Vous êtes sur la page 1sur 32

DHF (Dengue Haemoragic Fever)

1. Pengertian

DHF (Dengue Haemoragic Fever) adalah penyakit yang disebabkan oleh virus dengue
sejenis virus yang tergolong arbovirus dan masuk ke dalam tubuh penderita melalui
gigitan nyamuk Aedes Aegypti (betina). (Christantie Effendy, 1995).

Dengue Haemoragic Fever (DHF) adalah penyakit yang terdapat pada anak dan orang
dewasa dengan gejala utama demam, nyeri otot dan nyeri sendi yang disertai ruam atau
tanpa ruam. DHF sejenis virus yang tergolong arbovirus dan masuk kedalam tubuh
penderita melalui gigitan nyamuk aedes aegepty betina (Seoparman , 1990).

DHF (Dengue Haemoragic Fever) adalah demam khusus yang dibawa oleh aedes aegepty
dan beberapa nyamuk lain yang menyebabkan terjadinya demam. Biasanya dengan cepat
menyebar secara efidemik. (Sir,Patrick manson,2001).

Dengue Haemoragic Fever (DHF) adalah suatu penyakit akut yang disebabkan oleh virus
yang ditularkan oleh nyamuk aedes aegepty (Seoparman, 1996).

DHF (Dengue Haemoragic Fever) berdasarkan derajat beratnya penyakit, secara klinis dibagi
menjadi 4 derajat (Menurut WHO, 1986):
1)
Derajat I
Demam disertai gejala klinis lain, tanpa perdarahan spontan, uji tourniquet, trombositopenia dan
hemokonsentrasi.
2)
Derajat II
Derajat I dan disertai pula perdarahan spontan pada kulit atau tempat lain.
3)
Derajat III
Ditemukan kegagalan sirkulasi, yaitu nadi cepat dan lemah, tekanan daerah rendah (hipotensi),
gelisah, cyanosis sekitar mulut, hidung dan jari (tanda-tanda dini renjatan).
4)
Dejara IV
Renjatan berat (DSS) dengan nadi tak teraba dan tekanan darah tak dapat diukur.
2. Anatomi Fisiologi
Struktur nyamuk terdiri atas ; kepala, toraks yang setiap segmenya dilengkapi dengan sepasang
kaki yang beruas-ruas dan abdomen. Daerah kepala terdiri atas mata, antena berbentuk poliform
yang terdiri atas 15 segmen. Antena nyamuk betina disebut pilose dengan bulu-bulu yang lebih
sedikit sedangkan yang jantan memiliki banyak bulu disebut plumose. Seperti halnya dengan
serangga lain nyamuk memiliki sepasang mata majemuk oseli (mata tunggal). Di bagian dorsal
toraks terdapat bentuk bercak yang keras berupa dua garis sejajar pada bagian tengah dan dua
garis lengkung di bagian tepi. Vena sayap meliputi seluruh bagian sayap sampai ke ujung
berukuran 2,5 3,0 mm. Di bagian abdomen nyamuk betina berukuran kecil terdapat dua caudal
cerci yang berukuran kecil, sedangkan pada nyamuk jantan terdapat organ seksual yang disebut
hypopygium.
Nyamuk ini bersifat antropofilik ( senang sekali pada manusia), biasanya nyamuk betina menggit
di dalam rumah, kadang-kadang di luar rumah di tempat yang agak gelap. Pada malam hari
nyamuk beristirahat dalam rumah pada benda-benda yang digantung seperti pakaian, kelambu,

pada dinding dan tempat yang dekat dengan tempat peridukannya. Nyamuk A.aegypti memilliki
kebiasaan menggigit berulang-ulang (multiple biters) yakni menggit beberapa orang secara
bergantian dalam waktu singkat. Keadaan ini sangat berpengaruh terhadap peranannya sebagai
vektor penyebab penyakit DBD ke beberapa orang dalam sekali waktu. Nyamuk jantan juga
tertarik terhadap manusia pada saat melakukan perkawinan, tetapi tidak menggigit.
Dalam perkembangan hidupnya nyamuk ini mengalami metamorfosis sempurna (holometabola)
yaitu dari telur menetas menjadi larva (jentik), kemudian menjadi pupa dan selanjutnya menjadi
nyamuk dewasa. Dalam keadaan optimal, perkembangan telur sampai menjadi nyamuk dewasa
berlangsung sekurang-kurangnya selama 9 hari. Nyamuk dewasa baik jantan maupun betina
membutuhkan glukosa sebagai bahan makanan yang dapat diperoleh dari cairan tumbuhan,
sedangkan nyamuk betina membutuhkan protein-protein dari darah untuk pematangan sel telur
setelah perkawinan. yamuk betina dewasa mulai menghisap darah setelah berumur 3 hari, setelah
itu sanggup bertelur sebanyak 100 butir. Nyamuk betina mampu bertahan hidup 2 minggu lebih
di alam, sedangkan nyamuk jantan setelah proses kawin dalam waktu 1 minggu akan mati.
Nyamuk betina dapat terbang sejauh 20 meter, kemampuan normalnya adalah 40 meter.
3. Etiologi
Penyebab utama : virus dengue tergolong albovirus
Vektor utama :

Aedes aegypti.

Aedes albopictus.

Adanya vektor tesebut berhubungan dengan :


1. kebiasaan masyarakat menampung air bersih untuk keperlauan sehari hari.
2. Sanitasi lingkungan yang kurang baik.
3. Penyediaan air bersih yang langka.
Daerah yang terjangkit DHF adalah wilayah padat penduduk karena.
1. Antar rumah jaraknya berdekatan yang memungkinkan penularan karena jarak terbang
aedes aegypti 40-100 m.
2. Aedes aegypti betina mempunyai kebiasaan menggigit berulang (multiple biters) yaitu
menggigit beberapa orang secara bergantian dalam waktu singkat, (Noer, 1999).
4. Patofisiologi

klik gambar diatas untuk melihat dalam

ukuran besar
5. Tanda dan Gejala
Gambaran klinis DHF seringkali mirip dengan beberapa penyakit lain seperti :
1)
Demam chiku nguya.
Dimana serangan demam lebih mendadak dan lebih pendek tapi suhu di atas 40 0C disertai ruam
dan infeksi konjungtiva ada rasa nyeri sendi dan otot.
2)
Demam tyfoid
Biasanya timbul tanda klinis khas seperti pola demam, bradikardi relatif, adanya leukopenia,
limfositosis relatif.
3) Anemia aplastik
Penderita tampak anemis, timbul juga perdarahan pada stadium lanjut, demam timbul karena
infeksi sekunder, pemeriksaan darah tepi menunjukkan pansitopenia.
4)
Purpura trombositopenia idiopati (ITP)
Purpura umumnya terlihat lebih menyeluruh, demam lebih cepat menghilang, tidak terjadi
hemokonsentrasi.

Meningkatnya suhu tubuh

Nyeri pada otot seluruh tubuh

Nyeri kepala menyeluruh atau berpusat pada supra orbita, retroorbita

Suara serak

Batuk

Epistaksis

Disuria

Nafsu makan menurun

Muntah

Ptekie

Ekimosis

Perdarahan gusi

Muntah darah

Hematuria masif

Melena

6. Komplikasi
a. Perdarahan luas.
b. Shock atau renjatan.
c. Effuse pleura
d. Penurunan kesadaran.
6. Klasifikasi
a. Derajat I :
Demam disertai gejala klinis lain atau perdarahan spontan, uji turniket positi, trombositopeni dan
hemokonsentrasi.
b. Derajat II :
Manifestasi klinik pada derajat I dengan manifestasi perdarahan spontan di bawah kulit seperti
peteki, hematoma dan perdarahan dari lain tempat.
c. Derajat III :
Manifestasi klinik pada derajat II ditambah dengan ditemukan manifestasi kegagalan system
sirkulasi berupa nadi yang cepat dan lemah, hipotensi dengan kulit yang lembab, dingin dan
penderita gelisah.
d. Derajat IV :
Manifestasi klinik pada penderita derajat III ditambah dengan ditemukan manifestasi renjatan
yang berat dengan ditandai tensi tak terukur dan nadi tak teraba.
7. Pemeriksaan Diagnostik
Patokan WHO (1986) untuk menegakkan diagnosis DHF adalah sebagai berikut :
1) Demam akut, yang tetap tinggi selama 2 7 hari kemudian turun secara lisis demam disertai
gejala tidak spesifik, seperti anoreksia, lemah, nyeri.
2) Manifestasi perdarahan :
1. Uji tourniquet positif
2. Petekia, purpura, ekimosi

3. Epistaksis, perdarahan gusi


4. Hematemesis, melena.
3) Pembesaran hati yang nyeri tekan, tanpa ikterus.
4) Dengan atau tanpa renjatan.
Renjatan biasanya terjadi pada saat demam turun (hari ke-3 dan hari ke-7 sakit ). Renjatan yang
terjadi pada saat demam biasanya mempunyai prognosis buruk.
5)
Kenaikan nilai Hematokrit / Hemokonsentrasi
Laboratorium
Terjadi trombositopenia (100.000/ml atau kurang) dan hemokonsentrasi yang dapat dilihat dan
meningginya nilai hematokrit sebanyak 20 % atau lebih dibandingkan nilai hematokrit pada
masa konvalesen.
Pada pasien dengan 2 atau 3 patokan klinis disertai adanya trombositopenia dan hemokonsentrasi
tersebut sudah cukup untuk klinis membuat diagnosis DHF dengan tepat.
Juga dijumpai leukopenia yang akan terlihat pada hari ke-2 atau ke-3 dan titik terendah pada saat
peningkatan suhu kedua kalinya leukopenia timbul karena berkurangnyam limfosit pada saat
peningkatan suhu pertama kali.
8. Penatalaksanaan Medis
Penatalaksanaan penderita dengan DHF adalah sebagai berikut :
1. Tirah baring atau istirahat baring.
2. Diet makan lunak.
3. Minum banyak (2 2,5 liter/24 jam) dapat berupa : susu, teh manis, sirup dan beri
penderita sedikit oralit, pemberian cairan merupakan hal yang paling penting bagi
penderita DHF.
4. Pemberian cairan intravena (biasanya ringer laktat, NaCl Faali) merupakan cairan yang
paling sering digunakan.
5. Monitor tanda-tanda vital tiap 3 jam (suhu, nadi, tensi, pernafasan) jika kondisi pasien
memburuk, observasi ketat tiap jam.
6. Periksa Hb, Ht dan trombosit setiap hari.
7. Pemberian obat antipiretik sebaiknya dari golongan asetaminopen.
Monitor tanda-tanda perdarahan lebih lanjut.
1. Pemberian antibiotik bila terdapat kekuatiran infeksi sekunder.
2. Monitor tanda-tanda dan renjatan meliputi keadaan umum, perubahan tanda-tanda vital,
hasil pemeriksaan laboratorium yang memburuk.

3. Bila timbul kejang dapat diberikan Diazepam.


Pencegahan
Prinsip yang tepat dalam pencegahan DHF ialah sebagai berikut :
1. Memanfaatkan perubahan keadaan nyamuk akibat pengaruh alamiah
melaksanakan pemberantasan vektor pada saat sedikit terdapatnya kasus DHF.

dengan

2. Memutuskan lingkaran penularan dengan menahan kepadatan vektor pada tingkat sangat
rendah untuk memberikan kesempatan penderita viremia sembuh secara spontan.
3. Mengusahakan pemberantasan vektor di pusat daerah penyebaran yaitu di sekolah, rumah
sakit termasuk pula daerah penyangga sekitarnya.
4. Mengusahakan pemberantasan vektor di semua daerah berpotensi penularan tinggi.
Ada 2 macam pemberantasan vektor antara lain :
1. Menggunakan insektisida.
Yang lazim digunakan dalam program pemberantasan demam berdarah dengue adalah malathion
untuk membunuh nyamuk dewasa dan temephos (abate) untuk membunuh jentik (larvasida).
Cara penggunaan malathion ialah dengan pengasapan atau pengabutan. Cara penggunaan
temephos (abate) ialah dengan pasir abate ke dalam sarang-sarang nyamuk aedes yaitu bejana
tempat penampungan air bersih, dosis yang digunakan ialah 1 ppm atau 1 gram abate SG 1 % per
10 liter air.
2. Tanpa insektisida
Caranya adalah:
1. Menguras bak mandi, tempayan dan tempat penampungan air minimal 1 x seminggu
(perkembangan telur nyamuk lamanya 7 10 hari).
2. Menutup tempat penampungan air rapat-rapat.
3. Membersihkan halaman rumah dari kaleng bekas, botol pecah dan benda lain yang
memungkinkan nyamuk bersarang
9. Pengkajian Keperawatan
Data obyektif yang sering ditemukan menurut Christianti Effendy, 1995 yaitu :
1.) Lemah.
2.) Panas atau demam.
3.) Sakit kepala.
4.) Anoreksia, mual, haus, sakit saat menelan.
5.) Nyeri ulu hati.
6.) Nyeri pada otot dan sendi.
7.) Pegal-pegal pada seluruh tubuh.

8.)
Konstipasi
(sembelit).
Adalah data yang diperoleh berdasarkan pengamatan perawat atas kondisi pasien. Data obyektif
yang sering dijumpai pada penderita DHF antara lain:
1)
Suhu tubuh tinggi, menggigil, wajah tampak kemerahan.
2)
Mukosa mulut kering, perdarahan gusi, lidah kotor.
3) Tampak bintik merah pada kulit (petekia), uji torniquet (+), epistaksis, ekimosis,
hematoma, hematemesis, melena.
4)
Hiperemia pada tenggorokan.
5)
Nyeri tekan pada epigastrik.
6)
Pada palpasi teraba adanya pembesaran hati dan limpa.
7)
Pada renjatan (derajat IV) nadi cepat dan lemah, hipotensi, ekstremitas dingin, gelisah,
sianosis perifer, nafas dangkal.
Pemeriksaan laboratorium pada DHF akan dijumpai :
1) Ig G dengue positif.
2) Trombositopenia.
3) Hemoglobin meningkat > 20 %.
4) Hemokonsentrasi (hematokrit meningkat).
5) Hasil pemeriksaan kimia darah menunjukkan hipoproteinemia, hiponatremia, hipokloremia.
Pada hari ke- 2 dan ke- 3 terjadi leukopenia, netropenia, aneosinofilia, peningkatan limfosit,
monosit, dan basofil
1) SGOT/SGPT mungkin meningkat.
2) Ureum dan pH darah mungkin meningkat.
3) Waktu perdarahan memanjang.
4) Asidosis metabolik.
5) Pada pemeriksaan urine dijumpai albuminuria ringan.
10. Diagnosa Keperawatan
1. Peningkatan suhu tubuh berhubungan dengan proses penyakit (viremia).
2. Nyeri berhubungan dengan proses patologis penyakit
3. Gangguan pemenuhan kebutuhan nutrisi, kurang dari kebutuhan berhubungan dengan
mual, muntah, anoreksia
4. Kurangnya volume cairan tubuh berhubungan dengan peningkatan permeabilitas dinding
plasma
5. Keterbatasan mobilitas fisik berhubungan dengan rasa nyeri, terapi tirah baring.
6. Resiko terjadinya syok hypovolemik berhubungan dengan kurangnya volume cairan
tubuh
7. Resiko terjadinya perdarahan lebih lanjut berhubungan dengan trombositopenia
11. Rencana Asuhan Keperawatan
1. Peningkatan suhu tubuh berhubungan dengan proses penyakit (viremia)

Tujuan dan kriteria hasil:


Setelah dilakukan perawatan .. x 24 jam diharapkan suhu tubuh pasien dapat berkurang dengan
kriteria hasil:

Pasien mengatakan kondisi tubuhnya nyaman.

Suhu 36,80C-37,50C

Tekanan darah 120/80 mmHg

Respirasi 16-24 x/mnt

Nadi 60-100 x/mnt

Intervensi:
1. Kaji saat timbulnya demam.
2. Observasi tanda vital (suhu, nadi, tensi, pernafasan) setiap 3 jam
3. Anjurkan pasien untuk banyak minum (2,5 liter/24 jam)
4. Berikan kompres hangat
5. Anjurkan untuk tidak memakai selimut dan pakaian yang tebal
6. Berikan terapi cairan intravena dan obat-obatan sesuai program dokter
Rasional:
1. untuk mengidentifikasi pola demam pasien.
2. tanda vital merupakan acuan untuk mengetahui keadaan umum pasien
3. Peningkatan suhu tubuh mengakibatkan penguapan tubuh meningkat sehingga perlu
diimbangi dengan asupan cairan yang banyak.
4. Dengan vasodilatasi dapat meningkatkan penguapan yang mempercepat penurunan suhu
tubuh.
5. pakaian tipis membantu mengurangi penguapan tubuh
6. pemberian cairan sangat penting bagi pasien dengan suhu tinggi
2. Nyeri berhubungan dengan proses patologis penyakit

Tujuan dan kriteria hasil:


Setelah dilakukan perawatan .. x 24 jam diharapkan nyeri pasien dapat berkurang dan
menghilang dengan kriteria hasil:

Pasien mengatakan nyerinya hilang

Nyeri berada pada skala 0-3

Tekanan darah 120/80 mmHg

Suhu 36,80C-37,50C

Respirasi 16-24 x/mnt

Nadi 60-100 x/mnt

Intervensi:
1. Observasi tingkat nyeri pasien (skala, frekuensi, durasi)
2. Berikan lingkungan yang tenang dan nyaman dan tindakan kenyamanan
3. Berikan aktifitas hiburan yang tepat
4. Libatkan keluarga dalam asuhan keperawatan.
5. Ajarkan pasien teknik relaksasi
6. Kolaborasi dengan dokter untuk pemberian obat analgetik
Rasional:
1. Mengindikasi kebutuhan untuk intervensi dan juga tanda-tanda perkembangan/resolusi
komplikasi
2. Lingkungan yang nyaman akan membantu proses relaksasi
3. Memfokuskan kembali perhatian; meningkatkan kemampuan untuk menanggulangi
nyeri.
4. Keluarga akan membantu proses penyembuhan dengan melatih pasien relaksasi.
5. Relaksasi akan memindahkan rasa nyeri ke hal lain.
6. Memberikan penurunan nyeri.

3. Gangguan pemenuhan kebutuhan nutrisi, kurang dari kebutuhan berhubungan dengan


mual, muntah, anoreksia
Tujuan dan kriteria hasil:
Setelah dilakukan tindakan keperawatan selama x 24 jam diharapkan perubahan status nutrisi
kurang dari kebutuhan tubuh dapat teratasi dengan kriteria:

Mencerna jumlah kalori/nutrien yang tepat

Menunjukkan tingkat energi biasanya

Berat badan stabil atau bertambah

Intervensi:
1. Observasi keadaan umam pasien dan keluhan pasien.
2. Tentukan program diet dan pola makan pasien dan bandingkan dengan makanan yang
dapat dihabiskan oleh pasien
3. Timbang berat badan setiap hari atau sesuai indikasi
4. Identifikasi makanan yang disukai atau dikehendaki yang sesuai dengan program diit.
5. Ajarkan pasien dan Libatkan keluarga pasien pada perencanaan makan sesuai indikasi
6. Kolaborasi dengan dokter untuk pemberian obat anti mual.
Rasional:
1. Mengetahui kebutuhan yang diperlukan oleh pasien.
2. Mengidentifikasi kekurangan dan penyimpangan dari kebutuhan terapeutik
3. Mengkaji pemasukan makanan yang adekuat (termasuk absorbsi dan utilisasinya)
4. Jika makanan yang disukai pasien dapat dimasukkan dalam pencernaan makan,
kerjasama ini dapat diupayakan setelah pulang
5. Meningkatkan rasa keterlibatannya; Memberikan informasi kepada keluarga untuk
memahami nutrisi pasien
6. Pemberian obat antimual dapat mengurangi rasa mual sehingga kebutuhan nutrisi pasien
tercukupi.
4. Kurangnya volume cairan tubuh berhubungan dengan peningkatan permeabilitas
dinding plasma

Tujuan dan kriteria hasil:


Setelah dilakukan perawatan selama x 24 jam diharapkan kebutuhan cairan terpenuhi dengan
kriteria hasil:

TD 120/80 mmHg

RR 16-24 x/mnt

Nadi 60-100 x/mnt

Turgor kulit baik

Haluaran urin tepat secara individu

Kadar elektrolit dalam batas normal.

Intervensi:
1. Pantau tanda-tanda vital, catat adanya perubahan tanda vital.
2. Pantau pola nafas seperti adanya pernafasan kusmaul
3. Kaji suhu warna kulit dan kelembabannya
4. Kaji nadi perifer, pengisian kapiler, turgor kulit dan membran mukosa
5. Pantau masukan dan pengeluaran cairan
6. Pertahankan untuk memberikan cairan paling sedikit 2500 ml/hari dalam batas yang
dapat ditoleransi jantung.
7. Catat hal-hal seperti mual, muntah dan distensi lambung.
8. Observasi adanya kelelahan yang meningkat, edema, peningkatan BB, nadi tidak teratur
9. Berikan terapi cairan normal salin dengan atau tanpa dextrosa, pantau pemeriksaan
laboratorium(Ht, BUN, Na, K)
Rasional:
1. hipovolemia dapat dimanisfestasikan oleh hipotensi dan takikardi
2. pernapasan yang berbau aseton berhubungan dengan pemecahan asam aseto-asetat dan
harus berkurang bila ketosis harus terkoreksi

3. demam dengan kulit kemerahan, kering menunjukkan dehidrasi.


4. merupakan indicator dari dehidrasi
5. memberi perkiraan akan cairan pengganti, fungsi ginjal, dan program pengobatan.
6. mempertahankan volume sirkulasi.
7. kekurangan cairan dan elektrolit menimbulkan muntah sehingga kekurangan cairan dan
elektrolit.
8. pemberian cairan untuk perbaikan yang cepat berpotensi menimbulkan kelebihan beban
cairan
9. mempercepat proses penyembuhan untuk memenuhi kebutuhan cairan
5. Keterbatasan mobilitas fisik berhubungan dengan rasa nyeri, terapi tirah baring
Tujuan dan kriteria hasil:
Setelah dilakukan perawatan selama x 24 jam diharapkan pasien dapat mencapai kemampuan
aktivitas yang optimal, dengan kriteria hasil:

Pergerakan pasien bertambah luas

Pasien dpt melaksanakan aktivitas sesuai dengan kemampuan (duduk, berdiri, berjalan)

Rasa nyeri berkurang

Pasien dapat memenuhi kebutuhan sendiri secara bertahap sesuai dengan kemampuan

Intervensi:
1. Kaji dan identifikasi tingkat kekuatan otot pada kaki pasien.
2. Beri penjelasan tentang pentingnya melakukan aktivitas.
3. Anjurkan pasien untuk menggerakkan/mengangkat ekstrimitas bawah sesui kemampuan
4. Bantu pasien dalam memenuhi kebutuhannya
5. Kolaborasi dengan tim kesehatan lain: dokter (pemberian analgesik)
Rasional:
1. mengetahui derajat kekuatan otot-otot kaki pasien.

2. Pasien mengerti pentingnya aktivitas sehingga dapat kooperatif dalam tindakan


keperawatan
3. melatih otot otot kaki sehingga berfungsi dengan baik
4. Agar kebutuhan pasien tetap dapat terpenuhi
5. Analgesik dapat membantu mengurangi rasa nyeri.
6. Resiko terjadinya syok hypovolemik berhubungan dengan kurangnya volume cairan
tubuh
Tujuan dan kriteria hasil:
Setelah dilakukan perawatan .. x 24 jam diharapkan tidak terjadi syok hipovolemik dengan
kriteria hasil:

TD 120/80 mmHg

RR 16-24 x/mnt

Nadi 60-100 x/mnt

Turgor kulit baik

Haluaran urin tepat secara individu

Kadar elektrolit dalam batas normal.

Intervensi:
1. Monitor keadaan umum pasien
2. Observasi tanda-tanda vital tiap 2 sampai 3 jam.
3. Monitor tanda perdarahan
4. Chek haemoglobin, hematokrit, trombosit
5. Berikan transfusi sesuai program dokter
6. Lapor dokter bila tampak syok hipovolemik.
Rasional:
1. memantau kondisi pasien selama masa perawatan terutama pada saat terjadi perdarahan
sehingga segera diketahui tanda syok dan dapat segera ditangani.

2. tanda vital normal menandakan keadaan umum baik


3. Perdarahan cepat diketahui dan dapat diatasi sehingga pasien tidak sampai syok
hipovolemik
4. Untuk mengetahui tingkat kebocoran pembuluh darah yang dialami pasien sebagai acuan
melakukan tindakan lebih lanjut
5. Untuk menggantikan volume darah serta komponen darah yang hilang
6. Untuk mendapatkan penanganan lebih lanjut sesegera mungkin
7. Resiko terjadinya perdarahan lebih lanjut berhubungan dengan trombositopenia
Tujuan dan kriteria hasil:
Setelah dilakukan perawatan .. x 24 jam diharapkan tidak terjadi perdarahan dengan kriteria
hasil:

Tekanan darah 120/80 mmHg

Trombosit 150.000-400.000

Intervensi:
1. Monitor tanda penurunan trombosit yang disertai gejala klinis
2. Anjurkan pasien untuk banyak istirahat
3. Beri penjelasan untuk segera melapor bila ada tanda perdarahan lebih lanjut
4. Jelaskan obat yang diberikan dan manfaatnya
Rasional:
1. Penurunan trombosit merupakan tanda kebocoran pembuluh darah.
2. Aktivitas pasien yang tidak terkontrol dapat menyebabkan perdarahan
3. Membantu pasien mendapatkan penanganan sedini mungkin
4. Memotivasi pasien untuk mau minum obat sesuai dosis yang diberikan
DAFTAR PUSTAKA
Sunaryo, Soemarno, (1998), Demam Berdarah Pada Anak, UI ; Jakarta.
Effendy, Christantie, (1995), Perawatan Pasien DHF, EGC ; Jakarta.
Hendarwanto, (1996), Ilmu Penyakit Dalam, jilid I, edisi ketiga, FKUI ; Jakarta.

Doenges, Marilynn E, dkk, (2000), Penerapan Proses Keperawatan dan Diagnosa Keperawatan,
EGC ; Jakarta.
Diposkan oleh ABDUL MUFTI UBAIDILLAH di 04.30
Reaksi:
Tidak ada komentar: Link ke posting ini

Kamis, 21 Maret 2013


ASUHAN KEPERAWATAN PADA PASIEN GLAUKOMA
Askep Glaukoma
ASUHAN KEPERAWATAN PADA
PASIEN DENGAN GLAUKOMA
BAB I
TINJAUAN TEORI
A. PENGERTIAN
Glaukoma adalah suatu penyakit yang memberikan gambaran klinik berupa tekanan intra okuler
penggaungan pupil saraf optik dengan defek lapang pandangan mata.
Glaukoma adalah sekelompok kelainan mata yang ditandai dengan peningkatan tekanan intra
okuler. (Long Barbara, 1996)
B. Klasifikasi
1. Glukoma primer
Glukoma sudut terbuka terjadi karena tumor aqueus mempunyai pintu terbuka ke jaringan
trabekular kelainannya berkenang lambat.
Glaukoma sudut tertutup
Glaukoma sudut tertutup terjadi karena ruang anterior menyempit, sehingga iris terdorong ke
depan, menempel ke jaringan trabekular dan menghambat humor aqoeus mengalir ke saluran
schlemm.
2. Glaukoma sekunder
Glaukoma yang terjadi akibat penyakit mata lain yang menyebabkan penyempitan sudut /
peningkatan volume cairan dari dalam mata dapat diakibatkan oleh : perubahan lensa
Kelainan uvea
Trauma
Bedah
3. Glaukoma kongenital
Glaukoma yang terjadi akibat kegagalan jaringan mesodermal memfungsikan trabekular.
4. Glaukoma absolut
Merupakan stadium akhir, sudah terjadi kebutaan total akibat tekanan bola mata memberikan
gangguan fungsi lanjut.
Berdasarkan lamanya :
1. Glaukoma akut
Penyakit mata yang disebabkan oleh tekanan intra okuler yang meningkat mendadak sangat
tinggi.
2. Glaukoma kronik
Penyakit mata dengan gejala peningkatan tekanan bola mata sehingga terjadi kerusakan anatomi
dan fungsi mata yang permanen.

C. Anatomi dan Fisiologi


Di dalam terdapat dua macam cairan :
1. Aqueus humor
Cairan ini berada di depan lensa.
2. Vitreus humor
Cairan penuh albumin berwarna keputih putihan seperti agar agar yang berada dibelakang
biji mata, mulai dari lensa hingga retina. (Evelin C Pearce : 317)
Dalam hal ini cairan yang mengalami gangguan yang dihubungkan dengan penyakit glaukoma
adalah aqueus humor, dimana cairan ini berasal dari badan sisiari mengalir ke arah bilik anterior
melewati iris dan pupil dan diserap kembali kedalam aliran darah pada sudut antara iris dan
kornea melalui vena halus yang dikenal sebagai saluran schlemm. (Evelin C. Pearce : 317).
Secara normal TIO 10 -21 mmHg karena adanya hambatan abnormal terhadap aliran aqueus
humor mengakibatkan produksi berlebih badan silier sehingga terdapat cairan tersebut. TIO
meningkat kadang kadang mencapai tekanan 50 70 mmHg.
D. ETIOLOGI
1. Primer
Terdiri dari
a. Akut
Dapat disebabkan karena trauma.
b. Kronik
Dapat disebabkan karena keturunan dalam keluarga seperti :
Diabetes mellitus
Arterisklerosis
Pemakaian kortikosteroid jangka panjang.
Miopia tinggi dan progresif.
Dari etiologi diatas dapat menyebabkan sudut bilik mata yang sempit.
2. Sekunder
Disebabkan penyakit mata lain seperti :
Katarak
Perubahan lensa
Kelainan uvea
Pembedahan
E. Manifestasi Klinis
1. Glaukoma primer
a. Glaukoma sudut terbuka
- Kerusakan visus yang serius
- Lapang pandang mengecil dengan macam macam skotoma yang khas
- Perjalanan penyakit progresif lambat
b. Glaukoma sudut tertutup
- Nyeri hebat didalam dan sekitar mata
- Timbulnya halo disekitar cahaya
- Pandangan kabur
- Sakit kepala
- Mual, muntah
- Kedinginan
- Demam bahkan perasaan takut mati mirip serangan angina, yang dapat sedemikian kuatnya

sehingga keluhan mata (gangguan penglihatan, fotofobia dan lakrimasi) tidak begitu dirasakan
oleh klien.
2. Glaukoma sekunder
- Pembesaran bola mata
- Gangguan lapang pandang
- Nyeri didalam mata
3. Glaukoma kongenital
- Gangguan penglihatan
(Asuhan Keperawatan Klien Gangguan Mata, hal 147 150)
F. Patofisiologi
Tekanan Intra Okuler ditentukan oleh kecepatan produksi akues humor dan aliran keluar akues
humor dari mata. TIO normal 10 21 mmHg dan dipertahankan selama terdapat keseimbangan
antara produksi dan aliran akueos humor. Akueos humor di produksi didalam badan silier dan
mengalir ke luar melalui kanal schlemm ke dalam sistem vena. Ketidakseimbangan dapat terjadi
akibat produksi berlebih badan silier atau oleh peningkatan hambatan abnormal terhadap aliran
keluar akueos melalui camera oculi anterior (COA). Peningkatan tekanan intraokuler > 23
mmHg memerlukan evaluasi yang seksama. Iskemia menyebabkan struktur ini kehilangan
fungsinya secara bertahap. Kerusakan jaringan biasanya dimulai dari perifer dan bergerak
menuju fovea sentralis. Kerusakan visus dan kerusakan saraf optik dan retina adalah ireversibel
dan hal ini bersifat permanen tanpa penangan, glaukoma dapat menyebabkan kebutaan.
Hilangnya penglihatan ditandai dengan adanya titik buta pada lapang pandang.
(Asuhan Keperawatan Klien Gangguan Mata, hal 147 150)
ASUHAN KEPERAWATAN GLAUKOMA
A. Pengkajian
1. Anamnesis
Anamnesis meliputi data demografi, yang meliputi :
- Umur, glaukoma primer terjadi pada individu berumur > 40 tahun.
- Ras, kulit hitam mengalami kebutaan akibat glaukoma paling sedikit 5 kali dari kulit putih
(dewit, 1998).
- Pekerjaan, terutama yang beresiko besar mengalami trauma mata.
Selain itu harus diketahui adanya masalah mata sebelumnya atau pada saat itu, riwayat
penggunaan antihistamin (menyebabkan dilatasi pupil yang akhirnya dapat menyebabkan Angle
Closume Glaucoma), riwayat trauma (terutama yang mengenai mata), penyakit lain yang sedang
diderita (DM, Arterioscierosis, Miopia tinggi)
Riwayat psikososial mencakup adanya ansietas yang ditandai dengan bicara cepat, mudah
berganti topik, sulit berkonsentrasi dan sensitif, dan berduka karena kehilangan penglihatan.
(Indriana N. Istiqomah, 2004)
2. Pemeriksaan Fisik
a. Neurosensori
- Gangguan penglihatan (kabur/ tidak jelas), sinar terang dapat menyebabkan silau dengan
kehilangan bertahap penglihatan perifer, kesulitan memfokuskan kerja dengan dekat/ merasa
diruang gelap (katarak), tampak lingkaran cahaya/ pelangi sekitar sinar, kehilangan penglihatan
perifer, fotfobia (galukoma akut) bahan kaca mata/ pengobatan tidak memperbaiki penglihatan.
- Tanda : pupil menyempit dan merah/mata keras dengan kornea berwarna, peningkatan air mata.
(www.IFC.com)
- Pemeriksaan fisik dilakukan dengan menggunakan oftalmaskop untuk mengetahui adanya

cupping dan atrofi diskus optikus. Diskus optikus menjadi lebih luas dan dalampada glaukoma
akut primer, karena anterior dangkal, Aqueus humor keruh dan pembuluh darah menjalar keluar
dari iris.
- Pemeriksaan lapang pandang perifer, pada keadaan akut lapang pandang cepat menurun secara
signifikan dan keadaan kronik akan menurun secara bertahap.
- Pemeriksaan melalui inspeksi, untuk mengetahui adanya inflamasi mata, sklera kemerahan,
kornea keruh, dilatasi pupil, sedang yang gagal bereaksi terhadap cahaya (Indriana N.
Istiqomah,2004)
b. Nyeri/ kenyamanan
- Ketidaknyamanan ringan/ mata berair (glaukoma kronis0
- Nyeri tiba- tiba / berat menetap atau tekanan pada dan sekitar mata, sakit kepala (glaukoma
akut). (www. IFC.com).
3. Pemeriksaan Diagnostik
a. Kartu snellen / mesin telebinoklear
Digunakan untuk mengetahui ketajaman mata dan sentral penglihatan
b. Lapang penglihatan
Terjadi penurunan disebabkan oleh CSV, masa tumor pada hipofisis / otak, karotis /
patofisiologis, arteri serebral atau glaukoma.
c. Pengukuran tonografi
Mengkaji intraokuler (TIO) (normal 12 25 mmHg)
d. Pengukuran gonoskopi
Membantu membedakan sudut terbuka dan sudut tertutup
e. Tes provokatif
Digunakan dalam menentukan tipe glaukoma jika TIO normal / hanya meningkat ringan.
f. Pemeriksaan aftalmoskop
Menguji struktur internal okuler, mencatat atrofi lempeng optik, papiledema, perdarahan retina
dan mikroaneurisma.
g. Darah lengkap, LED
Menunjukkan anemia sistemik / infeksi
h. EKG, kolesterol serum dan pemeriksaan lipid
Memastikan arterosklerosis, PAK
i. Tes toleransi glukosa
Menentukan adanya DM
B. Diagnosa Keperawatan
1. Nyeri berhubungan dengan peningkatan tekanan intraokuler
2. Perubahan persepsi sensori berhubungan dengan hilangnya pandangan perifer
3. Gangguan citra diri berhubungan dengan kebutaan
C. Intervensi Keperawatan
1. Nyeri berhubungan dengan peningkatan tekanan intraokuler
Tujuan : nyeri terkontrol / tulang
Kriteria hasil :
Pasien mengatakan nyeri berkurang / hilang
Ekspresi wajah rileks
Pasien mendemonstrasikan pengetahuan akan penilaian pengontrolan nyeri.
Intervensi :
a. Observasi derajat nyeri mata

Rasional : mengidentifikasi kemajuan / penyimpangan dari hasil yang diharapkan.


b. Anjurkan istirahat di tempat tidur dalam ruangan yang tenang
Rasional : stress mental / emosi menyebabkan peningkatan TIO
c. Ajarkan pasien teknik distraksi
Rasional : membantu dalam penurunan persepsi / respon nyeri
d. Kolaborasi pemberian analgetik sesuai program
Rasional : untuk mengurangi nyeri
2. Perubahan persepsi sensori berhubungan dengan hilangnya pandangan perifer
Tujuan : Penggunaan penglihatan yang optimal
Kriteria hasil :
Pasien berpartisipasi dalam program pengobatan
Pasien akan mempertahankan lapang ketajaman penglihatan lebih lanjut.
Intervensi :
a. Kaji derajat / tipe kehilangan penglihatan
Rasional : mengetahui harapan masa depan klien dan pilihan intervensi.
b. Dorong klien untuk mengekspresikan perasaan tentang kehilangan / kemungkinan kehilangan
penglihatan.
Rasional : intervensi dini untuk mencegah kebutaan, klien menghadapi kemungkinan /
mengalami kehilangan penglihatan sebagian atau total.
c. Tunjukkan pemberian tetes mata, contoh menghitung tetesan, mengikuti jadwal, tidak salah
dosis.
Rasional : Mengontrol TIO, mencegah kehilangan penglihatan lebih lanjut
d. Kolaborasi pemberian obat sesuai indikasi, misalnya agen osmotik sistemik.
Rasional : untuk mengurangi TIO
3. Resiko cedera berhubungan dengan kebutaan
Tujuan : peningkatan lapang pandang optimal
Kriteria hasil :
Tidak terjadi cedera.
Intervensi :
a. Bersihkan sekret mata dengan cara benar.
Rasional : sekret mata akan membuat pandangan kabur.
b. Kaji ketajaman penglihatan, catat apakah satu atau dua mata yang terlibat.
Rasional : terjadi penurunan tajam penglihatan akibat sekret mata.
c. Anjurkan pasien menggunakan kaca mata gelap
Rasional : mengurangi fotofobia yang dapat mengganggu penglihatan klien.
d. Perhatikan keluhan penglihatan kabur yang dapat terjadi setelah penggunaan tetes mata dan
salep mata
Rasional : membersihkan informasi pada klien agar tidak melakukan aktivitas berbahaya sesaat
setelah penggunaan obat mata.
DAFTAR PUSTAKA
Brunner & Suddarth. 2002. Keperawata Medikal Bedah Edisi 8. Jakarta : EGC.
Carpenito, Lynda Juall. 2007. Buku Saku Diagnosis Keperawatan Edisi 10. Jakarta : EGC.
Mansjoer, Arif.1999. Kapita Selekta Kedokteran. Edisi III Jilid 1. Jakarta : FKUI.
Diposkan oleh ABDUL MUFTI UBAIDILLAH di 04.27
Reaksi:
Tidak ada komentar: Link ke posting ini

Senin, 18 Maret 2013


ASKEP HIPOTIROID

ASKEPHIPOTIROID
BABI
PENDAHULUAN

1.1LatarBelakang
Kelenjartiroidmerupakankelenjaryangmempertahankantingkat metabolismediberbagai jarinanagar
optimalsehinggamerekaberfungsinormal.Hormontiroidmerangsangkonsumsioksigenpadasebagianbesarseldi
tubuh,membantumengaturmetabolismelemakdankarbohidrat,danpentinguntukpertumbuhandanpematangan
normal.
Kelenjar tiroid tidak esensial bagi kehidupan, tetapi ketiadaannya menyebabkan
perlambatanperkembanganmentaldanfisik,berkurangnyadayatahanterhadapdingin,sertapadaanakanaktimbul
retardasi mental dan kecebolan.Sebaliknya, sekresi tiroidyang berlebihan menyebabkanbadanmenjadi kurus,
gelisah,takikardia,tremor,dankelebihanpembentukanpanas.
Fungsitiroiddiaturolehhormoneperangsangtiroiddarihipofisisanterior.Sebaliknya,sekresihormoneini
sebagian diatur oleh umpan balik inhibitorik langsung kadar hormontiroid yang tinggipadahipofisis serta
hipotalamus dan sebagian lagi melalui hipotalamus. Dengan cara ini, perubahanperubahanpadahipofisis serta
hipotalamusdansebagianlagimelaluihipotalamus.
Dalam hal ini perawat dituntut untuk dapat profesional dalam menangani halhal yang terkait
denganhipotirodmisalnya saja dalam memberikan asuhan keperawatan harus tepat dan cermat agar dapat
meminimalkankomplikasiyangterjadiakibathipotiroid.
1.2.RumusanMasalah
1.Apakahdefinisidarihipotiroid?
2.Bagaimanaetilogidarihipotiroid?
3.Apakahmanifestasiklinisdarihipotiroid?
4.Bagaimanapatofisiologipadahipotiroid?
5.Bagaimanapenatalaksaansertapencegahanpadahipotiroid?
6.Bagaimanapengkajianpadakliendenganhipotiroid?
7.Bagaimanadiagnosapadakliendenganhipotiroid?
8.Bagaimanaintervensipadakliendenganhipotiroid?
1.3Tujuan
TujuanUmum

MampumenjelaskanapayangdimaksuddenganHipotiroid.
TujuanKhusus
1)MampumenjelaskandefinisiHipotiroid.
2)MampumenjelaskanpenyebabpenyakitHipotiroid.
3)MampumenjelaskangejaladanpengobatanpenyakitHipotiroid.
4)MampumenjelaskanAsuhankeperawatanpenyakitHipotiroid.
1.4Manfaat
Manfaatyangingindiperolehdalampenyusunanmakalahiniadalah:
1)MendapatkanpengetahuantentangdefinisiHipotiroid.
2)MendapatkanpemahamantentangpenyebabpenyakitHipotiroid.
3)MendapatkanpemahamantentanggejaladanpengobatanpenyakitHipotiroid.
4)MendapatkanpemahamantentangAsuhankeperawatanpasienpadapenyakitHipotiroid.
BABII
TINJAUANTEORITISHIPOTIROID

2.1Definisi
Hipotiroidadalahsuatukondisiyangdikarakteristikanolehproduksihormontiroidyangrendah.Adabanyak
kekacauankekacauan yang berakibat pada hipotiroid. Kekacauankekacauan ini mungkin langsung atau tidak
langsungmelibatkankelenjartiroid.Karenahormontiroidmempengaruhipertumbuhan,perkembangan,danbanyak
prosesproses sel, hormon tiroid yang tidak memadai mempunyai konsekuensikonsekuensi yang meluas untuk
tubuh.

2.2Etiologi
Hipotiroid adalah suatu kondisi yang sangat umum. Diperkirakan bahwa 3% sampai 5% dari populasi
mempunyaibeberapabentukhipotiroid.Kondisiyanglebihumumterjadipadawanitadaripadapriadankejadian
kejadiannyameningkatsesuaidenganumur.
Dibawahadalahsuatu daftar dari beberapapenyebabpenyebabumum hipotiroid padaorangorangdewasa
diikutiolehsuatudiskusidarikondisikondisiini.
a)Hashimoto'sthyroiditis
b)Lymphocyticthyroiditis(yangmungkinterjadisetelahhipertiroid)
c)Penghancurantiroid(dariyodiumberradioaktifatauoperasi)
d)Penyakitpituitariatauhipotalamus
e)Obatobatan
f)Kekuranganyodiumyangberat

2.3JenisjenisHipotiroid
Lebihdari95%penderitahipotiroidmengalamihipotiroidprimeratautiroidalyangmengacukepadadisfungsi
kelenjartiroiditusendiri.Apabiladisfungsitiroiddisebabkanolehkegagalankelenjarhipofisis,hipotalamusatau
keduanya hipotiroid sentral (hipotiroid sekunder) atau pituitaria. Jika sepenuhnya disebabkan oleh hipofisis
hipotiroidtersier.
a.Primer
1)Goiter:TiroiditisHashimoto,fasepenyembuhansetelahtiroiditis,defisiensiyodium
2)Nongoiter:destruksipembedahan,kondisisetelahpemberianyodiumradioaktifatauradiasieksternal,agenesis,
amiodaron
b.Sekunder:
kegagalanhipotalamus(TRH,TSHyangberubahubah,T4bebas)ataukegagalanpituitari(TSH,T4bebas)

2.4Gejalagejalahipotiroid
Gejalagejalahipotiroidadalahseringkalitidakkelihatan.Merekatidakspesifik(yangberartimerekadapat
menirugejalagejaladaribanyakkondisikondisilain)danadalahseringkalidihubungkanpadapenuaan.Pasien
pasiendenganhipotiroidringanmungkintidakmempunyaitandatandaataugejalagejala.Gejalagejalaumumnya
menjadilebihnyataketikakondisinyamemburukdanmayoritasdarikeluhankeluhaniniberhubungandengansuatu
perlambatanmetabolismetubuh.
Gejalagejalaumumsebagaiberikut:
a)Kelelahan
b)Depresi
c)Kenaikkanberatbadan
d)Ketidaktoleranandingin
e)Ngantukyangberlebihan
f)Rambutyangkeringdankasar
g)Sembelit
h)Kulitkering
i)Kejangkejangotot
j)Tingkattingkatkolesterolyagmeningkat
k)Konsentrasimenurun
l)Sakitsakitdannyerinyeriyangsamarsamar
m)Kakikakiyangbengkak

Ketikapenyakitmenjadilebihberat,mungkinadabengkakbengkakdisekelilingmata,suatudenyutjantung
yangmelambat,suatupenurunantemperaturtubuh,dangagaljantung.Dalambentuknyayangamatbesar,hipotiroid
yangberatmungkinmenjuruspadasuatukomayangmengancamnyawa(miksedemakoma).Padaseorangyang
mempunyaihipotiroidyangberat,suatumiksedemakomacenderungdipicuolehpenyakitpenyakitberat,operasi,
stres,ataulukatrauma.
Kondisiinimemerlukanopname(masukrumahsakit)danperawatansegeradenganhormonhormontiroid
yangdiberikanmelaluisuntikandidiagnosissecarabenar,hipotiroiddapatdenganmudahdansepenuhnyadirawat
dengan penggantian hormon tiroid. Pada sisi lain, hipotiroid yang tidak dirawat dapat menjurus pada suatu
pembesaranjantung(cardiomyopathy),gagaljantungyangmemburuk,dansuatuakumulasicairansekitarparuparu
(pleuraleffusion).

2.5Patofisiologi
Hipotiroiddapatdisebabkanolehgangguansintesishormontiroidataugangguanpadaresponjaringanterhadap
hormontiroid.Sintesishormontiroiddiatursebagaiberikut:
1.HipotalamusmembuatThyrotropinReleasingHormone(TRH)yangmerangsanghipofisisanterior.
2.Hipofisisanteriormensintesisthyrotropin(ThyroidStimulatingHormone=TSH)yangmerangsangkelenjartiroid.
3.Kelenjar tiroid mensintesis hormon tiroid (Triiodothyronin= T3 dan Tetraiodothyronin= T4 =Thyroxin) yang
merangsang metabolisme jaringan yang meliputi: konsumsi oksigen, produksi panas tubuh, fungsi syaraf,
metabolismeprotrein,karbohidrat,lemak,danvitaminvitamin,sertakerjadaripadahormonhormonlain.

Hipotiroiddapatterjadiakibatmalfungsikelenjartiroid,hipofisis,atauhipotalamus.Apabiladisebabkanoleh
malfungsikelenjartiroid,makakadarHTyangrendahakandisertaiolehpeningkatankadarTSHdanTRHkarena
tidakadanyaumpanbaliknegatifolehHTpadahipofisisanteriordanhipotalamus.
Apabilahipotiroidterjadiakibatmalfungsihipofisis,makakadarHTyangrendahdisebabkanolehrendahnya
kadarTSH.TRHdarihipotalamustinggikarenatidakadanyaumpanbaliknegatifbaikdariTSHmaupunHT.
HipotiroidyangdisebabkanolehmalfungsihipotalamusakanmenyebabkanrendahnyakadarHT,TSH,danTRH.

2.6GambaranKlinis
a)Kelambanan,perlambatandayapikir,dangerakanyangcanggunglambat
b)Penurunanfrekuensidenyutjantung,pembesaranjantung(jantungmiksedema),danpenurunancurahjantung.
c)Pembengkakkandanedemakulit,terutamadibawahmatadandipergelangankaki.
d)Penurunankecepatanmetabolisme,penurunankebutuhankalori,penurunannafsumakandanpenyerapanzatgizi
darisalurancema
e)Konstipasi
f)Perubahanperubahandalamfungsireproduksi

g)Kulitkeringdanbersisiksertarambutkepaladantubuhyangtipisdanrapuh

2.7PemeriksaanDiagnostik
a)Untukmendiagnosishipotiroidismeprimer,kebanyakandokterhanyamengukurjumlahTSH(Thyroidstimulating
hormone)yangdihasilkanolehkel.hipofisis.
b) Level TSH yang tinggi menunjukkan kelenjar tiroid tidak menghasilkan hormon tiroid yg adekuat (terutama
tiroksin(T4)dansedikittriiodotironin(fT3).
c)TetapiuntukmendiagnosishipotiroidismesekunderdantertiertidakdapatdgnhanyamengukurlevelTSH.
d)Olehitu,ujidarahyangperludilakukan(jikaTSHnormaldanhipotiroidismemasihdisuspek),sbb:
1.freetriiodothyronine(fT3)
2.freelevothyroxine(fT4)
3.totalT3
4.totalT4
5.24hoururinefreeT3

2.8PenatalaksanaanMedisdanKomplikasi
Komamiksedemaadalahsituasiyangmengancamnyawayangditandaioleheksaserbasi(perburukan)semua
gejalahipotiroidismetermasukhipotermitanpamenggigil,hipotensi,hipoglikemia,hipoventilasi,danpenurunan
kesadaranhinggakoma.KematiandapatterjadiapabilatidakdiberikanHTdanstabilisasisemuagejala.Dalam
keadaandarurat(misalnyakomamiksedem),hormontiroidbisadiberikansecaraintravena.
Hipotiroidismediobatidenganmenggantikankekuranganhormontiroid,yaitudenganmemberikansediaanper
oral(lewatmulut).YangbanyakdisukaiadalahhormontiroidbuatanT4.Bentukyanglainadalahtiroidyang
dikeringkan(diperolehdarikelenjartiroidhewan).
Pengobatanpadapenderitausialanjutdimulaidenganhormontiroiddosisrendah,karenadosisyangterlalu
tinggi bisa menyebabkan efek samping yang serius. Dosisnya diturunkan secara bertahap sampai kadar TSH
kembalinormal.Obatinibiasanyaterusdiminumsepanjanghiduppenderita.
Pengobatanselalumencakuppemberiantiroksinsintetiksebagaipenggantihormontiroid.Apabilapenyebab
hipotiroidism berkaitan dengan tumor susunan saraf pusat, maka dapat diberikan kemoterapi, radiasi, atau
pembedahan.

ContohKasus:Seorangwanita,usia28tahun,BB40kg,TB160cm,Riwayatpenyakit:duatahunyanglalu
pasienpernahmelakukanpengobatandiPuskesmasdengankeluhanadabenjolandileherdepandannyeritekan,
pasienjugamerasakandadaseringberdebardebardanbadannyatetapkurus.
Hasilpemeriksaanfisikjantungnyaamembesar,nadi<60.=""15pg=""20=""aspiration=""benjolan=""
biopsy="" dan="" di="" disarankan="" dl="" dokter="" exofthalmus="" fineddle="" ft3="" ft4="" g=""

iodium=""kali=""kemudian=""laboratorium=""leher=""matanya=""melakukan=""menit=""ml=""nyeri.=""
oleh=""pemeriksaan=""radioaktif=""rasa=""span=""tsh=""untuk="">

Kurangyodiumberat
Operasitiroid
WOC:
Penyakitautoimun
Gondokendemik
HIPOTIROID
Penurunanmetabolismbasal
Kelemahanotot
oftalmopati
G.TeRmoregulasi
Prod.Kel.Sebasea&kringatmnurun.
Eksitensineuromuscularmenurun
s.integumn
s.cerna
Kulitkering
Absorbsiganggu/anoreksi
MotilitasSraktusturun
Ketidakseimbangannutrisikurangdarikebutuhantubuhb/danoreksia
karotenemia
Kulitkekuning2n
g.citratubuh
Hipotermi.
Kerusakanintegritaskulit
.Gangguanpersepsisensorik(penglihatan)b/dgangguantransmisiimpulssensoriksebagaiakibatoftalmopati.

.Penurunancurahjantungb/dperubahanvolumesekuncup
Intoleranaktivitasberhubungandengankelemahanumum
Konstipasi
.Ketidakefektifanpolanafasberhubungandengansindromhipoventilasi
SindromgangguanInterpretsasilingkunganberhubungandengandepresi
InkonsentrasiproteinG/Reseptoradrenergik
anoreksia
g.moblisasi
bradikardi
Selotakdisfugsikognitif

BABIII
ASUHANKEPERAWATAN

3.1Pengkajian
Dampak penurunan kadar hormon dalam tubuh sangat bervariasi, oleh karena itu lakukanlah pengkajian
terhadapha1ha1pentingyangdapatmenggalisebanyakmungkininformasiantaralain:
a.Identitaspasien:
Nama:Ny.Mona
Umur:28tahun
Jeniskelamin:Perempuan
Pekerjaan:Pegawaiswasta
Beratbadan:40kg
Tinggibadan:160cm
b.Keluhanutama:
Sesaknafas
Sulitmenelan
Pembengkakandanrasanyeripadaleher
Pasiennampakgelisah
Pasientidaknafsumakan

Rasacapek/lelah
Pasienintoleranterhadapdingin
Sembelit
c.Riwayatkesehatan:
Pernah melakukan pengobatan 2 tahun lalu dengan keluhan terdapat benjolan di leher depan dan nyeri saat
ditekan.
d.Kebiasaanhidupseharihariseperti:
1.Polamakan
Mengkonsumsimakananyangkadaryodiumnyarendah,dannafsumakanmenurun
2.Polatidur
Pasienseringtidurlarutmalam
3.Polaaktivitas
Pasienterlalumemforsirpekerjaansehinggaseringmengeluhkelelahan
e.Pemeriksaanfisikmencakup:
1)Sistem intergument, seperti : kulit dingin, pucat , kering, bersisik dan menebal,pertumbuhan kuku buruk, kuku
menebal,rambutkering,kasar,rambutrontokdanpertumbuhannyarontok.
2)Sistempulmonary,seperti:hipoventilasi,pleuralefusi,dispenia
3)Sistem kardiovaskular, seperti : bradikardi, disritmia, pembesaran jantung, toleransi terhadap aktifitas menurun,
hipotensi.
4)Metabolik,seperti:penurunanmetabolismebasal,penurunansuhutubuh,intoleransiterhadapdingin.
5)Sistemmusculoskeletal,seperti:nyeriotot,kontraksidanrelaksasiototyangmelambat.
6)Sistem neurologi,seperti:fungsiintelektualyanglambat,berbicaralambatdanterbatabata,gangguanmemori,
perhatiankurang,bingung,hilangpendengaran,penurunanreflekstendom.
7)Gastrointestinal,seperti:anoreksia,peningkatanberatbadan,obstipasi,distensiabdomen.
8)Psikologisdanemosional;apatis,igitasi,depresi,paranoid,menarikdiri/kurangpercayadiri,danbahkanmaniak.
f.PemeriksaanPenunjang:
1)PemeriksaankadarT3danT4padapasienyaitu:KadarT315pg/dl,dankadarT420g/dl.
2)PemeriksaanTSH(padakliendenganhipotiroidismeprimerakanterjadipeningkatanTSHserum,sedangkanpada
yangsekunderkadarTSHdapatmenurunataunormal):KadarTSHpadapasientersebutyaitu<0i=""ml="">
g.PemeriksaanUSG:
Pemeriksaaninibertujuanuntukmemberikaninformasiyangtepattentangukurandanbentukkelenjartiroiddan
nodulh.

h.AnalisisData:

1)Gangguanpersepsisensorik(penglihatan)b/dgangguantransmisiimpulssensoriksebagaiakibatoftalmopati
Datayangdidapat:fungsiintelektualyanglambat,berbicaralambatdanterbatabata,gangguanmemori,perhatian
kurang,bingung,hilangpendengaran,parastesia,penurunanreflekstendom.
2)Penurunancurahjantungb/dpenurunanvolumesekuncupsebagaiakibatbradikardi,hipotensi.
Datayangdidapat:bradikardi,disritmia,pembesaranjantungdanhipotensi.
3)Perubahan nutrisi kurang dari kebutuhan tubuh b/d penurunan kebutuhan metabolisme,dan napsu makan yang
menurun.
Datayangdidapat:anoreksia,obtipasi,distensiabdomen,hemoglobinmenurun,dingin,pucat,kering,bersisikdan
menebal,pertumbuhankukuburuk,sertakukumenebal.
4)Polanafastidakefektifberdasarkanpenurunantenaga/kelelahan,ekspansiparuyangmenurun,dispnea.
Datayangdidapat:hipoventilasi,dispenia,efusipleural
3.2DiagnosaKeperawatan
a.Gangguanpersepsisensorik(penglihatan)b/dgangguantransmisiimpulssensoriksebagaiakibatoftalmopati.
b.Penurunancurahjantungb/dperubahanvolumesekuncup
c.Ketidakseimbangannutrisikurangdarikebutuhantubuhb/danoreksia
d.Intoleranaktivitasberhubungandengankelemahanumum
e.Hipotermib/dpenyakit.
f.Konstipasiberhubungandenganpenurunanmotilitastraktusgastrointestinal
g.Ketidakefektifanpolanafasberhubungandengansindromhipoventilasi
h.SindromgangguanInterpretsasilingkunganberhubungandengandepresi

3.3Intervensi
Dx1.Gangguanpersepsisensorik(penglihatan)berdasarkangangguantransmisiimpulssensoriksebagaiakibat
oftalmopati.
Tujuan:agarpasientidakmengalamipenurunanvisusyanglebihburukdantidakterjaditrauma/cederapadamata.

Intervensi:
1)Anjurkanpadapasianbilatidurdenganposisielevasikepala.
R/untukmengurangitraumapadamata
2)Basahimatadenganborwatersteril.
R/untukmemberirasanyamanpadamata

3)Jikapasientidakdapatmenutupmatarapatpadasaattidur,gunakanplesternonalergi.
R/memudahkanpasienuntuktidur
4)Berikanobatobatansteroidsesuaiprogram.Padakasuskasusyangberat,biasanyadoktermemberikanobatobat
untukmengurangiedemasepertisteroiddandiuretik.
R/mengurangiedemadancairan

Dx2.Penurunancurahjantungb/dperubahanvolumesekuncup
Tujuan:agarfungsikardiovaskulertetapoptimalyangditandaidengantekanandarah,daniramajantungdalambatasnormal.
Intervensi:
1.Pantautekanandarah,denyutdaniramajantungsetiap2jam
R/ untuk mengindikasi kemungkinan terjadinya gangguan hemodinamik jantung seperti hipotensi, penurunan
pengeluaranurinedanperubahanstatusmental.
2.Anjurkanpasienuntukmemberitahuperawatsegerabilapasienmengalaminyeridada,
R/karenapadapasiendenganhipotiroidkronikdapatberkembangarteiosklerosisarterikoronaria.

3.Kolaborasipemberianobatobatan
R/untukmengurangigejalahgejalah.
Obatyangseringdigunakanadalahlevotyroxinesodium.
Observasidenganketatadanyanyeridadadandispenia.Padadosisawalpemberianobatbiasanyadokter
memberikandosisminimal,yangkemudianditingkatkansecarabertahapsetiap23minggusampaiditemukan
dosisyangtepatuntukpemeliharaan.
4. Ajarkankepadapasiendankeluargacarapenggunaanobatsertatandatandayangharusdiwaspadaibilaterjadi
hipertiroidakibatpenggunaanobatyangberlebihan.
R/untukmengidentifikasikanreaksiobatyangdiberikanpadapasien

Dx3:Ketidakseimbangannutrisikurangdarikebutuhantubuhb/danoreksia
Tujuan:agarnutrisipasiendapatterpenuhidengankriteria:beratbadanbertambah,teksturkulitbaik.
Intervensi:
1.Dorongpeningkatanasupancairan
R/Untukmenambahasupancairanpadatubuhpx
2.Berikanmakananyangkayaakanserat
R/Agarasupannutrisipadatubuhtercukupi
3.Ajarkankepadaklien,tentangjenisjenismakananyangbanyakmengandungair.
R/Agarpxtautentangmakananapasajayangbaikuntukdimakan
4.Kolaborasidengantimmedisdalampemberianobatdanterapiyangtepat

R/untukpemberianobatpecahardanenemabiladiperlukan
5.Kolaborasidenganahligizi
}R/untukpemberiannutrisiyangdiberikantepat

Dx4.Intoleranaktivitasberhubungandengankelemahanumum
Tujuan:agarpasiendapatberistirahat.
Intervensi:
1.Aturintervalwaktuantaraktivitasuntukmeningkatkanistirahatdanlatihanyangdapatditolerir.
R/untukmeningkatkanistirahatdanlatihanyangdapatditolerir.
2.Bantuaktivitasperawatanmandiriketikapasienberadadalamkeadaanlelah.
R/Agartidakterjadilukadekusbitus
3.Berikanstimulasimelaluipercakapandanaktifitasyangtidakmenimbulkanstress.
R/Bertujuanagartidakmenimbulkanstress
4.Pantauresponpasienterhadappeningkatanaktivitas.
R/Untukmengetahuiperkembangandalamberaktivitaspadapasien

Dx5.Hipotermiberhubungandenganpenyakit.
Tujuan:Pemeliharaansuhutubuhnormal.
Intervensi:
1.Berikantambahanlapisanpakaianatautambahanselimut.
R/Agarpasienmerasahangatdannyaman
2. Hindari dan cegah penggunaan sumber panas dari luar (misalnya, bantal pemanas, selimut listrik atau
penghangat).
R/Agartidakterjadihalhalyangtidakdiinginkanatauefeksampingdaribendatsb
3.Pantausuhutubuhpasiendanmelaporkanpenurunannyadarinilaidasarsuhunormalpasien.
R/Untukmengetahuisuhunormalpadapx
4.Lindungiterhadaphawadingindanhembusanangin
.R/Agarhipotermitidakkambuhlagi

Dx6.Konstipasiberhubungandenganpenurunanmotilitastraktusgastrointestinal
Tujuan:Pemulihanfungsiususyangnormal.
Intervensi:
1.Dorongpeningkatanasupancairan.
R/Agarasupancairanpadatubuhterpenuhi

2.Berikanmakananyangkayaakanserat.
R/Agarasupannutrisiterpenuhidenganbaik
3.Ajarkankepadapasien,tentangjenisjenismakananyangbanyakmengandungair.
R/Memberiwawasanpadapasienmakananapasajayangbaikuntukdikonsumsi
4.Pantaufungsiusus
R/Untukmengetahuikerjaususapakahsudahnormalataubelum
5.Dorongpasienuntukmeningkatkanmobilisasidalambatasbatastoleransilatihan.
R/Untukmerileksasikanototototagartidakkaku
6.Kolaborasi:untukpemberianobatpencahardanenemabiladiperlukan.
R/:untukpemberianobatpencahardanenemabiladiperlukan
Dx7.KetidakefektifanPolanapasberhubungandengansindromhipoventilasi.
Tujuan:Perbaikanstatusrespirasidanpemeliharaanpolanapasyangnormal.
Intervensi:
1.Pantaufrekuensi;kedalaman,polapernapasan;oksimetridenyutnadidangasdaraharterial.
R/untukmengetahuitindakanselanjutnyadaripemeriksaantsb
2.Dorongpasienuntuknapasdalamdanbatuk.
R/untukmengetahuitindakanselanjutnyadaripemeriksaantsb
Berikanobat(hipnotikdansedatip)denganhatihati.
R/karenadosisyamgberlebihaakanmenimbulkanefeksampingdariobattsb
4.Peliharasalurannapaspasiendenganmelakukanpengisapandandukunganventilasijikadiperlukan.
R/untukmengaturpolanafaspaseinagarbisabernafasdenganbaik
Dx8.SindromgangguanInterpretsasilingkunganberhubungandengandepresi
Tujuan:Perbaikanprosesberpikir
Intervensi:
1.Orientasikanpasienterhadapwaktu,tempat,tanggaldankejadiandisekitardirinya.
R/Untukmengurangiterjadinyastreskarenaprosespenyakit
2.Berikanstimulasilewatpercakapandanaktifitas
R/Untukmengurangistresakibatpenyakityangdideritapx
3. Jelaskankepadapasiendankeluargabahwaperubahanpadafungsikognitifdanmentalmerupakanakibatdan
prosespenyakit.
R/Memberiwawasanpadakeluagapasiententangapayangterjadiakibatprosespenyakittsb

BABIV
PENUTUP
Kesimpulan
Hipotiroidadalahsuatukondisiyangdikarakteristikanolehproduksihormontiroidyangabnormalrendahnya.Ada
banyakkekacauankekacauanyangberkaitanpadaHipotiroid.Kekacauankekacauaninimungkinlangsungatautidak
langsungmelibatkankelenjartiroid.Karenahormontiroidmempengaruhipertumbuhan.
Hormonhormon tiroid di produsikan oleh kelenjar tiroid.Kelenjar tiroid bertempat pada bagian bawah
leher,Kelenjarmembungkussekelilingsaluranudara(Trakea)danmempunyaisuatubentukyangmenyerupaikupu
kupuyangdibentukolehduasayapdandilekatkanolehsuatubagiantengah.
Kelenjar tiroid mengambil yodium dari darah ( yang kebanyakan datang dari makananmakanan seperti
seafood,roti,dangaram)danmenggunakannyauntukmemproduksihormonhormontiroid.Duahormonyangpaling
pentingadalahthyroxine(T4)dantriiodothyronine(T3)mewakili99.9%dan0.1%darimasingmasinggormon
hormontiroid.
SARAN
1.Seringseringlahmengkonsumsigaramyangmengandungyodiumdengancukup
2.Jagapoladiettiapharidenganmengkonsumsimakananbanyakseratdanbanyakproteinsertarendahkolesterol
3.Segeraperiksakanjikamerasamemilikitandaataugejalahipotiroid.