair. De plus, dans
OHV OLJQHV VXLYDQWHV  HVW SOXVLHXUV IRLV XWLOLVp SRXU
dsigner lensemble de la basilique60.

47. Vita Constantini III, 37, l. 1-6.


48. Voir, par exemple, Choricius Laudatio Marciani, d. R. Foerster
(Leipzig, 1929), I, 22 et 24.
49. Marc le Diacre, Vie de Porphyre vque de Gaza, d. H. Grgoire,
M.-A. Kugener (Belles-Lettres), Paris, 1930, 75 (p. 60, l. 13).
50. Je remercie B. Flusin pour ses suggestions concernant ce paragraphe 37,
qui na dailleurs gure t comment. Dans Vie de Constantin, cit.
Q SQLOHVWFRQVLGpUpTXHVDGLIFXOWpHVWGXHjOHPSKDVH
rhtorique dEusbe, tandis quil ne reoit aucun commentaire dans
Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2).
51. K. Latte, P. A. Hansen, Hesychii Alexandrini Lexicon, 3, Berlin /
1HZ<RUNOHPPHS
>@
52. Cest dailleurs ainsi que lexpression a t comprise dans Vie de
Constantin, cit. (n. 2), p. 399. On peut noter que certains manuscrits
des Mmorables de Xnophon donnent pour 3.8.9 un emploi de
TXLGHYUDLWrWUHFRPSULVFRPPHVLJQLDQWSRUWLTXH
/HGHUQLHUpGLWHXU FKRLVLW XQH OHoRQ  GRQQpH SDU XQ DXWUH
groupe de manuscrits : Xnophon, Mmorables, d. Bandini (Belles/HWWUHV 3DULVGHSUpIpUHQFHjFISDSSDUDW
jODO3RXUOHVHQVGHVXSSRUWGRQQpjYRLU)+LOOHUYRQ
Gaertringen (dir.), Inschriften von Priene, Berlin, 1906, rimpr. 1968,
nr. 49, l. 7. De mme, dans M. R. Vallois, Attiques dliens, dans CRAI,
SOHPRWYHXWELHQGLUHVXSSRUW FIS
53. Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 136.

54. Vie de Constantin, cit. (n. 2), p. 399.


55. Sh. Gibson, J. E. Taylor, Beneath the Church, cit. (n. 18), p. 73 cf. leur
FRPPHQWDLUHSFRQVLGqUHQWDXVVLTXHVLJQLHOHEkWLPHQW
GDQVVRQHQVHPEOHLOVWUDGXLVHQWSDUIDFHLQWpULHXUHFH
qui ne rsout pas le problme.
56. Le texte a t compris ainsi par Av. Cameron, S. Hall, Life of
Constantine, cit. (n. 2), et par C. Mango, The Art, cit. (n. 31). Dans
Vie de Constantin, cit Q SHVWWUDGXLWSDUSLODVWUHDX
lieu de pilier.
57. Ctait dj linterprtation propose par H. Vincent, F.-M. Abel,
Jrusalem, cit. (n. 19), p. 159.
58. Vita Constantini III, 10, 1, pour la salle dans laquelle sest tenue la
SUHPLqUHUpXQLRQGXFRQFLOHGH1LFpH
3RXUODTXHVWLRQGHVDORFDOLVDWLRQYRLUVie de Constantin,
cit. (n. 2), p. 363, n. 4 ; Av. Cameron, S. Hall, Life of Constantine, cit.
(n. 2), p. 264-265.
59. Histoire ecclsiatique



3RXUOHVGLIIpUHQWVHPSORLVG/9RHONODie konstantinischen
Kirchenbauten nach Eusebius, cit. (n. 19), p. 54-58.

       
       
      
       
      



AnTa rd , 2 2 , 2 0 1 4

Mais le sens restreint simpose dans cette description


de la basilique du Saint-Spulcre61. Dans cette basilique
cinq nefs, des colonnes sparent la nef centrale des
premires nefs latrales, celles-ci tant spares par des
piliers des nefs latrales externes62/DQGXSDUDJUDSKH
WURLVSRUWHVTXLVRXYUHQWVXUODIDoDGHQHIDLWSDVGLIFXOWp
HWFRQUPHTXHOpJOLVHHVWRFFLGHQWpH
On a ensuite limpression quEusbe, comme sil tait
parvenu prs de ces portes, se retourne pour dcrire le
sanctuaire. La description se fait comme si un narrateur,
venu du lieu de la tombe, aprs avoir travers la cour entre
OHVGHX[pGLFHVpWDLWHQWUpSDUXQHSRUWHRXHVWGDQVOD
basilique dont il dcrirait les nefs en les parcourant, puis,
arriv prs des trois portes principales, se retournait en
direction du sanctuaire63 ,O SDUOH DORUV GH O 
'HPDQLqUHSUpFLVHODEVLGHVHWURXYH
bien lextrmit de la nef principale et nenglobe pas
WRXWHODODUJHXUGHOpGLFH(XVqEHGpVLJQHHQFRUHXQH
IRLVSDUODQHIFHQWUDOH/HUDSSURFKHPHQWHQWUHFH
SDVVDJHHWOHPSORLGLVFXWpFLGHVVXVGHYUDLWHQFRQUPHU
linterprtation.
GpVLJQHOH[WUpPLWpGHODQHIHWQRQOHSRLQWOH
plus haut64. Eusbe dit que lemplacement ainsi dsign
est celui dun hmisphre , ce qui a fait lobjet de
nombreuses discussions65. Trois, sinon quatre possibilits
de sens ont t proposes : lhmisphre pourrait tre la
coupole de lAnastasis ; cela supposerait que labside du
martyrion ait t perce de larges ouvertures66. Cela parat
peu vraisemblable. On a voulu en faire une vritable coupole
GHODEDVLOLTXHVDQVYRLUODGLIFXOWpGXSRLQWGHYXHDUFKLtectural, quon suppose une coupole place au-dessus du
sanctuaire ou quelque part sur la nef67. On a voulu en faire

61. Cest aussi linterprtation propose par C. Mango, The Art, cit.
(n. 31), p. 13. Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2),
SWUDGXLVHQWSDUKRXVHVDQVDXWUHSUpFLVLRQ,OHVWLQXWLOH
GHWUDGXLUHSDUSLOLHU/RSSRVLWLRQFRORQQHSLOLHU
doit tre garde.
62. Pour Sh. Gibson, J. E. Taylor, Beneath the Church, cit. (n. 18), p. 73 et
 YRLUOHVUHQYRLVjODJXUH FRPSUHQQHQWDXFRQWUDLUHTXHOHV
nefs qui sont devant sont celles qui courent le long des murs de
lglise et que celles qui sont limites par des piliers bordent la nef
principale, ce qui est peu vraisemblable.
63. Vita Constantini III, 38.
64. Cest par contre la traduction propose par Av. Cameron, S. Hall, Life
of Constantine, cit. (n. 2), p. 136 : the highest part of the royal house .
65. Les rfrences anciennes se trouvent dans A. Piganiol, Lhmisphairion
et lomphalos des Lieux Saints, dans CA, 1, 1945, p. 7-14 ; quelques
rfrences complmentaires dans Av. Cameron, S. Hall, Life of
Constantine, cit. (n. 2), p. 290.
66. Cette hypothse avait t dfendue par A.W. Byvanck, Die Grabeskirche
in Jerusalem und die Bauten am Grabe des Hl. Felix bei Nola, dans ByzZ,
30, 1929-1930, p. 550-553, et plusieurs fois reprise depuis.
67. En dernier, Sh. Gibson, J. E. Taylor, Beneath the Church, cit. (n. 18),
SHWFIOHSODQGRQQpJSRXQHFRXSROHHVWLQGLTXpH
en pointills il est vrai, au-dessus de labside sans aucun support audel de lhmicycle de labside. On ne sait pas trop comment, p. 74,
les auteurs simaginent les douze colonnettes qui lentouraient ,
peut-tre des colonnettes engages la base de la coupole, mais, de
toute manire, cette solution est impossible.

EN SUIVANT EUSBE AU SAINT-SPULCRE

101

un omphalos rappelant celui de Delphes, partant de lide


que Jrusalem tait considr comme le nombril du monde
et en sappuyant sur un texte du e sicle qui mentionne
un omphalos situ entre lAnastasis et le martyrion68.
Lhmisphairion dEusbe serait cet omphalos qui, en
raison de ses rsonnances paennes, aurait t rapidement
banni de lglise et plac l o on la vu au e sicle.
Lensemble est assez invraisemblable69. On a aussi pens
que le mot dsignait le baldaquin slevant au-dessus de
lautel70 8Q WHO EDOGDTXLQ DXUDLWLO VXIVDPPHQW DWWLUp
lattention pour tre ainsi mis en valeur ?
Plus frquente est linterprtation qui en fait labside,
PDOJUp OD GLIFXOWp GX VHQV TXL VXSSRVH XQH FRQIXVLRQ
entre une demi-sphre et une demi-coupole ou entre un
hmisphre et un hmicycle 71. Cette dernire
confusion est rendue vraisemblable dans la mesure o
+pV\FKLXV H[SOLTXH  SDU 72. Ce
sens pourrait tre attest dans un papyrus du e sicle
avant J. C.73. Chez Eusbe, cest le seul emploi du mot
 GDQV XQ FRQWH[WH DUFKLWHFWXUDO ,O OXWLOLVH
surtout pour parler de la vote cleste. Par ailleurs, il
Q\DVHPEOHWLODXFXQHDWWHVWDWLRQGHFKH]
lui. Lhypothse dune confusion et dune improprit
de vocabulaire reste le plus vraisemblable. Eusbe a d
employer le mot pour dsigner lhmicycle de labside.

68. Voir A. Piganiol, LHmispharion, cit. (n. 66) ; A. Baumstark, Die


Heiligtmer der byzantinischen Jerusalem nach einer bersehenen
Quelle, dans Oriens Christianus, 5, 1905, p. 227.
69. Cest A. Piganiol (LHmispharion, cit. [n. 66], p. 10-12), qui prsente
cette hypothse, sans dailleurs avoir lair dtre lui-mme absolument
convaincu.
70. Ibidem, p. 9.
71. Cette interprtation avait t dj retenue par A. Heisenberg,
Grabeskirche und Apostelkirche, Munich, 1908, I, 21 ; A. Baumstark,
Die Modestianischen und die Konstantinischen Bauten am Heiligen
Grabe zu Jerusalem (St. zur Geschichte und Kultur des Altertums
VII), Paderborn, 1915 ; H. Vincent, F.-M. Abel, Jrusalem, cit. (n. 19),
p. 162-163, avec renvoi larticle abside du DACL I, 1 83. Cf. aussi
H.A. Drake, Eusebius, cit. (n. 22), p. 10.
72. K. Latte, Hesychii Alexandrini lexikon, II, Copenhague, 1966, lemme 97,
p. 284.
73. A. Piganiol, LHmispharion, cit. (n. 66), p. 9 et n. 2, renvoie
O. Guraud, P. Jouguet, Un livre dcolier du e sicle avant J.-C., Le
Caire, 1938 ; pour le commentaire ce passage, cf. p. 22 : les diteurs
SHQVHQWTXHOHPRWGpVLJQHXQHYDVTXHRXXQHFRXSROHDX
dessus de ce monument. Le premier sens ne parat gure vraisemblable,
pour le second, voir ci-aprs. Ce texte est encore comment par
A. Krte, Literarische Texte mit Ausschluss Christlichen, dans Archiv
fr Papyrusforschung, 13, 1939, p. 118-132, le commentaire sur le
papyrus concern, p. 104-109, et, sur lpigramme qui contient le mot
discut, p. 106, mais il ne dit rien sur ce point ; E. Schweitzer, Ein
Nymphoeum des frhen Hellenismus (Festgabe fr Winckelmannsfeste
des archologischen Seminars der Universitt), Leipzig, 1938 (non
pagin), reprend lpigramme concerne qui dcrit une fontaine. Il
KpVLWHVXUOLQWHUSUpWDWLRQGHGHPLFHUFOHRXGHPLVSKqUH
WRXWHQIDLVDQWUHPDUTXHUTXHQHSRXYDLWSDVrWUHHPSOR\p
pour des raisons mtriques. Lensemble semblant tre en marbre de
Paros, lide dune fontaine en demi-cercle, ou avec une niche en demicercle, parat beaucoup plus vraisemblable que celle dune coupole.
Mais on pourrait aussi penser une demi-coupole, donc un quart de
sphre, au-dessus de la partie incurve de la fontaine.

102

JEAN-MICHEL SPIESER

Cela permet de comprendre que la mention des douze


cratres sur les colonnes qui entourent cet hmisphairion
dsigne douze colonnes engages bordant labside74.
La suite de la description pose moins de problme.
Aprs avoir regard vers labside, Eusbe revient aux
portes et continue son itinraire vers lEst. Son texte nous
fait sortir dans un espace ouvert. De celui-ci, Eusbe dit
dabord quil a des exdres de chaque ct, puis mentionne
des portiques75. Il sagit donc dune cour portiques, de
latrium habituel des basiliques palochrtiennes. La
PHQWLRQGH[qGUHVDIDLWGLIFXOWpVLELHQTXRQDYRXOX
comprendre quEusbe entendait par l les arcades des
colonnades76. Mais les deux autres emplois de ce mot chez
(XVqEH WRXMRXUV HQ OLHQ DYHF GHV L QH SHUPHWWHQW
pas cette interprtation77. Il faut donc penser des pices
annexes lies aux portiques de latrium, ce qui est courant
dans les basiliques palochrtiennes. Eusbe appelle cette
cour premire cour . Eusbe se place ici au point de
vue de celui qui entrerait par les propyles dont il parle
tout de suite aprs, par opposition une deuxime cour,
FHOOHHQWUHODEDVLOLTXHHWO$QDVWDVLV(QQOHVSRUWHVGH
latrium sont prcdes dun propyle, quEusbe appelle
    HW TXL VRXYUHQW VXU XQH UXH
SXLVTXH FHVW ELHQ OH VHQV GH  2Q SRXUUDLW GLUH
une avenue puisquil sagit du cardo maximus, une des
principales rues de Jrusalem78.
Eusbe dcrit bien un ensemble en allant douest
en est, de la tombe aux propyles de lglise, tout en
revenant, dans une sorte de conclusion, sur la richesse
du dcor de lensemble79. Pour ce faire, il suit un
cheminement possible, mme si sa description de lglise
laspect extrieur, les plaques de marbre lintrieur,
laspect extrieur des murs, les toits, le plafond, les
colonnades nest pas toujours systmatique. Il y avait
certainement une communication souvrant sur lespace

74. H. Vincent, F.-M. Abel, Jrusalem, cit. (n. 19), p. 163-164, pensent que
la disposition des douze cratres symbolisent, sans image, les douze
aptres runis autour du Christ. Daprs S. De Blaauw, Konstantin, cit.
(n. 28), p. 170, ces colonnes seraient places dans lAnastasis, mais cela
enlve toute cohrence la description dEusbe.
75. Vita Constantini III, 39.
76. Av. Cameron, S. Hall, Life of Constantine, cit. (n. 2), p. 136.
77. Louanges de Constantin (De laudibus Constantini, d. Heikel,
Eusebius Werke I (GCS 7), Leipzig, 1902, 9, 15, l. 12-13 ; Histoire
ecclsiastique 10, 4, 45 (description de la basilique de Tyr). Dautres
emplois de exedra vont dans la mme direction. Voir par exemple
Thodoret de Cyr, Commentaire sur Isae, II, d. J.-N. Guinot (SC 295),
Paris, 1982, 6.22.16 (p. 164 l. 680), o exedra est traduit par salle .
78. Le Forum est effectivement au sud et non lest ; pour le Forum,
Sh. Gibson, J. E. Taylor, Beneath the Church, cit. (n. 18), p. 67-69. Pour
OHVHQVGHYRLU/5REHUWtudes anatoliennes : recherches sur
les inscriptions grecques dAsie Mineure, Paris, 1937 (rimpr. 1970),
p. 532, n. 3 et 4.
&HVWTXHMHUHQGVDLQVL&HODSRVHpYLGHPPHQWOHSUREOqPH
GHVDYRLUVLOHVDQFWXDLUHGRQWSDUOH(XVqEHGDQVVDSKUDVH
(Vita Constantini III, 40) dsigne lensemble des installations quil a
dcrites ou seulement lglise. Mais, quoiquil en soit de cette dernire
phrase, cest bien un ensemble qui a t dcrit par Eusbe.

AnTard , 22, 2014

entre glise et tombe. Cest par l quEusbe a pu faire


entrer son lecteur. La disposition des lieux telle quon
peut la restituer rend vidente la ncessit dune telle
porte, sinon de plusieurs80.
Faut-il encore mentionner ce dont Eusbe ne parle
pas, cest--dire, le rocher du Calvaire et la relique de
la Croix ? On sest tellement tonn de son silence sur
ces points quon a essay dy trouver, malgr tout, des
allusions, du moins la vraie croix . On sest servit
dun passage du pangyrique de Constantin dEusbe
pour montrer que celui-ci connaissait la relique de la croix
et le rocher du Calvaire81 :



        
      

Les commentateurs et traducteurs les plus rcents


comprennent que, dans la premire partie de cette phrase
GLIFLOH(XVqEHIDLWDOOXVLRQjGHX[PRQXPHQWVGpFRUpV
sur lordre de Constantin, limmense maison de prires
 HWXQVDLQWWHPSOHSRXUOH
VLJQHGXVDOXW  WDQGLV
que le double objet de la seconde partie de la phrase,
OH PRQXPHQW GLJQH GXQH PpPRLUH pWHUQHOOH  
 HWOHVWURSKpHVGHODYLFWRLUHVXU
ODPRUWGXJUDQG6DXYHXU 
 UHQYHUUDLWXQLTXHPHQWj
la tombe.
Mais le fait quil ne semble pas y avoir de traces
archologiques dun monument constantinien mettant en
YDOHXU OH &DOYDLUH UHQG GLIFLOH GHQ WURXYHU XQH WUDFH
dans cette phrase82. Cela nexclut pas ncessairement
TXH OH[SUHVVLRQ   VRLW XQH DOOXVLRQ
au Calvaire, qui, au moment de ce discours dEusbe
tait connu, peut-tre la Croix. Mais cette expression
implique-t-elle la prsence dun troisime monument,
dun amnagement autour du Calvaire ou dune chapelle

80. La question du passage entre le martyrium et la cour trois portiques


nest pas clairement rsolue. Une diffrence de niveau entre le
martyrion et le triportique est en tout cas bien atteste.
81. Eusbe, De laudibus Constantini IX, 16-17 (ed. Heikel, GCS 7,
p. 221, 15-19). Pour le commentaire qui essaie den tirer des
conclusions sur les silences volontaires dEusbe, H.A. Drake, In
praise of Constantine, cit. (n. 32), p. 38-45.
82. Pour le Calvaire lpoque de Constantin, voir V. Corbo, Santo Sepolcro,
cit. (n. 1), p. 99. Plus gnralement sur la topographie et larchologie
de cette zone, ibidemSSOHWJ+$'UDNHIn
praise of Constantine, cit. (n. 32), p. 172, veut encore voir une allusion
ce monument dans la suite du texte (IX, 17), parce quEusbe utilise
lexpression combat . H.A. Drake, Eusebius, cit. (n.22), dveloppe
la mme interprtation. Contra, juste titre : P. Maraval, La Thologie
politique de lempire chrtien, Paris, 2001, p. 141 : il est clairement fait
allusion dans ce passage trois grottes, celle de Bethlem, celle du Mont
des Oliviers, la troisime ne pouvant tre que celle de la Rsurrection.

AnTa rd , 2 2 , 2 0 1 4

EN SUIVANT EUSBE AU SAINT-SPULCRE

103

abritant la relique de la Croix83 ? Lexpression, le saint


temple reprend-il simplement le terme prcdent et la
basilique, dans son ensemble, est-elle considre comme
destine commmorer le lieu du salut ou la Croix ? La
contradiction apparente entre les donnes archologiques
et le texte ambigu dEusbe ne me semble pas tre justiciable dune solution vidente.
Le rocher du Golgotha est un lment naturellement
SUpVHQW TXL D SX rWUH LGHQWLp HW PLV HQ YDOHXU VDQV
que cela soit li la construction dun btiment. Les
recherches rcentes donnent limpression que le rocher a
t taill lest sous Constantin pour le faire tenir dans
langle sud-est du portique et pour pouvoir mettre en
place les nefs latrales de la basilique, en particulier pour
la tranche de fondation du mur ouest de la basilique dans
sa partie sud84. Il a pu dabord tre vu comme un obstacle
la communication entre la tombe et le martyrion. Sa
base semble consolide par un remblai retenu par un mur
de soutnement qui est constantinien puisque les travaux
de lpoque dHadrien ne semblent pas avoir touch cette
zone. Les ouvriers de Constantin ont peut-tre trouv
un rocher, fragile sa base, sils ne lont pas dabord
FUHXVp HX[PrPHV DQ GH IDLUH GLVSDUDvWUH XQ REVWDFOH
SXLVFRQVROLGpTXDQGRQ\DYXOHOLHXGHOD&UXFL[LRQ85.
Cette prise de conscience a d se faire trs vite, ce qui

HVW FRQUPp SDU OH 3qOHULQ GH %RUGHDX[ TXL PHQWLRQQH


le monticulus Golgotha86. Le Calvaire semble se trouver
dans un endroit tellement resserr et exigu, peu mis en
valeur par sa position, que la conclusion la plus simple
est quil ne faisait pas partie du programme originel, mais
quil y a t vite intgr.
Pourquoi alors ce silence ou ce manque de prcision
dEusbe ? On a essay de montrer quil tait d ses
conceptions thologiques. On a fait allusion son
orignisme 87. Mais, au-del de la personne propre
dEusbe ny a-t-il pas un christianisme constantinien
qui va disparatre, o la Rsurrection et lAscension taient
bien plus importantes que la Passion, non passe sous
silence, mais vue travers le triomphe de la Rsurrection,
comme cela apparat aussi dans liconographie contemporaine, en particulier dans les sarcophages dits de la
Passion ? Mais rapidement, Jrusalem, mise en valeur
du Golgotha et culte de la Croix, tel quil est attest ds
les catchses de Cyrille qui marquent un terminus ante
quem sr pour la dcouverte de ce que lon pensait tre la
vraie Croix, font natre des accents diffrents.

83. Cest cette dernire interprtation qui est propose par P. Maraval, La
Thologie, cit. (n. 82), p. 140, n. 3.
84. V. Corbo, Santo Sepolcro, cit. (n. 1), p. 96-97.
85. Je rejoins ici le point de vue de M. Bacci, Il Golgotha, cit. (n. 9), p. 115,
qui envisage aussi une dcouverte du rocher loccasion des travaux
GH&RQVWDQWLQHWXQHLGHQWLFDWLRQUDSLGHDYHFOHOLHXGHOD&UXFL[LRQ

86. Itinerarium Burdigalense, cit. (n. 42), 593, 4, p. 97. Il faut noter que le
gauche (a sinistra parte) ne doit pas sentendre par rapport aux autres
btiments du Saint-Spulcre. Pour une analyse trs diffrente, quil serait
trop long de discuter ici, mais dont certains aspects restent intressants,
voir J.E. Taylor, Christian and the Holy Places, cit. (n. 7), p. 113-142.
87. Voir, par ex., P. Maraval, La Thologie, cit. (n. 82), p. 140, n. 3.

Universit de Fribourg Suisse

AnTard , 22, 2014, p. 105- 110


DOI 10.1484/J.AT.5.103180

BERLEGUNGEN ZUR REKONSTRUKTION


DER KONSTANTINISCHEN GEBURTSKIRCHE IN BETHLEHEM
::

Reflections on the reconstruction of the Constantine Church of the Nativity in Bethlehem


Since the excavations carried out in the Church of the Nativity in Bethlehem by the British Department of
Antiquities in Palestine in 1927 and during the 1930s, it has become clear that the current day building is not the
church commissioned by the Emperors mother, Helena, which the so-called Pilgrim of Bordeaux saw as early as
333 AD, but rather the more recent structure erected in the late 5th century or even the 6th century. Unfortunately, the
archaeological research in the eastern part of the church could only be carried out in its northern half; the church has
been an UNESCO World Heritage Site since 2012.
The documentation in the reports of the walls and remains of the floor discovered during the excavation is often
imprecise, so that many questions with regard to the reconstruction of the Constantine basilica remain unanswered. An
atrium lays to the west of the five-aisled basilica. Compared to todays building, the Constantinian basilica was around
one bay shorter. A reconstruction of the part of the building over the Grotto of the Nativity is difficult. The excavated
walls and the remains of the mosaic floor lead one to believe that a towering octagonal building was located here,
at the centre of which an octagonal raised platform with steps and a round opening was situated, allowing a view of
the Grotto of the Nativity below. This reconstruction is widely accepted today and has found its way into the reference
books of early Christian architecture. So the Constantine Church of the Nativity is considered to be the earliest example
of the combination of basilica and central-plan buildings in early Christian churches.
B. Bagatti had doubts about this reconstruction back in 1952 and suggested a polygonal apse as an alternative
to the eastern terminal. When a model of the Church of the Nativity was produced for the Constantine exhibition held
in Trier in 2007, the excavation documentation was examined and numerous irregularities were discovered, so as to
question the existence of an octagonal tower-like structure. A sanctuary with a three-sided apse solves this problem
however. Both of the narrow walls, which run angled along to the nave, are actually choir screens, which strikingly
framed the holy domain with the raised platform. The connection of the sanctuary, with its side rooms onto the basilica
section of the Church of the Nativity, which had galleries over its side aisles, can be realised without any problems, too.
The towering octagon, which from the exterior seemed to stand alone, was not actually a feature of the Constantine
Church of the Nativity in Bethlehem. [Author, transl. F. Webster]

Zur Vorbereitung der im Jahre 2007 in Trier veranstalteten groen Konstantin-Ausstellung sollten im
%LVFK|LFKHQ 'RP XQG 'L|]HVDQPXVHXP DXFK HLQLJH
Modelle der groen konstantinischen Kirchenbauten
prsentiert werden; dazu gehrten auch Modelle der
Grabeskirche in Jerusalem und der Geburtskirche in
Bethlehem. Dies erforderte zunchst eine berprfung
der bislang vorgeschlagenen Rekonstruktionen, wobei im
Falle des konstantinischen Kirchenbaues in Bethlehem

besondere Probleme auftraten, obwohl in allen einschlgigen Handbchern Rekonstruktionszeichnungen publiziert


VLQGGLHHLQHIQIVFKLIJH%DVLOLNDPLWHLQHPYRQ2VWHQ
angeschobenen oktogonalen Zentralbau zeigen ($EE)1.

1. B. Brenk, Sptantike und frhes Christentum, Propylen Kunstgeschichte,


Suppl. 1, Frankfurt a. M. / Berlin / Wien, 1977, S. 43, 192-193;

106

AnTard , 22, 2014

WINFRIED WEBER

Abb. 1 Bethlehem, Geburtskirche; Isometrische Reconstruktion des konstantinischen Baus mit Oktogon
(nach R. Krautheimer, Early Christian and Byzantine Architecture, Harmondsworth, 1965, S. 61, Abb. 26).

So wird die Geburtskirche in Bethlehem als frhestes


Beispiel einer Verbindung von Lngsbau und Zentralbau
im konstantinischen Kirchenbau angesehen und gilt neben
der Grabeskirche in Jerusalem als eine berzeugende
Lsung fr eine Memorial- und Pilgerkirche2. Es stellte
sich jedoch die Frage, auf welchen Erkenntnissen diese
Rekonstruktionsvorschlge beruhen.
Aufgrund der nach einem Erdbeben von 1927 in den
1930er Jahren vom British Department of Antiquities in
Palestine durchgefhrten Sondagen in der Geburtskirche
ist es sicher, dass es sich bei der heutige Kirche nicht, wie

R. Krautheimer, Early Christian and Byzantine Architecture, Harmondsworth, 1965, S. 38-39.


2. G. Stanzl, Lngsbau und Zentralbau als Grundthemen der frhchristlichen Architektur, Wien, 1979, S. 43-45; B. Brenk, Der Kultort,
seine Zugnglichkeit und seine Besucher, in Jahrbuch fr Antike und
Christentum, 20,1, Mnster, 1995, S. 90-94; T. Lehmann, Zur Genese der
Trikonchosbasiliken, in B. Brenk (Hrsg.), Innovation in der Sptantike
(Kolloquium Basel 6. und 7. Mai 1994),Wiesbaden, 1996, S. 321.

man frher glaubte, um den Ursprungsbau, sondern um


einen im spten 5. oder wohl eher erst im 6. Jahrhundert
errichteten Neubau handelt, dessen Lngsmauern und
Sulenstellungen allerdings auf dem Vorgngerbau
gegrndet sind3. Dieser Vorgngerbau ist jener Bau, den
Helena, die Mutter des Kaisers Konstantin, hat errichten
lassen. Nach der Vita Constantini des Eusebius hat
Konstantin seiner Mutter bei ihrer in den Jahren 328/329

3. Zu den Ausgrabungen: W. Harvey, Structural Survey of the Church of


the Nativity Bethlehem, London, 1935; L.-H. Vincent, Bethlem. Le
sanctuaire de la Nativit daprs les fouilles rcentes, in Revue biblique,
1936, S. 544-574; A. Rcker, Bericht ber die archologischen
Ergebnisse der Untersuchungen in der Geburtskirche in Bethlehem, in
Oriens Christianus, 35, 1938, S. 224-238; G. Kroll, Auf den Spuren
Jesu, Stuttgart, 1980, S. 54-59. Zuletzt hat sich U. Verstegen in
ihrer 2013 der Philosophischen Fakultt der Friedrich-AlexanderUniversitt Erlangen-Nrnberg eingereichten und noch ungedruckten
Habilitationsschrift Heiliger Ort sakraler Raum. Kontinuitt und
Wandel in der Inszenierung der Herrenorte in Jerusalem, auch mit dem
Ursprungsbau der Geburtskirche befasst.

AnTa rd , 2 2 , 2 0 1 4

DER KONSTANTINISCHEN GEBURTSKIRCHE IN BETHLEHEM

107

Abb. 2 Bethlehem, Geburtskirche; Grundriss der heutigen Kirche und Grabungsbefunde des konstantinischen Baus
(nach G. Kroll, Auf den Spuren Jesu, Stuttgart, 1980, S. 54, Abb. 30).

unternommenen Reise ins Heilige Land Zugriff auf den


kaiserlichen Schatz gewhrt:
Sofort weihte sie also dem verehrten Gott zwei Tempel,
den einen an der Grotte der Geburt, den anderen auf dem
Berg der Empornahme (Himmelfahrt). Denn auch sich
der Geburt zu unterziehen, hielt der Gott, der mit uns ist,
XQVHUHWZHJHQDXVXQGGHU3ODW]VHLQHUHLVFKOLFKHQ*HEXUW
wurde bei den Hebrern als Bethlehem mit Namen
verkndet. Deshalb nun schmckte die gottesfrchtigste
Kaiserin die Schwangerschaft der Gottesgebrerin
durch wunderbare Denkmler aus, indem sie auf allerlei
Weise die dortige heilige Grotte aufstrahlen lie, und der
Kaiser ehrte wenig spter auch diese (Gottesgebrerin)
durch kaiserliche Weihgeschenke, indem er durch die
Kleinodien aus Silber und Gold und durch die bunten
Tcher die Liebe seiner Mutter zum Schnen steigerte4.

Der im Jahre 333 in Bethlehem verweilende


sogenannte Pilger von Bordeaux notierte in seinem
Pilgerbericht: Dort, wo Jesus Christus, der Herr, geboren
ZXUGHEHQGHWVLFKGLHDXI%HIHKO.RQVWDQWLQVHUULFKWHWH

4. Eusebius, Vita Constantini III, 43, 1-2. bersetzung: P. Drger,


Eusebios. ber das Leben des glckseligen Kaisers Konstantin,
Oberhaid, 2007, S. 203-204.

Kirche und gibt damit einen terminus ante quem zur


Fertigstellung der Geburtskirche5.
Die Grabungen von 1932 auf dem Vorplatz und 1934
im Innern der Kirche, denen in den 1940er Jahren und
1962-1964 weitere Untersuchungen folgten, sind zwar
in verschiedenen Grabungsberichten bekannt gemacht
worden, doch waren die Grabungsareale jeweils begrenzt
und wurden, was den Bereich des Querhauses angeht,
zudem nur unzureichend dokumentiert ($EE ). Aus
diesem Grunde stellen sich viele Fragen, die auch heute
noch nicht beantwortet werden knnen. Dringend wre
eine exakte Bauaufnahme sowohl des heutigen Baues
als auch neuere archologische Untersuchungen dieses
fr die Kenntnis des konstantinischen Kirchenbaues
so wichtigen Denkmals notwendig, das seit 2012 zum
Weltkulturerbe der UNESCO gehrt.
Dennoch lassen die Grabungsergebnisse erkennen,
dass der geosteten konstantinischen Kirche im Westen
ein Hof vorgelagert war, vielleicht gestaltet als ein von
Portiken umgebenes Atrium. Doch erlauben die aufgefun-

5. Itin. Burdig. 598 (CCSL 175 [1965], 20). bersetzung: H. Donner,


Pilgerfahrt ins Heilige Land. Die ltesten Berichte christlicher
Palstinapilger (4.-7. Jahrhundert),$X6WXWWJDUW S. 61.

108

WINFRIED WEBER

denen Baureste auch hierzu keine klare Aussage. Sicher


EHOHJWLVWGDVEDVLOLNDOHIQIVFKLIJH.LUFKHQJHElXGHPLW
einer Mittelschiffsbreite von etwa 9 m; die beiden inneren
Seitenschiffe sind 3 m, die beiden ueren Seitenschiffe
3,50 m breit. Whrend diese Gliederung und auch die
Breite des Kirchenschiffes und der Seitenschiffe vom heute
bestehenden Nachfolgebau bernommen wurden, wurde
der heutige Bau um ein Joch nach Westen hin verlngert.
So sind durch die Ausgrabungen in Hhe des ersten
westlichen Sulenpaares des heutigen Kirchenbaues in der
0LWWHODFKVH GLH 7UVFKZHOOH GHV  P EUHLWHQ ]ZHLJHligen Mittelportals der konstantinischen Kirche sowie im
nrdlichen inneren Seitenschiff die Schwelle des 1,50 m
breiten Seitenportals belegt, dem im sdlichen inneren
Seitenschiff ein ebensolches Portal entsprochen haben
drfte, welches aber nicht im Befund nachgewiesen ist.
Bemerkenswert ist, dass das uere Seitenschiff nach
Westen eine geschlossene Wand aufwies und demnach
kein eigenes Portal besa; auch nach Osten ist das uere
Seitenschiff im heutigen Bau durch eine Mauer geschlossen.
Denkbar sind, hnlich der Grabeskirche in Jerusalem, ber
den Seitenschiffen der konstantinischen Kirche Emporen,
doch gibt es dazu keinen Befund.
Schwierig und zu diskutieren ist die Frage nach der
Gestaltung des Altarraumes des Ursprungsbaues und des
unmittelbar ber der Geburtsgrotte liegenden Bauteils.
Der heutige Bau weist dort ein Querhaus mit einer nach
Norden und einer nach Sden angefgten Apsis auf; nach
Osten schliet sich die Ostapsis an. Die Grabungen haben
in diesem Bereich seinerzeit im Wesentlichen nur im
nrdlichen Querhaus und der Nordapsis stattgefunden; die
Befundsituation in der sdlichen Hlfte des Querhauses ist
nicht erforscht. Zunchst wurde im Bereich der nrdlichen
Apsis festgestellt, dass sich die Nordwand etwa 7,20 m
weiter nach Osten fortsetzt, um dann im rechten Winkel
nach Sden abzubiegen; nach etwa 4,50 m stsst sie gegen
eine in West-Ost-Richtung verlaufende, 1,20 m breite
Mauer, die nach Osten etwa 5,40 m weit zu verfolgen ist
und dann in einem 45 Grad-Winkel in Sd-Ost-Richtung
abknickt. Im weiteren Verlauf wurde nach 7,90 m eine
weitere Mauerecke mit einem nach Sden verlaufenden
Mauerstck freigelegt. Aufgrund dieser Mauerbefunde,
ber die man sich eine exaktere Grabungsdokumentation
und Beschreibung wnschte, wurde ein Oktogon mit
etwa 7,80 m breiten ueren Seiten und einer ueren
Gesamtbreite von etwa 18,60 m in Nord-Sd-Richtung
rekonstruiert. Bemerkenswert ist jedoch, dass die
nordwestliche Oktogonseite als nur 0,60 m breite Mauer
oder gar nur als Ausbruchgrube im Mosaik nachgewiesen
ist6. Im Zentrum des Oktogons befand sich eine achteckige

6. Stanzl, a.O., S. 43, hlt es fr mglich, dass diese schmalen Mauern


vielleicht bei einem zweiten Arbeitsgang oder in Folge einer
Plannderung [...] geschaffen worden sein knnten.

AnTard , 22, 2014

Plattform, zu der drei Stufen hinauffhrten. In der Mitte der


Plattform lag eine kreisrunde, etwa 3,90 m weite und von
einer Steinfassung umgebene ffnung, die einen Einblick in
die darunter liegende Geburtsgrotte erlaubte und ehemals,
nach Ausweis der in die Auenseite der Steinfassung
eingearbeiteten Vertiefungen, von einem Gitter umgeben
war. An die untere Stufe schliet ein Mosaikboden an, der
den Umgang zwischen den Auenmauern und dem oktogonalen Stufenpodest ziert. Vom Mittelschiff erlaubten drei
Stufen den Zugang zum etwa 0,60 m hher liegenden
Bodenniveau des Oktogons. Hier ergaben die Grabungen
auch einen, wenigstens einmal vernderten Zugang zur
Geburtsgrotte, wobei unklar blieb, ob an dieser Stelle auch
schon im konstantinischen Bau der Zugang zur Grotte
gelegen hat. Angesichts des schmalen Umgangs um das
Stufenpodest, scheint jedoch nur vom Mittelschiff aus ein
Zugang mglich gewesen zu sein.
Das Aufgehende des Oktogons wird meist als
turmhnliches Oktogon rekonstruiert, eine Lsung, die
scheinbar allgemein akzeptiert und in verschiedene
Handbcher Eingang gefunden hat. R. Krautheimer
deckt das Oktogon mit einem Pyramidendach mit einem
Opaion ($EE ). Sowohl auf der Nordseite als auch
auf der Sdseite sind jeweils zwei Rume angegliedert,
zunchst ein dreieckiger Raum mit Verbindungstren
zum Oktogon und nach Westen zum inneren Seitenschiff
und nach Norden bzw. nach Sden zu den ueren, etwas
tiefer liegenden rechteckigen Nebenrumen.
Die Lsung eines hochaufragenden Oktogons ist
jedoch keineswegs gesichert und erfuhr auch schon 1952
durch B. Bagatti Widerspruch, der statt des Oktogons eine
polygonal gebrochene Apsis als Ostteils der konstantinischen Kirche vorgeschlagen hat7. Bei der Annahme eines
Oktogons bleiben tatschlich einige Ungereimtheiten,
die sich mit der Oktogonlsung nicht erklren lassen. So
ist nicht erklrbar, aus welchem Grunde die nordwestliche bzw. sdwestliche Oktogonseite mit 0,60 m Breite
nur halb so stark sind wie die anderen Oktogonseiten.
Zudem scheinen im Befund nur die Ausbruchgruben
dieser schmalen Mauern gefunden worden zu sein. Ein
turmhnliches Oktogon bedarf aber auch an diesen Stellen
ausreichender Fundamente. Des weiteren stellt sich die
Frage, auf welche Weise im Aufgehenden das Oktogon
an die stlichen Mittelschiffspfeiler angeschlossen war
und wie sich die Annexbauten dazu verhielten. In einer
Zeichnung lsst sich manches darstellen, doch schon der
Bau eines Modells offenbart die Schwierigkeiten, sowohl
LQIRUPDOHUDOVDXFKLQEDXWHFKQLVFKHU+LQVLFKW
Unverstndlich ist bei der Oktogonlsung auch die
nrdliche Oktogonseite, die als 1,20 m breite Mauer ber
die nordwestliche Oktogonecke hinaus noch weiter nach

7. B. Bagatti, *OLDQWLFKLHGLFLVDFULGL%HWOHPPHJerusalem, 1952.

AnTa rd , 2 2 , 2 0 1 4

DER KONSTANTINISCHEN GEBURTSKIRCHE IN BETHLEHEM

109

Abb. 3 Bethlehem, Modell der


konstantinischen Geburtskirche
(Foto R. Schneider, Bischfliches
Museum Trier).

Westen reicht und mit der Sulenstellung zwischen den


EHLGHQ 6HLWHQVFKLIIHQ XFKWHW 'LH $XVJUlEHU QDKPHQ
an, dass die Mauer in einem Mauerkopf endet, der in der
darunter liegenden Grotte der Unschuldigen Kinder von
einer Rundsule abgesttzt wurde; vom Mauerkopf sei nach
Westen eine Arkade zu denken mit einem Trdurchgang
zwischen dem dreieckigen Raum zum ueren Annexbau.
Eine weiterer, bisher scheinbar nicht diskutierter Befund
lsst sich ebenso wenig mit der Oktogonlsung in Einklang
bringen. So sind offenbar die inneren Polygonseiten nicht
gleichlang, wie man es bei solch einem Bau erwarten
msste: die nrdliche und dementsprechend wohl auch
die sdliche Polygonseite sind um etwa 0,40 m krzer als
GLHDQGHUHQ,QQHQVHLWHQGHV2NWRJRQV'HPHQWVSUHFKHQG
ist auch die Lnge des Oktogons in West-Ost-Richtung
geringer. Wenn auch der ergrabene Befund und die zur
Verfgung stehende Dokumentation hinsichtlich dieser
Mauern unsicher ist, so ist aber an den freigelegten
Mosaikresten klar ersichtlich, dass auch der Umgang um
das Stufenpodest nicht die gleiche Breite aufweist. So
ist der Abstand zwischen der nrdlichen Oktogonmauer
und der unteren Stufe des oktogonalen Podestes etwa um
0,60 m grer als der Abstand der anderen Oktogonwnde
]XU 6WXIHQDQODJH 0LW HLQHP KRFKDXIUDJHQGHQ XQG GLH
Ostpartie der Kirche dominierenden Oktogon lassen sich
diese Unregelmigkeiten nicht erklren und fordern
vielmehr eine andere Lsung fr den Ostabschluss der
*HEXUWVNLUFKH
Gerade die Verlngerung der nrdlichen Oktogonmauer ber die Oktogonecke hinaus und ihre Ausrichtung
auf die Sulenstellung zwischen den Seitenschiffen weist

vielmehr auf eine Chorlsung mit dreiseitig gebrochenem


Chorabschluss, hnlich einem 5/8-Chorschluss, hin, so
wie es bereits B. Bagatti vorgeschlagen hatte. Dabei htte
der polygonale Chorschluss drei gleiche Mauerlngen,
whrend die beiden auf die Sulenstellung ausgerichteten
und bisher als nrdliche bzw. sdliche Oktogonseiten
angesprochenen Mauern als Seitenwnde den etwa 17 m
tiefen Chorraum rahmen; die oben aufgezeigten strenden
Unregelmigkeiten treten bei dieser Chorlsung nicht auf
($EE)8. Die zum Kirchenschiff hin weisenden schmalen
Oktogonmauern sind wahrscheinlich Schrankenmauern,
die als Entsprechung zum polygonalen Chorschluss den
heiligen Bezirk mit dem oktogonalen Stufenpodest und
dem in die Geburtsgrotte einen Einblick gewhrenden
Okulus wirkungsvoll einfassten. Man knnte sich diese
Schrankenmauern hnlich vorstellen wie die in der
Trierer Sdostbasilika (im Bereich der heutigen gotischen
Liebrauenkirche gelegen) nachgewiesenen, verputzten, etwa
40 cm breiten und etwa 1,70 m hohen Mauerschranken, die
den Rechteckchor des 4. Jahrhunderts zum Kirchenschiff
KLQ DEVFKUDQNWHQ XQG LQ GHUHQ 9HUSXW] ]DKOUHLFKH *UDIWL
Christogramme, Namen und kurze Gebetsformeln

8. Zum Modell: W. Weber, Unsichtbar ist er und erfllt sind Himmel


und Erde. Der christliche Kirchenbau ein neues Kapitel der
europischen Architekturgeschichte, in Antike Welt, 3, 2007, S. 25-30,
hier 27-28; B. Weber-Dellacroce, W. Weber, Dort wo sich Gottes Volk
versammelt Die Kirchenbauten konstantinischer Zeit, in A. Demandt,
J. Engemann, Konstantin der Groe Ausstellungskatalog, Trier /
Mainz, 2007, S. 244-255, hier 251, Kat. II.2.17 (W. Weber).

110

WINFRIED WEBER

AnTard , 22, 2014

Abb. 4 Bethlehem, Modell der


konstantinischen Geburtskirche;
Einblick in den Chorraum (Foto
R. Schneider, Bischfliches Museum
Trier).

eingeritzt waren9. Vielleicht war in der Geburtskirche in


den Schrankenmauern ein Durchgang, der den Zutritt auch
von der Seite aus ermglichte ($EE)10. Der zwischen den
Schrankenmauern und den Chorseitenwnden entstehende
kleine dreieckige Raum diente als Verbindung zwischen den
inneren Seitenschiffen, den ueren Annexrumen und dem
Chorraum. Dass man die Seitenwnde des Chorraumes auf
die Sulenstellung zwischen den Seitenschiffen ausrichtete,

9. Dazu A. Binsfeld, 9LYDV LQ 'HR 'LH *UDIWL GHU IUKFKULVWOLFKHQ


Kirchenanlage in Trier. Die Trierer Domgrabung, 5, Trier, 2006.
10. Das Modell im Mastab 1:200 fertigte nach Angaben des Verfassers
und unter Mitwirkung von B. Weber-Dellacroce im Auftrag des
%LVFK|LFKHQ 0XVHXPV 7ULHU GLH 0RGHOOEDXHULQ / 6WHLHU $\O
Die Zeichnungen fr das Modell fertigte Dipl. Ing. (FH) Carsten
Henschel, Trier.

mag damit zu begrnden sein, dass auf diese Weise fr das


Stufenpodest eine grere Raumbreite zu gewinnen war.
Dies erffnete aber auch die Mglichkeit, die Seitenwnde
des Chores nach Westen bis zur Kirchenfassade als
durchfensterter Obergaden weiter zu fhren. Damit knnten
die inneren Seitenschiffe mit Emporen ausgestattet gewesen
sein, whrend die ueren Seitenschiffe solche nicht besaen
und mit einem Pultdach an den Obergaden anschlossen. Die
im Modell vorgeschlagene Chorlsung ist in bautechnischer
Hinsicht ohne Probleme mglich; auch die ergrabenen
Befunde widersprechen dieser Lsung nicht. Dies bedeutet
aber auch, dass es das hochaufragende, von auen als eigener
Baukrper erscheinende Oktogon der konstantinischen
*HEXUWVNLUFKHLQ%HWKOHKHPQLHJHJHEHQKDW
%LVFK|LFKHV'RPXQG'L|]HVDQPXVHXP7ULHU

AnTard , 22, 2014, p. 111- 123


DOI 10.1484/J.AT.5.103181

LA CATHDRALE DE PAULIN DE TYR


DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?
6*)$.%

The Cathedral of Paulinus of Tyre described by Eusebius of Caesarea:


myth or reality?
The qualities of construction attested in the archeological remains of the impressive and well decorated church
now named Basilica of Quarter sand in Tyre (formerly known under the name Basilica of the Quarter Hajj
Qaafarani), have raised debates for the identification of this church with the cathedral mentioned by Eusebius
of Caesarea in the famous panegyric included in his Ecclesiastical History (Book 10, Chap. 4), and delivered in
313-314 under the aegis of bishop Paulinus of Tyre. But recent epigraphic and topographic studies, C14 analysis
and other archaeological discoveries, confronted with Eusebius panegyric, give us data in order not to identify
Paulinuss cathedral with the remains of Basilica of Quarter Sand; and, in contrary, to propose the identification
of the latter, which seemingly had martyrial and funerary functions, with the Saint Mary of Swamp mentioned in the
Acts of the Synod held under the aegis of Epiphanius of Tyre on September 16th of 518. [S. Garreau-Forest]

/HV GLIFXOWpV j UHVLWXHU OHV FRPSOH[HV pSLVFRSDX[


dans leur trame urbanistique, dterminer leur datation
DLQVLTXHOHXULGHQWLFDWLRQjSDUWLUGHVVRXUFHVWH[WXHOOHV
ont dj t releves travers ltude des cits chrtiennes
de la partie occidentale de lEmpire, notamment en
Gaule et en Italie1. Le mme schma se reproduit dans
OpWXGHGHVpGLFHVFKUpWLHQVGpJDJpVORUVGHVIRXLOOHVDX
Proche-Orient et dont on essaie de recouper les donnes
avec les tmoignages crits. Ce que livre le pangyrique dEusbe de Csare ici en cause2 nous renvoie

Abrviations : CPG = G. Geerand, J. Desmet, Clavis Patrum


Graecorum, Turnhout, 1979-1998. ACO = Acta conciliorum
oecumenicorum, d. E. Schwartz et al., Strasbourg puis Berlin, 1914-.
1. F. Monfrin, La christianisation de lespace et du temps. A. Ltablissement
matriel de lglise aux e et e sicles, dans J.-M. Mayeur, Ch. et L. Pietri,
A. Vauchez, M. Venard (dir.), Histoire du Christianisme des origines nos
jours, 3. Les glises dOrient et dOccident, Paris, 1998, p. 961-966.
2. Eusbe de Csare, Histoire ecclsiastique, III, Livres VII-X [traduit
du grec . Grapin], nouv. d. revue par Y. Germain (La Bibliothque
de lAntiquit), 2012. Dixime livre, chapitre 4, Discours sur ltat des
affaires, 1. Discours sur lrection des glises, adress Paulin, vque
de Tyr, p.154-179.

aux mmes problmatiques. Rappelons que le discours


fut prononc par Eusbe en prsence de lvque Paulin
lors de la conscration dune cathdrale construite ou
plutt rnove Tyr (Sour), dans lancienne province
de Phnicie Maritime, dans le sud du Liban actuel,
durant la deuxime dcennie du e sicle de notre re.
Les interrogations souleves concernent effectivement
HQSUHPLHUOLHXOLGHQWLFDWLRQGHOpGLFHOHGLVFRXUVHQ
question donnant une description prcise dun vnement
religieux mais galement dune ralisation architecturale
qui aura marqu son temps. Il est donc incontournable de revenir dabord au contenu de ce texte et de le
resituer dans son contexte historique. En deuxime lieu
YLHQGUDODWHQWDWLYHGHORFDOLVHUFHWpGLFHGDQVODWUDPH
urbanistique protobyzantine connue de la cit ; cette
investigation topographique devra tre opre par le biais
des dcouvertes archologiques les plus rcentes et dune
interprtation des vestiges chrtiens dj dgags au
cours des dernires dcennies, en confrontant toutes ces
donnes aux sources historiques. On sattachera ensuite
jXQHWHQWDWLYHGLGHQWLFDWLRQSUpFLVHGHYHVWLJHVPLVDX
jour en 1995, correspondant manifestement une glise

112

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

AnTard , 22, 2014

Fig. 1 La Basilica of Quarter


Sand , Hajj Qaafarani, Tyr :
vue gnrale du double chur
(phot. S. Garreau-Forest, 1998).

qui se dmarque par ses dimensions et la qualit des


matriaux employs dans sa construction, sa dcoration
ainsi que ses amnagements liturgiques (J ) ; cette
glise, situe dans le quartier anciennement appel Hajj
Qaafarani du nom du propritaire du terrain lors du
dgagement3, avait ds sa dcouverte fait polmique pour
sa corrlation avec la cathdrale de Paulin voque par
Eusbe. Le quartier a t renomm Basilica of Quarter
Sand en raison des indices gologiques obtenus lors des
fouilles et du changement de propritaire du terrain4.
Analyse du discours dEusbe de Csare
Le texte de lHistoire Ecclsiastique
dans son contexte historique
Rappelons que cette compilation fait partie des
sources historiques et hagiographiques majeures pour la
connaissance de la formation de lEmpire chrtien sous
OH UqJQH GH &RQVWDQWLQ PDLV TXH VD FODVVLFDWLRQ UHVWH

3. A. Badawi, Dcouverte dune basilique palochrtienne Tyr, dans


Liban lautre rive (catalogue dexposition, 27 oct.1998-2 mai 1999,
Paris, Institut du Monde Arabe), Paris, 1998, p. 215.
4. Nous remercions la Direction gnrale des Antiquits du Liban
Beyrouth et plus particulirement Ali Badawi, responsable de
la DGAL dans le sud du Liban, davoir permis laccs au site et au
matriel archologique de lglise protobyzantine de Hajj Qaafarani
et davoir ainsi permis de prsenter laboutissement de plusieurs
annes de recherches communes dans cette synthse archologique et
historique sur les monuments chrtiens protobyzantins dcouverts Tyr
ces dernires annes et mis en lumire travers le tmoignage crit
dEusbe de Csare

encore dbattue5 du fait des diffrents thmes et genres


abords dans chacun des livres. Louvrage recourt en effet
la fois au style du rcit historique, celui des martyrologes, ou encore celui des textes liturgiques (et plus
prcisment des homlies) ; nous retiendrons essentiellement, pour le chapitre 4 du Livre X qui nous concerne
ici, le caractre de tmoignage proprement historique du
discours prononc par Eusbe.
LHistoire ecclsiastique suit, comme son titre
lindique, un droulement chronologique sur la vie de la
FRPPXQDXWpFKUpWLHQQHGDQVO(PSLUHURPDLQjODQGH
lAntiquit. Les livres VIII X traitent des vnements les
plus contemporains dEusbe, depuis lpoque prcdant
le dclenchement de la perscution sous Diocltien et
Galre (soit les dernires annes du e sicle) jusqu
la mort de Licinius en 324. Dans le livre VIII, lintrt
est concentr sur les martyrs chrtiens de cette poque.
Le livre IX passe du ct des perscuteurs et relate plus
particulirement les actions des empereurs paens et leur
PRUW(QQGDQVOHOLYUH;TXLFRQWLHQWQRWUHWH[WHLOHVW
TXHVWLRQGHODFRQVWUXFWLRQGHVpGLFHVUHOLJLHX[GHVpGLWV
favorables aux chrtiens et lglise, et de lempereur
bienfaiteur Constantin6 JXUH DSSHOpH j FRQVWLWXHU OH
modle du parfait dirigeant chrtien.
Dans lintroduction du chapitre 4 du Livre X portant
sur l tat des affaires , Eusbe pose le contexte de

5. P.-L. Gatier, Tyr dans les sources hagiographiques antiques, dans


P.-L. Gatier, J. Aliquot, L. Nordigian (dir.), Sources de lHistoire de
Tyr, Textes de lAntiquit et du Moyen ge, Beyrouth, 2011, p. 135-136.
6. E. Prinzivalli, Description sommaire de lHistoire Ecclsisatique,
dans S. Morlet, L. Perrone (dir.), S. Morlet, L. Perrone (dir.),
Eusbe de Csare. Histoire ecclsiastique. Commentaire, 1. tudes
dintroduction (Anagg, 6), Paris, Les Belles Lettres, 2012, p. 143.

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

son discours quil dlivre devant une grande assemble :


lglise est comble , il y a l un grand nombre de
pasteurs en silence et en ordre et lon est notamment
en prsence dun vque tout fait excellent et pieux
(Paulin de Tyr), grce auquel le temple de Tyr, le plus
beau de tous ceux de Phnicie, a t activement bti 7.
Le discours dEusbe sinscrit dans une tradition
littraire chrtienne antique, o il est fait usage de
formules et dun style communs pour voquer les
vnements et les monuments. Il faut donc observer une
certaine distanciation dans la lecture de ce texte et ne pas
OHSHUFHYRLUFRPPHXQHGHVFULSWLRQDEVROXPHQWGqOHGX
monument dans les moindres dtails, mais pas non plus
comme un pur exercice de style priv dobjectivit. En
effet, si lon compare ce texte diffrents autres dpoque
protobyzantine relatifs au Proche et Moyen-Orient, on
se convainc aisment de la ralit de lvnement et du
caractre en partie vritablement descriptif de lauteur, et
QRQXQLTXHPHQWGXFDUDFWqUHJpGHOH[HUFLFHUKpWRULTXH
dlivr par lorateur. Pour exemple, un autre crit,
enregistr sous le numro dinventaire BHG 877h, portant
sur lglise des Saints-Aptres Constantinople, rvle
le choix tout particulier de son auteur qui commence
par une vocation des parties intrieures dcoratives et
images des votes mosaques, en ne laissant que peu
de place aux parties architecturales, au plan et aux amnaJHPHQWVH[WpULHXUVGHOpGLFH8. Ici au contraire, Eusbe
demeure plutt dans une tradition classique, en donnant
une grande place larchitecture et aux amnagements
extrieurs de lglise et en sy livrant mme, au passage,
une description prcise et raliste. Nous ne sommes donc
pas davis, contrairement certains, de linutilit du texte
G(XVqEHSRXUODFRPSUpKHQVLRQSUDWLTXHGHOpGLFH,O
ne sagit pas que dune simple mditation allgorique ,
interprtation avance sous prtexte quEusbe se situe
dans la tradition de lexgse alexandrine9. Lauteur
MXVWLH GDLOOHXUV OXLPrPH VD GpPDUFKH GHVFULSWLYH
par son souhait de clbrer lacte dvergtisme de
lempereur Constantin et de lvque Paulin, cest--dire
pour le don de ces parures et offrandes ornant lglise
de Tyr : Ces merveilles auraient besoin dun discours
spcial pour en faire loisir et avec exactitude lexposition et lexplication 10. Mais notons aussi quEusbe
a toutefois lui-mme conscience des limites ncessaires
GHVDGHVFULSWLRQGDQVFHFRQWH[WHRIFLHOHWOLWXUJLTXH

7. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 154.


8. L. James, I. Gavril, A Homily with a description of the Church of the
Holy Apostles in Constantinople, dans Byzantion, 83, 2013, p. 154.
9. F. Alpi, La basilique palochrtienne de Tyr : fragments inscrits et
SUREOqPHV GLGHQWLFDWLRQ, dans LHistoire de Tyr au tmoignage de
larchologie (Actes du Sminaire international), Bulletin dArchologie
et dArchitecture Libanaises, hors-srie 8, Tyr, 2011, p. 199.
10. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 161.

113

maintenant il me semble inutile de prciser la longueur


HWODODUJHXUGHOpGLFH11.
Eusbe voque galement les raisons qui ont dtermin
OD FRQVWUXFWLRQ GH OpGLFH  RX SOXW{W VD UHFRQVWUXFWLRQ
car le site semble avoir t lobjet de vandalisme de la
part des paens, qui ne sont pas explicitement mentionns
dans ce passage, mais que lon suppose avoir t luvre
auparavant : cela par le biais de mtaphores employes par
lauteur dans le texte mme de lHistoire Ecclsiastique,
dautre part en raison dun contexte historique dans
lequel les tenants de la foi nouvelle taient menacs par
GHV PHVXUHV DQWLFKUpWLHQQHV HQ UDSSRUW DYHF OHV FRQLWV
dintrt opposant les deux Augustes, Constantin et
Licinius, alors tous deux la tte de lEmpire romain. La
reconstruction de lglise de Paulin de Tyr et le discours
dEusbe semblent en effet concider avec une priode
GHWUrYHSRXUOHVFKUpWLHQVYHUVODQGHODQQpHHWOH
dbut de lanne 314, aprs la campagne de Cibali12. Quant
aux indications que livre le texte, il sagit de mtaphores
animalires que lon retrouvera par ailleurs aussi bien dans
les rpertoires dcoratifs chrtiens que de la littrature
GH OD Q GH O$QWLTXLWp$LQVL OHV FRXSOHV DQLPDOLHUV HQ
confrontation, tels le cobra et la mangouste par exemple,
devaient faire partie du rpertoire favori des pavements de
PRVDwTXHVGHVpJOLVHVHQWUHODQGXe et le e sicle ; dans
les textes religieux, ce mme langage imag et symbolique
confrait plus de poids aux propos13. Cet usage tait inspir
de textes plus anciens tel le Physiologus, recueil traitant
par questions et rponses des mirabilia de la nature et qui
avait t diffus par des exgses allgoriques chrtiennes
en latin et en grec, notamment au Proche-Orient. Les
mtaphores utilises dans le texte dEusbe sont tout fait
explicites dans ce contexte de lutte :
le diable haineux [] comme un chien enrag qui mord
les pierres quon lui jette, et qui dcharge sur des objets
inanims sa colre contre ceux qui le repoussent, a tourn
sa fureur bestiale contre les pierres des oratoires et les
matriaux sans vie des maisons ; il nous a, ainsi quil le
pensait en lui-mme, privs dglises. Ensuite il a lanc
GHWHUULEOHVVLIHPHQWVHWGHVFULVGHVHUSHQWWDQW{WSDU
le biais des menaces de tyrans impies, tantt par celui des
constitutions blasphmatoires de princes pervers14.

11. Ibidem, p. 169.


12. M. Amerise, Note sulla datazione del panegirico per linaugurazione
della basilica di Tiro, dans Adamantius, 14, 2008, p. 229-234.
13. S. Garreau-Forrest, Les glises protobyzantines de Phnicie maritime
et libanaise : architecture et amnagements extrieurs et intrieurs pour
la liturgie, thse de doctorat de lUniversit Paris IV-Sorbonne, 2007, 1,
p. 100 ; Idem, 'pFRUVJXUpVVXUOHVPRVDwTXHVGHVpJOLVHVGX/LEDQ,
mmoire de matrise, Universit Paris IV-Sorbonne, 2000, 2e partie :
Programme iconographique religieux et reprsentations idalises
de la vie quotidienne , p. 128-135 ; B. Bagatti, Espressioni bibliche
nelle antiche iscrizioni cristiane di Palestina, dans Liber Annuus, 3,
1953, p. 111-148 ; J. Balty, Mosaques antiques du Proche-Orient, dans
Annales littraires de lUniversit de Besanon, Paris, 1995, p. 222.
14. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 158.

114

AnTard , 22, 2014

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

Fig. 2 Plan cadastral de la ville de Tyr incluant les vestiges ( Ali Khalil Badawi).

Eusbe fait ainsi directement allusion aux perscutions de la communaut de cette glise qui avait la
lettre subi le sige des ennemis, qui avait t la premire
la peine et avait support les mmes perscutions que
nous et avant nous.. 15. Plus loin il ajoute :
ce sont absolument les ralits qui se prsentent nous,
non pas en des rcits mais dans les choses elles-mmes.
Cette glise tait un dsert dessch, une veuve sans
dfense. Comme on coupe le bois dans une fort, ils
coupaient ses portes coups de hache ; dans le mme
dessein ils lattaquaient avec la cogne et le marteau ;
ils dtruisaient ses livres, mettaient en feu le sanctuaire
de Dieu ; ils ont profan en le jetant terre le tabernacle
de son nom16

Les paens avaient donc dvast lancienne glise


et lvque Paulin montra sa volont de la relever en
SXULDQWOHVLWHTXL

et na pas favoris la malice de ceux qui en taient les


auteurs ; il lui tait cependant loisible daller ailleurs (il
y avait une multitude dautres places dans la ville) et
de trouver une facilit plus grande dexcution comme
aussi dviter des embarras17.

Il tait donc symbolique et sacr pour les chrtiens


de rinvestir un mme monument outrag par les paens
pour le librer de ses dmons et du relent des croyances
impies18 ; la prcision quant la multitude des places
GLVSRQLEOHV SRXU OD FRQVWUXFWLRQ GH QRXYHDX[ pGLFHV
indique que nous nous situons une poque o la
VXSHUFLHGHODFLWppWDLWWUqVpWHQGXHDWWHLJQDQWPrPH
son maximum entre lancienne le louest, rattache par
OLVWKPHVRQEDQFGHVDEOHDUWLFLHOMXVTXDXVHFWHXUGH
lhippodrome lest sur le continent.

tait encombr dordures de toute sorte par la malveillance des ennemis. Il ne la pas dlaiss avec mpris

15. Ibidem, p.163.


16. Ibid., p. 165.

17. Ibid., p. 163.


18. S. Garreau-Forrest, Les glises protobyzantines, cit. (n. 12),
1, p. 72-75, 3.4 : tablissement des glises en milieu urbain ou
en milieu rural. Roccupation dun site paen par les chrtiens :
L. Nordigian, La christianisation des temples paens dans larrirepays de Byblos, dans Mlanges de lUniversit de Saint-Joseph, 62,
2009, p. 149-189.

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

Les indications topographiques, techniques


et pratiques (amnagements extrieurs et intrieurs)
livres dans le texte
Eusbe nous renseigne sur les amnagements extrieurs
et intrieurs de lglise de Paulin de Tyr. Laspect
PRQXPHQWDOHWPrPHJUDQGLRVHGHOpGLFHQHIDLWSDVGH
GRXWH GDQV OHV TXDOLFDWLIV XWLOLVpV SDU ODXWHXU ORUVTXLO
voque points importants les dlimitations du sanctuaire
HWVHVIRUWLFDWLRQV

115

mais on entend bien que, dans la conception sur le terrain,


OH U{OH GH ODUFKLWHFWH IXW GpWHUPLQDQW@ W WURLV SRUWHV GXQ
seul ct [et] il lui plut que celle du milieu dpasst de
beaucoup les autres en hauteur et en largeur , et il dcora
cette dernire dappliques dairain runies par des liens de
fer 22&HWWHSUpFLVLRQWHFKQLTXHHVWSDUWLFXOLqUHPHQWGqOHj

il [lvque Paulin] a donc dlimit un emplacement


beaucoup plus grand que le premier. Du dehors, il la
protg par une forte muraille qui lentoure tout entire,
de faon ce quelle constitue un rempart trs sr de
lensemble [...] cela donne ceux qui sont loin de cette
enceinte sacre le dsir de voir ce qui est lintrieur ;
il invite presque les trangers la foi regarder vers les
premires entres19

/H FDUDFWqUH IRUWLp HW pWHQGX GH OHQVHPEOH LPSOLTXH


que le complexe tait situ dans une aire vaste, dgage de
toute contrainte urbanistique ; et aussi une zone sensible de la
cit, vraisemblablement sur la ceinture extrieure orientale,
septentrionale ou mridionale ouvrant sur les axes de circulation ctiers ou sur larrire-pays, et donc fortement expose
dans cette priode dinstabilit politique face aux Perses.
Lorientation du monument, point essentiel galement
dans larchitecture religieuse, est clairement donne ; cela
rfute demble la thse de la correspondance entre lglise
de Paulin de Tyr dcrite par Eusbe et limpressionnante
glise dgage en 1995 dans le secteur Basilica of Quarter
Sand (Hajj Qaafarani) (J ), prs du quartier de la
ncropole et de lhippodrome, sur laquelle nous reviendrons plus loin de manire dtaille. Les vestiges de cette
dernire ont en effet rvl un chur orient plein est, tandis
quEusbe insiste bien sur le fait que, dans la cathdrale de
Paulin, cest lentre du monument et non pas le sanctuaire
(le chur) qui se situe lest : un grand vestibule trs lev
se dresse du ct des rayons du soleil levant 20.
Le caractre monumental du complexe ressort galement,
dans le discours dEusbe, avec lvocation du vestibule
(narthex) faisant suite un atrium pourvu dune fontaine
ablutions au centre et de quatre portiques colonnades au
pourtour, dont les entrecolonnements taient ferms par des
barrires de bois rticules et slevant mi-hauteur21. Les
prcisions de lauteur sont galement riches quant lamnaJHPHQWLQWpULHXUGHOpGLFH/HQDUWKH[HVWFRQVWLWXpGHWURLV
volumes ouvrant sur une salle basilicale trois nefs : face
aux rayons du soleil, il [lvque Paulin matre douvrage,

19. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 167.


20. Ibidem.
21. Ibid., p. 167-168. La cour centrale prcdant lglise tait ainsi entoure
dun portique ferm par des barrires vraisemblablement dcores dun
motif rticul, cest--dire dun motif ajour en sorte de rsille.

Fig. 3 Plaque de marbre sculpte en bas-relief imitant


un chapiteau de pilastre avec trou de fixation
(phot. S. Garreau-Forest, 2002).
Fig. 4 Plaque de marbre ; dtail dun trou
de fixation (phot. S. Garreau-Forest, 2002).

Fig. 5 Attache mtallique pour fixer les lments


de placage (phot. Ali Khalil Badawi, 2014).

22. Ibid., p. 168.

116

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

la ralit puisque de tels lments ont bien t retrouvs lors


de la fouille de lglise protobyzantine du Quarter Sand :
j VDYRLU GHV DWWDFKHV HQ EURQ]H SHUPHWWDQW OD [DWLRQ GHV
placages de marbre pour les dcors muraux et les entablements23 (J).
Lvocation du nombre de nefs du quadratum et des
subdivisions du narthex-vestibule, ainsi que celle des
divers portiques doit galement tre releve, dans la
mesure o ces espaces pouvaient jouer un rle important
dans les pratiques cultuelles (ainsi pour linitiation
pr-baptismale).
Lordonnancement intrieur nchappe pas non plus
lauteur, bien que de faon sommaire ; il fait ainsi mention
de la partie sacre du sanctuaire, rserve au clerg, en
RSSRVLWLRQDYHFFHOOHUpVHUYpHDX[GqOHV/DGHVFULSWLRQ
correspond bien aux parties des glises de cette poque,
avec un chur surlev pourvu de trnes trs levs en
lhonneur de ceux qui prsident . Nous remarquerons
galement quil est fait mention dun autel majeur dans
le sanctuaire, sans aucune indication de dpt de reliques,
ni dallusion un culte martyrologique en relation avec
XQ GpS{W GH FH JHQUH$LQVL LO VH YpULH TXH ODXWHO j
cette poque encore haute, tait uniquement consacr
au culte christologique. On sarrtera aussi au propos
suivant dEusbe : au milieu du chur entour des siges
hauts (cest--dire le synthonos) se trouvait lautel des
saints mystres, et pour quil ne ft pas accessible la
foule, il [lvque] lentoura dune barrire en bois [
dcor] rticul qui, vers le sommet, tait travaille avec
un art achev 24. Le chancel tait donc, cette poque et
dans cette cathdrale, un ouvrage ajour ralis en bois
et assez lev ; ce que lon devait sans doute remplacer,
dans les amnagements ultrieurs, par des chancels bas
(ou mi-hauteur) en marbre, moins sujets destruction
lors des incendies qui se propageaient rapidement dans les
glises en raison, prcisment, de lusage du bois. Quant
aux autres matriaux mis en uvre, dans les pavements en
particulier, ils sont signals sans gure de prcision ( des
marbres de toute beaut ).
(QQOpYRFDWLRQGHVGpSHQGDQFHVUDSSHOOHDXVVLXQ
type de plan habituel, avec des exdres et salles trs
YDVWHV GH FKDTXH F{Wp DX[ DQFV GH OD EDVLOLTXH   OHV
passages se faisaient galement dans les collatraux par
un systme de portes centrales et latrales. Notons que
de tels amnagements ont aussi t relevs, par exemple,
dans les deux glises du site de Khn Khald (galement
HQ 3KpQLFLH 0DULWLPH  DYHF GHV HQODGHV GDQQH[HV VXU
les cts septentrionaux et mridionaux 25.

23. S. Garreau-Forrest, Les glises protobyzantines, cit. (n. 12), Corpus 1,


dossiers no 37, p. 419-443 ; no 36, p. 413-418, et no 32, p. 389-401.
24. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 169.
25. P. Donceel-Vote, Les pavements des glises byzantines de la Syrie
et du Liban/RXYDLQ/D1HXYHSJ

AnTard , 22, 2014

Notre connaissance des glises


datables du e au e sicle dans la zone tyrienne :
sources historiques et vestiges archologiques
Outre le pangyrique dEusbe, dautres sources
textuelles apportent quelques prcieux tmoignages
de lexistence de plusieurs glises Tyr. Un document
administratif ecclsiastique, notamment, a t longtemps
utilis pour rendre compte du contexte religieux de la
Phnicie protobyzantine. Nous nous situons cette fois
deux sicles aprs le discours dEusbe. Il sagit des actes
du synode runi Tyr le 16 septembre 518 sous lgide
du mtropolite chalcdonien piphane son retour dexil,
lorsque son adversaire le patriarche Svre fut dpos de
son sige Antioche lavnement de Justin Ier. Il sagissait
en loccurrence de sassocier la condamnation de Svre
prononce Constantinople et les acclamations de la
foule [] poncturent la clture de lassemble 26. Ce
synode se tint dans la cathdrale de Tyr, o dans une
GHVHVDQQH[HV/pGLFHHVWTXDOLpGDQWLTXHHW>@
sainte glise 27. Dans ce mme texte est mentionne une
autre glise place sous le vocable de Sainte-Marie-dela-Mer (Thotokos Iampsyphis), possdant un baptistre28
et qui avait t, comme beaucoup dglises de la rgion,
occupe et profane par les svriens entre 515 et 518. Le
vocable Sainte-Marie tait courant Tyr : deux ou trois
glises mentionnes lpoque avaient la mme ddicace,
telle celle dont fait tat une inscription indite trouve
dans la banlieue Khirbet Ali, prs de Taschiba. Cette
inscription donne la date de 529-540 de notre re et rvle
lexistence dun autre sanctuaire encore ddi Marie29.
Lglise mentionne dans les actes de 518 avait une
fonction martyrologique, puisquelle conservait daprs
la tradition les reliques dune vraie croix et peut-tre
quelques restes de saints martyrs. En effet, daprs les
actes, la foule rclamait au mtropolite piphane le
rapatriement dans lglise de la dpouille de son frre
Flavien dAntioche, galement vinc par Svre en 512
et mort en exil Ptra en 51630.
Un autre monument chrtien de Tyr a galement fait
couler beaucoup dencre quant sa fondation suppose
ancienne, en fonction de laquelle on tentait de liden-

S. Garreau-Forrest, Les glises protobyzantines, cit. (n. 12), Corpus 1,


dossier no 37, p. 419-443.
26. F. Alpi, La basilique palochrtienne, cit. (n. 8), p. 199 ; CPG
= ACO, III, p. 80-90.
27. ACO, p. 85, l.3-4 ; F. Alpi, La basilique palochrtienne, cit. (n. 8),
p. 199.
28. J.-P. Rey-Coquais, Tyr, Temps et Espace. Point de vue dpigraphiste,
dans LHistoire de Tyr, cit. (n. 8), p. 33 ; CPG = ACO, III, p. 33 ;
Idem, Tyr aux derniers sicles palochrtiens : autour du synode
de 518, dans Mlanges de lUniversit de Saint-Joseph, 58, 2005,
p. 523-524.
29. Idem, Tyr, Temps et Espace, cit. (n. 27), p. 35.
30. ACO, p. 82.

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

WLHU j OD FDWKpGUDOH GH 3DXOLQ GpFULWH SDU (XVqEH ,O


sagit dune glise majeure ou cathdrale, construite
lpoque des Croiss, et dont les vestiges encore
bien visibles aujourdhui dominent, par leur caractre
imposant, la zone archologique du bord de mer au
nord de lancienne le (J )31. Les fouilles de ce
complexe colossal ont rvl lantriorit dun temple
phnicien ddi Melqart-Herakls, mais jusqu
prsent aucun indice na permis de rattacher ce site
OpGLFH SDOpRFKUpWLHQ WDQW UHFKHUFKp 'H QRPEUHXVHV
pJOLVHVIXUHQWpGLpHVjOpSRTXHGHV&URLVDGHVHWSDUWLculirement partir de 118732. Outre la cathdrale de la
Sainte-Croix correspondant au sige mtropolitain de
Tyr relevant du patriarcat de Jrusalem33, de nombreuses
glises paroissiales riges par diffrentes communauts
italiennes tablies dans la presqule ont d roccuper

Fig. 6 Vue gnrale de la cathdrale dpoque croise


(site archologique maritime sur la presqule de Tyr)
(phot. S. Garreau-Forest, 2013).

117

des sites chrtiens plus anciens. Il est certain que les


YHVWLJHV GH OpGLFH j FRORQQDGH GRPLQDQW OH ERUG GH
mer appartenaient lun des nombreux ordres religieux
pWDEOLV GDQV OD YLOOH IUDQTXH ,O SRXUUDLW rWUH LGHQWLp
mais sans certitude, lun des monuments les mieux
documents par les sources : lglise Sainte-Marie de
lordre du Saint-Spulcre, qui fut tablie sur lancienne
cathdrale protobyzantine Sainte-Marie de Tyr34 et o
lon pouvait visiter la spulture dOrigne, mort en 254
et dont la dpouille avait t dpose l ; il tait en effet
considr comme un des pres fondateurs de lexgse
biblique et lun des nombreux martyrs chrtiens de Tyr35.
(QQ GHV pOpPHQWV VFXOSWpV D\DQW DSSDUWHQX j XQH
des glises protobyzantines de Tyr ont t retrouvs dans
les fonds marins au large de la ville. Ces pices ont fait
partie dune collection prive reconnue par le ministre
de lIntrieur en 1998 et devenue Fondation Pp
Abed . Cette collection a t publie dans un catalogue
et est aujourdhui conserve en partie dans le restaurant
ponyme situ sur le port de Jbail-Byblos. Llment le
SOXVVLJQLFDWLIHQHVWXQSRWHDXGHFKDQFHOHQPDUEUH
class sous le no 5236. Il porte sur ses faces un dcor de
vigne sortant dun vase. Le corps de forme rectangulaire est surmont dun petit globe. Lensemble mesure
1,14 m de haut et environ 20 cm de ct. Ce poteau de
chancel provenait vraisemblablement dune autre glise
du littoral tyrien.
5pYLVLRQGHOLGHQWLFDWLRQHWGHODGDWDWLRQ
de lglise prs de lhippodrome et de la ncropole
antique ( Basilica of Quarter Sand )
Une glise protobyzantine a t dcouverte de faon
fortuite en 1995 lors de travaux de construction. Le site a
t class en premier lieu auprs de la Direction gnrale
des Antiquits du Liban sous le nom du propritaire du
terrain, Hajj Qaafarani . Les vestiges en question se
situent trs exactement 370 m louest de lhippodrome, 190 m au sud de la voie romaine traversant la
ville dest en ouest, 500 m lest de lenceinte urbaine
dpoque romaine, quelque 90 m seulement du bord de
mer au sud de la ville et environ 370 m du bord de mer
septentrional (J). Devant lampleur et la qualit de ces
vestiges, nous avons entrepris une fouille de sauvetage,
qui devait aboutir en 1998 au classement du site sur la
liste du Patrimoine mondial de lUnesco. En effet, en
avril 1997, une mission dexpertise a t mene par

31. Voir le plan dtaill ralis dans le cadre de la reprise de ltude des
anciennes fouilles de lmir Chhab, dans C. Duvette, Le secteur 7,
un quartier dhabitat au pied du complexe thermal de Tyr, dans
LHistoire de Tyr, cit. Q SVHFWHXUJ
32. P. Antaki-Masson, La ville franque de Tyr : visite guide de ses
dfenses, son port, ses quartiers et ses monuments, dans LHistoire
de Tyr, cit. (n. 8), p. 210.
33. D. Pringle, The Crusader Cathedral of Tyre, dans Levant, 33, 2001,
p. 165-188.

34. E. De Rozire, Cartulaire de lglise du Saint-Spulcre de Jrusalem,


Paris, 1894, p. 19, no 16.
35. P. Antaki-Masson, La ville franque de Tyr, cit. (n. 31), p. 210 ;
P.-L. Gatier, Tyr dans les sources, cit. (n. 4), p. 135-136.
36. Catalogue Pp Abed Byblos, no 52, Archives Unesco-Paris.

118

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

Fig. 7-8 Vues ariennes de la mission franaise (anne 1920-1940) donnant sur listhme ensabl
reliant la presqule larrire-pays de Tyr (Fonds photographiques IFPO
[Institut franais du Proche-Orient], Damas).

AnTard , 22, 2014

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

N. Duval et M. Mayer dans le cadre de la revalorisation


et conservation des sites de la rgion de Sada et de Tyr
par la Division du Patrimoine culturel de lUnesco ; cette
mission visait notamment inscrire cette glise de Tyr sur
la liste du Patrimoine mondial.
Aujourdhui, au vu du changement de nom du propritaire du terrain ainsi que des connaissances nouvelles sur
ce secteur archologique, le site est appel Basilica
RI 4XDUWHU 6DQG  (Q HIIHW OHV QLYHDX[ GH VDEOH Q
dgags lors des fouilles rappellent lhistoire et lvolution gomorphologique du secteur, puisque lle fut,
j OpSRTXH KHOOpQLVWLTXH DUWLFLHOOHPHQW UDWWDFKpH j
la cte par des travaux damnagement colossaux : il
sagissait dtablir un isthme de sable, comme cela tait
encore visible sur des clichs ariens franais des annes
 VRLWDYDQWODGHQVLFDWLRQXUEDLQHGH7\UDX
cours de ces dernires dcennies) (J). Ces amnagements expliquent que le secteur soit demeur marcageux
comme cela apparaissait sur les repres topographiques
GHV FDUWHV GHV H[SORUDWHXUV RULHQWDOLVWHV GH OD Q GX
e sicle. F. Gaillardot, notamment, avait dress, en
1873 pour la mission de E. Renan, un plan utilisant
comme indicatif topographique de ce secteur de Tyr37
Ltude pigraphique apporte galement de prcieuses
indications topographiques. Ainsi, Frdric Alpi parvient
retracer, en remontant aux racines smitiques du vocable
de lglise mentionne dans les actes du synode de 518, le
lien fort probable de ce monument avec les vestiges protobyzantins dgags louest de lhippodrome : car si nous
comprenons le sens du vocable de lglise Sainte-Marie
GXTXDUWLHUQRQSDVFRPPHSainte-Mariede-la-Mer mais plutt comme Sainte-Marie-des-Roseaux
ou Sainte-Marie-des-Marais, le rapprochement avec les
vestiges dcouverts dans cette ancienne zone marcageuse en priphrie de lancienne cit parat simposer38.
La partie centrale de lglise dgage lors des fouilles
de sauvetage a rvl quelques structures, telles celles
du chur. Elle prsentait par ailleurs une couche de
GHVWUXFWLRQWpPRLJQDQWGXQDEDQGRQGpQLWLIjODQGH
lpoque protobyzantine ou au dbut de lpoque protoislamique. Le monument a alors t dtruit et, beaucoup
plus rcemment, recouvert de constructions modernes :
des immeubles aux fondations btonnes et armes ont t
tablis dans les vestiges de la partie orientale comprenant
le chevet et dans la partie occidentale recouvrant les nefs
ainsi que les hypothtiques vestibules dentre et atrium
louest. Dans la zone septentrionale, un parking en terre
battue a t surimpos de probables annexes et accs
H[WpULHXUVODWpUDX[HQQXQHURXWHJRXGURQQpHDRFFXOWp
les vestiges de la partie mridionale de lglise.

37. F. Alpi, La basilique palochrtienne, cit. (n. 8), p. 201.


38. Ibidem, p. 199-200.

119

Quant aux traces dincendie et de destruction violente


que nous avons voques, il sagissait dabord de taches
noires releves sur le dallage, correspondant la calcination des parties hautes de lglise ayant chut au sol ;
par ailleurs, de nombreux lments architecturaux et
GpFRUDWLIV DYDLHQW YROp HQ pFODWV  HQQ OHV FRORQQHV
du collatral sud semblent tre tombes dun seul coup,
suivant une mme trajectoire nord-est/sud-ouest. Ce
sont les bases des colonnes ainsi que les parties basses
des amnagements liturgiques du chur, conserves en
place, qui ont permis de reconstituer lessentiel du plan de
la partie orientale de lglise (J) avec trois nefs, des
HQODGHVGDQQH[HVDXQRUGHWXQGRXEOHFKXUFHOXLFL
prsentait en effet, juste devant labside, un podium avec
les tombes de personnes illustres et saintes (qui nont pu
rWUHLGHQWLpHVjFHMRXUSDUOHVLQVFULSWLRQVUHFXHLOOLHVVXU
les dalles de marbre39), un autel et les bases dun ciborium
layant surmont ; puis, en contrebas et dans le prolon-

Fig. 9 Basilica of Quarter Sand ( E. Hobdari).

39. Ibid., p. 199.

120

AnTard , 22, 2014

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

gement du prcdent, un second chur ferm dune


clture en marbre dcore de cerfs affronts en rondebosse (J) HWSUpVHQWDQWHQQOHVYHVWLJHVGXQDPERQ
langle nord-ouest.
Le site de Tyr avait vraisemblablement fait lobjet
dun programme de reconstruction au e sicle,
programme dont on ignore le commanditaire. Cest sans
doute cela que correspondent les amnagements de ce
chur, double, un chur haut avec son podium et un
chur bas, de plein pied, dans le prolongement et dans
la nef centrale, ferm dune clture de chancel basse et
avec une typologie dautel galement caractristique de
cette poque et de cette rgion (surmont dun ciborium
et install sur un podium). En considrant la qualit de
FRQVWUXFWLRQGHOpGLFHLOHVWYUDLVHPEODEOHTXLODYDLW
un statut minent : peut-tre sagissait-il dune fondation
piscopale, impriale, ventuellement dun sanctuaire
vocation martyrologique, atteste par la prsence de
spultures amnages dans la partie la plus sacre de
lglise, le saint des saints, le podium du chur isol par
une enceinte ainsi que par des objets mtalliques retrouvs
sur le site proximit des tombes qui pourraient avoir eu
un rle dans le rite de libation (J).

Fig. 10 Passoire de libation en alliage mtallique fondu


sous laction du feu (phot. Ali Khalil Badawi, 2014).

/RFDOLVDWLRQGHOpGLFH
dans la trame urbanistique antique
/pGLFHDpWpFRQVWUXLWGDQVXQvORWGHODQFLHQQHWUDPH
urbanistique remontant au plus tt lpoque romaine et
organise selon un modle classique orthonorm est-ouest/
nord-sud (encore aujourdhui prserv dans les amnagements modernes de la ville) (J). Il appartenait un
quartier ecclsiastique situ mi-chemin entre la partie
maritime et portuaire louest et la partie continentale de
lest de la cit. Cette situation apparat alors excentre par
rapport au cur de la cit et en bordure du secteur de la
ncropole. Cela rejoint les caractristiques dimplantation
des premires glises du e sicle, tablies en priphrie
tout en restant lintrieur de lenceinte. Cette implantation en priphrie de la cit dnote donc semble-t-il une
poque plus haute que celle assignable aux vestiges dcrits
SOXVKDXWVRLWHQWUHODQGXe et le milieu du e sicle
(cf. ci-aprs la datation par C14). Cette glise avait, comme
on vient de le voir, toutes les caractristiques dun sanctuaire
minent. On songe alors naturellement en premier lieu aux
glises piscopales qui trouvrent en gnral leur place dans
la zone priurbaine durant le e sicle, vitant par-l les
problmes lis lattribution et aux rachats de terrains40 ;
PDLVQRXVYHUURQVSOXVORLQFHTXLHQGpQLWLYHVDYqUHOH
plus vraisemblable.
Lorganisation urbaine de la cit de Tyr semble avoir t
GpWHUPLQpHSDUODWRSRJUDSKLHPDULWLPHHWGpQLHHQGHX[
ensembles distincts : louest la vieille cit construite sur
ODQFLHQQHvOHUHOLpHjOHVW SDUOLVWKPHDUWLFLHO jODSDUWLH
continentale, le passage de lenceinte tant matrialis par
un premier arc triomphal (oriental) sparant la ncropole de
larrire-pays lest, et un second arc (occidental) donnant
accs la route qui passait devant lhippodrome et menait au
cur de la cit sur la presqule (J). Daprs les vestiges
FRQVHUYpVLOHVWSRVVLEOHGHUHSODFHUQRWUHpGLFHGDQVFHWWH
trame, son axe principal est-ouest tant bien parallle la
voie dalle principale qui reliait la grande ncropole extra
muros la vieille ville de lancienne le (J). Le quartier
du complexe ecclsiastique en question devait tre reli au
rseau de circulation. Cela, dune part dans sa partie septentrionale, en rejoignant le grand axe est-ouest menant de la
cit au secteur hippodrome-ncropole (secteur aujourdhui
connu sous le nom du site archologique Al-Bass et faisant
lobjet actuel de nouveaux amnagements touristiques et
musographiques) ; cette voie se poursuivait au-del du
second arc triomphal marquant lentre de la ncropole,
vers larrire-pays. Dautre part, le complexe ecclsiastique
devait galement tre accessible dans sa partie occidentale,
o avaient t implants les espaces ciel ouvert et vestibules
prcdant le quadratum populi de lglise elle-mme.

40. F. Monfrin, La christianisation, cit. (n. 1), p. 963.

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

121

Fig. 11 Vue gnrale de la ncropole


de Tyr depuis lhippodrome, arc triomphal occidental vu du sud-ouest
(phot. S. Garreau-Forest, 2003).

Plan, dcor et matriaux de construction


Les fouilles ainsi que ltude du matriel archologique dgag ont apport de nombreuses indications sur
cette glise. La nef centrale tait large de 12,30 m et le
bas-ct nord, assez bien prserv, atteignait une largeur
GH  P /pGLFH SUpVHQWDLW GRQF DSSDUHPPHQW OHV
proportions courantes dans les glises protobyzantines,
les nefs latrales correspondant la moiti de la largeur de
la nef centrale. Nous pouvons ainsi restituer une largeur
totale quelque peu suprieure 23 m (sans compter les
ventuelles annexes, actuellement sous les amnagements modernes). Quant la longueur conserve, elle est
de 16 m environ ; en se fondant sur les proportions alors
dusage, elle devait avoisiner les 50 m de long.
Le sanctuaire connut plusieurs tats damnagement.
Lamorce de labside centrale se devine sous les constructions modernes, juste derrire les deux bases orientales
du ciborium (elles aussi prises, dailleurs, sous les
fondations modernes). Dans sa dernire phase (prcdant
la destruction voque ci-dessus), nous avons vu que le
chur se subdivisait en deux parties distinctes suivant le
schma ordinaire des glises de Phnicie Maritime aux
e-e sicle, avec devant labside un podium dlimit par
une clture mi-hauteur et une partie en avance et de
plain-pied avec la nef centrale.
Le collatral mridional, large de 5,75 m, ainsi quune
partie de la nef centrale et le collatral septentrional
taient entirement recouverts dun riche pavement en
opus sectile de marbre tricolore. Les annexes qui ont t
conserves au nord taient spares du collatral nord
par un mur, dont seules les premires assises, les seuils

et quelques chambranles de porte sont encore in situ. Les


bases de la colonnade qui la barrait au nord sont en partie
en place. Elle tait par ailleurs dlimite par des parapets
dont quelques fragments ont t recueillis.
Lglise fut construite avec des matriaux de grande
qualit, slectionns dans les productions locales ou
imports. Cela atteste le niveau exceptionnel de la
commande de ce projet architectural. Les blocs de
maonnerie murale avaient t taills dans une pierre locale
(pierre Ramleh LVVXHGHVEDQFVF{WLHUVGHVDEOHFDOFLp
Cela constituait un bel appareil soigneusement dress en
double parement parpaings et boutisses, lis au mortier.
Malgr tout, laspect encore assez irrgulier de la surface
de la pierre avait, suivant les usages de lpoque, incit les
btisseurs revtir les murs dun placage de marbre. On
constate aussi cette technique de recouvrement Jiyeh et
Khn Khald41 sur le bord de mer phnicien. Ici, plusieurs
FDWpJRULHVGHPDUEUHRQpUHX[DYDLHQWpWpPLVHVjSURW
marbre blanc de Carrare, cipollin vert de Carystos, marbre
de Proconnse.
Les diffrents dallages et placages taient eux-mmes
[pV j ODLGH GXQ PRUWLHU SOXV RX PRLQV pSDLV IDLW
GH FKDX[ HW XWLOLVDQW HVVHQWLHOOHPHQW GHV EUHV HW GHV
morceaux de charbon de bois, ainsi que quelques rsidus
de terre cuite comme dgraissant.
Des traces de dorure et des rsidus de pigmentation
rouge brique ont t par ailleurs observes sur de

41. S. Garreau-Forrest, Les glises protobyzantines, cit. (n. 12), Corpus


Phnicie Maritime, dossiers nos 32, 37.

122

SOPHIE GARREAU-FORREST, ALI KHALIL BADAWI

AnTard , 22, 2014

nombreux lments en marbre au moment de la ralisation de linventaire. Ces traces ont essentiellement t
observes sur des chapiteaux de grand module de style
corinthien (J), sur des placages de pilastres ou de piles
dangle du mme style, sur des dalles, sur des fragments
dopus sectile mural, sur les pitaphes du chur, sur des
mosaques murales ainsi que sur dautres lments encore
QRQLQYHQWRULpVRXQRQLGHQWLpV/HVWUDFHVGHSLJPHQtation pourraient faire songer aux techniques dextraction
de lor ou de largent, en usage depuis lAntiquit. En
effet, ces matires premires taient dissocies in situ dans
les carrires de leur gangue ou de leur minerai de souche
par amalgamation avec un mtal volatil, le mercure. Il est
possible que par laction du feu lors de lincendie dans
lglise, les molcules dor en fusion se soient spares
de celles du mercure. En disparaissant ainsi ltat
liquide et le mercure ltat volatil, lor aurait laiss des
dpts de mercure sous forme de poudre rouge-oranger,
certains endroits, notamment dans le creux des sculptures.
Nous expliquons ainsi que des feuilles dor soient mieux
conserves dans les creux profonds de certains reliefs et
que seules des traces de pigmentation (sous laspect de
poudre de couleur rouge brique) aient subsist en surface.
Mais une autre explication pourrait tre simplement que
les lments architectoniques taient peints de couleurs
vives. Les rsidus de dorure pourraient alors provenir
dailleurs, probablement des parties hautes du chur
(telles les demi-coupoles des absides) qui devaient
pJDOHPHQWrWUHUHFRXYHUWHVGHQHVGRUXUHV

Lglise devait, suivant lusage courant, tre


recouverte dune charpente en bois double pente sur
la nef centrale, et dune charpente en appentis niveau
infrieur sur les collatraux. Lensemble tait revtu de
tuiles plates (tegulae) et de tuiles de joint (imbrices),
retrouves dans la couche de destruction. Par ailleurs, de
nombreux types de clous ont t inventoris. Parmi les
diffrentes formes et dimensions de leurs corps et ttes,
une srie de ces clous pourraient provenir de la charpente
cela notamment pour la catgorie des clous les plus
longs, lextrmit du corps recourbe (dautant plus que
ces clous ont t relevs dans la mme couche suprieure
de destruction que les tuiles, souvent amalgams avec des
rsidus de mortier et de charbon) (J).

Fig. 12 Chapiteau corinthien, Basilica of Quarter Sand


(Hajj Qaafarani) (Anciennes rserves du site archologique
Al Bass avant restauration, phot. S. Garreau-Forest, 2003).

Datation au carbone 14 :
analyse de la gangue de bois conserve sur des clous
Quelques rsidus de bois brls au moment de
lincendie, qui dvasta lglise une date et pour des
raisons qui restent encore imprcises, ont t conservs
parmi les dcombres de la toiture et des parties hautes.
Comme nous venons de le voir, une grande quantit de
clous trs oxyds, pris dans une gangue de bois ou dans un
conglomrat de mortier et de divers rsidus de destruction
ont t relevs parmi les dcombres. Lanalyse au C14
de trois chantillons de bois prlevs en 2006 dans ce
matriel archologique a permis dapporter des repres
FKURQRORJLTXHV SRXU OD FRQVWUXFWLRQ GH OpGLFH TXL VH
situe donc entre 257 et 42242. Ainsi, en considrant que le

Fig. 13 Clou de charpente oxyd


(phot. Ali Khalil Badawi, 2014).

42. Les analyses ont t effectues avec le concours de lIFPO de


Beyrouth ainsi que celui de lUniversit Paris IV-Sorbonne en 2006,
au Centre de Datation par le radiocarbone, Universit Lyon I, CNRS /
805  UpVXOWDWV UHoXV HQ QRYHPEUH   ,GHQWLFDWLRQ GH
lchantillon : 17950 ; nom du site : Hajj Qaafarani, Liban ; US :
+4kJHFDOLEUpGHj/DPDUJHVWDWLVWLTXHDGpQLXQ
intervalle dans lequel lge radiocarbone exact a deux chances sur
trois de se trouver.

AnTa rd , 2 2 , 2 0 1 4

LA CATHDRALE DE PAULIN DE TYR DCRITE PAR EUSBE DE CSARE : MYTHE OU RALIT ?

temps de schage aprs la coupe nexcdait pas quelques


annes, lutilisation du bois dans la charpente (ou dautres
SDUWLHV GH OpGLFH  DXUDLW SX DYRLU OLHX HQWUH OD Q GX
e et la moiti du e sicle, soit pour la construction
initiale soit pour ses rfections ; ou encore, comme cela
tait dusage, au cours dun chantier programm en
plusieurs campagnes sur plusieurs dcennies, pour des
UDLVRQV WHFKQLTXHV QDQFHPHQW DSSURYLVLRQQHPHQW HQ
matriaux, embauche des artisans et ouvriers, interruptions diverses, incendies partiels, etc.). Ainsi, entre la
priode dabattage des arbres et les oprations de coupe
du bois qui ont t dates par lanalyse au C14, et la mise
en uvre architecturale, il pouvait scouler une trentaine
danne, voire plus. Mais cela ninterdit pas quentre
OD Q GX e-dbut du e sicle et le premier quart du
e sicle, cette glise de Hajj Qaafarani devait tre en
partie construite (du moins le chur, le narthex, lune ou
lensemble des nefs, pouvaient alors avoir t achevs).
1RWRQVSDUDLOOHXUVTXHTXDQWjOHVVHQFHPLVHjSURW
le sycomore tait un bois bien exploit dans la rgion pour
les constructions navales, comme lattestent des tmoignages plus tardifs43, mais le cdre tait pourtant plus
DGDSWp j OD FRQVWUXFWLRQ GHV SDUWLHV KDXWHV GHV pGLFHV
Ce bois est dailleurs mentionn pour la construction de
la cathdrale de Paulin (Eusbe parle de cdres prcieux
du Liban qui reposent dans le haut 44).
(QQUHOHYRQVTXHFHTXLUHVVRUWGHFHWH[DPHQGpQRWH
bien la ralit de deux phases distinctes dans cette glise :
car si les donnes ci-dessus renvoient une priode assez
haute, le style des plaques de chancel sculptes en rondebosse, ainsi que les inscriptions des dalles recouvrant les

43. Nous devons avancer dans le temps, lpoque Abbasside, pour


constater lintrt technique que lon portait dautres essences
de bois, notamment le sycomore. Ce dernier tait cette poque
FRQVLGpUp FRPPH XQ ERLV GXYUH GH ERQQH TXDOLWp$O0XTDGGDL
relate en effet comment son grand-pre, se plaignant de la perte du
savoir-faire de la construction dans leau, ralisa, sous le rgne dIbn
7OQODUHFRQVWUXFWLRQGXSRUWG$FUH $NN jOLPDJHGHFHOXL
GH7\U 6U  HQ HPSOR\DQW GH JURVVHV SLqFHV GH ERLV GH V\FRPRUH
comme pilotis dans le sable pour servir de fondation.
44. Eusbe, Histoire ecclsiastique, cit. (n. 2), p. 169.

123

tombes dans le sanctuaire, concourent situer le ramQDJHPHQWGHFHWWHSDUWLHHQWUHODQGXe et le e sicle.


Conclusions
Les qualits architecturales de lglise du quartier
renomm Basilica of Quarter Sand , correspondant
une zone priphrique de la cit antique, indiquent
quelle fut un monument phare de Tyr entre le e et la
Q GX e-dbut du e sicle. Les recherches rcentes
portant sur lpigraphie des dalles funraires du podium
du chur, ltude au C14 des clous de charpente chus
ORUV GH OD GHVWUXFWLRQ GH OpGLFH  UHFKHUFKHV TXH
FRQUPHURQW VDQV GRXWH FHOOHV TXL SRUWHURQW XOWpULHXrement sur les dcors sculpts et sur les procds de
recouvrement en marbre (placage des maonneries,
sculptures) permettent denvisager au moins deux
phases principales de construction ou damnagements
GDQV OpJOLVH  XQH SUHPLqUH HQWUH OD Q GX e-dbut
du e sicle et le premier tiers du e sicle, puis une
seconde entre le e et le dernier tiers du e sicle. Quant
au rapprochement mythique entre le texte dEusbe,
au demeurant riche de considrations quant la
construction et aux amnagements des grandes glises
protobyzantines de la Phnicie Maritime, il ne fait plus
aucun doute aujourdhui que les vestiges dcouverts
sur le site Basilica of Quarter Sand , bien quils
FRUUHVSRQGHQW j FH TXL IXW XQ pGLFH PDMHXU GDQV OH
SD\VDJHXUEDLQGHODYLOOHQHSHXYHQWrWUHLGHQWLpVj
la cathdrale dcrite par Eusbe. Les tombes ensevelies
dans son chur lui attribueraient plutt une fonction
martyrologique et funraire, que suggre galement sa
proximit avec la ncropole romano-byzantine. Et une
caractristique comme son orientation exclut catgoriTXHPHQW VRQ LGHQWLFDWLRQ j OD FDWKpGUDOH GH OpYrTXH
Paulin. Tout cela, au contraire, taye la thse de son
rapprochement avec lglise Sainte-Marie-des-Marais
mentionne dans les actes du synode de 518.
Universit Paris-Sorbonne / UMR 8167
& DGAL, Direction des Antiquits de Tyr, Liban

AnTard , 22, 2014, p. 125- 136


DOI 10.1484/J.AT.5.103182

ANTIOCHE SUR LORONTE,


LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE
&6

Constantines church at Antioch, between history and memory


This article is devoted to the church built by Constantine in Antioch. It is mentioned twice by Eusebius and appears
in numerous texts, but it has not yet been recognized in the field. The names given to the church in the texts are examined:
the original name seems to have been The Golden Church. However, already under Julians reign the church was commonly called The Great Church or even simply The Church. This name implies that the building was the main church
of the Christian community. Its topographical situation is unknown. Due to the ambiguities of the architectural vocabulary
used by Eusebius, any speculation about the architectural appearance of the church must be taken with great caution.
Constantines decision to build this church must be interpreted as an act of recognition of the importance of Antioch as
Metropolis of the East. Although the dedication of the church took place in 341, in the presence of Constantius, the
church maintained the memory of Constantine until the beginning of the 6th century. In Malalas Chronicle, the narrative
of its construction is associated with the appointment of the first Comes Orientis, the foundation of his praetorium and,
anachronistically, the destruction of a temple and its replacement by Rufinus basilica, which played an important role in
Antiochean urban space until at least the reign of Justinian. [Author, with the help of Luke Lavan]

Lglise leve Antioche sur lOronte par dcision


de Constantin a t brivement voque par Eusbe
de Csare deux reprises et dans des termes presque
identiques, dans les Louanges de Constantin, discours
prononc lors des Tricennales de lempereur le 25 juillet
3361, puis dans la Vie de Constantin, rdige entre

Abrviations : Burgess, Studies = R.W. Burgess, Studies in Eusebian


and post-Eusebian chronography, Stuttgart, 1999. Deichmann, Das
Oktogon = F. W. Deichmann, Das Oktogon von Antiocheia: HeroonMartyrion, Palastkirche oder Kathedrale?, dans Byzantinische Zeitschrift,
65, 1972, p. 40-56. Downey, Antioch = Gl. Downey, A history of Antioch
in Syria from Seleucus to the Arab Conquest, Princeton (N.J.), 1961.
Fournet, Thermes = Th. Fournet, Thermes impriaux et monumentaux
de Syrie du Sud et du Proche-Orient, dans J. Jouanna, P. Toubert, M. Zink
(dir.), Leau en Mditerrane de lAntiquit au Moyen ge, Paris,
2011, p. 185-246. Goilav, Proposal = A.-M. Goilav, Proposal for the
reconstruction of the Golden Octagon, dans Les sources de lhistoire du
paysage urbain dAntioche sur lOronte (Actes des Journes dtudes
des 20 et 21 septembre 2010), http://www.bibliotheque-numeriqueparis8.fr/fre/ref/146505/COLN1/ (consult le 8 mai 2014), p. 159-177.
Kleinbauer, Antioch = W. E. Kleinbauer, Antioch, Jerusalem and
Rome. The patronage of Emperor Constantius II and architectural

335/336 et la mort de son auteur en 3392 (annexe 1). Ces


deux descriptions ont t rdiges avant la ddicace de
OpGLFH TXL HXW OLHX HQ  HW ULHQ QLQGLTXH TXHOOHV
aient la valeur de tmoignages oculaires. Lglise na pas

invention, dans Gesta, 45, 2006, p. 125-144. Maraval, Thologie


politique = P. Maraval, Eusbe de Csare, la thologie politique de
lEmpire chrtien : louanges de Constantin (Triakontatrikos), Paris,
2001. Martin, Sources = A. Martin, Des sources pour la topographie
dAntioche : les Histoires ecclsiastiques de la premire moiti du e sicle,
dans Topoi, 17/2, 2011, p. 413-420. Mayer, Allen, Churches = W. Mayer,
P. Allen, The Churches of Syrian Antioch (300-638 CE), Leuven / Paris /
Walpole (Mass.), 2012. Recherches = S. Agusta-Boularot, J. Beaucamp,
A.-M. Bernardi, E. Caire (dir.), Recherches sur la Chronique de Jean
Malalas, 2, Paris, 2006. Studies = E. Jeffreys, B. Croke, Studies in
John Malalas, Sydney, 1990. Voelkl, Kirchenbauten = L. Voelkl, Die
Konstantinischen Kirchenbauten nach Eusebius, dans RAC, 29, 1953,
p. 49-66 et 187-206.
1. Eus., LC IX, 15 ; cf. Maraval, Thologie politique, p. 22-24, pour la
date et les circonstances du discours.
2. Eus., VC III, 50, 2 ; cf. L. Pietri, M.-J. Rondeau, Vie de Constantin,
Paris, 2013 (SC 559), p. 13-20 pour la date et les modalits
dlaboration de louvrage.

126

CATHERINE SALIOU

t retrouve sur le terrain mais des sources textuelles


QRPEUHXVHV HW GLYHUVLpHV3 fournissent des lments
dinformation sur son architecture et son histoire4. Dans
OD PHVXUH R OpGLFH QHVW FRQQX TXH SDU GHV VRXUFHV
littraires, il importe tout dabord dtablir les conditions
GHSRVVLELOLWpGHVRQLGHQWLFDWLRQGDQVOHVWH[WHVFHVW
-dire de sinterroger sur la faon dont il y est nomm
ou voqu. On dressera ensuite le bilan de ce que lon
peut savoir de sa forme architecturale et de la chronologie
comme des motivations de sa construction. Cette glise
QpWDLW SDV OH VHXO pGLFH OLp j $QWLRFKH j OD JXUH GH
Constantin. Au e sicle, dans son Histoire universelle,
Malalas attribue Constantin plusieurs initiatives aussi
bien institutionnelles qudilitaires (annexe 25). Lanalyse
de son rcit permettra de mettre en vidence quelques
traits de la mmoire antiochenne de Constantin et de
prciser le rle quy jouait lglise, avant de sinterroger
HQFRQFOXVLRQVXUOHGHYHQLUXOWpULHXUGHOpGLFH
De lglise dOr la Grande glise
Lglise fonde par Constantin est dsigne par Eusbe
DQQH[H VRLWFRPPHXQWHPSOH VRLWFRPPHXQH
pJOLVH 6. Dans sa Chronique, mise au point
entre 379 et 3807, Jrme utilise, lorsquil voque le
GpEXWGHODFRQVWUXFWLRQGHOpGLFHHWVDGpGLFDFHOHPRW
dominicum8. Dans la sienne, Thophane, la charnire du
e et du e sicle, emploie propos des mmes pisodes

3. On exclura de ces sources le discours de Bmarchios voqu de


faon mchamment ironique par Libanios (Or. I, 39 et 41) et qui,
contrairement ce que lon a cru longtemps, ne concerne pas cette glise
(cf. M. Raimondi, Bemarchio di Cesarea, panegirista di Costantino
e Costantinopoli: per une reinterpretazione di Libanio, Or. I 39; 41,
dans Rivista storica dellantichit, 33, 2003, p. 171-199 ; D. Woods,
Libanius, Bemarchius and the Mausoleum of Constantine I, dans
C. Deroux [dir.], Studies in Latin Literature and Roman History, 13,
Bruxelles, 2006, p. 428-439). De mme les passages de Chrysostome
parfois allgus propos de larchitecture ou du dcor intrieur de
lglise ne la concernent peut-tre pas (cf. Mayer, Allen, Churches,
p. 71), ils seront donc galement exclus de la prsente tude.
4. Une synthse en a rcemment t propose par W. Mayer et P. Allen dans
leur ouvrage sur les glises dAntioche (Mayer, Allen, Churches, p. 6880). Cette synthse, trs utile, peut toutefois tre complte, et surtout
prcise, voire discute sur plusieurs points. Nous nous appuierons
galement sur linventaire des sources propos par A. Martin dans sa
contribution aux journes dtudes sur Les sources de lhistoire du
paysage urbain dAntioche sur lOronte (http://www.bibliothequenumerique-paris8.fr/fre/ref/146505/COLN1/), p. 117-118.
5. Une analyse de ce passage a t propose par Gl. Downey (Antioch,
p. 650-653) ; voir aussi ses utiles remarques p. 348, n. 138 et p. 349-350.
6. Sur ce vocabulaire, cf. Voelkl, Kirchenbauten, p. 51-54. Les mots
 HW  VRQW pJDOHPHQW XWLOLVpV SDU GHV DXWHXUV SOXV WDUGLIV
soucieux dutiliser un langage lev et de se dmarquer des usages
plus communs (ex. : Thodoret, HE9 
7. Cf. B. Jeanjean, B. Lanon (dir.), Saint Jrme, Chronique :
continuation de la Chronique dEusbe, annes 326-378, Rennes,
2004, p. 20-26.
8. Jrme, Chron. a. 327, p. 231, l. 26 Helm ; a. 342, p. 235, l. 20 Helm.

AnTard , 22, 2014

WDQW{W OH WHUPH 9 dont le mot dominicum est


OH[DFW FRUUHVSRQGDQW ODWLQ  WDQW{W OH PRW 10.
Jrme et Thophane sappuient sur une source commune
reconstruite par R. W. Burgess sous le titre de Continuatio
Antiochensis Eusebii11. En latin comme en grec, le mot
dominicum HVW GXQ XVDJH j OD IRLV DQFLHQ
antrieur la Paix de lglise et populaire12, mme
si lexplication quen a donn Eusbe13 lui a en quelque
sorte confr ses lettres de noblesse. R. W. Burgess, dans
sa reconstruction de la Continuatio, a donn avec raison
ODSUpIpUHQFHDXPRWDXVVLELHQGDQVOHSDVVDJH
FRQFHUQDQWOHGpEXWGHOpGLFDWLRQGHOpJOLVHTXHGDQV
celui qui concerne la ddicace14.
Dans la Chronique de Jrme comme dans celle
GH 7KpRSKDQH OH WHUPH JpQpULTXH GpVLJQDQW OpGLFH
est accompagn dun adjectif. Jrme emploie aureum
GRUGRUp 'HIDLW(XVqEHVLJQDOHTXHOpGLFH
tait orn dune profusion dor 157KpRSKDQH TXDOLH
OpJOLVHGRFWRJRQDOH 16) puis de sphrode
17) . Plusieurs lments font penser que le
QRP SURSUH GH OpGLFH ORUV GH VD GpGLFDFH pWDLW FHOXL
quindique Jrme, cest--dire lglise dOr18 : Jrme
crit au e sicle, il utilise la mme expression aussi
bien propos du dbut de la construction qu propos
de la ddicace, il a vcu Antioche et en connat bien la
topographie et les monuments ; de plus, lors de sa premire
occurrence, le groupe dominicum aureum est explicitement
prsent comme une appellation (dominicum, quod uocatur
aureum /HVDGMHFWLIVHWSHXYHQW
constituer dans la Chronique de Thophane des anachronismes, tmoignant de dsignations attribues lglise
postrieurement au e sicle19.

9. Thophane, a. 5819, p. 28, l. 16 De Boor.


10. Thophane, a. 5833, p. 36, l. 27, l. 29 De Boor.
11. Burgess, Studies.
12. Cf. F. J. Dlger, Kirche als Name fr den christlichen Kultbau,
dans Idem, Antike und Christentum, VI, 3, Mnster, 1941, p. 161-195 ;
Chr. Mohrmann, /HV GpQRPLQDWLRQV GH OpJOLVH HQ WDQW TXpGLFH HQ
grec et en latin au cours des premiers sicles chrtiens, dans Revue des
sciences religieuses, 36/2, 1962, p. 155-174 (repris dans tudes sur le
latin des Chrtiens, 4, Rome, 1977, p. 211-230) : p. 165-167.
13. Eus., LC XVII, 4. Ce dveloppement sinscrit dans la deuxime
partie de louvrage dEusbe (LC XI-XVIII), qui correspond, non au
discours prononc lors des Tricennales, mais un expos doctrinal
prsent sans doute Constantinople devant Constantin entre
novembre 335 et 336 (Maraval, Thologie politique, p. 29-34).
14. Burgess, Studies, p. 166, p. 170.
15. Eus., VC III, 50, 2.
16. Thophane, a. 5819, p. 28, l. 16 De Boor.
17. Thophane, a. 5833, p. 36, l. 29 De Boor. Cf. Chronicon miscellaneum
ad AD 724, dans Burgess, Studies, p. 158 ; Michel le Syrien, VII, 4
(trad. Chabot, 1, Paris, 1899, p. 270).
18. Le groupe nominal dominicum aureum est lui-mme la transcription
GX JUHF   H[SUHVVLRQ TXL WRXWHIRLV QHVW MDPDLV
atteste dans les textes propos de la fondation de Constantin.
19. La restitution de lexpression glise octogonale dans la Continuatio
Antiochensis (Burgess, Studies, p. 166-167) parat donc contestable.

AnTa rd , 2 2 , 2 0 1 4

ANTIOCHE SUR LORONTE, LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE

Dans le rcit par Malalas du tremblement de terre de


 TXL RFFDVLRQQD OD UXLQH GH OpGLFH FH GHUQLHU HVW
GpVLJQpFRPPH
OD*UDQGH
glise construite par Constantin le grand souverain20 .
Malalas dsigne lglise de Constantin comme la Grande
eJOLVHGqVVDSUHPLqUHPHQWLRQ DQQH[H SXLVjODQ
du rcit du rgne de Constantin21, ainsi qu propos de
la ddicace de lglise22, mais il peut sagir danachroQLVPHV 3OXV DEOH HVW OH WpPRLJQDJH GH7KpRGRUHW TXL
signale la fermeture par Julien de la Grande glise,
construite par Constantin23 . Thodoret crit au e sicle,
mais Ammien Marcellin, tmoin oculaire des vnements,
mentionne lui aussi propos du mme pisode lecclesia
maior24. Au plus tard partir du rgne de Julien, lglise
dOr est donc dsigne comme la Grande glise25. Plutt
TXDX[GLPHQVLRQVGHOpGLFHODGMHFWLIGRLWUHQYR\HUj
son statut dglise principale de la ville26. Cest ce que
montre le rle que la Grande glise joue dans lhistoire
tourmente du christianisme antiochen : la faction qui
loccupe est celle qui jouit des faveurs du pouvoir imprial
et peut se dire majoritaire ou lgitime27. On trouve aussi
quelques mentions28GXQpGLFHGpVLJQpFRPPHOeJOLVH
sans autre prcision, en particulier propos de lpisode
du pillage et de la fermeture de lglise par Julien29. Ces
dernires occurrences montrent que lglise doit tre
LGHQWLpHjOD*UDQGHeJOLVHVXVFHSWLEOHGrWUHGpVLJQpH
simplement comme lglise la fois parce quelle na
pas de titulaire particulier et parce quelle est lglise
principale, lglise par excellence, de la ville. La trs
sainte glise mentionne dans les Actes du synode
prsid par lvque Domnos en 44430 doit aussi lui tre
LGHQWLpH31.

20. Malalas XVII, 16, p. 347, l. 26-27 Thurn.


21. Malalas XIII, 14, p. 249, l. 63-64 Thurn.
22. Malalas XIII, 17, p. 250, l. 83-92 Thurn.
23. Thodoret, HE,,,

24. Ammien Marcellin XXII, 13, 2 : maiorem ecclesiam Antiochiae.
&HVWDLQVLTXH7KpRSKDQHDXVVLGpVLJQHOpGLFHORUVTXLOHQPHQWLRQQH
la fermeture par Julien (a. 5854, p. 50, l. 15 De Boor).
26. Voir dj en ce sens Downey, Antioch, p. 345, et Deichmann, Das
Oktogon, p. 48.
27. Voir ce propos Mayer, Allen, Churches, p. 77-78.
28. Outre les textes cits la note suivante, voir aussi Socrate, HE V,
22, 53.
29. Jrme, Chron. a. 363, p. 243, l. 4 Helm ; Philostorge, HE VII, 10,
l. 28 (SC 564).
30. Mansi, Sacrorum conciliorum nova et amplissima collectio, VII,
S
31. Lexpression peut avoir un sens institutionnel et dsigner lglise,
la communaut chrtienne (cf. vagre le Scholastique, HE II, 8,
l. 59-60 ; II, 18b, l. 195-196 ; II, 18c, l. 142 [SC 542] ; Chronique
Paschale, S  O  'LQGRUI  4XDQG HOOH VDSSOLTXH j XQ pGLFH
concret, il doit sagir de lglise principale de la ville, celle qui
constitue prcisment le lieu de rassemblement de la communaut
dans son ensemble (cf. Malalas, XIII, 45a, fragment de Tusculum,
p. 270, l. 59 Thurn ; Malalas XVIII, 143, p. 429, l. 81-82 Thurn ; Jean

127

Il nest pas certain en revanche, contrairement ce qui


a pu tre crit32, que lglise dOr ait t dsigne comme
lglise Neuve. Lorsque Sozomne mentionne la ddicace
GHOpGLFHOXVDJHGXTXDOLFDWLIQRXYHDXVLQVFULW
GDQV FH FRQWH[WH VSpFLTXH HW QH UHQYRLH HQ DXFXQ FDV
une expression lexicalise33. Thodoret voque quant
lui lglise nouvellement construite34 dont Jovien avait
donn lusage aux Mlciens : dans la mesure o lon sait
par ailleurs que ces derniers se rassemblaient auparavant
dans la Vieille glise tandis que la Grande glise tait
occupe, sous le rgne de Julien en tout cas, par ceux que
Thodoret appelle les Ariens, lon peut admettre que la
priphrase dsigne bien lglise ddicace en 341, sans
que cela implique quil sagisse de sa dsignation usuelle.
Comme le souligne W. Mayer, il peut au reste sagir dune
autre glise plus rcente35(QQ&KU\VRVWRPHSURQRQoD
une homlie dans la Vieille glise, aprs une prcdente
synaxe tenue dans lglise Neuve laquelle il avait
particip conjointement avec lvque36. Il semble bien
ici que lexpression glise Neuve ait la valeur dun
QRPSURSUH3RXUDXWDQWOLGHQWLFDWLRQGHOpGLFHDLQVL
dsign avec lglise dOr ne simpose pas.
Un manuscrit de la Vie grecque de Symon Stylite
lAncien signale, dans le cadre du rcit du transfert
Antioche de la dpouille du saint en 459, que la Grande
eJOLVHpWDLWGpVLJQpHGXQRPGH 3pQLWHQFH 37.
Dans les versions latines de la Vie JXUHQW OHV QRPV GH
Concordia Poenitentiae, Concordia et poenitentia ou
Concordia Poenitentalis38, et un manuscrit du martyrologue hironymien dat du xe sicle comporte la mention de
la dposition du corps de Symon in Antiochia in ecclesia
quae uocatur Poenitentia, ou Concordia daprs une
seconde main39. Comme le souligne W. Mayer, limportance parfois attache au nom de Concordia, qui nest
attest que dans ces adaptations latines, est dmesure40. Le

Moschos, Pr Spirituel 185, PG 87, 3, col. 3060, l. 15-16 ; Chronique


Pascale, p. 411, l. 18 ; p. 569, l. 17-18 ; p. 727, l. 11 Dindorf).
32. Deichmann, Das Oktogon, p. 49.
33. Sozomne HE ,,,
34. Thodoret HE,9
35. Mayer, Allen, Churches, p. 77.
36. Jean Chrysostome Hom. In faciem ei restitui , titulus, PG 51,

37. Cf. H. Lietzmann, Das Leben des hl. Symeon Stylites, dans Texte
und Untersuchungen zur Geschichte der altchristlichen Literatur,
32/4, 1908, p. 77, ms;
    6XU OD PHQWLRQ    YRLU
C. Saliou, propos de la Taurian pul. Remarques sur la localisation
prsume de la Grande glise dAntioche de Syrie, dans Syria, 77,
2000, p. 217-226.
38. Cf. H. Lietzmann, Das Leben, cit. (n. 37), p. 209.
39. Martyrologium Hieronymianum, dans AA. SS nov., II, p. 26 : addition
du manuscrit S. Sur ce manuscrit, voir AA. SS nov., II, p. XI, et
R. Aigrain, R. Godding, Lhagiographie : ses sources, ses mthodes,
son histoire, Bruxelles, 2000, p. 41-42.
40. Mayer, Allen, ChurchesS /HQRP GRQW Concordia
serait une traduction, est attest comme nom dglise Constantinople
et Antinoupolis (cf. J. Gascou, Encore une fois sur lonomastique

128

CATHERINE SALIOU

QRPGHPpULWHGDYDQWDJHGHUHWHQLUODWWHQWLRQ
toutefois rien nindique que cette dsignation remonte la
fondation ou la ddicace de la Grande glise, et elle peut
lui avoir t attribue postrieurement, on y reviendra.
Sur la localisation de la Grande glise, les informations
dont on peut disposer sont malheureusement tnues41. Au
dbut du e sicle, la ville dAntioche se dveloppait sur les
deux rives de lOronte : la Vieille Ville sallongeait entre
ODULYHJDXFKHGXHXYHHWODPRQWDJQHTXLODGRPLQHWDQGLV
que sur une le forme par un bras de lOronte aujourdhui
disparu se trouvait la Ville Neuve , dote de ses propres
remparts et abritant notamment le palais imprial (J).
Thodoret, dans son rcit de la grande manifestation de
UpFRQFLOLDWLRQHWGHUpXQLFDWLRQGHOeJOLVHDQWLRFKpHQQH
intervenue au dbut du e sicle, localise explicitement la
*UDQGHeJOLVHjSUR[LPLWpGHO2URQWHHWVXUXQH42.
Cette dernire indication pourrait tre dcisive, condition
GDGPHWWUHTXHOHPRWGpVLJQHj$QWLRFKHXQVHXO
espace, qui serait lunique place publique de la ville. Or on
ne peut pas exclure que le mot soit employ ici non comme
un toponyme mais comme un terme gnrique. Thodoret
mentionne galement une poterne occidentale , dont la
ORFDOLVDWLRQ HW OLGHQWLFDWLRQ IRXUQLURQW FHUWDLQHPHQW OD
cl du problme. Pour linstant mieux vaut rester prudent
et se contenter denregistrer la mention de la proximit
par rapport lOronte. Le fait que la Grande glise nait
apparemment pas t atteinte par le sisme de 458, qui
a frapp essentiellement la Ville Neuve, peut tre un
indice dune localisation dans la Vieille Ville43. Daprs
Malalas, lglise aurait t construite lemplacement
GXQ pGLFH WKHUPDO GpVDIIHFWp DQQH[H   6L IDQWDLVLVWH
que soit le tmoignage de Malas sur les constructions
constantiniennes (voir infra), cette indication nest pas
invraisemblable44.

ecclsiale ancienne, dans M.-A. Vannier, O. Wermelinger, Gr. Wurst


[dir.], Anthropos Laikos. Mlanges Alexandre Faivre, Fribourg, 2000,
p. 119-130 : p. 128), mais il ne lest pas Antioche. Sur lintroduction
du nom de Concordia dans la tradition occidentale latine, voir
Deichmann, Das Oktogon, p. 43-44 et p. 50-52.
41. Contrairement ce que pourrait laisser croire une note de la rcente
traduction commente de la Vie de Constantin parue aux Sources
Chrtiennes (note III, 50, 2, p. 415) quil faut corriger sur ce point,
DXFXQDUJXPHQWQHSHUPHWGpWDEOLUTXHOpGLFHVHWURXYDLWVXUOvOH
de lOronte et jouxtait le palais imprial, et la mosaque dite de Yaqto
ne peut tre invoque lappui de cette thse. Les pages consacrs par
Gl. Downey la localisation de lglise (Antioch, p. 346-349) forment
un savant tissu derreurs et dinterprtations abusives. Voir en dernier
lieu Mayer, Allen, Churches, p. 72, avec la bibliographie antrieure.
42. Thodoret, HE V, 37, 4. Cf. Martin, Sources, p. 418, Mayer, Allen,
Churches, p. 73.
43. Mayer, Allen, Churches, p. 152.
44. La Grande glise dAlexandrie, amnage sous le rgne de
Constance (pour la chronologie des travaux, cf. A. Martin, Athanase
dAlexandrie et lglise dgypte au e sicle (328-373), Rome, 1996,
p. 148) succderait daprs piphane un bain dsign dabord comme
(bain d) Hadrien puis de Licinius ou encore imprial
(piphane, Panarion 69, 2, 2, GCS 37, p. 153, l. 16-23, cf. J. Gascou,
Les glises dAlexandrie : questions de mthode, dans Alexandrie

AnTard , 22, 2014

Daprs les vocations brivement esquisses quen a


donnes Eusbe qui sont antrieures de cinq ans pour
lune, de deux au moins pour lautre, la ddicace de
OpJOLVH DQQH[H OpGLFHpWDLWHQWRXUpGXQHHQFHLQWH
dlimitant un vaste espace clos, et comportait lui-mme
un noyau central entour despaces annexes45. Le noyau
FHQWUDO HVW GpVLJQp SDU (XVqEH FRPPH  SXLV
FRPPH  46. Dans ses autres occurrences
GDQVOXYUHG(XVqEHOHWHUPHGpVLJQHVRLW
le Temple de Jrusalem47, soit une salle dun palais48.
Le choix de ce mot renvoie donc une reprsentation
V\PEROLTXHGHOpGLFHGHFXOWHFRPPHXQHVSDFHSDODWLDO
associe une conception thologique exaltant la souverainet du Christ49/pWDLWGHSODQRFWRJRQDO50.

mdivale, 1, Le Caire, 1998, p. 23-44 : p. 32-33). La popularit


constante, voire croissante, des pratiques thermales Antioche et plus
gnralement dans le Levant romain durant lAntiquit tardive est
bien atteste (Fournet, Thermes, p. 218-220) et lon ne tirera de cette
substitution ventuelle dune glise un bain aucune conclusion en
termes dvolution des pratiques corporelles et des comportements.
,O FRQYLHQW pJDOHPHQW GH UHVWHU WUqV SUXGHQW GDQV OD UpH[LRQ VXU OH
VWDWXWMXULGLTXHGHFHWpGLFHWKHUPDOHWGXVROVXUOHTXHOLOVpOHYDLW
En revanche, on ne saurait surestimer limportance symbolique de la
VXEVWLWXWLRQ j XQ W\SH GpGLFH RXYHUW j WRXV HW GHVWLQp DX[ XVDJHV
GH WRXV GXQ pGLFH QH FRQFHUQDQW TXH OD FRPPXQDXWp FKUpWLHQQH 
il sagit dun signal fort de reconnaissance de cette communaut,
induisant en elle-mme une forme de marginalisation des tenants des
autres religions. Cest ce qui peut au reste expliquer que Malalas ait pris
soin denregistrer cette circonstance, sil ne la pas invente.
45. Linterprtation architecturale de ces deux descriptions est lobjet
de dbats et les comparaisons avec des ralisations architecturales
observables permettent surtout de prciser les enjeux de ces discussions
en termes deffet visuel et spatial (cf. p. ex. Goilav, Proposal, avec
la bibliographie antrieure). Nous nous cantonnerons la mise en
pYLGHQFHGHVGLIFXOWpVGRUGUHSKLORORJLTXHVRXOHYpHVSDUFHVWH[WHV
46. Dans chacun des deux passages, la syntaxe du texte montre clairement
TXH OHVSDFH GpVLJQp SDU  RX   QH FRQVWLWXH
TXXQH SDUWLH GH OHQVHPEOH GH OpGLFH /HV FULWLTXHV IRUPXOpHV SDU
G. J. M. Bartelink (Maison de prire comme dnomination de lglise en
WDQWTXpGLFHHQSDUWLFXOLHUFKH](XVqEHGH&pVDUpH, dans RG, 84, 1971,
p. 101-118 : p. 115) lgard des propositions de L. Voelkl (Kirchenbauten,
p. 56-67) sont, en ce qui concerne ce passage prcis, irrecevables.
47. Prparation vanglique IX, 34, 13.
48. Eus.,VC III, 15, 2, VC III, 49, 1, LC prologue, 4 (dans ces trois cas,
le mot est au pluriel).
49. Cf. Voelkl, Kirchenbauten, p. 191-199.
50.W. E. Kleinbauer (The Origin and Functions of the aisled tetraconchs
Churches in Syria and Northern Mesopotamia, dans DOP, 27, 1973,
SS DIDLWUHPDUTXHUTXHOHPRWVDSSOLTXHHQ
principe un volume, non une surface, mais il faut ici le comprendre
dans son sens tymologique de huit faces : en lvation soit ds
le niveau du sol soit au-dessus des volumes des espaces annexes, et
VRLWGHOLQWpULHXUVRLWGHOH[WpULHXUOpGLFHGHYDLWFRPSRUWHUKXLW
parois verticales visibles. Sur ce choix planimtrique, voir Deichmann,
Das Oktogon, 1972, p. 55-56 ; sur les prcdents constitus par les
salles dapparat plan centr ou plus prcisment octogonal, attestes
GHSXLVOH+DXW(PSLUHFI5.UDXWKHLPHU6XULEarly Christian
and Byzantine Architecture, 4e d, New Haven, 1986, p. 77. Le plan
octogonal est galement attest dans le domaine de larchitecture
thermale, en particulier pour les grandes salles froides, lieux de
rencontre et dapparat (ex. : Thermes du Sud Bostra ; bains dAdraha/
Deraa ; bains de Znobie Palmyre ; Bath C , Antioche, dans
VD SKDVH ,, GDWpH GH OD Q GX e s. ; cf. Fournet, Thermes, p. 193,
p. 209-210, p. 229, p. 232). Comme on la vu supra, Malalas signale
que la Grande glise a t substitue un complexe thermal dsaffect

AnTa rd , 2 2 , 2 0 1 4

ANTIOCHE SUR LORONTE, LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE

129

Fig. 1 Antioche dans lAntiquit tardive


(G. Poccardi, daprs R. Stillwell [dir.], Antiochon-the-Orontes II excavations of 1933-1936,
Princeton, 1938, p. 215, pl. I).

Autour se dveloppaient des espaces annexes. Lambigut


des descriptions dEusbe doit ici tre souligne. Le mot
 SHXW VDSSOLTXHU j WRXW W\SH GH ORFDO FRQVWUXLW
LQGpSHQGDQWRXLQWpJUpjXQpGLFHFRPSOH[H/HWHUPH
GHPSORLWUqVVRXSOHGpVLJQHXQHVSDFHFRXYHUW
ou non, largement ouvert sur un autre51. Il nest pas
possible de savoir, la lecture de la seule description,
si les annexes sont des lments constitutifs de lespace
ecclsial proprement dit, quil faudrait imaginer, par
exemple, daprs lglise San Vitale de Ravenne52, ou sil

FIDQQH[H &HUWHVLODIUPHTXHODFRQVWUXFWLRQGHOpJOLVHDpWp
prcde par le dmantlement de ces bains, mais on peut se demander
sil ne sagit pas dune transformation rutilisant le gros uvre dune
salle octogonale.
51. Eusbe lemploie pour dsigner des amnagements de latrium de la
Basilique du Saint-Spulcre (VC III, 39).
52. Cf. Goilav, Proposal, p. 169-170.

sagit de locaux adjacents, spatialement distincts du corps


central53. Pour mmoire et pour bien mettre en vidence
lambigut du texte, on rappellera aussi qu Antioche
PrPHjODQGXe sicle, le mot HVWXWLOLVpSRXU
dsigner les bras de lglise cruciforme mise au jour sur
le site de Kaoussi54.

53.Dans son loge descriptif de la basilique de Tyr, Eusbe utilise galement


OHVGHX[PRWVDVVRFLpV  DSSDUHPPHQWSRXUGpVLJQHU
des amnagements extrieurs lglise, mais communiquant avec
elle. En effet lglise est de plan basilical et les collatraux, dsigns
comme des portiques , ont t dcrits, de mme que la nef centrale,
DYDQWTX(XVqEHQHSDVVHjOpYRFDWLRQGHFHVTXL
communiquent avec la basilique par des passages (HE X, 4, 45).
54. IGLS III, 1, 774 (mars 387) ; IGLS III, 1, 776 ; IGLS III, 1, 777. Sur
OpGLFHOXLPrPHYRLUGpVRUPDLV0D\HU$OOHQChurches, p. 32-49
OLGHQWLFDWLRQGHOpGLFHjOpJOLVHGH%DE\ODVDWWHVWpSDUOHVWH[WHV
nous parat cependant trs douteuse).

130

CATHERINE SALIOU

/DEVWUDLW  XWLOLVp SDU (XVqEH GDQV OD Vie


de Constantin est encore plus vague. Lapport de cette
seconde description rside dans lindication de deux
niveaux superposs despaces annexes, mettant en
vidence la grande hauteur de loctogone central, dont
on doit supposer que sa couverture au moins dominait
lensemble du complexe. Un espace octogonal peut tre
couvert soit par un comble huit pans cest ainsi quest
restitue la couverture de la salle centrale octogonale de
lglise de plerinage du monastre de Symon Stylite
lAncien55  VRLW SDU XQH FRXSROH /H TXDOLFDWLI GH
sphrode suppose une couverture en coupole56, mais
comme on la vu, il est probablement entr dans lusage
postrieurement au e sicle, et il peut donc sappliquer
j XQ VHFRQG pWDW GH OpGLFH 2Q LJQRUH GRQF FRPPHQW
il tait couvert dans son premier tat57. On ignore aussi
si lautel se trouvait dans lespace central octogonal ou
dans un des espaces annexes. On sait en revanche que
cet autel tait tourn non vers lest, mais vers louest58,
conformment une tendance caractristique du e sicle
et des fondations constantiniennes59.
La Continuatio Antiochensis Eusebii date le dbut des
travaux de 32760. D. Woods, toutefois, a fait remarquer
quun certain nombre dvnements signals dans cette
chronique le sont avec une erreur de deux ans61, on ne
peut donc pas exclure que les travaux aient commenc ds
325. La ddicace eut lieu le 6 janvier 34162, et intervint
daprs Thophane six ans aprs le dbut du chantier,
quil faudrait alors situer en 334/335. Sappuyant comme
Thophane sur la Continuatio, la Chronique ad annum 724
mentionne une dure de 15 ans pour les travaux63, ce qui
saccorde avec un dbut des travaux en 327. Toutefois, il
pourrait sagir dune correction de sa source de la part du

55. Cf. J.-P. Sodini, J.-L. Biscop, Qalat Seman et Deir Seman : naissance
et dveloppement dun lieu de plerinage durant lAntiquit tardive,
dans J.-M. Spieser (dir.), Architecture palochrtienne, Gollion, 2011,
p. 11-59 : p. 44-51.
6XUOHVHQVGHVPRWHWYRLU*O'RZQH\
On some post-classical Greek architectural terms, dans Transactions
and Proceedings of the American Philological Association, 77, 1946,
p. 22-34 : p. 23-26.
57. Comme le signale Gl. Downey (Antioch, p. 344, n. 113), lindication
de Malalas selon laquelle lglise fut dtruite en 526 non par les
secousses du sisme mais par lincendie qui suivit suggre une
couverture en bois.
58. Socrate HE V, 22, 53.
59. S. De Blaauw, Konstantin als Kirchenstifter, dans A. Demandt,
J. Engemann (dir.), Konstantin der Gre. Geschichte, Archologie,
Rezeption, Trves, 2007, p. 163-172 : p. 166-168. Voir aussi, propos
de la basilique du Saint-Spulcre, Eus. VC III, 35, 1.
60. Cf. Burgess, Studies, p. 166.
61. D. Woods, (XVHELXV RQ 6RPH &RQVWDQWLQLDQ 2IFLDOV, dans Irish
Theological Quarterly, 67, 3, 2002, p. 195-223 : p. 196, n. 3.
62. Sur cette date et les discussions auxquelles elle peut donner lieu, cf.
Burgess, Studies, p. 138-139 et p. 239, n. 62 ; S. Parvis, Marcellus of
Ancyra and the Lost Years of the Arian Controversy, 325-345, New
York / Oxford, 2006, p. 160-161.
63. Cf. Burgess, Studies, p. 158.

AnTard , 22, 2014

UpGDFWHXUGHOD&KURQLTXH,OHVWGRQFGLIFLOHGHVHIRQGHU
sur ces diverses indications pour prciser la chronologie
des travaux. Une indication fcheusement ambigu est
fournie par Socrate :
        
     
      

lglise, que le pre des Augustes avait commenc
GHEkWLUHWTXHVRQOV&RQVWDQFHDYDLWDFKHYpHDSUqVVD
mort, neuf ans aprs quon en eut jet les fondations64 .

&HWWH SKUDVH SHXW VLJQLHU VRLW TXH OHV WUDYDX[ RQW


commenc en 33165 interprtation incompatible avec les
autres tmoignages dont on dispose , soit que la mort
de Constantin est intervenue durant la dixime anne
DSUqV OH GpEXW GHV WUDYDX[ FH TXL FRQUPH OD GDWH GH
32766. Sozomne prcise que le projet tait bien un projet
constantinien et que sa ralisation fut le fait de Constance,
agissant en tant que subordonn de son pre et son vivant,
donc en tant que Csar67. Tel est le sens dune pigramme
cite par Malalas comme se rapportant la Grande
glise68. De fait, Constance a sjourn en tant que Csar
Antioche, peut-tre ds 33369. Les deux vocations
dEusbe sont trop vagues pour quon puisse en dduire
ltat du chantier en 336 et 337. Les travaux se sont certai-

64. Socrate, HE II, 8, 2 (trad. P. Pruchon, P. Maraval, SC 493).


65. Cf. Downey, Antioch, p. 343, n. 106 ; Mayer, Allen, Churches, p. 133.
66. Cf. Martin, Sources, p. 403-404.
67. Sozomne, HE ,,,         


et comme lglise de ce lieu [scil. Antioche], que Constantin avait
commenc faire construire, surnaturelle de grandeur et de beaut,
GHVRQYLYDQWHQXWLOLVDQWFRPPHDX[LOLDLUHVRQOV&RQVWDQFH pWDLW
acheve .
68. Malalas XIII, 17, p. 250, l. 85-88 Thurn. Cf. S. Agusta-Boularot,
Malalas pigraphiste ? Nature et fonction des citations pigraphiques
dans la Chronique, dans Recherches, p. 97-135 : p. 127-129, avec la
bibliographie antrieure. Lattribution de cette pigramme la Grande
glise a t conteste par D. Woods, (Malalas, Constantin and a church
inscription from Antioch, dans Vigiliae Christianae, 69, 2005, p. 5462). En effet, le texte mme de cette pigramme a t trs maltrait
par la traduction manuscrite, et la mention de lempereur Constantin
dpend en fait dune correction de la leon de lunique manuscrit.
Toutefois, si lon admet linterprtation propose par D. Woods, selon
laquelle lpigramme se rapporterait en fait une glise construite
linitiative de Constance II sous la supervision de Gallus, il faut alors
rendre compte de ce que Malalas ou sa source associe bien linscription
j OD *UDQGH eJOLVH HW QRQ j XQ DXWUH pGLFH FH TXL QHVW SDV FKRVH
aise (cf. Mayer, Allen, Churches, p. 116-117). Comme le signale
A. Martin (SourcesS ODGpGLFDFHDX&KULVWGHOpGLFHGRLW
tre rapproche des indications dEusbe selon lesquelles les glises
FRQVWUXLWHVSDU&RQVWDQWLQpWDLHQWpGLpHVDX&KULVW VC III, 50, 2 ;
LC ,; FHTXLWHQGjFRQUPHUODSUpVHQFHGXQRPGH&RQVWDQWLQ
dans la ddicace. Il faut donc suivre D. Feissel qui, dans sa contribution
aux actes du XVIe Congresso Internazionale di Archeologia Christiana
( paratre), conclut quil faut conserver la correction du nom de
Constance en Constantin, en sappuyant notamment sur la proximit
entre le contenu de cette pigramme et la formule de Sozomne.
69. Cf. Downey, Antioch, p. 334. Voir aussi P. Maraval, /HV OV GH
Constantin, Paris, 2013, p. 22, avec les rfrences aux sources.

AnTa rd , 2 2 , 2 0 1 4

ANTIOCHE SUR LORONTE, LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE

131

nement poursuivis aprs la mort de Constantin puisque la


ddicace neut lieu quen 34170. Constance a pu prendre
une part plus ou moins active la mise en uvre architecturale du projet, ou du moins le superviser. Toutefois la
responsabilit effective des travaux, daprs lpigramme
cite par Malalas, aurait t le fait, non de Constance
lui-mme, mais de son cubiculaire Gorgonios71.
La dcision mme de la construction de lglise dOr
relve quant elle de la volont de Constantin. Daprs
Eusbe, qui emploie exactement les mmes termes dans
son discours des Tricennales et dans la Vie de Constantin,
cest en tant que mtropole de lOrient , place la
WrWHGHVSURYLQFHVGHODUpJLRQTX$QWLRFKHDEpQpFLp
dune telle faveur (cf. annexe 1). La construction de
lglise dOr signale donc la reconnaissance par le
pouvoir imprial de la prvalence de la ville dAntioche
sur lensemble du diocse dOrient72. Elle apparat ainsi
comme une consquence de la mise en place en 314 de
lorganisation diocsaine73. Linventaire des fondations
constantiniennes74 ne permet cependant pas de parler dune
politique systmatique de la part de Constantin dvergtisme religieux lgard des capitales de diocses. Il est
possible que lempereur nait fait que rpondre favorablement une demande de lvque dAntioche, par
exemple, qui aurait lui-mme mis en avant le statut supraprovincial dAntioche dans sa ptition.
Dans le cours du e sicle, lglise fut pille et ferme
au culte par Julien, puis servit denjeu entre les divers
groupes chrtiens de la ville jusquau dbut du e sicle75.
Les sources fournissent quelques points de repre sur

un complexe piscopal dont on peut supposer quil sest


dvelopp progressivement autour de lglise, comportant
un hospice76, un secretarium dt77 attest en 444, une
rsidence dote dun secteur thermal, divers autres locaux
administratifs78. La dpouille de Symon le Stylite y fut
dpose en 45979, avant dtre transfre dans son propre
martyrion qui ntait peut-tre toutefois en ralit
quune chapelle martyriale ajoute la Grande glise80.
Dans la Vie syriaque du saint, date par son colophon du
24 avril 473, la Grande glise est dsigne comme la
sainte et grande glise que Constantin avait construite ,
ce qui montre quelle continuait porter la mmoire de
&RQVWDQWLQjODQGXe sicle81&HVWFHTXHFRQUPH
pour le premier tiers du e sicle encore, la Chronique de
Malalas.

Dans sa Chronique, Malalas consacre un long dveloppement au rgne de Constantin, dont il voque notamment
un sjour quil aurait effectu Antioche82 (annexe 2).
Laccumulation de confusions et derreurs prsente par ce
SDVVDJHVHPEOHGpHUOHFRPPHQWDLUH83. De plus, Malalas
situe le suppos sjour de Constantin Antioche lissue
dune expdition contre les Perses quil prparait, certes,
avant de mourir, mais qui na jamais eu lieu, et fournit
deux indications de datation une date consulaire peine
corche84 et une date dans lre dAntioche85 correspondant toutes deux 335, tout en plaant lpisode,

70. Dans la Vie prmtaphrastique de Paul le confesseur, vque de


Constantinople (BHG 1472), la tonalit anti-arienne trs marque, le
rle de Constance est rduit lorganisation de la ddicace (PG 104,
col.121 B = Photius cod. 257, 474b Bekker).
71. On ne peut donc quexprimer les plus grandes rserves lgard
dentreprises comme celle de W. E. Kleinbauer dans son article
Antioch : dans la mesure o la part prise par Constance dans
llaboration du projet nest pas aise dterminer et peut avoir t
PLQLPHHWRGHSOXVODUFKLWHFWXUHGHOpGLFHQHSHXWrWUHUHVWLWXpH
de faon assure, il parat extrmement prilleux dutiliser la Grande
glise dAntioche dans le cadre dune dmonstration de linventivit
architecturale de Constance.
72. Cette primaut fonde celle de lvque dAntioche sur lensemble des
vques du diocse, lexception de ceux dgypte. La prminence de
lglise dAlexandrie sur les glises dgypte, de Lybie et la Pentapole
D pWp DIUPpH HQ  SDU OH FDQRQ  GX FRQFLOH GH 1LFpH TXL QH
reconnat en revanche apparemment Antioche que les privilges dune
mtropole provinciale. Cf. G. Alberigo, J.A. Dossetti, P.-P. Joannou
(dir.), Les conciles cumniques (trad. A. Duval et alii), Paris, 1994,
II, 1, p. 40-42.
73. Cf. C. Zuckerman, Sur la liste de Vrone et la province de Grande
Armnie, la division de lempire et la date de cration des diocses,
dans V. Droche, D. Feissel, C. Morrisson, C. Zuckerman (dir.),
Mlanges Gilbert Dagron = T&Mbyz, 14, Paris, 2002, p. 617-637.
74. Cf. G.T. Armstrong, Constantines Churches, dans Gesta, 6, 1967,
p. 1-9 : lvergtisme religieux de Constantin a concern en Occident
Rome, Aquile, Trves et Cirta, en Orient, outre Constantinople,
Nicomdie, la Palestine, Hliopolis de Phnicie et Antioche.
75. Cf. Mayer, Allen, Churches, p. 77-78.

76. Voir annexe 2 et nos remarques dans la suite de larticle.


77. Mansi, Sacrorum conciliorum nova et amplissima collectio, VII,
p. 325 Cf. Downey, Antioch, n. 76 p. 467 et supra, n. 31.
78. Le corpus svrien est particulirement riche pour la connaissance de
ce complexe piscopal : cf. Fr. Alpi, La Route royale, Beyrouth, 2009,
p. 150. Sur le secteur thermal de la rsidence, cf. Vie anonyme de Svre,
dans S. Brock, B. Fitzgerald, Two Early Lives of Severos, Patriarch of
Antioch, Liverpool, 2013, p. 126, 58. Sur lapport de la version syriaque
de la Vie de Plagie la Pnitente, voir Mayer, Allen, Churches, p. 78.
79. Mayer, Allen, Churches, p. 74.
80. Voir la discussion de Mayer, Allen, Churches, p. 104-106.
81. Cf. R. Doran, The Lives of Simeon Stylites, Kalamazoo, 1992, p. 193.
82. En ralit, Constantin na jamais sjourn Antioche (cf. P. Maraval,
Constantin le Grand, empereur romain, empereur chrtien, 306-337,
Paris, 2011, p. 292).
1RXVQHSUpWHQGRQVSDVHQDYRLUUpVROXWRXWHVOHVGLIFXOWpV/DPHQWLRQ
dun second comitatus (XIII, 4) est obscure, peut-tre Malalas pense-til une seconde comitiua, ou dignit de comte (de second rang ?). Ce
TXLOIDXWUHWHQLUGHFHSDVVDJHTXHOOHTXHQVRLWODGLIFXOWpHVWTXHOD
dignit du reprsentant de ltat rejaillit sur la cit dans son ensemble.
La mention des delegatores attend aussi aussi dtre explique.
,OORVHW$OELQRVVRQWOHVFRQVXOVGH&HLRQLXV5XXV$OELQXVHW
Iulius Constantius (cf. E. Jeffreys Chronological structures in the
chronicle, dans Studies, p. 111-166 : p. 146 ; R.S. Bagnall, A. Cameron,
S.R. Schwartz, K.A. Worp, Consuls of the Later Roman Empire,
Atlanta, 1987, p. 204-205).
85. Lan 383 dans lre dAntioche correspond au e s. la priode
qui stend du 1er octobre 334 au 30 septembre 335. E. Jeffreys,
Chronological structures in the chronicle, dans Studies, p. 151.

De lglise de Constantin lglise dEphrem

132

CATHERINE SALIOU

dans son rcit, avant le voyage dHlne en Palestine et


la fondation de Constantinople. La date de 335 est celle
que Thophane semble indiquer pour le dbut des travaux
de la Grande glise (supra) : soit cette date est issue de
la lecture de Malalas par Thophane ou ses sources, soit
Malalas et Thophane sont deux tmoins distincts dune
tradition plus ancienne dont la valeur historique serait
dautant plus grande. Lanalyse du passage de Malalas ne
SHUPHWSDVGHFRQUPHUFHWWHGHUQLqUHK\SRWKqVH'HX[
parties en effet sy distinguent. La premire est consacre
avant tout aux monuments de Constantin Antioche
avec quelques rfrences des vnements pseudo-historiques, sans aucune indication explicite de datation ;
la phrase cette statue se dresse encore de nos jours
signale, plutt quune intervention dauteur de Malalas en
tant que tmoin oculaire, lutilisation dune source crite
qui comportait dj cette mention86. La deuxime partie,
R JXUHQW OHV GHX[ GDWHV FRQFRUGDQWHV SUpFpGHPPHQW
signales, est consacre la nomination du premier
comte dOrient87, et sinscrit ainsi dans un ensemble de
rfrences dont la prsence dans la Chronographie fait
penser que Malalas faisait partie Antioche de lRIFLXP
du comte dOrient88. Il semble que le chronographe ait
combin en ralit deux notices diffrentes, provenant
de sources distinctes, et ait insr le dveloppement ainsi
constitu dans son rcit sans tenir compte des donnes
chronologiques quil pouvait contenir, puisquil le place
avant le voyage dHlne en Terre Sainte en 326. Quoi
quil en soit, on se gardera den tirer argument, dans un
sens ou dans lautre, pour la datation du dbut des travaux
de la Grande glise.
Un premier groupe dactivits relevant de lamnagement et de lembellissement urbain est li directement
la construction de lglise dOr. Le premier gouverneur
chrtien de la province de Syrie non attest par ailleurs
et dont lhistoricit est fort douteuse, mais ce nest pas
le problme ici est charg par Constantin de suivre
les chantiers de construction de lglise et de lhospice
qui lui est associ. Ce dtail na aucune valeur chronologique, il montre simplement quaux yeux de Malalas
ou de sa source Grande glise et hospice constituaient
un ensemble fonctionnel indissociable, et devaient donc
avoir t fonds en mme temps. Lors des travaux de
construction de lhospice, le gouverneur fait fondre une
statue de Posidon qui assurait la fonction de talisman
contre les sismes comme de nombreuses statues dans

86. Cf. C. Saliou, Statues dAntioche de Syrie dans la Chronographie de


Malalas, dans Recherches, p. 69-95 : p. 72.
87. La rfrence Flicianus, premier comte dOrient en 335, est
extrmement douteuse, mme si lon connat un Felicianus consul en
337 (cf. T. D. Barnes, The New Empire of Diocletian and Constantine,
Cambridge Mass, 1982, p. 142 ; E. Jeffreys, Chronological structures
in the chronicle, dans Studies, p. 161).
88. B. Croke, Malalaslife, dans Studies, p. 1-25 : p. 10-11.

AnTard , 22, 2014

la Chronique de Malalas89 et la transforme en une statue


de Constantin. Lexistence dune statue de Constantin
Antioche nest certes pas douteuse90, mais lpisode
en lui-mme na aucune raison dtre authentique. Sa
fonction est de marquer le dbut de la dpaganisation du
paysage urbain antiochen, dans une perspective apologtique dun point de vue chrtien, mais peut-tre aussi
dans une perspective polmique et critique du point de
vue des tenants des religions traditionnelles, puisque la
suite de lhistoire de la ville, marque par une srie de
tremblements de terre dvastateurs, montre quelle avait
bien besoin dune protection contre les sismes.
Les autres oprations dilitaires mentionnes par
Malalas sont lies la nomination du premier comte
dOrient, associe la transformation du sanctuaire
des Muses en prtoire. Malalas attribue de plus un
SUpIHW GX SUpWRLUH QRPPp 5XQRV OD VXEVWLWXWLRQ GXQH
basilique portant son nom un sanctuaire dHerms.
Or daprs Libanios le culte dHerms tait encore
clbr Antioche au temps de Julien91. De fait, comme
le soulignait dj Gl. Downey92, on ne connat pas par
DLOOHXUV GH 5XQRV SUpIHW GX SUpWRLUH VRXV OH UqJQH GH
Constantin93PDLVRQVDLWTXH5XQRV94, prfet du prtoire
G2ULHQW VRXV 7KpRGRVH , W FRQVWUXLUH HQWUH  HW
 XQH  95 Antioche96. Malalas commet
GRQF XQ DQDFKURQLVPH /D  EDVLOLTXH  GH 5XQRV HVW
mentionne plusieurs reprises dans les rcits relatifs
lhistoire de la ville. vagre, qui crit lextrme
Q GX e sicle, rappelle, parmi dautres constructions attribues des hauts fonctionnaires du rgne de
Thodose II, la construction par Zolos, dun portique
UR\DO  FHVWjGLUH GXQH  IODQTXDQW OH F{Wp

89. A. Mofatt, A record of public buildings and monuments, dans Studies,


p. 87-109 : p. 107-108.
90. La mention de linscription Bono Constantino pourrait correspondre
la transcription tronque dune inscription latine de lpoque
constantinienne comportant la formule bono rei publicae (sur ce
type dinscription, cf. Y. Maligorne, Bono reipublicae natus : une
louange impriale sur quelques monuments de lAntiquit tardive
( propos dune inscription de Lancieux : CIL, XIII, 8994 = XVII-2,
420a), dans Revue archologique de lOuest, 25, 2010, p. 291-304,
mais il sagit plus probablement dune citation lgrement dforme
dune formule dacclamation dorigine latine transcrite en grec dont
lusage est attest au e s. en Orient ; Malalas ou sa source aurait soit
invent une inscription dans le style de son temps soit lu une inscription
(ou un JUDIWWR) trace en au e ou au e s. sur la base de la statue (cf.
D. Feissel, Bulletin pigraphique, dans RG, 119, 2006, no 529, p. 749750, avec les rfrences aux sources).
91. Cf. Libanios, Or. XV, 79.
92. Downey, Antioch, p. 651-653.
  SURSRV GH9HWWLXV 5XQXV YRLU OD PLVH DX SRLQW GH 3 3RUHQD Le
origini della prefettura del pretorio tardoantica, Rome, 2003, p. 356-371.
94. Cf. PLRE ,)ODYLDQXV5XQXV
95. Sur cette priphrase, cf. C. Saliou, Dire lespace basilical, de
Vitruve aux gens de Nabha, paratre dans les actes du colloque Dire
larchitecture (Aix-en-Provence, 2010).
96. Downey, Antioch, p. 433-434. Cf. Zosime, Histoire nouvelle V, 2, 8.

AnTa rd , 2 2 , 2 0 1 4

ANTIOCHE SUR LORONTE, LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE

VXG GH FHOOH GH 5XQRV97. Sous le rgne dAnastase,


OD  EDVLOLTXH  GH 5XQRV IXW LQFHQGLpH ORUV GXQH
meute, on apprend cette occasion quelle jouxtait le
prtoire du comte dOrient, puisque le feu allum par les
meutiers se communiqua de la basilique au prtoire98.
Anastase la reconstruisit99. Dans le rcit par Malalas de
la campagne de reconstruction conscutive au sisme de
ODEDVLOLTXHGH5XQRVHVWPHQWLRQQpHFRPPH
un point de repre permettent de localiser lglise de
la Thotokos100. Quelles que soient sa forme architecturale exacte et les fonctions quelle pouvait assurer101,
ODEDVLOLTXHGH5XQRVpWDLWXQpGLFHLPSRUWDQWGH
la ville de lAntiquit tardive, troitement li au prtoire
du comte dOrient. Lanachronisme commis par Malalas
ou sa source remplit au moins deux fonctions : la plus
obvie est dattribuer le dbut du processus de dpaganisation de lespace urbain antiochen au rgne du premier
empereur chrtien, en ce sens lpisode est cohrent avec
celui de la fonte de la statue de Posidon ; il sagit aussi de
faire remonter cette poque et la cration des diocses
lorigine dun des principaux monuments dAntioche
aux e-e sicles, troitement li au prtoire du comte
G2ULHQW /D  EDVLOLTXH GH 5XQRV  HVW PHQWLRQQpH
deux fois, dans chacune des deux parties du passage : on
aimerait pouvoir dterminer si cette rptition montre que
OpGLFHJXUDLWGDQVOHVGHX[VRXUFHVGLVWLQFWHVXWLOLVpHV
notre sens par Malalas, ce qui soulignerait limportance
GH OpGLFH GDQV OD SHUFHSWLRQ GH OHVSDFH XUEDLQ RX VL
elle est le fait du compilateur, dans un effort de mise en
cohrence de son propre rcit.
Le rcit de Malalas, tout entach danachronismes et
FKDUJp GH FWLRQV TXLO VRLW WpPRLJQH GH OD IDoRQ GRQW
certains lments de lespace urbain antiochen ont pu
porter la mmoire de Constantin et de lpoque constantinienne au moins jusquau dbut du rgne de Justinien.
Eusbe signalait dj que la dcision de construire
lglise dOr marquait la reconnaissance par Constantin
de la position minente de la ville dans le cadre de la
nouvelle organisation de lempire en diocses. Le rcit
de Malalas met en vidence limportance aux yeux des
Antiochens du statut de capitale supra-provinciale que
leur a valu la cration des diocses et du prestige supplmentaire quils pouvaient tirer du titre de comte dOrient

97. vagre, HE I, 18. Les traducteurs de la collection SC crivent


Portique royal , ce qui implique quil sagit du nom propre de
OpGLFH SC 542, p. 184). Il faut prfrer sur ce point la traduction
de M. Whitby (The Ecclesiastical History of Evagrius Scholasticus,
Liverpool, 2000, p. 45) qui rend la priphrase par le mot basilica.
98. Malalas, XVI, 6, p. 325 l. 10-17 Thurn.
99. Malalas, XVI, 8, p. 325, l. 30-31 Thurn.
100. Malalas, XVII, 19, p. 351, l. 49-51 Thurn.
/HPRWHVWSRO\VpPLTXHHWSHXWVDSSOLTXHUjXQpGLFH
de plan basilical ou un simple portique. Cf. Gl. Downey, The
DUFKLWHFWXUDOVLJQLFDQFHRIWKHXVHRIWKHZRUGVVWRDDQGEDVLOLNHLQ
Classical Literature, dans AJA, 41, 1937, p. 194-211.

133

port par le reprsentant du pouvoir imprial. cet gard


la Grande glise apparat comme un lment au sein dun
ensemble progressivement constitu, comportant une
statue et son inscription, le prtoire du comte dOrient
et une basilique associe topographiquement ce
prtoire et, au prix dun anachronisme, narrativement au
rgne de Constantin.
La Grande glise de Constantin fut dtruite lors
du tremblement de terre de 526. Dans la Chronique du
pseudo-Zacharie est mentionne la ddicace, aprs
sa reconstruction par lvque Ephrem, dune glise
dsigne comme the church that is rounded in face 102.
Cette pithte est la traduction littrale de lpithte
VSKpURwGHTXLJXUHGDQVOD&KURQLTXHGH7KpRSKDQH
Elle peut tre simplement descriptive, ou avoir une valeur
GpWHUPLQDWLYHHWVHUYLUDORUVjLGHQWLHUXQHpJOLVHSUpFLVH
(QFHGHUQLHUFDVLOIDXWLGHQWLHUOpJOLVHUHFRQVWUXLWHSDU
(SKUHP j OpJOLVH pGLpH j OLQLWLDWLYH GH &RQVWDQWLQ103,
ce qui nexclut pas au reste que cette dsignation ne lui
ait t donne quaprs sa reconstruction, puisquelle
nest connue que par des sources elles-mmes postrieures cette reconstruction104. Cette glise assure en
tout cas la fonction dglise principale de la ville, elle
est ce titre susceptible dtre dsigne comme la trs
sainte glise105 , voire comme lglise par excellence,
VDQVDXWUHTXDOLFDWLI106/HTXDOLFDWLIGHVSKpURwGH
suppose quant lui une couverture en coupole107. De fait,
propos de la trs sainte glise dEphrem, vagre
PHQWLRQQH XQ  FHVWjGLUH XQH FRXSROH108.
Cette glise, en usage durant tout le e sicle, aprs la
reconstruction de la ville par Justinien, devait donc se
trouver dans les limites de lenceinte de Justinien (J),
cest--dire en rive gauche. Le tmoignage de Procope
WHQG j FRQUPHU FHWWH FRQFOXVLRQ SXLVTXH OKLVWRULHQ
indique que Chosros descendit de la Citadelle, sur la
montagne dAntioche, pour parvenir lglise, mais non

102. Ps. Zach. X, 5a, cf. G. Greatrex (dir.), The Chronicle of PseudoZachariah Rhetor: Church and War in Late Antiquity, Liverpool
(Royaume-Uni), 2011, p. 412-413. Cf. Michel le Syrien, IX, 24,
trad. Chabot, 2, Paris, 1901, p. 207.
103. Contra Mayer, Allen, Churches, p. 74-75. Une tude philologique
prcise des sources en langue syriaque devrait permettre de trancher
la question.
104. Cf. supra, n. 17.
105.vagre, HE9,
106. Au e s., Procope remarque que glise est le nom propre dun des
lieux de culte antiochens (Bell.,, >&KRVURqV@
 &KRVURqVGHVFHQGLW
de la citadelle vers le lieu de culte que lon appelle glise ), cf. ibid.
9, 17 ; 10, 6 ; vagre le Scholastique, HE IV, 25, daprs Procope.
107. Cf. supra, n. 56.
108. vagre, HE VI, 8. vagre voque dans ce passage lutilisation de
bois, pour tayer la construction, mais peut-tre aussi dans la mise en
XYUH GH OD FRXSROH HOOHPrPH 6XU OHV GLIFXOWpV GLQWHUSUpWDWLRQ
de ce passage, cf. M. Whitby, The Ecclesiastical History of Evagrius
Scholasticus, Liverpool, 2000, p. 298-299 et note 29.

134

CATHERINE SALIOU

quil franchit lOronte109. La reconstruction de lglise


a t suivie dune nouvelle ddicace, qui a peut-tre
FRUUHVSRQGXjODFROODWLRQGXQRXYHDXQRPGH
 3pQLWHQFH  (Q HIIHW FH QRP TXL JXUH GDQV ODVie
JUHFTXHGH6\PpRQ6W\OLWHO$QFLHQSRVWpULHXUHjODQGX
e et peut-tre mme au dbut du e sicle110, nest attest
notre connaissance par aucune source plus ancienne, en
sorte que lon peut se demander sil ne sagit pas dun
anachronisme de la part du rdacteur de la Vie : le nom
de Pnitence pourrait tre celui que portait lglise
reconstruite par Ephrem111. Une ddicace est un bon
moment pour le choix dun nouvelle dsignation et un tel

AnTard , 22, 2014

nom, pour une glise reconstruite aprs un sisme, serait


cohrent avec linterprtation des catastrophes subies
par Antioche en termes de chtiment divin pour idoltrie
attestes par ailleurs112. De fait, cest aprs le sisme de
528, et sous lpiscopat dEphrem, que la dcision fut
prise de changer le nom de la ville en Thoupolis, celui
dAntioche ayant le tort de conserver la mmoire dun
souverain paen113. Quoi quil en soit, mme si lglise
reconstruite par Ephrem tait bien celle quavait fonde
Constantin, sa nouvelle ddicace avait d lui confrer une
nouvelle identit et contribuer ainsi oblitrer quelque
peu Antioche la mmoire du premier empereur chrtien.
Univerit Paris 8 / EPHE

109. Procope, Bell. II, 9, 14 (cit supra, n. 106).


110. Cf. Mayer, Allen, Churches, p. 106.
111. J. Gascou, dans un article fondateur consacr lonomastique
ecclsiale, a rassembl plusieurs exemples tendant montrer que les
noms propres renvoyant des abstractions sont un trait archaque, et
que ces dsignations, au e s., ntaient plus comprises pour ce quelles
taient (J. Gascou, Notes donomastique ecclsiale ancienne, dans ZPE,
96, 1993, p. 135- 140 : p. 138-139). Certaines de ces dsignations,
toutefois, ne sont attestes qu une poque relativement tardive ( Paix
et Bndiction Arsino en 477, Madame et Lumineuse ou
Madame et Lumineuse Hermopolis en 498, Anastasia
Hermopolis partir de 493), ce qui peut bien tre videmment le rsultat
du hasard des sources, et le nom de Sophie pour la Grande glise de
Constantinople nest devenu courant quau e s. (ibid.). Il faut aussi faire
la part dventuelles diffrenciations rgionales : il nest pas impossible
quune pratique onomastique devenue dsute Constantinople soit
toujours vivante ou susceptible dtre remise en vigueur Antioche.

 /DWWDFKHPHQW DX SDJDQLVPH GHV$QWLRFKpHQV MXVWLH OD SULVH GH OD
ville par les Perses dans la Vie ancienne de Symon Stylite le Jeune
(P. Van den Ven, La Vie ancienne de s. Symon Stylite le Jeune : 521-592,
%UX[HOOHV /DVVRFLDWLRQGXQRPjXQHYRORQWp
de conversion est atteste par lexemple du monastre pachmien de
Canope qui, install lemplacement de sanctuaires paens dans un
faubourg dAlexandrie la rputation sulfureuse, portait prcisemnt ce
nom, attest pour la premire fois son propos en 404 (cf. J. Gascou, Le
monastre de la mtanoia, disponible en ligne : http://halshs.archivesouvertes.fr/halshs-00001111/en/ [dernire consultation le 8 mai 2014]).
113. Downey, Antioch, p. 529-530.

AnTa rd , 2 2 , 2 0 1 4

ANTIOCHE SUR LORONTE, LGLISE DE CONSTANTIN ENTRE HISTOIRE ET MMOIRE

135

1- Les deux descriptions de lglise constantinienne


dAntioche par Eusbe

Les termes identiques dans les deux descriptions sont en gras.

Eusbe de Csare, Triakontaetrikos IX, 14-15, GCS 7,


p. 200-221

Eusbe de Csare, Vita Constantini III, 50, 1-2

. [Constantin faisait surgir


des glises], parant la ville
qui porte son nom de diverses
glises de Dieu, honorant la
capitale de la Bithynie dune
trs grande et trs splendide
glise,








 Tels sont les monuments


dont il embellit sa ville. Et il
honora de mme la capitale
de la Bithynie de loffrande
dune immense et admirable
glise []

1




[]

il ornait des mmes (genres


GpGLFHV OHVFLWpVOHV
plus puissantes des autres
provinces





 Et il mettait en valeur les


cits les plus puissantes des
autres provinces grce aux
beauts des oratoires (quil
construisait),







Ayant distingu deux


parties minentes de lOrient,
lun dans la province de
Palestine,




 

lautre dans la mtropole


orientale qui honore
lappellation tire du nom
dAntiochos, dans cette
dernire, parce quelle est la
tte de toutes les provinces de
la rgion,








comme dans la mtropole


orientale laquelle est chue
lappellation tire du nom
dAntiochos : dans cette
dernire, puisquelle est
la tte des provinces de la
rgion,


,




il consacrait une chose divine


et singulire, par sa taille et
sa beaut





il consacrait une glise qui


tait une chose singulire par
sa taille et sa beaut



,

lextrieur, entourant
lensemble du temple par de
longs priboles,



,

lextrieur, aprs avoir


entour lensemble du temple
par de longs priboles,





lintrieur, levant la
demeure du Seigneur une
hauteur prodigieuse en une
JXUHjKXLWSDQVLOORUQDLW
dun dcor chatoyant,


,



lintrieur, aprs avoir lev


une hauteur prodigieuse le
lieu de prire, formant une
JXUHjKXLWSDQV




,

et layant enveloppe circulairement de pices fort


nombreuses et dexdres, il la
couronnait de toutes sortes de
beauts.





.

envelopp circulairement
despaces, ltage et au sol,
de tous cts, quil couronnait
aussi dune abondance dor
en grande quantit, de bronze
et aussi de toutes les autres
sortes de matriaux luxueux.








.

136

CATHERINE SALIOU

AnTard , 22, 2014

2- Constantin et Antioche dans le rcit de Malalas


Des alinas ont t introduits pour faciliter la lisibilit de lensemble.

Malalas XIII, 3-4 p. 244 l. 33-p. 245, l. 62 Thurn


 
      


        

        

       



        

          
      





>&RQVWDQWLQ@YLQWj$QWLRFKHOD*UDQGHHWLO\WFRQVWUXLUHOD
Grande glise, gigantesque construction, aprs avoir fait abattre
le bain dit du souverain Philippe : il sagissait en effet dun bain
DQFLHQ HW GpWUXLW SDU OH WHPSV HW TXL QH IRQFWLRQQDLW SOXV ,O W
construire dautre part un hospice proximit.
'HPrPHDXVVLLOWFRQVWUXLUHODEDVLOLTXHGLWHGH5XQRV&pWDLWHQ
HIIHWXQVDQFWXDLUHG+HUPqVHW5XQRVSUpIHWGHVVDFUpVSUpWRLUHV
OHWDEDWWUH$ORUVTXLOpWDLWSDUWLFRPEDWWUHDYHFOHVRXYHUDLQLOOXL
fut demand par ce dernier de rester Antioche et il acheva cette
mme basilique, alors que le souverain sen retournait Rome.
Alors que le souverain Constantin sapprtait quitter Antioche,
LO W SRXU OD SUHPLqUH IRLV JRXYHUQHXU G$QWLRFKH GH 6\ULH XQ
chrtien du nom de Ploutarchos. Ce dernier reut lordre de suivre
les travaux de construction de lglise et de la basilique.
Ce mme Ploutarchos, ayant trouv pendant la construction de
lhospice la statue de bronze de Posidon qui avait t rige comme
WDOLVPDQDQTXHODYLOOHQHVXELVVHSDVOHVHIIHWVGHVWUHPEOHPHQWVGH
WHUUHOD\DQWIDLWHQOHYHUODWIRQGUHHWHQWXQHVWDWXHHQOKRQQHXU
du souverain Constantin, la faisant riger lextrieur de son prtoire
et faisant crire au-dessous delle : Bono Constantino . Cette
statue de bronze se dresse encore de nos jours.


       
        

      

 Le mme souverain promut pour la premire fois dans la mme


grande cit des Antiochens sous le consulat dIllos et Albinos,
en faisant pour lui du sanctuaire des Muses un prtoire, un comte
dOrient jouant en Orient le rle du prfet des prtoires, un chrtien
du nom de Flicianus, faisant grcieusement don cette cit des

      
        


      
         

      
      


Antiochens, par sa divine dcision, de la dignit dun second


comitatus, lan 383 de la grande cit des Antiochens.
En effet auparavant il ny avait pas de comte dOrient en rsidence
Antioche la Grande, mais quand la guerre commenait un
delegatorVLQVWDOODLWj$QWLRFKHHWTXDQGODJXHUUHSUHQDLWQOH
delegator tait dgag de cette fonction.
Le souverain Constantin quitta Antioche, en y laissant le prfet
5XQRV FH 5XQRV TXL DFKHYD DYHF ]qOH OD EDVLOLTXH  HW FHVW
SRXUTXRLHOOHIXWDSSHOpHGH5XQRV

AnTard , 22, 2014, p. 137- 142


DOI 10.1484/J.AT.5.103183

EUSBE DE CSARE FACE AUX IMAGES :


VERS UNE INTERPRTATION PLUS POSITIVE
ET MOINS INCERTAINE DE SES ATTITUDES ?
-3&

Eusebius of Caesarea and the images:


toward a more positive and less uncertain interpretation of his views?
We here confront the contradictory opinions more or less recently expressed about Eusebiusattitudes
toward images, as attested in several of his texts. Even if it is necessary to be cautious in such matters
given the impossibility of producing any true proof , it appears, firstly, that the Letter to Constantia may
probably be held as an authentic Eusebian testimony, and that some figurative works of art elsewhere mentioned by the Caesarean bishop (mainly at Constantinople and Paneas) certainly were of genuine Christian
character; and, secondly, that if Eusebius clearly manifests an opposition to the concept of the portrayal of
the Divine Being, his position about allegorical or narrative representations might have been more tolerant
and even favourable. [Author]

Le prsent dossier offre une excellente occasion de


tenter une mise au point sur deux aspects videmment
cruciaux quant au dveloppement de limagerie aux
premires dcennies suivant la promulgation de ldit
de tolrance de 313 ; et cela en impliquant directement
lune des deux personnalits, et dans un cas au moins
lautre, autour desquelles gravitent les contributions ici
rassembles : il sagit en effet de revenir sur les attitudes
et options dEusbe et par contrecoup, avec une ralisation dans la nouvelle capitale, de Constantin lgard
GH UHSUpVHQWDWLRQV JXUpHV GH QDWXUH FKUpWLHQQH 3RXU
Eusbe, il en est fait tat de faon purement thorique dans
la fameuse Lettre Constantia, dont nous traiterons en
premier lieu. Nous en viendrons ensuite dautres crits
de lvque de Csare, dans lesquels il mentionne des
uvres quil a pu voir ou dont il a, du moins, eu connaissance ; lune delles, prcisment, aurait t commandite
par lempereur. Certaines publications plus ou moins
rcentes, dans lesquelles sont exprimes des opinions
tout fait divergentes, montrent que linterprtation de
ces textes est encore trs dbattue. Nous ne prtendons
FHUWHVSDVUpXVVLUjWUDQFKHUGHIDoRQGpQLWLYHFDUWURS
de donnes font aujourdhui dfaut, quant lexacte

situation dans les milieux considrs ; et linterprtation


de ce qui nous est parvenu ne peut sabstraire dune part
aussi rduite soit-elle de subjectivit. Nanmoins, la
confrontation des points de vue sera susceptible, nous
lesprons, dapporter quelque clart.
La Lettre Constantia
Rappelons dabord que le contenu de cette Lettre ne
nous a t transmis que trs indirectement, par la citation
de vingt-et-un fragments de longueur ingale dans des
documents mdiobyzantins. Il sagit dune part des actes
du concile tenu en 787 Nice pour le rtablissement de la
lgitimit des images chrtiennes : on visait alors rfuter
ce que les iconoclastes runis Hireia en 754 avaient
tir de ce mme crit, prsent comme manant dEusbe
de Csare, lappui de leurs positions. Cest ensuite le
patriarche Nicphore qui y revient aux deux premires
dcennies du e sicle, pour combattre les iconoclastes
alors en train de reprendre lavantage. La dernire publication de lensemble des fragments en question, avec
renvois prcis aux sources mdiobyzantines pour chacun

138

JEAN-PIERRE CAILLET

deux, introduction et traduction allemande, est due


Annette von Stockhausen1.
Quant la teneur de ce texte, rsumons-la aussi trs
brivement. Sollicit par Constantia, sur de Constantin,
pour quil lui procure une image du Christ, Eusbe
sy refuse sur la base de largumentation suivante : il
distingue dabord limage prexistante du Christ divin et
celle sous laspect d esclave quil a endosse aprs
lincarnation ; il considre que cest un spcimen de cette
dernire que lui demande la princesse ; mais une telle
image ne saurait convenir, dans la mesure o la divinit na
cess dinvestir le Sauveur durant son existence terrestre
(comme cela se trouve clairement tabli lors de lpisode
GH OD 7UDQVJXUDWLRQ   (XVqEH VH IRQGH pJDOHPHQW VXU
linterdit biblique et sa ncessaire observance ; et il
GpFODUH TXLO D GDLOOHXUV OXLPrPH G FRQVTXHU j XQH
IHPPHGHVSHLQWXUHVVXSSRVpHVJXUHU3DXOHWOH&KULVW
DQ GH OXL pYLWHU GrWUH DFFXVpH GLGROkWULH  LO DMRXWH
encore que ce sont les hrtiques (Simon le Mage, Mans)
qui ont lusage de dpeindre et de vnrer les portraits
des fondateurs de leur secte ; les chrtiens, au contraire,
doivent sen tenir une vnration purement spirituelle.
Les principaux recueils de textes relatifs lart palochrtien et protobyzantin nont donc pas manqu pas de
produire ce document au titre des principales manifestations dhostilit envers une imagerie teneur chrtienne2.
Et, dans le cadre dun ouvrage de porte diachronique
beaucoup plus large sur les positions de lglise ce
sujet, Daniele Menozzi3 la galement utilis, non sans se
dpartir dun minimum de rserve mais en faisant valoir
que, somme toute, cet crit tait gnralement rput
authentique , et manait bien de lvque de Csare.
De srieux doutes ont toutefois t mis lencontre
de cette vue. Ainsi notamment, Charles Murray4 puis Knut
Schferdick5 et Stephen Bigham6 ont relev que liconoSKRELHDIFKpHGDQVFHWWHLettre contrastait fcheusement
avec les positions moins ngatives adoptes par Eusbe
dans les autres textes que nous voquions ici en intro-

1.A. von Stockhausen, Epistula ad Constantiam Augustam, dans


T. Krannich, Chr. Schubert, Cl. Sode, A. von Stockhausen, Die
ikonoklastische Synode von Hiereia 754, Tbingen, 2002, p. 92-96
(remarques introductives), 97-105 (texte grec avec renvois aux sources
des e-e sicles ainsi quaux parallles chez Eusbe mme), 106-112
(traduction allemande) et 113-121 (bibliographie).
2. Cf. notamment C. Mango, The Art of the Byzantine Empire 312-1453,
Toronto / Buffalo / Londres, 1972 (et rimpr. 1986), p. 4 et 16-18.
3. D. Menozzi, Les images. Lglise et les arts visuels, Paris, 1991,
p. 69-72.
4. Ch. Murray, Art and the Early Church, dans Journal of Theological
Studies, n.s. 28, 1977, en particulier p. 326-336.
5. K. Schferdick, Zur Verfasserschaft und Situation der Epistula ad
Constantiam de imagine Christi, dans Zeitschrift fr Kirchengeschichte,
91, 1980, p. 177-186.
6. St. Bigham, Les chrtiens et les images : les attitudes envers lart
dans lglise ancienne, Montral, 1992, et d. angl. Early Christian
Attitudes toward Images, Rollingsford N.H., 2004, p. 206 s.

AnTard , 22, 2014

duction : do son ncessaire retrait du corpus littraire de


lvque de Csare.
La seconde attaque majeure est venue de Claudia
Sode et Paul Speck7, et relve dune prise en compte
trs dtaille du contenu du document. Pour lessentiel,
les deux auteurs concluent quaussi bien les conciliaires
nicens que Nicphore ont raisonn sur des versions
diversement altres dun texte dont loriginal peut-tre
un faux compos pour le concile dHireia de 754 ? ne
peut aujourdhui tre reconstitu ; ils observent dautre
part que lesprit de ces versions saccorde mal aux
conceptions dEusbe et de son temps, mais correspond
en revanche parfaitement au dbat entre iconoclastes et
iconophiles de lOrient haut-mdival (ainsi par exemple,
le fait que le Christ ait, aprs lincarnation galement,
pleinement conserv sa nature divine, sest trouv au
cur de la thmatique du concile dHireia).
Cest largumentation de Stephen Gero8 que nous
devons prsent voquer au premier chef en faveur
de lauthenticit du document. Selon cet auteur, la
Lettre prsente en effet des traits bien caractristiques
de la production dEusbe : ainsi, la tendance assez
marque un archasme atticisant, des singularits de
vocabulaire comme (notamment) lemploi du verbe
 GHV SURFpGpV UKpWRULTXHV FRPPH OH
frquent recours des interrogations et aux synonymes,
ou linterposition du verbe entre le nom et les adjectifs
ou pronoms qui lui sont lis ; des formulations telles
TXH     RX    VDYqUHQW DXVVL
DVVH] SURSUHV j (XVqEH XQH YpULFDWLRQ GH WRXW FHOD D
dailleurs t opre par Annette von Stockhausen dans
sa nouvelle dition de la Lettre Constantia). Mais
Stephen Gero sappuie galement sur les concordances
thologiques entre le contenu de la Lettre et ce que lon
sait par ailleurs des conceptions eusbiennes ; et dj, en
particulier, la notion suivant laquelle le corps humain du
Christ incarn a galement t investi par sa divinit (soit
ce que Claudia Sode et Paul Speck entendent surtout faire
endosser par les iconoclastes du e sicle, comme nous
venons de le rappeler) ; ou encore, lvocation de lincarQDWLRQGX9HUEHDQGHWLUHUOKXPDQLWpGXSpFKpLQGXLW
par le dmon. Stephen Gero a dailleurs pu renvoyer ce
quavait bien auparavant not Hans von Campenhausen9
quant la convergence de la teneur de la Lettre et de la
christologie eusbienne.

7. Cl. Sode, P. Speck, Ikonoklasmus vor der Zeit?, dans Jahrbuch fr


sterreichische Byzantinistik, 54, 2004, p. 113-134.
8. St. Gero, The true image of Christ: Eusebius Letter to Constantia
reconsidered, dans Journal of Theological Studies, n.s. 32, 1981,
p. 460-470.
9. H. von Campenhausen, Tradition und Leben, Krfte der Kirchengeschichte. Aufstze und Vortrge, Tbingen, 1960, et d. angl. Tradition
and Life in the Church, Londres, 1968, p. 171-200.

AnTa rd , 2 2 , 2 0 1 4

Revenant quant elle sur lincompatibilit suppose


du contenu de la Lettre avec les autres crits eusbiens,
Annette von Stockhausen10 attire lattention sur ce que
dclare notre vque dans le livre III de sa Prparation
vanglique, inopportunment nglig sous cet aspect :
sy trouve bien pose galement, en effet, limpossibilit
de vraiment reprsenter ltre divin par une image au
sens o on lentend ordinaire. Et il ressort de ce texte,
tout comme de la Lettre, que la production dimages de
divinits est une attitude rsolument paenne.
Chiara Bordino11 sest elle aussi rcemment dclare
en faveur de lauthenticit du document. Cela dabord
comme Annette von Stockhausen, dailleurs sur la
base de largumentation de Stephen Gero. Puis, quant la
discordance lgard des autres passages eusbiens, elle
relve bon droit quil nest pas vritablement contradictoire de sopposer lide dun portrait du Verbe
incarn en tant que tel et de manifester une attitude plus
tolrante envers des reprsentations de caractre narratif
ou allgorique. Dans un tout autre registre, elle ajoute un
lment non ngligeable en faisant observer que, dans les
DFWHV GX FRQFLOH GH  &RQVWDQWLD VH WURXYH TXDOLpH
d pouse de Licinius ; ce qui correspond en effet la
ralit, puisque la sur de Constantin avait bien t unie
au co-empereur rgnant jusquen 324 ; mais ce sur quoi les
conciliaires de 787, dont le but tait de prsenter comme
parfaitement lgitime la requte de lAugusta, navaient
nul intrt insister puisque Licinius tait de longue
date compt au nombre des ennemis de la foi chrtienne.
Largument nest incontestablement pas dpourvu de
poids, et Chiara Bordino en a donc assez logiquement
dduit que les conciliaires de 787 avaient bien pu avoir
accs loriginal eusbien et en reprendre les termes tels
quels : car si la lettre a t rdige peu aprs 313 (ou avant
324, du moins), Eusbe na pu juger incongru dvoquer
cette union Licinius ntant encore, en ces annes
dentente avec Constantin, nullement frapp danathme.
Il demeure toutefois un point susceptible de poser
problme, selon Chiara Bordino elle-mme : il sagit,
dans le cas de lauthenticit de la Lettre, dune mise en
rapport assez insolitement prcoce, alors, de la reprVHQWDWLRQ JXUpH GX &KULVW DYHF OH GpEDW VXU VHV GHX[
QDWXUHVGpEDWTXLQHGHYDLWGRQQHUOLHXjXQHGpQLWLRQ
vraiment claire que lors de la tenue des deux grands
conciles dphse (431) et de Chalcdoine (451). Chiara
Bordino12 fait valoir que quelques autres tmoignages
vont pourtant bien dans ce mme sens : elle renvoie ainsi

10. A. von Stockhausen, Epistula ad Constantiam, cit. (n. 1), p. 93-96.


11. Ch. Bordino, I Padri della Chiesa e le immagini, thse de doctorat,
Universit della Tuscia (dir. M. Andaloro), 2010 [http://hdl.handle.
net/2067/1027], 1, p. 94-106.
12. Ibidem, 1, p. 124-126.

EUSBE DE CSARE FACE AUX IMAGES

139

des critsde Grgoire le Thaumaturge13 et dpiphane


de Salamine14, lun favorable et lautre hostile aux
images, mais tous deux liant dj aussi implicitement,
GX PRLQV  OH SUREOqPH GH OD JXUDWLRQ GX &KULVW j VD
double nature. Elle reconnat cependant quil ne peut tre
exclu que les passages grgoriens en question, transmis de
manire indirecte, nmanent dun milieu iconophile trs
postrieur. Et pour ce qui est dpiphane, relevons que, si
sa prise de position se situe certes encore au e sicle, elle
est bien plus tardive que celle suppose dEusbe avant
324 ; et ce titre donc, plus mme davoir constitu une
relle anticipation de ce qui devait tre dbattu lors des
grands conciles du e sicle.
Cette dernire rserve tant mise, il nous semble
cependant quau stade actuel, le poids des arguments
en faveur de lauthenticit demeure prdominant.
Lincompatibilit entre lesprit de la Lettre et les autres
passages eusbiens savre moindre, on la vu, quil ny
paraissait de prime abord. Et si Claudia Sode et Paul Speck
nont videmment pas ignor largumentation de leurs
devanciers celle de Stephen Gero notamment , notons
quils sen sont affranchis en quelques mots seulement,
se contentant de dclarer que tout faussaire pouvait avoir
tir de divers autres crits dEusbe ses traits de langage
VSpFLTXHVFHTXLRQHQFRQYLHQGUDVDQVGRXWHFRQVWLWXH
un raccourci plutt abrupt lgard de tout ce qui a pu
tre produit par ailleurs
Les autres images mentionnes par Eusbe
Mambr
Nous passerons dabord trs rapidement sur ce dont fait
tat Eusbe dans sa Dmonstration vanglique (V, 9) :
savoir, une composition picturale sur le site de Mambr,
qui reprsentait manifestement la vision dAbraham relate
dans la Gense (XVIII, 1-8). Cela sous la forme de trois
anges au milieu desquels se serait intercale, aux dires
G(XVqEH OXLPrPH OD JXUH GX 6HLJQHXU ,O IDXW VXUWRXW
bien noter l, et en plein accord avec Chiara Bordino15
pour ce qui relve des compositions bibliques caractre
narratif, quaucune connotation ngative naffecte cette
vocation dans le texte de la Dmonstration.

13. Il sagit de deux fragments (interprtation du Livre de la Sagesse et


Horos SynodikoV FRQWHQXVGDQVOHRULOqJHGX&RGH[3DULVLQXV*U
Texte grec et traduction italienne dans Ch. Bordino, I Padri della Chiesa,
cit. (n. 11), 2, p. 137, nos 177-178 ; cf. galement A. Alexakis, Codex
Parisinus Graecus 1115 and its Archetype (Dumbarton Oaks Studies, 34),
Washington (D.C.), 1996, appendix II, p. 320-321, citations nos 49-50.
14. piphane, Trait contre ceux qui font les images. Texte grec et traduction
italienne in Ch. Bordino, I Padri della Chiesa, cit. (n. 11), 2, p. 119-121,
no 159 ; cf. galement P.J. Alexander, The Iconoclastic Council of St.
6RSKLD  DQGLWV'HQLWLRQ, dans DOP, 7, 1953, p. 63-64.
15. Ch. Bordino, I Padri della Chiesa, cit. (n. 11), 1, p. 98.

140

JEAN-PIERRE CAILLET

Constantinople
Nous nous arrterons davantage sur les mentions de
deux autres images qui, outre le problme de lattitude
dEusbe lgard de lune delles, ont pu faire lobjet
dune remise en cause de leur nature vritablement
chrtienne. Nous commencerons par le cas du groupe
statuaire en bronze dor associant le Bon Pasteur et Daniel
entre des lions dans lornementation de la fontaine dune
place publique de Constantinople le nouveau forum de
&RQVWDQWLQ   Vie de Constantin, VII,
49) ? Les premires dngations relatives lidentit
des personnages en question ont t mises par Charles
Picard16 puis Giovanni Becatti17, qui ont considr quil
GHYDLW SOXW{W VrWUH DJL GH JXUDWLRQV SDwHQQHV HW SOXV
prcisment dun groupe prsentant Orphe entre les
animaux, suivant une iconographie largement rpandue
dans le monde classique. Pour Giovanni Becatti, qui
suivait le texte eusbien la lettre, ce groupe orphique
aurait dailleurs occup le centre mme du nouveau
forum, la colonne de porphyre surmonte dune statue de
lempereur stant donc trouve quelque peu dporte ;
il sappuyait, pour cela, sur un dessin du e sicle de la
colonne dArcadius, montrant en effet le forum constantinien avec la colonne assez nettement dcentre. Mais
relevons tout de suite que ce dernier argument est de peu
de poids, dans la double mesure o le dessin en question
savre plutt approximatif et o il apparatrait fort
insolite que, contrairement tous usages, lon nait pas
UpVHUYp j OHIJLH LPSpULDOH OHPSODFHPHQW GKRQQHXU
Dautres auteurs, en revanche, ont accept lide dune
vritable reprsentation du Bon Pasteur : ainsi Johannes
Kollwitz18 puis Robert Grigg19, pour lesquels le caractre
SXUHPHQW DOOpJRULTXH GH FHWWH JXUH ODXUDLW UHQGXH
passible dune telle exposition publique ; de fait, le texte
HXVpELHQ GpVLJQH FHV VFXOSWXUHV SDU OH WHUPH 
Plus rcemment, Averil Cameron et Stuart G. Hall20 et,
leur suite, Franz Alto Bauer et Christian Witschel21, sont
revenus une position ngative, considrant sans trop sy
tendre, au demeurant que lon avait trs certainement
affaire des reprsentations paennes mal interprtes par

16. Ch. Picard, Sur lOrphe de la fontaine monumentale de Byblos, dans


Miscellanea G. de Jerphanion (Orientalia christiana periodica, 10),
Rome, 1947, p. 266-281.
17. G. Becatti, Costantinopoli, dans Enciclopedia dellarte antica, Rome,
1959, en particulier p. 889 ; Idem, La colonna coclide istoriata, Rome,
1960, p. 210-212.
18. J. Kollwitz, Zur Frhgeschichte der Bilderverehrung, dans Rmische
Quartalschrift fr christliche Altertumskunde und Kirchengeschichte,
48, 1953, p. 1-20.
19. R. Grigg, Constantine the Great and the Cult without Images, dans
Viator, 8, 1977, en particulier p. 6.
20. A. Cameron, St.G. Hall, Eusebius, Life of Constantine, translated
with introduction and commentary, Oxford, 1999, p. 298.
21. F.A. Bauer, Chr. Witschel, Statuen in der Sptantike, dans F.A. Bauer,
Chr. Witschel (dir.), Statuen in der Sptantike, Wiesbaden, 2007, p. 14.

AnTard , 22, 2014

(XVqEH (Q GHUQLHU OLHX HQQ OH GRVVLHU D pWp UpRXYHUW


par Teodoro Crespo Mas22, avec une argumentation alors
trs dveloppe. Aprs avoir expos de faon dtaille
les opinions prcdentes, il a fait valoir ce qui, selon lui,
induisait accorder plein crdit au propos dEusbe ; nous
en rsumons ci-aprs lessentiel.
Le premier point majeur est quil apparat impossible
quEusbe ait pu confondre une reprsentation dOrphe
avec lun des deux sujets dont fait tat le passage de la
Vie de ConstantinOHWKqPHJXUDWLIG2USKpHDYHFVHV
FDUDFWqUHVLFRQRJUDSKLTXHVELHQVSpFLTXHVpWDLWHQHIIHW
trop largement rpandu et connu depuis des sicles ; et
Teodoro Crespo Mas renvoie dailleurs fort pertinemment
un autre extrait de la Vie de Constantin (XIV, 5) dans
lequel lvque trace prcisment un parallle entre
le hros mythologique et le Christ, en soulignant bien que
le premier calme les animaux avec les accords de linstrument quil a en main, tandis que le second impartit
la paix aux mes humaines par la seule loi divine quil
dispense. Quant une confusion entre Orphe et Daniel,
elle ne savre pas plus vraisemblable dans la mesure o
mme en imaginant un Daniel vtu lorientale , si le
SUHPLHUHVWJXUpDVVLVHWIDLVDQWVRQQHUVDO\UHOHVHFRQG
est toujours debout et dans la position de lorant ; la
nature, la disposition et le nombre des animaux diffrent
aussi trs nettement, de lun lautre cas.
Teodoro Crespo Mas en vient ensuite aux raisons qui
ont pu induire Constantin lui-mme dployer les sujets
en question dans lespace public de sa nouvelle capitale.
Limage du Bon Pasteur aurait, selon lui, pu simposer au
souverain du fait de son analogie (dj releve par Ernst
Kitzinger23) avec Alexandre le Grand en tant que modle
du bon monarque ; en outre et bien plus dcisivement sans
doute, notre sens , loption de faire riger cette statue
a pu tre suscite par ce que dclarait Eusbe propos
de lempereur chrtien, et dont il fait trs exactement
tat dans son loge de celui-ci (Vie de Constantin, II, 5) :
cest--dire, lexaltation de Constantin comme pasteur de
Dieu qui, au lieu dimmoler les animaux suivant lancien
usage, guide les mes vers la connaissance du Seigneur
et la vraie foi. Pour Daniel dautre part, et au-del de
limage paradigmatique dun salut imparti par laction
divine, Teodoro Crespo Mas envisage une dimension
vritablement politique. Il rappelle en effet que le livre
de Daniel (II, 37-45, et VII, 19-28) contient les prophties
relatives la succession des empires, aboutissant au rgne

22. T. Crespo Mas, Constantino el grande y Daniel el Profeta. Problemas


GHLFRQRJUDDHLGHRORJLDHQOD&RQVWDQWLQRSODFRQVWDQWLQLDQD, dans
Lucentum, 27, 2008, p. 87-99. Nos remerciements Isabelle Mathian,
qui nous a indiqu cet article.
23. T. Crespo Mas renvoie l lune des Princeton Lectures dlivres
par E. Kitzinger et dont la teneur a t reprise par W.D. Wixom, Early
Christian sculptures at Cleveland, dans Bulletin of the Cleveland
Museum of Art, 50, 1967, p. 88.

AnTa rd , 2 2 , 2 0 1 4

ternel de Dieu ; et l encore, il relve le fait que dans


la Vie de Constantin (III, 2), Eusbe associe la souveUDLQHWp GH FHOXLFL HW GH VHV OV j XQH SKUDVH WLUpH GX
livre de Daniel ( et les saints du Trs-Haut recevront la
royaut ). Teodoro Crespo Mas ajoute ensuite quil nest
pas impossible tout le moins que lempereur ait t
VXIVDPPHQWLPSUpJQpGHOHFWXUHELEOLTXHSRXUDYRLUGH
son propre chef, conu un tel programme ; et il revient
sur la localisation du groupe au centre mme du nouveau
forum (juste ct, alors, de la colonne surmonte de
la statue de Constantin) pour souligner la pertinence du
dploiement dune iconographie aussi investie de lidologie impriale chrtienne en ce lieu focal de la ville. Il ne
manque cependant pas dinsister, LQQH, sur le caractre
hypothtique de ses propositions : car, bien videmment,
les preuves proprement parler font dfaut.
Il nous apparat toutefois que son argumentation est
VXIVDPPHQWVHUUpHSRXUHPSRUWHUODGKpVLRQVXUOLGHQWLFDWLRQFKUpWLHQQHGXJURXSHVWDWXDLUHHWOHVPRWLYDWLRQV
de lempereur pour linitiative de sa mise en uvre ne
sortent gure, en tout cas, du domaine de la vraisemblance. On demeurera peut-tre un peu plus circonspect,
en revanche, quant lemplacement exact. cet gard, ce
quavait envisag Franz Alto Bauer24 en se fondant sur les
indications du chroniqueur mdival Georgios Kedrenos
semble recevable : le nymphe en question, face au
EkWLPHQWGX6pQDW  VH
serait trouv dans le portique mridional du forum ; mais
cela ne saurait nouveau tre repris, bien entendu, qu
titre conjectural.
Paneas
Le crdit ainsi de nouveau accord aux propos
G(XVqEHTXDQWjOLGHQWLFDWLRQGXPRQXPHQWFRQVWDQtinopolitain induit par contrecoup renvisager dun
il moins sceptique ce quil dit par ailleurs du groupe
VWDWXDLUH JXUDQW -pVXV HW OKpPRUURwVVH j 3DQHDV
(Caesarea Philippi). Car l aussi, une dngation de
la nature chrtienne de luvre a t mise. Elle est
le fait de Peter Stewart25, qui revient sur le passage de
lHistoire ecclsiastique (VII, 18) mais nglige celui
beaucoup plus laconique, il est vrai du Commentaire
sur lvangile de Luc26. Rappelons quil sagissait

24. F.A. Bauer, Stadt, Platz und Denkmal in der Sptantike. Untersuchungen
zur Austattung des ffentlichen Raums in der sptantiken Stdten Rom,
Konstantinopel und Ephesos0D\HQFHSHWJS
25. P. Stewart, Continuity and tradition in Late Antique perceptions of
portrait statuary, dans F.A. Bauer, Chr. Witschel (dir.), Statuen in der
Sptantike, cit. (n. 21), en particulier p. 32-34.
26. Quant ce dernier texte, cf. notamment D.S. Wallace Hadrill,
Eusebius of Caesareas Commentary on Luke: its origin and early
history, dans Harvard Theological Review, 67, 1964, p. 55-63.

EUSBE DE CSARE FACE AUX IMAGES

141

nouveau de statues en bronze, places devant la maison


R OD WUDGLWLRQ [DLW ODFFRPSOLVVHPHQW GX PLUDFOH HW
montrant une femme agenouille levant les bras vers
un personnage masculin debout, tendant lui-mme une
main vers la femme. Peter Stewart pense que lon avait
en ralit vraisemblablement affaire un groupe de
facture antrieure lpoque dEusbe, compos dun
HPSHUHXUHWGXQHSHUVRQQLFDWLRQGHSURYLQFHSUpVHQWpH
en suppliante suivant un schma attest, notamment, sur
des monnaies dHadrien. Et il ajoute que de telles rinterprtations chrtiennes duvres paennes ou profanes
devaient alors tre courantes : lerreur de notre vque en
serait un tmoignage. On peut semble-t-il opposer cette
vue lattestation probable dun vritable discernement
de la part dEusbe (ainsi, comme nous le soulignions
plus haut en suivant Teodoro Crespo Mas, dans ce quil
voque au sujet de limage dOrphe). Observons encore
que si le passage de lHistoire ecclsiastique manifeste
dabord quelque rserve personnelle quant lidentiFDWLRQ H[DFWH  OHV KDELWDQWV GH OD YLOOH GLVDLHQW TXLO
sagissait de Jsus ), ce lger doute disparat ensuite
puisquEusbe sattache expliquer que lon ne doit
gure stonner [de lexistence de telles images dans
des milieux o les populations] ont reu des bienfaits
du Sauveur . En outre, un autre argument nous semble
devoir carter lventualit dune confusion : Eusbe
dclare avoir vu lui-mme le monument in situ ; et il
pWDLWSDUDLOOHXUVVXIVDPPHQWIDPLOLHUGXPLOLHXDXOLTXH
(donc, lvidence, des attributs du souverain) ; comment
aurait-il alors pu se mprendre sur un dtail du vtement
de la statue masculine ? Contrairement ce quenvisage
Peter Stewart, le double manteau quarborait celle-ci
aurait trs certainement t reconnu comme une partiFXODULWp GX FRVWXPH LPSpULDO VL FpWDLW j XQH HIJLH GH
cette nature quavait t confront Eusbe. moins,
videmment, que luvre ait t de facture grossire, et
trs approximative dans le rendu des diffrents traits ;
mais cela apparat assez improbable pour un monument
en bronze, matriau de prix.
Conclusions
Les doutes nous paraissant ainsi non sans
abandonner toute prudence, bien sr pouvoir tre levs
tant pour luvre constantinopolitaine que pour celle de
Paneas, il nous faut pour conclure refaire le point sur la
position dEusbe lgard de limagerie chrtienne.
Nous avons dj ci-dessus renvoy lopinion de Chiara
Bordino, selon laquelle il conviendrait de distinguer
lattitude envers les portraits proprement iconiques du
Christ (ou loccasion des aptres), franchement hostile,
et celle beaucoup plus tolrante lgard de rfrences
bibliques vnementielles ou dexpressions allgoriques.
Ce constat nous apparat globalement valide. Il convient

142

JEAN-PIERRE CAILLET

dailleurs certainement denvisager une volution dans


lesprit dEusbe. Car lvocation du groupe de Paneas
dans le Commentaire sur lvangile de Luc donne dabord
OLHX j OD TXDOLFDWLRQ G DGPLUDEOH PRQXPHQW GH OD
bienveillance du Sauveur . Plus tard, dans lHistoire
ecclsiastique, avec la notation suivant laquelle de
telles uvres taient propres des paens touchs par
les bienfaits du Christ , lapprciation savre moins
positive ; la nuance est certes sensible mais elle ne
dbouche pas, pour autant, sur une condamnation pure
HWVLPSOH(QQGDQVODVie de Constantin, cest bien en
tant que dmonstration de la pit de lempereur chrtien
quEusbe mentionne le groupe associant le Bon Pasteur

AnTard , 22, 2014

et Daniel : aucune connotation ngative nintervient,


donc, dans ce qui est plus que probablement le dernier
crit dEusbe. Et mme si lon remettait encore en cause
la nature chrtienne du monument en question, cette prise
de position de notre auteur doit sans conteste tre retenue
comme telle : car, tort ou raison, cest bien ainsi quil
LGHQWLDLW OHV SHUVRQQDJHV GX JURXSH /HV pYHQWXHOOHV
XFWXDWLRQV SUpFpGHPPHQW HQYLVDJpHV QH VDXUDLHQW WURS
surprendre, au demeurant, dans le dveloppement dune
pense sur prs de quatre dcennies, et une poque
marque par de tels bouleversements.
Universit Paris-Ouest

AnTard , 22, 2014, p. 143- 155


DOI 10.1484/J.AT.5.103184

VARIA

HISTORIA AVGVSTA CONTRA CHRISTIANOS.


RECHERCHES SUR LAMBIANCE ANTICHRTIENNE
DANS LHISTOIRE AUGUSTE
-)165

Historia Augusta contra christianos.


An overview of the anti-Christian atmosphere in the Historia Augusta
The religious Tendenz of the Historia Augusta has long been a contentious issue among specialists; only by
paying close attention to the richly-layered inter-textuality of the work can it be established how acquainted the
author was with the niceties of Christian culture, biblical and patristic, and their Jewish core. Samples culled from
the biographies of Avidius Cassius, Heliogabalus, Geta, and the two Maximini showcase a cogent literary strategy
of juggling parodic allusions to Christianity; the Vita Maximini duo, particularly, would appear to revolve around
the inversion of specific chunks of the Gospel of Luke. The epistles of Saint Paul too come in for some tough love.
The whole polemical aspect of the Historia Augusta through the cover up of jest and ribaldry must therefore be
maintained against the skeptical bowdlerization of the collection some of the most recent scholarship amounts to. It
also provides clues that point in the direction of the great Pagan statesman Nichomachus Flavianus senior as our
elusive writer. [Authors]

La tendance idologique de lHistoire Auguste constitue


lun des points, vrai dire nombreux, sur lesquels Alan
Cameron, ayant mis avec alacrit une opinion minimaliste, sest fait vivement accrocher par ses critiques1. Il

1. The Last Pagans of Rome, Oxford, 2011, p. 782 : The author of


the HA was a frivolous, ignorant person with no agenda worthy of
the name at all , ou p. 745 : It has come to be treated as the high
point of the pagan reaction less because of the virulence of its
(inevitably covert) polemic than for the assumption that it needed to
be concealed. Alfldi saw the HA as a bitter attack on Christianity,
Straub as a plea for toleration, a pagan response to Orosiuss Historia
adversus paganos. The sheer improbability of both these views
(which are, of course, mutually contradictory and exclusive) has often
been noted, as has the lack of evidence for the assumption that pagans
were afraid to state their views openly. F. Paschoud a rpliqu en
attirant lattention sur les singularits de la tactique employe par le
savant amricain : Cameron is essentially attacking the thesis that
sees in the HA a weapon of the pagans directed against their Christian
adversaries. Bizarrely, instead of refuting this interpretation, he tries
hard to put back the chronology of the HA and to make it a work that
appeared at latest in about 385, that is to say, before the dramatic

attache peu dimportance, au rebours de la majorit des


spcialistes, la dimension intertextuelle de cette uvre ;
tous saccordent pourtant, avec de nombreux collgues,
considrer aujourdhui comme secondaire ou marginal le
militantisme paen de lauteur2, mme si les positions de

moment of the usurpation of Eugenius (On a recent book by Alan


Cameron: The Last Pagans of Rome, dans AnTard, 20, 2012, p. 359388, ici p. 381). Pour une dnonciation de la faon dont A. Cameron
loigne (en amont) lHistoire Auguste et (en aval) Macrobe du climax
du Frigidus en 394, cf. St. Ratti, Polmiques entre paens et chrtiens,
Paris, 2012, p. 179-187.
2. F. Paschoud, On a recent book, cit. (n. 1), p. 384, crit en effet que
there is no clear Tendenz in the HA. On the other hand, the author
FOHDUO\KDGKLVKREE\KRUVHVDQGKLVREVHVVLRQV&HWWHDIUPDWLRQ
sonne comme une retractatioGHVYXHVGXPrPHDXWHXULGHQWLDQWOH
passage dAurel. 18, 7-20, 8, sur la consultation des Livres Sibyllins,
lcho de la controverse de 384 autour de lAutel de la Victoire
(Histoire Auguste V, 1, Vies dAurlien et de Tacite, Paris, CUF, 1996,
p. 123-124 : cf. les paralllismes textuels dtaills en p. 126-127, 128129). Autre drobade tendancieuse : The HA did not play the least
UROHLQWKHFRQLFWRUVXSSRVHGFRQLFWEHWZHHQSDJDQVDQG&KULVWLDQV

144

AnTard , 22, 2014

JEAN-FABRICE NARDELLI, STPHANE RATTI

certains savants semblent dnoter une volution rcente sur


ce sujet3'DQVOHGURLWOGHVWUDYDX[GH6WpSKDQH5DWWL4,
les prsentes recherches aimeraient replacer au centre du
dbat le jeu de la forme et du fond dans ce pseudpigraphe :
le manque de srieux le plus norme y procde du dsir
de crypter une hostilit envers le christianisme digne dun
manifeste ou dun pamphlet politique. Ce en quoi nous
UHFRQQDLVVRQVOHPDVTXHGHODERXIIRQQHULHUHqWHXQHVL
QHFRQQDLVVDQFHGHODFXOWXUHFKUpWLHQQHELEOLTXHSDWULVtique5, et mme juive6 XQ VHQV VL GpOLFDW GX VLJQLDQW HW
GXVLJQLpTXHODWWULEXWLRQGHOHistoire Auguste ce bel

at the end of the fourth century, since it never circulated openly (On
a recent book, cit. [n. 1], p. 385). Du fait que nul texte ne mentionne
lHistoire Auguste dans ce contexte, on ne saurait avec sret exciper ni
son positionnement idologique ni sa capacit militante, encore moins
son aptitude circuler. Ces trois paramtres ne se recouvrent pas et
dpendent de lesprit des temps il y a loin, de lHistoire Auguste,
362, quand Libanios pouvait se permettre de clore sa lettre 697
HQ pFULYDQW             
    3RXU XQH UpSRQVH j ) 3DVFKRXG HW XQH
datation de lHistoire Auguste entre 390 et 394, cf. St. Ratti, La date et
la diffusion de lHistoire Auguste, dans RA, 114 (2), 2012, p. 567-580
( Lecture critique sur F. Paschoud, Histoire Auguste, Vies des Trente
tyrans et de Claude, CUF, Paris, 2011).
3. Par exemple P. Maraval, /HVOVGH&RQVWDQWLQ, Paris, 2013, p. 226 :
Les ractions critiques des paens furent plus nombreuses durant
les dernires annes du sicle, lorsque Thodose reprit et durcit ces
mesures [de Constance II]. Elles sont exprimes parfois de faon
crypte, ainsi dans lHistoire Auguste , avec renvois nombreux
St. Ratti, Antiquus error. Les ultimes feux de la rsistance paenne
(Bibliothque de lAntiquit tardive, 14), Turnhout, 2010.
4. St. Ratti, Antiquus error, cit. (n. 3), et O. Desbordes, Histoire
Auguste IV 2, Vie des deux Valriens et des deux Galliens, CUF,
Paris, 2000, p. XXIII-XXX, surtout XXVII-XXVIII, suggrait dj
de prendre la Vita Valeriani solidairement de la lacune dparant la
collection et de lire lune et lautre comme une riposte littraire dans
un dbat politique et religieux . Voir depuis ses Polmiques entre
paens et chrtiens, Paris, 2012, passim. Voir aussi, pour un argument
indit en faveur de la paternit de Nicomaque Flavien senior, St. Ratti,
Herennianus dans lHistoire Auguste, Flavius Pollio Flavianus et
Nicomaque Flavien senior, dans C. Freu, S. Janniard (dir.), Mlanges
en lhonneur de Jean-Michel Carri (Bibliothque de lAntiquit
Tardive), 2014, paratre.
5. Voir par exemple F. Mundt, Die Maske des Christen. Spuren
christlicher Literatur in der Historia Augusta, dans G. Thome,
J. Holzhausen, S. Anzinger (dir.), Es hat sich viel ereignet, Gutes
wie Bses, Mnchen / Leipzig, 2001, p. 37-56, qui relve divers
emprunts de lHistoire Auguste la littrature chrtienne, expliquant
par exemple (p. 41-42) le nom de lhistorien grec inconnu Theoclius
en Aurelian. 6, 4 par un rapprochement tymologique avec le nom
de Samuel en hbreu. Sa conclusion densemble est que lauteur est
ein ausgezeichneter Kenner christlich-jdischer Tradition (p. 55).
F. Mundt est ignor par A. Cameron, The Last Pagans, cit. (n. 1).
6. J. Schwartz la pressenti qui, dans un article oubli, Une fantaisie
impie dans lHistoire Auguste, dans Revue dHistoire et de
Philosophie Religieuses, 69, 1989 (4), p. 481-483, avait attir
lattention sur Alex. 51, 7, 8 (cum quamdam aniculam adfectam
iniuriis a milite audisset, exauctoratum eum militia seruum ei dedit,
quod artifex carpentarius esset, ut eam pasceret). Il y voyait une
double intention basphmatoire : dune part travers lallusion
des rcits juifs sur la naissance de Jsus o lon voit une pauvre
femme chasse par son poux accoucher des uvres dun soldat
(cf. Origne, Contre Celse 1, 28 et 32), dautre part travers un
dtournement de Jrme, In psalm. 109 (PL 26, col. 1165A) o
JXUH OH[SUHVVLRQ artifex carpentarius qui pourrait rappeler ltat
de charpentier de Joseph et celui de Jsus.

esprit que fut Nicomaque Flavien senior plutt qu un


plumitif quelconque gravitant dans les milieux snatoriaux,
nous parat la plus tentante.

*
*

En bonne philologie classique, la rsistance dun


mot ou dun membre de phrase qui fait broncher la
lecture attentive, dtermine les zones textuelles o le
FRPPHQWDWHXU GRLW [HU VRQ DWWHQWLRQ 3UpVHQWRQV GRQF
pour montrer de quelle manire les dtournements intertextuels dobdience paenne rehaussent sporadiquement
une matire assez pauvre, une slection de passages dont
la forme grammaticalement satisfaisante ne laisse pas
souponner une altration, mais dont la teneur apparat
dcale dans le contexte local, voire gratuite.
Soit la prtendue lettre de Lucius Vrus Marc-Aurle
en Avidius Cassius 1, 8 : Avidius y est dnonc comme
affublant les deux empereurs dun sobriquet infamant,
te philosopham aniculam me luxuriosum morionem
uocat. Or, autant crtin dbauch appliqu Vrus se
conoit, autant vieille peau philosophe surprend pour
Marc. La diffrence dge entre les deux hommes tait
peu considrable7, si bien que la polarit induite tombe
plat ; et pourquoi le fminin ? On se gardera dy voir
une banale expression de la misogynie des Anciens ; telle
tait la construction des rles sexuels en vigueur Rome
que traiter en femelle un individu revenait laccuser de
mollitia8. Or, supposer quAvidius ait vraiment voulu
stigmatiser Marc via le topos de linversion sexuelle des
philosophes9, il serait tonnant quil et choisi un mot
comme anicula : laccent y porte sur la vieillesse, non sur
le gender blurring10 ! On dira quil ny a pas expliquer
une calomnie si elle est imaginaire et porte par une
pice forge ; alors les exgtes de Timon le Sillographe
schinent en vain autour dune pointe similaire11... Une

7. Neuf ans et demi (26 avril 121 pour Marc, 15 dcembre 130 pour
Lucius). Sur ce dernier, voir P. Hadot, Marc Aurle. crits pour luimme, 1, Paris, CUF, 1998, p. CXIX-CXXVII.
8. C. Williams, Roman Homosexuality, 2e d., Oxford, 2010, p. 139-153.
9. Voir Martial 9, 48, 8 : dic mihi, percidi, Pannyche, dogma quod est ?,
avec C. Henriksn, Martial, Book IX. A Commentary, 2, Uppsala,
1998, p. 220-223. Le nom prt ce faux philosophe constitue dj
XQHVDQJODQWHH[pFXWLRQ IpPLQLQDWWHVWpSRXU
des pallakai GpFRPSRVpHQFHOXLjTXLLOHVWIDLWODPRXU
toute la nuit .
10. Si on la suppose pertinente, lantithse entre le vieux sage et
le dissip (sous-entendu jeune ) parodierait-elle Tatien, Oratio
ad Graecos         
      " /D UHQFRQWUH
thmatique et lexicale frappe certes, mais concerne une polarit use
et conventionnelle.
11. Supplementum Hellenisticum 812, 1-2, taxe Znon de vieille
SKpQLFLHQQHFXSLGH " 
_/HFRPPHQWDLUHGH9'H0DUFR7imone

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

MXVWLFDWLRQ PLQLPDOH GH philosopha anicula serait que


lHistoire Auguste, confronte la ralit prosopographique des femmes philosophes12, entendait plaisanter
Marc-Aurle sur sa qualit de sage. Mme mis au compte
dun usurpateur, cela est si malvenu quil vaut mieux
chercher une autre explication. Ici la Bible vient notre
aide. Lvangile de Luc met en scne la (trs ?) vieille
VDYDQWH$QQHOOHGH3KDQRXHO13XQHSURSKpWHVVHFRQWH
en dvotion qui sert de tmoin Christ jeune (Luc 2,
36-38)14. La transposition du souvenir de cette Juive a
d transiter par la paraphrase virgilienne de Juvencus (1,
214-220)15 : celui-ci en effet ne nomme pas Anne en tte
de la pricope, contrairement lvangliste, qui prcise
demble sa qualit et son lignage, mais use de propheta
feminea. Cette formule fournissait un modle dautant
plus percutant notre philosopha anicula quelle tait
de mmorisation facile vu le rejet mtrique. La saillie
contre lempereur philosophe mise au compte dAvidius
SDU OH IDX[ /XFLXV DIFKH VRQ REpGLHQFH chrtienne :
Marc-Aurle HVW PRTXp HQ WDQW TXH QRXYHOOH 
5ppFKLVVDQWGRHOOHSDUWODQDVDUGHpJUDWLJQH
lusurpateur ce dernier aurait manqu de discernement

di Fliunte, Silli, Rome, 1989, p. 194-197, qui insiste sur le registre de


lavarice prte au philosophe et le visualise ici faisant son march
DX[LGpHVSKLORVRSKLTXHVDUPpGXQSDQLHUpFODLUHPRLQV
 TXH - ) *DQQRQ An interpretation of Timon of Phlius
Fr. 38 D, dans American Journal of Philosophy, 108, 1987, p. 603611, surtout p. 608 et suivantes, quand mme ce dernier na gure
t suivi dans son interprtation densemble (on tend favoriser une
satura plutt scolaire : D. L. Cleyman, Timo of Phlious. Pyrrhonism
into Poetry, Berlin, 2009, p. 111-112, est reprsentatif).
12. Philosopha apparat trs rarement, e.g. en CIL, VI, 33898 (ILS, 7783
[II, 2, p. 827]) : Euphrosyne pia, docta nouem musis, philosopha,
u.a. XX ; il existe un peu plus de documentation du ct grec :
M. N. Tod, Sidelights on Greek philosophers, dans Journal of
Hellenic Studies, 77, 1957, p. 140.
 /D FRQMRQFWLRQ  GDQV OD SURSRVLWLRQ WHPSRUHOOH  
  HQ /XF   SHXW VLJQLHU DXVVL ELHQ
pour , auquel cas Anne est reste veuve pendant 84 ans et serait
plus que centenaire, comme Judith (Jdth 16, 23), que jusqu ,
ce qui exprimerait son ge total. Sagissant dun rcit hyperbolique
et messianique (le chapitre 2 est maill de motifs typiquement
vtrotestamentaires, e.g. la consolation Isral [2, 25] ou la
rdemption de Jrusalem [2, 38]), une Anne de 84 ans ferait un bien
beau tmoin juif aux enfances du Christ.
14. J. H. Marshall, The Gospel of Luke, Exeter, 1978, p. 123-124 ;
F. Bovon, Das Evangelium nach Lukas, I Lk 1,1-9,50, Zrich /
Neukirchen-Vluyn, 1989, p. 148-151 ; J. B. Green, The Gospel of
Luke, Grand Rapids, 1997, p. 150-152.
 /XF          
        

        
     a -XYHQFXV ,  
mox ecce prophetae_femineam sancto complet spiramine mentem. |
$QQDIXLWQDWXJUDXLRUTXDPLQRUHLXXHQWDH_destituit uiduam mors
immatura mariti._Casta sed in templo semper pro coniuge uita_et
cultus cessere Dei. R. P. H. Green, Latin Epics of the New Testament.
Juvencus, Sedulius, Arator, Oxford / New York, 2006, p. 1-7, assigne
le pome de celui quil appelle the aristocratic priest (p. 8) lan
329, indiqu par Jrme, et balaie comme infondes et entirement
hypothtiques toutes les autres chronologies.

145

envers le perscuteur des chrtiens. Considrant les


convictions philosophiques de Flavien, une pique sincre
contre Marc aurait t surprenante.
Une allusion intertextuelle beaucoup plus blessante
pour le christianisme rside sans doute aussi dans les
quatre passages de la Vie dHliogabale o la passivit
homosexuelle de cet empereur est croque sur le vif
comme sa jouissance dhommes bien membrs (5, 3 ; 8,
6 ; 9, 3 ; 31, 6 ; cf. galement le enormitate membrorum
de 12, 2). Si lhapax uasatus, drivatif de uas qui est
une mtaphore des parties gnitales depuis Plaute,
Poenulus 863, na rien que de classique16, ladjonction
systmatique de lpithte bene change la donne. Loin
en effet dtre anodin, bene uasatus calque de manire
IUDSSDQWH OKDSD[ GH OD 6HSWDQWH  GDQV OH
passage de dbauche htrosexuelle en gypte ; zchiel
     \ WUDGXLW  17. Alors
que la Vulgate comprend littralement (magnarum
carnium), lHistoire Auguste prfre leuphmisme le
SOXV FODVVLFLVDQW SRXU pWULU FH SUHPLHU IRVVR\HXU GH OD
religion traditionnelle quest ses yeux Hliogabale.
Pour des Romains de lVrbs attachs la religion tradiWLRQQHOOHLOQHGHYDLWSDVPDQTXHUGHVHOGHYRLUDJHOOHU
par un vocable dduit du grec biblique celui qui ne fut
gure jamais quun Oriental, conventionnellement cruel
et dbauch18. Bene uasatus UDSSHODLW SHUGHPHQW OD
Bible chaque fois quil tait question des obsessions

16. Mentulatus / coleatus, cf. W. Goldberger, Kraftausdrcke im


Vulgrlatein, dans Glotta, 18, 1929, p. 56, et surtout J. N. Adams, The
Latin Sexual Vocabulary, Londres, 1982, p. 41-43, surtout p. 42. Tant
cet emploi de XV, osco-ombrien uasus (J. Untermann, Wrterbuch
des Oskisch-Umbrischen, Heidelberg, 2008, p. 826 : wahrscheinlich
Gef, Behlter ), que notre uasatus manquent dans M. de Vaan,
Etymological Dictionary of Latin and the Other Italic Languages,
Leyde / Boston, 2008, p. 655.
17. Voir T. Muraoka, A Greek English Lexicon of the Septuagint,
Louvain / Paris / Walpole, 2009, p. 444 ; Idem, A Greek-Hebrew /
Aramaic Two-way Index to the Septuagint, Louvain / Paris /
:DOSROHS a HWHXSKpPLTXHVSRXUOH
phallus remontent lAthnes classique (J. Henderson, The
Maculate Muse. Obscene Language in Attic Comedy, 2e d.,
New York / Oxford, 1991, p. 115 ad 18 et 115-116 ad 21) ; leur
combinaison par les traducteurs alexandrins serre lhbreu au
maximum mais ne manifeste rien de judo-chrtien pour qui ne
FRQQDvWGHSUqVQLOD%LEOHKpEUDwTXHQLOH1RXYHDX7HVWDPHQW
mis pour le phallus, comme le syriaque
, chair, viande ,
cf.
, membre, partie (M. Sokoloff, A Syriac Lexicon.
A Translation from the Latin. Correction, Expansion, and Update of
C. Brockelmanns Lexicon Syriacum, Winona Lake / Piscataway,
2009, p. 167, 331-332), est assez commun dans lAncien Testament
(Gen 17, 13 ; Lev 6, 3 ; 12, 3 ; 15, 2-3 ; 16, 4 ; Ez 23, 20 ; J. Milgrom,
Leviticus 1-6, New York, 1991, p. 748) ; cette dsignation a entran
lassociation paulinienne de la chair avec la circoncision (Gal 6, 1213 ; Rom 2, 28 ; Col 2, 11, 13). De tout cela lHistoire Auguste
navait videmment cure ; son auteur a juste cru dployer un
idiotisme biblique.
18. Pas seulement par sa dvotion outre au Sol inuictus Elagabal.Voir
A. Timonen, Cruelty and Death. Roman Historians Scenes of Imperial
Violence from Commodus to Philippus Arabs, Turku, 2000, p. 119-123
( Elagabalus in the HA: Cruelty as a Complementary Vice ).

146

JEAN-FABRICE NARDELLI, STPHANE RATTI

sodomitiques dHliogabale ; cette saillie constitue un


jeu de lettr paen caractristique de la tradition rudite
romaine19. Fielleuse plus encore que cocasse, elle scande
avec linsistance dun leitmotiv les sentiments de lauteur,
en renvoyant dos dos les chrtiens et lmsien.
Terminons avec Geta 5, 7-8 :
Habebat etiam istam consuetudinem ut conuiuia et
maxime prandia per singulas litteras iuberet scientibus
seruis, uelut in quo erat anser, apruna, anas, item
pullus, perdix, pauus, porcellus, piscis, perna et quae in
eam litteram genera edulium caderent, et item fasianus,
IDUUDWDFXVHWWDOLD4XDUHFRPLVHWLDPKDEHEDWXULQ
adulescentia.

Quel que soit le caractre fantasmagorique de cette


scne, on est bien oblig de donner un sens la spciFDWLRQ VHORQ ODTXHOOH OHV HVFODYHV VRQW scientes. Le
vague skilful de David Magie affadit ladjectif ; Paolo
Soverini suggre al corrente dei suoi intenti , ce qui
demande beaucoup du contexte ; et l initis de Andr
Chastagnol convient mal, car il suggre une capacit
spciale des serviteurs, or le fait de porter les mets dans
lordre alphabtique de leur nom ne requiert aucune
formation ou science. Pourtant, la solution de Paolo
Soverini simpose au vu de Luc 12, 47 :


aille autem seruus, qui cognouit uoluntatem domini sui et
non praeparauit uel non fecit secundum uoluntatem eius.

Il y a mieux : le tour seruus sciens JXUH GDQV OD


version latine de ce verset que reproduit le Commentaire
de saint Jrme Ose en 406 ; dans une lettre de saint
Augustin Victorianus en 409-410 ; dans un sermon
augustinien prononc immdiatement aprs la chute
GH 5RPH HQ   HQQ GDQV XQ WUDLWp WKpRORJLTXH pFULW
vers 52020. Cette impressionnante srie dattestations de

19. Comparer, mutatis mutandis, le traitement par Stace de sacer Argus


tel que lclaire B. Mulligan,  $UJXV ELOLQJXDO ZRUGSOD\ LQ
Statius Silvae 5, 4, 11-13, dans Mnemosyne, 64, 2011, p. 471-480,
surtout p. 475 et suivantes ; toutes les dfenses traditionnelles de
sacer tournant court, la seule autre option serait dmender, hlas
pour ainsi dire laveugle (bilan chez G. Liberman, Stace Silves.
dition et commentaire critiques, Paris, 2010, p. 465, qui se garde
bien de risquer une conjecture personnelle). En Heliog. 5, 3, comme
dans la Silve sur le Sommeil, la formule latine, via son pithte, a
pWpIDoRQQpHSDUOHVGHX[DXWHXUVDQGpYHLOOHUODWWHQWLRQGXOHFWHXU
avis et de lui suggrer larrire-plan grec.
20. Hier., In Os. 2, 9, 91, PL 25, col. 890C : Aliter enim nesciens Deum,
aliter punitur recedens a Deo, quia seruus qui scit uoluntatem domini
sui, et non facit eam, uapulabit ; Augustin, epist. 111, 2, p. 644
(lignes 19-21), 645 (lignes 1-2) Goldbacher (CSEL, 34, 2) : dominus
enim dicit : seruus nesciens uoluntatem domini sui et faciens digna
plagis uapulabit pauca, seruus autem sciens uoluntatem domini sui
et faciens digna plagis uapulabit multa ; Augustin, urb. exc. 7, 8
(CC, 46, Turnhout, 1969, p. 260 OReilly) : manu ergo emendantis
dei correpta est potius ciuitas illa quam perdita, tamquam seruus
sciens uoluntatem domini sui et faciens digna plagis, uapulabit

AnTard , 22, 2014

peu postrieures au terminus ante quem de lHistoire


Auguste propos par Franois Paschoud et Stphane Ratti
permet de conjecturer que seruus sciens constitue une
expression chrtienne ; on quittera de peu le domaine de
la vraisemblance en postulant que seruus sciens circulait
dj sous Thodose, point nomm pour que lHistoire
Auguste, familire quelle est de lvangile de Luc, en ait
vent et lutilise.
Notre attention attire par cet cho chrtien, on savise
dune seconde indication gratuite dans la parade des plats
impriaux en Geta 5, 7-8 : au sein dune anecdote sans
autre sel que le pdantisme le plus bizarre, le moment de la
journe auquel elle se tient est trs clairement prcis le
repas de midi, prandia. Cest lheure propice aux inspirations divines chez les premiers chrtiens : Saul de Tarse,
IXWXUVDLQW3DXOUHoRLWVDYLVLRQGH'DPDV
(Actes 22, 6), Philippe est envoy par lange sur un chemin
(Actes 8, 26) o il fait une rencontre et
une conversion. Lindice ne ment pas ; lptre de Paul aux
Philippiens comporte un verset que lnumration allitrante
des plats la vue desquels se rgale Gta transpose avec
une verve aristophanesque : Phil 4, 12, aux vigoureuses
DQWLWKqVHV DVVRQDQFpHV HQ 21. Laptre y dmontrait son
indiffrence aux retours de fortune, lHistoire Auguste lui
oppose le comportement typiquement romain consistant se
remplir la panse tant que le sort est favorable. Ce serait une
concidence extraordinaire si la parchse en p- de lHistoire
Auguste, qui comporte le mme nombre de membres que la
VpULHDVVRQDQFpHHQFKH]3DXOpWDLWLQGpSHQGDQWHGHFHWWH
dernire. Mais, dira-t-on, la fantaisie sur les sries de mets
prsents dans lordre alphabtique ne correspond rien
dans lptre canonique. Nous croyons, tout au contraire,

multis ; Fulgence de Ruspe citant Luc 17, 47-48 en rem. pecc. 1, 13, 3
(J. Fraipont, Sancti Fulgentii episcopi Ruspensis Opera, 2, Turnhout,
1968, p. 661) : et Saluator noster ait : seruus nesciens uoluntatem
domini sui et faciens digna, uapulabit paucis, et seruus sciens
uoluntatem domini sui et faciens digna plagis, uapulabit multis.
          
        
 a scio et humiliari, scio et abundare ; ubique et in
omnibus institutus sum et satiari et esurire et abundare et penuriam
pati, avec G. D. Fee, Pauls Letter to the Philippians, Grand Rapids,
1995, p. 430-434. Phil 4, 12 is unique in that Paul asserts in it
his indifference not only to hardship but to times of abundance as
well, which in the context has its most immediate reference to the
Philippians gift (P. A. Holloway, Consolation in Philippians.
Philosophical Sources and Rhetorical Strategy, Cambridge, 2001,
p. 157, n. 62) ; cf. J. A. Marchal, Hierarchy, Unity, and Imitation.
A Feminist Rhetorical Analysis of Power Dynamics in Pauls Letter
to the Philippians, Leyde / Boston, 2006, p. 153 : Dissociating
need from contentment, Paul shows a lack of concern with his own
condition (4, 11-12) and demonstrates the continuing devaluation of
VHOIEHQHW LQ WKH OHWWHU 3DXO DOVR PDLQWDLQV WKDW WKLV VHOIVXIFLHQW
contentment comes from another source: the one who strengthens
me (4, 13). Since Paul has worked so strenuously to link himself
with divine forces throughout the letter, this most likely refers to
either God or Christ . Il tait sanglant de transporter un tel passage
dans un repas bouffon et gargantuesque.

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

quelle fut amene par la notation de Phil 4, 3 DGQHP sur


les auxiliaires de laptre :


a et ceteris adiutoribus meis, quorum nomina sunt in
libro uitae.

Le livre de la vie (mieux : des vivants), symbole


typiquement juif22, prtait raillerie pour un paen de
par lemphase de lexpression grecque applique de
simples particuliers (les co-workers de G. D. Fee) ;
substituant labondance culinaire la plus dcadente la
frugalit paulinienne contente de peu, lHistoire Auguste
a appliqu cette formule aux serviteurs de table de son
HPSHUHXU(QQOHcomis dont la VieJUDWLH*pWDDSUqV
cette historiette voque peut-tre en creux lexhortation
de Paul se rjouir en Phil 4, 4 :

agaudete in domino semper ; iterum dico, gaudete.

Cette allgresse inconditionnelle dans le Seigneur23 se


PXHHQEHOOHKXPHXULURQLTXHjODQGXUDJRWVXU*pWD
GRQW OD VLJQLFDWLRQ SURIRQGH UHoRLW DLQVL OD GHUQLqUH
touche : le lecteur a t trs ostensiblement convi rire
avec lHistoire Auguste de la petitesse de lempereur, le
SDUH[FHOOHQFHGH5RPHPDLVODSODLVDQWHULHYLVH
aussi et surtout les dicta et facta de laptre du Christ.

*
*

 OLYUHGHVYLYDQWV3V FI  WRXVFHX[


LQVFULWVSDUPLOHVYLYDQWV HQ,VHW GXOLYUHTXH
tu as crit ) en Ex 32, 32 ; comparer aussi, quand il est employ par
DVVRQDQFHDYHFJUDYHUXQLQVWUXPHQWGHSUpFLVLRQGRQW
le contexte fait stylet (Is 8, 1), burin (Ex 32, 4). On partira de
R. Bauckham, The Jewish World around the New Testament. Collected
Essays, 1, Tbingen, 2008, p. 293-294 ; cf. L. Koep, Das himmlische
Buch in Antike und Christentum. Eine religionsgeschichtliche
Untersuchung zur altchristlichen Bildersprache, Bonn, 1952, p. 31GRQWODELEOLRJUDSKLHHVWFRPSOpWpHSDU03RSRYLReading the
Human Body. Physiognomonics and Astrology in the Dead Sea Scrolls
and Hellenistic-Early Roman Period Judaism, Leyde, 2007, p. 45,
n. 107. De mme, la Vetus Latina de Jer 17, 13 nous parle dun liber
mortis : M. Kraus, Hebraisms in the old latin version of the Bible, dans
Vetus Testamentum, 53, 2003, p. 505-506.
23. Explicite de manires complmentaires plutt que divergentes par
G. D. Fee, Pauls Letter, cit. (n. 21), p. 402-406 (cf. p. 256-257), et par
B. Witherington, Pauls Letter to the Philippians. A Socio-rhetorical
Commentary, Grand Rapids, 2011, p. 242-246 ; joy in Philippians is a
GHDQW1HYHUWKHOHVVZKLFK3DXOVHWVOLNHDIXOOVWRSDJDLQVWWKH3KLOLSSLDQV
anxiety. [...] It is in fact as keynote that this joy is meant, beyond the joy that
one has feels, can show , crit K. Barth, The Epistle to the Philippians
(40th Anniversary Edition), Louisville, 2001, p. 120. Ajoutons ce qui nest
SDVIRUFpPHQWpYLGHQWjVDYRLUTXHUHSUpVHQWHWRXW
ensemble un des tours prfrs de Paul et une marque distinctive de sa
langue (J. D. G. Dunn, The Theology of Paul the Apostle, Grand Rapids /
Cambridge, 1998, p. 396-401, en particulier p. 398 s.).

147

Il est temps de quitter la sphre des allusions ponctuelles


pour montrer comment le jeu de lintertextualit antichrtienne fonctionne au niveau macrostructurel. Seule, en
effet, une suite continue de railleries sous chape prenant
le lecteur in the know tmoin du caractre ridicule ou
pernicieux du christianisme, permet de valider notre
recherche des subtilits participatives dissimules sous
les asprits inexpliques du texte.
En 2012, dans lultime chapitre des Polmiques entre
paens et chrtiens, Stphane Ratti proposait de voir
dans lpisode rapport dans la Vie des deux Maximins
de lHistoire Auguste qui raconte comment les femmes
dAquile avaient accept par deuotio et par GHV le
VDFULFH GH OHXU FKHYHOXUH DQ GH OHV WUDQVIRUPHU HQ
cordages une charge paenne dirige notamment contre
saint Paul et Lactance24. Or il se trouve que la mme Vita
recle bien dautres traits antichrtiens, majoritairement
inspirs en apparence par lvangile de Luc.
Demble suspecte est la ddicace de cette Vie
Constantin le Grand, ou plutt sa clementia et sa pietas
(Maximin. 1, 1). On annonce ds les premires lignes
YRXORLU \ UpXQLU OHV DFWHV GXQ SqUH HW GXQ OV   
La premire autorit mentionne (1, 2) est un inconnu,
Tatius Cyrillus, dont le nom revt une double consonance
chrtienne, Tatius pouvant faire songer lapologiste grec
syrien Tatien et Cyrillus Cyrille de Jrusalem. Cet auctor
fabriqu serait connu pour ses traductions du grec au latin.
Maximin est prsent comme dorigine barbare et ayant t
pastor ; dans sa jeunesse il tait la tte dune troupe de
jeunes gens, des activistes svissant contre les brigands :
2, 1 et in prima quidem pueritia fuit pastor, iuuentum
etiam procer et qui latronibus insidiaretur et suos ab
incursionibus uindicaret.

Le mot procer retient lattention : au contraire du


substantif proceritas, commun partir du quatrime
sicle, ce potisme (et virgilianisme) classique, the
leading man of a country, society, etc. ; the leader of a
profession, art, etc. (OLD), semble sorti dusage dans
le latin tardif, hormis chez notre biographe et chez les
chrtiens, qui le font dsigner un chef juif25. Comme

24. Chapitre Dvotion et foi : des valeurs paennes ? , p. 165-178, et


Maximin. 33, 1 : SUDHWHUHXQGXP QH LOOXG TXLGHP HVW TXRG WDQWD GH
Aquileienses contra Maximinum pro senatu fuerunt ut funes de capillis
muliebribus facerent cum deessent nerui ad sagittas emittendas ;
cf. aussi Max. Balb. 11, 3 et 16, 5.
25. C. Heinsdorff, Christus, Nikodemus und die Samaritanerin bei
Juvencus. Mit einem Anhang zur lateinischen Evangelienvorlage, Berlin,
2003, p. 95-96. Outre Juvencus et les Veteres Latinae, cf. la Vulgate
en Nombres 16, 2 : VXUUH[HUXQWFRQWUD0RVHQDOLLTXHOLRUXP,VUDKHO
ducenti quinquaginta uiri proceres synagogae et 1 Paralipomenon 29,
6 : polliciti sunt itaque principes familiarum, et proceres tribuum Israhel,
tribuni quoque, et centuriones, et principes possessionum regis. Il est
intressant de voir que Cassiodore sen tiendra aux usages classiques :
cf. O. J. Zimmermann, The Late Latin Vocabulary of the Variae of

148

JEAN-FABRICE NARDELLI, STPHANE RATTI

le texte nous informe par la suite que Maximin suscite


ladhsion et mme laffection chez les barbares comme
les Goths, cela de manire unique (4, 4 : amatus est
autem unice a Getis), tandis que les Alains vont jusqu le
considrer comme un ami (4, 5) capable de la plus haute
sociabilit envers eux26, il est tentant de voir en procer
lamorce lexicale dune attitude non romaine27 chez un
empereur dpeint comme un pre pour ses soldats
(6, 3 : ut autem patrem militibus praeberet), avec toutes
les connotations chrtiennes que lon voudra.
Sa bravoure sillustre dans un premier combat
contre seize valets darme , rcompens par seize
prix (2, 7). Sa seconde aristie est une victoire contre
sept soldats particulirement braves que lui opposa,
pour lprouver, lempereur Alexandre Svre (3, 4-5),
lequel lui tint ds lors grande estime. Dans les deux cas
lHistoire Auguste dit que la victoire fut totale et en un
seul assaut (uno sudore : 2, 7 et 3, 5). Lallusion
OD VXHXU YHUVpH GDQV OHIIRUW VDFULFLHO GX FRPEDWWDQW
sexplique par un dtournement biblique, comme on va le
voir28. Maximin aime souffrir, ce que quelques tribuns
lui reprochent (6, 4 : quid tantum laboras) et ce quil
considre quant lui tre sa mission sur cette terre (6, 5 :
ego uero, quo maior fuero, tanto plus laborabo). La Bible
offre un vaste champ demplois mtaphoriques du verbe
laborare ; citons ici simplement Paul 2 Tim 2, 3 :

alabora sicut bonus miles Christi29

AnTard , 22, 2014

Quant au nombre seize et au chiffre sept, leur


symbolique chrtienne est bien connue : le premier renvoie
en effet aux seize livres des prophtes selon Isidore de
Sville30, tandis que sept, selon le mme auteur, dans les
eFULWXUHVVDLQWHVVLJQLHWDQW{WODWRWDOLWpGXWHPSVGHFH
sicle, tantt le repos, et quelquefois il indique lunit de
lglise 31. Le dtournement du chiffre sept notamment
dans lHistoire Auguste32 est bien attest ailleurs dans
la collection, sous la forme dallusions la semaine
juive33, ou encore dans lpisode de la monte au Capitole
entreprise par Alexandre Svre tous les sept jours 34,
ainsi quAndr Chastagnol lavait nagure bien repr35.
Ce nest pas un hasard non plus si, selon le tmoignage
DEOHGX&DWDORJXHGH0XUEDFKOHistoire Auguste tait
originellement structure en sept livres36. La tonalit
SDURGLTXH GX FKRL[ GHV QRPEUHV VH FRQUPH SOXV EDV
   ORUVTXH +pOLRJDEDOH SDU GpULVLRQ GpH 0D[LPLQ
de faire lamour trente femmes, aprs avoir rappel le
chiffre de ses seize, vingt et trente victoires antrieures.
Isidore de Sville explique en effet que le chiffre vingt
sapplique Isral37 et celui de trente au Christ38.
La parodie antichrtienne atteint un sommet dans
le chapitre (4, 1-2) o lon voit Maximin sabstenir de
manger des lgumes :
bibisse autem illum saepe in die uini Capitolinam
amphoram constat, comedisse et quadraginta libras
FDUQLV XW DXWHP &RUGXV GLFLW HWLDP VH[DJLQWD 4XRG
satis constat, holeribus semper abstinuit.

ou 4, 5 :
atu uero uigila in
omnibus labora.

Cassiodorus. With Special Advertance to the Technical Terminology of


Administration, diss. Washington, 1944, p. 103.
26. Une forme de fraternit assez peu en accord avec le sentiment
ordinaire de lauteur de lHistoire Auguste envers les barbares :
cf. St. Ratti, article Histoire Auguste dans B. Dumzil (dir.),
Dictionnaire des barbares, paratre aux PUF.
27. Le dtournement de potismes ou de mots classiques ne saurait
revtir un caractre problmatique en cette poque friande de centons,
notamment virgiliens (un sous-genre dont la technique gagne tre
tudie sans se focaliser avant tout sur Ausone : D. F. Bright, Theory
and practice in the Vergilian Cento, dans Illinois Classical Studies, 9,
1984, p. 84-90). Le vocabulaire du pote de Mantoue ny subit-il
pas un enrichissement qui peut tre gnrique autant que thmatique
(S. McGill, Tragic Vergil: rewriting Vergil as a tragedy in the Cento
Medea, dans Classical World, 95, 2002, p. 148-161) ?
28. Maximin estime, quand il est trahi par le Snat qui proclame Gordien,
VrWUHVDFULpHQYDLQSRXUOHV3qUHVme hostem iudicauerunt cum
pro his pugnarem et ipsis uincerem (18, 2).
29. La variante collabora, adopte dans les dernires moutures du
1HVWOH$ODQG HVW j MXVWH WLWUH H[FOXH GH ODSSDUDW VLPSOLp GH OD
Biblia Sacra iuxta uulgatam uersionem (d. R. W. Osb, Stuttgart,
UppG ODYRORQWpGHUHQGUHOHSUp[HLQWHQVLIVXIWj
lexpliquer et il est douteux que collaborareSXLVVHYUDLPHQWVLJQLHU
HQGXUHUFRPPH 

30. Lib. num. 83 : hic tamen [numerus] per mysterium prophetis creditur
assignatus. Eorum enim libri sedecim esse probantur.
31. Lib. num. 36, d., trad. et commentaire J.-Y. Guillaumin, Isidorus
Hispalensis, Liber Numerorum, Paris, 2005 : in Scripturis autem
sanctis iste numerus interdum omne tempus saeculi huius, interdum
UHTXLHP VLJQLFDW ; nonnumquam Ecclesiae unitatem demonstrat.
Les emplois testamentaires du nombre sept dbordent videmment de
beaucoup ce que nous apprend ce tmoignage, cf. J. J. Davis, Biblical
Numerology. A Basic Study of the Use of Numbers in the Bible, Grand
Rapids, 1968, p. 158-195, et A. Schimmel, The Mystery of Numbers,
New York / Oxford, 1993, p. 132-136.
32. St. Ratti, 394 : Q GH OD UpGDFWLRQ GH OHistoire Auguste ?, dans
AnTard, 16, 2008, p. 335-348, ici p. 338-339.
33. Auid. 6, 2 : arma militum septima die semper respexit ; Auid. 6, 3 :
Exercitium septimi diei fuit omnium militum.
34. Alex. 43, 5 : Capitolium septimo quoque die, cum in Vrbe esset,
ascendit, templa frequentauit.
35. A. Chastagnol, Le septime jour dans lHistoire Auguste, dans Bonner
Historiae Augustae Colloquium 1975-1976, Bonn, 1978, p. 133-139.
36. St. Ratti, Nicomaque Flavien auteur de lHistoire Auguste, dans
Idem, Antiquus error, cit. (n. 3), 2010, p. 217-223, ici p. 219.
37. Isidore, lib. num. 89 : datur enim et hic numerus Israel atque
Leui ; uiginti enim annorum ad proelia eliguntur, et XX annorum
tabernaculo deseruire mandantur.
38. Isidore, lib. num. 95 : in Zacharia enim Dominus triginta argenteos
pretium suae mortis accepit, et in Euangelico Christum Iudas totidem
argenteis uenumdedit. Ipse quoque Dominus et Saluator noster eadem
aetate in Iordanem descendit et mundo Euangelium praedicauit.
Siquidem et tricesimus fructus coniugatorum datur propter carnis
FRQLFWXPQHOLELGLQHVXSHUHQWXU.

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

Le passage croque videmment la feritas de Maximin39,


mais cette explication ne permet pas de comprendre la
conjonction de livrognerie et de la soif de viande pousses
lextrme comme il sied pour un gant barbare, avec
labstinence, proprement extraordinaire, de lgumes. Tout
devient limpide une fois rapproche lptre de Paul aux
Romains 14, 1-2 :
       



149

au dsert41. Lpiphrase etiam sexaginta tue aussitt


dans luf cette symbolique tout en attirant lattention
sur elle.
La moquerie antichrtienne se poursuit et, pourrait-on
dire, culmine dans la suite du passage (4, 3) :
sudores saepe suos excipiebat et in calices uel in
uasculum mittebat, ita ut duos uel tres sextarios sui
sudoris ostenderet42.

Il ne sagit rien moins que du dtournement de la


thmatique et des propres termes de la scne de Luc o
la sueur du Christ devant son calice de souffrance se fait
caillots (22, 42-44)43, dtournement non pas depuis le grec
mais par le truchement de la Vulgate ou dune quelconque
Vetus Latina porteuse des mots cls sur lesquels Flavien
exerce sa verve :

Flavien a pris au pied de la lettre, soit par ignorance


du sens dun passage quelque peu oblique mme pour
un exgte moderne40, soit par moquerie dlibre, la
faiblesse de ces Juifs de Rome qui, vers 57, simposaient une dite bien plus rigoureuse que ne le prescrivit
jamais la Loi mosaque. Ayant trouv un trait par lequel
il tait facile de ridiculiser les chrtiens, notre homme
la transpos concrtement en faiblesse physique et
a par derechef son hros imprial des prfrences
alimentaires qui conviennent un paen fort. Le niveau
GH OHFWXUH VXSHUFLHO SDU OD feritas puis la bouffonnerie sur la transpiration servent de masques la pointe
antichrtienne. Le total des viandes consommes par
Maximin nest pas le moins du monde arbitraire : on
sait limportance du nombre quarante dans la tradition
judo-chrtienne, surtout comme laps de temps, que ce
soit le Dluge, le deuil observ aprs la mort de Mose,
les rgnes de David et Salomon, ou le sjour du Christ

Sudor... guttaeFKH]/XFODWLQLVpDPrPHpWpGqOHPHQW
transport dans lHistoire Auguste : sudores... sudoris,
avec une interversion de nombre qui nie avec vigueur
le miracle christique (les gouttes de limpriale sueur
restent de la sueur). Maximin successivement propos
en exemple de vigueur paenne puis en prototype dantiChrist : la gradation savante mnage par 4, 1-3, dvore
EHOOHVGHQWVGHX[SDUWLFXODULVPHVGHODUHOLJLRQRIFLHOOH
de lEmpire relevant respectivement de la distinction entre

39. Manifestation de sa barbarie : A. Timonen, Cruelty and Death,


cit. (n. 18), p. 132 et suivantes, surtout p. 139-140 ; J.-P. Martin,
Limage de Maximin le Thrace dans Hrodien, dans M.-H. Quet (dir.),
La crise de lEmpire romain de Marc-Aurle Constantin, Paris,
2006, p. 95-98. Sur la feritas dans la taxinomie romaine classique,
voir A. Cooley, The moralizing message of the senatus consultum
de Cn. Pisone Patre, dans Greece & Rome, 145, 1998, p. 199-212,
ici p. 200 ( in short, the vice of feritas is the polar opposite of the
virtue of humanitas ), et E. Ndiaye, Ltranger barbare Rome :
essai danalyse smique, dans LAntiquit Classique, 74, 2005,
p. 119-135 passim, e.g. p. 122-123 ( la feritas englobe toutes les
manifestations de la sauvagerie, comprise comme un excs de force :
violence et cruaut sous toutes leurs formes [ferocia, belli furor] ).
La gloutonnerie de Maximin peut du reste aussi tre une mtaphore
de limprialisme romain (S. E. Phang, Roman Military Service.
Ideologies of Discipline in the Late Republic and Early Principate,
Cambridge, 2008, p. 272-273). J.-M. Carri, Le soldat, dans
A. Giardina (dir.), Lhomme romain, Paris, 2002, p. 146-147 et 150151, propose pour ce passage une clef de lecture complmentaire :
la valeur mtonymique de sudor renvoit par essence la condition
militaire, faite de labor.
40. Pace, par exemple, L. T. Johnson, Reading Romans. A Literary
and Theological Commentary, Macon, Ga, 2001, p. 209-212, voir
& ( % &UDQHOG Romans, II 9-16, Londres / New York, 1979 et
rimpr., p. 690-698 ; D. J. Moo, The Epistle to the Romans, Grand
Rapids / Cambridge, 1996, p. 830-831 ; T. L. Carter, Paul and the
3RZHU RI 6LQ 5HGHQLQJ Beyond the Pale, Cambridge, 2001,
S  3RXU XQ SDwHQ GH OD Q GX e sicle, il importait bien
HQWHQGX IRUW SHX GH VDYRLU TXL pWDLW GRFWULQDOHPHQW  GDQV
loptique paulinienne plus de trois sicles auparavant.

41. Il sagit de la longueur typique de la priode dpreuve, de mise en


cause, de retour sur soi, de contrition ou de repentance. Citons quelques
rfrences patristiques, moins accessibles que les textes bibliques
(Jrme, Sur Jonas, PL 25, col. 1140 = P. Antin, Sur Jonas, Paris,
1956, p. 94-95 ; Jean Chrysostome, Homlies sur les statues 20, 1 et
9 ; Prudence, Cathemerinon 7, 38-39, 186-187), et de la bibliographie :
J. J. Davis, Biblical Numerology, cit. (n. 31), ne traite de ce nombre
que comme un arrondi, p. 52-54, avant de mettre en tableau les valeurs
susdites p. 122-123 ; voir de prfrence A. Schimmel, The Mystery of
Numbers, cit. (n. 31), p. 246-249, qui met en exergue la symbolique
comparable de quarante dans les traditions juives et islamiques pace
notamment E. Frankel, B. P. Teutsch, The Encyclopedia of Jewish
Symbols, Oxford, 1992, p. 57 : numbers such as three and seven
KDYH ZLGHVSUHDG V\PEROLF VLJQLFDQFH EXW WKH VLJQLFDQFH RI WKH
number forty seems peculiar to the Judeo-Christian tradition ;
R. Arbesmann, Fasting and prophecy in Pagan and Christian Antiquity,
dans Traditio, 7, 1949-1951, p. 42-45 ; et S. B. Hoenig, The designated
number of kinds of labor prohibited on the Sabbath, dans Jewish
4XDUWHUO\5HYLHZ, 68, 1978, p. 193-208, en particulier p. 193, 205-206.
42. J.-M. Carri, Le soldat, dans A. Giardina (dir.), Lhomme romain, Paris,
2002, p. 151, voyait dans ce passage une libation physiologique qui
unissait symboliquement lempereur-soldat ses troupes.
43. J. H. Marshall, The Gospel, cit. (n. 14), p. 830-833 ; F. Bovon, Das
Evangelium nach Lukas, IV Lk 19,28-24,53, Zrich, 2009, p. 309-321 ;
J. B. Green, The Gospel, cit. (n. 14), p. 779-781. Le sens, ici vanescent,
de HVWWUqVELHQH[SORUpFKH]$6DXJHJsus de Nazareth contre
Jsus-Christ, 2. La fabrique du Nouveau Testament ; 3. Restitution de
lenseignement de Jsus de Nazareth, Paris, 2012, p. 420-446, surtout
p. 426-428, 432-437, mme si les conclusions gntiques auxquelles il
aboutit, comme sa thologie, sont inacceptables.

pater, si uis, transfer calicem istum a me ; uerumtamen


QRQPHDXROXQWDVVHGWXDDW. [...] Et factus est sudor
eius sicut guttae sanguinis decurrentes in terram.

150

JEAN-FABRICE NARDELLI, STPHANE RATTI

christianisme et judasme et dun merveilleux suspect


dobscurantisme pour les esprits forts ou sceptiques.
Maximin, comme sil tait une forme dgnre
du Christ (le prince pratiquait le supplice de la mise en
FURL[ DIFKHXQHVSULWGHVDFULFHHWODYDQLWHXVH
conviction en son immortalit. Mais cet orgueil est tout
animal : neque enim fuit crudelius animal in terris omnia
sic in uiribus suis ponens quasi non posset occidi (9, 2).
Cette outrecuidance fonde sur la foi en limmortalit
pourrait bien sappliquer un autre messie, dautant que
cette vaine croyance est moque dans la phrase suivante :
et qui ab uno non potest occidi a multis occiditur (9, 4).
Voil les chrtiens renvoys leur propre histoire et la
condamnation mort collective du Christ.
En forme danti-Christ non seulement Maximin
massacre les innocents (quod [] innocentes occideret :
ODUWLFOH GpQL D LFL WRXWH VRQ LPSRUWDQFH PrPH VDQV
majuscule Innocents) mais encore condamne quiconque
est pass en son Jugement : quod [] damnaret omnes
quicumque in iudicium uenissent (13, 5). Ce jugement
a ceci dinique que, sans charit ni misricorde, il ne fait
pas la part de linnocence, comme incite le comprendre
labsence de virgule entre omnes et quicumque quil faut
absolument maintenir pour conserver au texte sa saveur
antichrtienne. Il est savoureux que le Snat, une fois
*RUGLHQGHYHQXSULQFHYRXGUDYRLULQLJHUj0D[LPLQj
son tour le supplice de la croix (16, 6 : inimicus senatus
in crucem tollatur), ce qui na rien de vraisemblable
concernant un empereur, mme dchu44, et souhaitera que
quiconque le mettra mort reoive rcompense (16, 4 : qui
occiderit praemium merebitur).
La Vie des deux Maximins contient deux noms propres
qui ont, depuis longtemps, attir lattention des spcialistes et qui tous deux renvoient la dcennie 390. Celui de
7R[RWLXV  WRXWGDERUGMDGLVLGHQWLpSDU+HUPDQQ
Dessau45 comme le mari de Paula nomm par saint Jrme
(epist. 66, 107, 108). Maximin le Jeune, ensuite, excellent
lve, bilingue et cultiv, se voit donner comme matre
un rhteur du nom dEugamius. Ronald Syme46 en 1968
avait dj propos dy voir peine dform le nom
dEugenius, lui-mme rhteur mrite, proclam Auguste
en 392. Nous croyons quant nous dautant plus vraisem-

44. Prcisons au passage que la nature de ce supplice pose problme


en raison du caractre vasif de ses vocables et de la polyvalence
des descriptions ; cest le mrite de la dissertation de G. Samuelsson,
&UXFL[LRQ LQ $QWLTXLW\ $Q ,QTXLU\ LQWR WKH %DFNJURXQG DQG
6LJQLFDQFH RI WKH 1HZ 7HVWDPHQW 7HUPLQRORJ\ RI &UXFL[LRQ,
Tbingen, 2011, que de lavoir prouv, cf. p. 152-207 pour le latin
rpublicain et imprial.
45. H. Dessau, ber Zeit und Persnlichkeit der S.H.A., dans Hermes, 24,
1889, p. 337-392, ici p. 351.
46. Emperors and Biography, Oxford, 1971, p. 11. Rappelons que
5 6\PH pWDLW DX ERUG GLGHQWLHU HQ 1LFRPDTXH )ODYLHQ VHQLRU
lauteur de lHistoire Auguste : cf. Ammianus and the Historia
Augusta, Oxford, 1968, p. 111.

AnTard , 22, 2014

EODEOHFHWWHLGHQWLFDWLRQTXHFRPSRUWHFHVPRWV
que personne jusquici na correctement interprts. Au
moment de conclure sa biographie, Nicomaque Flavien
crit quil est press de passer autre chose (ad alia
properantes). Pouss par quelle urgence ? La rponse est
dans le texte : ut iubetur uelut publico iure. Ces mots ne
VLJQLHQW SDV FRPPH SHQVH SRXYRLU OHV WUDGXLUH$QGUp
Chastagnol, comme le demande ce quon pourrait
appeler le droit public , ce qui na gure de raison. Il faut
plutt comprendre : comme jen ai lobligation en raison
de mon devoir dtat . Ce devoir revt pour Flavien
limprieuse ncessit de rejoindre larme dArbogast
et dEugne en route pour les Alpes o se droulera
les 5 et 6 septembre 394 la bataille dcisive du Frigidus
contre Thodose. Stphane Ratti a dj relev dautres
passages dans lHistoire Auguste qui ne se comprennent
que si on les replace dans les mois qui prcdent lengaJHPHQW QDO  SDU H[HPSOH FHV IRUPXOHV GDSSDUHQFHV
anodines et topiques, mais qui ne le sont pas au fond, et
qui laissent percer linquitude du scriptor sur le sort qui
lattend dans un futur proche, la mort faisant partie des
hypothses devant raisonnablement tre envisages en
cas de dfaite47. Quant lobjection suivant laquelle un
des chefs du parti paen, lapproche du jugement des
armes, avait bien autre chose en tte que des frivolits
littraires comme notre collection, rappeler les exemples
DQWLTXHVVXIWSRXUOpFDUWHU48.
Un ultime passage de la Vie des deux Maximins mrite
HQQ GrWUH YHUVp DX GRVVLHU GHV QRPEUHXVHV DOOXVLRQV
antichrtiennes dissmines dans cette biographie.
/RUVTXH 0D[LPLQ OH -HXQH PHXUW GDQV OD HXU GH OD
jeunesse (LQ LSVR RUH LXXHQWXWLV ; il a tout au plus 18
ou 21 ans selon lauteur : Maximin. 27, 2) son cadavre est
MHWpDXHXYHDSUqVGpFROODWLRQ Maximin. 31, 5). Lauteur
de lHistoire Auguste cite alors le bogus scriptor
$HOLXV6DELQXVVHORQOHTXHOOHYLVDJHGXOVH[SULPDLW
une telle beaut que mme la tte du mort dj noire, dj

47. Cf Aurelian. 24, 9, lorsque Nicomaque Flavien envisage dcrire


une biographie dApollonios de Tyane si le sort (la guerre civile qui
se dessine contre Thodose) lui en laisse le loisir : Ipse autem, si uita
suppetet atque ipsius uiri fauor uisque iuuerit, breuiter saltem tanti uiri
facta in litteras mittam et de mme lorsquil achve la Vie de Probus
et voque la conclusion venir de lHistoire Auguste sur les Vie de
&DUXVHWGHVHVOVProb. 24, 8 : Post deinde, si uita suppetet, Carum
incipiemus propagare cum liberis ; voir, sur tout cela, St. Ratti, 394 :
Q GH OD UpGDFWLRQ, cit. (n. 32), p. 342 ; Nicomaque Flavien senior
auteur de lHistoire Auguste, dans Antiquus error, cit. (n. 3), p. 222, et
Nicomaque Flavien dmasqu, dans ibid., p. 261-269, ici p. 269.
48. Les soldats de Csar paniquent devant Besanon et, croyant leur
dernire heure arrive, rdigent leurs testaments (Gall. 1, 39, 5) ;
Ptrone, prs de souvrir les veines, rdige des Mmoires crypts :
DJLWLD SULQFLSLV VXE QRPLQLEXV H[ROHWRUXP IHPLQDUXPTXH HW
nouitatem cuiusque stupri perscripsit atque obsignata misit Neroni
(Tacite, ann. 16, 19. 3) ; Libanios, tout au soir de sa vie, trouva encore
PR\HQGDMRXWHUTXHOTXHVSDJHVjVRQVDQVFHVVHDXJPHQWpGDQV
sa vieillesse et malgr tout inachev (J. Martin, P. Petit, Libanios.
Autobiographie [Discours I], Paris, CUF, 1979, p. 3-7, 21).

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

souille, dj en putrfaction et marque par la corruption


offrait comme lombre dun beau visage (scribit Aelius
Sabinus, quod praetermittendum non fuit, tantam pulchriWXGLQHPRULVIXLVVHLQOLRXWHWLDPFDSXWHLXVPRUWXLLDP
QLJUXP LDP VRUGHQV LDP PDFHUDWXP GLIXHQWH WDER
uelut umbra pulchri oris uideretur)49. Nous lisons une
GRXEOHVLJQLFDWLRQUHOLJLHXVHGDQVFHVPRWV'XQHSDUW
linsistance macabre sur les effets de la dcomposition sur
la tte du jeune dcapit ne relve pas, contrairement ce
quon pourrait penser, dun got dplac pour un ralisme
de mauvais aloi. Non, il sagit dautre chose, dune pique
antichrtienne de plus. Les croyances des adeptes de la
nouvelle religion en la rsurrection de la chair dans sa
splendeur originelle sont bien connues. Les rcits des
martyrs chrtiens sont emplis de descriptions de ces corps
souffrants qui, brls et martyriss, conservent dans le
supplice leur beaut initiale50. On peut citer par exemple,
parmi les rcits dinvention de reliques, celui que fait
Paulin de Milan, qui en fut le tmoin oculaire, de la
dcouverte des restes de saint Nazaire par saint Ambroise
en 395, lui aussi victime dune dcollation :
caput etiam ipsius, quod ab impiis fuerat abscissum, ita
integrum atque incorruptum cum capillis capitis atque
barba, ut nobis uideretur eodem tempore quo leuabatur
lotum atque compositum in sepulcro51.

Lexemple le plus connu et le plus proche dans le


temps de la rdaction de lHistoire Auguste est celui de
linvention le 17 juin 38652 des reliques de Gervais et de
Protais, connue par saint Ambroise grce au rcit que
lvque en fait dans une lettre sa sur Marcellina53. Mais
ce rcit, en loccurrence, insiste sur le fait que ce sont des
VTXHOHWWHVTXLVRQWUHWURXYpVFHUWHVEDLJQpVGHVDQJ DQ
dattester de la vracit du martyre : la littrature latine na
pas attendu les chrtiens pour galer le sang et la vie54),
mais Ambroise nvoque aucunement un tat de conservation qui serait parfait. Or cest tout linverse dans le rcit
du mme vnement par saint Augustin. Alors Milan, le
futur vque na pas assist linvention des reliques, mais
rapporte les tmoignages qui lui ont t faits. Et son tour,
cdant aux topoi en vogue, il mentionne ltat de conservation des deux corps, quil dit, comme Paulin le fera pour
saint Nazaire, incorrupta :

49. Maximin. 32, 1 ; cf. A. Timonen, Cruelty and Death, cit. (n. 18),
p. 196-197.
50. Voir par exemple la premire passion connue, Le Martyre de
Polycarpe, trad. franaise dans P. Maraval, Actes et passions des
martyrs chrtiens des premiers sicles, Paris, 2010, p. 50-51,
(Polycarpe 14, 2 ; 16, 1), et Eusbe de Csare, HE 4, 15, 33, 38.
51. Paulin de Milan, Vita Ambrosii 32, PL 14, col. 38 B.
52. H. Savon, Ambroise de Milan (340-397), Paris, 1997, p. 223.
53. Epist. 77, 12, p. 134 Zelzer, CSEL, 82, 3.
54. Servius, ad Aen. 4, 2, p. 460 Thilo I : per uenas amor currit, ut
sanguis ; nam in sanguine anima, in anima amor est ; cf. dj Cicron,
Tusc. 4, 24, et Snque, Phaedr. 279-280, 640-644.

151

tunc memorato antistiti tuo per uisum aperuisti, quo loco


laterent martyrum corpora Protasii et Geruasii, quae per
tot annos incorrupta in thesauro secreti tui reconderas55.

On pourrait penser que linsistance de lHistoire


Auguste dcrire ltat de corruption de la tte coupe de
Maximin le Jeune cherche btir une antithse parfaite
avec le topos chrtien du corps demeur incorruptum, ce
mme mot tant prsent la fois chez Augustin et chez
Paulin56. Il sagit l de la premire pique antichrtienne.
La seconde est plus subtile. La beaut de Maximin le
Jeune, sur laquelle lauteur a plusieurs fois insist57, est
telle quelle transcende la mort et soffre au spectateur de la
scne malgr les dgradations subies : uelut umbra pulchri
oris uideretur. Limage est platonicienne, lide ou la forme
de la beaut du jeune prince tant visible comme par-del
la mort. Nulle ide ici de rsurrection de la chair dans la
splendeur dune vie aprs la mort, mais plutt une conviction
philosophique : le Beau obit une ide, lIde du Beau
rside au-del de son incarnation. Lon reconnat lenseignement fondamental du platonisme lmentaire. Doit-on
ici rappeler que Stphane Ratti a dcouvert, en lisant Jean
de Salisbury, que Nicomaque Flavien senior, lauteur de
lHistoire Auguste et le traducteur de la Vie dApollonius de
Tyane, tait un intellectuel noplatonisant58 ? Aurait-il pu
avoir connaissance du rcit dAmbroise Marcellina ? Rien
ne permet de le supposer, sauf peut-tre une phrase de cette
lettre de juin 386 dans laquelle lvque de Milan rappelle
la gurison miraculeuse des possds et des malades qui
ont pu toucher les vtements des martyrs : umbra quadam
sanctorum corporum plerosque sanatos cernitis59. Comme
dans lHistoire Auguste une mystrieuse et diffuse aura
sourd des corps des saints et de Maximin. Le tmoignage
rapport par Aelius Sabinus est postrieur la dcollation
GH 0D[LPLQ HW JXUH GDQV OH SpQXOWLqPH FKDSLWUH GH OD
uita. Mais le thme en est si cher au biographe quil est en

55. Augustin, Conf. 9, 16 ; cf. P. Courcelle, Recherches sur les Confessions


de saint Augustin, Paris, 1968, p. 148-149. On sait le rle jou par le
culte institutionnalis des martyrs sous Damase, la fois restaurateur
des catacombes et pionnier des pigrammes chrtiennes votives ; sa
literary strategy served to emphasize the peaceful coexistence of old
and new, classical and Christian, as well as to highlight the ideal of peace
in a city torn apart by violent tensions (M. Sghy, Scinditur in partes
populus: Pope Damasus and the Martyrs of Rome, dans Early Medieval
Europe, 9, 2000, p. 277 ; pour le renforcement de lidentit chrtienne
par le biais de la mmoire des morts, voir S. Dieffenbach, Rmische
Erinnerungsrume. Heiligenmemoria und kollektive Identitten im
Rom des 3. bis 5. Jahrhunderts n. Chr., Berlin, 2007, p. 215-329). Il
est raisonnable de penser que notre imposteur avait prsent lesprit en
aiguisant sa pointe ce puissant levier idologique des chrtiens.
56. Sur les relations de dpendance entre saint Augustin et Paulin de
Milan (le second, en relation avec Augustin en Afrique vers 412413, stant peut-tre inspir des Confessions pour son rcit de la
translation des saints Gervais et Protais), cf. E. Lamirande, La
datation de la Vita Ambrosii de Paulin de Milan, dans RAug, 27,
1981, p. 44-55, ici p. 52-53.
57. Maximin. 22, 7 ; 27, 1 ; 28, 3.
58. St. Ratti, Polmiques, cit. (n. 1), p. 129-148.
59. Ambroise, epist. 77, 9, p. 132, l. 88-89, d. Zelzer, CSEL, 82, 3.

152

AnTard , 22, 2014

JEAN-FABRICE NARDELLI, STPHANE RATTI

ralit annonc dans une anticipation qui a dconcert le


traducteur franais. On lit en effet en Max. 28, 3 :
Infamabant eum [Maximin le Jeune] ob nimiam pulchritudinem amici Maximi et Balbini et Gordiani et maxime
senatores, qui speciem illam uelut diuinitus lapsam
incorruptam esse noluerunt.

Andr Chastagnol traduit quelque peu maladroitement : [] ils ne concevaient pas quune telle vnust
qui semblait descendre du ciel pt tre reste sans tache 60.
Incorruptam constitue en ralit une prolepse, la beaut
de Maximin demeurant intacte aprs son supplice et
sa mort, rapports plus loin dans le texte. Nous proposons
de comprendre ainsi : les soutiens de Maxime, de Balbin
et de Gordien ainsi que les snateurs au premier chef le
critiquaient pour sa trop grande beaut car ils refusrent
dadmettre que cette grce pour ainsi dire accorde par les
dieux ait pu demeurer intacte . Car la beaut est depuis
la plus haute Antiquit un don des dieux, ici accorde ce
nouvel Achille tournant la course autour des remparts
dAquile61, ce que le rendu peine forc par grce
laisse entendre tout en conservant au texte la saveur
polmique antichrtienne qui est la sienne.
Maximin le Jeune se voit reprocher sa superbia qui
le pousse accepter les signes dallgeance les plus
humiliants pour ses sujets. La gradation est savamment
mnage : il se fait baiser la main, les genoux et mme les
pieds : manum porrigebat, genua sibi osculari patiebatur,
nonnumquam etiam pedes (Maximin. 28, 7). Tout lecteur
mme peu au fait de la Bible savait alors que le dieu des
chrtiens, le Christ, faisait de mme ainsi que le rapporte
Luc 7, 38 de la pcheresse dans la maison du Pharisien :

pisode. Rien dtonnant cela quand on sait que lauteur


du Satyricon, sous Trajan64, avait dj parodi la scne
de lonction de Bthanie dans un passage du roman qui
montre des esclaves oignant les pieds des convives65 :
pudet referre quae secuntur : inaudito enim more
pueri capillati attulerunt unguentum in argentea pelue
pedesque recumbentium unxerunt 66.

La scne se rpte plus bas et cette fois cest Trimalchion


en personne qui procde lonction de ses htes :
statim ampullam nardi aperuit omnesque nos unxit
et Spero , inquit, futurum ut aeque me mortuum
iuuet tanquam uiuum . Nam uinum quidem in uinarium
iussit infundi et Putate uos , ait, ad parentalia mea
inuitatos esse 67.

Le pseudo-Ptrone et Nicomaque Flavien qui avait lu


et apprci le Satyricon68 partagent le mme tonnement
scandalis devant ces pratiques et, les rapportant respectivement Trimalchion et Maximin le Jeune, y voient
la preuve dun dvoiement condamnable dans leur
comportement. Maximin senior exprime sans ambigut
sa rprobation vieille romaine, sans doute partage par
lauteur : Dii prohibeant ut quisquam ingenuorum pedibus
PHLVRVFXOXPJDW (Maximin. 28, 7). Le monde chrtien et
le vieil univers paen ne se comprennent pas.

*
*

Lutilisation du mme verbe dans les trois passages


(osculari) laisse penser que lauteur de la Vie des deux
Maximins avait au moins entendu une version orale de cet

Les railleries antichrtiennes apparaissent donc avec


une densit particulire dans la Vie des deux Maximins,
biographie qui a tout lair de reposer sur une stratgie
cohrente, subtilement dose, dinversion de la doctrine
chrtienne en gnral et de pans de lvangile de Luc en
particulier. Nous en concluons que notre modle interWH[WXHOHVWMXVWLp
Laccumulation de tous ces passages conduit nuancer
labsence de positionnement paen de lHistoire Auguste qui
fait peu prs consensus chez ceux qui se sont intresss
la question aprs Andreas Alfldi et Johannes Straub et
au rebours de leurs conclusions, cest--dire depuis une
cinquantaine dannes. Certes, aucune opposition frontale

60. Histoire Auguste. Les empereurs romains des e et e sicles, Paris,


1994, p. 681.
61. Maximin. 28, 4 : circum Aquileiam muros circumiens.
/XF
        
        



 /XF             


64. Pour la datation du roman sous le rgne de Trajan et sa situation dans


lentourage de la maisonne de Pline le Jeune, voir St. Ratti, Le monde
du Satyricon et la maison de Pline le Jeune, dans Anabases, 13, 2011,
p. 79-94.
65. Cf. K. M. Schmidt, Wege des Heils. Erzhlstrukturen und
Rezeptionskontexte des Markusevangeliums, Gttingen, 2010,
p. 79, n. 170 ; St. Ratti, Les vangiles dans le Satyricon : lments
parodiques, paratre dans Anabases, 22, 2015.
66. Sat. 70, 8.
67. Sat. 78, 3.
68. Voir St. Ratti, Polmiques, cit. (n. 1), p. 141-145.

et stans retro secus pedes eius {HQV} (om. cett. codd,


Osb) lacrimis coepit rigare pedes eius et capillis capitis
sui tergebat et osculabatur pedes eius et unguento
unguebat (Vieille latine, Vetus italica : unguebat
unguento)62

et 7, 45 :
osculum mihi non dedisti haec autem ex quo intrauit
non cessauit osculari pedes meos (Vieille latine, Vetus
italica : non cessauit osculando pedes meos)63.

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

ou dclare au christianisme ne ressort a priori de la


collection ; celle-ci se tait mme si ostensiblement sur la
UHOLJLRQRIFLHOOHTXHODVie des deux Maximins, avec son
feu roulant de lazzis peine dguiss envers le Christ et
GHVSDQVHVVHQWLHOVGXGRJPHIDLWSRXUOHPRPHQWJXUH
dexception69. Mais le scriptor Historiae Augustae na
nullement attendu de revtir le masque de Vopiscus pour
aiguiser ses nasardes codes supposant une familiarit avec
la thologie catholique chez ceux auxquels il sadresse70.
/DODWLQLWpDILJHDQWHGHV9LHVGDQVODVHFRQGHPRLWLpGHOD
collection, ou du moins de maints passages (car lauteur sait
hausser loisir le ton quand il lentend) ne fait pas obstacle
cette intertextualit ne se donnant jamais pour telle ; car
nulle contradiction nexiste entre des fautes qui semblent
symptomatiques le plus souvent dun manque de soin et
la dissimulation de piques auxquelles on peut croire que
notre homme prenait autant de plaisir qu ses inventions
historiographiques les plus oses71.
Cest mme tout le contraire. On a d objecter mille
IRLV j 6WpSKDQH 5DWWL TXXQ DULVWRFUDWH UDIQp FRPPH
Flavien navait pu crire pareille pochade, aussi mal
tourne. Le style dcidment de lHistoire Auguste ne
cadrerait pas avec son milieu dorigine. Cest oublier,
pour commencer, que la ralit humaine na jamais tabli
de cohrence absolue entre luvre et lhomme. Les
Goncourt, gens fort bien levs et hantant la bonne socit,
ont crit en leur Journal nombre dignominies de fond et
de forme dont la trivialit heurte juste titre le lecteur
contemporain. Le divin Ronsard a galement commis des

69. On ne pourra en tre sr que lorsque le type denqute auquel nous


nous sommes livrs ci-dessus aura t tendu lensemble des Vies
intermdiaires et secondaires. En effet, si nos conclusions croises
avec celles de J. Schwartz et de F. Mundt savrent valables pour un
assez grand nombre dautres passages, un seuil critique sera atteint
HW LO IDXGUD ELHQ TXDOLHU GH IURQGHXVH FHWWH LQGLIIpUHQFH HQYHUV OH
christianisme.
70. Est vise ici plus spcialement une conclusion comme celle de
S. A. Stertz, Christianity in the Historia Augusta, dans Latomus, 36,
1977, p. 694-715 (article absent des Last Pagans of Rome de
A. Cameron et qui semble pass de mode chez les spcialistes, malgr
ses qualits), ici p. 714-715 : Christianity is not a preoccupation
of the work as we have it, whatever may have been in the authors
mind. Like many of his pagan contemporaries, he tried not to think
of it and, when thought could not be avoided, treated it with ironical
resignation .
71. Les phrases aussi lourdes et gauches que Maximin. 15, 8, passage
de surcrot dpar par le consternant ad illam beluam atque illius
amicos, o le second dmonstratif est quasiment intolrable, donnent
un vif relief aux attendus de F. Paschoud, Vies dAurlien et de Tacite,
cit. (n. 2), p. XLVII-XLVIII, sur les dfaillances dun auteur qui se
surveille peu, sans doute par ngligence (p. XLVIII). Et pourtant,
les passages antichrtiens que nous avons examins invitent mettre
en doute le caractre sublittraire de lHistoire Auguste. Derrire des
allures de spontanit stylistique et par-del lapparence dcousue,
voire chevele, des ides, lintertextualit se dploie dans un choix
de mots extrmement soign selon une cohrence interne secrte. La
possibilit ne doit donc pas tre exclue a priori que le savant moderne
soit victime dun effet de texte dlibr quand, se plaant un certain
degr de gnralit, il dplore la pitre criture de la collection.

153

pices de vers qui comptent parmi les plus obscnes de la


littrature franaise toutes poques confondues72.
Cest oublier aussi que maintes uvres antiques
jouaient des registres. Sans remonter jusquaux Mnippes
de Varron, le Satyricon, apprci de Flavien, demeure une
satura dont certains passages pourraient tre du Quintilien
ou du Lucain. Les biographies romances de lHistoire
Auguste devraient-elles, s qualits, tre mieux crites que
les aventures dEncolpe ? Le trait Du sublime, rdig
dans une prose dart trs labore, se permet de nombreux
effets mimtiques aux antipodes de ce grand style ; les plus
frappants sont sans conteste les phrases lapidaires et sches
du 42, consacr la concentration de lexpression, et le
beau dsordre (Boileau) exalt chez Dmosthne
propos des effets psychologiques de lhyperbate en 22, 473.
Flavien savait tre loquent, Symmaque le disait74, et de
nombreux discours dans les Vies le prouvent ; devait-il ltre
continment, quand mme le pseudo-Longin svade parfois
GHO")ODYLHQQHSHXWQLQHYHXWSRXUVDSDUWOHMXUHU
prfrant ne promettre, dans le prambule de la Vita Probi, le
respect ni de quelque facultas (le talent) ni de leloquentia75.
Aprs tout pourquoi ne pas prendre au srieux laveu selon
lequel il naurait rdig son Histoire (rem) que dans le but de
fournir un suivant plus loquent que lui-mme une matire
susceptible dtre rehausse stylistiquement76 ?
Eunape, au mme moment, manie les registres littraires
et les claviers dexpression comme le rhteur professionnel quil est : lapidaire et accessible dans les Vies des
Sophistes, alambiqu jusqu la confusion dans les dissertations morales ou les rcits de son Histoire Nouvelle, son
style devient dune abstraction rebutante sans rien renoncer
de sa complexit lorsquil prend position en historiographie77. Faut-il dautres exemples ? La biensance dont le

72. Retranches par lui ses Folastries au tmoignage de Pierre de


ltoile et qui ont leur exact parallle dans les Sonneti lussuriosi de
Pietro Aretino (publis en 1527 avec les gravures pornographiques
de Marcantonio Raimondi) ; ce sont les trois sonnets Dieu, cons
rondelets, corralines fossettes... (J. Card, D. Mnager, M. Simonin,
Ronsard. uvres compltes, 2, Paris, 1994, p. 1231) ; Foutez bouches,
culs, cons, et dune main lubrique... (ibidem, p. 1246) ; Il me dplait
beaucoup quune nouvelle mche... (ibid., p. 1247).

          


        

       &I
D. A. Russell, Longinus On the Sublime. Edited with Introduction
and Commentary, Oxford, 1964, p. 139 et surtout, C. M. Mazzucchi,
Dionisio Longino, Del sublime. Introduzione, testo critico, traduzione e
commentario, 2e dition largie, 2010, p. 228-230.
74. Epist. 9, 110, 2.
75. Prob. 1, 6 : Neque ego nunc facultatem eloquentiamque polliceor.
76. Prob. 2, 6 : Illud tantum contestatum uolo me rem scripsisse quam,
si quis uoluerit, honestius eloquio celsiore demonstret.
77. Citons la partie du fr. 73 Mller qui cible ses concurrents rcents (259,
'LQGRUI 

154

AnTard , 22, 2014

JEAN-FABRICE NARDELLI, STPHANE RATTI

philologue moderne ne veut imaginer quelle nait pas t


partage par les Anciens a conduit, contre Robert Yervelton
Tyrrell / Louis Claude Purser et Jrme Carcopino, ldition
Bud de la correspondance de Cicron athtiser le billet
Basilus du 15 mars 44 dans lequel lArpinate exprimait de
manire trop crue sa joie la nouvelle la mort de Csar78 :
si peu dhumanitas ne pouvait convenir un homme
comme Cicron ! Romain Gary, car cela ne lui ressemblait
pas, navait pu crire ni Gros Clin ni la Vie devant soi : on
crut alors lexistence dmile Ajar79.
Et si le style si peu acadmique de Flavien dans
lHistoire Auguste tait le masque de son effronterie ?
Ce noplatonicien ne voulait tre ni lu ni compris de
tous, conformment au vieil habitus des philosophes
qui distinguaient leur enseignement exotrique de leur
message sotrique80. Saint Augustin avait, quant lui,
bien compris que le scepticisme de la Nouvelle Acadmie
cachait quelque chose dautre, quil tait essentiellement
une prudence, un paravent, destin soustraire les thses
spiritualistes de lcole platonicienne aux attaques des
matrialistes stociens et picuriens : Je croyais alors
que leur doctrine tait pour de bon celle quon leur

        

           
       


          


        VF
  7UDGXFWLRQ DEOH FKH] ) 3DVFKRXG Zosime, Histoire
nouvelle, III 1, Paris, CUF, 1986, p. 325-326 ; le commentaire le moins
rducteur de ce passage semble tre A. B. Breebaart, Eunapius of Sardes
and the writing of History, dans Mnemosyne, 32, 1979, p. 366-367, 371.
Le trs formaliste M. Steinrck, Haltung und rhetorische Form. Tropen,
Figuren und Rhythmus in der Prosa des Eunap von Sardes, Hildesheim,
2004, ptit de son absence presque totale de considration pour les
fragments historiques (voir le Stellenindex, p. 173).
78. Voir St. Ratti, Cicron, Att. 15, 20, 2 (772, 2) : une correction tragique,
dans Revue de Philologie, 79 (2), 2005, p. 319-324, surtout p. 320, n. 3.
Fam. 6, 15 (699 Tyrrell-Purser, 322 Shackleton Bailey), en date du
15 mars, dit : tibi gratulor, mihi gaudeo ; te amo, tua tueor ; a te amari
HW TXLG DJDV TXLGTXH DJDWXU FHUWLRU HUL XROR. Lditeur de Cicron
dans la CUF, J. Beaujeu, refuse la contemporanit des Ides de mars et
relgue le billet en petits caractres dans une notice annexe au texte
(Cicron, Correspondance IX, Paris, CUF, 2002, p. 54), tout fait
tort, cf. D. R. Shackleton Bailey, Cicero. Epistulae ad Familiares,
2, Cambridge, 1977, p. 461-462, qui parle de ces lignes comme so
uniquely apt to this context that it is hard to imagine them in any other .
Pour ce quelles nous apprennent sur lArpinate, relire J. Carcopino,
Les secrets de la correspondance de Cicron, 2, Paris, 1947, p. 31-33.
79. R. Gary demeurait prisonnier de la gueule quon lui avait faite et il
SDUDLVVDLWLPSHQVDEOHTXHOpFULYDLQHQQGHSDUFRXUVTXLOpWDLWHW
produit quelque chose daussi neuf que Gros Clin. Lorsque lauteur se
dvoilait, on ne voulait pas le croire : Romain Gary tait bien incapable
davoir crit cela ! (R. Gary, Vie et mort dmile Ajar [Collection
Blanche], Paris, 1981, p. 17). Sur cette question, cf. St. Ratti, Les anctres
dmile Ajar, dans Mdium, 40, 2014, p. 109-124.
80. Voir L. Strauss, La perscution et lart dcrire, Paris, 2003, p. 39, et
St. Ratti, Polmiques, cit. (n. 1), p. 26-27.

impute communment ; je navais pas alors pntr leurs


vritables intentions 81.
Paratre trivial loignait les soupons et le nglig du
style, particulirement sensible dans cette priode friande
de sophistication formelle82, dcourageait les non-initis.
Faire fuir pour ne conserver que les lecteurs que lon
dsire avoir est une vieille tactique des gens de lettres.

*
*

En conclusion, nous dirons encore quelques mots en


faveur de la paternit de Flavien sur lHistoire Auguste.
Les traits qui loignent le plus la collection de lhistoriographie romaine traditionnelle mesure quelle se
dveloppe, soit la malveillance sous-jacente de certaines
des Vies intermdiaires et secondaires envers le christianisme et lingniosit suppler suo Marte les lacunes
de la documentation, ont chance de reprsenter les deux
versants de la mme stratgie littraire. Une phrase
FRPPHODFRQFHVVLRQKDXWDLQHSDU&RQVWDQWLQGH
  DX[ SDwHQV GHV SURYLQFHV ODLVVH HQ
effet songeur83 : si lantithse entre la vrit chrtienne
et lerreur ou le mensonge paen remonte aux apologistes
du second sicle84, les termes exalts que sa canonisation
dans cette clause de ldit constantinien revt chez Eusbe
respirent plus que du triomphalisme. De fait, la tranquille
assurance que le polythisme a vcu y transpire. Ds
lors on voit assez bien, une fois que le recul des temps
D PDQLIHVWp OHV OLPLWHV GH FHWWH WROpUDQFH XQ Q OHWWUp
SDwHQ HQGRVVHU FHWWH DVVLJQDWLRQ GX  UHOLJLHX[

81. Conf. 5, 19 : ita enim et mihi liquido sensisse uidebantur ut uulgo


habentur, etiam illorum intentionem nondum intellegenti ; cf. aussi
Augustin, C. Acad. 3, 20, 43
82. J. Fontaine, tudes sur la posie latine tardive dAusone Prudence.
Recueil de travaux, Paris, 1980, p. 2-5 ; J.-L. Charlet, Tendances
esthtiques de la posie latine tardive (325-470), dans Lempire des
Thodoses, AnTard, 16, 2008, p. 159-167, ici p. 162 (no-alexandrinisme).
83. Eusbe, Vita Constantini        
        

84. Entre bien dautres, citons Tertullien, Scap. 2, 2 sed nec religionis
est cogere religionem, quae sponte suscipi debeat, non ui ; cum et
hostiae ab animo libenti expostulentur. Ita etsi nos compuleritis ad
VDFULFDQGXPQLKLOSUDHVWDELWLVGLLVXHVWULV ;DELQXLWLVHQLPVDFULFLD
non desiderabunt nisi si contentiosi sunt ; contensiosus autem deus
non est. Denique qui est uerus, omnia sua ex aequo et profanis et suis
praestat, et Aristide, Apologie 15, 3 (C. Alpigiano, Aristide di Atene.
Apologia)ORUHQFHS   


&I
A. L. Fischer, Lactantius ideas relating Christian truth and Christian
society, dans Journal of the History of Ideas, 43, 1982, p. 355-377,
surtout p. 361-366 ; F. van Haeperen, Reprsentations chrtiennes du
SRQWLFDWSDwHQ, dans Latomus, 64, 2005, p. 695-698.

AnTa rd , 2 2 , 2 0 1 4

RECHERCHES SUR LAMBIANCE ANTICHRTIENNE DE LHISTOIRE AUGUSTE

aux tenants de la religion traditionnelle et satteler


OXL pULJHU XQ  OLWWpUDLUH VRXV FRXYHUW GKLVWRULRJUDSKLH (Q WDQW TXH YLUWXRVH GX PHQVRQJH RIFLHO
sachant quoi sen tenir sur les arcana imperii, un trs
haut fonctionnaire romain cadre, croyons-nous, mieux
que quiconque avec cette motivation. Les Relationes de
Symmaque85, un moindre titre celles dAurelius Anicius
Symmachus prserves par la Collectio Auellana86
illustrent abondamment la vacuit et le sens politique et
mondain du cant qui sont alors la marque de fabrique
des rapports des prfets aux bureaux impriaux. Comme
dj du temps de Pline le Jeune rendant compte Trajan
depuis la Bithynie, les vritables problmes sont traits
SDU OD SUpWpULWLRQ RX UpVHUYpV SRXU OHV SLqFHV MXVWLFDtives ; prdominent les broutilles circonstancielles et les
lieux communs nourrissant lapologie du prfet son
prince, selon les codes du crmonial aulique plutt que
GDSUqV OHV SUpFHSWHV GXQH DGPLQLVWUDWLRQ HIFDFH87.
(Cette dernire appartenait du reste au pass rvolu pour

85. Jusques et y compris la Relatio 3, propos de lAutel de la Victoire,


calibre en fonction dun contexte formel et diplomatique trs
SDUWLFXOLHUTXLDLQXHQFpORUDWHXUVLOQHODSDVHQIHUPpGDQVXQ
vritable carcan : J. F. Matthews, Symmachus and the Oriental Cults,
dans JRS, 63, 1973, p. 188-189.
86. Ne ft-ce que par la force des choses, Aurelius Symmachus ayant
t prfet de la Ville au moment de la mort du mdiocre pape Zosime
et ayant d naviguer en eaux troubles entre Ravenne, la populace, et
les deux prlats rivaux (S. Christo, Some notes on the BonifacianEulalian schism, dans Aevum, 51, 1977, p. 163-167, fournit un rcit
circonstanci et clair des vnements). cette occasion, laveu pour
le moins candide du coup de chance sans lequel il serait tomb aux
mains des esclaves en furie (Auell., 29, 5 nisi ad liberandos nos
diuinitas affuisset egressique per secretiorem partem ictum saxorum
et impetum conspiratae multitudinis uitaremus, minime potuissemus
HXDGHUH 4XRUXP PDLRUHP SDUWHP LQ VHUXLV FRQVWDW IXLVVH H[
quibus aliquanti agniti atque tenti sunt audiendi) tire son excuse des
circonstances, peut-tre aussi du rang du destinataire du rapport (le
patrice Constantin, non lempereur lui-mme).
87. Dmonstration clairante chez G. Sabbah, La mthode dAmmien
Marcellin. Recherches sur la construction du discours historique
dans les Res Gestae, Paris, 1977, p. 148-150, en particulier p. 150 :
Tiraill entre lobligation de faire rgner lordre et celle de ne
jamais avouer que lordre a besoin dtre rtabli, le prfet se rfugie
dans les gnralits et procde par compensations. [] Ces deux
DUWLFHV  FRPSHQVDWLRQV SUpOLPLQDLUHV UHMHW GH OLQDYRXDEOH j
OD Q  DSSDUDLVVHQW FKH] 6\PPDTXH DYHF XQH QHWWHWp HW SUHVTXH
une ingnuit qui prtent facilement la caricature. On peut croire
SRXUWDQWTXHVXUFHSRLQWHQFRUHVDSUDWLTXHUHSUpVHQWHGqOHPHQW
et sans humour autre quinvolontaire, celle dune poque o la
FRQWUDLQWHH[SOLTXHHWMXVWLHWRXWHVOHVIRUPHVGK\SRFULVLH,OHVW
facile de manquer cette interpntration de la forme et du fond ; ainsi
dans son esquisse, au demeurant solide, de la valeur testimoniale
de ces compositions (Commento storico alle Relationes GL 4XLQWR
Aurelio Simmaco, Pise, 1981, p. LXVII-LXXXVIII), D. Vera ne
signale gure comme rserves historiographiques que le manque de
donnes dtailles (p. LXXIX-LXXX), alors quil insiste pourtant,
et juste titre, sur le scrittore impreciso, amante del linguaggio
fumoso dei letterati, approssimativo in fatto di terminologia giuridica
e amministrativa (p. LXXX).

155

les Ambroise, Ammien, Libanios ou Symmaque.) Avec


son affectation de srnit et de rigueur, la compensation
rhtorique semble tablir une passerelle entre le genre
des relationes et la parodie antichrtienne dans lHistoire
Auguste : l o les Symmaques devaient composer avec
OpWLTXHWWH VH MXVWLHU HW IDLUH HQWHQGUH j GHPLPRW OHV
soucis de fond88 en marge de la mise en scne du business
as usual et des sentiments lgitimistes de la populace,
dans son Histoire Auguste, Flavien feinte avec le respect
d la religion des empereurs pour mieux lreinter sitt
que se prsente loccasion de broder sur un prince ou un
usurpateur. Sources inventes, archives imaginaires et
anecdotes controuves89 conspirent alors avec la srnit
de ton affecte du moins jusqu lhypostase Vopiscus
DQGHIDLUHGHFHVJXUHVGRXWHXVHVGHOD5RPHpWHUQHOOH
dont le paganisme tardif ne se sentait gure solidaire, les
victimes expiatoires de la rancune envers le christianisme
dont Alan Cameron a chou faire table rase. Par un
jeu de compensation, le traditionaliste Flavien les tourne
la gloire du mos maiorum. Ce nest pas le moindre des
paradoxes de son texte fascinant.
Marseille &
Universit de Franche-Comt

88. On serait plus quintress connatre le son de cloche que Symmaque


GRQQDDX[EXUHDX[LPSpULDX[TXDQGjODQGHOpWpLOWFKDVVHU
les trangers de Rome pour rserver les distributions frumentaires aux
seuls citoyens (H. P. Kohns, Versorgungskrisen und Hungerrevolten
im sptantiken Rom, Bonn, 1961, p. 168-182). Cet pisode fort peu
glorieux ne lui arrache, dans sa correspondance, que des lamentations
conventionnelles (epist. 2, 7, 3 : Dii patrii, facile gratiam neglectorum
sacrorum ! Miseram famam pellite ! : cf. G. A. Cecconi, Commento
storico al libro ,,GHOO(SLVWRODULRGL4 Aurelio Simmaco, Pise, 2002,
p. 164-165), suivies par une coda (quamprimum reuocet urbs nostra,
quos inuita dimisit !). Dans cette dernire on est libre de reconnatre,
au choix, une piteuse exonration rhtorique ou un aveu de mauvaise
gouvernance antrieure (par Gratien selon O. Seeck, 4 Aurelii
Symmachi quae supersunt, Berlin, 1883, p. CXIX-CXX ?) ; en tout
cas il serait imprudent de la surinterprter au vu de G. A. Cecconi,
p. 155. Or, face aux accusations dAmbroise, off. 3, 7, 49-51,
notamment 49 : nihil hoc turpius : excludere quasi alienum et exigere
quasi suum et 51 : quam uero illud superius honestum atque utile, le
rapport, certainement apologtique et vasif, que na pu se priver de
rdiger Symmaque manque dans ses Relationes. loquent silence !
On mesure combien, au-del de la conduite administrative, le souci
de la fama du prfet jouait au moment de la rdaction de ces pices
minemment sensibles que sont ses rapports. Cest dire aussi quel
point les circonlocutions de cour dont tait tisse la relatio affrente
jXQHPHVXUHGLIFLOHUHVWpHGDQVOHVPpPRLUHVSRXYDLHQWFRQWLQXHU
de se montrer embarrassantes pour son auteur et protagoniste encore
des dcennies plus tard.
89. Soit encore un trait commun aux parties imaginatives de lHistoire
Auguste et aux moins littraires des relationes, cf. G. Sabbah, La
mthode, cit. (n. 87), p. 154, n. 185 (appels aux tmoignages et aux
vidences dans la Collectio Auellana).

AnTard , 22, 2014, p. 156- 176


DOI 10.1484/J.AT.5.103185

AT TUM INSTANTIUS, SALVIANUS


ET PRISCILLIANUS ROMAM PROFECTI:
EL VIAJE DE LOS PRISCILIANISTAS HACIA LA CIUDAD ETERNA
'3$

$WWXP,QVWDQWLXV6DOYLDQXVHW3ULVFLOOLDQXV5RPDPSURIHFWL
The Priscillianists itineraries to the Eternal City
Following the enactment of Gratians rescript, Priscillianists were expelled from the episcopal sees they had
so eagerly achieved. Given the seriousness of their situation, they decided to march to Rome in the hope that, by
presenting themselves in person before the Pope Damaso, they could reverse the position they were in. Although
Sulpicius Severuss account provides little information about the route followed by the Priscillianists, we believe that
it is possible to offer a plausible reconstruction of the path that led Priscillian and his companions to the Eternal
City. In this task, we will take account of every source traditionally employed for the study of Priscillianism, as well
as information provided by the main itineraria known in Roman times. [Author]

Sulpicio Severo nos dice que Instancio, Salviano y


Prisciliano marcharon hacia Roma para defenderse ante
el obispo Dmaso de las acusaciones de carcter hertico
que sus adversarios haban empleado contra ellos, y
TXH KDEtDQ QDOPHQWH SURYRFDGR OD H[SXOVLyQ GH ORV
priscilianistas de sus iglesias mediante el rescripto de
*UDFLDQR TXH GHVSRMy D QXHVWURV SURWDJRQLVWDV GH ODV
VHGHVVREUHODVFXDOHVHMHUFtDQVXLQXHQFLD1.
/D GHFLVLyQ WRPDGD SRU 3ULVFLOLDQR \ VXV VHJXLGRUHV
tiene gran trascendencia en el desarrollo de los
DFRQWHFLPLHQWRVTXHFRQGXFLUiQDODFRQGHQD\HMHFXFLyQ
de los lderes priscilianistas, dado que supone un punto de
LQH[LyQGHJUDQLPSRUWDQFLDHQWRGRHOFRQLFWR7UDVVX
regreso de Roma, los priscilianistas tomarn la iniciativa.
Conseguirn recuperar las iglesias perdidas, asediarn
D VXV DGYHUVDULRV \ HQ GHQLWLYD UHYHUWLUiQ OD GLItFLO
VLWXDFLyQ HQ OD TXH VH HQFRQWUDEDQ DQWHV GH VX SDUWLGD
Todo ello convierte este viaje y todo lo que lo rodea en

1. Sulp. Sev., Chron.  KHPRV HPSOHDGR OD YHUVLyQ GH


G. de Senneville, Sulpice Svre ; introduction, texte critique,
traduction et commentaire, 1999, Pars.

XQDFXHVWLyQGHVXPDLPSRUWDQFLDMXVWLFDQGRVXDQiOLVLV
pormenorizado. Ms an cuando en el relato de Sulpicio
existen incongruencias notables a las cuales trataremos de
dar respuesta en el presente trabajo.
No obstante, si uno se sumerge en la profusa
bibliografa disponible, es difcil encontrar un anlisis
profundo de esta parte de la historia priscilianista. En
la mayora de los casos los investigadores recurren a las
informaciones transmitidas por Sulpicio Severo sin ir ms
all. Sus enfoques se centran en los antecedentes del viaje,
as como en los sucesos acaecidos tras el regreso de los
priscilianistas. Benedikt Vollmann, sin lugar a dudas uno
GHORVSLODUHVGHODLQYHVWLJDFLyQVREUHHOSULVFLOLDQLVPR
analiza el Konzil von Caesaraugusta, los sucesos de
Mrida (Die Ereignisse von Emerita \ODSURPXOJDFLyQ
del primer rescripto de Graciano (ersten Reskipt Gratian)
con gran perspicacia, reproduciendo despus el Romreise
VHJ~QHOUHODWRVXOSLFLDQR$FRQWLQXDFLyQVHFHQWUDHQHO
anlisis del Konzil von Burdigala y el Trierer Proze2.

2. B. Vollmann, Priscillianus, en RE, 1974, pp. 485-559.

158

AnTard , 22, 2014

DIEGO PIAY AUGUSTO

Reconstruccin del viaje de los priscilianistas a Roma ( D. Piay Augusto).

(V HYLGHQWH QR REVWDQWH TXH HQWUH OD PRWLYDFLyQ TXH


OOHYyD3ULVFLOLDQR\DVXVFRPSDxHURVDGHVSOD]DUVHKDVWD
ODFLXGDGHWHUQD\ODVFRQVHFXHQFLDVGHGLFKDDFFLyQH[LVWH
un gran vaco ante el cual las breves palabras de Sulpicio
parecen ser el nico recurso. Virginia Burrus es quien con
mayor xito ha tratado de superar este obstculo, haciendo
observaciones de gran perspicacia en su trabajo sobre el
priscilianismo3. Una de las cuestiones quizs ms llamativa a
la que trata de dar respuesta es el desvo de los priscilianistas
hacia Burdigala en su camino hacia Roma. A su entender,
OD YLVLWD D OD FLXGDG EDxDGD SRU HO *DURQD REHGHFLy D
motivos de ndole estratgica. Los priscilianistas queran
REWHQHUFDUWDVGH'HOQLRRELVSRGHBurdigala y acaso de
Febadio, obispo de Agen, para demostrar que no haban sido
condenados en el concilio que haba tenido lugar haca poco

3. V. Burrus, The Making of a Heretic. Gender, Authority, and the


Priscillianist Controversy (Transformations of the Classical
Heritage, 24), Berkeley, 1995.

tiempo en Caesaraugusta46L'HOQLRUHFKD]yUHFLELUDORV
SULVFLOLDQLVWDV HOOR VH GHELy D TXH 3ULVFLOLDQR \ ORV VX\RV
representaban una amenaza para la unidad de la comunidad
FULVWLDQDORFDO'LFKDKLSyWHVLVVHRSRQHDODLGHDH[SUHVDGD
SRU+HQU\&KDGZLFNSDUDTXLHQHQUHDOLGDG'HOQLRQHJy
el acceso de los priscilianistas a Burdigala porque recordaba
bien las sesiones de CaesaraugustaHQHODxR5. En su

4. Al concilio acudieron 12 obispos, cuatro galos y el resto posiblemente


hispanos. De entre los asistentes, destaca la presencia de Delphinus,
obispo de Burdigala, Itacius, obispo de Ossonoba, Simposius,
obispo de Asturica Augusta e Idatius, obispo de Emerita, todos
ellos implicados en la controversia priscilianista. De todos ellos
VyOR 6LPSRVLR GHPRVWUy FRQ HO WLHPSR TXH HVWDED D IDYRU GH
3ULVFLOLDQR\VXVVHJXLGRUHV/RVFiQRQHVUPDGRVHQHOFRQFLOLR
UHFRJHQODSUHRFXSDFLyQGHODMHUDUTXtDHFOHVLiVWLFDSRUFRQWURODUORV
PRYLPLHQWRV DVFpWLFRV \ VREUH WRGR HO SULVFLOLDQLVPR 8QD HGLFLyQ
crtica del Concilio de Caesaraugusta en G. Martnez, F. Rodrguez,
La Coleccin Cannica Hispana, 4, Madrid, 1984, pp. 291-296.
5. H. Chadwick, Prisciliano de vila. Ocultismo y poderes carismticos
en la Iglesia primitivaWUDG-//ySH]0XxR]0DGULG

AnTa rd , 2 2 , 2 0 1 4

EL VIAJE DE LOS PRISCILIANISTAS HACIA LA CIUDAD ETERNA

RSLQLyQ ORV SULVFLOLDQLVWDV Vt KDEtDQ VLGR FRQGHQDGRV HQ


dicho concilio, por lo que era una temeridad permitirles
HQWUDU HQ OD FLXGDG 2WUR SXQWR GH FRQLFWR HQWUH DPERV
investigadores se basa en el orden de los acontecimientos:
Virginia Burrus opina que los priscilianistas visitaron a
Ambrosio en Mediolanum antes de acudir a Dmaso;
+HQU\ &KDGZLFN GHIHQGtD OD VXFHVLyQ GH ORV KHFKRV WDO
y como aparece en la obra de Sulpicio Severo. Escribano
haba seguido tambin a Henry Chadwick, sugiriendo que
probablemente los priscilianistas haban acudido en primer
OXJDU D 'iPDVR \ VyOR SRVWHULRUPHQWH D$PEURVLR GDGR
que la superior potestas de la sede romana as lo aconsejaba6.
La mayora de los investigadores aceptan en la
actualidad el relato de los acontecimientos propuesto
por Virginia Burrus. Mara Veronese, analizando los
sucesos que llevaron a la condena y muerte de Prisciliano,
sigue sus teoras al referirse al viaje emprendido por
los priscilianistas, sin aportar mayores precisiones y sin
apartarse en lo esencial de Virginia Burrus7. Tambin
Margarida Simes se adhiere sin controversia al discurso
de Virginia Burrus8. Daniel Knig es tambin heredero
de la investigadora anglosajona, si bien aporta un anlisis
PiV SURIXQGR GH OD PRWLYDFLyQ GH *UDFLDQR D OD KRUD
de condenar a los priscilianistas con su rescriptum9. En
OD LQWURGXFFLyQ D VX UHFLHQWH WUDGXFFLyQ GH ORV WUDWDGRV
SULVFLOLDQLVWDV 0DUFR &RQWL HQVDO]D OD UHFRQVWUXFFLyQ
del viaje ofrecida por Virginia Burrus, retomando sus
conclusiones10+HUQiQ*LXGLFHVHGRFWRUyFRQXQDWHVLV
sobre el empleo de la Biblia por Prisciliano, en cuyo
proemio pasa velozmente por el relato de los hechos
y tambin del viaje a Roma, sin complementar las
conclusiones de Virginia Burrus11.
6iQFKH] UHSLWH HQ VX REUD PRQRJUiFD VREUH HO
priscilianismo las informaciones ofrecidas por Sulpicio
6HYHUR SHUR ODV DFRPSDxD GH YDOLRVDV SUHFLVLRQHV
FURQROyJLFDV12. De este modo actualizaba las informaciones
que Ernest-Charles Babut haba ofrecido en su trabajo ya
centenario sobre el priscilianismo13.

6. M. V. Escribano, Iglesia y Estado en el certamen priscilianista. Causa


Ecclesiae y iudicium publicum, Zaragoza, 1988.
7. M. Veronese, Tempora Gravia et periculosa: Il caso Priscilliano, en
Auctores Nostri, Studi e testi di letteratura cristiana antica, 5, 2007,
pp. 237-262. Sobre el viaje a Roma ver pp. 240-241.
8. M. Simes, Prisciliano e as tenses religiosas do sculo IV, Lisboa,
2002.
9. D. Knig, 0RWLYHVDQGMXVWLFDWLRQVIRUHQIRUFLQJUHOLJLRXVFRQIRUPLW\
A manichean Priscillianist case study (302-572), en Francia:
Forschungen zur westeuropischen Geschichte, 35, 2008, pp. 1-29.
10. M. Conti, Priscillian of Avila, The Complete Works, Oxford / New York,
2009.
11. H. M. Giudice, Prisciliano y la Biblia, Roma, 2008.
12. S. J.-G. Snchez, Priscillien, un chrtien non conformiste. Doctrine
et pratique du priscillianisme, Pars, 2009.
13. E.-Ch. Babut, Priscillien et le Priscillianisme, Pars, 1909. A da
de hoy las conclusiones de E.-Ch. Babut siguen siendo vlidas en
PXFKDV GH ODV FXHVWLRQHV WUDWDGDV SRU OD LQYHVWLJDFLyQ VREUH HO

159

John Matthews enmarca la controversia priscilianista


dentro de las intrincadas relaciones de las aristocracias
occidentales y la corte imperial durante la tardorromanidad,
haciendo un valioso anlisis de las motivaciones que
llevaron a los priscilianistas a buscar el apoyo del poder
secular tras el rechazo de las autoridades episcopales en
su viaje a Roma14.
Random Van Dam analiza el viaje realizado por los
priscilianistas dentro del contexto galo tardorromano,
DUPDQGRTXHORVSULVFLOLDQLVWDVGXUDQWHVXYLDMHD,WDOLD
aparecieron en las ciudades galas como una suerte de
monjes itinerantes del Medievo15.
5RVD 6DQ] FRQ JUDQ VDJDFLGDG GHVFXEULy HQ OD OH\
recogida en el CTh XVI, 2.35, lo que muy posiblemente
SRGUtD VHU XQD DOXVLyQ DO UHVFULSWR GH *UDFLDQR TXH
expulsaba a los maniqueos y pseudoepiscopos a
100 millas de sus ciudades (VWD OH\ DIHFWy GH PDQHUD
decisiva a los priscilianistas impulsndolos a viajar a
Roma16. Sanz difera as de las tesis de Aline Rousselle
y Mara Victoria Escribano, para quienes el rescripto de
Graciano se esconda bajo la ley recogida en el CTh XVI,
5.4, promovida por los emperadores Valente, Graciano
y Valentiniano contra los herejes en general y fechada
HQWUHORVDxRV\17. Reivindicaba adems el alto
status de los priscilianistas, dado que su proceder tras
OD SURPXOJDFLyQ GHO UHVFULSWR GH *UDFLDQR VyOR SRGtD
entenderse en el seno de grupos poderosos y conocedores
de la esfera poltica. Sugera incluso que Prisciliano y
Dmaso quizs ya se conocan, circunstancia que de ser
FLHUWD KDEUtD VLQ GXGD LQXHQFLDGR D ORV SULVFLOLDQLVWDV
FXDQGRWRPDURQODGHFLVLyQGHYLDMDUD5RPD18.

priscilianismo. Su trabajo ocupa sin duda un merecido lugar entre las


obras de referencia para el estudio del priscilianismo.
14. J. Matthews, Western Aristocracies and Imperial Court. AD 364425, Oxford, 1975.
15. R. Van Dam, Leadership and Community in Late Antique Gaul,
Berkeley / Los Angeles / Londres, 1985.
16. J. Roug, Lois religieuses des empereurs romains de Constantin
Thodose II (312-438), 1. Code Thodosien XVI (SC, 497), Pars, 2005,
pp. 188-191, XVI, 2.35. Si los sacerdotes reunidos en asamblea han
expulsado a alguno de la sede y del nombre episcopal y si es sorprendido
conspirando o en contra de la ley o en contra de la tranquilidad pblica
\UHFODPDQGRGHQXHYRHOVDFHUGRFLRGHOFXDOKDVLGRPDQLHVWDPHQWH
expulsado, que pase su vida, segn la ley de Graciano de divina
memoria, a ms de cien millas de la villa que ha mancillado.
17. M. V. Escribano, Iglesia, cit. (n. 6), p. 280; A. Rousselle, 4XHOTXHV
aspects politiques de laffaire priscillianiste, en RA, 83, 1981, pp. 85/DOH\YHUVDVREUHODFRQVFDFLyQGHORVOXJDUHVGHUHXQLyQGHORV
herejes. J. Roug, Lois religieuses, cit. (n. 16), pp. 230-232, XVI, 5.4,
$QWDxRDIDYRUGHODUHOLJLyQGHODVDQWLGDGFDWyOLFD\SDUDSRQHUQD
ODXVXUSDFLyQGHODVUHXQLRQHVKHUpWLFDVTXHVXVUHXQLRQHVVHFHOHEUHQ
en villas o en el mundo rural fuera de las iglesias donde reina nuestra
SD]KHPRVRUGHQDGRTXHVHDQFRQVFDGRVWRGRVORVOXJDUHVGRQGH
EDMRHOIDOVRSUHWH[WRGHODUHOLJLyQVHKD\DQHULJLGRDOWDUHV6LHVWR
VXUJLySRUODQHJOLJHQFLDGHORVJREHUQDGRUHVRSRUODGHVKRQHVWLGDGGH
los sacrlegos, que esto sea la ruina de unos y de otros.
18. R. Sanz, Aproximacin al estudio de los ejrcitos privados en
Hispania durante la antigedad tarda, en Gerin, 4, 1986, pp. 225264. Sobre el priscilianismo pp. 229-234. Segn el /LEHU3RQWLFLDOLV,

160

DIEGO PIAY AUGUSTO

Del anlisis realizado sobre el estudio del viaje de los


priscilianistas en la bibliografa existente, se deduce que
los investigadores que han tratado el tema hasta la fecha se
han centrado en tres cuestiones principales: la cronologa,
ODLGHQWLFDFLyQGHOUHVFULSWRGH*UDFLDQR\HORUGHQGHORV
acontecimientos narrados por Sulpicio, concretamente en lo
TXHVHUHHUHDODSUHVHQFLDGHORVSULVFLOLDQLVWDVHQ0LOiQ
Ninguna de ellas representa el tema central de nuestro
estudio, que como ya hemos expresado, pretende reconstruir
el itinerario seguido por los priscilianistas durante su
viaje a Roma19. No obstante, todas ellas se encuentran
estrechamente relacionadas con nuestro objeto de estudio,
por lo que sern tratadas en mayor o menor medida cuando
QXHVWUD DUJXPHQWDFLyQ DVt OR H[LMD 6t FUHHPRV QHFHVDULR
GHGLFDUXQDQiOLVLVPiVH[KDXVWLYRDODSDUWDGRFURQROyJLFR
GDGR TXH OD UHDOL]DFLyQ GHO YLDMH GH ORV SULVFLOLDQLVWDV D
5RPDQHFHVLWyGHXQWLHPSRGHUHDOL]DFLyQTXHQRSRGUiHQ
QLQJ~QFDVRHQWUDUHQFRQWUDGLFFLyQFRQHOGHVDUUROORGHORV
acontecimientos conocidos.
)XHQWHVGLVSRQLEOHV
Para reconstruir el itinerario seguido por los priscilianistas
hacia Roma disponemos de dos tipos de fuentes. En primer
lugar, contamos con una serie de testimonios escritos que
WUDWDQ OD FXHVWLyQ GHO YLDMH GH IRUPD GLUHFWD DOXGLHQGR D
aspectos relacionados con su desarrollo. Son referencias
en ocasiones muy escuetas, y que casi nunca responden a
las necesidades que nos hemos marcado para este trabajo.
De entre todas ellas destaca sobre las dems Sulpicio
6HYHURTXHHQVX&UyQLFDUHODWDGHIRUPDEUHYHHOYLDMH
de los priscilianistas a Roma. Sulpicio no reconstruye el
recorrido de los priscilianistas de forma precisa, sino que
simplemente se detiene en alguna ciudad porque considera
que los hechos all acaecidos tienen un mayor inters para
el desarrollo de su relato. O simplemente para transmitir un
rumor, una historia que circulaba por aquel entonces:
Desde all retomaron el camino con un cortejo
vergonzoso, con sus propias esposas y otras mujeres,
HQWUH ODV FXDOHV HVWDEDQ (XFURFLD \ VX KLMD 3UyFXOD
acerca de la cual se rumoreaba que la haba embarazado
Prisciliano y que haba abortado ingiriendo hierbas20.

texto, introduction et commentaire par L. Duchesne, 1, p. 84, Dmaso


era natione Spanis, ex patre Antonio.
 7DQ VyOR 0 9 (VFULEDQR Iglesia, cit. (n. 6), p. 224, sugiere sin
PD\RUHVSUHFLVLRQHVTXH3ULVFLOLDQR\VXVFRPSDxHURVSXGLHURQKDEHU
partido desde Emerita, desplazndose posteriormente a Complutum,
Blbilis, Caesaraugusta, Pompaelo, Elusa y Burdigala, a travs
de los Pirineos Atlnticos. Por su parte, V. Burrus, The Making of,
cit Q SDSXQWyTXHTXL]iVORVSULVFLOLDQLVWDVKDEtDQSDVDGR
por Agen para visitar a Febadio, obispo presente en el concilio de
Caesaraugusta, defendiendo adems que los priscilianistas pasaron
por Mediolanum antes de visitar Roma.
20. Sulp. Sev., Chron. 2.48.3.

AnTard , 22, 2014

Es por ello una fuente incompleta para nuestro


cometido, dado que contamos con pocas referencias para
reconstruir el itinerario de los priscilianistas.
Poca ayuda nos ofrece tambin el relato de los hechos
que Prisciliano ofrece en su Liber ad Damasum. A pesar de
ello, no se puede negar a esta fuente el inestimable valor
GHFRQUPDUHQERFDGHVXVSURWDJRQLVWDVHOYLDMHD5RPD
[...] viajando hasta ti los que pudimos [...]21. Prisciliano
expone al Papa Dmaso las circunstancias que le han
impulsado a l y a los suyos a solicitar su audiencia. Dado
TXH HV XQ UHODWR GH FDUiFWHU RFLDO QR WLHQHQ FDELGD ODV
vicisitudes de su trayecto hasta la ciudad eterna; tampoco al
VXPRSRQWtFHOHLQWHUHVDUtDQORVSRUPHQRUHVGHOYLDMHTXH
llevara a los priscilianistas a Roma. Prisciliano se limita
VLPSOHPHQWHDMXVWLFDUDQWHHO3DSDODVPRWLYDFLRQHVTXH
OHKDQLQGXFLGRDHPSUHQGHUHOYLDMHMXQWRDVXVFRPSDxHURV
VLQDPHQD]DVFRQWUDQDGLHGHVHDQGRWDQVyORSUHVHQWDUQRV
cuanto antes ante ti22.
Tambin Hidacio demuestra conocer el viaje que los
priscilianistas realizaron a Roma, dado que lo incluye en
VX&UyQLFDHQXQRGHORVSDVDMHVTXHKDFHUHIHUHQFLDDOD
FXHVWLyQSULVFLOLDQLVWD
3ULVFLOLDQR UHSUHVHQWDQWH GH OD KHUHMtD JQyVWLFD HV
ordenado obispo de vila por los obispos que haba
reunido alrededor de l. Tras haber sido escuchado por
DOJXQDVDVDPEOHDVGHRELVSRVYLDMyD,WDOLD\5RPD23.

Disponemos adems de otro testimonio cuya referencia


al priscilianismo no es aceptada de forma unnime, y que
podra aludir a la presencia de los priscilianistas en las
*DOLDV\$TXLWDQLD/DLQIRUPDFLyQSURFHGHGH)LODVWULR
obispo de Brescia al menos desde el 381 d.C., pues como
WDO DFXGLy DO FRQFLOLR FHOHEUDGR HQ $TXLOHLD )DOOHFLy
SRVLEOHPHQWH HQWUH ORV DxRV  \  G&24. Gracias a
Agustn, sabemos adems que tuvo un encuentro con
$PEURVLRSRVLEOHPHQWHHQWUHORVDxRV\/DREUD
en la que presumiblemente menciona a los priscilianistas
es el Diversarum haereseon liber, compuesta seguramente
entre el 380 y el 387, si bien es probable que la fecha
GH FRPSRVLFLyQ GH OD REUD VH HQFXHQWUH PiV FHUFDQD
DO DxR  GDGR TXH QR VH PHQFLRQD D 3ULVFLOLDQR SRU

21. Prisciliano, Tractatus II. Liber ad Damasum, en M. Conti, Priscillian,


cit. (n. 10), p. 76: [...] et ad te qui potuimus uenientes [...].
22. Ibidem: [...] uenimus Romam, nulli graues, hoc solum desiderantes,
ut te primum adiremus [...].
23. Hidacio, Chron. VII, Priscillianus declinans in haeresim
Gnosticorum, per episcopos quos sibi in eadem pravitate collegerat,
Abulae episcopus ordinatur: qui aliquot episcoporum conciliis
auditus, Italiam petit et Romam +HPRV HPSOHDGR OD HGLFLyQ GH
A. Tranoy, Hydace, Chronique, 1. Introduction, texte critique,
traduction, Pars, 1974.
24. Agustn, Ep. CXXII (Migne XXXIII, 999); Filastrius quidam
Brixiensis episcopus, quem cum sancto Ambrosio Mediolani etiam
ipse vidi, scripsit hinc librum nec illas haereses praetermittens quae in
populo Iudaeo fuerunt ante domini aduentum CXX et VIII. Citada en
San Filastrio di Brescia, Delle varie eresei. Introduzione, traduzione,
note e indici di G. Banterle (Biblioteca Ambrosiana), p. 10.

AnTa rd , 2 2 , 2 0 1 4

EL VIAJE DE LOS PRISCILIANISTAS HACIA LA CIUDAD ETERNA

nombre25. En este sentido, es interesante recordar que


3UyVSHUR GH $TXLWDQLD VLW~D HO LQLFLR GHO PRYLPLHQWR
SULVFLOLDQLVWDHQHODxR26.
Dice Filastrio:
Otros herejes se encuentran entre los galos, los hispanos
y en Aquitania, por as decirlo abstinentes, que siguen
LJXDOPHQWH OD SHUQLFLRVtVLPD VHFWD GH ORV JQyVWLFRV \
de los maniqueos y no dudan en difundirla, separando
con sus doctrinas los matrimonios entre los hombres
y, propugnando la abstinencia alimentaria, la cual fue
concedida como gracia, no por el precepto de la ley, sino
dada por Cristo a la voluntad de los hombres para exaltar
\GLJQLFDUHOFLHOR27.

El pasaje no est exento de problemas; efectivamente


)LODVWULR SXGLHUD HVWDU UHULpQGRVH D ORV SULVFLOLDQLVWDV
dado que sabemos que las fuentes conciliares les atribuyen
transgresiones de carcter alimenticio28. Si bien es cierto
TXHSUiFWLFDVGHHVWHWLSRJR]DEDQGHXQDJUDQGLIXVLyQHO
PRPHQWRFURQROyJLFR\ODVUHJLRQHVHQODVFXDOHV)LODVWULR

25. A. di Bernardino (dir.), Nuovo Dizionario Patristico e di Antichit


Cristiana (Institutum Patristicum Augustinianum), Roma / Genova /
Milano, 2006, pp. 1942-1943.
7RGDVQXHVWUDVUHIHUHQFLDVD3UyVSHURFRUUHVSRQGHQDWUDGXFFLRQHV
SURSLDVDSDUWLUGHODHGLFLyQODWLQDGHOWH[WRSRU7 0RPPVHQ en:
Chronica Minora Saec. IV, V, VI, VII vol. 1, pp. 341-501, (1892,
repr. Berlin, 1961); En aquel entonces, el obispo Prisciliano de
*DOOHFLD GHO GRJPD GH ORV JQyVWLFRV \ GH ORV PDQLTXHRV IXQGy OD
KHUHMtD TXH OOHYD VX QRPEUH VLHQGR FyQVXOHV $XVRQLR \ 2OLEULR.
([LVWH XQD WUDGXFFLyQ GH OD &UyQLFD GH 3UyVSHUR DO LQJOpV HQ
A. C Murray, From Roman to Merovingian Gaul: A Reader ed. &
trans., Ontario, 2003, pp. 62-76.
27. Filastrio, Liber De Haeresibus (Migne XII, 1196); Sunt in Galliis,
et Hispaniis, et Aquitania veluti abstinentes, qui et Gnosticorum,
et Manichaeorum particulam perniciosissimam acque sequuntur
eamdemque non dubitant praedicare, separantes persuasionibus
conjugia homunum, et escarum abstinentiam promittentes, quae non
ex Legis praecepto, sed promotionis coelestis, et dignitatis causa
voluntati hominum talis a Christo concessa est gratia.
 (O &RQFLOLR GH 7ROHGR , DxR   LQFOX\H HQ ORV$UWtFXORV GH )H
FDWyOLFDFRQWUDWRGDVODVKHUHMtDV\VREUHWRGRFRQWUDORVSULVFLOLDQLVWDV
un canon en contra de aquellos que ven los matrimonios como actos
execrables (c. XVI), y otro en contra de aquellos que consideran
execrable el consumo de carne de aves o animales (c. XVII); en
el primer Concilio celebrado en Bracara Augusta HQ HO DxR  VH
incluye el canon XI, que anatemiza la condena de los matrimonios
humanos; y el canon XIV, que hace referencia explcita a maniqueos
y priscilianistas, quienes juzgan inmundos los alimentos de las carnes
que Dios dio a los hombres, e incluso se abstienen de comer legumbres
cocidas con carne. Para el Concilio de Toledo I ver, G. Martnez,
F. Rodrguez, Coleccin Cannica, cit. (n. 4), p. 344. Para el Concilio I
de Bracara ver J. Vives, Concilios visigticos e hispano-romanos,
Madrid / Barcelona, 1963, pp. 68-69. H. M. Giudice, Prisciliano,
cit. (n. 11), p. 71, cree que los priscilianistas, que defendan la lectura
GHHVFULWRVDSyFULIRVVHLQWHUHVDURQHVSHFLDOPHQWHSRUORV+HFKRVGH
ORV$SyVWROHV TXL]iV SRU VX pQIDVLV HQ OD FRQWLQHQFLD 3RU VX SDUWH
C. Sfameni cree que Prisciliano no condenaba el matrimonio y la
SURFUHDFLyQSHURVXPHQVDMHGHULJXURVRDVFHWLVPRFXOPLQDUtDHQOD
SURFODPDFLyQ GH XQ DVFHWLVPR UDGLFDO FRPR FRQQRWDFLyQ GLVWLQWLYD
e imprescindible para todos aquellos que quisieran llegar al status
de verdaderos cristianos. Priscilliano asceta carismatico o criptomanicheo? I fondamenti antropologici dellenkrateia priscillianista,
en Hestiasis. Studi di tarda antichit offerti a Salvatore Calderone, 4,
Messina, 1992, pp. 163-212.

161

ubica a los veluti abstinentes VHxDODQGLUHFWDPHQWHDORV


priscilianistas. Si es as, la importancia de este pasaje
radica en que podemos inferir que quizs Filastrio supo de
la presencia de Prisciliano y sus seguidores mientras stos
se detuvieron en las Galias de camino a Roma, all por el
DxRG&6XVXFHVRUHQODVHGHGH%UHVFLD*DXGHQFLR
no deja lugar a dudas sobre la versatilidad de Filastrio. En
HOHORJLRTXHOHWULEXWyHQHOGHFLPRFXDUWRDQLYHUVDULRGH
VXyELWRQRVGLFHTXH)LODVWULRUHFRUULyHOPXQGRURPDQR
predicando el Evangelio (sed circuiens uniuersum
paene ambitum Romani orbis dominicum praedicauit
verbum), que estuvo en Miln en tiempos del obispo
arriano Ausencio por tanto antes de que Ambrosio fuese
obispo (Nam et in Mediolanensi urbe idoneus olim
custos dominici gregis fuit Arriano repugnans Auxentio,
priusquam beatus eligeretur Ambrosius \TXHSDVyODUJR
tiempo en Roma antes de ser eleg