Vous êtes sur la page 1sur 2

CHAPITRE 2.

5 : LES ISOENZYMES Introduction


Dans les annes 50-60, grce au dveloppement de nouvelles mthodes de sparation des prparations enzymatiques, plusieurs chercheurs ont mis en vidence des formes multiples denzymes. partir dune solution partiellement purifie de LDH (lactate dshydrognase), Kaplan a dtermin par lectrophorse que la solution contenait 5 formes qui avaient la mme activit enzymatique. Est alors apparu le concept disoenzyme. Les isoenzymes sont des formes multiples denzymes provenant dune modification gntique de la structure primaire de la protine et catalysant une mme raction pour un organisme donn. Les isoformes prsentent habituellement des paramtres cintiques diffrents ou des proprits de rgulation diffrentes.

1.2. Protines possdant une structure primaire similaire mais non identique Les isoenzymes sont des formes multiples denzymes provenant dune modification gntique de la structure primaire de la protine et non dune modification ultrieure dune mme squence.
LDH-M LDH-H ATLKDQLIHNLLKEE.HVPHNKITVVGUGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSL ATLKEKLIAPVAQQETTIPNNKITVVGUGQVGMACAISILG KSLTDELALVDVLE DKLKGEMMDLQHGSL

FLRTPKITSGKDYNVTAHSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFP FLQTPKITANKDYSVTAHSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPNCIIIVVSNPVDILTYVTWKLSGLP KNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKE KHRVIGSGCNLDSARFRYLMAEKLGVHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQQLNPEMGTDNDSENWKEVHKM VVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDV VKVTLTPEEEAH VVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVQGMYGIENEVFLSLPCVLNARGLTSVINQKLKDDEVAQ LKKSADTLWGIQKELQF LKNSADTLWGIQKDLKDL (331 acides amins) (333 acides amins)

1. Structure des isoenzymes


1.1. Protines possdant une structure tertiaire voire quaternaire
1.1.1. Mise en vidence des isoenzymes

Figure 2 : squence en acides amins des chanes M et H de la LDH de porc La structure primaire des isoenzymes varie. Comment cela se traduit-il au niveau des gnes qui codent cette structure primaire ? 1.3. Protines codes par des gnes
1.3.1. Gnes diffrents lis ou non

Si on analyse une solution possdant une activit lactate dshydrognase grce une lectrophorse en gel de polyacrylamide dans des conditions non dnaturantes, on peut observer jusqu cinq bandes. A gauche, lextrait enzymatique provient dun muscle : on obtient une bande qui migre lgrement vers la cathode. A droite, lextrait provient du cur : on obtient une seule bande forte mobilit lectrophortique. Dans le puits central, on travaille sur un extrait srique : on obtient cinq bandes. Le milieu tant non dnaturant, cela signifie que la LDH est une enzyme ttramrique car on obtient 5 bandes. On obtient une seule bande dans les deux extraits de muscle et de cur, on a donc deux types de sous-units appeles H et M de poids molculaires 35 000 g.mol-1. On en dduit la structure quaternaire des isoenzymes de la LDH. Figure 1 : lectrophorse de solutions de LDH extraite de diffrents tissus bovins ( gauche : muscle, au centre : srum, droite ; cur) et mise en vidence des 5 formes isoenzymatiques. La plupart des isoenzymes comme la LDH possdent une structure quaternaire mais il existe des isoenzymes monomriques (ex : hexokinase, adnylate kinase).
1.1.2. Famille denzymes prsentant des formes multiples

Les isoenzymes sont codes par des gnes du noyau. Les gnes qui codent ces protines ou les sous-units de celles-ci peuvent tre sur le mme chromosome ou sur des chromosomes diffrents.
1.3.2. Allles diffrents : allozymes

Les allozymes sont les produits dun mme gne qui possdent des allles diffrents. Les deux allles dun gne codant une isoenzyme sont codominants chez un individu htrozygote.

2. Proprits des isoenzymes


2.1. Proprits diffrentes
2.1.1. selon lespce

Quel que soit le tissu considr, lisoenzyme a une mobilit lectrophortique propre chaque espce. La LDH est une isoenzyme universelle. Son profil lectrophortique varie selon lespce.
2.1.2. selon le tissu ou le compartiment cellulaire

Les proprits des isoenzymes varient selon leur localisation tissulaire ou mme cellulaire. Cela aura une retombe sur leur fonction.
2.1.3. selon le stade de lontogense

On a trouv une trentaine denzymes qui possdent des formes isoenzymatiques : des hydrolases : estrases, ribonuclase, pepsine, trypsine, lysozyme des transfrases : hexokinase, adnylate kinase, phosphatase alcaline et acide des dshydrognases : celles du lactate, du malate, de lisocitrate Les isoenzymes dune mme famille se ressemblent par leurs structures tertiaire et quaternaire mais elles diffrent par leur structure primaire.

La synthse des isoenzymes dune mme espce varie au cours du dveloppement embryonnaire. On peut observer une apparition et une augmentation de leur activit ou au contraire une disparition de cette activit. Exemple de la variation de la distribution des isoformes de la LDH 25 entre ladulte et le ftus humain dans le foie. Application mdicale : certaines enzymes du catabolisme du 20 M4 glucose dans les cellules malignes (cancreuses) sont des 15 M2H2 10 isoenzymes ftales et non adultes. Si on arrivait comprendre H4 5 comment seffectue le changement dactivit au cours de lontogense, on pourrait peut-tre modifier les isoenzymes des 0 cellules cancreuses en isoenzymes saines. adulte ftus

C. LARCHER

2.5- Isoenzymes Page 1 / 4

C. LARCHER

2.5- Isoenzymes Page 2 / 4

2.2. Proprits physico-chimiques


2.2.1. Mobilits lectrophortiques diffrentes

La structure primaire des isoenzymes diffre de quelques acides amins. La modification dun rsidu et donc ventuellement de la charge ionique peut modifier la charge ionique de la molcule et donc sa mobilit lectrophortique.
2.2.2. Stabilit

Les isoenzymes dune mme famille ont une stabilit diffrente. Ainsi, grce des mthodes de dnaturation telle que linactivation par la chaleur ou par lure, on va pouvoir dtecter les diffrences structurales dun mlange isoenzymatique. 2.3. Proprits catalytiques
2.3.1. Constantes cintiques diffrentes

#!!!! H4 Au niveau cardiaque, le lactate est oxyd en pyruvate qui est alors dgrad en conditions arobies grce au cycle de Krebs et la chane respiratoire (rcupration maximale dnergie). Au contraire, au niveau musculaire, le pyruvate est rduit en lactate ; cela permet la rgnration des coenzymes pour permettre la ralisation de la glycolyse en conditions anarobies. b. entre les compartiments sub-cellulaires Lisocitrate dshydrognase (IDH) existe sous deux formes isoenzymatiques : - la forme mitochondriale fonctionne principalement avec le coenzyme NAD+ - la forme cytoplasmique fonctionne avec le coenzyme NADP+ + NAD+ isocitrate + H2O + NADP+ Matrice mitochondriale !!!!" Cytoplasme NADH,H+ NADPH,H+ + $-ctoglutarate + CO2

Les isoenzymes sont des protines enzymatiques qui catalysent la mme raction mais leurs paramtres cintiques vis--vis dun mme substrat sont souvent diffrents. Do la possibilit de rgulation fine selon les besoins de la cellule ou du tissu. Exemple : - hexokinase avec un KM de 0,1 mM - glucokinase avec un KM de 10 mM vis--vis du glucose
2.3.2. Rgulations diffrentes de leur activit enzymatique

LIDH mitochondriale intervient dans le cycle de Krebs et cre du pouvoir rducteur sous forme de NADH,H+ qui sera rgnr au niveau de la chane respiratoire. LIDH cytoplasmique produit du NADPH,H+ qui va permettre la ralisation des ractions anaboliques rductrices (lipogense = synthse des acides gras).
3.2.2. Rle dans la rgulation des voies mtaboliques

Du fait de leurs proprits catalytiques, lactivit enzymatique des isoenzymes dune mme famille est rgule diffremment. Des isoenzymes dune mme famille ne sont pas rgules et sensibles aux mmes effecteurs. 2.4. Proprits immunochimiques Si on injecte un mlange disoenzymes chez une souris, on obtient un anti-srum spcifique de toutes les formes enzymatiques (mlange polyclonal). Les sous-units peuvent porter des dterminants antigniques distincts. On peut observer des ractions croises du fait disoformes ayant les mmes sousunits (ex : H3M, H2M2 et HM3).

3. Rpartition dans lorganismes et fonctions biologiques des isoenzymes


3.1. Rpartitions tissulaire et cellulaire Les enzymes ont gnralement une grande spcificit de fonction. Chaque tissu est quip denzymes en relation avec sa fonction. Mais cette organospcificit nest pas absolue. En effet, la LDH se trouve en quantit comparable dans diffrents tissus (cur, foie, muscle squelettique). Ce manque de spcificit absolue est compens par la prsence des isoenzymes. Dans le cur, on trouve plutt la LDH1(H4) et la cratine kinase CK-MB (B pour brain : cerveau), alors que dans les muscles squelettiques, on trouve la LDH5(M4) et la CK-MM. La distribution des enzymes varie suivant les tissus, mais aussi lchelle infrieure au niveau cellulaire. La quantit disoenzymes contenues dans le srum est faible. 3.2. Fonctions biologiques principales
3.2.1. La compartimentation des voies mtaboliques

a. Rgulation de la glycmie De nombreuses enzymes de la glycolyse possdent des formes isoenzymatiques : lhexokinase, la fructose-2-bisphosphatase, laldolase, la pyruvate-kinase,... b. Rgulation du niveau nergtique La rgulation de lactivit de lIDH permet de rguler le rapport NADPH,H+/NADP+ qui doit tre trs suprieur 1. La rgulation de lactivit de la MDH au niveau de la navette mitochondriale permet de rguler le rapport NAD+/NADH,H+ qui doit aussi tre trs suprieur 1.

Conclusion
Les isoenzymes ayant une rpartition dans lorganisme bien dfinie, elles sont de bons marqueurs tissulaires. Exemple 1 : lors de la ncrose tissulaire, il y a libration des isoenzymes intracellulaires. Cela a un intrt pour le diagnostic de linfarctus du myocarde. Le praticien peut demander un dosage de la LDH et de la CK. Lvolution des activits enzymatiques est trs caractristique et permet de dater la survenue de lischmie cardiaque : - llvation de la CK totale et de son isoenzyme CK-MB est prcoce et peu durable, - llvation de la LDH1(H4) et de la LDH2(H3M) est tardive et plus durable. Exemple 2 : la %- glutamyltransfrase (%-GT) est un marqueur trs sensible du dysfonctionnement hpatique. Cela permet la dtection dhpatites, le dpistage de lthylisme chronique et la surveillance de lvolution de la maladie (ex : suivi du sevrage alcoolique avec diminution de lactivit enzymatique srique de la %-glutamyltransfrase). Exemple 3 : une autre application importante est le suivi des priodes de rmission et de reprise tumorale lors de traitement de cancers. Les enzymes principalement utilises sont : la phosphatase alcaline (PAL) pour apprcier le traitement de tumeurs osseuses, la LDH dans le traitement de cancers testiculaires,

a. entre les tissus Les interconversions du pyruvate et du lactate sont facilites grce aux diffrentes proprits catalytiques des isoenzymes de la LDH dans les diffrents tissus.

pyruvate + NADH,H+
C. LARCHER

M4 !!!!"

lactate + NAD+
2.5- Isoenzymes Page 3 / 4
C. LARCHER

2.5- Isoenzymes Page 4 / 4