Vous êtes sur la page 1sur 30

EXIBITIONWATCHREPORT

MobileIT&BigData rd th 23 25 ofOctober,2012
Paris,PortedeVersailles Applicationsformobile,BusinessIntelligence

Pourtousrenseignements:contact@veillesalon.com Tl.0871572178Fax.0134350489 AreportmadebytheVIEDOCcompany UnsiteproduitetditparVIEDOCSolutions 2ruedeHlneBoucher,78280Guyancourt,FRANCE 8ruedeMalleville,95880Enghienlesbains

Foranyfurtherinformation:contact@veillesalon.comTel:+33(0)130434527 Websites:www.veillesalon.comandwww.viedoc.fr

P a g e |2

TABLEOFCONTENTS
ABSTRACT................................................................................................................................................................4 RESUME ..................................................................................................................................................................4 . Part1. innovationsonmobileit........................................................................................................................5 1.1 BackgroundonGamificationonmobile................................................................................................5 1.1.1 Definitionofgamification .................................................................................................................5 . 1.1.2 Gamificationmarketforecast...........................................................................................................6 1.1.3 Innovationsfromplatformproviders................................................................................................6 1.2 NomalysbyNomalys(Mobileapplication)............................................................................................7 1.3 TeopadbyThales...................................................................................................................................8 Part2. Bigdata................................................................................................................................................12 2.1 BackgroundonBigData......................................................................................................................12 2.1.1 Definingbigdata.............................................................................................................................12 2.1.2 CharacteristicsofBigData:ThefourVs..........................................................................................12 2.1.3 TheImportanceofBigData............................................................................................................13 2.1.4 EstimationsofITspendingdrivenbyBigDataissues.....................................................................15 2.2 BigDataArchitectureCapabilitiesandtheirprimarytechnologies ....................................................16 . 2.2.1 Comparisonofinformationarchitectures.......................................................................................16 2.2.2 StorageandManagementCapability..............................................................................................17 2.2.3 DatabaseCapability.........................................................................................................................19 2.2.4 ProcessingCapability ......................................................................................................................20 . 2.2.5 DataIntegrationCapability.............................................................................................................21 2.2.6 StatisticalAnalysisCapability..........................................................................................................22 2.3 Trendsonbigdata...............................................................................................................................23 2.3.1 TheInternetofThingsalreadyhere................................................................................................24 2.3.2 Gettingtotherightbusinessmodel(s)fordata..............................................................................24 2.3.3 AddingaSociallayertotraditionalactivities..................................................................................24 2.3.4 TheNewFrontierofBusinessIntelligence&Semanticsatpetabytescale.....................................25 2.4 KeycompaniesintheBigDataexibitioninParis.................................................................................25 2.4.1 DataPublica....................................................................................................................................25 2.4.2 Altic.................................................................................................................................................25 2.4.3 Talend..............................................................................................................................................26 Conclusion.............................................................................................................................................................27 AboutVEILLESALON.............................................................................................................................................28 PRESENTATIONofVIEDOCSARL...........................................................................................................................29

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |3

DISCLAIMER

Thisreportwascompiledfrominterviewsconductedbyuswiththeexhibitorspresentat each event, from gathering and analyzing information in conferences and from the compilationofinformationonthewebafterwards. Thus,thedatacontainedinthisreporthaveinformationvalue.Althoughtheobjectiveisto disseminatetimelyandaccurateinformation,VEILLESALONcannotguaranteetheresult. Anydamagethatmayresultfromuseofthisinformationcantbeimputedtothissite.The useorreproductionofallorpartofthisdocumentisprohibitedwithoutthepriorwritten consentofVEILLESALON. Forfulltermsandconditionsofuseofthisreport,thankyouforcontactingus.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |4

ABSTRACT
According to the organizers, the exhibition Mobile IT and Big Data have not attracted many visitors. Big companieslikeOrange,SFR,Bouygues,FreefortelecomsorlikeIntel,Dell,IBMforBigDatawereabsent.But theconferencesontheevolutionofthesesectorshavebeenverysuccessful.Inagloomyatmospherewhere visitorsandexhibitorstalkopenlyabouttinybudgetsforinformationtechnology,somesectors,however,were quite healthy and innovative. This was the case for equipment manufacturers and developers of next generationtelephony,orwebprovider.Thereweresomeimpressiveinnovationsinthefieldofsmartphones coming from a large number of young companies, specializing in mobile business solutions. The advent of smartphones and tablets is revolutionizing enterprise mobility. Judicious use of interfaces from the video games industry brings playful applications, which allows more friendly use by customers. We talk about "gamification"phenomenon,whichisabouttocommerciallyexplodeintheshortterm. ConferencesonBigDatagrewquiteacrowdandallowedvisitorstodiscoveranemergingsectorthatshould weighheavilyinthedevelopmentofenterprises.Inonly10years,theamountofdataincreasedexponentially. Datastorageisacostlyproblemforbusinesses,butthesedataarerelativelyuntappedbycompanies.Theidea of big data is to create added value from very diverse data. People now talk about flows, exchanges, collaborationsratherthanstorage.Nothingissortedbuteverythingcanbefound.BigData(from10TBofdata) isrevolutionizingtheinfrastructureininformationtechnology.EnvironmentssuchasHadoopprovideflexibility in resources and adapt to the workload by adding inexpensive servers in parallel. Big Data has generated a turnoverof$17billionin2011anditisestimatedthatthisfigurewilldoubleby2016.Thegreatdebatewith bigdataistofindabalancebetweendatatransparencyandprivacyofcitizens.

Keywords:mobile,gamification,smartphone,security,bigdata,datascientists,hadoop,businessintelligence

RESUME
Delaveummedesorganisateurs,lessalonMobileITetBigDatanontpasattirbeaucoupdevisiteursetles grandsdumilieucommeOrange,SFR,Bouygues,FreepourlestlcomsoucommeIntel,Dell,IBMpourlesBig Datataientabsents.Maislesconfrencestechniquesetsocitalessurlvolutiondecessecteursontconnu un vif succs. Dans une ambiance morose o visiteurs et exposants parlent ouvertement de chutes des budgets aux technologies de linformation, certains secteurs affichent cependant une sant de fer, les fabricantsdquipementsetdveloppeursdetlphoniedenouvellegnration,ouleshbergeurs,pourne citerqueux.Onassisteparticulirementdesinnovationsflorissantesdansledomainedessmartphonesavec un grand nombre de jeunes socits, spcialises dans les solutions professionnelles mobiles. Larrive des smartphones et des tablettes rvolutionne la mobilit en entreprise. Lutilisation judicieuse des interfaces venant de lindustrie des jeux vidos apporte un ct ludique aux applications, qui permet une meilleure appropriation par les utilisateurs. On parle de gamification, phnomne amener exploser commercialementtrscourtterme. LesconfrencessurleBigDataontamenlesvisiteursdcouvrirunsecteurnaissantquidevraitpesertrs lourddansledveloppementdesentreprises.Onassistedepuis10ansuneexplosiondupoidsdesdonnes. Le stockage de donnes est une problmatique couteuse pour les entreprises, mais ces donnes sont relativementpeuexploitesparlesentreprises.Lidedesbigdataestdecrerdelavaleurajoutepartirdes donnesdenaturetrsdiverses.Onraisonnedsormaisenflux,change,collaborationpluttquenstockage. On ne classe rien mais on retrouve tout. Le Big Data ( partir de 10 To de donnes) est en train de rvolutionner les infrastructures dans les technologies delinformation.Les environnements comme Hadoop permettentdavoirunegrandesouplessedanslesressourcesetdesadapterlamassedetravailenajoutant enparalllesdesserveurspeucouteux.LeBigDataadjgnrunchiffredaffairesde17milliardsdedollars en2011etonestimequecechiffredoubleradici2016.Legranddbataveclafinessedexploitationdesbig datavatreoplacerlecurseurentrelatransparencedesdonnesetlerespectdelavieprivedescitoyens.

Motscls:bigdata,stockage,donnes,valorisation,golocalisation,mobilit,smartphone,serveur,Hadoop

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |5

PART1.

INNOVATIONSONMOBILEIT

1.1 BACKGROUNDONGAMIFICATIONONMOBILE
1.1.1 Definitionofgamification

Gamificationistheuseofgamesorcompetitiontoencourageausertocompleteanactionorsetofactions. Usersrespondtoarangeofpromptsandareencouragedtoreturnregularlytotheapplication.Theprompts include:

Whatmakesgamificationsoattractiveisthefactthatwegenerallyenjoyactivelyparticipatingandengaging with others through entertainment. It is in our human nature to interact and be entertained with playful applications,particularlywhenthereareengaginggamedesignelementsemployed. Consumergamesanddigitalentertainmentcontinuestoattractattentiongiventheinterestthepublichaswith games.Compellinggamemechanicsanddesignareatthecoreofanengaginguserexperience.Gamification, thereforemustworktoenhancetheuserexperienceinordertobetterengage,retain,motivateandpromote overallparticipation. Gamification takes advantage of game mechanics to deliver engaging applications, and make nongame

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |6

applications more entertaining and appealing. By deploying these dynamics in a coordinated application, a company can use games to motivate behaviours and drive outcomes for both the customer and the organisation.

1.1.2

Gamificationmarketforecast

The adoption of applying game mechanics in more nontraditional industries has grown exponentially in the past 18 months. This is due in part to the growth of social and mobile games, as well as the increasing consumeradoptionofsocialmedia.

M2 Research estimates that the market spend on gamification solutions, applying game mechanics and behavioralanalyticsinnontraditionalapplicationswillreach$242millionbytheendof2012,whichismore thandoublefrom2011.Revenueestimatesarecomprisedofanumberofcomponentsthatincludes: 1. Platformvendorrevenue 2. Agencyandproductionrevenue 3. Internaldevelopment

1.1.3

Innovationsfromplatformproviders

2012isamilestoneyearforgamificationandasitgrowswillevolveintoaseriouscomponentofconsumerand employee engagement. It will be critical for both platform providers as well as deploying organizations to understand that implementing gamification is not a shortterm strategy. It is a longterm commitment that requires diligence in audience research, application design and activation/maintenance to ultimately benefit fromtheopportunitiesthatgamificationprinciplesoffer.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |7

Despite the anticipated growth rates, gamification will remain a market that will be carefully evaluated by potentialcustomersforplatformproviders.MobileITtookreallyadvantageofgamificationforapplication,and themaininnovationsdisplayedintheMobileITexhibitioninPariscomefromplatformproviders.

1.2 NOMALYSBYNOMALYS(MOBILEAPPLICATION)
Address: Contact: 46rueAugusteBlanqui CelineBLANC 94250Gentilly,France Courriel:contact@nomalys.com Website:http://www.nomalys.com/ Tel:0146652158 Fax:0179735589 NOMALYS offers the opportunity to nomad professionals using a Smartphone (iphone, iPad, Android, BlackBerryetWindowsPhone8)tofinallyaccessthetotalityoftheirstrategiccompanysdata.

Source:Nomalys,2012 Every company equipped with a structured IT system can connect it to the Nomalys application. The applications ergonomics, engine and algorithms have been designed to be generic, this means that every IT systemcanbebrowsedbyanymobiledevicewiththesameergonomicsandcolorfuluserinterface. However,NomalysisnotonlyawaytomakeyourCRMorERPmobile.Itisalsoachanceforeachcompanyto buildthroughthepowerandtheinnovativeergonomicsofNomalysanapplicationabletodisplaytheirlarge range of products and services. The access is immediate, intuitive, dynamic and secured. It is possible to be warnedinrealtimeofanyimportanteventhappeningonyourdatabase.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |8

Source:Nomalys,2012 Connection is made on existing CRM or ERP software. This allows to access data such as: clients, prospects, stocks,invoices,quotations,pays,humanresources,complaints

Source:Nomalys,2012 With the solution developed by NOMALYS, your software becomes mobile, dynamic, interactive and fully promoted. Nomalys received a Convergence 2012 awards in the Mobile IT exhibition. Nomalys has developed close partnershipswithCNRS,InstitutTelecomfordevelopinguniquealgorithms.

1.3 TEOPADBYTHALES
Contact: RaphalBINET ProductMarketingManager Email:Raphael.binet@thalesgroup.com Tel:+33146132952 Mobile:+33608179391 TEOPADisasecuringsolutionforprofessionalapplicationsonsmartphonesandtablets,developedbyThales anddedicatedtocompaniesandpublicservices. TEOPAD allows to create on the terminal a secure professional environment that can coexist with an open personal context. This professional environment is in the form of an application that can be started after a

Address: ThalesCommunications&Security 45,ruedeVilliers 92200NeuillysurSeineCedex. Website:http://www.thalesgroup.com

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |9

stronguserauthenticationandbymeansofasimpleiconontheterminal'snativedesktop.Theusercanthen accessaseconddesktop,whichconstituteshis/herprofessionalenvironment.Thelatteriscompletelyisolated fromthepersonalandnativepartbyapatentedsandboxingtechnology.

Source:Thales,2012 Thispartisentirelyencryptedandcontrolled,containsalltheapplications,dataandsettingsnecessaryforthe userwithintheframeworkofhis/herbusinessactivity: Applications of all types: web browser, email client, viewers, note pads, telephony client, business applications,etc. Documents,contactdatabase,personalorganizer,emailarchives,etc. TheinnovationsdevelopedbyThalesenableTEOPADtoproposesignificantdifferentiatorswithrespecttothe othermarketsolutions: Flexibility in choosing the terminal: for a given OS, the solution may be deployed on most of the marketterminalsusingthisOS. Flexibilityinchoosingtheapplications:foragivenOS,mostoftheapplicationsavailableonthemarket maybehostedandprotectedinthesecureenvironment.Thisappliestonativeapplications,aswellas tothirdapplicationsorapplicationsdevelopedbythecompanyforitsownneeds. Protection of the information in all its forms: information remains vulnerable when manipulated, transmittedorstored.Therefore,thereisnouseencryptingonlyemailsortelephony,asmostofthe current solutions offer to do so. TEOPAD allows to protect information in all its editing, viewing or exchangingcontexts. Flexibilityofthesecureperimeter:thanksto"TEOPADMarketPlace"thecompanycanmakeanytime newsecureapplicationsavailableforitsemployees.Forinstance,theycanbeadapteddependingon theemployees'missionsorbusinesstrips.Thisflexibilityenablestheemployeetotravelincomplete safetywithaterminal,thecontentofwhichisstrictlyadaptedtohis/herneeds.He/shecanleavewith a terminal with no professional context, the latter being downloaded securely once he/she has reachedhis/herdestination. Simplicity of deployment for the user: once he/she has received his/her authentication means, the user downloads the TEOPAD application and his/her customized professional context from the "TEOPADMarketPlace"availableontheIntranetofhis/hercompany. Userfriendly interface: TEOPAD preserves integrally the ergonomics of the native OS and the applicationsused.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |10

No additional specific infrastructure: TEOPAD is connected very simply to the existing information system.Thereisnousedeployingproprietaryserversorgateways,whichhighlylimitsthecosts. Offerofhighqualityprofessionalservicesdedicatedtotheusers Flexibleoperation:itmaybepartiallyorcompletelygiventoatrustworthythird.

Source:Thales,2012 TheTeopadsandboxingtechnologyisauniqueandpatentedtechnologythatallowstocreateterminalduality between two environments professional and personal working simultaneously, but independently,and withoutresortingtoproprietaryapplications. This technology does not rely on virtualization principles, which makes it particularly light, with all possible benefitsintermsofperformanceandautonomy.TheAndroidapplicationsareauthorizedtoperformspecific tasksorreachsystemcomponentsdependingontheprivilegestheyreceived. TheTEOPADSANDBOXsystemcontrolstheauthorizations,andthen,filterstheexchangesbetween: professionalandpersonalapplications; professionalapplicationsandoperatingsystem. ThismechanismallowstheInformationSystemDepartmenttolimittheinteractioncapabilitiesofprofessional applications with their environment. The ringfenced professional environment is then generated and is displayedintheformofaseparatedesktopontheterminal.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |11

This technology supplies efficient means to fight against intrusions, information leaks or trapping of professionalapplications. TheTEOPADSANDBOXadvantages: customizedcompartmentalizationofprofessionalapplicationsanddatawithrespecttotherestofthe terminal; professionaldesktopthatcanhostanytypeofapplicationsavailableonthemarketordevelopedby thecompany(nomandatoryThalesproprietaryapplication); simultaneousoperationofprofessionalandpersonalenvironmentswithuniquenotificationinterface fortheuser(Androidnativebar); applicationcontentexclusivelyfromthecompany'sTeopadMarketPlaceandentirelyundercontrolof thelatter; protectionofprofessionaldata,includingthosebeingvisualized,whentheyarenolongerencrypted; verypoorprintontheterminal,whichenablestomaintainperfectlytheperformanceofthelatter; userfriendlyinterfacemaintained. The TEOPAD SANDBOX compartmentalization service is proposed independently from the local encryption serviceontheterminal.Thesearetwocomplementaryservices.

Source:Thales,2012 TheTEOPADsolutioniscomposedofthefollowingelements: Fortheuser: o TheTEOPADapplicationtobeinstalledontheterminal. o TheTEOPADMarketPlaceclientapplication. Forthecompany: o TheTEOPADinfrastructureisparticularlylightasitdoesnotrequireanyproprietaryelement toconnecttheuserstotheinformationsystem. o It allows a centralized and industrialized deployment, and then operation of TEOPAD. The toolsenableinparticulartocreategenericorcustomizedprofilesandtobecomeadaptedto fleetswithhighdimensionsorspecializedperbusinessactivity.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |12

PART2.
2.1 BACKGROUNDONBIGDATA
2.1.1 Definingbigdata

BIGDATA

Bigdatatypicallyreferstothefollowingtypesofdata: Traditional enterprise data includes customer information from CRM systems, transactional ERP data,webstoretransactions,generalledgerdata. Machinegenerated /sensor data includes Call Detail Records (CDR), weblogs, smart meters, manufacturingsensors,equipmentlogs(oftenreferredtoasdigitalexhaust),tradingsystemsdata. Social data includes customer feedback streams, microblogging sites like Twitter, social media platformslikeFacebook

TheMcKinseyGlobalInstituteestimatesthatdatavolumeisgrowing40%peryear,andwillgrow44xbetween 2009and2020.Butwhileitsoftenthemostvisibleparameter,volumeofdataisnottheonlycharacteristic thatmatters. BigDataissizedinpeta,exa,andsoonperhaps,zettabytes!And,itsnotjustaboutvolume,theapproachto analysiscontendswithdatacontentandstructurethatcannotbeanticipatedorpredicted.Theseanalyticsand the science behind them filter low value or lowdensity data to reveal high value or highdensity data. As a result,newandoftenproprietaryanalyticaltechniquesarerequired.BigDatahasabroadarrayofinteresting architecturechallenges.

2.1.2

CharacteristicsofBigData:ThefourVs

Infact,therearefourkeycharacteristicsthatdefinebigdata:Volume,Velocity,VarietyandValue.Itisoften said that data volume, velocity, and variety define Big Data, but the unique characteristic of Big Data is the mannerinwhichthevalueisdiscovered.

a) Volume.
Machinegenerateddataisproducedinmuchlargerquantitiesthannontraditionaldata.Forinstance,asingle jet engine can generate 10TB of data in 30 minutes.With more than25,000 airlineflights perday, thedaily volumeofjustthissingledatasourcerunsintothePetabytes.Smartmetersandheavyindustrialequipment

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |13

likeoilrefineriesanddrillingrigsgeneratesimilardatavolumes,compoundingtheproblem.Peoplereallyspeak aboutbigdatawhenthevolumeisabove10To.

b) Velocity.
Social media data streams while not as massive as machinegenerated data produce a large influx of opinionsandrelationshipsvaluabletocustomerrelationshipmanagement.Evenat140characterspertweet, thehighvelocity(orfrequency)ofTwitterdataensureslargevolumes(over8TBperday).

c) Variety.
Traditional data formats tend to be relatively well described and change slowly. In contrast, nontraditional data formats exhibit a dizzying rate of change. As new services are added, new sensors deployed, or new marketingcampaignsexecuted,newdatatypesareneededtocapturetheresultantinformation.

d) Value
Theeconomicvalueofdifferentdatavariessignificantly.Typicallythereisgoodinformationhiddenamongsta larger body of nontraditional data; the challenge is identifying what is valuable and then transforming and extractingthatdataforanalysis. With Big Data, the value is discovered through a refining modeling process: make a hypothesis, create statistical, visual, or semantic models, validate, then make a new hypothesis. It either takes a person interpretingvisualizationsormakinginteractiveknowledgebasedqueries,orbydevelopingmachinelearning adaptivealgorithmsthatcandiscovermeaning.Andintheend,thealgorithmmaybeshortlived.

2.1.3

TheImportanceofBigData

Thegrowthofbigdataisaresultoftheincreasingchannelsandvarietyofdataintodaysworld.Someofthe new data sources are usergenerated content through social media, web and software logs, cameras, informationsensingmobiledevices,aerialsensorytechnologies,genomics,andmedicalrecords.

Source:Cisco,VNIServiceAdoptionForecast,20112016,May2012 Companieshaverealizedthatthereiscompetitiveadvantageinthisinformationandthatnowisthetimeto

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |14

putthisdatatowork.Tomakethemostofbigdata,enterprisesmustevolvetheirITinfrastructurestohandle therapidrateofdeliveryofextremevolumesofdata,withvaryingdatatypes,whichcanthenbeintegrated withanorganizationsotherenterprisedatatobeanalyzed.

Whenbigdataisdistilledandanalyzedincombinationwithtraditionalenterprisedata,enterprisescandevelop a more thorough and insightful understanding of their business, which can lead to enhanced productivity, a strongercompetitivepositionandgreaterinnovationallofwhichcanhaveasignificantimpactonthebottom line. For example, in the delivery of healthcare services, management of chronic or longterm conditions is expensive.Useofinhomemonitoringdevicestomeasurevitalsigns,andmonitorprogressisjustonewaythat sensordatacanbeusedtoimprovepatienthealthandreducebothofficevisitsandhospitaladmittance. Manufacturingcompaniesdeploysensorsintheirproductstoreturnastreamoftelemetry.Sometimesthisis used to deliver services like OnStar, that delivers communications, security and navigation services. Perhaps moreimportantly,thistelemetryalsorevealsusagepatterns,failureratesandotheropportunitiesforproduct improvementthatcanreducedevelopmentandassemblycosts. TheproliferationofsmartphonesandotherGPSdevicesoffersadvertisersanopportunitytotargetconsumers when they are in close proximity to a store, a coffee shop or a restaurant. This opens up new revenue for serviceprovidersandoffersmanybusinessesachancetotargetnewcustomers. Retailersusuallyknowwhobuystheirproducts.Useofsocialmediaandweblogfilesfromtheirecommerce sitescanhelpthemunderstandwhodidntbuyandwhytheychosenotto,informationnotavailabletothem today.Thiscanenablemuchmoreeffectivemicrocustomersegmentationandtargetedmarketingcampaigns, aswellasimprovesupplychainefficiencies. Finally, social media sites like Facebook and LinkedIn simply wouldnt exist without big data. Their business modelrequiresapersonalizedexperienceontheweb,whichcanonlybedeliveredbycapturingandusingall theavailabledataaboutauserormember.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |15

2.1.4

EstimationsofITspendingdrivenbyBigDataissues

Thehugevolumesofdatageneratedbytodaysdigitalbusinesses,knownasbigdata,willdrive$28billionof worldwide IT spending this year and $34bn next year, according to a forecast from Gartner, the IT research firm.

At the same time, Gartner predicted that by 2015, 4.4 million IT jobs will be created to support big data, including 1.9 million in the US, but warned that there will be a scramble for the limited number of IT professionalsqualifiedtofillthesejobs.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |16

$232Billionisprojectedtobesoldintotalacrossallcategoriesintheforecastfrom2011to2016.From$24.4 Billionin2011to$43.7Billionin2016,thispresentsa12.42%CAGRintotalmarketgrowth.

2.2 BIGDATAARCHITECTURECAPABILITIESANDTHEIRPRIMARYTECHNOLOGIES
2.2.1 Comparisonofinformationarchitectures

Big data differs from other data realms in many dimensions. In the following table you can compare and contrastthecharacteristicsofbigdataalongsidetheotherdatarealms.

Source:Oracle,2012 These different characteristics have influenced how you capture, store, process, retrieve, and secure your information architectures. As you evolve into Big Data, you can minimize your architecture risk by finding synergies across your investments allowing you to leverage your specialized organizations and their skills, equipment,standards,andgovernanceprocesses.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |17

Hereisanexamplefordataflowarchitecturediagramwhenbigdataisusedforcombinedanalytics.

Source:Oracle,2012

2.2.2

StorageandManagementCapability
a) HadoopDistributedFileSystem(HDFS)

HDFShastwomainlayers: Namespace o Consistsofdirectories,filesandblocks o It supports all the namespace related file system operations such as create, delete, modify andlistfilesanddirectories. BlockStorageServicehastwoparts

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |18

o BlockManagement(whichisdoneinNamenode) Providesdatanodeclustermembershipbyhandlingregistrations,andperiodicheart beats. Processesblockreportsandmaintainslocationofblocks. Supports block related operations such as create, delete, modify and get block location. Managesreplicaplacementandreplicationofablockforunderreplicatedblocksand deletesblocksthatareoverreplicated. Storage is provided by datanodes by storing blocks on the local file system and allows read/writeaccess.

In order to scale the name service horizontally, federation uses multiple independent Namenodes/namespaces.TheNamenodesarefederated,thatis,theNamenodesareindependentanddont require coordination with each other. The datanodes are used as common storage for blocks by all the Namenodes. Each datanode registers with all the Namenodes in the cluster. Datanodes send periodic heartbeatsandblockreportsandhandlescommandsfromtheNamenodes.HeretheKeyBenefits Namespace Scalability HDFS cluster storage scales horizontally but the namespace does not. Large deployments or deployments using lot of small files benefit from scaling the namespace by adding moreNamenodestothecluster Performance File system operation throughput is limited by a single Namenode in the prior architecture. Adding more Namenodes to the cluster scales the file system read/write operations throughput. Isolation A single Namenode offers no isolation in multi user environment. An experimental applicationcanoverloadtheNamenodeandslowdownproductioncriticalapplications.Withmultiple Namenodes,differentcategoriesofapplicationsanduserscanbeisolatedtodifferentnamespaces. Bywayofconclusion,herearethemaincharacteristicsofHDFSknownbydevelopers: AnApacheopensourcedistributedfilesystem,http://hadoop.apache.org Expectedtorunonhighperformancecommodityhardware Known for highly scalable storage and automatic data replication across three nodes for fault tolerance Automaticdatareplicationacrossthreenodeseliminatesneedforbackup Writeonce,readmanytimes

b) ClouderaManager:
Cloudera Manager is the marketleading management platform for CDH (Cloudera's Distribution, including Apache Hadoop). As the industrys first endtoend management application for Apache Hadoop, Cloudera Manager sets the standard for enterprise deployment by delivering granular visibility into and control over every part of CDH empowering operators to improve cluster performance, enhance quality of service, increasecomplianceandreduceadministrativecosts.

HerearethemaincharacteristicsofClourderaManager: Cloudera Manager is an endtoend management application for Clouderas Distribution of Apache Hadoop,http://www.cloudera.com Cloudera Manager gives a clusterwide, realtime view of nodes and services running; provides a single,centralplacetoenactconfigurationchangesacrossthecluster;andincorporatesafullrangeof reportinganddiagnostictoolstohelpoptimizeclusterperformanceandutilization.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |19

2.2.3

DatabaseCapability
a) OracleNoSQL

OracleNoSQLDatabasedeliversscalablethroughputwithboundedlatency,easyadministration,andasimple programming model. It scales horizontally to hundreds of nodes with high availability and transparent load balancing. "NoSQL" is a general term meaning that the database isn't an RDBMS which supports SQL as its primaryaccesslanguage,buttherearemanytypesofNoSQLdatabases:BerkeleyDBisanexampleofalocal NoSQLdatabase,whereasHBaseisverymuchadistributeddatabase.

Source:Oracle,2012 HerearethemaincharacteristicsofOracleNoSQL: Dynamicandflexibleschemadesign.Highperformancekeyvaluepairdatabase.Keyvaluepairisan alternativetoapredefinedschema.Usedfornonpredictiveanddynamicdata. Able to efficiently process data without a row and column structure. Major + Minor key paradigm allowsmultiplerecordreadsinasingleAPIcall Highlyscalablemultinode,multipledatacenter,faulttolerant,ACIDoperations Simpleprogrammingmodel,randomindexreadsandwrites Not Only SQL. Simple pattern queries and customdeveloped solutions to access data such as Java APIs.

b) ApacheHBase
Apache HBase is the Hadoop database, a distributed, scalable, big data store. You can use Apache HBase whenyouneedrandom,realtimeread/writeaccesstoyourBigData.Thisproject'sgoalisthehostingofvery largetablesbillionsofrowsXmillionsofcolumnsatopclustersofcommodityhardware.ApacheHBaseis anopensource,distributed,versioned,columnorientedstoremodeledafterGoogle'sBigtable:ADistributed Storage System for Structured Data by Chang et al. Just as Bigtable leverages the distributed data storage provided by the Google File System, Apache HBase provides Bigtablelike capabilities on top of Hadoop and HDFS. HerearethemaincharacteristicsofApacheHbase: Allowsrandom,realtimeread/writeaccess Strictlyconsistentreadsandwrites Automaticandconfigurableshardingoftables AutomaticfailoversupportbetweenRegionServers

c) ApacheCassandra
The Apache Cassandra database is the right choice when you need scalability and high availability without

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |20

compromising performance. Linear scalability and proven faulttolerance on commodity hardware or cloud infrastructuremakeittheperfectplatformformissioncriticaldata. HerearethemaincharacteristicsofApacheCassandra: Data model offers column indexes with the performance of logstructured updates, materialized views,andbuiltincaching Faulttolerancecapabilityisdesignedforeverynode,replicatingacrossmultipledatacenters Canchoosebetweensynchronousorasynchronousreplicationforeachupdate

d) ApacheHive
HiveisadatawarehousesystemforHadoopthatfacilitateseasydatasummarization,adhocqueries,andthe analysis of large datasets stored in Hadoop compatible file systems. Hive provides a mechanism to project structure onto this data and query the data using a SQLlike language called HiveQL. At the same time this languagealsoallowstraditionalmap/reduceprogrammerstoplugintheircustommappersandreducerswhen itisinconvenientorinefficienttoexpressthislogicinHiveQL. HiveisbasedonHadoop,whichisabatchprocessingsystem.Asaresult,Hivedoesnotandcannotpromise lowlatenciesonqueries.Theparadigmhereisstrictlyofsubmittingjobsandbeingnotifiedwhenthejobsare completedasopposedtorealtimequeries.IncontrasttothesystemssuchasOraclewhereanalysisisrunona significantlysmalleramountofdata,buttheanalysisproceedsmuchmoreiterativelywiththeresponsetimes betweeniterationsbeinglessthanafewminutes,Hivequeriesresponsetimesforeventhesmallestjobscan beoftheorderofseveralminutes.Howeverforlargerjobs(e.g.,jobsprocessingterabytesofdata)ingeneral theymayrunintohours. Insummary,lowlatencyperformanceisnotthetoppriorityofHive'sdesignprinciples.WhatHivevaluesmost are scalability (scale out with more machines added dynamically to the Hadoop cluster), extensibility (with MapReduceframeworkandUDF/UDAF/UDTF),faulttolerance,andloosecouplingwithitsinputformats. HerearethemaincharacteristicsofHive: Toolstoenableeasydataextract/transform/load(ETL)fromfilesstoredeitherdirectlyinApacheHDFS orinotherdatastoragesystemssuchasApacheHBase UsesasimpleSQLlikequerylanguagecalledHiveQL QueryexecutionviaMapReduce

2.2.4

ProcessingCapability
a) MapReduce

Source:Oracle,2012

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |21

MapReduce is a programming model and an associated implementation for processing and generating large data sets. Users specify a map function that processes a key/value pair to generate a set of intermediate key/value pairs, and a reduce function that merges all intermediate values associated with the same intermediatekey.Manyrealworldtasksareexpressibleinthismodel. HerearethemaincharacteristicsofMapReduce: DefinedbyGooglein2004 Breakproblemupintosmallersubproblems Abletodistributedataworkloadsacrossthousandsofnodes CanbeexposedviaSQLandinSQLbasedBItools

b) ApacheHadoop

ApacheHadoopis100%opensource,andpioneeredafundamentallynewwayofstoringandprocessingdata. Insteadofrelyingonexpensive,proprietaryhardwareanddifferentsystemstostoreandprocessdata,Hadoop enablesdistributedparallelprocessingofhugeamountsofdataacrossinexpensive,industrystandardservers that both store and process the data, and can scale without limits. With Hadoop, no data is too big. And in todayshyperconnectedworldwheremoreandmoredataisbeingcreatedeveryday,Hadoopsbreakthrough advantagesmeanthatbusinessesandorganizationscannowfindvalueindatathatwasrecentlyconsidered useless. HerearethemaincharacteristicsofApacheHadoop: LeadingMapReduceimplementation Highlyscalableparallelbatchprocessing Highlycustomizableinfrastructure Writesmultiplecopiesacrossclusterforfaulttolerance

2.2.5

DataIntegrationCapability
a) OracleBigDataConnectors,OracleLoaderforHadoop,OracleDataIntegrator

BuiltfromthegroundupbyOracle,OracleBigDataConnectorsdeliversahighperformanceHadooptoOracle Database integration solution and enables optimized analysis using Oracles distribution of open source R analysisdirectlyonHadoopdata.Byprovidingefficientconnectivity,BigDataConnectorsenablesanalysisofall dataintheenterprisebothstructuredandunstructured.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |22

HerearethemaincharacteristicsofBigdataconnectors: ExportsMapReduceresultstoRDBMS,Hadoop,andothertargets ConnectsHadooptorelationaldatabasesforSQLprocessing Includes a graphical user interface integration designer that generates Hive scripts to move and transformMapReduceresults Optimizedprocessingwithparalleldataimport/export CanbeinstalledonOracleBigDataApplianceoronagenericHadoopcluster

2.2.6

StatisticalAnalysisCapability
a) OpenSourceProjectRandOracleREnterprise:

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |23

Risafreesoftwareenvironmentforstatisticalcomputingandgraphics.Itcompilesandrunsonawidevariety of UNIX platforms, Windows and MacOS. R provides a wide variety of statistical (linear and nonlinear modelling,classicalstatisticaltests,timeseriesanalysis,classification,clustering,...)andgraphicaltechniques, andishighlyextensible.TheSlanguageisoftenthevehicleofchoiceforresearchinstatisticalmethodology, andRprovidesanOpenSourceroutetoparticipationinthatactivity. OneofR'sstrengthsistheeasewithwhichwelldesignedpublicationqualityplotscanbeproduced,including mathematicalsymbolsandformulaewhereneeded.Greatcarehasbeentakenoverthedefaultsfortheminor designchoicesingraphics,buttheuserretainsfullcontrol.RisavailableasFreeSoftwareunderthetermsof the Free Software Foundation's GNU General Public License in source code form. It compiles and runs on a widevarietyofUNIXplatformsandsimilarsystems(includingFreeBSDandLinux),WindowsandMacOS. HerearethemaincharacteristicsofprojectR: Programminglanguageforstatisticalanalysis Introduced into Oracle Database as a SQL extension to perform high performance indatabase statisticalanalysis OracleREnterpriseallowsreuseofpreexistingRscriptswithnomodification

2.3 TRENDSONBIGDATA

IntheBigDataexhibitioninParis,innovationswerenotreallydisplayedastheBigDataworldiscontinuously evolvingtowardssomething,noonereallyknows.So,expertsweremostlyexchangingwordsonwhattheyare doing and most importantly on how they feel about the future on big data. They were all agreeing on one thing:BigDataissomethingthatisgoingtofuelthe21stcenturyanditisalmostimpossibletoforecasthowbig aneconomicalimpactwillcomefromtheuseofBigData. Indeed,anewkindofjobiscoming:Datascientist!But,alltheexpertspointedoutthattherewillbeashortage of talent for these jobs. The advance of big data shows no signs of slowing. Data scientists are

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |24

difficult and expensive to hire, and given the very competitive market for their services, difficult to retain. There simply are not a lot of people with their combination of scientific background and computational and analyticalskills. Amongtheconferences,itwaspossibletodefinesometrendsintheBigDataworld.

2.3.1

TheInternetofThingsalreadyhere

ItisnotsolongagothattheInternetofThings(avastcollectionofsmalldevicesseamlesslyconnectedtothe Net)wasstilljustaconceptinresearchpapers.Andbeforeyouknowit,itshere,andlikeMonsieurJourdain, peopledontquitefullyunderstandit.EvenifyouthinkcallingyoursmartphoneaThingisdebatable,and yetitisaThingthatsendslotsandlotsofinformationtomanyserversworldwide,youwouldbeamazedto knowthenumberofanonymousdevicesthatarealreadyfullyconnected. Forexample,LaPostehasworkedwithExaleadonconnectingtheoptoelectronicmachinesthatitusestofilter and sort our mail to the Net. It then uses all the information gathered to build a fullfledged business intelligencetool,usedtooperationallymonitorthesystem.Anotherexample:didyouknowthathighendcar manufacturers have turned their vehicles into Things that keep sending monitoring information to central serverstoassurebetterserviceandmaintenance?OnehastounderstandthateverysuchThingcreateshuge logsof,literally,hundredsofbillionsofrecords:thatsmorethanpagesontheentireWeb!

2.3.2

Gettingtotherightbusinessmodel(s)fordata

Data,isthenewfrontierthesedays.BigData,OpenData,DaaS(DataasaService),asonecannameit.Datais likeSoftware,itisveryscalable:oneinvestsheavilytocreatedatasets,andthensellsthembythemillions, withzeroorverysmallmarginalcosts.Atleastthatishowthetheorygoes. Butinfairness,itshardtosaythatanybodyhascrackedtherightbusinessmodelfordata.Forinstance,one interesting question remains: to be scalable, a data set needs to be reusable by many applications and developers.Butthen,thevalueofsuchadatadatasetisprobablyverylow,unlessitsabsolutelyneededto build everybodys application and you have exclusivity, which is likely to be a very rare case, especially with OpenData. Attheotherendofthespectrum,usingtheBigDataartillerytobuildaveryspecificdatasetcanyieldavery exclusiveproductthatcanonlybeusedbyoneormaybeahandfulofnoncompetingcompanies.Suchadata setcanbeveryexpensive(tobuildandtobuy),andcanalsocreatealotofvalueforthecompanythatusesit. Butitsanentirelydifferentbusinessmodelthatisverydifferentfromtheintrinsicallyscalablebusinessmodel ofthesoftwareindustry(especially,SaaS).Atleastuntilsomeonecracksit.

2.3.3

AddingaSociallayertotraditionalactivities

Well,thatisalsoaveryinterestingtrend:usingsocialnetworkslikeTwittertoproducerealtimevoiceofthe customerapplications.Indeed,Facebookknowswhatyouaredoing,Twitterknowswhatyouaresaying,and Googleknowswhatyouarethinking. Forinstance,MesagraphisworkingwithbroadcasterstobuildiPadapplicationsconnectedtoTVprogramsso thatyoucancommentandinteractwithotherviewersinrealtime,whileyourewatchingashow.Thatistruly revolutionary:finally,awaytoconnectbacktothebroadcasters.Consumerscanfindtheirinterestshere,quite obviously,butatthesametime,thinkoftheimplicationsintermsofadvertising.Realtimeadvertising,even. Finegrainedaudiencesegmentation.Thisisanentirelynewfieldwithallsortsofpromisesandchallenges. Another very interesting application that was presented at WWW2012 is the use of tweets to monitor the Netflixmediastreamingservice,bydetectingtweetscontainingphraseslikeisout(comeon,guys,youcan dobetterthanthat:).Evenwithverysimpleheuristics,about90%ofoutageswerecorrectlydetected.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |25

2.3.4

TheNewFrontierofBusinessIntelligence&Semanticsatpetabytescale

The Internet of Things is making petabyte scales a reality today (a petabyte is 1,000 terabytes, or 1,000,000 gigabytes). A copy of the entire Web amounts to several petabytes. So Big Data technologies are needed to handlesuchavastamountofdata,andonehastoperformsomeformofBusinessIntelligencetomakesense ofit. Therearetwomajorbreakthroughstohandlethischallenge. Ononeside,RAMbaseddatabases,wheredataisorganizedincolumns,asopposedtorows,allowforvery fastprocessingoflargequantitiesofdata(aslongasthisdatafitsinRAM,thatis).Slicinganddicingcouldntbe anyfasteroreasier. Ontheotherhand,searchengines,whicharecolumnarbyessence,areevolvingtohandlemanymorekind ofdata(semantic,numeric,etc.),arebecomingmoreandmoretransactional(ACID,inbarbarianterms)and canprocessevenlargerdatasetssincetheydonotrequirethatentiredatasetsfitinRAM. You get to choose your favorite. But one thing is clear: semantic treatment of textual data will be a major requirement for nextgeneration Business Intelligence platforms. That is the next frontier for Big Data. And searchenginesareuniquelypositionedtowinthisrace.

2.4 KEYCOMPANIESINTHEBIGDATAEXIBITIONINPARIS
2.4.1 DataPublica
Address: DataPublica8rueJouffroydAbbans 75017Paris,France Website:http://www.datapublica.com/ Contact: M.FranoisBANCILHON Mail:francois.bancilhon@datapublica.com

Created in July 2011, Data Publica is one of the leading historical open data in France. The company has benefitedfromtechnologicalinvestmentsmadein2010aspartofaR&DprojectThecompanywasinitially fundedbyagroupof"angels"andtheseedfundITTranslation. DataPublicaisacompanyworkingonassemblingdatasetsbuiltfrombothpublicdataandopendata,andthen sellingthesedatasetstocompaniestohelpthembuildinnovativeapplications.DataPublicadescribesitselfas a Data Vendor similar, in the domain of Open Data, to what Software Vendors are to the domain of Software.

2.4.2

Altic

Address: 95AvenueVictorHugo,93360NEUILLYPLAISANCE Tel:0953646369 Website:http://www.altic.org/ Contact:MarcSALLIERES(CEO),contact@altic.org ALTICisanALTernativeofInformationandCommunication. ItisanOpenSourceSoftwareintegratorcreatedinJuneof2004,andafoundingmemberoftheASS2L.ALTIC assistscompaniesandadministrationtoimplementthemanagementsoftwareinOpenSource.Itworksonthe following domains and open source solutions: Business Solutions (SpagoBI, Talend, JasperReports, BIRT, LemonOLAP), Management Solutions (Compiere, Vtiger, SQL/Ledger), Communication Solutions (Joomla!, Tutos,LemonLDAP).AlticsupportsalsotheLemonLDAPproject,theOpenSourceWebSSO.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |26

2.4.3

Talend

Contact: Address: M.CdricCARBONE TalendSA,9ruePags, Tel:+33146250600 92150Suresnes sales.fr@talend.com FranceWebsite:http://fr.talend.com/ Talend is one of the largest pure play vendors of open source software, offering a breadth of middleware solutionsthataddressbothdatamanagementandapplicationintegrationneeds. Sincetheemergenceofdataintegrationanddataqualitytoolsinthe1990s,andthemorerecentappearance of Master Data Management solutions, the data management market has been dominated by a small and quickly consolidating number of traditional vendors offering proprietary, closed solutions, which only the largest and wealthiest organizations can afford. The situation in the application integration space is quite similar, with significant consolidation occurring as well. As a result, only a minority of organizations use commercial solutions to meet their data management and application integration needs. Indeed, these solutions not only demand a steep initial investment, but they also often require significant resources to manageimplementationandongoingoperation. Furthermore,companiesarefacedwithexponentialgrowthinthevolumeandheterogeneityofthedataand applicationstheyneedtomanageandcontrol.AkeychallengethatITdepartmentsfacetodayisensuringthe consistency of their data and processes by using modeling tools, workflow management and storage, the foundationsofdatagovernanceinanycompanytoday.Thischallengeisactuallyfacedbyorganizationsofall sizesnotonlythelargestcorporations. Injustafewyears,Talendhasbecometherecognizedmarketleaderinopensourcedatamanagement.The acquisitionin2010ofSopera,aleaderinopensourceapplicationintegration,hasreinforcedTalendsmarket coverage,creatingagloballeaderinopensourcemiddleware.Manylargeorganizationsaroundtheglobeuse Talend's products and services to optimize the costs of data integration, data quality, Master Data Management (MDM) and application integration. With an ever growing number of product downloads and payingcustomers,Talendoffersthemostwidelyusedanddeployeddatamanagementsolutionsintheworld.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |27

CONCLUSION
According to the organizers, the exhibition Mobile IT and Big Data have not attracted many visitors. Big companieslikeOrange,SFR,Bouygues,FreefortelecomsorlikeIntel,Dell,IBMforBigDatawereabsent.But theconferencesontheevolutionofthesesectorshavebeenverysuccessful.Inagloomyatmospherewhere visitorsandexhibitorstalkopenlyabouttinybudgetsforinformationtechnology,somesectors,however,were quite healthy and innovative. This was the case for equipment manufacturers and developers of next generationtelephony,orwebprovider.Thereweresomeimpressiveinnovationsinthefieldofsmartphones coming from a large number of young companies, specializing in mobile business solutions. The advent of smartphones and tablets is revolutionizing enterprise mobility. Judicious use of interfaces from the video games industry brings playful applications, which allows more friendly use by customers. We talk about "gamification"phenomenon,whichisabouttocommerciallyexplodeintheshortterm.

ConferencesonBigDatagrewquiteacrowdandallowedvisitorstodiscoveranemergingsectorthatshould weighheavilyinthedevelopmentofenterprises.Inonly10years,theamountofdataincreasedexponentially. Datastorageisacostlyproblemforbusinesses,butthesedataarerelativelyuntappedbycompanies.Theidea of big data is to create added value from very diverse data. People now talk about flows, exchanges, collaborationsratherthanstorage.Nothingissortedbuteverythingcanbefound.BigData(from10TBofdata) isrevolutionizingtheinfrastructureininformationtechnology.EnvironmentssuchasHadoopprovideflexibility in resources and adapt to the workload by adding inexpensive servers in parallel. Big Data has generated a turnoverof$17billionin2011anditisestimatedthatthisfigurewilldoubleby2016.Thegreatdebatewith bigdataistofindabalancebetweendatatransparencyandprivacyofcitizens. Bigdataisrapidlyemergingasamarketforce,notjustasinglemarketuntoitself.BigDataITServicesSpending will attain a 10.20% CAGR from 2011 to 2016. By 2020, big data functionality will be part of the baseline of enterprisesoftware,withenterprisevendorsenhancingthevalueoftheirapplicationswithit.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |28

ABOUTVEILLESALON
Officiallylaunchedinearly2010byVIEDOCConsulting,abusiness&competitive&technologicalintelligence company, VeilleSalon.com is the first professional service for watching and reporting on trade show innovationsforcompaniesandisbasedononeofthelargestglobaldirectoryoftradeshows,symposiumsand otherinternationalevents. This new professional service is designed both for visitors / companies, for exhibitors and trade show organizers. Through a bilingual directory, VEILLE SALON has already referenced more than 7,500 exhibitions and internationaleventssortedandsearchableaccordingtobusinessareas: for industrial sector : Aerospace, Agriculture, Agribusiness, Automotive, Materials, Construction, Consumer goods, Cosmetics, Electronics, Defense, Energy, Optics, Pharmaceuticals, Telecommunications... fortertiarysector:Banking/Insurance,Hospitality,RealEstate,Media/advertising,HumanServices, Tourism... for business area : Chemistry, Design / Architecture, Distribution, Packaging, Education / Training, Health&Environment,Computing,Innovation,Maintenance,Mechanical,Quality,HumanResources. Besidesthepowerfulfeaturesofmulticriteriasearches(dates,places,keywords,sectors,organizers,exhibitors ...), VeilleSalon.com also offers visitors a customized and interactive calendar of forthcoming exhibitions, a monthlynewsletter,aforumandmanyotherservices. For potential exhibitors and events organizers, VeilleSalon.com is a real communication tool: registration of newevents,presentationofyourcompanyandoflatestnews(product&processinnovations,newservices), freeorchargedconferenceproceedings,realtimeinformationforthevisitor...VeilleSalon.comisalsoaforum where visitors can meet directly with you to prepare at best their visit and where they can get information aboutyourcompany. Whyofferaprofessionalservicededicatedtotradeshowinnovationwatching? Watchingtradeshowinnovationsisanidealwaytoidentifyandanalyzecompetitors,suppliers,newproducts, equipment, and services, to detect technology transfers and innovations, to achieve business development withpotentialnewcustomersandtoenhancemarketandtrendsknowledge. Therefore the team VEILLESALON, through experienced consultants and seasoned business intelligence engineersfromVIEDOCConsulting,offersarangeofservicesin:reportingontradeshowinnovations,inFrance andabroad,supportingindividualsonsiteevents,conductingondemandinvestigationsandinterviews,staff training... Sowhetheryouareacompanywishingtomaximizeyourtradeshowinnovationwatch,afutureexhibitororan eventorganizer,wehavedevelopedtailoredsolutionstomeetyourexpectations. Toaccessourwebsite:http://www.veillesalon.com.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |29

PRESENTATIONOFVIEDOCSARL
VIEDOC CONSULTINGs core business is information. VIEDOC is your companys partner from strategy to operation. VIEDOC aims to assist its customers in the first stages of their activities (Business intelligence, knowledge management, competitive analysis, technological watch, market research, patent monitoring, benchmarking, technologytransfers,stateoftheart...)throughinformationcollectandanalysisrelevanttoyourbusiness. BusinessIntelligencedoesnotrequiremandatorylifelongskillswithinthecompanybutimposetogettheright informationattherighttime.VIEDOChasworkedforcustomersbothonextendedandshortperiodsoftimeto assistcompaniesindecisionmaking. VIEDOC advises companies from all industries (automotive, aerospace and defense, food, cosmetics, health, materials,optics,packaging,telecommunications...). VIEDOCcanassistcompaniesthatareambitiousandawareoftheimportanceofinvestingatthislevel: Fromthesmallinnovativecompanylookingforwardtohavingstrategicadviceintightmilestones,up tomajorindustrialgroupsanxioustokeeptheirleadershipposition. Methodology: Wehaveapragmaticapproachbuiltonarigorousmethodologyshowingtheissuesofcollecting,processing, analyzinganddispatchingofinformationwithhighaddedvalueinformation. Through its multisector experience, VIEDOC provides its clients with services tailored to their needs by listeningtotheirconcernsandbeingavailabletomeettheirrequirementsandmethods. Tosuccessfullyhelpitscustomersatdifferentstagesofthelifeoftheircompany(fromcreationtorecovery),of theirproducts(fromdesigntosale)oroftheirprojects(fromthefirststudytotheendoftheproject),VIEDOC operates both on process and on product innovation. VIEDOC deals both with technical and economical information. Youcanbenefitfromourexperience,ofspecialistsincollectingandanalyzingvalueaddedinformation,from ourmethodologiesandanalyticalcapacitytoprovidequalifiedinformationandhighqualityvalidation. As experts in technology transfer identification, we have consistently grown our multisectoral vision by providing ourprofessionalism and expertise to many clients, large industrial groupsand SMEs, in a dozen of distinctsectors. This experience allows us today to make available to our customers, a meaningful analysis which does not neglectanytechnical,economical,legalandhumanimplicationsandfullycomplieswithethicalrulesthatguide allactivitiesofourcompany.

VIEDOCForanyfurtherinformation:contact@veillesalon.com

P a g e |30

www.veillesalon.com
Unservicemadeby:

VIEDOCSARL 2RueHlneBoucher 78280Guyancourt(France) Tel:+33(0)130434527 Email:info@viedoc.biz Website:www.viedoc.fr

VIEDOCForanyfurtherinformation:contact@veillesalon.com