Vous êtes sur la page 1sur 16

Serum albumin precursor (Allergen Bos d 6) (BSA)

Protein - its main function is the regulation of the colloidal osmotic pressure of b
This sequence is taken from http://en.wikipedia.org/wiki/Fasta_format
dit F 61 L
didit AB 59 K
dah C 59 E
didah EF 47 A
dahdit EC 40 D
dididit BAF 37 V
dididah ABC 35 C
didahdit EFE 33 T
dahdidit CBA 28 F
dahdah FA 28 P
didididit BCEF 28 S
didididah ECBA 26 R
dididahdit FABC 20 Y
F A B C E F F Lydian EGABDE didahdidit EFEC 20 Q
dahdididit BAFA 17 G
dahdahdit BCE 17 H
dahdidah FEC 14 I
didahdah BAF 14 N
dahdahdah ABC 4M
dididahdah EFEC 2W
didahdidah BAFA 0X

RGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAF
ADESHAGCEKSLHTLFGDELCKVASLRETYGD
LKPDPNTLCDEFKADEKKFWGKYLYEIARRHP
ACLLPKIETMREKVLASSARQRLRCASIQKFG
TDLTKVHKECCHGDLLECADDRADLAKYICDN
DAIPENLPPLTADFAEDKDVCKNYQEAKDAFL
TLEECCAKDDPHACYSTVFDKLKHLVDEPQNL
PQVSTPTLVEVSRSLGKVGTRCCTKPESERMP
CCTESLVNRRPCFSALTPDETYVPKAFDEKLF
KPKATEEQLKTVMENFVAFVDKCCAADDKEA
otic pressure of blood per Wikipedia.
sta_format
Leucine Leu 61 L

Lysine Lys 59 E

Glutamic Acid Glu 59 K

Alanine Ala 47 A

Aspartic Acid Asp 40 D

Valine Val 37 V

Cysteine Cys 35 C

Threonine Thr 33 T

Phenylalanine Phe 28 F

Proline Pro 28 P

Serine Ser 28 S

Arginine Arg 26 R

Tyrosine Tyr 20 Q

Glutamine Gln 20 Y

Glycine Gly 17 G

Histidine His 17 H

Isoleucine Ile 14 I

Asparagine Asn 14 N

Methionine Met 4M

Tryptophan Trp 2W

various 1X

589

GEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCV 67

LCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPK 127

WGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKG 187

QRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLV 247
DDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEK 307

CKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEA 367

DKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKV 427

TRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK 487

ETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKH 547

VDKCCAADDKEACFAVEGPKLVVSTQTALA
header
A 61 L
A 59 E
A 59 K
A 47 A
A 40 D
A 37 V
A 35 C
A 33 T
A 28 F
A 28 P
A 28 S
A 26 R
A 20 Q
A 20 Y
A 17 G
A 17 H
A 14 I
A 14 N
A 4M
A 2W
A 589
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
C 1
C 2
C 3
C 4
C 5
C 6
C 7
C 8
C 9
C 10
C 11
C 12
C 13
C 14
C 15
C 16
C 17
C 18
C 19
C 20
C 21
C 22
C 23
C 24
C 25
C 26
C 27
C 28
C 29
C 30
C 31
C 32
C 33
C 34
C 35
D 1
D 2
D 3
D 4
D 5
D 6
D 7
D 8
D 9
D 10
D 11
D 12
D 13
D 14
D 15
D 16
D 17
D 18
D 19
D 20
D 21
D 22
D 23
D 24
D 25
D 26
D 27
D 28
D 29
D 30
D 31
D 32
D 33
D 34
D 35
D 36
D 37
D 38
D 39
D 40
E 1
E 2
E 3
E 4
E 5
E 6
E 7
E 8
E 9
E 10
E 11
E 12
E 13
E 14
E 15
E 16
E 17
E 18
E 19
E 20
E 21
E 22
E 23
E 24
E 25
E 26
E 27
E 28
E 29
E 30
E 31
E 32
E 33
E 34
E 35
E 36
E 37
E 38
E 39
E 40
E 41
E 42
E 43
E 44
E 45
E 46
E 47
E 48
E 49
E 50
E 51
E 52
E 53
E 54
E 55
E 56
E 57
E 58
E 59
F 1
F 2
F 3
F 4
F 5
F 6
F 7
F 8
F 9
F 10
F 11
F 12
F 13
F 14
F 15
F 16
F 17
F 18
F 19
F 20
F 21
F 22
F 23
F 24
F 25
F 26
F 27
F 28
G 1
G 2
G 3
G 4
G 5
G 6
G 7
G 8
G 9
G 10
G 11
G 12
G 13
G 14
G 15
G 16
G 17
H 1
H 2
H 3
H 4
H 5
H 6
H 7
H 8
H 9
H 10
H 11
H 12
H 13
H 14
H 15
H 16
H 17
I 1
I 2
I 3
I 4
I 5
I 6
I 7
I 8
I 9
I 10
I 11
I 12
I 13
I 14
K 1
K 2
K 3
K 4
K 5
K 6
K 7
K 8
K 9
K 10
K 11
K 12
K 13
K 14
K 15
K 16
K 17
K 18
K 19
K 20
K 21
K 22
K 23
K 24
K 25
K 26
K 27
K 28
K 29
K 30
K 31
K 32
K 33
K 34
K 35
K 36
K 37
K 38
K 39
K 40
K 41
K 42
K 43
K 44
K 45
K 46
K 47
K 48
K 49
K 50
K 51
K 52
K 53
K 54
K 55
K 56
K 57
K 58
K 59
L 1
L 2
L 3
L 4
L 5
L 6
L 7
L 8
L 9
L 10
L 11
L 12
L 13
L 14
L 15
L 16
L 17
L 18
L 19
L 20
L 21
L 22
L 23
L 24
L 25
L 26
L 27
L 28
L 29
L 30
L 31
L 32
L 33
L 34
L 35
L 36
L 37
L 38
L 39
L 40
L 41
L 42
L 43
L 44
L 45
L 46
L 47
L 48
L 49
L 50
L 51
L 52
L 53
L 54
L 55
L 56
L 57
L 58
L 59
L 60
L 61
M 1
M 2
M 3
M 4
N 1
N 2
N 3
N 4
N 5
N 6
N 7
N 8
N 9
N 10
N 11
N 12
N 13
N 14
P 1
P 2
P 3
P 4
P 5
P 6
P 7
P 8
P 9
P 10
P 11
P 12
P 13
P 14
P 15
P 16
P 17
P 18
P 19
P 20
P 21
P 22
P 23
P 24
P 25
P 26
P 27
P 28
Q 1
Q 2
Q 3
Q 4
Q 5
Q 6
Q 7
Q 8
Q 9
Q 10
Q 11
Q 12
Q 13
Q 14
Q 15
Q 16
Q 17
Q 18
Q 19
Q 20
R 1
R 2
R 3
R 4
R 5
R 6
R 7
R 8
R 9
R 10
R 11
R 12
R 13
R 14
R 15
R 16
R 17
R 18
R 19
R 20
R 21
R 22
R 23
R 24
R 25
R 26
S 1
S 2
S 3
S 4
S 5
S 6
S 7
S 8
S 9
S 10
S 11
S 12
S 13
S 14
S 15
S 16
S 17
S 18
S 19
S 20
S 21
S 22
S 23
S 24
S 25
S 26
S 27
S 28
T 1
T 2
T 3
T 4
T 5
T 6
T 7
T 8
T 9
T 10
T 11
T 12
T 13
T 14
T 15
T 16
T 17
T 18
T 19
T 20
T 21
T 22
T 23
T 24
T 25
T 26
T 27
T 28
T 29
T 30
T 31
T 32
T 33
V 1
V 2
V 3
V 4
V 5
V 6
V 7
V 8
V 9
V 10
V 11
V 12
V 13
V 14
V 15
V 16
V 17
V 18
V 19
V 20
V 21
V 22
V 23
V 24
V 25
V 26
V 27
V 28
V 29
V 30
V 31
V 32
V 33
V 34
V 35
V 36
V 37
W
W
Y 1
Y 2
Y 3
Y 4
Y 5
Y 6
Y 7
Y 8
Y 9
Y 10
Y 11
Y 12
Y 13
Y 14
Y 15
Y 16
Y 17
Y 18
Y 19
Y 20