Vous êtes sur la page 1sur 549

Catlogos de productos

Controles industriales Sistemas de automatizacin Sensores The Motion Book Variadores de velocidad ajustable de CA y CC Motores de velocidad ajustable de CA y CC con control coordinado

Productos de seguridad
Rockwell Software Visite nuestro sitio web en: http://www.ab.com/safety o bien www.ejaltd.co.uk

Productos de seguridad
Dispositivos de seguridad para deteccin de presencia Interruptores con enclavamiento Rels de seguridad Interruptores de enclavamiento con atrapamiento de llave Dispositivos de paro de emergencia Interruptores de posicin (final de carrera) PLC de seguridad Contactores y rels de control Interruptores de carga IEC Dispositivos de control de dos manos Sistemas de aislamiento de seguridad Soluciones para seguridad aplicada Sistemas de conexin Interruptores para lugares peligrosos Terminal MobileView Guard

Productos de seguridad

Publicacin S115-CA001A-ES-P Mayo del 2003


Sustituye a las publicaciones S114-CA001A-ES-P Noviembre del 2000 y S114-CA002A-ES-P Marzo del 2002 Copyright 2003 Rockwell Automation. Todos los derechos reservados. Impreso en EE.UU.

Nuevo en este Catlogo

Atlas 5 Interruptores con enclavamiento Pgina 3-32 440G-MT Interruptores con enclavamiento Pgina 3-36

Ensign 3 Interruptores con enclavamiento Pgina 3-74

Minotaur MSR132E Rels de Minotaur MSR30RT/RTP seguridad Rels de seguridad Pgina 4-60 Pgina 4-26

Caja de distribucin y T-Port con cableado de seguridad Sistemas de conexin 15-4, 15-5, 15-8 Senator pequeo, de plstico Interruptores (de final de carrera) de posicin Pgina 7-2

Slamlock Electrical Dispositivos de enclavamiento con atrapamiento de llave Prosafe SafeZone Pgina 5-26 Dispositivos de seguridad para deteccin de presencia Pgina 2-68

Minotaur MSR238 Rels de seguridad Pgina 4-82

Senator grande, metlico Interruptores (de final de carrera) de posicin Pgina 7-8

ElectroGuard Sistema de aislamiento de seguridad Pgina 12-2 GuardShield Dispositivos de seguridad para deteccin de presencia Pgina 2-8

Lifeline 4 Dispositivos de paro de emergencia Pgina 6-8

SafeEdge Dispositivos de seguridad para deteccin de presencia Pgina 2-94

STFPro Soluciones de seguridad aplicada Pgina 13-7

ms AdeProductos incluidos en el Suplemento del Catlogo de productos de seguridad (S114-CA002A-ES-P) e interruptores


de carga IEC tambin incluidos en el Catlogo de productos de control industrial (A113 Marzo de 2000).

Servicios de seguridad de mquina Soluciones de seguridad aplicada Pgina 13-2

Compact PressMaster Soluciones de seguridad aplicada Pgina 13-8

StamPro Soluciones de seguridad aplicada Pgina 13-5

FeederPro Soluciones de seguridad aplicada Pgina 13-6

Generalidades

Generalidades
Pautas de seguridad y conversiones mtricas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-3 Trminos y condiciones de venta . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-4 Mantenimiento de equipos de control industrial . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-7 Envolventes IEC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-9 Envolventes NEMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-11

Principios de seguridad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Dispositivos de seguridad para deteccin de presencia . . . . . . . . . . . . . . . . . 2 Interruptores con enclavamiento . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Rels de seguridad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Interruptores de enclavamiento con atrapamiento de llave Prosafe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Dispositivos de paro de emergencia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Interruptores de posicin (final de carrera). . . . . . . . . . . . . . . . . . . . . . . . . . . 7 PLC de seguridad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Contactores y rels de control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Interruptores de carga IEC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Dispositivos de control de dos manos . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Sistemas de aislamiento de seguridad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Soluciones de seguridad aplicada . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Accesorios. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Sistemas de conexin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Lugares peligrosos e interruptores pneumticos . . . . . . . . . . . . . . . . . . . . . 16 Interfaces de terminal MobileView Guard . . . . . . . . . . . . . . . . . . . . . . . . . 17 Aplicaciones que usan dispositivos de seguridad . . . . . . . . . . . . . . . . . . . . . . 18 ndice de nmeros de catlogo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 ndice completo de productos. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 Oficinas de ventas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21

Informacin importante para el usuario

Debido a la variedad de usos de los productos descritos en esta publicacin, las personas responsables de la aplicacin y uso de este equipo de control deben asegurarse de que se hayan seguido todos los pasos necesarios para que cada aplicacin y uso cumpla con todos los requisitos de rendimiento y seguridad, incluyendo leyes, reglamentos, cdigos y normas aplicables. Los ejemplos de ilustraciones, grficos, programas y esquemas mostrados en este suplemento tienen la nica intencin de ilustrar el texto. Debido a las muchas variables y requisitos asociados con cualquier instalacin particular, Rockwell Automation no puede asumir responsabilidad u obligacin, incluyendo responsabilidad de propiedad intelectual, por el uso real basado en los ejemplos mostrados en esta publicacin
Informacin de seguridad relacionada

El instalador es responsable de la seguridad de todo el sistema de control instalado y de que se cumplan todas las leyes, cdigos y requisitos de seguridad pertinentes. ATENCIN: Como instalador de este sistema de control, usted debe estar bien informado de otras normas vigentes relacionadas a recomendaciones de seguridad respecto a: Construccin de mquinas Aspectos elctricos generales Seguridad de mquinas Guardas de punto de operacin, cortinas de luz de seguridad, guardas mecnicas, controles de dos manos y rels de monitoreo de seguridad Adems de las leyes y cdigos locales, usted es responsable del cumplimiento de las recomendaciones de seguridad detalladas en todos los cdigos y normas vigentes, entre ellos: Cdigo Elctrico Nacional Reglamentos de OSHA Normas ANSI NFPA CSA

Trminos y condiciones

Para obtener informacin sobre los Trminos y condiciones de venta, por favor consulte la pgina Generalidades-4.

IMPORTANTE

Rockwell Automation se reserva el derecho de hacer revisiones al material contenido en este catlogo y especficamente niega toda responsabilidad por daos incidentales o consecuentes que resulten del suministro, rendimiento o uso de este material.

Generalidades

Pautas de seguridad y garantas/conversiones mtricas


Consideraciones de aplicacin
Seleccin de equipos Debido a la variedad de usos de los productos descritos en este catlogo, las personas responsables de la aplicacin y uso de este equipo de control deben asegurarse de que se hayan seguido todos los pasos necesarios para que cada aplicacin y uso cumpla con todos los requisitos de rendimiento y seguridad, incluyendo leyes, reglamentos, cdigos y normas aplicables. Los ejemplos de ilustraciones, grficos y esquemas mostrados en este catlogo tienen la nica intencin de ilustrar el texto. Debido a las muchas variables y requisitos asociados con cualquier instalacin particular, Allen-Bradley no puede asumir responsabilidad u obligacin (incluyendo responsabilidad de propiedad intelectual) por el uso real basado en los ejemplos mostrados en esta publicacin. La publicacin SGI-1.1 de Allen-Bradley, Safety Guidelines for he Aplicacin, Installation and Maintenance of Solid-state Control (disponible a travs de la oficina regional de Allen-Bradley), describe algunas diferencias importantes entre dispositivos de estado slido y dispositivos electromecnicos, las cuales deben tenerse en consideracin al usar productos tales como los descritos en este catlogo. Condiciones de servicio e instalacin A menos que se indique lo contrario, los productos descritos en este catlogo estn diseados para cumplir con condiciones de servicio e instalacin usuales segn lo definido por la Publicacin de Estndares de NEMA (National Electrical Manufacturers Association), Parte ICS 1-108. Los dispositivos de tipo abierto deben proporcionarse con proteccin ambiental mediante montaje apropiado en envolventes clasificados para las condiciones especficas de la aplicacin. Consulte las pginas 1-7 y 1-9 de este catlogo para obtener informacin sobre los envolventes y una explicacin de los grados de proteccin que proporcionan los diferentes tipos, en base a la Publicacin 250 de Estndares NEMA y la publicacin 529 de IEC, segn corresponda. Datos de rendimiento Los datos de rendimiento proporcionados en este catlogo se ofrecen como gua para que el usuario determine la idoneidad y no constituyen una garanta. Pueden representar el resultado de pruebas aceleradas a niveles de estrs elevados, y el usuario debe compararlos con los requisitos especficos de su aplicacin. El rendimiento real est sujeto a la GARANTA y LMITE DE RESPONSABILIDAD de AllenBradley (consulte Trminos y condiciones de venta de Allen-Bradley en la pgina 1-4).
De Pulgadas (pulg.) Pulgadas (pulg.) Pies Yardas (yd.) Milmetros (mm) Centmetros (cm) Metros (m) Metros (m) Pulgadas cuadradas (pulg.2 ) Pulgadas cuadradas (pulg.2 ) Pies cuadrados (pies2) Yardas cuadradas (yd. ) Milmetros cuadrados (mm2) Metros cuadrados (m2 ) Metros cuadrados (m2 ) Onzas (oz.) Libras (lb) Gramos (g) Kilogramos (kg) Pulgadas cbicas (pulg.3 ) Pies cbicos (pies ) Pulgadas cbicas (pulg.3 ) Pies cbicos (pies3) Galones (Imp) Galones (EE.UU.) Centmetros cbicos (cm3 ) Metros cbicos (m ) Litros (L) Litros (L) Litros (L) Litros (L)
3 3 2

Factores de conversin mtrica A Longitud Milmetros (mm) Centmetros (cm) Metros (m) Metros (m) Pulgadas (pulg.) Pulgadas (pulg.) Pies Yardas (yd.) rea Milmetros cuadrados (mm2) Centmetros cuadrados (cm2 ) Metros cuadrados (m2 ) Metros cuadrados (m ) Pulgadas cuadradas (pulg.2 ) Pies cuadrados (pies2) Yardas cuadradas (yd.2) Peso Gramos (g) Kilogramos (kg) Onzas (oz.) Libras (lb) Volumen Centmetros cbicos (cm3) Metros cbicos (m3 ) Litros (L) Litros (L) Litros (L) Litros (L) Pulgadas cbicas (pulg.3 ) Pies cbicos (pies3) Pulgadas cbicas (pulg.3 )
2

Multiplicar por 25.4 2.54 0.305 0.914 0.0394 0.394 3.28 1.09 645.0 6.45 0.0929 0.836 0.00155 0.155 10.8 1.20 28.3 0.454 0.0353 2.20 16.4 0.0283 0.0164 28.3 4.55 3.79 0.061 35.3 61.0 0.0353 0.220 0.264 6.89 0.0689 0.145 14.5 0.113 8.85
! "

Centmetros cuadrados (cm2) Pulgadas cuadradas (pulg.2 )

Pies cbicos (pies3) Galones (Imp) Galones (EE.UU.) Presin Libras/pulgada cuadrada (psi) Kilopascales (kPa) Libras/pulgada cuadrada (psi) Barios (Bar) Kilopascales (kPa) Libras/pulgada cuadrada (psi) Barios (Bar) Libras/pulgada cuadrada (psi) Par Libra pulgada (lb pulg.) Newton metros (Nm) Newton metros (Nm) Libra pulgada (lb pulg.) Temperatura Grados Fahrenheit (F) Grados centgrados (C) Grados centgrados (C) Grados Fahrenheit (F)

! Frmula de conversin: 5/9 (F 32 F) = C " Frmula de conversin: 9/5 (C) + 32 F = F

Generalidades-3

Generalidades

Trminos y condiciones de venta


Estos trminos y condiciones de venta generales se aplican slo a ventas directas realizadas por el fabricante o sus afiliadas. Las ventas realizadas por distribuidores y otros revendedores autorizados estarn sujetas a los trminos y condiciones establecidos por separado por cada distribuidor o revendedor. Las ventas fuera de Norteamrica, as como las ventas de otros productos y servicios de Rockwell Automation, tambin pueden estar sujetas a trminos y condiciones de venta separadas o suplementarias. Para obtener informacin adicional, por favor consulte con la oficina de ventas de Rockwell Automation/Allen-Bradley. Generales Estos trminos y condiciones de venta generales (junto con cualquier especificacin o cotizacin escrita del Vendedor directamente asociada) regirn exclusivamente la venta u otorgamiento de licencia de todos los productos y servicios (incluyendo, sin limitacin, productos de hardware, firmware y software, servicios de capacitacin, programacin, mantenimiento, ingeniera, reparaciones y piezas llamados de manera colectiva, los Productos) proporcionados en virtud del presente. Ninguna adicin o modificacin a estos trminos y condiciones representar obligacin legal para el Vendedor, a menos que haya sido acordada por escrito y firmada por un representante autorizado en las oficinas del Vendedor. El vendedor rechaza otros trminos y condiciones que el cliente pueda proponer y que no estn de acuerdo con estos u otros trminos y condiciones establecidos en la especificacin, cotizacin o confirmacin de pedido escrita del Vendedor. Condiciones de pago Treinta (30) das netos a partir de la fecha de la factura con crdito actual aprobado segn lo determinado por el Vendedor. El Vendedor se reserva el derecho de suspender cualquier servicio adicional en virtud de este acuerdo o por cualquier otro motivo en caso de que no se efecte el pago a su vencimiento. No se permite pago por compensacin a menos que lo apruebe el vendedor. Condiciones de entrega Las condiciones de entrega son Ex Works con respecto a costo de envo, riesgo de prdida y transferencia de ttulo, excepto que el ttulo de todos los derechos de propiedad intelectual asociados con los Productos (por ej., software y firmware) permanecen con el Vendedor (o sus suministradores y concedentes de licencia), y dichos productos se ponen a disposicin o se autorizan slo para uso por el cliente de conformidad con este acuerdo u otro acuerdo de licencia del Vendedor. Las fechas confirmadas de envo son aproximadas y se basan en la oportuna recepcin de toda la informacin necesaria del cliente. Garanta A. Hardware: El Vendedor garantiza por un perodo de un (1) ao a partir de la fecha de la factura del Vendedor o su distribuidor designado, segn sea el caso, que los Productos de hardware suministrados en virtud del presente, sern de calidad comercial y estarn libres de defectos de material, fabricacin y diseo. Los Productos reparados o de reemplazo proporcionados bajo garanta estn igualmente garantizados durante un perodo de seis (6) meses a partir de la fecha de envo al Cliente, o por el resto del trmino de la garanta original, el que sea ms largo. B. Software y Firmware: A menos que se indique lo contrario en un acuerdo de licencia del Vendedor o tercera entidad, el Vendedor garantiza por un perodo de un (1) ao a partir de la fecha de la factura del Vendedor o su distribuidor designado, segn sea el caso, que los Productos de software o firmware estndar proporcionados en virtud del presente, si se usan con el hardware especificado por el Vendedor, tendrn un desempeo de acuerdo con las especificaciones publicadas preparadas, aprobadas y emitidas por la oficina central del Vendedor. El Vendedor no otorga garanta ni ofrece representacin alguna, expresa o implcita, de que la operacin de los Productos de software o firmware ser ininterrumpida o libre de errores, o de que las funciones del software o firmware cumplirn con el uso deseado o con los requisitos del cliente. Las correcciones de software y firmware estn garantizadas durante un perodo de tres (3) meses a partir de la fecha de envo al Cliente, o por el resto del trmino de la garanta original, el que sea ms largo. C. Reparacin en la fbrica e intercambio en la planta: El Vendedor garantiza por un perodo de seis (6) meses a partir de la fecha de la factura del Vendedor o su distribuidor designado, segn sea el caso, que los Productos de hardware facturables, ya sean reparados en la fbrica o intercambiados en la planta, y suministrados en virtud del presente, que no estn bajo garanta, estarn libres de defectos de material y fabricacin. Los productos suministrados en base a intercambio pueden ser nuevos o reacondicionados. Servicio: El Vendedor garantiza que los productos consistentes en servicios, e inclusive servicios de programacin de aplicacin personalizada e ingeniera, ya sea provistos en base a tiempo y material o costo fijo, se llevarn a cabo de acuerdo con las prcticas industriales generalmente aceptadas en la medida que dichos servicios estn sujetos a criterios de aceptacin escritos acordados por adelantado por el Vendedor. Se niega cualquier otra garanta relacionada a servicios proporcionados. Especificaciones del Cliente: El vendedor no garantiza y no ser responsable de ningn diseo, materiales o criterios de construccin proporcionados o especificados por el Cliente e incorporados en el Producto o para los Productos, fabricados o abastecidos por otros fabricantes o vendedores especificados por el Cliente. Cualquier garanta aplicable a dichos Productos especificados por el Cliente estar limitada exclusivamente a la garanta, de haberla, extendida por el vendedor o fabricante original, en lugar del Vendedor, en la medida permitida. Recursos: La satisfaccin de las garantas anteriores estar limitada, a opcin del Vendedor, al reemplazo, reparacin, reacondicionamiento o modificacin, o a la emisin de crdito por el precio de compra de los Productos implicados y, cuando corresponda, slo despus de la devolucin de dichos Productos con consentimiento del Vendedor. Los productos de reemplazo pueden ser nuevos o reacondicionados. Cualquier servicio de garanta (consistente en tiempo, viajes y gastos relacionados a dichos servicios) realizados en un lugar diferente a la fbrica del Vendedor, correr por cuenta del Cliente. Generalidades: La satisfaccin de la garanta estar disponible slo si (a) el Vendedor recibe notificacin inmediata por escrito y (b) el examen realizado por el Vendedor revela, a su satisfaccin, que cualquier supuesto defecto no fue causado por mal uso; negligencia; incorrecta instalacin, operacin, mantenimiento, reparacin, alteracin o modificacin; accidente; o degradacin o deterioro inusual de los Productos o partes de los mismos debido al ambiente fsico o al ambiente de ruido elctrico o electromagntico. LAS GARANTAS ANTERIORES SE OFRECEN EN LUGAR DE TODAS LAS OTRAS GARANTAS, SEAN EXPRESAS, IMPLCITAS O IMPUESTAS POR LA LEY, INCLUYENDO GARANTAS IMPLCITAS DE COMERCIABILIDAD O IDONEIDAD PARA ALGN USO GENERAL O ESPECFICO, O GARANTAS DE RENDIMIENTO O APLICACIN, Y SE EXTIENDEN SLO A LOS CLIENTES QUE COMPRAN DEL VENDEDOR O SU DISTRIBUIDOR DESIGNADO.

D.

E.

F.

G.

H.

Lmite de responsabilidad EN NINGN CASO EL VENDEDOR SER RESPONSABLE POR DAOS INCIDENTALES, INDIRECTOS O CONSECUENTES DE CUALQUIER TIPO. LA RESPONSABILIDAD ACUMULADA MXIMA DEL VENDEDOR RELACIONADA A CUALQUIER OTRO RECLAMO Y OBLIGACIONES, INCLUSIVE CON RESPECTO A

Generalidades-4

Generalidades

Trminos y condiciones de venta


DAOS DIRECTOS Y OBLIGACIONES BAJO CUALQUIER INDEMNIDAD, CON O SIN SEGURO, NO SER MAYOR QUE EL COSTO DE LOS PRODUCTOS POR LOS CUALES SURGE EL RECLAMO O RESPONSABILIDAD. CUALQUIER DEMANDA CONTRA EL VENDEDOR DEBER PRESENTARSE EN UN LAPSO DE DIECIOCHO (18) MESES CONTADOS A PARTIR DEL RESULTADO CAUSA DE LA DEMANDA. ESTOS DESCARGOS Y LIMITACIONES DE RESPONSABILIDAD ESTARN VIGENTES INDEPENDIENTEMENTE DE CUALQUIER OTRA DISPOSICIN EN CONTRARIO DEL ACUERDO E INDEPENDIENTEMENTE DE LA FORMA DE LA DEMANDA, YA SEA POR CONTRATO, AGRAVIO O POR CUALQUIER OTRO MOTIVO, Y SE EXTENDERN ADEMS A BENEFICIO DE LOS DISTRIBUIDORES DEL VENDEDOR, SUS DISTRIBUIDORES DESIGNADOS Y OTROS REVENDEDORES AUTORIZADOS COMO BENEFICIARIOS DE TERCERA ENTIDAD.CADA DISPOSICIN DEL ACUERDO QUE ESTABLEZCA UNA LIMITACIN DE RESPONSABILIDAD, DESCARGO DE GARANTA O CONDICIN O EXCLUSIN DE DAOS ES SEPARABLE E INDEPENDIENTE DE CUALQUIER OTRA DISPOSICIN Y DEBER CUMPLIRSE COMO TAL. Propiedad intelectual El Vendedor defender cualquier accin o proceso legal entablado contra el Cliente en basado en un reclamo de que el diseo o construccin de los Productos vendidos por el Vendedor, o con licencia otorgada en virtud del presente, infringen cualquier Patente de los Estados Unidos o Canad, derechos de autor o registro de proteccin de trabajo, siempre y cuando el cliente notifique inmediatamente por escrito al Vendedor de dicho reclamo y proceso o accin judicial resultante y siempre que, por cuenta del Vendedor, (a) el cliente otorgue al Vendedor el derecho exclusivo de defender o controlar la defensa del proceso legal o accin judicial, incluyendo la transaccin y (b) que el cliente proporcione toda la informacin y ayuda necesaria para dicha defensa. Excepto por daos consecuentes, el Vendedor pagar todos los costos y daos finalmente adjudicados o acordados por el Vendedor directamente relacionados a dicha demanda. En caso de cargo por violacion de obligacin del Vendedor segn el Acuerdo, sta ser satisfecha si el Vendedor, a su discrecin y por su cuenta, (i) ofrece al cliente el derecho de continuar usando dichos Productos; (ii) reemplaza los mismos con productos que no violan las especificaciones; (iii) modifica los mismos de manera que no violen las especificaciones; o (iv) acepta la devolucin de cualquier Producto que viole las especificaciones y devuelve el precio de compra. No obstante lo anterior, el Vendedor no asumir responsabilidad alguna respecto a cualquier reclamo de violacin en la medida que se base en una configuracin o modificacin incorporada en los Productos a pedido del cliente, o cualquier aplicacin de proceso en el cual los Productos hayan sido integrados por el cliente o utilizados en combinacin con otros equipos o productos no suministrados por el Vendedor. ESTE PRRAFO ESTABLECE LA RESPONSABILIDAD TOTAL DEL VENDEDOR CON RESPECTO A PROPIEDAD INTELECTUAL Y VIOLACIN DE PATENTES POR CUALQUIER PRODUCTO (INCLUYENDO PROGRAMAS DE SOFTWARE, EQUIPO O PRODUCTOS DE LOS MISMOS) O POR SU OPERACIN, Y REEMPLAZA TODAS LAS GARANTAS O CONDICIONES RELACIONADAS CON VIOLACIONES O PROPIEDAD INTELECTUAL YA SEAN EXPRESAS O IMPLCITAS. Software y Firmware con licencia Los productos compuestos de software o firmware pueden estar sujetos a trminos y condiciones adicionales establecidas en acuerdos de licencia separados del Vendedor que controlarn, en la medida que sea necesario, la resolucin de cualquier conflicto con los trminos y condiciones establecidos en el presente. Dichos Productos no se proporcionarn ni estarn disponibles hasta que el cliente tambin acepte los trminos y condiciones de dichos acuerdos de licencia separados. Embalaje y marcado El embalaje y marcado especificado por el cliente puede estar sujeto a cargos adicionales no incluidos en el precio de los Productos. Peso y dimensiones Los pesos y dimensiones publicados son aproximados y no representan una garanta. Cotizaciones Las cotizaciones escritas son vlidas por 30 das a partir de la fecha de su emisin, a menos que se indique lo contrario. Las cotizaciones verbales expiran el mismo da que se hacen. Todos los errores tipogrficos y errores del personal estn sujetos a correccin. Precios Los precios y otra informacin que aparecen en cualquier publicacin del Vendedor (incluidos catlogos y folletos de productos) estn sujetos a cambio sin previo aviso y confirmacin mediante cotizacin especfica. Dichas publicaciones no son ofertas de venta y se mantienen slo como fuente de informacin general. El cliente pagar o reembolsar al Vendedor el costo de todos los impuestos de venta, uso, consumo o similares. Los Productos consistentes en servicios de tiempo y material se proporcionarn de acuerdo con las tarifas por servicios publicadas del Vendedor (incluyendo sobretiempo y costo por viajes correspondientes) vigentes a la fecha en que se proporcionaron dichos servicios, a menos que se confirme lo contrario mediante confirmacin de pedido o cotizacin escrita del vendedor. El tiempo de servicio facturable incluye tiempo de viaje hacia y desde la planta y todo el tiempo que los representantes de Vendedor estn disponibles para trabajar y a la espera (ya sea en o fuera del lugar de trabajo) para llevar a cabo los servicios. Cambios Otros cambios solicitados por el cliente, incluyendo los que afectan la identidad, alcance y entrega de los Productos deben documentarse por escrito y estn sujetos a aprobacin previa del Vendedor y a ajustes de precio, programacin y otros trminos y condiciones afectados. En cualquier caso, el Vendedor se reserva el derecho a rechazar cualquier cambio que considere no seguro, tcnicamente no aconsejable o contradictorio con las normas y pautas de ingeniera o calidad, o incompatible con el diseo o capacidades de fabricacin del Vendedor. Devoluciones Todas las devoluciones de Productos estarn sujetas a aprobacin previa del Vendedor. La devolucin por crdito de Productos sin garanta no usados y comercializables estar sujeta a las polticas de devolucin del Vendedor vigentes al momento, incluyendo cargos de reabastecimiento y otras condiciones de devolucin. Los Productos devueltos bajo garanta deben ser correctamente embalados y enviados al lugar especificado por el Vendedor. Los contenedores de embarque deben estar claramente marcados segn las instrucciones del Vendedor, flete de transporte prepagado por el cliente. Cancelacin de un pedido Un pedido puede ser cancelado por el cliente antes de su envo slo mediante notificacin escrita y pago al Vendedor de los cargos razonables de cancelacin y reabastecimiento, incluyendo reembolso de costos directos ms costos por paro. Los cargos por cancelacin asociados con pedidos de Productos personalizados o Productos fabricados especficamente segn especificaciones del cliente pueden ser iguales al precio de venta de los Productos. El Vendedor tiene derecho de cancelar un pedido por causa en cualquier momento, mediante notificacin escrita, y el Vendedor tendr derecho a los cargos por cancelacin y reabastecimiento segn lo especificado anteriormente. El cliente no podr efectuar ninguna terminacin por causa a menos que el Vendedor no haya cumplido con corregir dicha causa alegada en un lapso de cuarenta y cinco (45) das a partir de la recepcin de notificacin escrita del cliente en la que especifique dicha causa. Fuerza mayor El Vendedor no ser responsable de ninguna prdida, dao o retraso producido por incumplimiento en virtud del presente debido a causas fuera de su control razonable, incluyendo sin limitacin, factores imprevisibles o actos del cliente, actos de la autoridad civil o militar, incendios, huelgas, inundaciones, epidemias, restricciones de cuarentena, guerra, tumultos, retrasos en el transporte o embargo del transporte. En caso de dicho retraso, la fecha de cumplimiento se extender por el perodo de tiempo razonablemente necesario para compensar el retraso. Clusulas y contratos del gobierno Ninguna clusula o reglamentacin de contrato gubernamental se aplicar a los Productos o a este acuerdo o accin para obligar al Vendedor, a menos que haya sido acordado especficamente por el vendedor por escrito, en las instalaciones del Vendedor. Los Productos vendidos o con licencia otorgada en virtud del presente no se han diseado para uso, ni deben utilizarse en ninguna aplicacin nuclear, ya sea como componente bsico segn la norma 10 CFR 21 (NCR de Estados Unidos) ni de ningn otro modo bajo leyes y reglamentos nucleares similares de este o cualquier otro pas.

Generalidades-5

Generalidades

Trminos y condiciones de venta


Control de exportacin Los Productos y materiales asociados suministrados o con licencia otorgada bajo este acuerdo pueden estar sujetos a diversas leyes y reglamentos de exportacin. Es responsabilidad del exportador cumplir con dichas leyes y reglamentos. Disputas Las partes intentarn de buena fe resolver prontamente cualquier disputa que surja de este acuerdo mediante negociaciones entre representantes con autoridad para resolver la controversia. Si no se llegara a un acuerdo satisfactorio, las partes intentarn de buena fe resolver la disputa a travs de mediacin de una tercera parte no obligatoria, cuyos cargos y gastos pagarn ambas partes por igual. Cualquier disputa que no se resuelva mediante negociacin o mediacin podr remitirse al tribunal de jurisdiccin competente de acuerdo con los trminos y condiciones de este acuerdo. Estos procedimientos son procedimientos exclusivos para la resolucin de todas las disputas entre las partes. Ley vigente Este acuerdo y todas las disputas que surjan del presente se regirn e interpretarn de acuerdo con las leyes internas del estado, provincia u otra jurisdiccin gubernamental correspondiente al lugar de residencia principal del negocio del Vendedor, pero excluyendo especficamente las provisiones de la Convencin de Contratos para la Venta Internacional de Productos de las NU de 1980 (1980 UN Convention on Contracts for the International Sales of Goods). Cesin Este acuerdo no puede ser cedido por ninguna de las partes sin el consentimiento escrito de la otra parte, sin embargo, no se requerir consentimiento para transferencias y cesiones internas entre el Vendedor y su corporacin matriz, subsidiarias o afiliadas como parte de una consolidacin, fusin u otra forma de reorganizacin corporativa. Idioma Las partes confirman que han solicitado que este acuerdo se formule en ingls. Les parties reconnaissent avoir exig la rdaction en anglais du Contrat. En el caso de conflicto entre la versin en ingls y la versin en cualquier otro idioma de este acuerdo, prevalecer la versin en ingls.

Generalidades-6

Generalidades

Mantenimiento de equipos de control industrial


ATENCIN: Realizar el servicio de mantenimiento de equipos de control industrial activados puede ser peligroso. Pueden producirse lesiones personales graves, o la muerte, por descargas elctricas, quemaduras o activacin no intencional del equipo controlado. La prctica recomendada es desactivar y desconectar el equipo de control de las fuentes de alimentacin y liberar la energa almacenada, si la hubiera. Consulte los documentos National Fire Protection Association Standard No. NFPA70E, Parte II y (segn corresponda) OSHA rules for Control of Hazardous Energy Sources (Lockout/Tagout) y OSHA Electrical Safety Related Work Practices para obtener informacin sobre prcticas de trabajo relacionadas a la seguridad, incluyendo procedimientos para bloquear/poner indicacin de advertencia, as como prcticas de trabajo apropiadas, calificaciones de personal y requisitos de capacitacin cuando no sea viable desactivar y bloquear o poner advertencias en los circuitos de electricidad y equipos antes de trabajar en o cerca de piezas de circuito expuestas. Inspeccin peridica Los equipos de control industrial deben Mecanismos de operacin Verifique el correcto funcionamiento y inspeccionarse peridicamente. Los intervalos entre inspecciones deben la ausencia de adherencias o atascamiento. Reemplace los ensambles y las basarse en las condiciones ambientales y de operacin y ajustarse segn piezas rotas, deformadas o desgastadas de acuerdo con las listas de lo requerido. Se sugiere llevar a cabo una inspeccin inicial 3 a 4 meses piezas de repuesto para productos individuales. Revise y vuelva a apretar despus de la instalacin. Consulte el Documento National Electrical los pernos de fijacin que estn flojos.Aplique lubricacin si as lo Manufacturers Association (NEMA) Standard No. ICS 1.3, Preventive indican las instrucciones de los productos individuales. Maintenance of Industrial Control and Systems Equipment, para obtener informacin general sobre cmo establecer un programa de Nota: Los arrancadores magnticos, contactores y rels de AllenBradley han sido diseados para funcionar sin lubricacin no mantenimiento peridico. Sugerimos establecer un programa de mantenimiento peridico. A continuacin se listan algunas pautas lubrique estos dispositivos porque el aceite o la grasa en las superficies especficas para productos Allen-Bradley. de los polos (superficies de contacto) del imn operativo pueden causar que el dispositivo se atasque en el modo ON (encendido). Algunas Contaminacin Si la inspeccin revela que entr polvo, suciedad, piezas de otros dispositivos son lubricadas en la fbricasi se necesita humedad u otros contaminantes al equipo de control, deber eliminarse lubricacin durante el uso o mantenimiento de estos dispositivos, esto la causa. Esto podra indicar un envolvente deficiente o incorrectamente estar especificado en sus instrucciones individuales.Si tiene alguna duda, seleccionado, aberturas del envolvente no selladas (conducto u otras) o comunquese con la oficina local de ventas de Allen-Bradley para procedimientos de operacin incorrectos. Reemplace cualquier obtener informacin. envolvente incorrectamente seleccionado por uno apropiado para las condiciones ambientales consulte el documento NEMA Standard Contactos Revise los contactos para determinar si han sufrido No. 250, Enclosures for Electrical Equipment para obtener las excesivo desgaste y acumulacin de suciedad. Aspire o limpie los contactos con un pao suave, si es necesario, para eliminar la suciedad. descripciones y criterios de pruebas de los envolventes. Reemplace los sellos de elastmero daados o frgiles y repare o reemplace cualquier Los contactos no sufren dao por decoloracin y corrosin ligera. Los otra pieza daada o defectuosa (por ej., bisagras, pernos de sujecin, contactos nunca deben limarse ya que el labrado acorta la vida til de los etc.). Los dispositivos de control hmedos, sucios o contaminados contactos. No deben utilizarse limpiadores de roco para limpiar los deben reemplazarse, a menos que puedan limpiarse eficazmente contactos, ya que el residuo en las superficies de los polos de imn o en mediante aspiracin o con un pao. No se recomienda usar aire los mecanismos de operacin puede causar atascamiento, y en lo comprimido para realizar la limpieza porque puede desplazar la suciedad, contactos puede interferir con la continuidad elctrica. Los contactos el polvo o materias residuales a otras partes del equipo o daar las piezas slo deben reemplazarse despus que la plata est bastante desgastada. delicadas. Siempre reemplace los contactos en conjuntos completos para evitar un mal alineamiento o presin desigual de los contactos. Dispositivos de enfriamiento Inspeccione los ventiladores usados para enfriamiento por aire forzado. Reemplace cualquier ventilador que Contactores en vaco Los contactos de los contactores de vaco no tenga aspas dobladas, despostilladas o faltantes, o si el eje no gira son visibles, por lo tanto el desgaste de los contactos debe verificarse libremente. Conecte la alimentacin elctrica momentneamente para indirectamente. Los frascos en vaco se deben reemplazar cuando: verificar la operacin. Si no funciona, revise y reemplace el cableado, el El nmero calculado de operaciones es igual a un milln, o fusible o el ventilador o motor del ventilador, segn corresponda. Limpie o cambie los filtros de aire, segn lo recomendado en el manual El indicador de lnea de vida til del contacto indica necesidad de del producto. Tambin limpie las aletas de los intercambiadores trmicos reemplazo, o para que no se vea afectado el enfriamiento por conveccin.

Envolventes para lugares peligrosos

ATENCIN: Peligro de explosin. Siempre desconecte la alimentacin elctrica antes de abrir envolventes en lugares peligrosos. Cierre y asegure dichos envolventes antes de volver a conectar la alimentacin elctrica.
Ubicacin de envolventes Los envolventes NEMA Tipos 7 y 9 requieren una manipulacin cuidadosa para no daar las bridas maquinadas. En el caso de cubiertas extrables, quite la cubierta y pngala a un lado con la superficie maquinada hacia arriba. En el caso de cubiertas abisagradas, abra completamente la cubierta y sujtela en la posicin completamente abierta si es necesario. Limpie y examine las bridas del cuerpo y la cubierta antes de volver a ensamblar. Si tienen rasguos, mellas, muescas u oxidacin en las superficies de contacto, reemplace el cuerpo o la cubierta segn sea necesario. Examine todos los pernos y reemplace los que tengan las roscas daadas. Tambin revise las roscas de empalme para determinar si han sufrido dao y reemplace el envolvente si es necesario. Las cubiertas y cuerpos de algunos envolventes se fabrican como conjunto (no intercambiables). Debe consultarse con el fabricante antes de reemplazar una cubierta o cuerpo, a menos que el fabricante haya especificado que son intercambiables.

La prueba de integridad del frasco en vaco indica necesidad de reemplazo. Reemplace simultneamente todos los frascos en vaco en el contactor para evitar un desalineamiento y desgaste desigual de los contactos. Si los frascos en vaco no requieren reemplazo, verifique y ajuste la sobrecarrera al valor indicado en las instrucciones de mantenimiento. Terminales Las conexiones flojas en los circuitos de alimentacin elctrica pueden producir sobrecalentamiento, lo cual puede causar un mal funcionamiento o fallo del equipo. Las conexiones flojas en los circuitos de control pueden causar mal funcionamiento del control. Las conexiones de unin o tierra flojas pueden aumentar el peligro de choque elctrico y contribuir a la generacin de interferencia electromagntica (EMI). Verifique la firmeza de todas las conexiones de terminales y la barra de bus y apriete de manera segura cualquier conexin floja. Reemplace cualquier pieza o cableado daado por sobrecalentamiento y cualquier cable o correa de unin rota. Cubiertas para arco Revselas para determinar si presentan grietas, roturas o erosin profunda. Las cubiertas para arco y las cmaras de arco deben reemplazarse si han sufrido dao o erosin profunda.

Generalidades-7

Generalidades

Mantenimiento de equipos de control industrial


Bobinas Si una bobina muestra seal de sobrecalentamiento (fisuras, fusin o aislamiento quemado), debe reemplazarse. En ese caso, verifique y corrija las condiciones de sobrevoltaje o bajo voltaje que pueden causar el fallo de la bobina. Asegrese de limpiar los residuos de aislamiento fundido de la bobina de otras partes del dispositivo o reemplace dichas piezas. Bateras Reemplace las bateras peridicamente segn lo especificado en el manual del producto o si la batera muestra signos de fuga de cido. Use herramientas para manipular las bateras con fuga de cido; la mayora de cidos de batera son corrosivos y pueden causar quemaduras. Deseche la batera usada siguiendo las instrucciones suministradas con la nueva batera o segn lo especificado en el manual del producto. Luces piloto Reemplace cualquier bombilla quemada o lente daada. Interruptores fotoelctricos Las lentes de los interruptores fotoelctricos requieren limpieza peridica con un pao suave seco. Los dispositivos reflectivos usados junto con los interruptores fotoelctricos tambin requieren limpieza peridica. No utilice disolventes ni agentes de limpieza en lentes o reflectores. Reemplace las lentes y los reflectores daados. Prueba de alto voltaje Las pruebas de resistencia de aislamiento (IR) de alto voltaje y de voltaje no disruptivo dielctrico (DWV) no deben utilizarse para verificar equipos de control de estado slido. Cuando se mida la IR o el DWV de equipos elctricos, tales como transformadores o motores, antes de realizar la prueba se debe desconectar el dispositivo de estado slido usado para control o monitoreo. Aunque no haya dao aparente despus de una prueba de IR o DWV, los dispositivos de estado slido se degradan y la aplicacin repetida de alto voltaje puede producir un fallo. Dispositivos de bloqueo y enclavamiento Revise estos dispositivos para asegurar su correcto funcionamiento y capacidad de desempeo de las funciones indicadas. Realice los reemplazos necesarios slo con piezas de repuesto o juegos de Allen-Bradley. Realice los ajustes y reparaciones slo de conformidad con las instrucciones de Allen-Bradley. Mantenimiento despus de una condicin de fallo La apertura del dispositivo de proteccin contra cortocircuito (tal como los fusibles o interruptores automticos) en un circuito derivado de motor correctamente coordinado es una indicacin de una condicin de fallo por exceso de la sobrecarga de operacin. Dichas condiciones pueden causar dao al equipo de control. Antes de restaurar la alimentacin elctrica, la condicin de fallo debe corregirse y deben realizarse las reparaciones o reemplazos necesarios para restaurar el equipo de control a un estado de operacin satisfactorio. Consulte la Publicacin de Estndares NEMA No. ICS-2, Parte ICS2-302 para obtener informacin sobre los procedimientos. Reemplazos Use slo piezas de repuesto y dispositivos recomendados por Allen-Bradley para mantener la integridad del equipo. Asegrese de que todas las piezas sean apropiadas para el modelo, serie y nivel de revisin del equipo. Revisin final Despus del mantenimiento o reparacin de controles industriales, siempre pruebe el sistema de control para asegurar su correcto funcionamiento bajo condiciones controladas que eviten peligros en caso de un mal funcionamiento. Para obtener informacin adicional, consulte el documento NEMA ICS 1.3, PREVENTIVE MAINTENANCE OF INDUSTRIAL CONTROL AND SYSTEMS EQUIPMENT, publicado por National Electrical Manufacturers Association, y NFPA70B, ELECTRICAL EQUIPMENT MAINTENANCE, publicado por National Fire Protection Association.

Dispositivos de estado slido

ATENCIN: El uso de equipos de prueba diferentes de los recomendados por la fbrica para controles de estado slido puede daar el equipo de control o de prueba, o causar la activacin inesperada del equipo controlado. Consulte el prrafo titulado PRUEBA DE ALTO VOLTAJE.
Los dispositivos de estado slido no requieren mucho ms que una inspeccin visual peridica. Los componentes descoloridos, calcinados o quemados pueden indicar la necesidad de reemplazar el componente o la tarjeta de circuitos. Los reemplazos necesarios deben realizarse slo en la tarjeta PC o a nivel del componente enchufable. Las tarjetas de circuitos impresos debe inspeccionarse para determinar si estn correctamente asentadas en los conectores correspondientes. Las lengetas de fijacin de las tarjetas tambin deben estar en su lugar. Los dispositivos de estado slido tambin deben estar protegidos contra contaminacin, y deben mantenerse los mecanismos de enfriamiento consulte los prrafos titulados CONTAMINACIN y DISPOSITIVOS DE ENFRIAMIENTO en la pgina anterior. No deben utilizarse disolventes en las tarjetas de circuitos impresos.

Generalidades-8

Generalidades

Envolventes IEC
Grado de proteccin
La publicacin 529 de IEC describe los grados de proteccin estndar que proporcionan los envolventes de un producto si se instalan correctamente.
Primer numeral ! Proteccin de personas contra el acceso a piezas peligrosas y proteccin contra penetracin de objetos extraos slidos. Segundo numeral ! Proteccin contra el ingreso de agua bajo condiciones de prueba especificadas en IEC 529.

Resumen
La publicacin define grados de proteccin con respecto a: Personas Equipo dentro de envolvente Ingreso de agua No define: La proteccin contra el riesgo de explosin La proteccin ambiental (por ej., contra humedad, atmsferas corrosivas o fluidos, moho o el ingreso de gusanos)
Nota: Los requisitos de las pruebas de IEC para grados de proteccin contra ingreso de lquidos se refieren slo al agua. Los productos descritos en este catlogo que tienen un alto grado de proteccin contra el ingreso de lquidos, en la mayora de casos tienen sellos de nitrilo. Estos tienen buena resistencia a una amplia gama de aceites, refrigerantes y fluidos cortantes. Sin embargo, algunos de lubricantes, fluidos hidrulicos y disolventes disponibles pueden causar un severo deterioro del nitrilo y otros polmeros. Algunos de los productos listados estn disponibles con sellos de Viton u otros materiales para una mayor resistencia a dichos lquidos. Para obtener recomendaciones acerca de este tema, consulte con la oficina local de ventas de Rockwell Automation, vea la Seccin 21 de este catlogo.

0 Sin proteccin 1 El dorso de la mano; objetos de


ms de 50 mm de dimetro

0 Sin proteccin 2 Cada vertical de gotas de


agua

3 Dedo; objetos de ms de
12.5 mm de dimetro

4 Cada vertical de gotas de


agua con envolvente inclinado 15

5 Herramientas y objetos de ms
de 2.5 mm de dimetro

6 Rociado de agua 8 Salpicadura de agua 10 Chorros de agua

7 Herramientas y objetos de ms
de 1.0 mm de dimetro

9 Proteccin contra polvo


(el polvo puede entrar durante la prueba especificada pero no debe interferir con la operacin del equipo ni afectar la seguridad)

11 A prueba de polvo (no se


observa polvo dentro del envolvente al final de la prueba)

12 Chorros potentes de agua 13 Sumersin temporal 14 Sumersin continua

Clasificacin de envolventes IEC


El grado de proteccin es indicado por dos letras (IP) y dos numerales. El Estndar Internacional IEC 529 contiene descripciones y requisitos de pruebas asociadas que definen el grado de proteccin que cada numeral especifica. La tabla a la derecha indica el grado de proteccin general consulte las Descripciones resumidas de los requisitos de pruebas para envolventes IEC que comienzan a continuacin. Para obtener informacin completa sobre los requisitos de pruebas, consulte la publicacin IEC 529.

Ejemplo: IP41 describe un envolvente diseado para proteger contra


la entrada de herramientas o objetos de ms de 1 mm de dimetro y para proteger contra el goteo vertical de agua bajo condiciones de prueba especificadas

Nota: Todos los primeros y segundos numerales hasta e incluyendo el numeral 6 de caracterstica, implican cumplimiento tambin con los requisitos de todos los numerales de caractersticas ms bajas en su respectiva serie (primera o segunda). Los segundos numerales 7 y 8 no implican idoneidad para exposicin a chorros de agua (el segundo numeral de caracterstica 5 6) a menos que tenga codificacin doble; por ej., IP_5/IP_7.
! El estndar IEC permite el uso de algunas letras suplementarias con los numerales
de caractersticas. Si se utilizan dichas letras, consulte la publicacin IEC 529 para obtener la explicacin correspondiente.

Descripciones resumidas de los requisitos de pruebas para envolventes IEC


(Consulte la publicacin IEC 529 para obtener informacin completa sobre las especificaciones de las pruebas por ej., configuraciones de los aparatos de pruebas; tolerancias; etc. Para obtener informacin sobre los factores de conversin mtrica vea la pgina 1-3.) Pruebas para proteccin contra acceso a piezas peligrosas (primer numeral de caracterstica) El primer numeral de caracterstica del nmero IP indica el cumplimiento con las siguientes pruebas para el grado de proteccin contra acceso a piezas peligrosas. Tambin indica el cumplimiento con pruebas segn lo mostrado en la siguiente seccin para el grado de proteccin contra objetos extraos slidos. La proteccin contra acceso a piezas peligrosas es satisfactoria si se mantiene la separacin adecuada entre la sonda de acceso y las piezas peligrosas. Para voltaje menor de 1,000 VCA y 1,500 VCC, la sonda de acceso no debe tocar la pieza energizada peligrosa. Para voltaje mayor de 1,000 VCA y 1,500 VCC, el equipo debe ser capaz de soportar pruebas dielctricas especificadas con la sonda de acceso en la posicin ms desfavorable.

IP0_ No se requiere prueba. IP1_ Una esfera rgida de 50 mm de dimetro no pasar completamente a travs de ninguna abertura. Fuerza = 50 N. IP2_ Un dedo de prueba articulado de 80 mm de largo y 12 mm de dimetro puede penetrar en toda su longitud de 80 mm, pero tendr una separacin adecuada segn lo especificado anteriormente, de las piezas energizadas peligrosas, en cada posicin posible del dedo de prueba mientras ambas articulaciones estn dobladas a un ngulo de hasta 90. Fuerza = 10 N. IP3_ Una varilla de prueba de 2.5 mm de dimetro no penetrar y se mantendr la separacin adecuada de las piezas energizadas peligrosas (segn lo especificado en la tabla anterior). Fuerza = 3 N. IP4_ Un alambre de prueba de 1 mm de dimetro no penetrar y se mantendr la separacin adecuada de las piezas energizadas peligrosas (segn lo especificado en la tabla anterior). Fuerza = 1 N.

Generalidades-9

Generalidades

Envolventes IEC
IP5_ Un alambre de prueba de 1 mm de dimetro no penetrar y se mantendr la separacin adecuada de las piezas energizadas peligrosas (segn lo especificado en la tabla anterior). Fuerza = 1 N. IP6_ Un alambre de prueba de 1 mm de dimetro no penetrar y se mantendr la separacin adecuada de las piezas energizadas peligrosas (segn lo especificado en la tabla de la pgina 1-9). Fuerza = 1 N. Pruebas para proteccin contra objetos extraos slidos (primer numeral de caracterstica) Para los primeros numerales 1, 2, 3 y 4 la proteccin contra objetos extraos slidos es satisfactoria si el dimetro total de la sonda especificada no pasa a travs de ninguna abertura. Tome nota de que para los primeros numerales 3 y 4 las sondas estn diseadas para simular objetos extraos que pueden ser esfricos. En los casos en que la forma de la trayectoria de entrada deje duda acerca del ingreso de un objeto esfrico con capacidad de movimiento, puede ser necesario examinar los dibujos o proporcionar acceso especial para la sonda del objeto. Para los primeros numerales 5 y 6, vea las descripciones de las pruebas a continuacin para obtener informacin sobre los criterios de aceptacin. IP0_ No se requiere prueba. IP1_ El dimetro completo de una esfera rgida de 50 mm de dimetro no debe pasar a travs de ninguna abertura en una prueba de fuerza de 50 N. IP1_ El dimetro completo de una esfera rgida de 12.5 mm de dimetro no debe pasar a travs de ninguna abertura en una prueba de fuerza de 30 N. IP3_ Una varilla de acero rgida de 2.5 mm de dimetro no debe pasar a travs de ninguna abertura en una prueba de fuerza de 3 N. IP4_ Un alambre de acero rgido de 1 mm de dimetro no debe pasar a travs de ninguna abertura en una prueba de fuerza de 1 N. IP5_ La muestra de prueba est disponible dentro de una cmara de polvo especificada donde se mantiene en suspensin talco en polvo que pasa a travs de un tamiz de malla cuadrada con cable de 50 mm de dimetro y anchura entre cables de 75 mm. Los envolventes para equipos sujetos a efectos de ciclos trmicos (categora 1) son bombeados al vaco a una presin interna reducida relativa a la atmsfera circundante: mxima depresin = 2 kPa; mximo rgimen de extraccin = 60 volmenes por hora. Si se obtiene el rgimen de extraccin de 40 a 60 volmenes/hr., la prueba contina hasta obtener 80 volmenes o hasta que hayan transcurrido 8 horas. Si el rgimen de extraccin es menos de 40 volmenes/hr. a una depresin de 20 kPa, el tiempo de prueba = 8 hr. Los envolventes para equipos no sujetos a los efectos de ciclos trmicos y designados con la categora 2 en el estndar de productos pertinentes, se prueban durante 8 horas sin bombeo al vaco. La proteccin es satisfactoria si el talco en polvo no se acumul en una cantidad o lugar tal que, con cualquier otro tipo de polvo, podra interferir con la correcta operacin del equipo o afectar la seguridad; y no se deposit polvo donde podra causar una trayectoria a lo largo de rutas conductivas. IP6_ Todos los envolventes son probados como categora 1, segn lo especificado anteriormente para IP5_. La proteccin es satisfactoria si no se observa depsito de polvo dentro del envolvente al final de la prueba. Pruebas para proteccin contra agua (segundo numeral de caracterstica) El segundo numeral de caracterstica del nmero IP indica el cumplimiento con las siguientes pruebas para el grado de proteccin contra agua. Para los numerales 1 al 7, la proteccin es satisfactoria si el agua que ingres no interfiere con la correcta operacin, no lleg a las partes energizadas no diseadas para funcionar cuando estn hmedas y no se acumul cerca de una entrada de cable ni entr al cable. Para el segundo numeral 8 la proteccin es satisfactoria si no ingres agua al envolvente. IP_0 No se requiere prueba. IP_1 Gotea agua sobre el envolvente desde un recipiente de goteo con aberturas separadas en un patrn cuadrado de 20 mm, a un rgimen de cada de lluvia de 1 mm/min. El envolvente se coloca en su posicin de operacin normal bajo el recipiente de goteo. Tiempo de la prueba = 10 min. IP_2 Gotea agua sobre el envolvente desde un recipiente de goteo con aberturas separadas en un patrn cuadrado de 20 mm, a un rgimen de cada de lluvia de 3 mm/min. El envolvente se coloca en 4 posiciones fijas con una inclinacin de 15 con respecto a su posicin de operacin normal, debajo del recipiente de goteo. Tiempo de la prueba = 2.5 min. para cada posicin de inclinacin. IP_3 Se roca agua a todos los lados del envolvente sobre un arco de 60 con respecto a la vertical, usando un dispositivo de tubo oscilante con orificios de rociado con separacin de 50 mm (o una boquilla de mano para envolventes de mayor tamao). Rgimen de flujo, dispositivo de tubo oscilante = 0.07 l/min. por orificio x nmero de orificios; para la boquilla de mano = 10 l/min. Tiempo de prueba, tubo oscilante = 10 min.; para la boquilla de mano = 1 min./m2 de superficie del envolvente, 6 min. como mnimo. IP_4 La misma prueba que para IP_3 excepto que el rociado cubre un arco de 180 con respecto a la vertical. IP_5 El envolvente es rociado desde todas las direcciones posibles con un flujo de agua de 12.5 l/min. a travs de una boquilla de 6.3 mm desde una distancia de 2.5 a 3 m. Tiempo de prueba = 1 min./m2 de superficie del envolvente que va a rociarse, 3 min. como mnimo. IP_6 El envolvente es rociado desde todas las direcciones posibles con un flujo de agua de 100 l/min. a travs de una boquilla de 12.5 mm desde una distancia de 2.5 a 3 m. Tiempo de prueba = 1 min./m2 de superficie del envolvente que va a rociarse, 3 min. como mnimo. IP_7 El envolvente se sumerge en agua en su posicin de servicio durante 30 min. Punto ms bajo de los envolventes menos de 850 mm de altura = 1000 mm debajo de la superficie de agua. Punto ms alto de los envolventes ms de 850 mm de altura = 150 mm debajo de la superficie de agua. IP_8 Las condiciones de prueba estn sujetas a convenio entre el fabricante y el usuario, pero sern por lo menos tan estrictas como las de IP_7

Generalidades-10

Generalidades

Envolventes NEMA
Especifique el envolvente correcto para sus controles de motor
Tipo 1 Montaje en superficie para uso general Los envolventes Tipo 1 estn diseados para uso en exteriores principalmente para proporcionar un grado de proteccin contra contacto con el equipo encerrado donde no existen condiciones de servicio inusuales. Los envolventes estn diseados para cumplir con las pruebas de entrada de varilla y resistencia a la oxidacin. El envolvente est hecho con plancha de acero tratada para resistir la corrosin. Tipo 1 Montaje al ras Envolventes de montaje al ras Tipo 1 para instalacin en estructuras de mquina y paredes de yeso. Estos envolventes son para aplicaciones similares y estn diseados a cumplir con las mismas pruebas que los de montaje en superficie Tipo 1. Tipo 3 A prueba de lluvia, hermtico al polvo Los envolventes Tipo 3 estn diseados para uso en exteriores, principalmente para proporcionar un grado de proteccin contra el polvo trasladado por el viento, la lluvia y el granizo; y para no sufrir dao por la formacin de hielo en el envolvente. Estn diseados para cumplir con las pruebas de resistencia a lluvia !, hielo externo", polvo y oxidacin. No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna o hielo interno. Tipo 3R A prueba de lluvia Los envolventes Tipo R3 estn diseados para uso en exteriores, principalmente para proporcionar un grado de proteccin contra la lluvia y para no sufrir dao por la formacin de hielo en el envolvente. Estn diseados para cumplir con las pruebas de entrada de varilla, resistencia a lluvia #, hielo exterior " y oxidacin. No estn diseados para proporcionar proteccin contra condiciones tales como polvo, condensacin interna o hielo interno. Tipo 4 Hermtico al agua Los envolventes Tipo 4 estn diseados para uso en interiores o exteriores, principalmente para proporcionar un grado de proteccin contra la lluvia y polvo trasladado por el viento, agua de salpicaduras y agua de lavado con manguera; y para no sufrir dao por la formacin de hielo en el envolvente. Estn diseados para cumplir con las pruebas de lavado con manguera, polvo y hielo exterior ". No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna o hielo interno. Tipo 4X no metlico, resistente a la corrosin Los envolventes Tipo 4X estn diseados para uso en interiores o exteriores, principalmente para proporcionar un grado de proteccin contra la corrosin, polvo trasladado por el viento y lluvia, agua de salpicaduras y agua de lavado con manguera; y para no sufrir dao por la formacin de hielo en el envolvente. Estn diseados para cumplir con las pruebas de resistencia al agua de lavado con manguera, polvo, congelamiento externo ", y corrosin. No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna o hielo interno. ! " #
Criterios de evaluacin: No ingres agua durante la prueba especificada. Criterios de evaluacin: No sufri dao despus que se derriti la formacin de hielo durante la prueba especificada (Nota: No se requiri que est operativo mientras estaba cargado de hielo. Criterios de evaluacin: No ingres agua en los mecanismos, aislamiento ni piezas energizadas.

Tipo 6P Para sumersin prolongada a una profundidad limitada Los envolventes Tipo 6P estn diseados para uso en interiores o exteriores, principalmente para proporcionar un grado de proteccin contra el ingreso de agua durante sumersin prolongada a una profundidad limitada; y para no sufrir dao por la formacin de hielo en el envolvente. Estn diseados para cumplir con las pruebas de resistencia a la presin de aire, congelamiento externo !, lavado con manguera y corrosin. No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna o hielo interno. Tipo 7 Para lugares con peligro de gases Los envolventes Tipo 7 son para uso en interiores, en lugares con clasificacin Clase I, Grupos C o D, segn lo definido en el Cdigo Elctrico Nacional de EE.UU. Los envolventes Tipo 7 estn diseados para soportar las presiones resultantes de una explosin interna de gases especificados, y contener dicha explosin lo suficiente como para que no entre en combustin una mezcla explosiva de gas y aire en la atmsfera circundante al envolvente. Los dispositivos generadores de calor instalados en envolvente estn diseados para evitar que las superficies externas lleguen a temperaturas capaces de encender mezclas explosivas de gas y aire en la atmsfera circundante. Los envolventes estn diseados para cumplir con las pruebas de resistencia hidrosttica, explosiones y temperatura. El acabado es un esmalte gris con resistencia especial a la corrosin. Tipo 9 Para lugares peligrosos expuestos al polvo Los envolventes Tipo 9 estn diseados para uso en lugares con clasificacin Clase II, Grupos E, F o G, segn lo definido por el Cdigo Elctrico Nacional de EE.UU. Los envolventes Tipo 9 estn diseados para evitar la entrada de polvo. Los dispositivos generadores de calor instalados en envolvente estn diseados para evitar que las superficies externas lleguen a temperaturas capaces de encender o decolorar el polvo sobre el envolvente o encender mezclas de polvo y aire en la atmsfera circundante. Los envolventes estn diseados para cumplir con las pruebas de resistencia a la temperatura y penetracin de polvo, as como el envejecimiento de las empaquetaduras. El acabado exterior es un esmalte gris con resistencia especial a la corrosin. Tipo 12 Uso industrial, hermtico al polvo Los envolventes Tipo 12 estn diseado para uso en interiores principalmente para proporcionar un grado de proteccin contra el polvo, la cada de suciedad y el goteo de lquidos no corrosivos. Estn diseados para cumplir con pruebas de resistencia al goteo ", polvo y oxidacin. No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna. Tipo 13, hermtico al aceite Los envolventes Tipo 13 estn diseado para uso en interiores principalmente para proporcionar un grado de proteccin contra el polvo, el rociado de agua, el aceite y los refrigerantes no corrosivos. Estn diseados para cumplir con las pruebas de exclusin de aceite y resistencia a la oxidacin. No estn diseados para proporcionar proteccin contra condiciones tales como condensacin interna.

Generalidades-11

Generalidades

Envolventes NEMA
ENVOLVENTES Consulte las siguientes descripciones breves de los diversos tipos de envolventes que ofrece Allen-Bradley. Vea la pgina 1-13 para obtener los criterios de seleccin. Para obtener definiciones, descripciones y criterios de prueba, consulte la Publicacin 250 sobre Estndares de la National Electrical Manufacturers Association (NEMA). Tambin vea las listas de productos individuales en el catlogo de Allen-Bradley para obtener informacin sobre los tipos de envolventes disponibles as como informacin adicional relacionada a estas descripciones. NOTA: Los envolventes normalmente no protegen a los dispositivos contra condiciones tales como condensacin, congelamiento, corrosin o contaminacin que pueden ocurrir dentro del envolvente o ingresar mediante el conducto o las aberturas no selladas. Los usuarios deben tomar las medidas apropiadas para proteger contra tales condiciones y asegurarse de que el equipo est correctamente protegido.

Criterios de seleccin
Envolventes para lugares no peligrosos
Diseado para cumplir con las pruebas No.! 6.2 6.2 6.8 6.5.1.2 (2) 6.5.1.1 (2) 6.3.2.2 6.4.2.1 6.4.2.2 6.6.2.2 6.7 6.11 (2) 6.3.2.2 6.12 6.9 Tipo Para uso en exteriores 3R 3

Para un grado de proteccin contra: Contacto accidental con equipo dentro del envolvente Cada de suciedad Moho Polvo circulando en el ambiente, pelusa, fibras y partculas voladoras " Polvo trasladado por el viento Cada de lquidos y salpicaduras de luz Lluvia (prueba evaluada segn 6.4.2.1) Lluvia (prueba evaluada segn 6.4.2.2) Nieve y granizo Lavado con manguera y agua de salpicaduras Sumersin prolongada espordica Filtracin de aceite y refrigerante Roco y salpicadura de aceite o refrigerante Agentes corrosivos

Para uso en interiores 1 12 13

Interiores o exteriores 4 4X 6P

% % %

% % % % %

% % % % %

% % %

% % % % % % % % %

% % % % % % % % % %

% % % % % % % % % %

% % % % % % % % % % %

% %

% % % % % % %

! "

Vea la pgina 1-13 para obtener una descripcin resumida de los requisitos de prueba de los envolventes NEMA. Consulte la Publicacin de Estndares NEMA No. 250 para obtener informacin completa sobre las especificaciones de prueba. Materiales no peligrosos, que no son de Clase III inflamable o combustible.

Envolventes para lugares peligrosos (Divisin 1 2) !


Para un grado de proteccin contra atmsferas que tpicamente contienen: # Acetileno Hidrgeno, gas manufacturado Prueba hidrosttica ter dietlico, etileno, sulfuro de hidrgeno Acetona, Butano, Gasolina, Propano, Tolueno Polvos de metal y otros polvos combustibles con resistividad de menos de 105 -cm. Negro de humo, polvos de carbn de lea, carbn o coque con resistividad entre 102108 -cm Polvos combustibles con resistividad de 105 -cm o ms Fibras, partculas voladoras Prueba de temperatura I I II Prueba de penetracin de polvo II Prueba de temperatura con manta de polvo II $ III % % % % % % % Diseado para cumplir con las pruebas " Prueba de explosin Clase (Cdigo Elctrico Nacional) I I 7, Clase I Grupo: A % % % B C D 9, Clase II Grupo: E F G

! Para interiores solamente, a menos que est catalogado con nmero(s) de envolventes Tipo NEMA adicionales apropiados para uso en exteriores, segn lo indicado en la tabla en esta
pgina. Algunos dispositivos de control (si se listan en el catlogo) son apropiados para uso en lugares peligrosos Divisin 2, en envolventes para lugares no peligrosos. Para obtener explicaciones de CLASES, DIVISIONES y GRUPOS, consulte el Cdigo Elctrico Nacional (National Electrical Code). Nota: Las clasificaciones de lugares peligrosos estn sujetas a aprobacin de la autoridad con jurisdiccin. Consulte el Cdigo Elctrico Nacional. " Vea la descripcin resumida de los requisitos de pruebas en la pgina 1-13. Para obtener informacin completa sobre los requisitos, consulte el Estndar 698 de UL, cuyo cumplimiento es requerido por los estndares para envolventes NEMA. # Para obtener una lista de materiales adicionales e informacin acerca de las propiedades de lquidos, gases y slidos, consulte la publicacin NFPA 497M-1991, Classification of Gases, Vapours, and Dusts for Electrical Equipment in Hazardous (Classified) Locations. $ UL 698 no incluye los requisitos de pruebas para Clase III. Los productos que cumplen con los requisitos de Clase II Grupo G, son aceptables para Clase III.

Generalidades-12

Generalidades

Envolventes NEMA
Criterios de seleccin Descripcin resumida de los requisitos de pruebas para envolventes NEMA
6.2 Prueba de entrada de varilla No debe entrar una varilla con un dimetro de 3.18 mm (.125 pulg.) al envolvente excepto en los lugares donde la pieza energizada ms cercana est a ms de 102 mm (4 pulg.) de una abertura dicha abertura no permitir que entre una varilla con un dimetro de 13 mm (0.5 pulg.). 6.3 Prueba de goteo Se hace gotear agua sobre el envolvente durante 30 minutos de un recipiente colocado en la parte superior con aberturas espaciadas de manera uniforme cada 12,900 mm 2 (20 pulg. cuadradas) del rea del recipiente, y cada abertura con un rgimen de goteo de 20 gotas por minuto. Evaluacin 6.3.2.2: No debe ingresar agua al envolvente. 6.4 Prueba de lluvia Toda la parte superior y todos los lados expuestos se rocan con agua a una presin de 0.35 kg/cm 2 (5 psi) a travs de boquillas por una hora, a un rgimen que hace que el agua suba 457 mm (18 pulg.) en un recipiente de lados rectos debajo del envolvente. Evaluacin 6.4.2.1: No debe ingresar agua a los mecanismos, aislamiento ni piezas energizadas. Evaluacin 6.4.2.2: No debe ingresar agua al envolvente. 6.5.1.1 (2) Prueba de polvo en exteriores (mtodo alternativo) El envolvente y los mecanismos externos se someten a un flujo de agua de 170.5 litros (45 galones) por minuto a travs de una boquilla de 25.4 mm (1 pulg.) de dimetro, dirigido a todas las juntas desde todos los ngulos a una distancia de 3 a 3.7 metros (10 a 12 pies). El tiempo de prueba es 48 segundos por la longitud de la prueba (altura + ancho + profundidad del envolvente en pies) o un mnimo de 5 minutos. No ingresar agua al envolvente. 6.5.1.2 (2) Prueba de polvo en interiores (mtodo alternativo) Se roca agua atomizada a una presin de 2.11 kg/cm2 (30 psi) en todas las uniones, juntas y mecanismos de operacin externos desde una distancia de 305 a 381 mm (12 a 15 pulg.), a un rgimen de 11 litros (3 galones) por hora. Se aplica no menos de 142 gm (5 oz) de agua por pie lineal de longitud de la prueba (altura + longitud + profundidad del envolvente). No ingresar agua al envolvente. 6.6 Prueba de congelamiento externo Se roca agua sobre el envolvente por una hora en una habitacin fra +2 C (36 F); luego la temperatura ambiente se baja a aproximadamente 5 C (23 F) y se controla el rociado de agua de manera que se forme hielo a un rgimen de 6.4 mm (.25 pulg.) por hora hasta que se haya formado hielo de 19 mm (.75 pulg.) de espesor en la superficie superior de una barra de metal de prueba de 25.4 mm (1 pulg.) de dimetro, luego se mantiene la temperatura a 5C (23 F) por 3 horas. Evaluacin 6.6.2.2: El equipo no sufrir dao despus que el hielo se haya derretido (los mecanismos externos no requieren estar operativos mientras estn cargados de hielo). 6.7 Prueba de lavado con manguera El envolvente y los mecanismos externos se someten a un flujo de agua de 246 litros (65 galones) por minuto a travs de una boquilla de 25.4 mm (1 pulg.) de dimetro, dirigido a todas las juntas desde todos los ngulos a una distancia de 3 a 3.7 metros (10 a 12 pies). El tiempo de prueba es 48 segundos por la longitud de la prueba [altura + ancho + profundidad] del envolvente en metros (pies) o un mnimo de 5 segundos. No ingresar agua al envolvente. 6.8 Prueba de resistencia al moho (aplicable slo a envolventes que incorporan partes ferrosas externas) El envolvente se somete a rociado de sal (nebulizacin) por 24 horas, usando agua con cinco partes por peso de sal (NaCI), a 35 C (95 F), luego se enjuaga y se seca. No presentar moho excepto donde la proteccin no es posible (por ej. superficies de contacto maquinadas, superficies de deslizamiento de bisagras, ejes, etc.). 6.9 Proteccin contra la corrosin Los envolventes de plancha de acero son evaluados segn especificaciones de Underwriters Laboratories (UL) 50, Parte 13 (prueba para proteccin equivalente como G-90, plancha de acero con revestimiento de zinc comercial). Otros materiales segn Underwriters Laboratories (UL) 508, 6.9 6.10. 6.11 (2) Prueba de presin de aire (mtodo alternativo) El envolvente se sumerge en agua a una presin igual a una profundidad de 2 metros (6 pies) de agua, durante 24 horas. No ingresar agua al envolvente. 6.12 Prueba de exclusin de aceite El envolvente se somete a un flujo de lquido de prueba durante 30 minutos a travs de una boquilla de 9.5 mm (0.375 pulg.) de dimetro a un rgimen de 7.57 litros (2 galones) por minuto. Se dirige agua con un agente humectante al 0.1 % desde todos los ngulos y desde una distancia de 305 a 457 mm (12 a 18 pulg.) mientras que cualquier dispositivo de operacin externa funciona a 30 operaciones por minuto. No ingresar el lquido de prueba al envolvente. Descripcin resumida de los requisitos de prueba del Estndar 698 de UL Prueba contra explosiones Durante una serie de pruebas en las que se encienden mezclas de gas y aire del gas especfico, en una gama de concentraciones explosivas dentro del envolvente, ste evitar el paso de llamas y chispas capaces de encender una mezcla de gas y aire similar en el rea circundante al envolvente. Adems, no sufrirn dao ni los mecanismos elctricos dentro del envolvente, ni el envolvente. Prueba hidrosttica El envolvente resistir durante 1 minuto una prueba hidrosttica basada en la mxima presin de explosin interna desarrollada durante las pruebas de explosin, de la siguiente manera: metal forjado, cuatro veces la presin de explosin sin ruptura o deformacin permanente; acero fabricado, dos veces la presin de explosin sin deformacin permanente y tres veces la presin de explosin sin ruptura. Excepcin: Las pruebas hidrostticas pueden omitirse si los clculos muestran un factor de seguridad de 5:1 para metal forjado y 4:1 para acero fabricado. Prueba de temperatura El dispositivo en el envolvente es sometido a una prueba de temperatura para determinar la mxima temperatura en cualquier punto de la superficie externa. La temperatura deber marcarse con un cdigo de temperatura basado en el resultado, slo si la temperatura excede de +100 C (+212 F). Prueba de penetracin de polvo El dispositivo funciona a la carga plena nominal hasta que se obtienen las temperaturas de equilibrio, luego se deja enfriar a la temperatura ambiente, a travs de seis ciclos de calentamiento y enfriamiento durante un perodo de por lo menos 30 horas, mientras est continuamente expuesto al aire que circula, con propiedades especificadas en una cmara de prueba. No ingresar polvo al envolvente. Prueba de temperatura con manta de polvo Esta prueba se realiza como se describe en la prueba de penetracin de polvo, excepto que se colocan boquillas de recirculacin de polvo de manera que el polvo no sea soplado directamente sobre el dispositivo bajo prueba. El dispositivo funciona a la carga plena nominal (y en condiciones anormales para equipo sometido a sobrecarga) hasta que se obtienen las temperaturas de equilibrio. El polvo en contacto con el envolvente no se encender ni se descolorar debido al calor, y las temperaturas exteriores basadas en una temperatura ambiente de +40 C (+104 F) no excedern de:
Grupo E F G Operacin normal +200 C (+392 F) +150 C (+302 F) +120 C (+248 F) Operacin anormal +200 C (+392 F) +200 C (+392 F) +165 C (+329 F)

Generalidades-13

Generalidades

Notas

Generalidades-14

Principios de seguridad

Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-3 Directivas y legislacin de la Unin Europea. . . . . . . . 1-4 Estndares Europeos armonizados de la UE . . . . . . . . 1-9 Seleccin de medidas de proteccin . . . . . . . . . . . . . 1-13 Estrategia de seguridad . . . . . . . . . . . . . . . . . . . . . . . . 1-16 Sistemas de control con fines de seguridad. . . . . . . . 1-22 Otras consideraciones y ejemplos . . . . . . . . . . . . . . . 1-25 Funciones de restablecimiento . . . . . . . . . . . . . . . . . . 1-28 Guardas de control . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-28 Cortinas de luz de seguridad . . . . . . . . . . . . . . . . . . . 1-39 Reglamentos de seguridad de EE.UU. . . . . . . . . . . . 1-45 Organizaciones. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-49 Reglamentos de seguridad australianos. . . . . . . . . . . 1-49

Principios de seguridad

Informacin importante para el usuario

Debido a la variedad de usos de los productos descritos en esta publicacin, las personas responsables de la aplicacin y uso de este equipo de control deben asegurarse de que se hayan seguido todos los pasos necesarios para que cada aplicacin y uso cumpla con todos los requisitos de rendimiento y seguridad, incluyendo leyes, reglamentos, cdigos y normas aplicables. Los ejemplos de ilustraciones, grficos, programas y esquemas mostrados en este catlogo tienen la nica intencin de ilustrar el texto. Debido a las muchas variables y requisitos asociados con cualquier instalacin particular, Rockwell Automation no puede asumir responsabilidad u obligacin, incluyendo responsabilidad de propiedad intelectual, por el uso real basado en los ejemplos mostrados en esta publicacin

Informacin de seguridad relacionada

Usted es responsable de la seguridad de todo el sistema de control instalado y de que se cumplan todas las leyes, cdigos y requisitos de seguridad pertinentes. ATENCIN: Como instalador de este sistema de control, usted debe estar bien informado de otras normas vigentes relacionadas a recomendaciones de seguridad respecto a: Construccin de mquinas Aspectos elctricos generales Seguridad de mquinas Guardas de punto de operacin, cortinas de luz de seguridad, guardas mecnicas, controles de dos manos y rels de monitoreo de seguridad

Adems de las leyes y cdigos locales, usted es responsable del cumplimiento de las recomendaciones de seguridad detalladas en todos los cdigos y normas vigentes, entre ellos: Cdigo Elctrico Nacional Reglamentos de OSHA Normas de ANSI NFPA CSA

Trminos y condiciones

Para obtener informacin sobre los Trminos y condiciones de venta, por favor consulte la pgina 1-4 de este catlogo.

IMPORTANTE

Rockwell Automation se reserva el derecho de hacer revisiones al material contenido en este catlogo y especficamente niega toda responsabilidad por daos incidentales o consecuentes que resulten del suministro, rendimiento o uso de este material.

1-2

Principios de seguridad

Descripcin general
UNA GUA RPIDA DEL CONTENIDO CON RESPECTO A LEGISLACIN SOBRE SEGURIDAD DE MAQUINARIA EN LA UNIN EUROPEA LA DIRECTIVA DE MAQUINARIAS DIRECTIVA DE USO DE EQUIPO DE TRABAJO

La maquinaria nueva suministrada dentro de la Comunidad Europea debe satisfacer los requisitos esenciales de salud y seguridad. Vea: Directivas y legislacin y estndares europeos armonizados.

Los empleadores deben asegurarse de que todo el equipo de trabajo proporcionado sea idneo y seguro. Vea: Directivas y legislacin y estndares europeos armonizados.

EVALUACIN DE RIESGOS
Determine las caractersticas de operacin y lmites de la mquina. Identifique los peligros. Calcule el riesgo. Vea: Estrategia de seguridad.

REDUCCIN DEL RIESGO


Tome las medidas requeridas para eliminar las fuentes de peligro o reducir el riesgo a un nivel aceptable. Vea: Seleccin de medidas de proteccin. Sistemas de control con fines de seguridad. Otras consideraciones y ejemplos. Dispositivos de enclavamiento.

ARCHIVO TCNICO
Asegure la disponibilidad de la informacin requerida para verificar la conformidad de la mquina. Vea: Directivas y legislacin

Los empleadores deben asegurarse de que todo el equipo de trabajo sea seguro, que funcione correctamente y que se mantenga en buen estado.

ENTIDADES APROBADAS
Cuando sea necesario (mquinas Anexo IV) tome las medidas apropiadas con una entidad aprobada. Vea: Directivas y legislacin

Los empleadores deben asegurarse de que est disponible la capacitacin e instruccin adecuada adems de informacin de salud y seguridad apropiada.

DECLARACIN
Prepare una declaracin de conformidad o una declaracin de incorporacin. Cuando sea apropiado, coloque la marca CE. Vea: Directivas y legislacin

Los fabricantes y empleadores pueden necesitar satisfacer otras directivas de la Comunidad Europea adems de las indicadas en este libro. La aplicacin de la marca CE indica cumplimiento con todas las directivas pertinentes de la Comunidad Europea.

1-3

Principios de seguridad

Directivas y legislacin de la Unin Europea


Esta seccin se proporciona como gua para las personas encargadas de la seguridad de las mquinas, especialmente sistemas protectores de guarda y enclavamiento. Ha sido concebida para diseadores y usuarios de equipo industrial. A fin de promover el concepto de un mercado abierto dentro de la CE y EFTA (rea Libre de Comercio Europeo), todos los pases miembros estn obligados a promulgar legislacin que defina los requisitos de seguridad esenciales para las maquinarias y su uso. Las maquinarias que no cumplan estos requisitos no podrn venderse en los pases de la CE y EFTA. seguridad esenciales contenidos en el Anexo I de la Directiva, deber realizarse una evaluacin de conformidad y deber otorgarse una Declaracin de conformidad. La Directiva entr en vigencia para maquinarias el 1 de enero de 1995 y para componentes de seguridad el 1 de enero de 1997. Se ofreci un perodo de transicin de dos aos en el cual podan utilizarse los reglamentos nacionales existentes o poda seguirse el rgimen de la nueva Directiva. Es responsabilidad del fabricante, importador o suministrador final del equipo asegurarse de que el equipo suministrado cumpla con la Directiva.

Directivas y legislacin de la Unin Europea


Hay dos directivas europeas de relevancia directa para la seguridad de maquinarias y equipos industriales. stas son: 1. La Directiva de maquinarias 2. La Directiva de uso de equipo de trabajo por trabajadores en el trabajo Estas dos directivas estn directamente relacionadas con los Requisitos de Salud y Seguridad Esenciales (EHSR) de la directiva de maquinarias y pueden usarse para confirmar la seguridad del equipo indicada en la Directiva de uso de equipo de trabajo. Esta seccin trata aspectos de ambas directivas y se recomienda enfticamente que las personas relacionadas con el diseo, suministro, compra o uso de equipo industrial en los pases de la CE y EFTA se familiaricen con sus requisitos. La mayora de suministradores y usuarios de maquinaria simplemente no podrn trabajar en la CE a menos que cumplan con estas directivas. Hay otras directivas europeas, ya sea vigentes o en preparacin, pertinentes a la seguridad industrial. La mayora son especializadas en su aplicacin y por lo tanto no se incluyen en esta seccin, pero es importante anotar que, cuando sea pertinente, sus requisitos deben cumplirse.Algunos ejemplos son: La Directiva de bajo voltajeLa Directiva EMCLa Directiva sobre prevencin de explosiones debido a atmsferas peligrosas.

Requisitos de salud y seguridad esenciales


(denominados tambin EHSR)

Figura 2
La Directiva proporciona una lista de EHSR que debe cumplir la maquinaria cuando son pertinentes. El propsito de esta lista es asegurar que la maquinaria es segura y que est diseada y construida de manera que pueda usarse, ajustarse y mantenerse en todas las fases de su vida til sin poner en riesgo a los operadores. La directiva tambin proporciona una jerarqua de medidas para eliminar los riesgos: (1) Diseo de seguridad inherenteEn la medida de lo posible, el diseo mismo evitar cualquier riesgo. En los casos en que esto no sea posible, debern usarse (2) dispositivos de proteccin adicionales, por ej., guardas con puntos de acceso enclavados, barreras no materiales tales como cortinas de luz, tapetes de deteccin, etc. Cualquier otro riesgo que no pueda eliminarse mediante los mtodos anteriores deber eliminarse mediante (3) equipo de proteccin personal y/o capacitacin. El suministrador de la mquina deber especificar lo apropiado. Deber usarse materiales idneos para construccin y operacin. Deber proporcionarse iluminacin e instalaciones de manejo adecuadas. Los controles y los sistemas de control deben ser seguros y confiables. Las mquinas no deben arrancar inesperadamente y deben tener uno o ms dispositivos de paro de emergencia acoplados. Se deber dar consideracin a instalaciones complejas donde los procesos corriente arriba o corriente abajo puedan afectar la seguridad de una mquina. El fallo de una fuente de alimentacin elctrica o circuito de control no deber causar una situacin peligrosa. Las mquinas deben ser estables y capaces de soportar tensiones previsibles. No deben tener bordes ni superficies expuestas que puedan causar lesiones al personal.

La Directiva de maquinarias (vea la Figura 9)


89/392/EEC, modificada por 91/368/EEC y 93/44/EEC ha sido consolidada en una nueva directiva 98/37/EC. Esta Directiva abarca el suministro de nueva maquinaria y otros equipos, inclusive componentes de seguridad. En la mayora de casos constituye un delito suministrar

Figura 1
maquinaria, a menos que cumpla con la Directiva. Esto significa que la maquinaria deber satisfacer una amplia gama de requisitos de

1-4

Principios de seguridad

Directivas y legislacin de la Unin Europea


Debern usarse guardas o dispositivos de proteccin para evitar riesgos tales como los causados por piezas movibles. Estos deben ser de construccin robusta y difciles de omitir. Las guardas fijas deben ser slo del tipo que requiere montaje y desmontaje mediante el uso de herramientas. Las guardas mviles deben estar enclavadas. Las guardas ajustables deben tener la capacidad de ser ajustadas de inmediato, sin el uso de herramientas. Debern evitarse los peligros elctricos y de suministro de energa.Deber haber riesgo mnimo de lesin causada por temperatura, explosin, ruido, vibracin, polvo, gases o radiacin. Debern tomarse las provisiones apropiadas al realizar el mantenimiento y servicio. Deben proporcionarse indicaciones y dispositivos de advertencia suficientes. La maquinaria debe proporcionarse con instrucciones para realizar la instalacin, uso, ajuste, etc. con toda seguridad. Una lista de: 1. Los EHSR pertinentes al equipo. 2. Los Estndares Europeos Armonizados aplicables. 3. Otros estndares aplicables. 4. Especificaciones tcnicas de diseo. Una descripcin de los mtodos adoptados para eliminar los riesgos que presenta la maquinaria. Si lo desea, cualquier informe tcnico o certificado obtenido de un organismo (entidad de pruebas) o laboratorio aprobado. Si se declara la conformidad con un Estndar Europeo Armonizado, cualquier informe tcnico que proporcione los resultados de las pruebas correspondientes. Una copia de las instrucciones de la maquinaria. B En el caso de fabricacin en serie, detalles de las medidas internas (sistemas de calidad, por ejemplo) para asegurar que toda la maquinaria producida est en conformidad: El fabricante debe realizar la investigacin o pruebas necesarias de los componentes, conexiones o la maquinaria completa para determinar si por su diseo y construccin puede instalarse y ponerse en servicio con toda seguridad. El archivo tcnico no necesita existir como archivo nico permanente, pero debe ser posible ensamblarlo para que est disponible en un plazo razonable. Deber estar disponible durante diez aos despus de la produccin de la ltima unidad. El hecho de que no est disponible como respuesta a una peticin justificada de una autoridad de aplicacin de leyes puede ser motivo para dudar la conformidad. El archivo tcnico no necesita incluir planes detallados ni otra informacin especfica respecto a los subensamblajes usados para la fabricacin de la maquinaria, a menos que estos sean esenciales para verificar la conformidad con los EHSR.

Evaluacin de conformidad
TEST RESULTS ---------------------------STANDARDS ------------------------------

Figura 3
El diseador u otra persona responsable deber mostrar pruebas que verifiquen la conformidad con los EHSR. Este archivo debe incluir toda la informacin pertinente tales como resultados de pruebas, dibujos, especificaciones, etc., tal como se muestra a continuacin. Cuando el equipo est diseado en concordancia con los estndares europeos armonizados, esto simplifica la tarea de mostrar conformidad. Estos estndares no son un requisito legal, sin embargo, su uso se recomienda enfticamente ya que probar la conformidad por mtodos alternativos puede ser extremadamente complejo.La estructura de estos estndares, los cuales son producidos por CEN (el Comit Europeo de Estandarizacin) y CENELEC (el Comit Europeo de Estandarizacin Electrotcnica), complementa la Directiva de maquinarias. Juntos CEN y CENELEC forman el Joint Institute for Standardization In Europe (Instituto Conjunto de Estandarizacin en Europa). Deber realizarse una evaluacin de riesgos detallada y documentada para asegurar que se han eliminado todos los posibles riesgos de la mquina.

Figura 4 Evaluacin de conformidad para mquinas listadas en el Anexo IV


Algunos tipos de equipo estn sujetos a medidas especiales. Estos equipos aparecen listados en el Anexo IV de la Directiva e incluyen mquinas peligrosas tales como mquinas para trabajo de madera, prensas, mquinas de moldeado por inyeccin, equipo subterrneo, mecanismos de levante para mantenimiento de vehculos, etc. El Anexo IV tambin incluye ciertos componentes de seguridad tales como cortinas de luz y unidades de control de dos manos.

Archivo tcnico
La persona responsable de la declaracin de conformidad debe asegurarse de que la siguiente documentacin estar disponible en las instalaciones para fines de inspeccin. A Un archivo tcnico que incluya: Esquemas generales del equipo, incluyendo dibujos del circuito de control. Esquemas detallados, notas de clculo, etc., requeridos para verificar la conformidad de la maquinaria con los EHSR.

1-5

Principios de seguridad

Directivas y legislacin de la Unin Europea


Examen de tipo CE
Para el examen tipo CE, la entidad aprobada requerir un archivo tcnico y acceso a la mquina a ser examinada. Verificarn que la mquina est fabricada en conformidad con su archivo tcnico y que satisface los EHSR aplicables. Si pasa el examen, se emitir un certificado de examen de tipo CE. Una entidad que se rehuse a emitir un certificado deber informar los casos a las otras entidades aprobadas.

Te

a nic ch le Fi

Figura 5
Para las mquinas listadas en el Anexo IV que cumplen con los Estndares Europeos Armonizados, se puede seleccionar entre tres procedimientos: 1. Enviar el archivo tcnico a una entidad aprobada que confirmar recepcin del archivo y se quedar con l. Nota: NOTA: Con esta opcin no hay evaluacin del archivo. Puede
usarse como referencia posteriormente en el caso de que ocurra un problema o un reclamo de falta de cumplimiento.

2. Enviar el archivo tcnico a una entidad aprobada que verificar que se hayan aplicado correctamente los Estndares Armonizados y emitir un certificado de suficiencia para el archivo. 3. Remitir una maquinaria de muestra a una entidad aprobada (agencia de pruebas) para examen de tipo CE. Si pasa el examen, se otorgar un certificado de examen de tipo CE para la mquina. En el caso de mquinas listadas en el Anexo IV que no cumplen con un estndar o para las cuales no existe un Estndar Europeo Armonizado, deber remitirse una muestra de la maquinaria a una entidad aprobada (institucin de pruebas) para el examen de tipo CE.

Entidades aprobadas
Se est constituyendo una red de entidades aprobadas que se comunicarn entre s y trabajarn siguiendo criterios comunes en todos los pases de la CE y EFTA. Puede obtenerse detalles acerca de las entidades y laboratorios de prueba con estado de aprobacin a travs del United Kingdom Accreditation Service, Audley House, 13 Palace Street, Londres SW1E 5HS.

Figura 6 1-6

T R ES T -- ESU T ------ ----------- L SS --------- RD TAND S A

Figura 7 Procedimiento de la Declaracin de Conformidad


La persona responsable emitir una Declaracin de Conformidad de la CE y colocar la marca CE (vea la Figura 7) sobre todas las mquinas suministradas. Las mquinas tambin debern suministrarse con la Declaracin de Conformidad. Nota: NOTA: Los componentes de seguridad deben tener una
Declaracin de Conformidad pero no la marca CE con respecto a la Directiva de maquinarias (aunque pueden tener la marca CE con respecto a las Directivas EMC o de bajo voltaje).

La marca CE representa una autocertificacin, pero es un delito colocar la marca CE a menos que la mquina cumpla con los EHSR y tenga todas medidas de seguridad correspondientes. Es tambin un delito colocar una marca en la maquinaria que pueda confundirse con la marca CE. Nota: NOTA: El uso de la marca CE tambin indica cumplimiento con
otras directivas europeas requeridas para la maquinaria.

Declaracin de conformidad EC
El certificado que constituye la declaracin de conformidad debe incluir detalles del fabricante y la persona responsable, detalles de la mquina (marca, nmero de serie, etc.), detalles de la entidad aprobada, (si corresponde), detalles de los estndares usados y los detalles de la persona autorizada a firmar el certificado de declaracin. Deber indicar conformidad de estado con los EHSR o con el ejemplo de la maquinaria sometida al examen de tipo CE (vea la Figura 8).

Principios de seguridad

Directivas y legislacin de la Unin Europea


Maykit Wright Ltd.

Declaration of Conformity
In respect of the following Directives: European Machinery Directive (89/392 EEC as amended by 91/368 EEC and 93/44 EEC). Any other Directives relevant to the machine (e.g., the EMC Directive) should also be included. Company: Maykit Wright Ltd. Main Street Anytown Industrial Estate Anytown, England AB1 2DC Tel: 00034 000890. Fax: 00034 000567 Machine: Meat Packaging Machine. Type: Vacustarwrap 7D Serial Number: 00516 Conforming to standards: All relevant Harmonized European Standards used and, where appropriate, any national standards and specifications. If the machine is covered by Annex IV (Schedule 4) it would be necessary at this point to include either: The name and address of the Approved Body and the number of the Type Examination Certificate. or The name and address of the Approved Body which has drawn up a Certificate of Adequacy for the technical file. or The name and address of the Approved Body to which the technical file has been forwarded. This is to declare that the above machine conforms with the relevant Essential Health and Safety Requirements of the European Machinery Directive (89/392 EEC as amended by 91/368 EEC and 93/44 EEC). Signed for Maykit Wright Ltd.

G.V. Wright
G.V. Wright Managing Director Issued 18th January 1996

Figura 8 Declaracin de incorporacin EC


Cuando el equipo se suministra para ensamblaje con otros componentes para formar una mquina completa posteriormente, la persona responsable debe emitir una DECLARACIN DE INCORPORACIN con ste (en lugar de una declaracin de conformidad). La marca CE NO debe usarse. La declaracin debe indicar que el equipo no debe ponerse en servicio hasta que se haya declarado la conformidad de la mquina en la cual ha sido incorporado (vea la Figura 9). Esta opcin no est disponible para equipos que pueden funcionar independientemente o que modifican la funcin de una mquina.

El uso de equipo de trabajo por los trabajadores en el trabajo (Directiva 89/655/EEC)


Mientras que la Directiva de Maquinarias est dirigida a los suministradores, esta Directiva est dirigida a los usuarios de maquinarias. Abarca todos los sectores industriales e imponen deberes generales a los empleadores junto con requisitos mnimos para la seguridad del equipo de trabajo. Todos los pases de Unin Europea estn promulgando sus propias formas de legislacin para implementar esta Directiva.

1-7

Principios de seguridad

Directivas y legislacin de la Unin Europea Todas las maquinarias deben satisfacer los requisitos de salud y seguridad esenciales
La mayora de maquinarias y componentes de seguridad (excepto los listados en el Anexo IV) Mquinas y componentes de seguridad listados en el Anexo IV

Deben cumplir Deben cumplir con los directamente estndares con los EHSR europeos armonizados O BIEN pertinentes

Si CUMPLEN con los estndares europeos armonizados pertinentes

Si NO CUMPLEN con los estndares europeos armonizados pertinentes

Enviar el ARCHIVO TCNICO a una entidad aprobada que confirmar O BIEN recepcin.

Enviar el equipo a Enviar el una entidad ARCHIVO aprobada para TCNICO a una EXAMEN TIPO CE entidad aprobada que lo examinar y emitir un O BIEN CERTIFICADO DE SUFICIENCIA para el archivo.

Usted debe poder ensamblar el ARCHIVO TCNICO a pedido

ste DEBE remitirse a una entidad aprobada para EXAMEN TIPO CE

PARA MAQUINARIAUsted debe emitir una Declaracin de Conformidad y colocar la marca CE o emitir una Declaracin de Incorporacin. PARA COMPONENTES DE SEGURIDADUsted debe emitir una Declaracin de Conformidad.

Figura 9: Descripcin general de procedimientos para la Directiva de Maquinarias


En el Reino Unido, sta ha sido implementada en la forma de una recoleccin de reglamentos enumerados titulada The Provision and Use of Work Equipment Regulations 1992 (Provisin y uso de reglamentos para equipos de trabajo de 1992) (generalmente abreviada como P.U.W.E.R.). La forma de implementacin puede variar de un pas a otro, pero el efecto de la Directiva es el mismo (vea la Figura 11).

La Directiva se implement el 1 de enero de 1993 y todas las nuevas mquinas proporcionadas para uso a partir de esa fecha deben cumplir con todos las regulaciones. Para mquinas existentes en uso antes de esta fecha, deben cumplirse las regulaciones 1 a 10, pero las regulaciones 11 a 24 no se implementarn totalmente hasta el 1 de enero de 1997.

1-8

Principios de seguridad

Estndares Europeos armonizados de la UE


Regulaciones 1 a 10 Estas regulaciones proporcionan detalles de cules tipos de equipo y lugares de trabajo estn cubiertos por la Directiva. Tambin imponen deberes generales a los empleados, tales como instituir sistemas seguros de trabajo y proporcionar equipos idneos y seguros los cuales deben recibir el mantenimiento adecuado. Los operadores de las mquinas deben recibir informacin y capacitacin adecuadas para que puedan usar la mquina con toda seguridad. La nueva maquinaria (y la maquinaria de segunda mano proveniente de pases fuera de la Comunidad Europea o EFTA) suministradas despus del 1 de enero de 1993, deben satisfacer las directivas pertinentes, por ej., la Directiva de Maquinarias (sujeto a arreglos de transicin). Los equipos de segunda mano provenientes de pases de la Comunidad Europea o EFTA que se suministraron por primera vez en el lugar de trabajo deben satisfacer inmediatamente las regulaciones 11 a 24. el equipo cumple con las directivas pertinentes, por ej., la Directiva de maquinarias, cumplir automticamente con los requisitos correspondientes de las regulaciones 11 a 24, ya que stas son de naturaleza similar a los EHSR de dicha directiva. De particular inters es la Regulacin 11, la cual proporciona una jerarqua de las medidas de proteccin. stas son: A. Guardas de aislamiento fijas. B. Otras guardas o dispositivos de proteccin. C. Aparatos de proteccin (guas, sujetadores, varillas de empuje, etc.) D. La provisin de informacin, instrucciones, supervisin y capacitacin. Estas medidas deben aplicarse desde la primera (a) hasta donde sea prctico, y generalmente se requerir una combinacin de dos o ms medidas (vea la Figura 11).

Estndares Europeos armonizados de la UE


Estos estndares son comunes a todos los pases de la Comunidad Europea y EFTA, y son producidos por las agencias de estandarizacin europea CEN y CENELEC. Su uso es voluntario, pero el diseo y la fabricacin de equipos conforme a sus especificaciones es la manera ms directa de demostrar cumplimiento con los EHSR. Al momento de la publicacin de esta seccin, algunos de los estndares todava no estn completos, pero a medida que estn disponibles, sus ttulos sern publicados en el Official Journal (Diario Oficial) de las Comunidades Europeas. Tambin se proporcionarn detalles en publicaciones tales como BSI News. Tendrn el prefijo comn EN, y en el Reino Unido tendrn el prefijo BS EN. Una vez que estos hayan sido publicados, se eliminarn los estndares nacionales existentes que tienen el mismo alcance. Estos estn divididos en 3 grupos: Estndares A, B y C. A. ESTNDARES: Abarcan aspectos aplicables a todos los tipos de mquinas. B. ESTNDARES: Subdivididos en 2 grupos. B1 ESTNDARES: Cubren aspectos especficos de seguridad y ergonoma de la maquinaria. B2 ESTNDARES: Cubren componentes y dispositivos de seguridad. C. ESTNDARES: Cubren tipos o grupos especficos de mquinas. Es importante notar que cumplir con un Estndar C proporciona la suposicin automtica de conformidad con los EHSR. En ausencia de un Estndar C adecuado, pueden usarse los Estndares A y B como prueba parcial o total de conformidad con los EHSR, indicando el cumplimiento con las secciones pertinentes. Puede usarse el sistema solar (vea la Figura 12) como modelo de la relacin de la directiva de maquinarias con los estndares europeos. Los planetas representan los estndares, los cuales giran alrededor del sol, el cual representa la directiva de maquinarias. Las rbitas interiores son los estndares A y B. Las rbitas exteriores representan los estndares C.

Figura 10
Nota: NOTA: La maquinaria existente o de segunda mano que sea
significativamente reacondicionada o modificada se clasificar como equipo nuevo, de manera que el trabajo que se realice en la misma debe asegurar el cumplimiento con la Directiva de Maquinarias (aunque sea para el propio uso de la compaa).

La Regulacin 5 Idoneidad del equipo de trabajo es la base de la directiva y resalta la responsabilidad de los empleadores (segn las Regulaciones de Administracin de Salud y Seguridad en el Trabajo de 1992) de llevar a cabo un proceso adecuado de evaluacin de los riesgos. La Regulacin 6 Mantenimiento requiere que la maquinaria reciba el servicio de mantenimiento apropiado. Esto normalmente significa que debe haber un programa rutinario y planificado de mantenimiento preventivo. Se recomienda usar un registro y mantenerlo actualizado. Esto es especialmente importante en casos en los que el mantenimiento e inspeccin del equipo contribuyen a la seguridad e integridad continua de un dispositivo o sistema protector. Regulaciones 11 a 24 Estas regulaciones abarcan peligros especficos y configuraciones de proteccin en las mquinas. No se implementaron totalmente hasta el 1 de enero de 1997 para mquinas no modificadas existentes, en uso antes del 1 de enero de 1993. Se aplicaron inmediatamente a otros equipos. Sin embargo, si

1-9

Principios de seguridad

Estndares Europeos armonizados de la UE

Provisin y uso de regulaciones de equipos de trabajo PARA MQUINAS PROPORCIONADAS PARA USO EN SUS INSTALACIONES TODAS LAS MQUINAS DEBEN CUMPLIR CON LAS REG. 1-10 INMEDIATAMENTE

MQUINA INSTALADA ANTES DE 1/1/93 (y no modificada desde entonces)

MQUINA INSTALADA DESPUS DE 1/1/93

ES NUEVA?

ES DE SEGUNDA MANO, CONTRATADA O ALQUILADA?

TAMBIN DEBE CUMPLIR CON LAS REG. 11-24 A MS TARDAR EL 1/1/97

DEBE CUMPLIR CON LA DIRECTIVA DE MAQUINARIAS y por lo tanto, debe cumplir con las Reg. 11-24 de PUWER

TAMBIN DEBE CUMPLIR CON LAS REG. 11-24 DE PUWER INMEDIATAMENTE

Figura 11: Descripcin general de procedimientos para uso de la Directiva de Equipos de Trabajo, de acuerdo a lo promulgado en el Reino Unido por la Provisin A y el uso de regulaciones de equipos de trabajo
Se han concertado acuerdos con otras entidades de estandarizacin en todo el mundo para lograr la colaboracin entre CEN/ CENELEC y entidades tales como IEC e ISO. Eventualmente, esto deber resultar en la implementacin de estndares comunes en todo el mundo. Las siguientes pginas listan algunos de los estndares A y B pertinentes a esta seccin. Cuando tienen el prefijo EN, significa que son estndares publicados. Cuando tienen el prefijo prEN, significa que todava no estaban en la etapa final de publicacin al momento de la impresin de esta seccin.

1-10

Principios de seguridad

Estndares Europeos armonizados de la UE


Estndares de maquinarias
Directiva para maquinarias Termoprocesamiento Goma y plstico

EN1114

EN746

EN418

B2 Paro de emergencia

Calzado

EN954 EN931

B1 Control

EN1050 EN1760
Curtidura Riesgo B2 Tapetes/bordes

EN414
Directiva para Normas maquinarias

EN1037

EN972

B1 Puesta en marcha

EN1088
B2 Enclavamientos

A
EN292

EN999
B1 Velocidades

EN693
Prensas hidrulicas

B2 Dos manos

EN60204 B2 Equipo

C
Envasado

EN574 EN692

EN415

Prensas mecnicas

Figura 12 EN 292 (ISO 12100 pts 1 y 2): Seguridad de maquinaria


Conceptos bsicos, principios generales de diseo. Es un estndar A que describe todos los principios bsicos, incluyendo evaluacin de riesgos, guardas, dispositivos de enclavamiento, paros de emergencia, dispositivos de disparo, distancias de seguridad, etc. Hace referencia a otros estndares e incluye los requisitos de seguridad esenciales de la Directiva de maquinarias.

EN 294 (ISO 13852): Seguridad de maquinaria


Distancias de seguridad para evitar introducir las extremidades superiores en las zonas de peligro. Proporciona datos para calcular tiempos de apertura seguros, posicionamiento de guardas, etc.

EN 811 (ISO 13853): Seguridad de maquinaria


Distancias de seguridad para evitar introducir las extremidades inferiores en las zonas de peligro. Proporciona datos para calcular tiempos de apertura seguros, posicionamiento de guardas, etc.

EN 60204-1 (IEC 60204-1): Seguridad de maquinaria


Equipo elctrico de mquinasRequisitos generales del Pt 1. ste es un estndar muy importante que indica recomendaciones sobre aspectos relacionados a la seguridad del cableado y equipos elctricos en las mquinas.

EN 349 (ISO 13854): Seguridad de maquinaria


Distancias mnimas para evitar triturar partes del cuerpo humano. Proporciona datos para calcular espacios seguros entre piezas movibles, etc.

1-11

Principios de seguridad

Estndares Europeos armonizados de la UE


EN 1088 (ISO 14119): Seguridad de maquinaria
Dispositivos de enclavamiento asociados con las guardasPrincipios de diseo y seleccin. Proporciona principios de diseo y seleccin de los dispositivos de enclavamiento asociados con las guardas. Con el fin de verificar los interruptores mecnicos, se refiere a IEC 60947-5-1 Interruptores de bajo voltajePt 5: Dispositivos de circuitos de control y elementos de conmutacinSeccin 1: Dispositivos de circuitos de control electromecnico. Con el fin de verificar interruptores no mecnicos se refiere a IEC 60947-5-3Requisitos particulares para dispositivos de proximidad con medidas de prevencin de fallos o comportamiento definido ante condiciones de fallo. (Nmero y ttulo provisional solamente).

EN 418 (ISO 13850): Seguridad de maquinaria


Dispositivos de paro de emergencia, aspectos funcionalesPrincipios de diseo. Proporciona principios y requisitos de diseo.

ISO 11161 (actualmente en revisin por ISO y EN: Sistemas de automatizacin industrial
Seguridad de sistemas de fabricacin integrados Requisitos bsicos. Este estndar especifica los requisitos de seguridad cuando dos o ms mquinas estn interconectadas y son operadas por un controlador capaz de ser reprogramado para la fabricacin de piezas o ensamblajes discretos.

IEC/EN 61496-1: Seguridad de maquinaria


Equipo protector electrosensible, Pt 1: Requisitos generales y pruebas. (Versin EN no publicada).

EN 954-1 (ISO 13849-1): Seguridad de maquinaria


Piezas de sistemas de control relacionadas con la seguridadPt 1: Principios generales de diseo. Este estndar describe los requisitos para las piezas crticas de seguridad de los sistemas de control de mquinas y describe 5 categoras de rendimiento B, 1, 2, 3 y 4. No se sabe con certeza el nmero que tendr posteriormente. Sin embargo, independientemente de la forma en que se publique, es importante tener un conocimiento prctico de este documento ya que sus categoras se estn convirtiendo en el lenguaje comn aceptado para describir el desempeo de sistemas de control relacionados a la seguridad.

IEC 61496-2: Requisitos generales y pruebas.


Pt 2: Requisitos especficos para equipos que usan dispositivos protectores de optoelectrnica activa. La Parte 1 proporciona los requisitos y procedimientos de prueba para el control y monitoreo de aspectos para equipos protectores electrosensibles. Las partes subsiguientes tratan aspectos referentes al lado de deteccin del sistema. La Parte 2 proporciona requisitos particulares para las cortinas de luz de seguridad.

EN 1760-1: Seguridad de maquinaria


Dispositivos de seguridad sensibles a la presin Pt 1: Tapetes y pisos. Proporciona los requisitos y procedimientos de pruebas.

EN 1050 (ISO 14121): Seguridad de maquinaria


Principios de la evaluacin de riesgos. Describe los aspectos fundamentales de la evaluacin de riesgos durante la vida til de la maquinaria.Resume los mtodos de anlisis de riesgos y estimacin de riesgos.

EN 1760-2: Seguridad de maquinaria


Dispositivos de seguridad sensibles a la presin Pt 2: Bordes y barras. Proporciona los requisitos y procedimientos de pruebas.

EN 999 (ISO 13855): Seguridad de maquinaria


El posicionamiento de equipo protector con respecto a las velocidades de aproximacin de partes del cuerpo humano. Proporciona mtodos para que los diseadores calculen las distancias de seguridad mnimas desde un peligro para dispositivos de seguridad especficos, en especial para dispositivos electrosensibles (por ej., cortinas de luz), tapetes/pisos sensibles a la presin y controles de dos manos. Contiene un principio para el posicionamiento de dispositivos de seguridad basados en la velocidad de aproximacin y el tiempo de paro de la mquina que pueden ser extrapolados razonablemente para cubrir puertas de guardas enclavadas sin bloqueo de guarda.

EN 1037 (ISO 14118): Seguridad de maquinaria


Requisitos generales para el diseo y construccin de guardas. Proporciona definiciones, descripciones y requisitos de diseo de las guardas fijas y movibles.

EN 1038Seguridad de maquinaria
Aislamiento y disipacin de energaPrevencin de arranque inesperado. Define medidas referentes al aislamiento de mquinas de las fuentes de alimentacin elctrica y a la disipacin de energa almacenada para evitar un arranque inesperado de la mquina y permitir una intervencin con toda seguridad en las zonas peligrosas.

EN 574Seguridad de maquinaria
Dispositivos de control de dos manosAspectos funcionalesPrincipios de diseo. Proporciona requisitos y gua para el diseo y seleccin de dispositivos de control de dos manos, incluyendo cmo evitar la desactivacin y cmo evitar fallos.

1-12

Principios de seguridad

Seleccin de medidas de proteccin


Seleccin de medidas de proteccin
Cuando la evaluacin de riesgos muestra que una mquina o proceso tiene el riesgo de causar lesiones personales, la fuente de peligro debe eliminarse o contenerse. La manera de hacer esto depender del tipo de mquina y la fuente de peligro. En trminos bsicos, esto significa evitar cualquier acceso a las piezas pertinentes mientras estn en una condicin peligrosa. La mejor seleccin de una medida de proteccin es un dispositivo o sistema que proporcione la mxima proteccin con la mnima obstruccin de la operacin normal de la mquina. Es importante considerar todos los aspectos de la mquina, ya que la experiencia demuestra que es ms probable que un sistema difcil de usar sea retirado o pasado por alto. Para lograrlo, se puede elegir uno de los siguientes: 1. Evitar el acceso durante un movimiento peligroso o bien 2. Evitar el movimiento peligroso durante el acceso. Las siguientes pginas proporcionan una descripcin general breve de las caractersticas de los dispositivos ms comnmente usados. Algunos interruptores de enclavamiento tambin incorporan un dispositivo de enclavamiento que enclava la puerta de la guarda en posicin cerrada y no permite que se abra hasta que la mquina est en una condicin segura. En la mayora de aplicaciones, la combinacin de una guarda movible y un interruptor de enclavamiento con o sin bloqueo de la guarda es la solucin ms confiable y econmica.

Evitar el acceso
Guardas de aislamiento fijas. Si la fuente de peligro se encuentra en una parte de la maquinaria que no requiere acceso, debe tener una proteccin permanente con guardas de aislamiento fijas.

Figura 14
Controles de dos manos El uso de los controles de dos manos (llamados tambin controles dobles) es un mtodo comn de evitar el acceso mientras la mquina est en una condicin peligrosa. Dos botones de inicio deben activarse simultneamente para que la mquina funcione. Esto asegura que ambas manos del operador estn ocupadas en una posicin segura (por ej., en los controles) y por lo tanto no puedan estar en el rea peligrosa.

Figura 13
Guardas movibles con interruptores de enclavamiento Si se requiere acceso, debe haber una guarda movible (que pueda abrirse), la cual se enclava con el suministro de energa de la pieza de peligro de manera que asegure que cada vez que la puerta de la guarda no est cerrada, se desactivar la alimentacin elctrica de la pieza de peligro. Este mtodo requiere el uso de un interruptor de enclavamiento acoplado a la puerta de la guarda. El control de la fuente de energa del peligro es encaminado a travs de la seccin de conmutacin de la unidad. La fuente de energa es generalmente elctrica, pero podra ser tambin neumtica o hidrulica. Cuando se detecta movimiento (abertura) de la puerta de la guarda, el interruptor de enclavamiento asla el suministro de energa de la fuente de peligro ya sea directamente, o mediante un contactor de alimentacin elctrica (o vlvula).

Figura 15
Nota: Este tipo de medida slo protege al operador y no ofrece
proteccin a los dems trabajadores.

Un sistema de dos manos depende en gran medida de la integridad de su sistema de control y monitoreo para detectar cualquier fallo, por lo tanto es importante que este aspecto est diseado segn la especificacin correcta. El diseo fsico debe impedir una operacin incorrecta (por ej., con la mano y el codo).

1-13

Principios de seguridad

Seleccin de medidas de proteccin


La mquina no debe ir de un ciclo a otro sin soltar y presionar ambos botones. Esto evita la posibilidad de bloquear ambos botones, dejando la mquina en funcionamiento continuo. El soltar cualquiera de los botones debe causar que la mquina se detenga. El uso del control de dos manos debe considerarse con cautela ya que generalmente permite la exposicin a algn tipo de riesgo. Sin embargo, es muy til en aplicaciones tales como dispositivos pendientes con fines de aprendizaje y controles de microavance porque puede ofrecer mayores niveles de proteccin cuando se usa junto con otros dispositivos de proteccin. Cmo evitar movimientos peligrosos Cuando se requieren accesos frecuentes, la guarda fsica en el lugar peligroso algunas veces es demasiado restrictiva para la carga de piezas o el ajuste. En este caso se requiere un dispositivo para evitar un movimiento peligroso y a la vez permitir un acceso no restringido mediante la deteccin de la presencia del operador y el aislamiento de la fuente de energa. Cortinas de luz fotoelctrica Estos dispositivos emiten una cortina de haces de luz infrarroja inocuos frente al rea peligrosa. Cuando alguno de los rayos es bloqueado debido a una intrusin hacia el rea peligrosa, el circuito de control de la cortina de luz desactiva la fuente de energa peligrosa. Muchos factores son los que rigen el tipo y posicionamiento de una cortina de luz, y estos se indican en EN 999 The positioning of protective equipment in respect of approach speeds of parts of the human body (El posicionamiento de equipo protector con respecto a velocidades de aproximacin de partes del cuerpo humano). Tapetes de seguridad para el piso sensibles a la presin Estos dispositivos se usan para proporcionar resguardo de una rea del piso alrededor de una mquina. Se coloca una matriz de tapetes interconectados alrededor del rea de peligro y cualquier presin (por ej., la pisada de un operador) causar que la unidad controladora del tapete desactive la alimentacin elctrica a la pieza peligrosa.

Figura 17
Los tapetes sensibles a la presin generalmente se usan dentro de un rea cerrada que contiene varias mquinas celdas robticas o de manufactura flexible, por ejemplo. Cuando se requiere acceso a la celda (para el establecimiento o aprendizaje del robot, por ejemplo), stos evitan un movimiento peligroso si el operador se sale del rea de seguridad. El tamao y posicionamiento de los tapetes debe calcularse usando las frmulas de EN 999 The positioning of protective equipment in respect of approach speeds of parts of the human body (El posicionamiento de equipo protector con respecto a velocidades de aproximacin de partes del cuerpo humano). Bordes sensibles a la presin Estos dispositivos son tiras para bordes que pueden montarse al borde de una pieza mvil, tal como la mesa o la puerta elctrica de una mquina, la cual constituye un riesgo de trituracin o corte.

Figura 16
Las cortinas de luz son extremadamente verstiles y pueden resguardar reas con una amplitud de muchos metros. Mediante espejos, los haces de luz pueden desviarse hacia alrededor de las esquinas para cercar una mquina. Estn disponibles con diferentes espaciamientos de los haces de luz, lo cual las hace ideales para una gama de aplicaciones desde resguardo de permetros para robots industriales hasta resguardo de punto de acceso en prensas y cortadoras.

Figura 18
Si la pieza mvil golpea al operador (o viceversa), el borde sensible flexible se oprime y desactivar la fuente de energa de la pieza peligrosa. Los bordes sensibles tambin pueden usarse para resguardar maquinaria cuando existe el riesgo de que se enrede el

1-14

Principios de seguridad

Seleccin de medidas de proteccin


operador. Si la mquina atrapa a un operador, el contacto con el borde sensible desactivar la alimentacin elctrica de la mquina. Las cortinas de luz de seguridad, los tapetes para el piso y los bordes sensibles pueden clasificarse como dispositivos de disparo. No restringen el acceso, lo detectan. Se basan totalmente en su capacidad de deteccin y conmutacin para la provisin de seguridad. Es importante que su circuito de control incorpore medidas de automonitoreo y a prueba de fallo. Generalmente son adecuados slo para maquinarias que se detienen razonablemente rpido despus que se desconecta la alimentacin elctrica. Puesto que un operador puede caminar o entrar directamente al rea peligrosa, obviamente es necesario que el tiempo requerido para que el movimiento se detenga sea menor que el tiempo requerido para que el operador entre en contacto con la pieza peligrosa despus causar el disparo del dispositivo. Paros En los EE.UU., Europa y a nivel internacional, existe un acuerdo sobre las descripciones de las categoras de paro para mquinas o sistemas de fabricacin. NOTA: estas categoras son diferentes a las categoras de EN 954-1 (ISO 13849-1). Vea Estndares NFPA79 e IEC/EN60204-1 para obtener ms detalles. Los paros pertenecen a tres categoras: Categora 0 es paro mediante desconexin inmediata de la alimentacin elctrica a los accionadores de la mquina. Esto se considera paro no controlado. Con la alimentacin elctrica desconectada, la accin de freno que requiere alimentacin elctrica no ser eficaz. Esto permitir que los motores giren libremente y paren por inercia en un perodo de tiempo extendido. En otros casos, la mquina que est reteniendo accesorios puede dejar caer material, lo cual requiere alimentacin elctrica para retener el material. Tambin puede usarse medios de paro mecnico que no requieren alimentacin elctrica con un paro de categora 0. El paro de categora 0 tiene prioridad sobre los paros de categora 1 2. Categora 1 es un paro controlado con alimentacin elctrica disponible a los accionadores de la mquina para realizar el paro. Luego, cuando se realiza el paro, la alimentacin elctrica se desconecta de los accionadores. Esta categora de paro permite que el freno energizado detenga rpidamente el movimiento peligroso y luego la alimentacin elctrica puede desconectarse de los accionadores. Categora 2 es un paro controlado con alimentacin elctrica disponible a los accionadores de la mquina. Un paro de produccin normal se considera paro de categora 2. Estas categoras de paro deben aplicarse a cada funcin de paro, cuando la funcin de paro es la accin tomada por las piezas asociadas con la seguridad del sistema de control en respuesta a una entrada, la categora 0 1 debera utilizarse. Las funciones de paro deben anular las funciones de arranque relacionadas. La seleccin de la categora de paro de cada funcin de paro debe determinarse mediante una evaluacin de riesgos. Funcin de paro de emergencia La funcin de paro de emergencia debe funcionar como paro de categora 0 o categora 1, segn lo determinado por una evaluacin de riesgos. Debe ser iniciada por una sola accin humana. Cuando se ejecuta, debe anular todas las otras funciones y modos de operacin de la mquina. El objetivo es desconectar la alimentacin elctrica tan rpidamente como sea posible sin crear peligros adicionales. Hasta hace poco, se requeran componentes electromecnicos cableados para circuitos de paro de emergencia de categora. Con la introduccin de los PLC de seguridad, la lgica electrnica que cumple con los requisitos de estndares tales como IEC61508 puede utilizarse en el circuito de paro de emergencia. La versin publicada actualizada de IEC 60204-1 requiere componentes electromecnicos. Se est considerando eliminar esta restriccin de IEC 60204-1 en futuras ediciones de este estndar. La desconexin final de la alimentacin elctrica en un circuito de paro de emergencia de categora 0 1 debe hacerse mediante un componente electromecnico. Dispositivos de paro de emergencia Siempre que exista el peligro de que un operador corra algn riesgo con una mquina, deben instalarse facilidades para un acceso rpido a un dispositivo de paro de emergencia. El dispositivo de paro de emergencia debe estar operativo continuamente y fcilmente accesible. Cada panel de operador debe tener por lo menos un dispositivo de paro de emergencia. Otros dispositivos de emergencia pueden utilizarse en otros lugares, segn sea necesario. Los dispositivos de paro de emergencia vienen en diversos formatos. Algunos ejemplos populares son los interruptores de botn pulsador y los interruptores accionados por cable. Cuando se activa el dispositivo de paro de emergencia, ste debe engancharse y no debe ser posible generar el comando de paro sin enganche. El restablecimiento del paro de emergencia no debe causar una situacin peligrosa. Una accin separada y deliberada debe utilizarse para volver a arrancar la mquina. Para obtener ms informacin sobre dispositivos de paro de emergencia, lea EN418 (ISO13850), IEC 60947-5-5, NFPA79 e IEC60204-1, AS4024.1, Z432-94. Botones de paro de emergencia La manera usual de proporcionar esto es mediante un botn pulsador de seta de color rojo sobre fondo amarillo que el operador presiona en caso de una emergencia (vea la Figura 19). Deben estar colocados estratgicamente en suficiente cantidad alrededor de la mquina para asegurar que siempre haya uno al alcance en un punto peligroso.

Figura 19 1-15

Principios de seguridad

Estrategia de seguridad
Interruptores accionados por cable Para maquinarias tales como transportadores, generalmente es ms conveniente y eficaz usar un dispositivo accionado por cable a lo largo del rea peligrosa (tal como se muestra en la Figura 20.) como dispositivo de paro de emergencia. Estos dispositivos usan un cuerda de acero conectada a los interruptores de accionamiento por cuerda de manera que al tirar de la cuerda en cualquier direccin y en cualquier punto a lo largo de su longitud se accionar el interruptor y se cortar la alimentacin elctrica de la mquina.

Estrategia de seguridad
Incluyendo evaluacin de riesgos y reduccin de riesgos
Desde un punto de vista puramente funcional, es mejor que una mquina realice su tarea de procesar material de la manera ms eficiente posible. Pero para que una mquina sea viable, tambin debe ser segura. De hecho, la seguridad debe ser una consideracin principal; esto incluye la seguridad del personal y del medio ambiente. (Aunque el medio ambiente est fuera del alcance de esta seccin, las dos categoras de seguridad son a menudo lo mismo). Para crear una correcta estrategia de seguridad, debe haber una: 1. EVALUACIN DE RIESGOS basada en un claro entendimiento de los lmites y funciones de la mquina, los cuales luego deben analizarse para identificar aquellos que presentan un posible peligro. Luego el grado de riesgo debido al peligro se calcula para proporcionar una base de juicio en etapas posteriores. Luego se requiere una evaluacin del riesgo para determinar si las medidas de seguridad existentes son satisfactorias o si se requieren medidas adicionales para reducir el riesgo. 2. Luego se realiza la REDUCCIN DEL RIESGO si es necesario y se seleccionan medidas de seguridad en base a la informacin derivada de la etapa de evaluacin de riesgos. Despus de la implementacin de estas medidas, el proceso se repite para determinar si se logr efectivamente la seguridad. La manera en que esto si hizo es la base de la ESTRATEGIA DE SEGURIDAD de la mquina. Necesitamos seguir una lista de verificacin y asegurar que todos los aspectos estn considerados y que el principio que debe prevalecer no se pierda en los detalles. El primer paso es asegurar que todo el proceso est documentado. Esto no slo asegurar un trabajo ms minucioso sino que tambin permitir que los resultados estn disponibles para que sean verificados por terceros. Esta documentacin tambin puede incluirse en el archivo tcnico que complementa la Declaracin de Conformidad para la Directiva de maquinarias. Puesto que es probable que el proceso se repita, la documentacin de los resultados permite evitar repeticiones innecesarias. Debe observarse aqu que si una mquina est diseada de conformidad con un estndar tipo C especfico para dicha mquina, esta ya debe incorporar todas las medidas necesarias para su seguridad. De todas maneras, se recomienda enfticamente llevar a cabo este proceso para asegurar que todos los aspectos han sido considerados. Aunque esta seccin parece ser pertinente slo para los fabricantes de la mquina, tambin es pertinente para los usuarios de la mquina, ya que las mquinas a menudo se usan en circunstancias no previstas por el fabricante. El usuario (o el empleador) debe proporcionar un ambiente de trabajo seguro. La regulacin P.U.W.E.R. 5 (prrafo de gua 60) indica claramente que la seguridad del ambiente de trabajo considera tres aspectos: A. Su integridad inicial B. El lugar donde se usa C. El propsito para el que se usa.

Figura 20
Interruptores de enclavamiento de compuerta Los interruptores de enclavamiento de compuerta se usan para enviar comandos de paro a las piezas relacionadas a la seguridad del sistema de control. Los enclavamientos de compuerta pueden, pero no necesariamente tienen que realizar la misma funcin que un dispositivo de paro de emergencia. La categora de paro 0 1 debe determinarse mediante una evaluacin de riesgos. El cerrar la compuerta no debe arrancar la mquina. Una accin separada y deliberada debe utilizarse para volver a arrancar la mquina. Interruptores de disparo telescpico Otras variaciones incluyen interruptores de antena telescpica donde la deflexin de la antena causa que el interruptor corte la alimentacin elctrica de la mquina. Estos dispositivos se usan ms comnmente como dispositivos de disparo en maquinaria tal como perforadoras de pilares. El interruptor se monta en la perforadora y la antena se extiende hacia abajo junto a la broca de la perforadora. En el caso de que el operador se enrede con la perforadora, desviar la antena que hace funcionar al interruptor (generalmente conectado a una unidad de freno por inyeccin de CC tal como se muestra en la Figura 21.)

Figura 21 1-16

Principios de seguridad

Estrategia de seguridad
Por ejemplo, una mquina fresadora usada en el taller de un colegio necesitar consideraciones adicionales con respecto a una que se usa en una sala de herramientas industriales. Tambin debe recordarse que si una compaa usuaria adquiere dos o ms mquinas independientes y las integra en un proceso, ellos sern, tcnicamente, los fabricantes de la mquina combinada resultante. Por lo tanto, consideremos ahora los pasos esenciales para obtener una estrategia de seguridad apropiada. Lo siguiente puede aplicarse a una instalacin de fbrica existente o a una sola mquina nueva. Cada mquina que presente un peligro debe ser identificada y marcada en la lista con los tipos de peligro presentes. En esta etapa slo trataremos la identidad y tipo de peligro. Es tentador empezar a calcular el grado de riesgo presentado por la fuente de peligro, pero debemos tratar este aspecto como un proceso separado de la estimacin de los riesgos. Estimacin de los riesgos ste es uno de los aspectos ms fundamentales de la seguridad de las maquinarias. Hay muchas maneras de tratar este tema y las siguientes pginas (vea la Figura 22), ofrecen un sistema simple pero eficaz y sirven para ilustrar los principios bsicos. El mtodo deber modificarse segn sea necesario para satisfacer los requisitos de situaciones individuales. Es absolutamente necesario entender el mtodo y su importancia. Toda maquinaria que contiene peligros presenta riesgos. Es importante poder describir en qu punto se encuentra el riesgo en una escala relativa de mnimo a mximo. Las siguientes pginas proporcionan un mtodo prctico para lograrlo. Se ha demostrado que es fcil de usar y confiable como gua para un enfoque lgico. Primero, consideremos algunos de los puntos fundamentales. 1. La estimacin del riesgo siempre debe documentarse. Es tentador hacer un juicio puramente intuitivo. Aunque esto a menudo puede basarse en la experiencia, por cierto no toma en cuenta todas las consideraciones necesarias y no puede verificarse fcilmente ni pasarse a otros. Usted debe seguir un patrn de trabajo lgico, escribir los resultados y solicitar la verificacin de terceros. 2. Qu es un riesgo? El trmino riesgo generalmente se confunde con la gravedad de un accidente. Debe tenerse en consideracin la gravedad de la lesin potencial Y la probabilidad de su ocurrencia para calcular la cantidad de riesgo presente. 3. Debe tener en consideracin todos los factores previsibles. Al igual que en la etapa de identificacin de peligros, es importante considerar todas las limitaciones y etapas de la vida de una mquina incluyendo instalacin, puesta en marcha, mantenimiento, desmantelamiento, correcto uso y operacin as como las consecuencias de un mal uso o mal funcionamiento razonablemente previsible.

Evaluacin de riesgos
Por qu es necesario una evaluacin de riesgos? Una razn es obvia, es un requisito legal en la Unin Europea. La mayora de las directivas y regulaciones respecto a la seguridad de maquinarias indican que debe llevarse a cabo una evaluacin formal de los riesgos. La mayora de los estndares armonizados europeos tipo A y B se refieren a sta, y el tema tiene un estndarEN 1050 Principios de la evaluacin de riesgos. Es posible que hayan algunas personas encargadas de la seguridad de la maquinaria que no reconozcan la importancia de la evaluacin de riesgos, pero como lo hemos establecido, es una parte integral de una estrategia de seguridad. Es un error considerar la evaluacin de riesgos como una carga. Es un proceso til que proporciona informacin vital y permite que el usuario o el diseador tomen decisiones lgicas acerca de las maneras de lograr la seguridad. Determinacin del lmite de la mquina e identificacin de peligros Debe prepararse una lista completa de todas las mquinas. En los casos en que mquinas separadas estn vinculadas ya sea mecnicamente o por sistemas de control, estas deben considerarse como una sola mquina. A su vez, se considera cada mquina para ver si presenta algn tipo de peligro y la lista se marca como corresponde. Es importante considerar todas las limitaciones y etapas de la vida de una mquina, incluyendo instalacin, puesta en marcha, mantenimiento, desmantelamiento, correcto uso y operacin as como las consecuencias de un mal uso o mal funcionamiento razonablemente previsible. Todos los tipos de peligro deben considerarse, incluyendo trituracin, corte, enredo, expulsin de piezas, vapores, radiacin, substancias txicas, calor, ruido, etc. Nota: Si para ofrecer seguridad una mquina requiere algo aparte de su
naturaleza intrnseca, esto debe indicarse como fuente de peligro. Una mquina con engranajes expuestos presenta un peligro obvio y directo. Pero si los engranajes estn protegidos por un panel de acceso enclavado, constituyen un peligro potencial que puede convertirse en un peligro real en el caso de fallo del sistema de enclavamiento.

1-17

Principios de seguridad

Estrategia de seguridad EVALUACIN DE RIESGOS


Identifique todas las mquinas del lugar de trabajoLuego, por cada mquina Consulte la informacin y experiencia pertinentes

principios bien establecidos que el estndar, pero tiene algunas variaciones menores en el mtodo detallado. Esto refleja el hecho de que han sido influenciadas significativamente por la necesidad de desarrollar un mtodo directo, confiable y especficamente diseado para ayudar a seleccionar los sistemas de proteccin. Los siguientes factores se tienen en consideracin: 1. LA GRAVEDAD DE UNA LESIN POTENCIAL. 2. LA PROBABILIDAD DE SU OCURRENCIA. La probabilidad de la ocurrencia incluye dos factores: a FRECUENCIA DE EXPOSICIN. b PROBABILIDAD DE LESIN. Trataremos cada factor independientemente y asignaremos valores a estos factores. Use todos los datos y experiencia disponibles. Usted est tratando con todas las etapas de la vida til de la mquina, por lo tanto base sus decisiones en el peor de los casos.

LMITES DE LA MQUINA Puede usted prever todas las situaciones posibles de operacin y uso de la mquina

NO

S
IDENTIFICACIN DE PELIGRO Identifique cada situacin de peligro Por cada peligro CLCULO DEL RIESGO Calcule el nivel de riesgo debido al peligro

REDUCCIN DEL RIESGO


NO

EVALUACIN DEL RIESGO Es aceptable el nivel de riesgo Se han analizado las medidas de seguridad y se ha comprobado que son adecuadas?

Solucione la situacin de peligro mediante un proceso de rediseo o medidas adicionales

NO

Determine si el desempeo y caractersticas funcionales de la medida de seguridad son apropiadas para la mquina y su uso

Recuerde que para el propsito de este ejercicio, usted debe suponer que no se ha aplicado un sistema de proteccin o que ste fall produciendo peligro. Por lo tanto, es posible que por ejemplo la alimentacin elctrica de la mquina no est aislada cuando se abre una guarda o la mquina puede arrancar inesperadamente mientras la guarda est abierta. 1. La gravedad de una lesin potencial Para esta consideracin estamos suponiendo que el accidente o incidente ya ocurri. Un estudio cuidadoso de la fuente de peligro revelar cul es la lesin ms grave posible.

S
FIN DEL PROCESO

ESTRATEGIA DE SEGURIDAD

Figura 22
4. Es un proceso iterativo pero no repita el trabajo innecesariamente. Por ejemplo: Una mquina tiene una puerta de resguardo con un sistema de enclavamiento que, durante una evaluacin de riesgos anterior, demostr ser satisfactorio. Siempre que no existan cambios que lo hayan afectado, durante las evaluaciones de riesgos subsiguientes no se requerir tomar medidas adicionales ya que el riesgo ha sido satisfactoriamente reducido (o eliminado). Pero si la mquina nunca fue sometida a una evaluacin formal de riesgos o si sus circunstancias de uso cambiaron, entonces no se puede suponer automticamente que el sistema de enclavamiento es satisfactorio y la estimacin del riesgo debe repetirse para verificar su idoneidad. Las sugerencias para calcular riesgos proporcionadas en las siguientes pginas no se ofrecen como mtodo definitivo ya que las circunstancias individuales pueden indicar la necesidad de un mtodo diferente. SE HAN DISEADO NICAMENTE COMO PAUTAS GENERALES PARA FOMENTAR EL USO DE UNA ESTRUCTURA METDICA Y DOCUMENTADA. Su propsito es explicar y complementar la seccin de clculo de riesgos en el estndar EN 1050 Principles for Risk Assessment (Principios de la evaluacin de riesgos). Utiliza los mismos

QU TAN GRAVE
En este ejemplo, la lesin ms grave posible sera fatal. En este ejemplo, la lesin ms severa posible sera grave. Con la posibilidad de magulladura, rotura, amputacin de dedo o lesin producida por expulsin de llave de mandril, etc.

Figura 23
Recuerde: Para esta consideracin estamos suponiendo que una lesin es inevitable y slo estamos preocupados por su gravedad. La gravedad de la lesin debe evaluarse como: FATAL MAYOR: (Normalmente irreversible) Incapacidad permanente, prdida de la vista, amputacin de extremidad, dao respiratorio, etc. GRAVE: (Normalmente reversible) Prdida del conocimiento, quemaduras, roturas, etc. MENOR: Magulladuras, cortes, abrasiones ligeras, etc.

1-18

Principios de seguridad

Estrategia de seguridad
2b. Probabilidad de lesin
Usted debe suponer que el operador est expuesto al movimiento o proceso peligroso.

1 MENOR
Figura 24

10
FATAL

QU PROBABI

MAYOR

GRAVE En este ejemplo, la probabilidad de lesin podra clasificarse como cierta por la cantidad del cuerpo en el rea de peligro y la velocidad de operacin de la mquina. En este ejemplo, la probabilidad de lesin puede clasificarse como posible ya que hay contacto mnimo entre el peligro y el operador. Quizs haya tiempo para alejarse del peligro.

2a. Frecuencia de exposicin

Figura 27

QU TAN GRAVE

Al considerar la manera en la cual el operador est involucrado con la mquina y otros factores (velocidad de puesta en marcha, por ejemplo), la probabilidad de lesin puede clasificarse como: Improbable Posible Probable Cierta

Figura 25
La frecuencia de la exposicin al peligro puede clasificarse como: FRECUENTE: Varias veces al da. OCASIONAL: Diariamente. INFRECUENTE: Semanalmente o menos.

FRECUENTEMENTE

IMPROBABLE

POSIBLE

PROBABLE

CIERTA

Figura 28: Los valores se signan como se indica a continuacin


Se asigna un valor a todos los encabezados y ahora se suman para obtener un clculo inicial. El siguiente paso es ajustar el clculo inicial considerando factores adicionales tales como lo indicados a continuacin. A menudo estos slo pueden considerarse correctamente cuando la mquina est instalada en su ubicacin permanente.

OCASIONALMENTE

INFRECUENTEMENTE

Figura 26: Los valores se signan como se indica a continuacin

1-19

Principios de seguridad

Estrategia de seguridad
Reduccin y evaluacin de riesgos Ahora debemos considerar cada mquina y sus riesgos respectivos y tomar medidas para solucionar todos sus peligros. La Seccin 1.2.2(b) del ANEXO I de la Directiva de Maquinarias explica que hay tres mtodos bsicos que deben considerarse y usarse en el siguiente orden: Eliminar o reducir riesgos en la medida de lo posible (diseo y construccin de maquinaria inherentemente segura), Tomar las medidas de proteccin necesarias en relacin a riesgos que no pueden eliminarse, Informar a los usuarios respecto a riesgos residuales debidos a deficiencias de las medidas de proteccin adoptadas, indicar si se requiere una capacitacin particular y especificar la necesidad de proporcionar equipo de proteccin personal. Si la mquina todava est en la etapa de diseo, quizs sea posible eliminar la fuente de peligro cambiando el diseo. Si los mtodos de diseo no pueden proporcionar la respuesta, deber realizarse otra accin. Los tipos de medidas a considerar se proporcionan en mayor detalle en la Regulacin 11 (2) JERARQUA DE MEDIDAS de P.U.W.E.R. (Regulacin sobre Provisin y uso de equipo de trabajo 1992): A. Guardas de aislamiento fijas.
Factor tpico Ms de una persona estn expuestas al peligro Tiempo prolongado en la zona de peligro sin un aislamiento completo de la alimentacin elctrica. El operador es inexperto o no tiene la capacitacin requerida. Intervalos muy largos (por ej., 1 ao) entre accesos. (Pueden haber fallos progresivos y no detectados, especialmente en los sistemas de monitoreo). Accin sugerida Multiplique el factor de gravedad por el nmero de personas. Si el tiempo de cada acceso es ms de 15 minutos, agregue 1 punto al factor de frecuencia. Agregue 2 puntos al total.

6 6
Figura 29 (Nota: Esto no se basa en las ilustraciones de los ejemplos previos).
Dependiendo del tipo y uso de la maquinaria, pueden haber otros factores pertinentes que deben listarse y considerarse en esta etapa, tal como se muestra en la Tabla 1.

B. Guardas movibles (enclavadas) o dispositivos de proteccin (cortinas de luz, tapetes para el piso, etc.). C. Aparatos de proteccin (guas, sujetadores, varillas de empuje, etc.): Usados para alimentar una pieza de trabajo manteniendo a la vez el cuerpo del operador fuera de la zona de peligro. A menudo se usa en combinacin con guardas. D. La provisin de informacin, instrucciones, capacitacin y supervisin. Es importante que los operadores tengan la capacitacin necesaria en los mtodos de trabajo seguro de una mquina. Esto no significa que pueden omitirse las medidas (a), (b) o (c). No es aceptable simplemente indicar a un operador que no debe acercarse a las reas peligrosas (como alternativa de proteccin). Equipo de proteccin personal Adems de las medidas indicadas anteriormente, tambin puede ser necesario que el operador use equipo como guantes especiales, gafas de proteccin, respiradores, etc. El diseador de la maquinaria debe especificar el tipo de equipo requerido. El uso de equipo de proteccin personal generalmente no constituir el mtodo de proteccin principal sino que complementar las medidas indicadas anteriormente. Cada medida de la jerarqua debe considerarse, empezando por la primera, y usarse siempre que sea posible. Esto puede resultar en el uso de una combinacin de medidas. Si no se requiere acceder a reas peligrosas, la solucin es protegerlas mediante algn tipo de guarda fija de aislamiento. Si se requiere acceso, entonces las cosas se complican un poco. Ser necesario asegurar que slo pueda obtenerse acceso mientras la mquina est en una condicin de seguridad. Se requerirn medidas de proteccin tales como puertas de guarda enclavadas y/o sistemas

Aada puntos equivalentes al mximo factor de frecuencia.

Tabla 1
Luego los resultados de los factores adicionales se suman al total previo, tal como se muestra (vea la Figura 30).

HIGH

MED

IUM

6 6
Figura 30 1-20

W LO

Principios de seguridad

Estrategia de seguridad
de disparo. La seleccin del dispositivo o sistema depender significativamente de las caractersticas de operacin de la mquina. Esto es extremadamente importante ya que un sistema que menoscaba la eficiencia de la mquina tiene el riesgo de que sea retirado u omitido sin autorizacin. La seguridad de la mquina en este caso depender del uso apropiado y de la correcta operacin del sistema de proteccin aun en condiciones de fallo. Ahora la aplicacin ha sido considerada con respecto al sistema de proteccin apropiado. Ahora debe considerarse la correcta operacin del sistema. Dentro de cada tipo es posible que haya una variedad de tecnologas con diversos grados de rendimiento del monitoreo, deteccin o prevencin de fallos. En un universo ideal, cada sistema de proteccin sera perfecto sin posibilidades de fallo ni condiciones peligrosas. Sin embargo, en el mundo real, estamos restringidos por los lmites actuales de conocimientos y materiales. Otra restriccin muy real es, por supuesto, el costo. Basado en estos factores, es obvio que se requiere un sentido de proporcin. El sentido comn nos indica que sera ridculo insistir en que la integridad de un sistema de seguridad de una mquina que puede causar, en el peor de los casos, magulladuras leves, sea igual a la integridad de un sistema requerido para mantener un avin en el aire. Las consecuencias de un fallo son drsticamente diferentes y por lo tanto necesitamos tener alguna manera de relacionar el grado de las medidas de proteccin con el nivel de riesgo obtenido en la etapa de estimacin de los riesgos, Independientemente del tipo de dispositivo protector seleccionado, debe recordarse que un sistema relacionado a la seguridad puede contener muchos elementos, entre ellos el dispositivo protector, el cableado, el dispositivo de conmutacin de alimentacin elctrica y algunas veces partes del sistema de control operativo de la mquina. Todos estos elementos del sistema (incluyendo guardas, montaje, cableado, etc.) deben tener caractersticas de rendimiento apropiadas pertinentes a sus principios y tecnologa de diseo. El Estndar ISO 13849-1 describe diversas categoras de piezas relacionadas con la seguridad de los sistemas de control. La siguiente seccin tiene ms informacin sobre este tema. Uno de los errores ms comunes es la creencia de que un nivel de riesgo alto siempre es directamente igual a un nivel de categora alta. Veremos en el siguiente captulo que ste no siempre es el caso. La tabla mostrada en la Figura 31 es una sugerencia para parte de un proceso documentado que considera todos los aspectos de seguridad de la maquinaria en uso. ste acta como gua para los usuarios de maquinaria, pero los fabricantes o suministradores de maquinaria tambin pueden usar el mismo principio para confirmar que todo el equipo ha sido evaluado y servir como ndice para informes ms detallados sobre evaluacin de riesgos. Esto muestra que cuando una mquina lleva la marca CE, simplifica el proceso porque los peligros de la mquina ya fueron evaluados por el fabricante y se han tomado todas las medidas necesarias. Aun con un equipo marcado con el distintivo CE, es posible que hayan peligros debido a la naturaleza de la aplicacin o al material que se est procesando, lo cual no fue previsto por el fabricante.

1-21

Principios de seguridad

Sistemas de control con fines de seguridad


Company - MAYKIT WRIGHT LTD Facility - Tool room - East Factory. Date - 8/29/95 Operator profile - Apprentice/Fully skilled. Risk Accident Notes Directive Equipment Identity & Date Conformity Assessment History Report Number
Bloggs center lathe. None Serial no. 8390726 claimed Installed 1978 RA302 None Electrical equipment complies with BS EN 60204 E-Stops fitted (replaced 1989)

Hazard Identity

Hazard Type

Action Required

Implemented and Inspected Reference


11/25/94 J Kershaw Report no 9567

Chuck rotation with guard open

Mechanical Entanglement Cutting

Fit guard interlock switch

Cutting fluid

Toxic

Change to non toxic type Supply gloves

11/30/94 J Kershaw Report no 9714 11/30/94 J Kershaw Report no 9715 4/13/95 J Kershaw Report no 10064

Swarf cleaning

Cutting

Bloggs turret head M/c Dir. milling m/c EMC Dir Serial no 17304294 Manuf 1995 Installed May 95

RA416

None

Movement of bed (towards wall)

Crushing

Move machine to give enough clearance

Figura 31

Sistemas de control con fines de seguridad


Qu es un sistema de control relacionado con la seguridad? (generalmente abreviado SRCS). Es la parte del sistema de control de una mquina que evita que ocurra una condicin peligrosa. Puede ser un sistema dedicado separado o puede estar integrado con el sistema de control normal de la mquina. Su complejidad puede variar desde un sistema simple tpico, tal como un interruptor de enclavamiento de puerta de guarda e interruptor de paro de emergencia conectados en serie, a la bobina de control de un contactor de alimentacin elctrica, hasta un sistema compuesto que comprende dispositivos simples y complejos que se comunican a travs de software y hardware. Para proporcionar la funcin de seguridad, el sistema debe continuar funcionando correctamente bajo todas las condiciones previsibles. Cmo diseamos un sistema que logre esto, y cuando lo hayamos hecho, cmo hacemos una demostracin? El estndar ISO 13849-1 Piezas relacionadas a la seguridad de sistemas de control trata estos aspectos. Establece un lenguaje de cinco categoras como puntos de referencia y describe el rendimiento de los SRCS (vea la Figura 32 para obtener un resumen de estas categoras). Nota: Nota 1: La Categora B por s misma no tiene medidas especiales de seguridad, pero forma la base para las otras categoras. Nota: Nota 2: En caso de mltiples fallos causados por una causa comn
o como consecuencia inevitable del primer fallo, stos deben contarse como un solo fallo.

Nota: Nota 3: La revisin de fallos puede limitarse a dos fallos


combinados si se justifica, pero los circuitos complejos (por ej., circuitos de microprocesador) pueden requerir la consideracin de ms fallos combinados.

Entonces, cmo se decide qu categora se necesita? Para traducir estos requisitos a una especificacin de diseo de sistema, tiene que haber una interpretacin de los requisitos bsicos. Es un error comn creer que la categora 1 proporciona la mnima proteccin y que la categora 4 proporciona la mxima. ste no es el razonamiento con el que se crearon las categoras. Estas se han diseado como puntos de referencia que describen el rendimiento funcional de diferentes mtodos de control relacionado con la seguridad y las partes que lo constituyen. La Categora 1 tiene el propsito de PREVENIR fallos. Esto se logra utilizando principios de diseo, componentes y materiales adecuados. La simplicidad del principio y el diseo complementado con caractersticas estables y predecibles del material, son las claves de esta categora. Las categoras 2, 3 y 4 requieren que si un fallo no se puede evitar, ste se debe DETECTAR (y realizar la accin apropiada). El monitoreo y la verificacin son las claves de estas categoras. El mtodo usual (pero no el nico) de monitoreo es duplicar las funciones crticas de seguridad (por ej., redundancia) y comparar la operacin.

1-22

Principios de seguridad

Sistemas de control con fines de seguridad


Comportamiento del sistema

Resumen de requisitos CATEGORA B (vea la nota 1) - Las piezas relacionadas con la seguridad de los sistemas de control de mquina y/o su equipo protector, as como sus componentes, se disearn, construirn, seleccionarn, ensamblarn y combinarn de acuerdo con los estndares pertinentes, de manera que puedan soportar las influencias esperadas. CATEGORA 1 - Los requisitos de la categora B se aplican junto con el uso de componentes de seguridad y principios de seguridad comprobados. CATEGORA 2 - Se aplican los requisitos de la categora B y el uso de principios de seguridad comprobados. - El sistema de control de la mquina verificar la(s) funcin(es) de seguridad al momento de la puesta en marcha de la mquina y peridicamente. Si se detecta un fallo se iniciar un estado de seguridad o, si esto no es posible, se emitir una advertencia.

Principio

Cuando ocurre un fallo, ste puede causar la prdida de la funcin de seguridad.

Segn lo descrito para la categora B pero con una confiabilidad ms alta de la funcin de seguridad. (A mayor la confiabilidad, menor la probabilidad de fallo). La verificacin detecta la prdida de la funcin de seguridad. La ocurrencia de un fallo puede causar la prdida de la funcin de seguridad entre los intervalos de verificacin. Cuando ocurre el fallo, la funcin de seguridad siempre se ejecuta. Se detectarn algunos fallos, pero no todos. Una acumulacin de fallos no detectados puede causar la prdida de la funcin de seguridad.

CATEGORA 3 (vea las notas 2 y 3) - Se aplican los requisitos de la categora B y el uso de principios de seguridad comprobados. - El sistema estar diseado de manera que un fallo en cualquiera de sus piezas no cause la prdida de la funcin de seguridad.

CATEGORA 4 (vea las notas 2 y 3) - Se aplican los requisitos de la categora B y el uso de principios de seguridad comprobados. - El sistema estar diseado de manera que un fallo en cualquiera de sus piezas no cause la prdida de la funcin de seguridad. - El fallo es detectado cuando o antes de que se ejecute la siguiente demanda en la funcin de seguridad. Si esta deteccin no es posible, entonces una acumulacin de fallos no causar una prdida de la funcin de seguridad.

Cuando ocurren fallos, la funcin de seguridad siempre se ejecuta. Los fallos se detectarn a tiempo para evitar la prdida de las funciones de seguridad.

Figura 32
Interruptor de Contactor de enclavamiento alimentacin elctrica Fallo de cortocircuito o tierra Controles de la mquina

El ejemplo en la Figura 33 es un sistema simple que consta de un interruptor de enclavamiento para la puerta de la guarda conectado en serie con la bobina de control de un contactor de alimentacin elctrica. Si consideramos que el objetivo es una confiabilidad completa sin posibilidad de fallo con condicin peligrosa, cul de las categoras es la ms apropiada?

Fallo por atascamiento de contactor

Figura 33

Por estructura (Hacia DETECCIN de fallos)

Por seleccin de componentes (Hacia PREVENCIN por fallos)

1-23

Principios de seguridad

Sistemas de control con fines de seguridad


Si nos referimos a la Figura 32, qu tipo de categora es la ms apropiada? La prevencin de fallos o la deteccin de fallos? El primer paso es separar los componentes principales del sistema y considerar sus modos de fallo potenciales. En este ejemplo los componentes son: 1. Interruptor de enclavamiento. 2. Contactor. 3. Cableado El interruptor de enclavamiento es un dispositivo mecnico. La tarea que realiza es simpleabrir los contactos cuando la puerta de la guarda se abre. Cumple con los requisitos de la categora 1 y con los principios de diseo y materiales correctos puede comprobarse que, cuando se usa dentro de sus parmetros de operacin establecidos, no tendr fallos con condicin peligrosa. Esto es factible debido al hecho de que el dispositivo es relativamente simple y tiene caractersticas predecibles que pueden demostrarse. El contactor es un dispositivo ligeramente ms complejo y puede tener algunas posibilidades tericas de fallo. Los contactores de fabricantes con prestigio son dispositivos extremadamente confiables. La informacin estadstica muestra que los fallos son raros y generalmente pueden atribuirse a una deficiente instalacin o mantenimiento. Los contactores siempre deben tener sus contactos de alimentacin protegidos por un dispositivo de corte de sobrecorriente para evitar la soldadura. Los contactores deben someterse a una rutina de inspeccin regular para detectar una corrosin excesiva o conexiones flojas que pueden causar sobrecalentamiento y distorsin. Debe verificarse que el contactor cumple con los estndares pertinentes que cubren las caractersticas y condiciones de uso requeridas. Teniendo en cuenta estos factores es posible mantener las posibilidades de fallo al mnimo. Pero en algunas situaciones inclusive esto es inaceptable, y para aumentar el nivel de seguridad necesitamos usar duplicacin y monitoreo. El cableado que conecta los componentes tambin debe considerarse. Los fallos de cortocircuito y de tierra no detectados pueden producir una condicin peligrosa, pero si est correctamente diseado e instalado con estndares tales como los IEC/EN 60204, las probabilidades de fallos se reducen significativamente. Este sistema puede proporcionar un nivel significativo de seguridad que ser adecuado para muchas situaciones. Usted habr notado que el contactor y el cableado son propensos a fallos inusuales, pero tericamente posibles. En algunos casos es posible eliminar todas las posibilidades de fallo, tomando precauciones (por ej., con respecto a la proteccin del cable y el encaminamiento). Si esto no es factible, entonces las tcnicas pertinentes a las categoras 2, 3 y 4, tales como duplicacin y monitoreo, generalmente son ms prcticas y econmicas.
Power Contactors Minotaur MSR6RT Safety Relay Monitoring Unit Interlock Switch

Machine Controls

Figura 34
La Figura 34 muestra un sistema que cumple con los requisitos de la categora 3. Una unidad de rel de monitoreo de seguridad Guardmaster MINOTAUR MSR6RT se usa para monitorear un circuito de control de dos canales. Cualquier fallo en el cableado o los contactores ser detectado por el Minotaur ante la siguiente demanda de la funcin de seguridad. NOTA: Aunque el interruptor de enclavamiento ahora tiene contactos de doble polo, sigue siendo un dispositivo que cumple con los requisitos de la categora 1y forma parte de un sistema que cumple los requisitos de la categora 3. La siguiente pregunta es cundo, y en qu grado, necesitamos tomar dichas medidas? La respuesta simple es decir que depende de los resultados de la evaluacin de riesgos. ste es el mtodo correcto pero debemos entender que esto incluye todos los factores y no slo el nivel de riesgo en el punto de peligro. Por ejemplo, puede pensarse que si el clculo de riesgos muestra un alto nivel de riesgo, el interruptor de enclavamiento debera duplicarse y monitorearse. Pero en muchas circunstancias este dispositivo, debido a su aplicacin, diseo y simplicidad, no fallar con condicin de peligro y no existirn fallos no detectados que monitorear. Por lo tanto, el tipo de categora usado depender de la evaluacin de riesgos y de la naturaleza y complejidad del dispositivo o sistema. Tambin es claro que cuando un sistema total cumple con los requisitos de la categora 3 por ejemplo, puede incluir dispositivos en la categora 1. Si hay posibilidades de fallo, a mayor grado de riesgo, calculado en el clculo de riesgos, mayor la justificacin para instalar medidas a fin de evitarlos o detectarlos. Debe seleccionarse el tipo de categora para obtener el mtodo ms apropiado y eficiente de hacerlo. Recuerde, el clculo de riesgos es un factor, pero tambin debe considerarse la naturaleza del dispositivo o sistema protector y las caractersticas de operacin de la mquina.

Power Contactors

Safety Light Curtain Control System

Safety Light Curtain

Machine Controls

Figura 35

1-24

Principios de seguridad

Otras consideraciones y ejemplos


La Figura 35 muestra el mismo circuito bsico, pero el interruptor de enclavamiento es reemplazado por una cortina de luz de seguridad. La cortina de luz de seguridad es un dispositivo complejo. An en su forma ms simple, tendr un nmero relativamente grande de componentes, incluyendo los circuitos integrados. Los tipos ms sofisticados (con ms funciones) pueden tambin depender de dispositivos y software programable. Anticipar y eliminar todos los fallos peligrosos en un dispositivo electrnico pero no programable sera una tarea enorme y con un dispositivo programable sera prcticamente imposible. Por lo tanto debemos aceptar que los fallos sern posibles y que la mejor respuesta es detectarlos y asegurar que se tome la accin de proteccin necesaria (por ej., bloqueo con paso a un estado de seguridad). Entonces, necesitaramos un dispositivo que satisfaga los requisitos de la categora 2, 3 4. Con un circuito simple, tal como en la Figura 35, la cortina de luz de seguridad tambin monitorear el cableado y los contactores. Puesto que las cortinas de luz son relativamente complejas, la opcin de categoras generalmente depender nicamente de los resultados de la evaluacin de riesgos. Esto no excluye el factor de que puede ser posible trabajar para satisfacer una categora diferente si un dispositivo utiliza un mtodo no convencional pero que puede comprobarse. Podemos ver a partir de los ltimos dos ejemplos que el mismo grado de proteccin es proporcionado por dos tipos de sistemas que usan dispositivos que satisfacen diferentes categoras. fabricado segn estndares especficos. La parte del sistema ms propensa a fallo es el cableado de conexin. Para superar esto, el cableado debe instalarse de acuerdo con las clusulas pertinentes de IEC 60204-1. Debe encaminarse y protegerse a fin de evitar cortocircuitos y fallos de tierra previsibles. Este sistema satisface los requisitos de la categora 1.
Start Stop

K1 Guard Interlock Switch

Figura 36
La Figura 37 muestra un circuito un poco ms complejo. En este caso se requiere que un dispositivo de enclavamiento controle ms de un contactor, cada uno en un circuito de alimentacin diferente. Debe darse la misma consideracin a sus componentes.
Start Stop

Otras consideraciones y ejemplos


Esta seccin proporciona ejemplos de circuitos de control de seguridad en referencia a prcticas recomendadas y las categoras de sistemas de control de seguridad, donde corresponde. Requisitos generales El sistema debe ser capaz de resistir las influencias esperadas. Estas incluirn temperatura, ambiente, carga de alimentacin, frecuencia de uso, interferencia llevada por el aire, vibracin, etc. El Estndar IEC 60204-1 Seguridad de maquinariaEquipo elctrico de mquinasEspecificacin para requisitos generales proporciona pautas detalladas respecto a proteccin contra choque elctrico, prcticas de cableado, aislamiento, unin de potencial de equipos, equipos, fuentes de alimentacin, circuitos y funciones de control, etc. Conocer este estndar es esencial para las personas dedicadas al diseo y mantenimiento de sistemas de control relacionados a la seguridad. Circuitos y unidades de rel de seguridad para monitoreo Los siguientes ejemplos se basan en el uso de un interruptor de enclavamiento de control, pero el mismo principio puede aplicarse a otros dispositivos de conmutacin (por ej., dispositivos de paro de emergencia o de disparo). Categora 1 La Figura 36 muestra un circuito simple de control de seguridad. El dispositivo de enclavamiento tiene operacin de modo positivo y satisface los requisitos de la categora 1. El contactor est correctamente seleccionado para su servicio y est diseado y
Minotaur MSR5T Safety Relay Monitoring Unit K2 Guard Interlock Switch K1

Figura 37
Con un circuito que no requiere seguridad puede usarse un rel ordinario para dividir la seal, pero cuando la seguridad es crtica, esto definitivamente no sera aceptable ya que stos algunas veces se pegan. Por lo tanto, se usa una unidad de rel de seguridad para monitoreo tal como el Guardmaster MINOTAUR MSR5T para proporcionar una accin de conmutacin asegurada. Este sistema satisface los requisitos de la categora 1. Categora 2 La Figura 38 muestra un sistema que satisface los requisitos de la categora 2 y por lo tanto la funcin de seguridad debe someterse a prueba antes de poner en marcha la mquina. Tambin debe probarse peridicamente. Al momento del encendido inicial, el Minotaur no permitir la conmutacin de alimentacin elctrica a la unidad del contactor hasta que la guarda haya sido abierta y cerrada. Esto inicia una verificacin de cualquier fallo en el circuito desde el interruptor hasta el Minotaur. Slo cuando esta verificacin sea satisfactoria se activar el contactor. En cada operacin subsiguiente de la guarda, el circuito se verificar de manera similar.

1-25

Principios de seguridad

Otras consideraciones y ejemplos


Start Guard Interlock Switch Stop

K1

Minotaur MSR6R (Reset mode) Safety Relay Monitoring Unit

Figura 38
Categora 3 La Figura 39 muestra un sistema que satisface los requisitos de la categora 3 y generalmente es apropiado para aplicaciones con clculos de riesgos ms altos. Es un sistema de dos canales totalmente monitoreado, incluyendo los dos contactores. Al abrir y cerrar la guarda, cualquier fallo peligroso causar que el Minotaur bloquee la alimentacin elctrica a los contactores hasta que se corrija el fallo y se restablezca el Minotaur.
Start Guard Interlock Switch Stop

Contactors K1

K2

Minotaur MSR6T Safety Relay Monitoring Unit

Figura 39
Categora 4 La categora 4 requiere que se proporcione la funcin del sistema de seguridad aun con una acumulacin de fallos no detectados. La manera ms prctica de lograr esto es emplear tcnicas de monitoreo continuas o de alta frecuencia. Esto no es factible con la mayora de componentes mecnicos o electromecnicos (por ej., interruptores mecnicos, rels, contactores), tales como aquellos usados en el enclavamiento y sistemas de paro de emergencia. Estas tcnicas son viables (y generalmente usadas) para monitorear componentes electrnicos de estado slido porque un cambio de estado de alta frecuencia es posible y no degrada substancialmente la vida til del componente. Por lo tanto, el mtodo de la categora cuatro generalmente se encuentra en subsistemas autnomos, tales como cortinas de luz. P.E.S. (sistemas electrnicos programables) En los circuitos de seguridad mostrados anteriormente, el dispositivo de proteccin est conectado directamente al (a los) contactor(es) usando slo cableado y dispositivos electromecnicos monitoreados de manera simple o total. Este es el mtodo de cableado recomendado. Su simplicidad significa que es confiable y relativamente fcil de monitorear. Cada vez ms el control operativo

normal de las maquinarias est siendo manejado por equipos programables. Con los avances tecnolgicos, los sistemas de control electrnico programables y complejos pueden considerarse el sistema nervioso central de muchas mquinas. Lo que pasa en el sistema de control afectar la accin de la mquina y viceversa, lo que le pase a la accin de la mquina afectar al sistema de control. El detener una de estas mquinas mediante una fuente diferente a su sistema de control puede resultar en dao grave a la herramienta y a la mquina, as como en prdida o dao del programa. Tambin es posible que al reiniciarse la mquina, esta pueda comportarse de manera impredecible debido a la alteracin de su secuencia de comandos de control. Desafortunadamente, debido a su complejidad, la mayora de sistemas electrnicos programables tienen demasiados modos de fallo para permitir su uso como manera nica de parar la mquina mediante comando proveniente de un enclavamiento de puerta de guarda o botn de paro de emergencia. En otras palabras, podemos pararlo sin causar dao a la mquina O BIEN pararlo DE MANERA SEGURA PERO NO AMBOS. A continuacin se ofrecen tres soluciones: 1. Sistemas programables con fines de seguridad Tericamente es posible disear un sistema programable que tenga un nivel de integridad de seguridad suficientemente alto para uso con fines de seguridad. En la prctica, esto se lograra usando medidas especiales tales como duplicacin y diversidad con monitoreo cruzado. En algunas situaciones esto es posible, pero es importante tener en cuenta que estas medidas especiales deben aplicarse a todos los aspectos, incluyendo la escritura del software. La pregunta bsica es, puede usted probar que no habrn (o habrn significativamente menos) errores? Un anlisis del modo fallo total para equipo programable relativamente simple puede ser, en el mejor de los casos, excesivamente costoso y requerir demasiado tiempo, y en el peor de los casos, imposible de realizar. El estndar IEC 61508 trata este tema en detalle y su lectura se recomienda para personas interesadas en sistemas programables con fines de seguridad. El costo de desarrollo de estos sistemas se justifica en aplicaciones donde stos ofrecen grandes ventajas o donde ningn otro mtodo funcionara. 2. Unidad de monitoreo con comando de anulacin con retardo de tiempo (vea la Figura 40). Este sistema tiene el alto nivel de integridad del cableado y tambin permite una desactivacin en correcta secuencia, lo cual protege la mquina y el programa.
Main Contactor Timed Delay Output Minotaur MSR10 RD

Guard Interlock Switch

PLC

Normal Machine Control

Figura 40

1-26

Principios de seguridad

Otras consideraciones y ejemplos


La salidas primarias Guardmaster MINOTAUR MSR10RD se conectan a las entradas en el dispositivo programable (por ej., P.L.C.) y las salidas con retardo se conectan al contactor. Cuando el interruptor de enclavamiento de guarda se activa, las salidas primarias en el Minotaur conmutan inmediatamente. Estas indican al sistema programable que realice un paro con la secuencia correcta. Despus que transcurre el tiempo suficiente para permitir este proceso, la salida retardada en el Minotaur conmuta y asla el contactor principal. La familia de productos Guardmaster puede usarse con diversos dispositivos protectores y est disponible con otras configuraciones y arreglos de conmutacin para satisfacer los requisitos de sistemas particulares. Nota: Cualquier clculo para determinar el tiempo total de paro debe tener en cuenta el perodo de retardo de la salida del Minotaur. Esto es especialmente importante cuando se usa este factor para determinar la posicin de los dispositivos segn el estndar EN 999.
Guardmaster Atlas Guard Interlock Switch with Solenoid Release Locking

Otras consideraciones
Reinicio de la mquina Si por ejemplo, se abre una guarda enclavada en una mquina en operacin, el interruptor de enclavamiento de seguridad detendr la mquina. En la mayora de casos es imperativo que la mquina no se reinicie inmediatamente cuando se cierra la guarda. Una manera comn de lograr esto es usar una configuracin con arranque de contactor de enclavamiento, tal como se muestra en la Figura 42. Aqu se usa una puerta de guarda enclavada como ejemplo, pero los requisitos se aplican a otros dispositivos de proteccin y sistemas de paro de emergencia.
Contactor Control Coil Interlock Switch Shown with Guard Closed

"Start" Button

"Stop" Button

Contactor Auxiliary Contacts Power Contacts

Derived Contactor Control Supply

Neutral

PLC Contactor

3 Phase Power to Machine Motor

Figura 42
El presionar y soltar el botn de inicio momentneamente activa la bobina de control del contactor, lo cual cierra los contactos de alimentacin elctrica. Siempre que la alimentacin fluya a travs de los contactos de alimentacin, la bobina de control se mantiene activada (enclavada elctricamente) mediante los contactos auxiliares del contactor, los cuales estn mecnicamente vinculados a los contactos de alimentacin. Una interrupcin de la alimentacin principal o del suministro del control resultar en la desactivacin de la bobina y en la abertura de los contactos auxiliares y la alimentacin principal. El enclavamiento de guarda est cableado al circuito de control del contactor. Esto significa que el reinicio puede lograse slo cerrando la guarda y luego realizando un encendido con el botn de inicio normal, lo cual restablece el contactor y arranca la mquina. Los requisitos para situaciones de enclavamiento normales se clarifican en ISO 12100-1 Prrafo 3.22.4 (extracto) Cuando la guarda se cierra, pueden operar las funciones peligrosas de la mquina cubiertas por la guarda, pero el cierre de la guarda no inicia por s solo su operacin. Muchas mquinas ya tienen contactores simples o dobles que funcionan como se describe anteriormente (o tienen un sistema que logra el mismo resultado). Cuando se acopla un enclavamiento a una maquinaria existente, es importante determinar si la configuracin de control de alimentacin elctrica cumple con estos requisitos y tomar las medidas adicionales necesarias.

Solenoid Release Signal

Figura 41
3. Dispositivos con bloqueo de guarda controlados por sistema programable (vea la Figura 41). Este sistema nuevamente proporciona el alto nivel de integridad del cableado combinado con la capacidad de proporcionar una desactivacin en la secuencia correcta, pero slo es aplicable donde la fuente de peligro est protegida por una guarda. Para permitir la abertura de la puerta de la guarda, el solenoide Guardmaster ATLAS debe recibir una seal de desbloqueo del P.L.C. Esta seal slo se dar despus que se haya completado una secuencia de comando de paro. Esto asegura que no ocurra dao a la herramienta o prdida del programa. Cuando se activa el solenoide, la puerta puede abrirse, lo cual causa que los contactos del circuito de control del ATLAS aslen el contactor de la mquina. A fin de evitar seales de liberacin falsas o de descarga de la mquina, quizs sea necesario usar una unidad con retardo de tiempo Guardmaster CU1 o un detector de movimiento detenido CU2 junto con el P.L.C. (En esta aplicacin pueden usarse interruptores Guardmaster Atlas o TLS-GD2)

1-27

Principios de seguridad

Funciones de restablecimiento
Funciones de restablecimiento
Los rels de seguridad Minotaur estn diseados con restablecimiento manual monitoreado o restablecimiento automtico/manual. debe confundirse con un dispositivo sin capacidad de restablecimiento. En este ltimo, el sistema de seguridad se habilitar inmediatamente despus de la desactivacin, pero no habr una verificacin de la integridad del sistema.

Restablecimiento manual monitoreado


Un restablecimiento manual monitoreado requiere el cierre y abertura de un circuito despus que la compuerta se cierra o se restablece el paro de emergencia. La Figura 43 muestra una configuracin tpica de un interruptor de restablecimiento conectado en el circuito de monitoreo de salida de un MSR6R/T. Los contactos auxiliares normalmente cerrados vinculados mecnicamente de los contactores de conmutacin de alimentacin estn conectados en serie con un botn pulsador momentneo. Despus que la guarda se abra y se cierre nuevamente, el Minotaur no permitir que se reinicie la mquina hasta que se presione y se suelte el botn de restablecimiento. Cuando esto sucede, el Minotaur verifica (es decir, monitorea) que ambos contactores estn desactivados y que ambos circuitos de enclavamiento (y por lo tanto la guarda) estn cerrados. Si estas verificaciones son satisfactorias, la mquina puede reiniciarse desde los controles normales.

Guardas de control
Una guarda de control detiene el funcionamiento de la mquina cuando se abre la guarda e inicia directamente el funcionamiento nuevamente cuando se cierra la guarda. El uso de guardas de control slo se permite bajo estrictas condiciones ya que cualquier inicio inesperado o incapacidad de parar puede ser extremadamente peligroso. El sistema de enclavamiento debe tener la ms alta confiabilidad posible (a menudo se aconseja usar enclavamiento de guarda). El uso de guardas de control SLO se puede considerar en maquinaria donde NO EXISTE LA POSIBILIDAD de que un operador o parte de su cuerpo permanezca, o entre en la zona de peligro mientras la guarda est cerrada. La guarda de control debe ser el nico acceso al rea de peligro.

Otras consideraciones
Impedancia de entrada La impedancia de entrada de los rels de seguridad de monitoreo determina cuntos dispositivos de entrada pueden conectarse al rel y qu tan lejos pueden montarse los dispositivos de entrada. Por ejemplo, el Minotaur MSR6R/T tiene una impedancia de entrada permitida mxima de 500 ohms (). Cuando la impedancia de entrada es mayor que 500 W, el MSR6R/T no activa sus salidas. El usuario debe tener cuidado para asegurarse de que la impedancia de entrada permanezca debajo de la especificacin mxima. La longitud, tamao y tipo de cable usado afecta la impedancia de entrada. La Tabla 2 muestra la resistencia tpica del cable de cobre recocido a 25 C.
Seccin transversal ISO, mm2 0,5 0,75 1,5 2,5 4

Momentary Push Reset Button

Interlock Switch

Minotaur MSR6RT Safety Relay Monitoring Unit

Machine Controls Power Contactors

Figura 43
El interruptor de restablecimiento debe ubicarse en un lugar que proporcione una buena visibilidad de la fuente de peligro, de manera que el operador pueda verificar que el rea est despejada antes de la operacin.

Calibre AWG 20 18 16 14 12

por 1000 m
33.30 20.95 13.18 8.28 5.21

por 1000 pies


10.15 6.385 4.016 2.525 1.588

Restablecimiento automtico/manual
Algunos rels de seguridad Minotaur tienen restablecimiento automtico/manual. En este caso, la lnea de restablecimiento puede conectarse en puente, permitiendo as un restablecimiento automtico. Entonces el usuario debe proporcionar otro mecanismo para impedir el inicio de la mquina cuando se cierre la compuerta. Alternativamente, el usuario puede usar el circuito mostrado en la Figura 43, pero el Minotaur no podr detectar un interruptor de restablecimiento en cortocircuito ni un contacto auxiliar en cortocircuito en el contactor. Un dispositivo de restablecimiento automtico no requiere una accin de conmutacin manual, pero despus de la desactivacin, siempre conducir una verificacin de la integridad del sistema antes de restablecer el sistema.Un sistema de restablecimiento automtico no

Tabla 2

1-28

Principios de seguridad

Guardas de control
Corriente trmica incluida Designacin A150 A300 A600 B150 B300 B600 C150 C300 C600 D150 D300 E150 Utilizacin AC-15 AC-15 AC-15 AC-15 AC-15 AC-15 AC-15 AC-15 AC-15 AC-14 AC-14 AC-14 10 10 10 5 5 5 2.5 2.5 2.5 1.0 1.0 0.5 120 V 6 6 6 3 3 3 1.5 1.5 1.5 0.6 0.6 0.3 125 V 10 10 10 5 5 5 2.5 2.5 2.5 1.0 1.0 2.2 2.2 2.2 1.1 1.1 1.1 0.55 0.55 0.55 0.22 0.22

Corriente de operacin nominal Ie a voltaje de operacin nominal Ue 240 V 3 3 1.5 1.5 0.75 0.75 0.3 250 V 1.1 1.1 0.55 0.55 0.27 0.27 0.1 380 V 1.9 0.95 0.47 0.375 400 V 0.63 0.31 0.15 0.35 500 V 0.55 0.27 0.13 0.3 600 V 0.4 0.2 0.1 275 275 275 138 138 138 69 69 69 28 28 480 V 1.5 0.92 500 V 1.4 0.75 600 V 1.2 0.6 Cierre 7200 7200 7200 3600 3600 3600 1800 1800 1800 432 432 216

VA Apertura 720 720 720 360 360 360 180 180 180 72 72 36

Corriente continua N150 N300 N600 P150 P300 P600 Q150 Q300 Q600 R150 R300 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13 DC-13

275 275 275 138 138 138 69 69 69 28 28

Tabla 3 Nmero de dispositivos de entrada


El proceso de evaluacin de riesgos debe usarse para ayudar a determinar cuntos dispositivos de entrada deben conectarse a una unidad de rel de seguridad de monitoreo (MSRU) y con qu frecuencia deben verificarse los dispositivos de entrada. Para asegurar que los dispositivos de paro de emergencia y los enclavamientos de compuerta estn en estado operativo, su funcionamiento debe verificarse a intervalos regulares, segn lo determinado por la evaluacin de riesgos. Por ejemplo, un MSRU de entrada de dos canales conectado a una compuerta enclavada que debe abrirse en cada ciclo de la mquina (por ej., varias veces al da) quizs no necesite verificarse. Esto se debe a que la abertura de la guarda hace que el MSRU se autoverifique, as como sus entradas y sus salidas (dependiendo de la configuracin) para determinar si tiene fallos individuales. A mayor frecuencia de abertura de la guarda, mayor integridad del proceso de verificacin. Otro ejemplo pueden ser los dispositivos de paro de emergencia. Puesto que los dispositivos de paro de emergencia normalmente slo se usan para emergencias, stos generalmente se usan muy poco. Por lo tanto, un programa debe establecerse para ejecutar los

paros de emergencia y confirmar su efectividad segn un cronograma especificado. Un tercer ejemplo puede ser el acceso a puertas para ajustes de la mquina, los cuales, al igual que los dispositivos de paro de emergencia, quizs se usen con poca frecuencia. En este caso, tambin debe establecerse un programa para ejecutar los paros de emergencia segn un cronograma especificado. La evaluacin de riesgos ayudar a determinar si los dispositivos de entrada necesitan verificarse y con qu frecuencia. A mayor nivel de riesgo, mayor integridad requerida del proceso de verificacin. Y mientras menos frecuente sea la verificacin automtica, ms frecuente deber ser la verificacin manual impuesta. Especificaciones de salida Las especificaciones de salida describen la capacidad del dispositivo de proteccin de conmutar las cargas. Normalmente, las especificaciones de los dispositivos industriales se describen como resistivas o electromagnticas. Una carga resistiva puede ser un elemento calefactor. Las cargas electromagnticas generalmente son rels, contactores o solenoides; donde existe una alta caracterstica inductiva de la carga. El Anexo A del estndar IEC 60947-5-1, mostrado en la Tabla 3, describe las capacidades nominales de las cargas.

1-29

Principios de seguridad

Guardas de control
Letra de designacin: La designacin es una letra seguida por un nmero, por ejemplo A300. A300 La letra se refiere a la corriente trmica convencional incluida y si dicha corriente es directa o alterna. Por ejemplo A representa 10 amps. de corriente alterna. Los nmeros se refieren al voltaje de aislamiento nominal. Por ejemplo, 300 representa 300 V. Utilizacin: La utilizacin describe los tipos de cargas que el dispositivo est designado para conmutar. Las tres utilizaciones relevantes a IEC 947-5 se muestran en la Tabla 4.
Utilizacin AC-12 AC-13 AC-14 AC-15 DC-12 DC-13 DC-14 Descripcin de la carga Control de cargas resistivas y cargas de estado slido con aislamiento por acopladores pticos Control de cargas de estado slido con aislamiento de transformador Control cargas electromagnticas pequeas (menores que 72 VA) Cargas electromagnticas mayores que 72 VA Control de cargas resistivas y cargas de estado slido con aislamiento por acopladores pticos Control de cargas electromagnticas Control de cargas electromagnticas que tienen resistencias econmicas en el circuito

Principios y dispositivos de enclavamiento


Uno de los tipos ms importantes de dispositivos protectores es un interruptor de enclavamiento de seguridad que enclava una puerta de guarda con el suministro de energa de la fuente de peligro. Cuando la puerta de la guarda se abre, la alimentacin elctrica se asla, asegurando as que la mquina est segura cuando el operador requiere acceso. Hay muchas variaciones de interruptores de enclavamiento, cada uno con sus propias caractersticas. Es importante asegurar que el tipo de dispositivo seleccionado sea el correcto para su aplicacin. Posteriormente en este captulo examinaremos una serie de decisiones lgicas que conducen a la seleccin precisa del dispositivo a usar. Primero, familiaricmonos con algunas de las caractersticas y requisitos generales que hacen que los dispositivos sean apropiados para aplicaciones de enclavamiento. Estndares El estndar ISO 14119: Los dispositivos de enclavamiento asociados con guardas proporcionan pautas y estn diseados para su uso en conjunto con los estndares IEC 60947-5-1 para interruptores electromecnicos y un estndar equivalente para interruptores magnticos y de proximidad (IEC 60947-5-3). Confiabilidad Un interruptor de enclavamiento debe funcionar de manera confiable en condiciones extremas y de tratamiento brusco. El mecanismo de operacin debe ser lo ms simple posible y todos los materiales usados en su fabricacin deben ser de la ms alta calidad. El diseo debe asegurar que el desgaste del componente se mantendr al mnimo. El mecanismo debe estar dentro de un envolvente cerrado resistente. Seguridad La seguridad de un interruptor de enclavamiento depende de su capacidad de resistir intentos de cambiar el mecanismo. Un interruptor de enclavamiento debe estar diseado de manera que no pueda cambiarse fcilmente su mecanismo. En algunas circunstancias, el personal puede verse tentado de suprimir el interruptor de alguna manera. La informacin respecto al uso de la mquina, recolectada en la etapa de evaluacin de riesgos, ayudar a decidir cul es la posibilidad de que esto suceda. Entonces, cuanto ms posibilidad haya de que esto suceda, ms difcil deber ser la supresin del interruptor o sistema. El nivel de riesgo calculado tambin debe ser un factor en esta etapa. Hay interruptores disponibles con varios niveles de seguridad, desde resistencia a manipulacin impulsiva, hasta imposibilidad virtual de cambio del mecanismo. Debe anotarse en esta etapa que si se requiere un alto grado de seguridad, algunas veces es ms prctico lograrlo mediante la forma de montaje.

Tabla 4
Corriente trmica, Ith: La corriente trmica incluida convencional es el valor de corriente usado para las pruebas de subida de temperatura del equipo cuando est montado en un envolvente especificado. Voltaje Ue y corriente Ie de operacin nominal; El voltaje y la corriente de operacin nominal especifican las capacidades de cierre y apertura de los elementos de conmutacin bajo condiciones de operacin normal. La capacidad nominal de los productos Guardmaster de AllenBradley es 125 VCA, 250 VCA y 24 VCC. Consulte con la fbrica para obtener informacin sobre uso a voltajes diferentes a estas capacidades nominales especificadas. VA: Las especificaciones de VA (Voltaje x Amperios) indican las especificaciones de los elementos de conmutacin cuando se cierra el circuito y cuando se abre el circuito. Ejemplo 1: Una capacidad nominal de A150, CA-15 indica que los contactos pueden cerrar un circuito de 7200 VA. A 120 VCA, los contactos pueden cerrar un circuito de entrada al momento del arranque de 60 amp. Puesto que CA-15 es una carga electromagntica, los 60 amp tienen una corta duracin; la corriente de entrada al momento del arranque de la carga electromagntica. La apertura del circuito es slo 720 VA porque la corriente de estado listo de la carga electromagntica es 6 A, que es la corriente de operacin nominal. Ejemplo 2: Una capacidad nominal de N150, CC-13 indica que los contactos pueden cerrar un circuito de 275 VA. A 125 VCA, los contactos pueden cerrar un circuito de 2.2 amp. Las cargas electromagnticas de CC no tienen una corriente de entrada al momento del arranque como las cargas electromagnticas de CA. La apertura del circuito tambin es 275 VA porque la corriente de estado listo de la carga electromagntica es 2.2, que es la corriente de operacin nominal.

1-30

Principios de seguridad

Guardas de control
contactos. En el caso de fallo del resorte, contactos soldados o adheridos, el sistema fallar, produciendo una situacin de peligro y por lo tanto es inaceptable. Este tipo de sistema puede desactivarse fcilmente empujando el pistn mientras la guarda est abierta. Peor an, el interruptor puede ser disparado accidentalmente por un operador que se apoye sobre la mquina, o entre a sta, mientras la guarda est abierta. Nota: Puede ser aceptable en algunas aplicaciones usar un interruptor
operativo en modo negativo junto con un dispositivo en modo positivo.

Figura 44
Por ejemplo, si el interruptor se monta como en la Figura 44 con un carril de cobertura, no habr acceso al interruptor con la puerta de la guarda abierta. La naturaleza de cualquier medida de prevencin contra el cambio tomada en la etapa de equipamiento depender del principio de operacin del interruptor. Modo de operacin positivo (llamado tambin abertura directa) ISO TR 12100-2 explica que si un componente mecnico mvil inevitablemente mueve otro componente, ya sea por contacto directo o mediante elementos rgidos, se dice que estos componentes estn conectados en el modo positivo. Con interruptores de enclavamiento mecnicos simples, cuando la guarda se abre, el movimiento de la guarda debe conectarse en el modo positivo a los contactos de seguridad del interruptor. Esto asegura que los contactos se separen fsicamente o se desconecten por fuerza debido al movimiento de la guarda. El interruptor NO debe depender nicamente de la presin del resorte para abrir los contactos, ya que la fuerza ejercida quizs no sea suficiente en el caso de contactos adheridos o soldados. Tambin existe la posibilidad de peligro si el interruptor falla por rotura del resorte y no hay otra manera de abrir los contactos.

ta d Puer

e la

da guar

Modo positivo Forzado Desconexin Prevalece Soldadura de contacto

Figura 46
La Figura 46 muestra un ejemplo simple de operacin en modo positivo que ofrece desconexin forzada de los contactos. Una leva se monta sobre la bisagra de la puerta de manera que haga funcionar directamente los contactos cada vez que se abre la puerta de la guarda. La presin del resorte slo puede cerrar los contactos cuando la guarda est completamente cerrada. Una rotura del resorte slo resultar en un fallo y el retorno a una condicin de seguridad. Envolvente El principio de operacin de modo positivo mostrado en la Figura 46 se usa cada vez que es pertinente en los interruptores de enclavamiento Guardmaster. Estos tambin evitan un posible abuso mediante la instalacin del bloque de contactos y la leva en un envolvente resistente y seguro. Esto significa que la leva y el bloque de contactos no pueden separarse y es imposible cambiar el mecanismo del interruptor cortando otra ranura en la leva. El principio es adaptado ms an para interruptores de enclavamiento con operacin de lengeta tal como se muestra en la Figura 47. Estos dispositivos son ampliamente usados y se incorporan fcilmente en el borde de abertura de la guarda y pueden usarse en puertas de guardas deslizantes, con bisagra y extrables. La lengeta de activacin se monta sobre la puerta de la guarda y la abertura de la guarda hace que la lengeta fuerce la desconexin de los contactos. El mecanismo del interruptor est montado en un envolvente y el principio de activacin de la lengeta est diseado para resistir la manipulacin indebida.

la ta de Puer

da guar

Contactos adheridos o soldados

Figura 45
La Figura 45 muestra un sistema operativo en modo negativo (o no positivo) tpico. No existe un vnculo directo entre la puerta de la guarda y los contactos de seguridad, de manera que el sistema depende completamente de la presin del resorte para abrir los

1-31

Principios de seguridad

Guardas de control
Aislamiento galvnico La Figura 48 muestra bloques de contactos con dos conjuntos de contactos. Se requiere una barrera de aislamiento galvnico si es posible que los contactos entren en contacto uno con otro consecutivamente en el caso de soldadura o adherencia de contactos.

Desconexin forzada

Cruce de voltaje

Figura 47
Idoneidad Como mnimo, todos los diseos y materiales deben ser capaces de resistir las tensiones de operacin y las influencias externas. Otros principios de seguridad En el caso de dispositivos no mecnicos, no hay contacto fsico (en condiciones normales) entre el interruptor y el accionador. Por lo tanto, no puede usarse el modo de operacin positivo como manera de asegurar la accin de conmutacin y se necesita usar otros mtodos, segn se indica a continuacin. Modo orientado a fallo Con dispositivos simples podemos usar componentes con modo orientado a fallo, segn se explica en ISO TR 12100-2. Esto significa usar componentes en los que el modo de fallo predominante se conoce con anticipacin y siempre es el mismo. El dispositivo se disea de manera que cualquier cosa que pueda causar un fallo tambin har que el dispositivo se desactive. Un ejemplo de un dispositivo que usa esta tcnica es el interruptor de enclavamiento accionado magnticamente sin contactos Guardmaster FERROGARD. Los contactos se conectan con un dispositivo interno de proteccin contra sobrecorriente que no puede restablecerse. Una situacin de sobrecorriente en el circuito conmutado resultar en un circuito abierto en el dispositivo protector diseado para funcionar a una corriente muy por debajo de lo que pondra en peligro los contactos de seguridad. Duplicacin (llamada tambin redundancia) Si en el diseo se usan componentes que no son inherentemente seguros y stos son crticos para la funcin de seguridad, entonces puede proporcionarse un nivel aceptable de seguridad mediante la duplicacin de esos componentes o sistemas. En caso de fallo de un componente, el otro puede realizar la funcin. Generalmente es necesario proporcionar monitoreo para detectar el primer fallo a fin de que, por ejemplo, un sistema de dos canales no se degrade a un solo canal sin que alguien se haya percatado de ello. Debe prestarse atencin a los fallos por causas comunes. Debe haber proteccin contra cualquier fallo que cause que todos los componentes (o canales) duplicados fallen simultneamente. Las medidas apropiadas pueden incluir usar diversas tecnologas para cada canal o asegurar un modo orientado a fallo.

Barrera de aislamiento galvnico

Figura 48
Formas de dispositivos de enclavamiento tpicos En trminos generales, hay dos tipos bsicos de sistemas de enclavamiento elctrico, cuyas caractersticas se muestran en la Figura 49.

Enclavamiento de control

Enclavamiento de alimentacin elctrica

Sin bloqueo de guarda

Con bloqueo de guarda

Dispositivos mecnicos

Dispositivos sin contacto

Desenclavamiento de guarda incondicional

Desenclavamiento de guarda condicional

Figura 49
Enclavamiento de alimentacin elctrica: El suministro de energa de la fuente de peligro se interrumpe directamente debido a la abertura de la guarda. Enclavamiento de control: El suministro de energa de la fuente de peligro es interrumpido por la conmutacin de un circuito que controla el dispositivo de conmutacin de alimentacin. El siguiente texto describe el enclavamiento de las fuentes de alimentacin elctrica, ya que ste es el requisito ms comn, pero los mismos principios bsicos pueden aplicarse a sistemas hidrulicos y pneumticos. Enclavamiento de alimentacin elctrica El movimiento de la guarda se enclava con la conmutacin directa de la alimentacin elctrica de la fuente de peligro. Para equipos que usan bajo voltaje y alimentacin elctrica, se pueden usar para enclavamiento de la alimentacin la mayora de tipos de interruptores de enclavamiento. Pero puesto que la mayora de maquinarias industriales usan un suministro trifsico de alimentacin relativamente alta, necesitamos sistemas de enclavamiento de alimentacin de diseo especfico con un conmutador de interrupcin de la alimentacin capaz de manejar y abrir la carga de manera confiable.

1-32

Principios de seguridad

Guardas de control

A A

Figura 50
El mtodo ms prctico de enclavamiento de la alimentacin es un sistema con atrapamiento de llave tal como el sistema PROSAFE (vea la Figura 50). El interruptor de aislamiento de la alimentacin funciona mediante una llave que queda atrapada en su posicin mientras el interruptor est en posicin de activado. Cuando se gira la llave, los contactos del interruptor de aislamiento se enclavan en la posicin abierta (aislando el suministro de alimentacin elctrica) y la llave puede retirarse. La puerta de la guarda se enclava en posicin cerrada y la nica manera de desenclavarla es usando la llave del aislador. Cuando la llave se gira para liberar la unidad de bloqueo de la guarda, sta queda atrapada en su posicin y no puede retirarse hasta que la guarda se cierre y se bloquee nuevamente. Por lo tanto, es imposible abrir la guarda sin aislar primero la fuente de alimentacin elctrica, y tambin es imposible conectar la alimentacin elctrica sin cerrar y bloquear la guarda. Este tipo de sistema es sumamente confiable y tiene la ventaja de no requerir cableado elctrico a la guarda. La principal desventaja es que debido a que se requiere la transferencia de la llave cada vez, no es apropiado si se requiere acceso frecuente a la guarda.

Figura 52
Gire la llave A y qutela del aislador de alimentacin elctrica. La alimentacin elctrica se desactiva. Para obtener acceso a travs de las puertas de la guarda, la llave A se inserta y se gira en la unidad de intercambio de llave. Luego ambas llaves B se sueltan para proteger los enclavamientos. La llave A queda atrapada evitando que se active la alimentacin elctrica. Dos llaves C se sueltan de los enclavamientos de la puerta de la guarda para uso en el siguiente paso de la secuencia o como llaves personales (vea la Figura 53).

Figura 53
Las Figuras 54 y 55 muestran otros ejemplos de aplicaciones de enclavamiento mediante atrapamiento de llave; usando unidades de enclavamiento de doble llave y llaves con cdigos diferentes junto con una unidad de intercambio de llave, es posible formar sistemas complejos. Adems de asegurar el aislamiento de la alimentacin elctrica antes de obtener el acceso, tambin se puede usar el sistema para asegurar una secuencia de operacin predefinida.

Figura 51
Cada vez que se requiera acceso del cuerpo completo, se recomienda el uso de una llave personal, tal como se muestra en la Figura 51. El rango del sistema PROSAFE est disponible en versiones de doble llave para requisitos de este tipo. El uso de una llave personal asegura que el operador no podr quedar bloqueado en el rea protegida. La llave tambin puede usarse para interruptores de modo aprendizaje robticos, controles de modo microavance, etc.

Figura 54

1-33

Principios de seguridad

Guardas de control
Interruptores de enclavamiento sin bloqueo de guarda Estos dispositivos no restringen el acceso y la puerta de la guarda puede abrirse en cualquier momento, pero tan pronto como se abre, el interruptor asla la alimentacin elctrica a la fuente de peligro mediante el circuito de control de contactores. Si el peligro siempre se elimina inmediatamente y el operador no puede tocar las piezas mientras son peligrosas, entonces se cumplen los requisitos de seguridad. SI EL PELIGRO NO SE ELIMINA INMEDIATAMENTE, existe la posibilidad de que un operador pueda tocarlo mientras est en proceso de desactivacin y todava es peligroso. Para evitar esta situacin inaceptable hay tres alternativas: 1. Use un dispositivo de enclavamiento con bloqueo de guarda para evitar que se abra la guarda antes que se elimine el peligro. (Vea la Figura 56).

Figura 55
Caractersticas requeridas Puesto que toda la seguridad de este tipo de sistema depende de su operacin mecnica, es importante que los principios y materiales usados sean adecuados para las demandas esperadas. Si un interruptor de aislamiento es parte del sistema, ste debe tener un modo de operacin positivo y debe satisfacer los requisitos pertinentes de la norma IEC 60947. La integridad y la seguridad del sistema se basan en el hecho de que en ciertas condiciones las llaves quedarn atrapadas en su lugar, por lo tanto deben asegurarse dos funciones bsicas: 1. EL ENCLAVAMIENTO SLO PODR FUNCIONAR MEDIANTE LA LLAVE DEDICADA. Esto significa que no ser posible cambiar el enclavamiento usando destornilladores, etc., ni cambiar el mecanismo mediante manipulacin indebida. En los casos que haya ms de un enclavamiento en el mismo lugar, esto significa que la especificacin de los cdigos de llave deber evitar cualquier posibilidad de una operacin falsa. 2. NO SER POSIBLE OBTENER LA LLAVE DE NINGUNA OTRA MANERA QUE LA ESPECIFICADA. Esto significa, por ejemplo, que una vez que la llave queda atrapada, cualquier fuerza excesiva aplicada sobre sta resultar en la rotura de la llave y no en la rotura del enclavamiento. Enclavamiento de control El enclavamiento de control es el mtodo de enclavamiento usado ms comnmente. Se acopla un interruptor de enclavamiento a la guarda para detectar el movimiento y abrir los contactos de conmutacin cada vez que la guarda no est completamente cerrada. Los contactos se conectan a travs de un circuito de control al elemento de control primario (contactor) de la fuente de peligro. Deben tenerse en cuenta las consideraciones del circuito de control. Observe los diferentes tipos de dispositivos apropiados para enclavamiento de control que se ilustran en la Figura 49 (pgina 32). La primera distincin importante es entre dispositivos con bloqueo de guarda y sin bloqueo de guarda.

Figura 56
2. Instale alguna forma de dispositivo de freno para lograr un paro rpido. (Vea la Figura 57). Nota: La integridad del dispositivo de freno debe considerarse en trminos de resistencia al fallo y caractersticas de desgaste.

D.C . INJ EC BRA TION KE

Figura 57
3. La distancia entre la fuente de peligro y la puerta de la guarda debe permitir que la eliminacin del peligro sea ms rpida que el tiempo que a un operador le tome entrar en contacto con la fuente de peligro. (Vea la Figura 58).

1-34

Principios de seguridad

Guardas de control

Figura 59 Figura 58
Si se requiere un clculo preciso, el estndar EN 999 indica el posicionamiento del equipo protector con respecto a las velocidades de aproximacin de partes del cuerpo humano. Actualmente no cubre especficamente puertas de guardas de enclavamiento, pero los principios para el posicionamiento de otros dispositivos de seguridad en base a velocidad de aproximacin y tiempo de paro de la mquina pueden extrapolarse razonablemente para cubrir puertas de guardas enclavadas sin bloqueo de guarda. La siguiente frmula de la norma EN 999 ofrecer resultados confiables. S = (K x T) + C Donde: S = La distancia mnima en mm desde la zona de peligro hasta el borde de abertura de la guarda. K = 1600 (sugerido). Este parmetro se basa en datos de investigacin que muestran que es razonable suponer una velocidad de aproximacin por el operador de 1600 mm por segundo. Deben tenerse en cuenta las circunstancias de la aplicacin real. Como pauta general, la velocidad de aproximacin vara de 1600 a 2500 mm por segundo. T = El tiempo total de paro del sistema, por ej., el tiempo total (segundos) desde la abertura de los contactos del interruptor de enclavamiento a la eliminacin del peligro. C = Una distancia adicional en milmetros basada en una posible intrusin hacia la zona de peligro. Esto depender de la posibilidad de pasar por arriba, alrededor, o a travs de la guarda, antes que los contactos se abran. Por ejemplo, la estructura de la guarda puede permitir que un dedo, la mano o el brazo se extienda a travs de la guarda. Los estndares EN 294 y EN 811 proporcionan ms informacin sobre el clculo de distancias de aproximacin. La siguiente seccin sobre dispositivos de enclavamiento sin bloqueo de guarda es su designacin como accionamiento mecnico o accionamiento sin contacto. Dispositivos de accionamiento mecnico Con estos dispositivos, la puerta de la guarda est vinculada mecnicamente a los contactos del circuito de control del interruptor mediante operacin de modo positivo. Hay tres tipos principales de accionamiento mecnico. stos son: Accionamiento mediante lengeta Con el interruptor Guardmaster Cadet mostrado en la Figura 59, la lengeta del accionador montado en la guarda abre o cierra los contactos a travs del mecanismo interno. Caractersticas La lengeta y el mecanismo estn diseados para impedir un fcil cambio del mecanismo del interruptor. Estos dispositivos son confiables y fciles de instalar. Pueden usarse en guardas deslizables, con bisagra y desmontables y su versatilidad hace que sean los interruptores de enclavamiento de uso ms comn. Para consideracin: La lengeta montada en la guarda necesita permanecer razonablemente bien alineada con el agujero de entrada en el cuerpo del interruptor. Los interruptores con accionamiento de lengeta pueden ser difciles de limpiar a fondo. Esto puede ser un problema en las industrias de alimentos y bebidas y en la industria farmacutica. Accionamiento mediante bisagra El dispositivo est montado sobre el pasador de la bisagra de una guarda con bisagra, tal como se muestra en la Figura 60. La abertura de la guarda se transmite mediante un mecanismo de operacin de modo positivo a los contactos del circuito de control.

Figura 60

1-35

Principios de seguridad

Guardas de control
Caractersticas Cuando se instalan correctamente, estos tipos de interruptores son ideales para la mayora de puertas de guarda con bisagra, donde hay acceso a la lnea central de la bisagra. Pueden aislar el circuito de control dentro de un intervalo de 3 de movimiento de la guarda y su mecanismo es prcticamente imposible de cambiar sin desmantelar la guarda. Para consideracin: Debe tenerse cuidado ya que un movimiento de abertura de slo 3 puede resultar en un espacio significativo en el borde de la abertura en puertas de guarda de gran ancho. Tambin es importante asegurar que una guarda pesada no ejerza tensin excesiva sobre el eje del accionador del interruptor. Accionamiento mediante leva Este tipo de configuracin generalmente toma la forma de un interruptor de final de carrera (o de posicin) de modo positivo y una leva lineal o rotativa (tal como se muestra en la Figura 61). Generalmente se usa en guardas deslizantes y cuando la guarda se abre, la leva fuerza el pistn hacia abajo para abrir los contactos del circuito de control.

Guarda cerrada

Interruptor de final de carrera no accionado por modo positivo

Interruptor de final de carrera de accionamiento por modo positivo

Figura 62
A menudo se aconseja usar dos interruptores, tal como se muestra en la Figura 62. Accionamiento sin contacto (no mecnico) Con estos dispositivos, la puerta de la guarda est vinculada a los contactos del circuito de control del interruptor mediante un campo magntico o electrnico. Para que estos tipos de dispositivo sean apropiados para servicio de enclavamiento, deben incorporar mejoras que aseguren una operacin satisfactoria. Puesto que no tienen el beneficio de una operacin de modo positivo verdaderamente mecnica, los interruptores sin contactos tienen otras maneras de asegurar que no fallarn causando una condicin de peligro. Esto se logra mediante los principios del modo orientado a fallo o mediante el uso de duplicacin y monitoreo. El Guardmaster Ferrogard usa el principio del modo orientado al fallo. Debido al uso de componentes especiales, el nico fallo crtico de seguridad que podra ocurrir sera una soldadura de los contactos encapsulados debido a una aplicacin de corriente excesiva al interruptor, tal como se ilustra en la Figura 63.
Accionador magntico configurado en envolvente cerrado Dispositivo de proteccin contra sobrecorriente no restablecible

Interruptor de final de carrera de modo positivo

Figura 61
Caractersticas La simplicidad del sistema permite que el interruptor sea compacto y confiable. Para consideracin: No puede usarse en guardas desmontables. Es muy importante que el pistn del interruptor slo pueda extenderse cuando la guarda est totalmente cerrada. Esto significa que puede ser necesario instalar retenes adicionales para limitar el movimiento de la guarda en ambas direcciones. Es necesario fabricar una leva con un perfil apropiado que funcione dentro de las tolerancias definidas. La leva montada en la guarda nunca debe separarse del interruptor, ya que esto causar que se cierren los contactos del interruptor. Un sistema de este tipo puede tener tendencia a fallos debido al desgaste, especialmente cuando existe el factor de levas con un perfil incorrecto o la presencia de materiales abrasivos.

Campo de accionamiento

Interruptor en envolvente sellado

Contactos encapsulados para servicio pesado de perfil especial

Fusible externo clasificado para proteger dispositivo de enclavamiento

Figura 63
Esto se evita usando un dispositivo interno de proteccin contra sobrecorriente que no puede restablecerse. Existe un gran margen de seguridad entre la capacidad nominal de este dispositivo y los contactos encapsulados. Puesto que no puede restablecerse, el interruptor debe ser protegido mediante un fusible externo con capacidad nominal apropiada. Es importante que el dispositivo sea activado slo por el accionador indicado. Esto significa que los dispositivos de proximidad ordinarios que detectan objetos de metal ferroso no son apropiados. El interruptor debe ser activado por un accionador activo.

1-36

Principios de seguridad

Guardas de control
La seguridad puede aumentarse ms an mediante codificacin tal como la del Guardmaster Ferrotek. Este interruptor usa el mismo principio de modo orientado a fallo que el Ferrogard, pero ofrece mayor seguridad debido a su accionador y detector codificados. Caractersticas Los dispositivos sin contactos estn disponibles en versiones totalmente selladas, lo cual los hace ideales para aplicaciones de la industria de alimentos y bebidas, ya que no tienen trampas de suciedad y pueden limpiarse a presin. Son sumamente fciles de aplicar y tienen una considerable tolerancia de operacin, de manera que pueden aceptar alguna distorsin o desgaste de la guarda y seguir funcionando correctamente. Desenclavamiento de guarda incondicional Estos dispositivos funcionan manualmente y la guarda puede abrirse en cualquier momento. Una manija o perilla que libera el bloqueo de la guarda tambin abre los contactos del circuito de control. En un dispositivo tal como el interruptor de perno Guardmaster Centurion, se impone un retardo de tiempo. El perno que bloquea la guarda en su lugar hace funcionar los contactos y se retrae rotando la perilla de operacin. Las primeras rotaciones abren los contactos pero el perno de bloqueo no se retrae totalmente hasta que se rota la perilla muchas veces ms (lo cual toma hasta 20 segundos). El sistema de llave con trampa Prosafe (vea la seccin de enclavamiento de alimentacin elctrica) tambin puede proporcionar un bloqueo de guarda incondicional. Caractersticas Estos dispositivos se aplican fcilmente y son sumamente resistentes y confiables. El interruptor de perno con retardo de tiempo es apropiado principalmente para guardas deslizantes. Para consideracin: El tiempo de paro de la fuente de peligro debe ser predecible y no debe ser posible la retraccin del perno antes que se haya eliminado el peligro. Slo debe ser posible extender el perno a su posicin enclavada cuando la guarda est totalmente cerrada. Esto significa que ser necesario aadir retenes para restringir el desplazamiento de la puerta de la guarda, tal como se muestra en la Figura 66.

Wiga

4HR n WN2 6

0942

5516

Ferrocode
Safety Switch dc 28V 1A Vac 120 0.5A

Hasta 6 interruptores

IP 67

e in Mad England

X1

X2

Red
R

Blk Blue

Wht

Seguridad 1

er Pr Tamp Safety 1
Aux

it ol Un Contr

Safety

2 Grn

Yel

Figura 64
Los dispositivos sin contacto sofisticados, tales como el Guardmaster Ferrocode, cuentan con un principio de codificacin electrnica. Ferrocode tambin tiene dos canales de conmutacin separados y diversos y una unidad de control disponible que monitorea hasta seis conjuntos de detectores ms los contactores y el cableado (vea la Figura 64). Para consideracin: Para los tipos de accionamiento ms simples, si la seguridad es un factor importante, quizs sea necesario aplicarlos tal como se muestra en la Figura 65, de manera que no pueda accederse a ellos mientras la guarda est abierta. Es importante, especialmente para los tipos sin codificacin, que no estn sujetos a interferencias externas proveniente de campos magnticos/elctricos.
rea peligrosa
Paro interruptor Accionador

Auxiliar

e ocod m Ferr oof Safety Syste

Seguridad 2

. r Ltd aste 2 4HR rdm .WN Gua land551 66 Eng 2 an, Wig Tel: 094

Fuente de alimentacin control elctrica

Unidad de

Monitoreo de contactores

Figura 66
Desenclavamiento de guarda condicional Con estos dispositivos, la guarda slo puede abrirse a la recepcin de una seal que muestra que: El contactor est desactivado.

Guarda deslizante Guarda abiertaMquina paradaGuarda cubriendo interruptor

Figura 65
Interruptores de enclavamiento con bloqueo de guarda Estos dispositivos son apropiados para mquinas con caractersticas de descarga, pero tambin pueden ofrecer un aumento significativo del nivel de proteccin para la mayora de tipos de mquinas. Proporcionan el enclavamiento de la fuente de alimentacin peligrosa con el movimiento de la guarda y evitan la abertura de la guarda hasta que sea seguro hacerlo. Estos dispositivos pueden dividirse en dos tipos: desenclavamiento de guarda incondicional y condicional.

Ha transcurrido un intervalo de tiempo preseleccionado o, alternativamente, el movimiento peligroso se ha detenido. Estas seales generalmente se derivan de los contactos auxiliares del contactor y de una unidad temporizadora tal como el Guardmaster CU1 o una unidad de deteccin de movimiento interrumpido tal como el Guardmaster CU2. Proporcionan el enclavamiento de la fuente de alimentacin peligrosa con el movimiento de la guarda y tambin evitan la abertura de la guarda hasta que sea seguro hacerlo. Puesto que se requiere una seal generada externamente para la liberacin del bloqueo, esto los hace especialmente apropiados para uso con PLC u otros mquinas controladas mediante electrnica programable.

1-37

Principios de seguridad

Guardas de control
R2 R1 R3

Indicador remoto
K1

Arranque Paro

Contactos de circuitos auxiliares y control de seguridad Lengeta del accionador montado en la guarda Solenoide con liberacin de bloqueo

A1

R2 R1 R3
Solenoide

Contactos de seguridad

Unidad de temporizador CU1


A2 13 14 K1

Interruptor de bloqueo de solenoide

Figura 69
Con la configuracin mostrada en la Figura 69, el interruptor no desenganchar la guarda hasta que el contactor est desactivado y haya transcurrido un intervalo de tiempo preseleccionado. El rango de tiempo puede establecerse entre 0.1 segundos a 40 minutos. El tiempo de paro ms largo de la mquina debe ser predecible y constante.. No debe depender de mtodos de freno que pueden degradarse con el uso.

Figura 67
El mejor tipo de dispositivo de enclavamiento para estos propsitos es un interruptor de bloqueo accionado por solenoide tal como el Guardmaster TLS-GD2 (como se muestra en la Figura 67) o el Atlas 4. Para aplicaciones de acceso menos frecuente, el sistema con atrapamiento de llave Prosafe (vea la seccin de enclavamiento de alimentacin elctrica) puede configurarse para funcionar de esta manera.
Interruptor de enclavamiento con bloqueo de solenoide (se muestra Titan)
Paro

A1 X1 K1

K1

Arranque Paro

X2

Unidad de deteccin de movimiento CU2

N P N P N P 13 14 A2

Arranque Circuito de seguridad

Detec tor

Detect or
Solenoide

Contactos de Interruptor de bloqueo de seguridad solenoide

42 54 A2 A1

41 53

12 22 34

11 21 33

Solenoide con liberacin de bloqueo

Circuito indicador

Figura 70
Con la configuracin mostrada en la Figura 70, el interruptor no desenganchar la guarda hasta que el contactor est desactivado y se haya detenido todo el movimiento. En los sistemas mostrados en las Figuras 69 y 70, la mquina es detenida por su sistema de control operativo ya sea manual o automticamente. Por lo tanto, estos sistemas son especialmente tiles en mquinas donde podra ocurrir dao a la mquina o prdida del programa debido a un paro total del sistema causado por la abertura de la guarda. Preguntas tiles para la seleccin de dispositivos de enclavamiento Las siguientes preguntas le ayudarn a realizar una seleccin lgica del tipo ms apropiado de dispositivo de enclavamiento. Requiere la mquina tiempo para descargarse despus del aislamiento de la alimentacin elctrica? S = Es posible que se requiera bloqueo de guarda con retardo temporizado. Es predecible y constante el tiempo de paro de la mquina? NO = Posiblemente se requiera bloqueo de guarda condicional con deteccin de movimiento.

Figura 68
En el ejemplo mostrado en la Figura 68, el peligro deja de existir tan pronto como la alimentacin elctrica es aislada mediante la desactivacin de la mquina en los controles normales. La guarda no puede abrirse hasta que el contactor est desactivado. Una vez que la guarda se abre, los contactos del circuito de control aseguran que el contactor no pueda reactivarse hasta que la guarda est cerrada y bloqueada.

1-38

Principios de seguridad

Cortinas de luz de seguridad


Se requiere acceso de todo el cuerpo? S = Posiblemente se requiera bloqueo de guarda operado con llave personal. Puede un paro total causar dao de la mquina o del sistema de control? S = Es posible que se requiera bloqueo de guarda condicional. Habr desgaste de la guarda que cause desalineamiento en el dispositivo de enclavamiento? S = Es posible que se requiera un dispositivo sin contactos. Necesita el dispositivo estar totalmente sellado, por ej., para ambientes con proyecciones de agua o alta humedad? S = Es posible que se requiera un dispositivo sin contactos. Se requiere acceso frecuente? S = Posiblemente el enclavamiento de control sea lo ms apropiado. Es probable que hayan intentos de cambiar el mecanismo del dispositivo de enclavamiento? S = Posiblemente se requiere un dispositivo con mayor seguridad.

Confiabilidad del control


La confiabilidad del control es un concepto que aparece en la serie de estndares ANSI B11 y en OSHA 1910.217. La definicin que aparece en el estndar B11 ms reciente es, La capacidad del sistema de control de mquina, proteccin, otros componentes de control e interfaces relacionadas de lograr un estado de seguridad en caso de un fallo de sus funciones de seguridad. Se puede obtener un sistema que cumpla con este requisito mediante una estrategia de diseo, mtodo o caracterstica que separe las funciones de seguridad de un sistema en componentes, mdulos, dispositivos o sistemas que puedan ser monitoreados o verificados por otros componentes, mdulos, dispositivos o sistemas. Aplicar los tres conceptos simples siguientes ayuda a asegurar el rendimiento de la funcin de seguridad. Redundanciauso de mtodos idnticos Diversidaduso de mtodos diferentes Monitoreouso de mtodos de verificacin La seleccin e integracin de componentes, mdulos, dispositivos y sistemas diseados especficamente para uso en funciones de seguridad tambin contribuye a lograr el control. Un proceso de diseo disciplinado es vital para lograr un diseo completo y preciso, y debe usarse para asegurar la confiabilidad del control. En trminos de proteccin optoelectrnica, esto significa que el sistema de cortina de luz de seguridad debe poder enviar una seal de paro a la mquina aun en el caso de fallo(s) de un componente. Las cortinas de luz de seguridad tienen dos salidas de monitoreo cruzado diseadas para cambiar de estado cuando se rompe el campo de deteccin de la cortina de luz de seguridad. Si una de las salidas falla, la otra salida responde y enva una seal de paro a la mquina controlada, y como parte del sistema de monitoreo cruzado detecta que la otra salida no cambi de estado o no respondi. Entonces el sistema entra en una condicin de bloqueo, la cual evita la operacin de la mquina hasta que se repare la cortina de luz de seguridad. El restablecer las cortinas de luz de seguridad o desconectar y volver a conectar la alimentacin elctrica no borrar la condicin de bloqueo.

Cortinas de luz de seguridad


Las cortinas de luz de seguridad son detectores de presencia fotoelctricos diseados especficamente para proteger al personal de la planta de lesiones relacionadas a movimiento peligroso de la mquina. Conocidas tambin como AOPD (dispositivos de proteccin optoelectrnica activa) las cortinas de luz ofrecen una seguridad ptima, permiten mayor productividad y son la solucin ms ergonmica en comparacin con las guardas mecnicas. Son ideales para aplicaciones donde el personal necesita acceso frecuente y fcil a un punto de peligro.

Operacin
Las cortinas de luz de seguridad constan de una pareja de emisor y receptor que crea una barrera de mltiples haces de luz infrarroja en frente o alrededor de un rea peligrosa. Cuando algunos de los haces es bloqueado por intrusin en el campo de deteccin, el circuito de control de la cortina de luz de seguridad enva una seal al dispositivo de paro de emergencia de la mquina. El emisor y el receptor pueden interconectarse a una unidad de control que proporcione la lgica, salidas, diagnstico de sistema y funciones adicionales necesarias (silenciamiento, supresin, PSDI) para satisfacer las necesidades de la aplicacin. Cuando se instala sola, la cortina de luz funcionar como interruptor de control confiable. Para eliminar la sensibilidad a disparos falsos atribuidos a la luz ambiental e interferencias de otros dispositivos optoelectrnicos, los indicadores LED del emisor son pulsados a un rgimen especfico (frecuencia modulada), con pulsos secuenciales de cada indicador LED de manera que un emisor slo puede afectar al receptor asociado con ste. Si bien este mtodo se presta para mayor seguridad, las cortinas de luz deben ofrecer proteccin adicional en trminos de confiabilidad del control.

Tipos y funciones
Las cortinas de luz de seguridad Guardmaster de Allen-Bradley pertenecen a tres familias de productos: Control de Punto de Operacin (POC), Control de Acceso a Area (AAC) y Control de Acceso a Permetro (PAC). Control de punto de operacin (POC) Las cortinas de luz de seguridad POC usan una pareja de cabezas pticas para crear una cortina de luz infrarroja que permite al personal un acceso frecuente y fcil a los peligros del punto de operacin. Estas cortinas de luz de seguridad se usan cuando el operador necesita hacer interface con maquinaria a una distancia relativamente corta del rea peligrosa. Las cortinas de luz de seguridad de punto de operacin Guardmaster de Allen-Bradley

1-39

Principios de seguridad

Cortinas de luz de seguridad


estn disponibles en resoluciones de 14 mm y 30 mm para proteccin de los dedos y de la mano, respectivamente. peligrosa. Cuando alguien entra al permetro protegido, la cortina de luz de seguridad enva una seal de paro a la mquina protegida, deteniendo el movimiento peligroso de la mquina y protegiendo al personal.

Figura 71: POC


Control de acceso a rea (AAC) AAC es un sistema de margen largo (hasta 275 pies) que utiliza unidades de emisor y receptor de un solo haz para crear una barrera protectora alrededor de mquinas peligrosas, incluyendo celdas robticas, estaciones de transferencia, paletizadoras y mquinas de carga. Se utiliza la rotura del haz para detener el movimiento de la mquina peligrosa. Mediante el uso de espejos de esquina se logra control de acceso de dos haces o mltiples lados.

Figura 73: PAC


SupresinFija y flotante La supresin permite inhabilitar porciones de un campo de deteccin de la cortina de luz de seguridad para que sta ignore los objetos tpicamente asociados con el proceso. Cuando este objeto es estacionariopor ej., accesorios de montaje, un accesorio de la mquina, herramienta o transportadortambin lo es la porcin de supresin del haz. Esta funcin, conocida como supresin fija, requiere que el objeto est en el rea especificada en todo momento. Si alguno de los haces programados como suprimidos no son bloqueados por el accesorio o pieza de trabajo, se enva una seal de paro a la mquina.
Haz de supresin fija

Trayectoria de trabajo de los rodillos

Pieza de trabajo

Figura 72: AAC


Control de acceso a permetro (PAC) Las cortinas de luz de seguridad PAC utilizan una pareja de emisor y receptor para crear una barrera de un haz o mltiples haces (1, 2, 3 4 haces) para deteccin de todo el cuerpo alrededor de la maquinaria

Figura 74: Supresin fija

1-40

Principios de seguridad

Cortinas de luz de seguridad


La supresin flotante permite que un objeto, como por ejemplo material de alimentacin, penetre en el campo de deteccin en cualquier punto sin parar la mquina. Esto se realiza inhabilitando hasta dos haces de luz en cualquier lugar dentro del campo de deteccin. En lugar de crear una ventana fija, los haces suprimidos se mueven hacia arriba y hacia abajo, es decir flotan segn sea necesario. Dependiendo del nmero de haces flotantes, cualquiera de dos haces puede bloquearse en cualquier lugar del campo protector sin que el sistema enve una seal de paro a la maquinaria protegida.
Pieza de trabajo

Pieza de trabajo

Haz de supresin flotante Pieza de trabajo

Fuente de alimentacin elctrica

Trayectoria de trabajo de los rodillos

M8200

Figura 76: Silenciamiento


El silenciamiento requiere la combinacin de una cortina de luz, dos o cuatro detectores de silenciamiento y una unidad de control para procesar seales y determinar si se activa la funcin de silenciamiento y cundo se activa. Los detectores de silenciamiento se montan en la parte frontal y detrs de la cortina de luz de seguridad y slo una combinacin especfica de salidas de los detectores iniciar la funcin de silenciamiento. Por ejemplo, cuando los dos detectores ubicados al frente de la cortina de luz de seguridad cambian de estado en un lapso de tiempo predeterminado, la cortina de luz entra al modo de silenciamiento. Los detectores deben montarse a una distancia de separacin suficiente para que el personal no pueda entrar al rea y disparar ambos detectores de silenciamiento simultneamente, y para que un perodo suficientemente largo inicie el silenciamiento de la cortina de luz. ANSI B11.19 establece los requisitos de rendimiento de seguridad para la funcin de silenciamiento. La funcin de silenciamiento del dispositivo est permitido durante la porcin no peligrosa del ciclo de la mquina. La funcin de silenciamiento del dispositivo se realizar de manera que un fallo de un componente, subensamblaje o mdulo del sistema/dispositvo que afecte el desempeo de las funciones de seguridad no evitar que se inicie un comando de paro normal, o causar un comando de paro inmediato. En el caso de fallo, la reiniciacin de la mquina se evitar hasta que el fallo haya sido corregido o el sistema o dispositivo haya sido restablecido manualmente. Por ejemplo, no es suficiente un interruptor simple de final de carrera accionado por leva cableado en paralelo con la salida del dispositivo. Un fallo del interruptor de leva no ser detectado.

Troquel de freno de prensa

Figura 75: Supresin flotante


Cuando use supresin, fija o flotante, se afecta la distancia de seguridad (la distancia mnima a la que la cortina de luz puede estar del peligro de manera que un operador no pueda llegar al peligro antes que se detenga la mquina). Puesto que la supresin aumenta el tamao mnimo del objeto que puede detectarse, la distancia mnima de seguridad tambin debe aumentar basado en la frmula para calcular la distancia mnima de seguridad (vea Clculo de la distancia de seguridad, pgina 1-43). Silenciamiento Algunas veces el proceso requiere que la mquina se detenga cuando entra personal al rea y que contine funcionando cuando se introduce material de alimentacin automtica. En dicho caso, se necesita una funcin de silenciamiento.

1-41

Principios de seguridad

Cortinas de luz de seguridad


Proteccin de rea
Dispositivos de disparo y deteccin de presencia Cuando se decide cmo proteger una zona o rea, es importante tener un claro entendimiento de cules funciones de seguridad se requieren exactamente. En general habrn por lo menos dos funciones. Desactivar o desconectar la alimentacin elctrica cuando una persona entra al rea de peligro. Evitar activar o conectar la alimentacin elctrica cuando una persona est en el rea de peligro. En un inicio podra parecer que estas dos funciones son la misma cosa, pero aunque obviamente estn vinculadas y generalmente son realizadas por el mismo equipo, en realidad son dos funciones diferentes.
Punto de disparo Inicio de deteccin Fin de deteccin

Detectado

No detectado

Peligro

Si el acceso de todo el cuerpo no es posible y por lo tanto una persona no puede continuar ms all del punto de disparo, su presencia siempre es detectada y se logra el segundo punto (evitar la activacin). Para estos tipos de aplicaciones, los mismos tipos de dispositivos realizan deteccin de presencia y disparo. La nica diferencia es el tipo de aplicacin. Podemos ver que si es posible obtener acceso de todo el cuerpo ms all del punto de disparo, entonces puede ser necesario tener alguna manera de detectar la presencia de una persona ms all del punto de disparo y en toda la zona de peligro accesible. En otras palabras un dispositivo detector de presencia en el rea. Algunos ejemplos de dispositivos de deteccin de presencia en el rea son tapetes sensibles a la presin, escneres de lser, cortinas de luz de seguridad montadas horizontalmente. Podemos usar un dispositivo que combine las funciones de deteccin de rea y activacin de permetro o podemos usar un dispositivo separado colocado dentro del permetro protegido o de activacin. Es obvio que cualquier dispositivo de deteccin en rea tambin actuar como dispositivo de disparo cuando alguien ingrese inicialmente al rea de deteccin. (por ej., ver a continuacin)
Punto de disparo Inicio de deteccin

Figura 77
Para lograr el primer punto, necesitamos usar alguna forma de dispositivo de disparo. En otras palabras, un dispositivo que detecte que una parte de una persona ha pasado ms all de un punto especfico y proporcione una seal para desconectar la alimentacin elctrica. Si la persona puede continuar pasado este punto de disparo y su presencia ya no es detectada, entonces puede que no se logre el segundo punto (evitar la activacin). Para aplicaciones en donde es posible el acceso de todo el cuerpo, algunos ejemplos de dispositivos con estas caractersticas son cortinas de luz de seguridad de montaje vertical, barreras de luz de seguridad de un solo haz, bordes sensibles, interruptores de antena telescpica. Una puerta de guarda enclavada generalmente tambin debe considerarse como dispositivo de disparo solamente porque (a menos que hayan provisiones especiales tales como sistemas de acceso con llave) generalmente no hay nada que evite que la puerta se cierre despus de la entrada.
Punto de disparo Inicio de deteccin

Peligro

Zona de deteccin Figura 79 Escner de lser


El primer paso en la zona de deteccin desactiva la alimentacin elctrica del peligro. Los pasos subsiguientes evitan la activacin o la conexin de la alimentacin elctrica. Para los dispositivos de disparo y los dispositivos de deteccin de presencia que tambin actan como dispositivos de disparo, se aplica el clculo de distancia de seguridad (ver la seccin correspondiente ms adelante). Hay dos requisitos fundamentales: No debe existir la posibilidad de acceder al peligro sin disparar el dispositivo. El dispositivo debe estar colocado suficientemente lejos para que no sea posible llegar al peligro antes de que haya tenido tiempo suficiente para pasar a la condicin de seguridad. Esto significa que la distancia de acceso ms corta entre el permetro de la zona de deteccin del dispositivo hasta el peligro debe cumplir como mnimo con las especificaciones de la frmula de distancia de seguridad.

UNDETECTED Peligro

Detectado

Figura 78

1-42

Principios de seguridad

Cortinas de luz de seguridad


Como alternativa, es posible tener una proteccin contra el peligro de manera que no dependa totalmente de la distancia de separacin. Normalmente, esto podra requerir guarda con enclavamiento y con bloqueo de puerta de guarda. La puerta no podr desbloquearse hasta que la mquina est en una condicin de seguridad. La seleccin del tipo de dispositivo depende de equiparar las caractersticas del dispositivo con las caractersticas de la aplicacin. En algunos casos, en lugar de que el operador se mueva hacia el peligro, el peligro se mueve hacia el operador, por ej., puertas energizadas. En este caso, el flanco ascendente del peligro se equipa con un borde sensible activado por el contacto ligero con una persona, y es capaz de detener el movimiento antes de que ocurra una lesin. En este caso, la cantidad de sobrecarrera o inercia al momento del paro del movimiento son crticos. Los bordes sensibles pueden proporcionar proteccin eficaz para muchos tipos de peligros problemticos, tales como corte y atrapamiento. Tambin pueden ser tiles como dispositivos de disparo generales.

Iniciacin del dispositivo de deteccin de presencia (PSDI)


Conocido tambin como modo de operacin de simple apertura/ doble apertura, PSDI requiere el uso de una cortina de luz no slo como dispositivo de seguridad sino como control de operacin de la mquina. PSDI inicia el ciclo de una mquina basado en el nmero de veces que se rompe el campo de deteccin. Por ejemplo, cuando un operador se aproxima al peligro para insertar una pieza de trabajo, la interrupcin de los haces detiene inmediatamente la mquina o evita el reinicio de la mquina hasta que el operador retire su mano del rea, y en ese momento la mquina inicia automticamente su siguiente ciclo. OSHA 1910.217 (h) describe especficamente los requisitos de aplicacin y las restricciones de uso de PSDI en prensas mecnicas.

Figura 80
Una evaluacin de riesgos puede mostrar que una persona podra entrar al rea protegida y quizs estar fuera de vista. La puerta de guarda puede cerrarse y la mquina puede ser arrancada por otra persona. Una manera de evitar esta situacin es detectar la presencia de una persona en cualquier lugar dentro del rea protegida encerrada. Usando este mtodo es posible ahorrar espacio, pero generalmente a expensas de la capacidad de acceso de montacargas, etc.

Uso de cortinas de luz de seguridad


Para determinar la cortina de luz de seguridad apropiada para la aplicacin, usted debe: 1. Identificar cada peligro individual en el equipo protegido 2. Determinar si la mquina puede detenerse en cualquier punto en su carrera o ciclo 3. Identificar las partes que deben protegerse: dedo, mano, extremidad, cuerpo 4. Calcular la distancia de seguridad 5. Dimensionar la cortina de luz de seguridadel personal no debe poder aproximarse ni por la parte de arriba ni por la parte de abajo, ni tampoco alrededor de la cortina de luz de seguridad para acceder al peligro. Finalmente, los pasos 1 al 3 del proceso de seleccin se basan en los hallazgos de la Evaluacin de riesgos descrita en la seccin Principios de seguridad (vea la pgina 1-17).

Figura 81
Si se usa un dispositivo de deteccin de presencia para ese propsito, no se necesita cumplir con los requisitos de tamao y posicionamiento de EN 999. Pero el requisito fundamental de todas maneras es que no sea posible acceder al peligro sin disparar el dispositivo. El movimiento de una persona activa el dispositivo. El dispositivo debe cubrir el rea encerrada. Los dispositivos tpicos son tapetes sensibles a la presin, rejillas o cortinas de luz de seguridad horizontales, escneres de lser.

Clculo de la distancia de seguridad


Al instalar las cortinas de luz de seguridad, se debe calcular la distancia de seguridad mnima a la cual la cortina de luz puede montarse desde el punto de peligro. La distancia entre el peligro y la cortina de luz de seguridad debe ser tal que el tiempo que requiere el operador para llegar al peligro (con respecto a las velocidades de aproximacin de partes del cuerpo humano) debe ser mayor que el tiempo de paro de la mquina. En los Estados Unidos se usan dos frmulas para calcular correctamente la distancia de seguridad. La primera es la frmula

1-43

Principios de seguridad

Cortinas de luz de seguridad


OSHA, la cual es requisito mnimo para el clculo de la distancia de seguridad. La segunda frmula, recomendada por Rockwell Automation, es la frmula ANSI, la cual incorpora factores adicionales a considerar cuando se calcula la distancia de seguridad. Frmula de clculo de distancia de seguridad OSHA La frmula de distancia de seguridad OSHA, segn lo especificado en CFR Subparte O 1910.217 es la siguiente: Ds = 63 X TS Donde: DS Distancia de seguridad 63 Es la constante de velocidad de la mano recomendada por OSHA en pulgadas por segundo TS Es el tiempo de paro total para todos los dispositivos del circuito de seguridad, medido en segundos. Este valor debe incluir todos los componentes involucrados en parar el movimiento peligroso de la mquina. En el caso de una prensa mecnica, es el tiempo de paro medido a una posicin de 90 aproximadamente de rotacin del cigeal. Nota: El nmero de TS debe incluir los tiempos de respuesta de todos los dispositivos, incluyendo el tiempo de respuesta del sistema de cortina de luz de seguridad, del controlador del sistema de cortina de luz de seguridad (si se usa), del circuito de control de la mquina y cualquier otro dispositivo que reaccione para parar el movimiento peligroso de la mquina. El no incluir el tiempo de respuesta de uno o ms dispositivos en el clculo del tiempo de paro resultar en una distancia de seguridad insuficiente para la aplicacin. Esto puede causar lesiones al operador. Tr Tiempo de respuesta de la cortina de luz de seguridad segn lo especificado en segundos. Tbm Tiempo de paro adicional atribuido al tiempo de respuesta de un monitor de freno. Si no hay un monitor de freno disponible, debe aadirse un factor de porcentaje que considere el deterioro del sistema de freno debido a desgaste. Para frenos nuevos, se recomienda 20 %; para frenos viejos, el factor recomendado es 10 %. Dpf Distancia adicional basada en el factor de profundidad de penetracin (consulte la Tabla 10 en 1910.217). Al conocer el tamao mnimo de objeto que la cortina de luz de seguridad puede ver, puede determinarse la distancia que un objeto puede penetrar el campo de deteccin antes que la luz inicie una seal de paro. Ejemplo: Usando la frmula ANSI, un tiempo de respuesta de cortina de luz de seguridad (Tr) de 15 ms, un tiempo de paro de mquina (Ts+Tc) de 180 ms, un tiempo de respuesta de monitor de freno (Tbm) de 40 ms y una profundidad de penetracin de 3.2 pulgadas, el clculo sera de la siguiente manera (recuerde que la constante de velocidad de la mano, K, fue establecida por OSHA en 63 pulgadas por segundo): Ds = K x (Ts + Tc + Tr + Tbm) + Dpf Ds = 63 x (0.180 + 0.015 + 0.040) + 3.2 Ds = 63 x (0.235) + 3.2 Ds = 14.805 + 3.2 Ds = 18.00 Por lo tanto, la mnima distancia de seguridad a la que la cortina de luz puede montarse del peligro es 18 pulgadas. Frmula EN 999 para distancia de seguridad EN 999 es el estndar europeo que considera el posicionamiento del equipo protector con respecto a las velocidades de aproximacin de partes del cuerpo humano. Se recomienda para uso en mquinas diseadas para venta o uso en Europa. Similar a la frmula ANSI, la frmula de EN 999 es: S = (K x T) + C Donde: S La distancia mnima en mm desde la zona de peligro al campo de deteccin de la cortina de luz de seguridad. K 1600 (sugerido). Este parmetro se basa en datos de investigacin que muestran que es razonable suponer una velocidad de aproximacin del operador de 1600 mm/seg. Deben tenerse en cuenta las circunstancias de la aplicacin real. Como pauta general, la velocidad de aproximacin vara de 1,600 a 2,500 mm/seg. T El tiempo total de paro del sistema, por ej., el tiempo total en segundos, desde la iniciacin de la seal de paro hasta la eliminacin del peligro.

Frmula de distancia de seguridad de ANSI El clculo de ANSI de la distancia de seguridad para cortinas de luz, segn lo usado en B11.1-1988 and B11.19-1990, es como sigue: Ds = K x (Ts + Tc + Tr + Tbm) + Dpf Donde: Ds La distancia de seguridad mnima de la zona de peligro a la cortina de luz de seguridad (pulg.) K 63 pulg./seg (sugerido). La constante de velocidad de la mano segn lo definido en ANSI B11.19-1990: la constante de velocidad de la mano, K, ha sido determinada por varios estudios, y aunque estos estudios indican velocidades de 63 pulg./seg a ms de 100 pulg./seg, no se consideran determinaciones concluyentes. El usuario debe considerar todos los factores, inclusive la capacidad fsica del operador al determinar el valor de K que se va a utilizar. Ts El tiempo de paro de la mquina, en segundos, medido en la posicin de aproximadamente 90 de rotacin del cigeal, segn lo determinado con un dispositivo de medicin. Tc Tiempo de respuesta, en segundos, del circuito de control para activar el paro de la mquina, segn lo determinado con un dispositivo de medicin.

1-44

Principios de seguridad

Reglamentos de seguridad de EE.UU.


C Una distancia adicional, en milmetros, basada en la posible profundidad de penetracin hacia el rea de peligro. Esto depender de la posibilidad de pasar por arriba, alrededor, o a travs de la cortina de luz de seguridad, antes que los contactos se abran. Los estndares EN 294 y EN 811 proporcionan ms informacin sobre el clculo de distancias de aproximacin. Ejemplo: Usando las mismas mediciones (convertidas a mm) del clculo de ANSI anterior, la ecuacin de EN 999 produce: S = (K x T) + C S = (1600 x 0.235) + 81.28 S = (376) + 81.28 S = 457.28 mm Por lo tanto, la distancia de seguridad mnima para la misma aplicacin sera 457.28 mm segn EN 999. Interferencia de superficies reflectivas y otros dispositivos optoelectrnicos Cuando hay superficies reflectivas (metal brilloso/pulido, lminas metlicas, superficies pintadas con pintura brillante, etc.) cerca a dispositivos electrnicos tales como cortinas de luz de seguridad, el sistema es sensible a fallos debido a la deflexin de los haces pticos. Una situacin como esta puede causar que la cortina de luz de seguridad no detecte un objeto o persona en el campo de deteccin.
Punto de operacin a Transmisor
4

Donde: D Distancia a la superficie reflectiva (el peor de los casos) R Distancia entre el emisor y el receptor de la cortina de luz de seguridad a El ngulo de desalineamiento aceptable (ngulo de divergencia) segn lo determinado por las especificaciones de la cortina de luz de seguridad Tambin es necesario considerar otros dispositivos optoelectrnicos cerca de la cortina de luz de seguridad. Es posible que las cortinas de luz interfieran una con otra.

Superficie reflectiva (por ej. un recipiente) D


4

Figura 83: POC mltiples

a Receptor

Reglamentos de seguridad de EE.UU.


Esta seccin presenta algunos reglamentos de seguridad para guardas de mquinas industriales en los EE.UU. Esto es slo un punto de inicio; los lectores deben investigar los requisitos de la aplicacin especfica y tomar medidas para asegurar que el diseo, uso y los procedimientos y prcticas de mantenimiento satisfagan sus necesidades as como las especificaciones de los cdigos y reglamentos nacionales y locales. Hay muchas organizaciones que promueven la seguridad industrial en los Estados Unidos. Estas incluyen: 1. Corporaciones, las cuales usan requisitos establecidos y establecen sus propios requisitos internos; 2. La OSHA (Occupational Safety and Health Administration); 3. Organizaciones industriales tales como National Fire Protection Association (NFPA), Robotics Industries Association (RIA), y Association of Manufacturing Technology (AMT); y los proveedores de productos y soluciones de seguridad, tal como Rockwell Automation.

Centro del haz Direccin de aproximacin Distancia de seguridad (a) mm (pulg.)


500

Haz de luz interrumpido

400

300

200

100 60 20 1 2 3 4 5 6

Margen de operacin

Figura 82: Alineamiento/distancia POC


Al instalar cortinas de luz, se puede calcular el potencial de interferencia para determinar la distancia mnima a la que la cortina de luz debe montarse de la superficie reflectiva. Como regla general, ninguna superficie reflectiva debe estar contenida dentro del ngulo de haz del emisor o receptor de la cortina de luz considerando el desalineamiento. Segn la siguiente frmula: D = R/2 (tan 2a)

Occupational Safety and Health Administration (OSHA)


En los Estados Unidos, uno de los principales impulsores de la seguridad industrial es la OSHA (Occupational Safety and Health Administration). La OSHA fue establecida en 1970 por una Ley del Congreso de los EE.UU. El propsito de esta ley es proporcionar condiciones de trabajo saludables y de seguridad y preservar los

1-45

Principios de seguridad

Reglamentos de seguridad de EE.UU.


recursos humanos. OSHA lleva a cabo esta tarea publicando reglamentos en el Ttulo 29 del Cdigo de Reglamentos Federales (29 CFR). Los estndares pertinentes a las maquinarias industriales son publicados por OSHA en Parte 1910 de 29 CFR. La Tabla 5 es una lista de dichos estndares correspondientes a mquinas especficas.
Seccin 1910.212 1910.213 1910.214 1910.215 1910.216 1910.217 1910.218 1910.219 Descripcin Requisitos generales para todas las mquinas Requisitos para mquinas de trabajos en madera Maquinaria de tonelera Maquinaria de ruedas abrasivas Fresadoras y satinadoras en la industria de caucho y plsticos Prensas mecnicas Mquinas de forjado Aparatos de transmisin de potencia mecnica

OSHA 1910.217(b)(13)Confiabilidad del control (13) Confiabilidad del control. Cuando lo requiera el prrafo (c) (5) de esta seccin, el sistema de control se construir de manera que un fallo dentro del sistema no impedir que se aplique la accin de paro normal a la prensa cuando sea necesario, pero s evitar la iniciacin de una carrera sucesiva hasta que el fallo haya sido corregido. El fallo ser detectable mediante una prueba simple, o indicado por el sistema de control. Este requisito no se aplica a los elementos del sistema de control que no tienen efecto en la proteccin contra lesiones de punto de operacin. OSHA 1910.217(b)(14)Monitoreo del sistema de freno (14) Monitoreo del sistema de freno. Cuando se requiera segn el prrafo (c)(5) de esta seccin, el monitor del freno cumplir con los siguientes requisitos: (i) Debe construirse de manera que evite automticamente la activacin de una carrera sucesiva, si el tiempo de paro o la distancia de frenado se deteriora hasta un punto en que la distancia de seguridad utilizada no cumple con los requisitos establecidos en el prrafo (c)(3)(iii)(e) o (c)(3)(vii)(c) de esta seccin. El monitor de freno usado con la compuerta Tipo B o dispositivo de barrera mvil se instalar de manera que detecte un funcionamiento excesivo de la parte superior deslizable con paro fuera del lmite normal razonable establecido por el empleador. (ii) Debe instalarse en una prensa que indique cuando el rendimiento del sistema de freno se haya deteriorado, en la medida descrita en el prrafo (b)(14)(i) de esta seccin; y (iii) Debe construirse e instalarse de manera que se monitoree el rendimiento del sistema de freno en cada carrera. OSHA 1910.217(c) Proteccin del punto de operacin (1) Requisitos generales. (i) Ser responsabilidad del empleador proporcionar y asegurar el uso de guardas de punto de operacin o dispositivos de punto de operacin correctamente aplicados y ajustados en cada operacin realizada en una prensa mecnica (vea la Tabla 010. (ii) El requisito de la subdivisin (i) de este subprrafo no se aplicar cuando la abertura del punto de operacin sea un cuarto de pulgada o menos (vea la Tabla 010). Tabla O-10 [de OSHA 1910.217 (f)(4)]
Distancia de abertura desde el peligro del punto de operacin (pulgadas) 1/2 a 1-1/2 1-1/2 a 2-1/2 2-1/2 a 3-1/2 3-1/2 a 5-1/2 5-1/2 a 6-1/2 6-1/2 a 7-1/2 7-1/2 a 12-1/2 12-1/2 a 15-1/2 15-1/2 a 17-1/2 17-1/2 a 31-1/2 Ancho mximo de la abertura (pulgadas) 1/4 3/8 1/2 5/8 3/4 7/8 1-1/4 1-1/2 1-7/8 2-1/8

Tabla 6
Siempre que sea posible, OSHA promulga estndares de consenso nacional o estndares federales establecidos como estndares de seguridad. Las provisiones mandatorias (es decir, el texto debe indicar que es mandatorio) de los estndares, incorporados segn referencia, tienen la misma vigencia y efectos que los estndares listados en Parte 1910. Por ejemplo el estndar NFPA 70 de consenso general se lista como documento de referencia en el Apndice A de Subparte S-Electrical, de Parte 1910 de 29 CFR. NFPA 70 es un estndar desarrollado por la National Fire Protection Association (NFPA). NFPA 70 se conoce tambin como el Cdigo Elctrico Nacional (NEC). Por lo tanto, todos los requisitos mandatorios del NEC son mandatorios de OSHA. Con referencia a las cortinas de luz de seguridad, los estndares se categorizan como estndares de aplicacin o estndares de construccin. Los estndares de aplicacin definen cmo aplicar una cortina de luz de seguridad a la maquinaria. Algunos ejemplos incluyen ANSI B11.1, que proporciona informacin sobre el uso de guardas de mquina en prensas mecnicas y ANSI/RIA R15.06, que describe el uso de la cortina de luz de seguridad para guarda de robot. Los estndares de construccin proporcionan detalles sobre el diseo y construccin de dispositivos de deteccin de presencia (PSD) en aplicaciones de seguridad. IEC61496, Seguridad de maquinaria Equipo protector electrosensible cubre los requisitos de las cortinas de luz de seguridad y los detectores fotoelctricos en general, usados en aplicaciones de seguridad. Los siguientes son estndares OSHA seleccionados, e interpretaciones de la Precision Metalforming Association (PMA) relacionadas a guardas de mquinas y cortinas de luz de seguridad: OSHA 1910.217(b)(7)Embrague de revolucin parcial, controles (7) Mquinas que usan embragues de revolucin parcial (i) Se soltar el embrague y se aplicar el freno cuando el medio de enganche de embrague externo sea retirado, desactivado o desenergizado. (ii) Se proporcionar un control de paro de color rojo con el sistema de control de embrague/freno. La operacin momentnea del control de paro desactivar inmediatamente el embrague y aplicar el freno. El control de paro anular cualquier otro control y el re-accionamiento del embrague requerir el uso del medio de operacin (disparo) seleccionado.

1-46

Principios de seguridad

Reglamentos de seguridad de EE.UU.


OSHA 1910.217 (c)(3)Dispositivos de punto de operacin (i) Los dispositivos de punto de operacin protegern al operador al: (a) Evitar y/o parar la carrera normal de la prensa si el operador coloca las manos en el punto de operacin. OSHA 1910.217 (c)(3)(iii)Dispositivo de deteccin de presencia (iii) Un dispositivo de deteccin de presencia en el punto de operacin proteger al operador segn lo indicado en el prrafo (c)(3)(i)(a) de esta seccin, y se enclavar dentro del circuito de control para evitar o detener el movimiento de la pieza deslizante si la mano u otra parte del cuerpo del operador est dentro del campo de deteccin del dispositivo durante la carrera descendente de la pieza deslizante de la prensa. (a) El dispositivo no puede usarse en mquinas que usan embragues de revolucin total. (b) El dispositivo no puede usarse como medio de disparo para iniciar el movimiento deslizante excepto cuando se use en total cumplimiento con el prrafo (h) de esta seccin. (c) El dispositivo no se construir de manera que un fallo dentro del sistema no impida que se aplique la accin de paro normal a la prensa cuando sea necesario, pero s evitar la iniciacin de una carrera sucesiva hasta que el fallo haya sido corregido. El fallo deber ser indicado por el sistema. (d) Se permitir la funcin de silenciamiento (pasar por alto la funcin de proteccin) de dicho dispositivo, durante la carrera ascendente de la pieza deslizante de la prensa con el propsito de expulsin de piezas, verificacin de circuito y alimentacin. (e) La distancia de seguridad (D(s)) desde el campo de deteccin al punto de operacin ser mayor que la distancia determinada por la siguiente frmula: D(s) = 63 pulgadas/segundo X T(s) Donde: Ds = distancia de seguridad mnima (pulgadas); 63 pulgadas/segundo = constante de velocidad de la mano; y Ts = Tiempo de paro de la prensa medido a una posicin de aproximadamente 90 grados de rotacin del cigeal (segundos). (f) Se usarn guardas para proteger todas las reas de entrada al punto de operacin no protegidas por el dispositivo de deteccin de presencia. OSHA 1910.217 (c)(5) Requisitos de proteccin adicionales Donde el operador alimente o retire piezas colocando una o ambas manos en el punto de operacin y se utilice un control de dos manos, dispositivo de deteccin de presencia de compuerta Tipo B o barrera mvil (en un embrague de revolucin parcial). (i) el empleador usar un sistema de control y un monitor de freno que cumpla con los prrafos (b) (13) y (14) de esta seccin. Deber cumplirse con este requisito antes del 1 de noviembre de 1975. (ii) la excepcin indicada en el prrafo (b)(7)(v)(d) de esta seccin para controles de dos manos fabricados e instalados antes del 31 de agosto de 1971, no es aplicable segn este prrafo (c)(5); (iii) se disear el control de mquinas de embrague pneumtico para evitar un aumento significativo en el tiempo de paro normal debido a un fallo dentro del mecanismo de vlvula de operacin y para inhibir la operacin si ocurre dicho fallo, donde se utilice un embrague de revolucin parcial. La excepcin en el prrafo (b)(7)(xi) de esta seccin para controles de dos manos fabricados e instalados antes del 31 de agosto de 1971, no es aplicable bajo este prrafo (c)(5). OSHA 1910.217(e) Inspeccin, mantenimiento y modificacin de prensas (1) Registros de inspeccin y mantenimiento. (i) Ser responsabilidad del empleador establecer y seguir un programa de inspecciones perodicas y regulares de sus prensas mecnicas para asegurar que todas sus piezas, equipo auxiliar y dispositivos de proteccin se encuentren en estado operativo seguro. El empleador mantendr registros de estas inspecciones, los cuales incluirn la fecha de inspeccin, la firma de la persona que realiz la inspeccin y el nmero de serie u otra identificacin de la prensa mecnica inspeccionada. (ii) Cada prensa se inspeccionar y probar por lo menos una vez a la semana para determinar la condicin del mecanismo de embrague/freno, la funcin anti-repeticin y el mecanismo de una carrera. El mantenimiento o reparaciones necesarias, o ambos, se llevarn a cabo antes de poner en funcionamiento la prensa. El empleador mantendr registros de estas inspecciones y el trabajo de mantenimiento realizado. Estos requisitos no se aplican a las prensas que cumplen con los prrafos (b) (13) y (14) de esta seccin. El empleador mantendr un registro certificado de las inspecciones, pruebas y trabajo de mantenimiento que incluya la fecha de inspeccin, la firma de la persona que realiz la inspeccin, la prueba o el mantenimiento; y el nmero de serie u otra identificacin de la prensa inspeccionada, probada o mantenida. (2) Modificacin. Ser responsabilidad de cualquier persona que modifique una prensa mecnica el proporcionar instrucciones con la modificacin para establecer pautas nuevas o modificadas de uso y mantenimiento de la prensa mecnica modificada. (3) Capacitacin del personal de mantenimiento. Ser responsabilidad del empleador asegurar la aptitud actual y continuada del personal encargado del cuidado, inspeccin y mantenimiento de las prensas mecnicas. OSHA 1910.217(f) Operacin de las prensas mecnicas (2) Instrucciones para los operadores. El empleador capacitar e instruir al operador respecto al mtodo seguro de trabajo antes de que comience a trabajar en cualquier operacin cubierta por esta seccin. El empleador se asegurar, mediante supervisin adecuada, que se sigan los procedimientos correctos de operacin. (3) rea de trabajo. El empleador proporcionar espacio libre entre las mquinas de manera que el movimiento de un operador no interfiera con el trabajo de otro. Tambin deber proporcionarse amplio espacio para realizar la limpieza de las mquinas, la manipulacin de materiales, piezas de trabajo y

1-47

Principios de seguridad

Reglamentos de seguridad de EE.UU.


desechos. El piso circundante deber mantenerse en buen estado y libre de obstrucciones, grasa, aceite y agua. (4) Sobrecarga. El empleador operar sus prensas segn las especificaciones de pesas y tonelaje indicadas por el fabricante. ANSI B11.1 Mquinas herramienta Prensas de potencia mecnica Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.2 Mquinas herramienta Prensas de potencia hidrulica Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.3 Frenos de prensa mecnica, requisitos de seguridad para la construccin, mantenimiento y uso ANSI B11.4 Mquinas herramienta Cortadoras Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.5 Mquinas herramienta Trabajadores de hierro Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.6 Tornos, requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.7 Mquinas herramienta Formacin de cabeza en fro y moldeado en fro, requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.8 Mquinas perforadoras, de fresado y barrenadoras, requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.9 Mquinas de esmerilado, requisitos de seguridad para la construccin, mantenimiento y uso ANSI B11.10 Mquinas de sierra para metal, requisitos de seguridad para la construccin, mantenimiento y uso ANSI B11.11 Mquinas de corte de engranajes, requisitos de seguridad para la construccin, mantenimiento y uso ANSI B11.12 Mquinas herramientas Mquinas de formacin de rollos y flexin de rollos Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.13 Mquinas herramienta Mquinas automticas portaherramientas y de barra de un eje y mltiples ejes Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.14 Mquinas herramienta Requisitos de seguridad para construccin, mantenimiento y uso de mquinas ranuradoras de bobinas ANSI B11.15 Mquinas de formacin y flexin de tuberas y tubos, requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.16 Prensas compactadoras de polvo metlico, requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.17 Mquinas herramienta Prensas de extrusin hidrulica horizontal Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.18 Mquinas herramienta Mquinas y sistemas de maquinaria para procesamiento de bandas, planchas o placas de configuracin en rollos Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.19 Mquinas herramienta Proteccin en caso de referencia por otros Estndares de seguridad de mquinas herramientas B11 Criterios de desempeo para el diseo, construccin, mantenimiento y operacin ANSI B11.20 Mquinas herramienta Sistemas/celdas de fabricacin Requisitos de seguridad para construccin, mantenimiento y uso ANSI B11.21 Mquinas herramienta Mquinas herramienta que usan rayos lser para el procesamiento de materiales Requisitos de seguridad para diseo, construccin, mantenimiento y uso

National Fire Protection Association (NFPA)


La National Fire Protection Association (NFPA) se cre en 1896. Su misin es reducir el efecto de los incendios en la calidad de vida promoviendo cdigos y estndares con base cientfica, as como investigacin y educacin sobre incendios y aspectos relacionados a la seguridad. La NFPA auspicia muchos estndares para ayudar a llevar a cabo su misin. Dos estndares muy importantes relacionados con la seguridad industrial y la proteccin son el Cdigo Elctrico Nacional y el Estndar Elctrico para maquinaria industrial. La National Fire Protection Association se ha desempeado como patrocinador del Cdigo Elctrico Nacional desde 1911. El documento de cdigo original se desarroll en 1897 como resultado de la unificacin de esfuerzos de diversos grupos de las industrias de seguros, electricidad, arquitectura y grupos aliados. Desde entonces el NEC se ha actualizado muchas veces; se revisa aproximadamente cada tres aos. El Artculo 670 del NEC abarca algunos detalles sobre maquinarias industriales y refiere al lector al Estndar Elctrico para Maquinarias Industriales, NFPA 79. NFPA 79 es aplicable a equipos elctricos/electrnicos, aparatos o sistemas de mquinas industriales que funcionan a un voltaje nominal de 600 volts o menos. El propsito de NFPA 79 es proporcionar informacin detallada para la aplicacin de equipos, aparatos o sistemas elctricos/electrnicos suministrados como parte de mquinas industriales que promueven la seguridad personal y de la propiedad. NFPA 79, que se adopt oficialmente en 1962, es muy similar en contenido al Estndar del Comit Electrotcnico Internacional IEC 60204-1. Las mquinas que no estn incluidas en los estndares especficos de la OSHA, deben estar libres de fuentes de peligro reconocidas que puedan causar la muerte o lesiones personales graves. Estas mquinas deben disearse y mantenerse de manera que se satisfagan o se superen los requisitos de los estndares industriales aplicables. NFPA 79 es un estndar que se aplicara a las mquinas que no estn especficamente cubiertas por los estndares de OSHA.

Estndares nacionales en EE.UU.


El American National Standards Institute (ANSI) sirve como administrador y coordinador del sistema de estandarizacin voluntaria del sector privado de los Estados Unidos. Es una organizacin de miembros privada y sin fines de lucro, que tiene el apoyo de un grupo diverso de organizaciones de los sectores privado y pblico. ANSI, no desarrolla estndares; facilita el desarrollo de estndares estableciendo consenso entre grupos calificados. ANSI tambin asegura que los grupos calificados sigan los principios de abertura y consenso, y los procedimientos debidos. A continuacin se ofrece una lista parcial de estndares de seguridad que pueden obtenerse mediante ANSI.

1-48

Principios de seguridad

Organizaciones
ANSI B11.1 Mquinas de moldeado por inyeccin horizontal Requisitos de seguridad para la fabricacin, mantenimiento y uso ANSI B151.15 Mquinas de moldeado por soplado de extrusin Requisitos de seguridad ANSI B151.21 Mquinas de moldeado por soplado de inyeccin Requisitos de seguridad ANSI B151.26 Maquinaria de plsticos Reaccin dinmica Mquinas de moldeado por inyeccin Requisitos de seguridad para la fabricacin, mantenimiento y uso ANSI B151.27 Maquinaria de plsticos Robots usados con mquinas de moldeado por inyeccin horizontal Requisitos de seguridad para la integracin, mantenimiento y uso ANSI B151.28 Maquinaria de plsticos Mquinas para cortar, ranurar o pulir espumas de plstico Requisitos de seguridad para la fabricacin, mantenimiento y uso ANSI B11.1 Maquinaria de envasado y maquinaria de conversin relacionada con envasado Requisitos de seguridad para construccin, mantenimiento y uso ANSI B65.1 Estndar de seguridad-Sistemas de prensas de impresin ANSI/NFPA 70 Cdigo Elctrico Nacional ANSI/NFPA 70E Requisitos de seguridad elctrica para empleados en el lugar de trabajo ANSI/NFPA 79 Estndar elctrico para maquinaria industrial ANSI/RIA 15.06 Requisitos de seguridad para robots y sistemas robticos industriales CEN--European Committee for Standardization Central Secretariat rue de Stassart 36, B-1050, Brussels, Blgica Telfono: 011-32-2-550-0819 Fax: 011-32-2-550-0811 Internet: http://tobbi.iti.is/cen/welcome.html CENELEC--European Committee for Electrotechnical Standardization Central Secretariat rue de Stassart 35, B-1050, Brussels, Blgica Telfono: 011-32-2-51-96-919 Fax: 011-32-3-51-96-871 OSHA--Occupational Safety & Health Administration U.S. Department of Labor 200 Constitution Avenue, NW Washington, DC 20210 Telfono: 202/693-1999 Internet: http://www.osha.gov

Reglamentos de seguridad australianos


Standards Association of Australia 1 The Crescent Homebush, NSW 2104 Telfono: 202/693-1999 Internet: http://www.standards.com.au AS 4024.1-1996 Proteccin de maquinaria. Parte 1: Principios generales Este estndar identifica los peligros y riesgos asociados con la maquinaria industrial y describe los mtodos de reduccin de riesgos. Tambin describe e ilustra los principios de seguridad y medidas de proteccin que deben aplicarse durante el ciclo de vida de la maquinaria. AS4024.2-1998 Proteccin de maquinaria. Parte 2: Requisitos de instalacin y puesta en marcha de sistemas electrosensibles Dispositivos optoelectrnicos La base de este estndar es IEC61496-1 y -2. La Parte 2 cubre la instalacin y puesta en marcha de cortinas de luz de seguridad relacionadas especficamente con la seguridad de la maquinaria. AS 4024.3-1998 Proteccin de maquinaria. Parte 3: Requisitos de fabricacin y prueba de sistemas electrosensiblesDispositivos optoelectrnicos La base de este estndar es IEC61496-1 y -2. La Parte 3 cubre la fabricacin y prueba de cortinas de luz de seguridad relacionadas especficamente con la seguridad de la maquinaria. AS4024.4-1998 Proteccin de maquinaria. Parte 4: Requisitos de instalacin y puesta en marcha de sistemas electrosensibles Dispositivos sensibles a la presin La base de este estndar es EN1760-1 y EN1760-2. La Parte 4 cubre la instalacin y puesta en marcha de tapetes de seguridad, pisos, bordes y barras usados con maquinaria, independientemente de la energa utilizada. AS 4024.5-1998 Proteccin de maquinaria. Parte 5: Requisitos de fabricacin y prueba de sistemas electrosensiblesDispositivos sensibles a la presin La base de este estndar es EN1760-1 y EN1760-2. La Parte 5 cubre la fabricacin y prueba de tapetes de seguridad, pisos, bordes y barras usados con maquinaria, independientemente de la energa utilizada.

Organizaciones
Las organizaciones que proporcionan copia de los estndares y directivas son: ANSIAmerican National Standards Institute 11 West 42nd Street, New York, NY 10036 Telfono: 212/642-4900 Fax (para hacer pedidos): 212/302-1286 Fax (general): 212/398-0023 Internet: www.ansi.org International Electromechanical Commission (IEC) 3, rue de Varembe, P.O. Box 131 CH 1211 Geneva 20 Suiza Telfono: 011-41-22-919-0211 Fax: 011-41-22-919-0300 Internet: www.iec.ch/ International Organization for Standardization (ISO) 1, rue de Varembe, CH 1211 Geneva 20 Suiza Telfono: 011-41-22-749-0111 Fax: 011-41-22-733-3430 Internet: www.iso.ch/ British Standards Institution 389 Chiswick High Road, London W4 4AL Reino Unido Telfono: 011-44-181-996-9000 Fax: 011-44-181-996-7400 Internet: www.bsi.org.uk/ Global Engineering Documents 7730 Carondelet Ave., Suite 407, St. Louis, MO 63105 Telfono: 800/854-7179 Fax: 314/726-6418 Internet: http://global.ihs.com

1-49

Principios de seguridad

Notas
Notas

1-50

Dispositivos de seguridad para deteccin de presencia


Cortinas de luz de seguridad
Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-2 Cortinas de luz de seguridad GuardShield . . . . . . . . . . . . . . . . . 2-8 Cortinas de luz de seguridad SafeShield . . . . . . . . . . . . . . . . . 2-14 Control de punto de operacin (POC) . . . . . . . . . . . . . . . . . . . 2-26 Control de acceso a permetro (PAC) . . . . . . . . . . . . . . . . . . . . 2-34 Control de acceso a rea (AAC) . . . . . . . . . . . . . . . . . . . . . . . . . 2-46

Interfaces de cortina de luz de seguridad


Mdulo SafeShield DeviceNet . . . . . . . . . . . . . . . . . . . . . . . . . Fuente de alimentacin de 120 VCA y rel de seguridad . . . . . Rel de seguridad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Unidad de control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-52 2-54 2-58 2-60

Escner lser de seguridad


Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-66 SafeZone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-68

Tapetes de seguridad
Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Tapetes MatGuard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Controladores MatGuard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Administrador de tapetes MatGuard . . . . . . . . . . . . . . . . . . . . 2-72 2-76 2-84 2-88

Bordes de seguridad
Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-90 Perfiles Safedge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-94 Controladores Safedge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-103

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general GuardShield
Configuracin tpica del sistema Componentes requeridos para un sistema de guarda solamente: 1. 2. 3. 4. Las cabezas pticas (funcionan con 24 VCC)se piden por parejas (transmisor/receptor) Cablesse requieren dos por parejaespecifique el cable transmisor y el cable receptor Escuadras de montajeincluidas Mdulo de rel de seguridadopcional (Nota: Es posible obtener un sistema de Categora 3 conectando las OSSD GuardShield directamente a dos contactores de seguridad y conectando y configurando el modo de operacin EDM en el receptor del GuardShield).
3

El sistema de luz de seguridad GuardMaster de Allen-Bradley es una cortina de luz de seguridad de dos cajas que consta de una pareja de transmisor y receptor desiguales. Cualquier transmisor GuardShield de la misma resolucin y altura de proteccin funcionar con cualquier receptor de la misma resolucin y altura de proteccin. La cortina de luz de seguridad GuardShield tiene dos salidas de seguridad PNP de tipo transistor. Estas salidas pueden conectarse a un mdulo de rel de seguridad o directamente al elemento de control primario de una mquina. El GuardShield tambin tiene una salida auxiliar que no es de seguridad, la cual puede conectarse a un PLC para informacin de estado de las OSSD, a una columna luminosa o para controlar un motor de alimentacin, etc. El GuardShield requiere cables separados de transmisor y receptor. El cable transmisor utiliza un conector micro de 4 pines y se ofrece en longitudes de 2 a 30 metros. El cable receptor tiene un conector micro de 8 pines y tambin se ofrece en longitudes de 2 a 30 metros.

2 4

2-2

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general
El GuardMaster GuardShield de Allen-Bradley es una cortina de luz Tipo 4 de dos cajas, con modos de operacin seleccionables mediante microinterruptor. El GuardShield tiene microinterruptores ubicados en las tapas finales del transmisor y del receptor. Se accede a los microinterruptores a travs de una puerta con bisagra, la cual se ha fijado a la tapa final con un tornillo de seguridad. Los microinterruptores del transmisor sirven para configurar y activar el cdigo de haces y la seal de prueba de la mquina. Codificacin de haces cambia el patrn de pulsos de la luz infrarroja transmitida. Esto ayuda a reducir la interferencia ptica mientras el receptor del GuardShield busca un patrn especfico de la luz infrarroja. Seal de prueba de la mquina se usa para simular la interrupcin del campo de deteccin del GuardShield, lo cual permite monitorear las salidas OSSD. El circuito de control de mquina de una prensa puede conectarse para monitorear el cambio en el estado de salida de ambas OSSD en cada carrera o ciclo de la prensa. Los microinterruptores del receptor GuardShield sirven para configurar y activar los siguientes modos de operacin: Guarda solamenteEl GuardShield funciona como interruptor de activacin/desactivacin. Las OSSD se desactivan cuando se interrumpe el campo de deteccin y vuelven al estado activado cuando se restaura el campo de deteccin. Enclavamiento de inicioEn este modo de operacin, el GuardShield se activa con las OSSD desactivadas hasta que se complete un restablecimiento manual del GuardShield. Enclavamiento de reinicio Las OSSD del GuardShield permanecern en el estado desactivado despus de cada interrupcin del campo de deteccin. Se requiere realizar el restablecimiento manual del sistema GuardShield. Codificacin de hacesEl estado del microinterruptor de codificacin de haces debe coincidir con la seleccin del transmisor, de lo contrario el GuardShield no se activar al estado Verde. EDMEs el monitoreo de dispositivos externos y permite que el GuardShield monitoree el estado de los contactores de control primarios u otros dispositivos de conmutacin final de la maquinaria protegida. Est diseado para requerir un cambio de estado del dispositivo de control cuando las OSSD del Guardshield cambian de estado. Supresin fijaUn objeto que siempre estar ubicado en el campo de deteccin puede suprimirse estableciendo el microinterruptor apropiado en la posicin de activado (ON) y luego oprimiendo el botn de activacin de modo. Esto permite que el GuardShield aprenda que el objeto siempre obstruir algunos haces. Supresin flotanteLa supresin flotante permite la interrupcin de uno o dos haces del GuardShield sin que las OSSD cambien al estado desactivado. La resolucin de 14 mm permite que dos haces floten a travs de la altura protectora del campo de deteccin del GuardShield. La resolucin de 30 mm permite que slo un haz flote a travs de la altura protectora del campo de deteccin del GuardShield.

Puerta de acceso del receptor


Enclavamiento Botn de activacin de modo Supresin fija Interruptor de estado de la puerta Guarda solamente MPCE/EDM

Supresin flotante de 2 haces

Supresin flotante de 1 haz

No se usa

Codificacin de haces

Microinterruptores del receptor

2-3

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general SafeShield
Las familias de cortinas de luz de seguridad Guardmaster SafeShield de Allen-Bradley pueden configurarse mediante software, Tipo 4 AOPD segn IEC 61496. SafeShield est disponible en resoluciones de 14 mm y 30 mm y ofrece muchas caractersticas avanzadas, tales como supresin fija, supresin fija flotante, resolucin reducida, codificacin de haces, EDM, as como pantallas de estado y diagnstico de siete segmentos en los transmisores y receptores. Tambin es posible conectar hasta tres segmentos en configuracin de cascada, cada segmento con caractersticas avanzadas programadas individualmente. Las longitudes de los cables entre segmentos pueden ser de hasta tres metros como mximo. Se proporciona un cable de comunicacin para vincular su laptop al transmisor y receptor del SafeShield, lo cual permite la programacin y configuracin de su sistema. La proteccin con contrasea asegura que una vez que el sistema est configurado, quedar almacenado con seguridad en la memoria del sistema y slo el personal autorizado tendr acceso. Este verstil sistema de cortina de luz de seguridad proporciona mxima flexibilidad para resolver aplicaciones de guarda de mquina simples a complejas. SafeShield. Con un envolvente compacto de montaje en riel DIN de 22.5 m, permite un fcil cableado y configuracin de los parmetros DeviceNet y de la informacin de diagnstico. Configuraciones tpicas del sistema El sistema de cortina de luz de seguridad Guardmaster SafeShield de Allen-Bradley tiene un diseo de dos cajas. Esto significa que la cortina de luz de seguridad no necesita un controlador separado para funcionar. Por lo tanto, las salidas de seguridad de la cortina de luz (OSSD) pueden conectarse directamente a cualquier rel de seguridad que acepte entradas PNP. Las siguientes son algunas configuraciones comunes de los sistemas de cortina de luz de seguridad. Los nmeros en el dibujo indican el orden de los pasos que debe seguir para asegurar la especificacin de un sistema completo. Componentes requeridos para un sistema de guarda solamente: 1. 2. 3. Las cabezas pticas (funcionan con 24 VCC)se piden por parejas (transmisor/receptor) Cablesse requieren dos por parejaespecifique la longitud Escuadras de montajevarios estilos disponibles

Componentes opcionales (suministrados por el cliente o por Guardmaster Allen-Bradley): 4. Rels de seguridad

Interface SafeShield DeviceNet


La familia de productos SafeShield tambin est disponible con una interface DeviceNet opcional, un dispositivo clasificado como no de seguridad que comunica informacin de estado y diagnstico proveniente de cualquier sistema de cortina de luz de seguridad

2-4

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general Descripcin general del control del punto de operacin (POC)
Configuraciones tpicas del sistema El sistema de cortina de luz de seguridad Guardmaster SafeShield de Allen-Bradley tiene un diseo de dos cajas. Esto significa que la cortina de luz de seguridad no necesita un controlador separado para funcionar en el modo de guarda solamente con restablecimiento manual. Por lo tanto, las salidas de seguridad de la cortina de luz (OSSD) pueden conectarse directamente a cualquier rel de seguridad que acepte entradas PNP. Cuando se requieren caractersticas ms avanzadas, tales como supresin fija, supresin flotante, iniciacin de dispositivo de deteccin de presencia (PSDI), etc., las salidas de la cortina de luz de seguridad deben conectarse al 440L-M8100. Esta interface programable puede configurarse para realizar estas funciones (tambin se requieren rels de seguridad separados con este mdulo). Las siguientes son algunas configuraciones comunes de los sistemas de cortina de luz de seguridad. Los nmeros en el dibujo indican el orden de los pasos que debe seguir para asegurar la especificacin de un sistema completo. Componentes requeridos para un sistema de guarda solamente: 1. 2. 3. Las cabezas pticas (funcionan con 24 VCC)se piden por parejas (transmisor/receptor) Cablesse requieren dos por parejaespecifique la longitud Escuadras de montajeun mnimo de 4 por pareja de cabezas pticas Componentes requeridos para un sistema con opciones tales como supresin, supresin flotante, PSDI, etc. 1. 2. 3. 4. Las cabezas pticas (funcionan con 24 VCC)se piden por parejas (transmisor/receptor) Cablesse requieren dos por parejaespecifique la longitud Escuadras de montajeun mnimo de 4 por pareja de cabezas pticas Interface programable440L-M8100

Componentes opcionales (suministrados por el cliente o por Guardmaster Allen-Bradley): 5. Rels de seguridad

4 5

Componentes opcionales (suministrados por el cliente o por Guardmaster Allen-Bradley): 4. Rels de seguridad

1 3

2 4

2-5

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general Control de acceso a permetro
Configuraciones tpicas del sistema El sistema de cortina de luz de seguridad con control de acceso a permetro (PAC) Guardmaster de Allen-Bradley tiene un diseo de dos cajas. Esto significa que la cortina de luz de seguridad no necesita un controlador separado para funcionar en el modo de guarda solamente con restablecimiento manual. Por lo tanto, las salidas de seguridad de la cortina de luz (OSSD) pueden conectarse directamente a cualquier rel de seguridad que acepte entradas PNP. Las siguientes son algunas configuraciones comunes de los sistemas de cortina de luz de seguridad. Los nmeros en el dibujo indican el orden de los pasos que debe seguir para asegurar la especificacin de un sistema completo. Componentes requeridos para un sistema de control de acceso a permetro (PAC) de mltiples haces, vea la Figura 1: 1. 2. 3. 4. 5. 6. Las cabezas pticas (funcionan con 24 VCC)se piden por parejas (transmisor/receptor) Cablescable de 7 pines para el transmisor y cable de 8 pines para el receptor Rels de seguridad Fuente de alimentacin120 VCA a 24 VCC Escuadras de montajeun mnimo de 4 por pareja de cabezas pticas Columnas de espejos (para proteccin de varios lados)
1

Componentes requeridos para un sistema de control de acceso a permetro (PAC) de un solo haz, vea la Figura 2: 1. 2. 3. 4. 5. 6. Cabeza pticael transmisor y el receptor estn en la misma cabeza ptica (funciona con 24 VCC) Cablesse requiere unoespecifique la longitud (cable con conector de 8 pines) Unidad de monitoreo Fuente de alimentacin120 VCA a 24 VCC (si es necesario) Escuadras de montaje Columna de espejo pasivo

1 5 4

2 6 3

Figura 2: PAC de un solo haz

Figura 1

2-6

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Descripcin general
Componentes requeridos para un sistema de control de acceso a permetro (PAC) con silenciamiento, vea la Figura 3: 1. 2. 3. 4. 5. 6. 7. Cabezas pticas (funcionan con 24 VCC) con mdulo de silenciamientose piden por pareja (transmisor/receptor) Cablescable de 7 pines para el transmisor y cable de 8 pines para el receptor Rels de seguridad Fuente de alimentacin elctrica Accesorios/escuadras de montaje (se requiere bombilla de silenciamiento) Detectores de silenciamiento (especificados en la pgina 2-38) Conectores de detectores (especificados en la pgina 2-38) Pieza de trabajo

Pieza de trabajo
5 1 7

Trayectoria de trabajo de los rodillos

Fuente de alimentacin elctrica


3

M8200

Figura 3: PAC con silenciamientoEl mdulo de silenciamiento est integrado en el receptor PAC

2-7

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Especificaciones
Normas Certificaciones Altura protegida Rango de escn/ resolucin Resolucin Clasificacin del envolvente Tipo de conexin EN 61496 Partes 1 y 2 TUV y marca CE; UL 61496, UL 1998 320 mm...1,760 mm (12.6 pulg....69.3 pulg.) en incrementos de 160 mm (6.3 pulg.) 0.3-7 m/14 mm (0.98-22.9 pies/0.55 pulg.) 0.3 m-18 m/30 mm (0.98-59 pies/1.18 pulg.) 14 mm/30 mm (0.55 pulg./1.18 pulg.) IP 65 Transmisor: conector micro de 4 pines Receptor: conector micro de 8 pines 24 VCC 20 % 5 Vss 0.9...2 Amps (sin carga) 0.4 A mx. (sin carga) ptica, sin canal de sincronizacin separado 2 x PNP, 0.5 A, con proteccin contra cortocircuito 1 x PNP 0.5 A mx. Uv 2 V Depende del nmero de haces Cortocircuito y sobrecarga 30 m (100 pies) mx. Reinicio manual o automtico Tipo 4 (autoverificacin) segn EN 61496 10 C a 55 C (14 F a 131 F) 15 %...95 % (sin condensacin) 25 C a 75 C (13 F a 167 F) La longitud depende de la altura protegida; (vea los dibujos de dimensiones) 40 mm x 50 mm (1.57 pulg. x 1.96 pulg.)

Descripcin
El sistema de cortina de luz de seguridad Guardmaster GuardShield de Allen-Bradley es una cortina de luz de seguridad de dos cajas, que consta de una pareja de transmisor y receptor desiguales. La cortina de luz de seguridad GuardShield es un dispositivo detector de presencia para uso general diseado para emplearse en maquinaria peligrosa que proporcione punto de operacin, as como guarda de permetro y acceso. Esta cortina de luz de seguridad de dos cajas, autnoma, tiene modos de operacin seleccionables mediante microinterruptor, y est disponible en resoluciones de 14 mm y 30 mm. Los modos de operacin, tal como supresin fija y flotante, codificacin de haces, enclavamiento de inicio/reinicio, monitoreo de dispositivos externos (EDM), seal de prueba de la mquina, se seleccionan mediante posicionamientos de microinterruptores. Estos microinterruptores estn ubicados debajo de una puerta de seguridad, convenientemente ubicada en las terminaciones de tapa final del transmisor y del receptor. El envolvente del GuardShield, de aluminio extruido torsionalmente rgido, con revestimiento de polvo de poliuretano y clasificacin ambiental IP65, permite usar el GuardShield en aplicaciones de guarda en una amplia gama de industrias.

Voltaje de suministro Uv Fluctuacin residual mxima Consumo de alimentacin Sincronizacin SalidasSeguridad SalidaSin seguridad Tensin de salida mnima Tiempo de respuesta Proteccin Longitud de cable Modo de operacin Categora de seguridad Temp. ambiente de funcionamiento Humedad del aire Temperatura de almacenamiento Dimensiones aproximadas Altura Seccin transversal del envolvente Longitud de onda del transmisor Resistencia a la vibracin Choque

Caractersticas
Supresin fijaaprendible Supresin flotanteuno o dos haces Codificacin de haces Monitoreo de dispositivo externo (EDM) Enclavamiento de inicio/reinicio

870 Nm IEC60068-2-6, frecuencia 10 Hz a 55 Hz Amplitud: 0.35 mm (0.01 pulg.) IEC60068-2-29 aceleracin 10 g, duracin de pulsos 16 ms

Nota: La fuente de alimentacin elctrica externa debe tener capacidad de amortiguar breves fallos de alimentacin de 20 ms, segn lo especificado en la norma IEC 60204.

2-8

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Seleccin de productos
1. Cortinas de luz de seguridadSistema estndar Las cortinas de luz de seguridad Guardmaster GuardShield de Allen-Bradley se piden en parejastransmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos.
Altura protegida mm (pulg.) 320 (12.6) 480 (18.9) 640 (25.2) 800 (31.5) 960 (37.8) 1,120 (44.1) 1,280 (50.4) 1,440 (56.7) 1,600 (63.0) 1,760 (69.1) Resolucin mm (pulg.) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) 14 (0.55) No. de haces 32 48 64 80 96 112 128 144 160 176 Nmero de catlogo 440L-P4J0320YD 440L-P4J0480YD 440L-P4J0640YD 440L-P4J0800YD 440L-P4J0960YD 440L-P4J1120YD 440L-P4J1280YD 440L-P4J1440YD 440L-P4J1600YD Altura protegida mm (pulg.) 320 (12.6) 480 (18.9) 640 (25.2) 800 (31.5) 960 (37.8) 1,120 (44.1) 1,280 (50.4) 1,440 (56.7) 1,600 (63.0) Resolucin mm (pulg.) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) 30 (1.18) No. de haces 16 24 32 40 48 56 64 72 80 88 Nmero de catlogo 440L-P4K0320YD 440L-P40480KYD 440L-P4K0640YD 440L-P4K0800YD 440L-P4K0960YD 440L-P4K1120YD 440L-P4K1280YD 440L-P4K1440YD 440L-P4K1600YD 440L-P4K1760YD

1,760 (69.1) 30 (1.18) 440L-P4J1760YD Nota: El transmisor GuardShield necesita un cable de 4 pines y el receptor necesita un cable de 8 pines.

2. Conjuntos de cablesSe requieren 2 (uno para el transmisor y otro para el receptor)


Conector hembra (extremo de detector) Vista frontal del conector hembra Transmisor 2 (6.5) 5 (16.4) Recto 1 Marrn 2 Blanco 3 Azul 4 Negro ngulo recto 10 (32.8) 15 (49.2) 20 (65.6) 22 AWG 300 V 3A 30 (98.4) 2 (6.5) 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) Receptor 2 (6.5) 5 (16.4) Recto 10 (32.8) 1 Blanco 2 Marrn 3 Verde 4 Amarillo 5 Gris 6 Rosado 7 Azul 8 Rojo 15 (49.2) 20 (65.6) 24 AWG 36 VCC/30 VCA 1.5 A 30 (98.4) 2 (6.5) 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) 889D-F8AB-2 889D-F8AB-5 889D-F8AB-10 889D-F8AB-15 889D-F8AB-20 889D-F8AB-30 889D-R8AB-2 889D-R8AB-5 889D-R8AB-10 889D-R8AB-15 889D-R8AB-20 889D-R8AB-30 889D-F4AC-2 889D-F4AC-5 889D-F4AC-10 889D-F4AC-15 889D-F4AC-20 889D-F4AC-30 889D-R4AC-2 889D-R4AC-5 889D-R4AC-10 889D-R4AC-15 889D-R4AC-20 889D-R4AC-30 Estilo de conector Pin/color de cable Cable Clasificacin de cable Longitudm (pies) Nmero de catlogo

1
4

2 3

1 7 6 8 5

2 3 4

ngulo recto

2-9

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Seleccin de productos (continuacin)
Dimensiones aproximadas de los conjuntos de cablesmm (pulgadas) Las dimensiones no se proporcionan para fines de instalacin.
51 (2.0) 84 (3.3) 25.4 (1.0) dim. 25.4 (1.0) dim. 68 (2.7)

Recto hembra
Las ilustraciones no se presentan en escala real.

ngulo recto hembra

3. Interfaces de rel de seguridadOpcional


Salidas de seguridad Salidas auxiliares Fuente de alimentacin elctrica Restablecimiento 24 VCA/CC 1 NC, 2 NC, o cortina de luz Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual 230 VCA Nmero de catlogo 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-N23117 440R-N23116 440R-N23115 440R-N23114 440R-N23113 440R-N23112 440R-N23123 440R-N23122 440R-N23121 440R-N23120 440R-N23119 440R-N23118 440R-C23139 Automtico/manual o manual monitoreado

Rel

Entrada

Terminales

3 N.A.

1 N.C.

Desmontable

115 VCA

MSR127RP
Cortina de luz o un solo canal (MSR126T) Dos canales (MSR126.1T) 2 N.A. Cortina de luz o un solo canal (MSR126R) Ninguna Fijo 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC Cortina de luz o tapete de seguridad 2 N.C. 2 PNP, estado Desmontable slido

Manual monitoreado

Automtico/manual

MSR126

Manual monitoreado

Dos canales (MSR126.1R)

3 N.A.

115 VCA

440R-C23137

230 VCA

440R-C23136

MSR131RTP

4. Intefaces de rel de seguridadOpcional (usados para aplicaciones de silenciamiento)


Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

Rel

PSDI

Salidas

24 VCC

Manual

no

no

2 N.A. Seguridad 1 N.C. Aux.

4-21

440R-P23071

MSR22LM

2-10

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Seleccin de productos (continuacin)
5. AccesoriosOpcional
Descripcin Nmero de catlogo

Escuadra de montaje central de aluminio para aplicaciones expuestas a vibracin

440L-AF6108

Escuadra de montaje de terminacin de tapa final, de acero, en forma de L (4 por paquete) Nota: 4 escuadras suministradas con cada pareja GuardShield.

440L-AF6101

Fuente de alimentacin elctrica: Entrada85...265 VCA Salida24 VCC, 3 Amps

1794-PS3

6. Espejo de esquina para guardas de varios lados Espejos de vidrio de construccin especial para aplicaciones de proteccin de 2 y 3 lados.
Nota: Cada espejo reduce el margen de escn mximo en un 10 % por espejo. Para modelos GuardShield 320 480 640 800 960 1,120 1,280 1,440 1,600 1,760 Juego de montaje para espejos. Cada juego contiene 1 escuadra con pernos de fijacin. Pida 2 juegos por espejo. Base de montaje para espejo y cortinas de luz (vea la pgina 2-20)

Nmero de catlogo 440L-AM1200450 440L-AM1200600 440L-AM1200750 440L-AM1200900 440L-AM1201050 440L-AM1201200 440L-AM1201350 440L-AM1201500 440L-AM1201650 440L-AM1201800 440L-AM120BRK 440L-AMSTD

2-11

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
Requiere escuadra de montaje (incluida con la cortina de luz) 20 (0.79) 52 (2.04) 52 (2.05) 42 (1.65) 18.9 (0.74) 14.5 (0.57) 40 (1.57) 11 (0.43) Cortina de luz de seguridad 42 (1.65) 20 (0.79)

40 (1.57)

3.0 (0.11)

32 (1.25)

C Escuadra de montaje central opcional 30 (1.18) 20 (0.78) 49.2 (1.93)

40.2 (1.58) 62 (2.44)

24 (0.94) >80 (3.14)

75 (2.95)

Nota: Debe usarse en aplicaciones expuestas a vibracin. A Altura protectora 320 0.5 480 0.5 640 0.5 800 0.6 960 0.6 1,120 0.6 1,280 0.7 1,440 0.7 1,600 0.8 1,760 0.8 B Valor de montaje 436 596 756 916 1,076 1,236 1,396 1,556 1,716 1,876 C Longitud total 472 1.5 632 1.5 792 1.5 952 1.5 1,112 1.5 1,272 1.8 1,432 1.8 1,592 1.8 1,752 2.0 1,912 2.0

Tipo 440L-P4J0320YD 440L-P4J0480YD 440L-P4J0640YD 440L-P4J0800YD 440L-P4J0960YD 440L-P4J1120YD 440L-P4J1280YD 440L-P4J1440YD 440L-P4J1600YD 440L-P4J1760YD

2-12

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


GuardShield Diagrama de cableado
El diagrama de cableado no se proporciona para fines de instalacin.
+24 VCC Transmisor Receptor Marrn Marrn Rojo Gris OSSD 1 S2 (Inicio/reinicio)

S1 Prueba Seal de prueba de la mquina Negro Rosado OSSD 2

K2
Boletn 100S Contactores de seguridad o rels de seguridad 700S

K1
Amarillo Blanco Azul Verde Tierra de 24 V Seal auxiliar MPCE/EDM

Azul

La salida auxiliar no es de seguridad. Puede conectarse a una bombilla, motor o estado a un PLC.

K1, K2 S1 S2

Rel de seguridad o contactor de seguridad para conexin OSSD 1 y OSSD 2 Interruptor para prueba externa del sistema (opcional) Interruptor para restablecer la cortina de luz desde el enclavamiento de inicio/reinicio

2-13

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Especificaciones
Normas Certificaciones Altura protegida Margen de escn Resolucin Clasificacin del envolvente Tipo de conexin Voltaje de suministro Uv Fluctuacin residual mxima EN 61496 Partes 1 y 2 TUV, cULus y marca CE 300 mm...1,800 mm (12 pulg....72 pulg.) 0-2 5 m, 2-6 m/14 mm 0-6 m 5-19 m/30 mm 14 mm/30 mm (0.55 pulg./1.18 pulg.) IP 65 Estilo M23 metlico de 12 pines en el transmisor y receptor 24 VCC 20 % 5 Vss

Descripcin
Las cortinas de luz de seguridad SafeShield son dispositivos de proteccin opto-electrnica activos (AOPD) con resoluciones de 14 mm (0.55 pulg.) o 30 mm (1.18 pulg.). Las cortinas de luz de seguridad Guardmaster SafeShield de AllenBradley cuentan con la funcin de autoverificacin y la clasificacin de dispositivo de seguridad Tipo 4. Se han diseado para aplicaciones industriales y tienen las siguientes caractersticas: Alto grado de confiabilidad Tamao compacto Construccin modular resistente Posibilidades de aplicacin universal Instalacin simple Configurable mediante software

Tiempo de activacin despus de conectar el voltaje de suministro al transmisor y receptor Consumo de alimentacin Sincronizacin Salidas Tensin de salida mnima Tiempo de respuesta Proteccin Conexin Seccin transversal de cable como mximo Longitud de cable

8 segundos mximo 0.9...2 Amps (sin carga) ptica, sin canal de sincronizacin separado 2 x PNP, 0.5 A, proteccin contra cortocircuito Uv 2 V Depende del nmero de haces Cortocircuito y sobrecarga 1.0 mm2 con forro 1.5 mm2 sin forro 60 m (196.8 pies) mximo Proteccin contra sobrevoltaje (1 kV) desde nivel 3 o superior (IEC 801 parte 5; 2 kV) entre PE y +V. Reinicio manual o automtico Tipo 4 (autoverificacin) segn EN 61496 0 C a 55 C (32 F a 131 F) 15 %...95 % (sin condensacin) 25 C a 70 C (-13 F a 158 F) La longitud depende de la altura protegida; (vea los dibujos de dimensiones) 40 mm x 48 mm (1.57 pulg. x 1.77 pulg.) 5 g 10-55 Hz segn IEC 68-2-6 10 g 16 ms segn IEC 68-2-29

Caractersticas
Salidas de estado slido de control confiable La ms moderna tecnologa de microprocesador con circuitos ASIC (circuitos integrados especficos para la aplicacin) personalizados. Fcil ensamblaje y alineamiento Conectores estilo M23 Largo margen de escn y alta resolucin Seccin transversal de envolvente compacto: 40 mm x 48 mm (1.57 pulg. x 1.77 pulg.) Tiempo de respuesta rpida Posibilidad de conectar en cadena hasta tres detectores (para evitar que el personal se coloque entre el campo protector y el punto de operacin) La construccin cumple con la norma EN 61496 Partes 1 y 2 Tipo 4 (autoverificacin) Probado y aprobado para uso en EE.UU., Europa y Japn Resolucin (sensibilidad al objeto) 14 mm/30 mm Altura mxima del campo protector 1,800 mm (72 pulg.) Altura mnima del campo protector 300 mm (12 pulg.) El eje ptico (centro de la ventana) est marcado en la terminacin de tapa final Supresin fija, supresin flotante Resolucin, codificacin de haces reducidas

Modo de operacin Categora de seguridad Temp. ambiente de funcionamiento Humedad del aire Temperatura de almacenamiento Dimensiones Altura Seccin transversal del envolvente Vibracin Choque

Nota: La fuente de alimentacin elctrica externa debe tener capacidad de amortiguar breves fallos de alimentacin de 20 ms, segn lo especificado en la norma IEC 60204.

2-14

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Seleccin de productos
1. Cortinas de luz de seguridadSistema estndar Las cortinas de luz de seguridad Guardmaster SafeShield de Allen-Bradley se piden en parejastransmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos.
Altura protegida mm (pulg.) 300 (12) 450 (18) 600 (24) 750 (30) 900 (36) 1,050 (42) Resolucin mm/Haces 14/40 30/15 14/60 30/23 14/80 30/30 14/100 30/38 14/120 30/45 14/140 30/53 Altura protegida mm (pulg.) 1,200 (48) 1,350 (54) 1,500 (60) 1,650 (66) 1,800 (72) Resolucin mm/Haces 14/160 30/60 14/180 30/68 14/200 30/75 14/220 30/83 14/240 30/90

Nmero de catlogo 442L-PA40314CBCD 442L-PA40330CBCD 442L-PA40414CBCD 442L-PA40430CBCD 442L-PA40614CBCD 442L-PA40630CBCD 442L-PA40714CBCD 442L-PA40730CBCD 442L-PA40914CBCD 442L-PA40930CBCD 442L-PA41014CBCD 442L-PA41030CBCD

Nmero de catlogo 442L-PA41214CBCD 442L-PA41230CBCD 442L-PA41314CBCD 442L-PA41330CBCD 442L-PA41514CBCD 442L-PA41530CBCD 442L-PA41614CBCD 442L-PA41630CBCD 442L-PA41814CBCD 442L-PA41830CBCD

Por favor haga su pedido de dispositivos principales diseados para aplicaciones de conexin en cadena (detector principal) por separado (vea la pgina 2-18).

2. Conjuntos de cablesSe requieren 2 (uno para el transmisor y otro para el receptor)


Conector hembra (extremo de detector) Vista frontal del conector hembra Estilo de conector Pin/color de cable Cable Clasificacin de cable Longitudm (pies) 2 (6.5) 1 Marrn 2 Azul 3 Gris 4 Rosado 5 Rojo 6 Amarillo 7 Blanco 8 Rojo/azul 9 Negro 10 Prpura 11 Gris/rosado 12 Verde 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 18 AWG 60 V 4A 30 (98.4) 2 (6.5) 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) Nmero de catlogo 889M-F12AH-2 889M-F12AH-5 889M-F12AH-10 889M-F12AH-15 889M-F12AH-20 889M-F12AH-30 889M-R12AH-2 889M-R12AH-5 889M-R12AH-10 889M-R12AH-15 889M-R12AH-20 889M-R12AH-30

Recto

1 2 3 4 10

9 11 5

8 12 7 6

ngulo recto

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
85 (3.35) Longitud

26.2 (1.03) dim. M23 x 1 Roscas internas

2-15

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Seleccin de productos
3a. Interfaces de rel de seguridadRequeridos
Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

PSDI

Salidas 4 amp 2 N.A. Seguridad 1 N.C. Aux.

24 VCC

Manual/ automtico

no

no

no

no

2-58

440L-M8200

Nota: Para obtener informacin sobre el cableado, consulte la seccin Aplicaciones de proteccin de este catlogo.

3b. Interfaces de rel de seguridadOpcional


Salidas de seguridad Salidas auxiliares Fuente de alimentacin elctrica Restablecimiento 24 VCA/CC 1 NC, 2 NC, o cortina de luz Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual 230 VCA Nmero de catlogo 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-N23117 440R-N23116 440R-N23115 440R-N23114 440R-N23113 440R-N23112 440R-N23123 440R-N23122 440R-N23121 440R-N23120 440R-N23119 440R-N23118 440R-C23139 Automtico/manual o manual monitoreado

Rel

Entrada

Terminales

3 N.A.

1 N.C.

Desmontable

115 VCA

MSR127RP
Cortina de luz o un solo canal (MSR126T) Dos canales (MSR126.1T) Cortina de luz o un solo canal (MSR126R) 2 N.A. Ninguna Fijo 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC Cortina de luz o tapete de seguridad 2 N.C. 2 PNP, estado Desmontable slido

Manual monitoreado

Automtico/manual

MSR126

Manual monitoreado

Dos canales (MSR126.1R)

3 N.A.

115 VCA

440R-C23137

230 VCA

440R-C23136

MSR131RTP

3c. Interface DeviceNet opcional


Tensin de entrada Salidas Ms detalles Nmero de catlogo

24 VCC

DeviceNet

2-52

442L-MDNET

2-16

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Seleccin de productos
4. AccesoriosOpcional
Productos Nmero de catlogo 442L-AF6106 (1 paquete por sistema)

Escuadra de montaje giratoria de plstico (4 por paquete)

Montura lateral metlica (4 por paquete)

442L-AF6107 (1 paquete por sistema)

Escuadra de montaje en L, de acero, fija (4 por paquete)

440L-AF6102 (1 paquete por sistema)

Fuente de alimentacin elctrica: Entrada85...265 VCA Salida24 VCC, 3 Amps Accesorio para alineamiento de lser Adaptador SafeShield para accesorio de alineamiento de lser Tuercas deslizables (4 piezas suministradas con el sistema SafeShield)

1794-PS3

440L-ALAT 442L-ALBK2 440L-AF6105

Tabla de seleccin de espejos de esquina Espejos de vidrio de construccin especial para aplicaciones de proteccin de 2 y 3 lados.
Nota: Cada espejo reduce el margen de escn mximo en un 10 % por espejo. Para modelos SafeShield 300 450 600 750 900 1,050 1,200 1,350 1,500 1,650 1,800 Juego de montaje para espejos. Cada juego contiene 1 escuadra con pernos de fijacin. Pida 2 juegos por espejo. Base de montaje para espejo y cortinas de luz (vea la pgina 2-20) Nmero de catlogo 440L-AM1200300 440L-AM1200450 440L-AM1200600 440L-AM1200750 440L-AM1200900 440L-AM1201050 440L-AM1201200 440L-AM1201350 440L-AM1201500 440L-AM1201800 440L-AM120BRK 440L-AMSTD

2-17

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield para configuracin en cascada Seleccin de productos
Los sistemas de cortina de luz de seguridad de la familia Guardmaster SafeShield de Allen-Bradley, para configuracin en cascada, se piden como parejatransmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos.

Sistema para configuracin en cascada

Conector, 3 m mx.

Sistema estndar (Pg 40)

Cortinas de luz de seguridadSistema de configuracin en cascada


Los dispositivos de configuracin en cascada vienen con dos conectores M23; un conector del sistema en un extremo del dispositivo para conectar la cortina de luz a su sistema de control de seguridad y un conector de extensin en el otro extremo del dispositivo para hacer conexin al siguiente segmento de cortina de luz. El nmero mximo de segmentos es tres. El primer segmento de un sistema de dos cascadas y el primer y segundo segmento de un sistema de tres cascadas debe siempre ser un dispositivo de configuracin en cascada (con un conector en ambos extremos). Esto permite conectar segmentos adicionales al sistema (un mximo de tres segmentos). El ltimo segmento, que puede ser el segundo segmento de un sistema de dos cascadas o el tercer segmento de un sistema de tres cascadas puede ser un sistema de cortina de luz estndar, indicado en la pgina 2-15, que slo tendra un conector en un extremo. El mximo nmero de haces de todos los segmentos no puede exceder de 480 haces. La resolucin puede combinarse entre segmentos. Por ejemplo, el primer segmento podra tener una resolucin de 14 mm y el segundo segmento podra tener una resolucin de 30 mm.

ATENCIN : Al combinar resoluciones de un sistema en cascada, asegrese de hacer los clculos apropiados sobre distancia de seguridad con la mayor resolucin.

Altura protegida mm (pulg.) 300 (12) 450 (18) 600 (24) 750 (30) 900 (36) 1,050 (42)

Resolucin mm/Haces 14/40 30/15 14/60 30/23 14/80 30/30 14/100 30/38 14/120 30/45 14/140 30/53

Nmero de catlogo 442L-PA40314DBCD 442L-PA40330DBCD 442L-PA40414DBCD 442L-PA40430DBCD 442L-PA40614DBCD 442L-PA40630DBCD 442L-PA40714DBCD 442L-PA40730DBCD 442L-PA40914DBCD 442L-PA40930DBCD 442L-PA41014DBCD 442L-PA41030DBCD

Altura protegida mm (pulg.) 1,200 (48) 1,350 (54) 1,500 (60) 1,650 (66) 1,800 (72)

Resolucin mm/Haces 14/160 30/60 14/180 30/68 14/200 30/75 14/220 30/83 14/240 30/90

Nmero de catlogo 442L-PA41214DBCD 442L-PA41230DBCD 442L-PA41314DBCD 442L-PA41330DBCD 442L-PA41514DBCD 442L-PA41530DBCD 442L-PA41614DBCD 442L-PA41630DBCD 442L-PA41814DBCD 442L-PA41830DBCD

Para hacer su pedido de controladores, rels de seguridad y accesorios, consulte la pgina 2-16.

2-18

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Seleccin de productosConjuntos de cables y conectores
Se requieren 2 (uno para el transmisor y uno para el receptor) para hacer conexin entre segmentos
Conector hembra (extremo de detector) Vista frontal del conector hembra Estilo de conector Pin/color de cable 1 Marrn 2 Azul 3 Gris 4 Rosado 5 Rojo 6 Amarillo 7 Blanco 8 Rojo/azul 9 Negro 10 Prpura 11 Gris/rosado 12 Verde Cable Clasificacin de cable Longitudm (pies) 0.3 (1.0) 0.6 (2.0) 22 AWG 250 V 8A Nmero de catlogo 889M-F12AHMU-0M3 889M-F12AHMU-0M6

1 2 3 4 10

9 11

8 12 7 6 5

Recto

1.0 (3.3) 2.0 (6.5)

889M-F12AHMU-1 889M-F12AHMU-2

3.0 (9.8)

889M-F12AHMU-3

Dimensiones aproximadasmm (pulgadas)


Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
85 (3.35) 26.2 (1.03) dim. M23 x 1 Roscas internas
3.8 (0.15)

Longitud

85 (3.35) 26.2 (1.03) dim.

Conector macho

Conector hembra

44.4 (1.75)

19 (0.75)

8 (0

.31)

13 (0.51) 44 (1.73) 50 (1.97)

18 (0.71)

30.6 (1.2) 75 (2.95) 9 (0.35) 15 (0.59)

5.5 (0.22) 42 (1.65) 34.5 (1.36) 6 (0.24)

Escuadra de montaje giratoria 442L-AF6106

Escuadra de montaje lateral 442L-AF6107

2-19

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
40 (1.57) 20 (0.79) 48 (1.89) 22.4 (0.88) 14 (0.55) 6 (0.24) 3.5 (0.14) 2.2 (0.09) 10.5 (0.41) L1 Ranura de tuerca deslizante para montaje lateral S L2 A Conector de cable 1 40 (1.57) 20 (0.79)
10 (0.39)

10 (0.39)

10.5 (0.41) Ranura de tuerca deslizante para montaje lateral

aprox. 150 (5.91) (margen del conector)

14 (0.55) 6 (0.24) 3.5 (0.14) 2.2 (0.09)

L2

L1

aprox. 140 (5.51) (margen del conector)

56.3 (2.22)

74 (2.91)

aprox. 140 (5.51) (margen del conector)

56.3 (2.22) 100 (3.94) 36.2 (1.43)

74 (2.91)

100 (3.94)

M23

Computadora principalTransmisor SafeShield, sistema de configuracin en cascada, receptor, imagen de espejo


Altura del campo protector S 300 (11.8) 450 (17.7) 600 (23.6) 750 (29.5) 900 (35.4) 1,050 (41.3) 1,200 (47.3) 1,350 (53.2) 1,500 (59.1) 1,650 (65.0) 1,800 (70.9) Dimensiones aproximadasmm (pulg.) L1 381 (15.0) 532 (20.9) 682 (26.9) 833 (32.8) 984 (38.8) 1,134 (44.7) 1,283 (50.5) 1,435 (56.5) 1,586 (62.4) 1,736 (68.4) 1,887 (79.3) L2 450 (17.7) 600 (23.6) 751 (29.6) 901 (35.5) 1,052 (41.4) 1,202 (47.3) 1,352 (53.2) 1,503 (59.2) 1,654 (65.1) 1,804 (71.0) 1,955 (77.0) A 224 (8.8) 374 (14.7) 524 (20.6) 674 (26.5) 824 (32.4) 974 (38.4) 1,124 (44.3) 1,274 (50.2) 1,424 (56.1) 1,574 (62.0) 1,724 (67.9)

Transmisor SafeShield, sistema estndar (no en cascada). Receptor, imagen de espejo


Altura del campo protector S 300 (11.8) 450 (17.7) 600 (23.6) 750 (29.5) 900 (35.4) 1,050 (41.3) 1,200 (47.3) 1,350 (53.2) 1,500 (59.1) 1,650 (65.0) 1,800 (70.9) Dimensiones aproximadasmm (pulg.) L1 381 (15.0) 532 (20.9) 682 (26.9) 833 (32.8) 984 (38.8) 1,134 (44.7) 1,283 (50.5) 1,435 (56.5) 1,586 (62.4) 1,736 (68.4) 1,887 (79.3) L2 427 (16.8) 578 (22.8) 728 (28.7) 879 (34.6) 1,030 (40.6) 1,180 (46.5) 1,329 (52.3) 1,481 (58.3) 1,632 (64.3) 1,782 (70.2) 1,933 (76.1) A 224 (8.8) 374 (14.7) 524 (20.6) 674 (26.5) 824 (32.4) 974 (38.4) 1,124 (44.3) 1,274 (50.2) 1,424 (56.1) 1,574 (62.0) 1,724 (67.9)

2-20

110

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Dimensiones aproximadasmm (pulgadas)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
7 (0.28) 39 (1.54) 33.5 (1.32) 15.4 (0.61)

Altura del campo protector S 300 (11.8)

Dimensiones aproximadasmm ( pulg.) L1 366 (19.4) 523 (20.1) 666 (26.2) 816 (32.1) 966 (38.0) 1,116 (43.9) 1,266 (49.8) 1,416 (55.8) 1,566 (61.7) 1,716 (67.6) 1,866 (73.5) L2 340 (13.4) 497 19.6() 640 (25.2) 790 (31.1) 940 (37.0) 1,090 (42.9) 1,240 (48.8) 1,390 (54.7) 1,540 (60.6) 1,690 (66.5) 1,840 (72.5) L3 307 (12.1) 307 (12.1) 528.5 (20.8) 639.5 (25.2) 750 (29.5) 972 (38.3) 1,146 (45.1) 1,296 (51.0) 1,415.5 (55.7) 1,596 (62.8) 1,746 (68.7) L4 707.95 (27.9) 798 (31.4) 873 (34.4) L5 29.5 (1.2) 108 (4.3) 68.75 (2.7) 88.25 (3.5) 108 (4.3) 72 (2.8) 60 (2.4) 60 (2.4) 75.25 (2.9) 60 (2.4) 60 (2.4)

43.5 (1.71)

450 (17.7) 600 (23.6)

152.5 (6.0)

750 (29.5)
L5

900 (35.4) 1,050 (41.3)

L4

L1

L2

18 (0.71)

1,200 (47.3)
L3

1,350 (53.2) 1,500 (59.1) 1,650 (65.0) 1,800 (70.9)

123.4 (4.86) 172 (6.77)

Para la Tabla de seleccin de espejos, vea la pgina 2-17

EspejoSerie 440L-AM1200
85.6 (3.73) 6.8 (0.27) dim. 11.1 (0.44) dim. 9.4 (0.73) (2) 25.4 (1.0) 1828.8 (72) 63.5 (2.5)

76 (3.0)

11.1 [7/16] (0.44) dim. 38 (1.5) 12.7 [1/2] (0.5) dim. Escuadra de montaje 63.5 (2.5) 89 (3.5) 19.05 (0.75) 12.7 (0.5) 6.35 (0.25) 304.8 (12) 6.35 (0.25) 25.4 (1.0) dim. 76.2 (3.0) 381.0 (15)

171 (6.75)

Escuadra de montaje de espejo 440L-AM120BRK

Bases de montaje 440L-AMSTD

2-21

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield
Elementos de los indicadores Los indicadores LED y la pantalla de 7 segmentos del transmisor y receptor indican el estado de operacin del SafeShield.
Pantalla Significado Anaranjado: Se necesita limpieza o realineamiento Amarillo parpadeante: Se necesita restablecer Rojo: El sistema proporciona seales para desactivar la mquina Verde: Sistema habilitado
Pantalla de 7 segmentos

Amarillo

Error del sistema. El dispositivo est defectuoso. Reemplace el receptor.

Mal alineamiento con el transmisor.

h.

Operacin con amplia anchura del campo protector Operacin con resolucin reducida y/o supresin

Indicadores de estado de operacin del transmisor


Pantalla Significado Amarillo: Fuente de alimentacin elctrica en buen estado Error del sistema. El dispositivo est defectuoso. Reemplace el transmisor. El dispositivo est en modo de prueba. Operacin no codificada (slo despus de conmutacin a activado) Operacin con cdigo 1 (slo despus de conmutacin a activado) Operacin con cdigo 2 (slo despus de conmutacin a activado) Otras pantallas Todas las otras pantallas son cdigos de error.

Operacin no codificada (slo despus de conmutacin a activado) Operacin con cdigo 1 (slo despus de conmutacin a activado) Operacin con cdigo 2 (slo despus de conmutacin a activado) Otras pantallas Todas las otras pantallas son cdigos de error.

Significado de los elementos indicadores de operacin del receptor

Significado de los elementos indicadores de operacin del transmisor

Anaranjado Amarillo

Rojo Verde

Pantalla de 7 segmentos

Indicador de elementos del receptor

2-22

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Instalacin elctrica ATENCIN: Asegrese de que toda la mquina/sistema est desconectado durante la instalacin elctrica.
Pin 1 2 Notas: Color de cables Marrn Azul

Transmisor Entrada de 24 VCC (suministro de voltaje) 0 VCC (suministro de voltaje) Entrada de prueba: 0 V: prueba externa activa 24 V: prueba externa inactiva Reservado Reservado

Receptor Entrada de 24 VCC (suministro de voltaje) 0 VCC (suministro de voltaje)

La cortina de luz de seguridad es un dispositivo Clase A. Puede causar interferencia de radio en reas residenciales. Para asegurar compatibilidad electromagntica total (EMC), debe conectarse la tierra (PE). El suministro de voltaje externo del dispositivo debe tener capacidad de amortiguar breves fallos de alimentacin de 20 ms, segn lo especificado en la norma EN 60204. Guardmaster de Allen-Bradley ofrece fuentes de alimentacin apropiadas como accesorios. El alineamiento del conector (direccin de giro) en el envolvente puede variar de una unidad a otra. Usted puede identificar la asignacin correcta de pines por la posicin de los pines uno en relacin con otro como se muestra en los dibujos. Las conexiones del sistema y las conexiones de extensin de un sistema en cascada deben conectarse slo si el sistema est fuera del lnea. La interface RS 232 puede conectarse y desconectarse con el sistema en lnea.

Gris

OSSD1 (salida de conmutacin 1)

4 5

Rosado Rojo

OSSD2 (salida de conmutacin 2) Restablecimiento/ reinicio Monitoreo de dispositivo externo (EDM) Reservado Reservado Comunicacin de dispositivo Comunicacin de dispositivo Computadora principal de entrada/SEL secundario Tierra funcional

6 7 8 9 10

Amarillo Blanco

Reservado Reservado Comunicacin de dispositivo Comunicacin de dispositivo Computadora principal de entrada/SEL secundario Tierra funcional

Rojo/azul Reservado Negro Prpura Gris/ rosado Verde

Dimensiones aproximadasmm (pulgadas)


Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.

11 FE

Asignacin de pines, conexin del sistema, M 2311 + FE

5 10

6 7 11

5 10

6 7 11

FE

FE 4 2

3 4 3 2 9 1 4 3 2 9 1

Configuracin de asignacin de pines, conexin M 8x4 (interface en serie) Asignacin de pines, conexin del sistema, M 2311 + FE
Transmisor/ Pin 1 2 3 4 RxD TxD Receptor No asignado Pin 3 Pin 2 0 VCC (suministro de voltaje) Pin 5 Lado de PC, RS 232 SubD

Configuracin de asignacin de pines, conexin M 8x4


Nota: La asignacin de pines del transmisor y del receptor es idntica.

2-23

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield Dimensiones aproximadasmm (pulgadas)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin. Monitoreo de dispositivo externo (EDM) El EDM verifica si los contactores realmente se desactivan cuando responde el dispositivo protector. Si despus de intentar un restablecimiento, el EDM no detecta una respuesta del amplificador de conmutacin en un lapso de 300 ms, el EDM desactivar las salidas de conmutacin OSSD nuevamente.

5 10

6 7 11

5 10

6 7 11

FE

FE Conector del sistema K1 de alimentacin Bobinas K2

4 3

4 3

Pin 6 24 V V (ver Notas) K2 K1 de alimentacin Contactos

4 3

Asignacin de pines, conexin de extensin, M 2311 + FEusada en dispositivos de configuracin en cascada.


Pin 1 2 3 4 5 6 7 8 9 10 Color de cables Marrn Azul Gris Rosado Rojo Amarillo Blanco Rojo/azul Negro Prpura Transmisor Salida de 24 VCC (suministro de voltaje) 0 VCC (suministro de voltaje) Reservado Reservado Reservado Reservado Reservado Reservado Comunicacin de dispositivo Comunicacin de dispositivo Receptor Salida de 24 VCC (suministro de voltaje) 0 VCC (suministro de voltaje) Reservado

Conexin de los elementos de contacto al EDM El EDM es implementado elctricamente al cerrarse ambos contactos N.C. (k1, k2) cuando los elementos de contacto (K1, K2) se desactivan por la interrupcin del campo de deteccin: luego se aplican 24 Volts a la entrada del EDM. Si no se aplican 24 V despus de una interrupcin del campo de deteccin, uno de los elementos de contacto est defectuoso y el EDM evita que se reinicie la mquina.
Notas:

Reservado Reservado Reservado Reservado Reservado Comunicacin de dispositivo Comunicacin de dispositivo Computadora principal de salida/SEL secundario Tierra funcional

El EDM permanece activo despus de conmutar el dispositivo a desactivado y nuevamente a activado. Slo puede desactivarse con la funcin de restablecimiento. Si conecta los elementos de contacto que van a ser monitoreados a la entrada del EDM, deber seleccionar el modo de operacin EDM en el SCD (software de Configuracin y diagnstico de seguridad). De lo contrario, el dispositivo mostrar el error . Si posteriormente cancel la seleccin del modo de operacin EDM, el pin 6 del conector del sistema no debe permanecer conectado a 24 V. En este caso, conecte el pin 6 a 0 V.

11 FE

Computadora principal Gris/rosado de salida/SEL secundario Verde Tierra funcional

Asignacin de pines, conexin de extensin, M 2311 + FE

2-24

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


SafeShield
Botn de restablecer/botn de reinicio En el modo de operacin con enclavamiento de reinicio interno, el operador primero debe presionar el botn de restablecimiento/ reinicio antes de reiniciar.

ATENCIN: Seleccione el sitio correcto de instalacin para el botn de restablecimiento. Instale el botn de restablecimiento fuera del rea peligrosa, de manera que no pueda ser activado desde el interior del rea peligrosa. Al activar el botn de restablecimiento, el operador debe poder

ATENCIN : Reconfiguracin despus de reemplazo de dispositivo. Si usted reemplaz una cortina de luz de seguridad configurada con la funcin de restablecimiento activada, con una unidad de reemplazo, la funcin de restablecimiento debe activarse nuevamente mediante el software. No es suficiente hacer las conexiones elctricas porque los nuevos dispositivos se

Transmisor

Receptor

Botn de restablecimiento/reinicio Pin 5 24 V

Conexin del botn de restablecimiento/reinicio

2-25

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin
6 m/18 m (19.69 pies/59.06 pies) 14 mm/30 mm Resolucin (sensibilidad al objeto) (0.55 pulg./1.18 pulg.) Altura mxima del campo de 1,814 mm/1,832 mm proteccin (71.4 pulg./72.1 pulg.) Altura mnima del campo de 314 mm/332 mm proteccin (12.36 pulg./13.07 pulg.) El eje ptico (centro de la ventana) est marcado en la terminacin de tapa final Mximo margen de escn

Especificaciones
Normas Certificaciones EN 50100 BG, cULus y marca CE 314 mm...1,832 mm (12.3 pulg....72.1 pulg.) 0.3 m...6 m (0.98 pies...19.6 pies)/0.3 m... 18 m (0.98 pies...59.0 pies) 14 mm/30 mm (0.55 pulg./1.18 pulg.) IP 65 Conector mini de 7 pines en transmisor y receptor 24 VCC 20 % 5 Vss

Descripcin
Las cortinas de luz de seguridad de control de punto de operacin (POC) son dispositivos de proteccin opto-electrnica activos (AOPD) con resoluciones de 14 mm (0.55 pulg.) o 30 mm (1.18 pulg.). Las cortinas de luz de seguridad Guardmaster POC de Allen-Bradley cuentan con la funcin de autoverificacin y pertenecen a la clasificacin de seguridad Tipo 4. Se han diseado para aplicaciones industriales y tienen las siguientes caractersticas: Alto grado de confiabilidad Sus componentes no requieren mantenimiento Tamao prctico Construccin modular resistente Posibilidades de aplicacin universal Instalacin simple

Altura protegida Margen de escn Resolucin Clasificacin del envolvente Tipo de conexin Voltaje de suministro Uv Fluctuacin residual mxima

Consumo de alimentacin 0.9...1.5 Amps (sin carga) Sincronizacin Salidas Tensin de salida mnima Tiempo de respuesta Proteccin Conexin Seccin transversal de cable como mximo Longitud de cable ptica, sin canal de sincronizacin separado 2 x PNP, 0.5 A, proteccin contra cortocircuito Uv 2 V

Caractersticas
Operacin libre de mantenimiento Salidas de estado slido de control confiable La ms moderna tecnologa de microprocesador con circuitos ASIC (circuitos integrados especficos para la aplicacin) personalizados. Fcil ensamblaje y alineamiento Conectores estilo mini Largo margen de escn y alta resolucin Seccin transversal de envolvente compacto: 52 mm x 55 mm (2.05 pulg. x 2.17 pulg.) Tiempo de respuesta rpido de 15 ms Considerable ganancia de exceso Posibilidad de conectar en cadena dos detectores (para evitar que el personal se coloque entre el campo protector y el punto de operacin) La construccin cumple con la norma EN 50100 Categora 4 (autoverificacin) Probado y aprobado para uso en EE.UU., Europa y Japn

15 ms
Cortocircuito y sobrecarga 1.0 mm2 con forro 1.5 mm2 sin forro 60 m (196.8 pies) Proteccin contra sobrevoltaje (1 kV) desde nivel 3 o superior (IEC 801 parte 5; 2 kV) entre PE y +V. Guarda solamente con reinicio automtico Tipo 4 (autoverificacin) Conformidad con EN 50100 0 C a 55 C (32 F a 131 F) 15 %...95 % (sin condensacin) 25 C a 70 C (13 F a 158 F)

Modo de operacin Categora de seguridad Requisito Temp. ambiente de funcionamiento Humedad del aire Temperatura de almacenamiento

Dimensiones aproximadas La longitud depende de la altura protegida; (vea los dibujos de dimensiones) Altura 52 mm x 55 mm (2.05 pulg. x 2.17 pulg.) Seccin transversal del envolvente El POC sin usar una unidad de control separada, funcionar en el modo de guarda solamente con reinicio automtico.

2-26

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Seleccin de productos
1. Cortinas de luz de seguridad Las cortinas de luz de seguridad Guardmaster POC de Allen-Bradley se piden en parejastransmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos.
Tamao mm (pulgadas) 300 (12) 450 (18) 600 (24) 750 (30) 900 (36) 1,050 (42) Altura protegida mm 314 332 464 482 614 632 764 782 914 932 1,064 1,082 pulg. 12.3 13.0 18.2 18.9 24.1 24.8 30.0 30.8 36.0 36.7 41.9 42.6 Nmero de catlogo 440L-P4B0300-N 440L-P4D0300-N 440L-P4B0450-N 440L-P4D0450-N 440L-P4B0600-N 440L-P4D0600-N 440L-P4B0750-N 440L-P4D0750-N 440L-P4B0900-N 440L-P4D0900-N 440L-P4B1050-N 440L-P4D1050-N Tamao mm (pulgadas) 1,200 (48) 1,350 (54) 1,500 (60) 1,650 (66) 1,800 (72) Altura protegida mm 1,214 1,232 1,364 1,382 1,514 1,532 1,664 1,682 1,814 1,832 pulg. 47.8 48.5 53.7 54.4 59.6 60.3 65.5 66.2 71.4 72.1 Nmero de catlogo 440L-P4B1200-N 440L-P4D1200-N 440L-P4B1350-N 440L-P4D1350-N 440L-P4B1500-N 440L-P4D1500-N 440L-P4B1650-N 440L-P4D1650-N 440L-P4B1800-N 440L-P4D1800-N

Resolucin mm 14 30 14 30 14 30 14 30 14 30 14 30

Resolucin mm 14 30 14 30 14 30 14 30 14 30

Por favor haga su pedido de dispositivos diseados para aplicaciones en cascada (detector principal/detector secundario) por separado (vea la pgina 2-18).

2. Conjuntos de cablesSe requieren 2 (uno para el transmisor y otro para el receptor)


Conector hembra (extremo de detector) Vista frontal del conector hembra Estilo de conector Pin/color de cable 1 Negro 2 Blanco 3 Azul 4 Marrn 5 Gris 6 Amarillo 7 Verde Cable Clasificacin de cable Longitudm (pies) 2 (6.5) (5)/18 AWG (2)20 AWG 300 V 3A 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) 55.8 (2.2) 25.4 (1.00) dim. Nmero de catlogo 889N-F7AG-2 889N-F7AG-5 889N-F7AG-10 889N-F7AG-15 889N-F7AG-20 889N-F7AG-30

6 5 4 7

1 2 3

Recto

Recto hembra
Las dimensiones son aproximadas. Las ilustraciones no se presentan en escala real.

2-27

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Seleccin de productos
3. Interface programableOpcional
Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

PSDI

Salidas

24 VCC

Manual/ automtico

2 PNP OSSD 1 Aux. PNP

2-60

440L-M8100

4. Interfaces de rel de seguridadRequeridos


Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

PSDI

Salidas 4 amp 2 N.O. Seguridad 1 N.C. Aux.

24 VCC

Manual/ automtico

no

no

no

no

2-58

440L-M8200

Nota: Para obtener informacin sobre el cableado, consulte la seccin Aplicaciones de proteccin de este catlogo.

5. Interfaces de rel de seguridadOpcional


Salidas de seguridad Salidas auxiliares Fuente de alimentacin elctrica Restablecimiento 24 VCA/CC 1 NC, 2 NC, o cortina de luz Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual 230 VCA Nmero de catlogo 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-N23117 440R-N23116 440R-N23115 440R-N23114 440R-N23113 440R-N23112 440R-N23123 440R-N23122 440R-N23121 440R-N23120 440R-N23119 440R-N23118 440R-C23139 Automtico/manual o manual monitoreado

Rel

Entrada

Terminales

3 N.A.

1 N.C.

Desmontable

115 VCA

MSR127RP
Cortina de luz o un solo canal (MSR126T) Dos canales (MSR126.1T) Cortina de luz o un solo canal (MSR126R) 2 N.A. Ninguna Fijo 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC Cortina de luz o tapete de seguridad 2 N.C. 2 PNP, estado Desmontable slido

Manual monitoreado

Automtico/manual

MSR126

Manual monitoreado

Dos canales (MSR126.1R)

3 N.A.

115 VCA

440R-C23137

230 VCA

440R-C23136

MSR131RTP

2-28

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Seleccin de productos
6. Interface de rel de seguridad (usado para aplicaciones de silenciamiento)
Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

PSDI

Salidas

24 VCC

Manual

no

no

2 N.A. Seguridad 1 N.C. Aux.

4-21

440R-P23071

MSR22LM

7. AccesoriosOpcional
Productos Escuadra de montaje en L, de acero, fija (4 por paquete) Nmero de catlogo 440L-AF6102 (1 paquete por sistema) 440L-AF6103 (1 paquete por sistema) 440L-AF6104 (1 paquete por sistema)

Escuadra de montaje, ajustable (4 por paquete) Escuadra de montaje, ajustable con montura contra choque (4 por paquete) Fuente de alimentacin elctrica: Entrada85...265 VCA Salida24 VCC, 3 Amps Accesorio para alineamiento de lser Adaptador POC para accesorio de alineamiento de lser Tuercas deslizables (4 piezas suministradas con el sistema POC)

1794-PS3

440L-ALAT 440L-ALBRK 440L-AF6105

Tabla de seleccin de espejos de esquina Espejos de vidrio de construccin especial para aplicaciones de proteccin de 2 y 3 lados.
Nota: Cada espejo reduce el margen de escn mximo en un 10 % por espejo. Para modelos POC 300 450 600 750 900 1,050 1,200 1,350 1,500 1,650 1,800 Juego de montaje para espejos. Cada juego contiene 1 escuadra con pernos de fijacin. Pida 2 juegos por espejo. Base de montaje para espejo y POC (vea la pgina 2-21) Nmero de catlogo 440L-AM1200300 440L-AM1200450 440L-AM1200600 440L-AM1200750 440L-AM1200900 440L-AM1201050 440L-AM1201200 440L-AM1201350 440L-AM1201500 440L-AM1201800 440L-AM120BRK 440L-AMSTD

Nota: Para obtener informacin sobre las dimensiones aproximadas de los espejos y bases de montaje, vea las pginas 2-20 y 2-21.

2-29

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Seleccin de productos

Receptor principal Transmisor principal

La longitud del cable es 170 mm (6.5 pulg.)

Receptor secundario

Transmisor secundario

Cortinas de luz de seguridadPrincipal y secundario Los sistemas de cortina de luz de seguridad de la familia Guardmaster POC principal y secundario de Allen-Bradley, se piden como pareja transmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos.
PrincipalesParejas Tamao mm (pulgadas) 900 (36) 1,050 (42) 1,200 (48) 1,350 (54) 1,500 (60) Resolucin/ No. de haces 14 mm/120 30 mm/60 14 mm/140 30 mm/70 14 mm/160 30 mm/80 14 mm/180 30 mm/90 14 mm/200 30 mm/100 Altura protegida mm 914 932 1,064 1,082 1,214 1,232 1,364 1,382 1,514 1,532 pulg. 36.0 36.7 41.9 42.6 47.8 48.5 53.7 54.4 59.6 60.3 Nmero de catlogo 440L-C4B0900-N 440L-C4D0900-N 440L-C4B1050-N 440L-C4D1050-N 440L-C4B1200-N 440L-C4D1200-N 440L-C4B1350-N 440L-C4D1350-N 440L-C4B1500-N 440L-C4D1500-N Tamao mm (pulgadas) 150 (6) 300 (12) 450 (18) 600 (24) 750 (30) 900 (36) Secundarios Parejas Resolucin/ No. de haces 14 mm/20 30 mm/10 14 mm/40 30 mm/20 14 mm/60 30 mm/30 14 mm/80 30 mm/40 14 mm/100 30 mm/50 14 mm/120 30 mm/60 Altura protegida mm 150 150 314 332 464 482 614 632 764 782 914 932 pulg. 5.9 5.9 12.3 13.0 18.2 18.9 24.1 24.8 30.0 30.8 36.0 36.7 Nmero de catlogo 440L-B4B0150-N 440L-B4D0150-N 440L-B4B0300-N 440L-B4D0300-N 440L-B4B0450-N 440L-B4D0450-N 440L-B4B0600-N 440L-B4D0600-N 440L-B4B0750-N 440L-B4D0750-N 440L-B4B0900-N 440L-B4D0900-N

Nota: El nmero mximo de haces permitido en cualquier combinacin de principal/secundario es 240 haces. Nota: Para hacer su pedido de controladores, rels de seguridad y accesorios, consulte la pgina 2-28.

2-30

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Dimensiones aproximadasmm (pulgadas)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
Nota: Las dimensiones aproximadas C y D representan las distancias sugeridas de las escuadras de montaje.

Conector Tipo Mini (aprox. 100 mm 28 (1.1) (3.94 pulg.) espacio requerido para enchufar) 21 (0.83) 62 (2.44) D

Altura protectora POC 300 POC 450 POC 600 POC 750 POC 900 POC 1050 POC 1200 POC 1350 POC 1500 POC 1650 POC 1800

A 300 450 600 750 900 1,050 1,200 1,350 1,500 1,650 1,800

B 384 534 684 835 985 1,135 1,285 1,435 1,586 1,736 1,886

C 224 374 524 675 825 975 1,125 1,275 1,426 1,576 1,726
Secundario

80

31 (1.22) A B C D

C A B

27.5 (1.08) 55 (2.17)

Eje ptico = centro de ventana de salida

52 (2.05)

27.5 (1.08)

Secundario A 150 300 450 600 750 900 150 300 450 600 750 900 B 200 350 500 650 800 950 C * 190 340 490 640 790 D * 80 80 80 80 80

52 (2.05) 55 (2.17) 61 (2.40)

2-31

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Diagramas de cableado tpicos
6 5 2 3 7 Transmisor POC Vista interior del conector 1 2 3 4 5 6 7 1 2 3 4 5 6 7 Pin #1 Pin #2
Comunicacin Comunicacin

Conector de cable transmisor Pin 1 2 3 4 5 6 7 Color Funcin Negro +24 VCC Blanco 0 VCC Azul Prueba Marrn Prueba Gris N.C. Amarillo N.C. Verde PE Transmisor POC Vista de la parte superior del conector Pin #6

6 7

6 7

Pin #5

24 VCC

24 VCC

Prueba Prueba

salida 1 salida 2

0V

NC

NC

PE

Pin #3 PE Pin #7
Pin #1 = +24 V Pin #2 = 0 V Pin #3 = Prueba Pin #4 = Prueba Pin #5 = NC Pin #6 = NC Pin #7 = PE

0V

Transmisor NC = sin conexin

Receptor

Conector interno
1 2 3 4 5 6 7

Mini conector
1 2 3 4 5 6 7

Pin #4

Instalacin elctrica La conexin de los componentes POC es simple. Se permiten cables de longitudes de hasta 60 m (196.8 pies) (proteccin contra sobrevoltaje para nivel 3 y superiores (IEC 801), vea Datos tcnicos). El transmisor se conecta a un suministro de 24 V usando un cable de 7 conductores. El receptor se conecta al control de la mquina y al suministro de 24 V usando un cable de 7 conductores. La mxima seccin transversal del cable es 1.5 mm (0.06 pulg.) sin forro; 1 mm (0.04 pulg.) con forro. Todas las cortinas de luz vienen estndar con conectores mini precableado en las terminaciones de tapa final. El POC necesita una fuente de alimentacin elctrica de +24 VCC ( 20 %), la cual est disponible a travs de Guardmaster AllenBradley. Indicadores LED
Transmisor Alimentacin conectada (mbar) Receptor

Diagrama de pines del cable POC (transmisor) Entrada de prueba (transmisor) El POC cambia a condicin verde despus que se conecta el voltaje de suministro y concluye la prueba de activacin automtica. Si se desea una prueba externa, puede conectarse un contacto (normalmente cerrado) a la entrada de prueba (MCC = contacto de control de mquina). Duracin de apertura mnima 50 ms. Corriente continua durante entrada de prueba cerrada: 12 mA. Corriente de entrada al momento del arranque cuando se cierra: 150 mA (20 ms). Entrada de prueba abierta = Prueba = Salidas en receptor inactivas (rojo). Entrada de prueba cerrada = No hay salidas de prueba en receptor activo (verde).
Transmisor POC 1 +24 V 3 4 2 7 PE prueba 0V o bien contacto de prueba

Transmisin (Amarillo)

Salida activa (Verde) Salida inactiva (Rojo) Seal dbil (mbar) Interrupcin de haz requerida (Amarillo) (slo con 440L-M8100)

Diagrama de conexin POC

2-32

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de punto de operacin Diagramas de cableado tpicos (continuacin)
Salidas (receptor) El voltaje de salida UA de cada canal depende del voltaje de suministro UV y de la carga conmutada, y es por lo menos UA = UV 2 V Ambas salidas OSSD1 y OSSD2 (OSSD = dispositivo de conmutacin de seal de salida) son salidas de estado slido PNP de control confiable, monitoreadas activamente. Las salidas pueden tener un mximo de 0.5 Amps y tienen proteccin contra cortocircuito. Si el campo protegido est libre, las dos salidas son ALTAS (activas). No debe aplicarse voltaje de suministro adicional a las salidas.
4 Transmisor POC 1 3 +24 V Imax = 0.5A RL Imax = 0.5A RL 5 6 2 7 PE RS 485 (440L-M8100/diagnsticos) 0V

ATENCIN: Ambas seales de salida deben procesarse por separado. No deben conectarse en serie ni en paralelo.

Diagrama de conexin del receptor

Interface de comunicacin RS-485 Esta interface sirve para comunicarse con el 440L-M8100 (opcional). Si el 440L-M8100 no se usa, la conexin no se usa.
1 6 5 2 3 7 Receptor POC Vista interior del conector Conector de cable receptor Pin 1 2 3 4 5 6 7 Color Negro Blanco Azul Marrn Gris Amarillo Verde Funcin +24 VCC 0 VCC Salida 1 OSSD 1 Salida 2 OSSD 2 Comunicaciones -RS 485 Comunicaciones +RS 485 PE

Receptor POC Vista de la parte superior del conector Pin #1 Pin #2 Pin #3 Pin #7 Pin #6 Pin #5

Pin #1 = +24 V Pin #2 = Tierra Pin #3 = OSSD1 Pin #4 = OSSD2 Pin #5 = Com- RS 485 Pin #6 = Com+ RS 485 Pin #7 = PE

Conector interno
1 2 3 4 5 6 7

Mini conector
1 2 3 4 5 6 7

Pin #4

Diagrama de pines del cable receptor

2-33

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro
Mximo margen de escn Mxima separacin de haces Conteo mnimo de haces Conteo mximo de haces Longitud mnima del envolvente Longitud mxima del envolvente 70 m 500 mm 1 haz 4 haces 320 mm 1,800 mm

Especificaciones
Normas EN 50100 BG y marca CE Depende de la seleccin de productos 70 m (225 pies), un solo haz PAC 7.5 m Depende de la seleccin de productos IP 65 Conector mini de 7 pines en transmisor y de 8 pines en receptor 24 VCC 20 % 5 Vss 7 wattsTransmisor 6 wattsReceptor ptica, sin canal de sincronizacin separado 2 x PNP, 0.5 A, proteccin contra cortocircuito Uv 2 V Certificaciones Altura protegida Margen de escn Separacin de haces Clasificacin del envolvente Tipo de conexin

Descripcin
Las cortinas de luz de seguridad de mltiples haces de Rockwell Automation son dispositivos de proteccin infrarroja con 1 a 4 haces infrarrojos. Funcionan con el principio de paso del haz, constan de una unidad de transmisor y receptor y son apropiados para resguardo de permetro y control de acceso. El PAC cumple con los requisitos de la norma pr EN 50100, categora de seguridad 4, puesto que es un dispositivo de automonitoreo. Evaluacin integrada con los ms modernos componentes electrnicos e IC de diseo especial (ASIC) Codificacin de haz para inmunidad a alta interferencia Salidas de semiconductor monitoreadas activamente Conectores estilo mini Tiempo de respuesta rpida Alta reserva de seales (factor 2) Sincronizacin ptica de las unidades de transmisor y receptor Proteccin mltiple mediante columnas y espejos de esquina Modos de operacin: Monitoreo de dispositivo electrnico (EDM) Enclavamiento de reinicio Configuracin de silenciamiento disponible Los dispositivos han sido diseados para aplicaciones industriales y ofrecen las siguientes ventajas: Codificacin de haz para una ptima inmunidad a interferencias Adaptacin para PLC seguro Construccin modular robusta Posibilidades de aplicacin universal Instalacin simple

Voltaje de suministro Uv Fluctuacin residual mxima Consumo de potencia Sincronizacin Salidas Tensin de salida mnima Tiempo de respuesta Proteccin Conexin Seccin transversal de cable mx. Longitud de cable

20 ms
Cortocircuito y sobrecarga 1.0 mm2 con forro 1.5 mm2 sin forro 60 m (196.8 pies) mximo Proteccin contra sobrevoltaje (1 kV) desde nivel 3 o superior (IEC 801 parte 5; 2 kV) entre PE y +V. Guarda solamente con reinicio manual Tipo 4 (autoverificacin) Conformidad con EN 50100 0 C a 55 C (32 F a 131 F) 15 %...95 % (sin condensacin) 25 C a 70 C (13 F a 158 F)

Modo de operacin Categora de seguridad Requisito Temp. ambiente de funcionamiento Humedad del aire Temperatura de almacenamiento Dimensiones aproximadas Altura

Seccin transversal del envolvente

La longitud depende de la altura protegida; (vea los dibujos de dimensiones) 52 mm x 55 mm (2.05 pulg. x 2.17 pulg.)

2-34

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Seleccin de productos
1a. PAC de mltiples haces Las cortinas de luz de seguridad Guardmaster PAC de mltiples haces de Allen-Bradley se piden en parejastransmisor y receptory se envan con un nmero de pieza. Despus de seleccionar la pareja de cortinas de luz apropiada, asegrese de pedir tambin las interfaces y accesorios requeridos. El sistema PAC de un solo haz puede pedirse con una columna de espejo pasivo (440L-AMIRSTDZ500) o dos espejos en ngulo recto (440L-AMIRR2).
Modelos sin silenciamiento Tamao mm (pulgadas) 684 (27) 600 (24) 1,000 (40) 534 (21) Separacin de haces mm 500 220 400 120 Nmero de haces 2 3 3 4 Tamao mm (pulgadas) 684 (27) 600 (24) 1,000 (40) Modelos con silenciamiento Separacin de haces mm 500 220 400 Nmero de haces 2 3 3

Nmero de catlogo 440L-P4H2500-N 440L-P4H3220-N 440L-P4H3400-N 440L-P4H4120-N

Nmero de catlogo 440L-P4H2500M-N 440L-P4H3220M-N 440L-P4H3400M-N

1b. PAC de un solo haz (Nota: El margen de escn mximo es 7.5 metros).
Modelos sin silenciamiento Tamao mm (pulgadas) 684 (27) Separacin de haces mm 500 Nmero de haces 1 Tamao mm (pulgadas) 684 (27) Modelos con silenciamiento Separacin de haces mm 500 Nmero de haces 1

Nmero de catlogo 440L-P4G1500-N 440L-AMIRSTDZ500

Nmero de catlogo 440L-P4G1500M-N 440L-AMIRSTDZ500

Requiere unidad de espejo

Requiere unidad de espejo

2a. Conjuntos de cablesRequeridosTransmisor PAC


Conector hembra Vista frontal del conector hembra Transmisor PAC
6 5 4 7 3 1 2

Cable Pin/color de cable 1 Negro 2 Blanco 3 Azul 4 Marrn 5 Gris 6 Amarillo 7 Verde Clasificacin de cable Longitudm (pies) 2 (6.5) (5)/18 AWG (2)20 AWG 300 V 3A 5 (16.4) 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) Nmero de catlogo 889N-F7AG-2 889N-F7AG-5 889N-F7AG-10 889N-F7AG-15 889N-F7AG-20 889N-F7AG-30

Estilo de conector

Recto

2b. Conjuntos de cablesPAC receptor y PAC de un solo haz


Conector hembra Vista frontal del conector hembra PAC de un solo haz y PAC receptor
6 5 4 7 8 3 1 2

Cable Pin/color de cable 1 Rojo 2 Blanco 3 Azul 4 Marrn 5 Gris 6 Amarillo 7 Verde 8 Rosado Clasificacin de cable Longitudm (pies) 2 (6.5) 5 (16.4) 18 AWG 300 V 3A 10 (32.8) 15 (49.2) 20 (65.6) 30 (98.4) Nmero de catlogo 889N-F8AE-2 889N-F8AE-5 889N-F8AE-10 889N-F8AE-15 889N-F8AE-20 889N-F8AE-30

Estilo de conector

Recto

2-35

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Seleccin de productos
3a. Interfaces de rel de seguridadRequeridos
Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

PSDI

Salidas 4 amp 2 N.A. Seguridad 1 N.C. Aux.

24 VCC

Manual/ automtico

no

no

no

no

58

440L-M8200

3b. Interfaces de rel de seguridadOpcional


Salidas de seguridad Salidas auxiliares Fuente de alimentacin elctrica Restablecimiento 24 VCA/CC 1 NC, 2 NC, o cortina de luz Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual 230 VCA Nmero de catlogo 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-N23117 440R-N23116 440R-N23115 440R-N23114 440R-N23113 440R-N23112 440R-N23123 440R-N23122 440R-N23121 440R-N23120 440R-N23119 440R-N23118 440R-C23139 Automtico/manual o manual monitoreado

Rel

Entrada

Terminales

3 N.A.

1 N.C.

Desmontable

115 VCA

MSR127RP
Cortina de luz o un solo canal (MSR126T) Dos canales (MSR126.1T) Cortina de luz o un solo canal (MSR126R) 2 N.A. Ninguna Fijo 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC Cortina de luz o tapete de seguridad 2 N.C. 2 PNP, estado Desmontable slido

Manual monitoreado

Automtico/manual

MSR126

Manual monitoreado

Dos canales (MSR126.1R)

3 N.A.

115 VCA

440R-C23137

230 VCA

440R-C23136

MSR131RTP

2-36

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Seleccin de productos
4. Intefaces de rel de seguridadOpcional (usados para aplicaciones de silenciamiento)
Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Ms detalles Nmero de catlogo

Rel

PSDI

Salidas

24 VCC

Manual

no

no

2 N.A. Seguridad 1 N.C. Aux.

4-21

440R-P23071

MSR22LM

5. Fuente de alimentacin elctrica


Descripcin Fuente de alimentacin elctrica: Entrada93...265 VCA Salida24 VCC, 3 Amps Nmero de catlogo

1794-PS3

6. AccesoriosOpcional
Descripcin Escuadra de montaje en L, fija (4 por paquete) Nmero de catlogo 440L-AF6102 (1 paquete por sistema) 440L-AF6103 (1 paquete por sistema) 440L-AF6104 (1 paquete por sistema) 440L-ALAT 440L-ALBRK

Escuadra de montaje, ajustable (4 por paquete) Escuadra de montaje, ajustable con montura contra choque (4 por paquete) Accesorio para alineamiento de lser Adaptador SafeShield para accesorio de alineamiento de lser

Juego de tuercas deslizable (se incluyen 4)Suministrado con PAC Bombilla de silenciamiento con cable de 2 m Bombilla de silenciamiento con cable de 10 m

440L-AF6105 440L-AMUTLP2M 440L-AMUTLP10M

2-37

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Seleccin de productos
7. AccesoriosColumnas de montaje y espejos Espejo de esquina Espejos de construccin especial para aplicaciones de proteccin de 2 y 3 lados. NOTA: Cada espejo reduce el margen de escn mximo en un 10 % por espejo.
Para modelos PAC Nmero de catlogo

2 haces 500 mm de separacin entre haces

440L-A2MIRSTND

3 haces 400 mm de separacin entre haces

440L-A3MIRSTND

Calzas para montaje de espejos

440L-ASHIM

Columnas de montaje
Descripcin Columna de montaje en el piso para PAC de 2 haces 500 mm de separacin entre haces Columna de montaje en el piso para PAC de 3 haces 400 de separacin entre haces Columna de montaje en el piso para columna PAC de 2 haces con bombilla de silenciamiento 500 mm de separacin entre haces Columna de montaje en el piso para columna PAC de 3 haces con bombilla de silenciamiento 400 mm de separacin entre haces Nmero de catlogo 440L-AMTSTND2B 440L-AMTSTND3B

440L-AMUTSTDLP2B

440L-AMUTSTDLP3B

Detectores con silenciamiento


Detector Haz transmitido Ubicacin de conexin Transmisor (activado mediante fuente de alimentacin externa) Receptor (conectado directamente al mdulo de silenciamiento u 8100) Conectado directamente al mdulo de silenciamiento u 8100 Reflector estndar de 3 pulgadas Conectado directamente al mdulo de silenciamiento u 8100 Reflector estndar de 3 pulgadas Conectado directamente al mdulo de silenciamiento u 8100 (La palanca de operacin debe seleccionarse por separado). Conmutacin en oscuridad Tipo Nmero de catlogo 42GRL-9000-QD 42GRR-9000-QD 42GRU-9000-QD 92-39 42GRU-9200-QD 92-39 802M-NX10 889D-F3ACDM-5 889D-F4AC-5

Retrorreflectivo Retrorreflectivo polarizado Interruptor de final de carrera mecnico

Usar con conector Micro de 4 pines, 3 hilos cuando se hace conexin al mdulo de silenciamiento (se muestra longitud de 5 m). Longitudes de 1 m, 2 m, 3 m y 5 m disponibles, nmero de catlogo 889D-F3ACDM-*. Donde * = longitud en metros. Conjunto de cables recomendado cuando se hace conexin al 440L-M8100. Se muestra longitud de cinco metros, hay otras longitudes disponibles, vea la pgina 15-10 de este catlogo.

2-38

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Dimensiones aproximadasmm (pulgadas)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
PAC 440L-P4G2502-N Conector Mini 31 (1.22) 21 (0.83) E E Conector Mini 31 (1.22) 21 (0.83) D Mltiples haces PAC de un solo haz Conexin de cable alternativo PG 9 Dim. de cable 4 a 8 (0.16 a 0.31)

R3 R

C R2 A B A B Detalle A Seccin transversal

R1

23 (0.91)

23 (0.91)

27.5 (1.08)

52 (2.05)

Detalle A 2.2 (0.09) 55 (2.17) 3.5 (0.14)

14 (0.55) 6 (0.24) 6.7 (0.26) 10.5 (0.41)

440L T4H-2500-N T4H-3220-N T4H-3400-N T4H-4120-N PAC de un solo haz P4G 1500-N

A 500 440 800 360 500

B 684 597 985 534 684

C 524 437 825 374 524

D 80 80 80 80 80

E 107 107 107 107 97

F 77 50 78 67 87

R 500 220 400 120 500

Con respecto al centro del envolvente

2-39

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
14 (0.55) 6 2.2 (0.09) (0.24) Detalle A 21 (0.83) 6.7 (0.26) 10.5 (0.41) 27.5 (1.08) 81 (3.1) 52 (2.05)

69 55 (2.72) (2.17) 3.5 (0.14) 52 (2.05)

55 (2.17)

23 (0.91)

500 668 (19.69) (26.3) Detalle A

87 (3.43)

B2 B1 A2 A1 Bombilla de silenciamiento Conexin Conector Mini 31 (1.22) E 179 (7.05)

440L-AMIRSTDZ500

Espejo de esquinausar con PAC de un solo haz (440L-P4G1500-N o 440L-P4G1500M-N)

A 440L-R4H 2500M-N 440L-R4H 3220M-N 440L-R4H 3400M-N 500 440 800

B 663 576 964

C 524 437 825

D 80 80 80

E 265 265 265

F 77 50 78

G 86 86 86 1

440L-R4H 1500M-N

500

663

524

80

255

87

76

2-40

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
147.7 (5.81) 147.7 (5.81)

400 (15.75) 1,216 (47.87)

400 (15.75) 1,216 (47.87)

400 (15.75)

400 (15.75)

300 (11.81)

300 (11.81)

180 (7.09) Nivel de burbuja A-A 115 (4.53) 147.7 (5.81)

3.1 (0.12)

M10

15 mm dim.

Montaje de las columnas de espejoscolumna 400

2-41

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
147.7 (5.81) 147.7 (5.81)

500 (19.69) 1,216 (47.87)

500 (19.69) 1,216 (47.87)

400 (15.75) A

400 (15.75) A

180 (7.09) A-A Nivel de burbuja 147.7 (5.81) 115 (4.53)

3.1 (0.12)

M10

15 mm dim.

Montaje de las columnas de espejoscolumna 500

2-42

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
440L-AF6102
Tuerca deslizante

M5 M5 x 18

10 (0.39) 25 (0.98)

5.3 (0.21) 24 (0.94) 12 14

5 (0.2)

60 (2.36)

22 (0.87) 44 (1.73)

4.8 (0.19)

440L-AF6103

80 (3.15) 65 (2.56) 40 (1.57) 23 (0.91)

M5 x 18

11 30 (1.18) (0.43)

51 (2.01)

440L-AF6104
Escuadra de montaje ajustable 90 (3.54) 65 (2.56) 40 (1.57)

25 (0.98) 23 (0.91) 30 (1.18) 11 (0.43) 51 (2.01)

M5 x 20

2 Instalacin en la mquina Escuadra ajustable con montura para choque, se necesitan 4

2-43

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Diagramas de cableado tpicos
Conector de 7 pines Unidad del transmisor Unidad del receptor y PAC de un solo haz Conector de 8 pines

6 5 4 7

1 2 3

Terminal de conexin
1234567

Terminal de conexin 1 Rojo 2 Blanco 3 Azul 4 Marrn 5 Gris 6 Amarillo 7 Verde 8 Rosado
1234567 1234567

6 5 4 7 8

1 2 3

Pin Color Negro 1 Blanco 2 Azul 3 Marrn 4 Gris 5 Amarillo 6 Verde 7

1234567

Pin 1 2 3 4 5 6 7 8

Color Rojo Blanco Azul Marrn Gris Amarillo Verde Rosado

+24 V 0V Prueba Prueba RW RW

NC = sin conexin

Transmisor

Receptor

Amarillo mbar

Indicador LED
Transmisor Amarillo mbar margen del transmisor: prueba MCC alto/bajo Amarillo la tensin de operacin est conectada mbar Rojo Verde Receptor presione el interruptor de reinicio contaminacin salidas inactivas haz de luz no obstruido, salidas activas

2-44

+24 V 0V OSSD 1 OSSD 2 RES EDM OWS

Amarillo mbar Rojo Verde

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a permetro Diagrama de cableado tpico
Cortina de luz de seguridad 440L a 440R-N23135 (MSR127RP)
+24 VCC

Prueba

3 4

Transmisor
2 3

Receptor
2

OSSDA

OSSDB
4 L1 L2 L3

K4 A K4 A2 K5 K5 S21 S22 S52 S12 13 23 33 41

MSR127RP
S34 14 24 34 42

Restablecimiento

K4

K5

Boletn 100S Contactores de seguridad o rels de seguridad 700S

Comn de CC Nota: Para la unidad 440L PAC, establezca los microinterruptores de la siguiente manera: Int. 1, 5, 6, 7, 8 en B Int. 2, 3, 4 en A Para obtener acceso a los microinterruptores quite la tapa de conexin de la unidad del receptor. La unidad del transmisor no necesitar configuracin de microinterruptores si se usan estas posiciones en el receptor.

2-45

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Especificaciones
Normas Certificaciones Margen del campo protector Nmero de haces Dimetro del haz de luz Voltaje de fuente de alim. elc. EN 50100 BG y marca CE 0.5 a 18 m o 15 a 70 m 1 23 mm 24 VCC 20 % 230 VCA +15 % a -10 % (pedido especial) 115 VCA +15 % a 10 % Mx. 5 % de Uv 48 a 62 Hz con la versin de CA Contacto de prueba Mx. 150 ms 75 ms

Unidad de transmisor/receptor

Fluctuacin

Descripcin
El interruptor de seguridad fotoelctrico AAC es un dispositivo de seguridad de deteccin de presencia sin contacto, de un solo haz, que consta de unidades de transmisor y receptor separadas. El haz de luz producido entre el emisor y el receptor proporciona proteccin de acceso para reas peligrosas. El AAC sirve como dispositivo de seguridad de deteccin de presencia para ofrecer proteccin de permetro a fin de proteger al personal de reas potencialmente peligrosas tales como: Celdas de trabajo robtico Centros de maquinado Paletizadoras Maquinaria de plsticos Apiladoras Establecimiento de maquinaria en la industria de trabajo con piedra

Frecuencia Entrada, transmisor Tiempo de prueba Tiempo mn. de apertura de contacto NC para prueba Consumo de energa Versin de voltaje Unidad de transmisor Unidad de receptor Sincronizacin Salidas

24 V 5W 8W ptica

115 V 8W 11 W

230 V 8W 11 W

Rels de seguridadMx. Frecuencia de operacin 0.2 Hz (1 operacin en 5 segundos) 2 A/0.02 A 250 VCA/24 VCC 22 ms Conector PG: IP67, mx. longitud de cable 50 m Estndar

Corriente de conmutacin (mx./mn.) Voltaje de conmutacin (mx./mn.) Tiempo de respuesta Cable de conexin Calentamiento de pantalla frontal Datos de operacin Clase de proteccin Categora de seguridad Requisito Temperatura ambiente de operacin Temperatura de almacenamiento Humedad del aire Vibracin Resistencia al impacto Peso

Caractersticas
Largo margen de escn Fcil instalacin Envolvente de aluminio moldeado Lente frontal calentada, es decir, puede usarse tambin para aplicaciones en exteriores

I Tipo 4 EN 50100 Parte I/Parte II 25 C a 55 C 25 C a 70 C 15 % a 95 % 5 g, 10 a 55 Hz segn IEC 68-2-6 10 g 16 ms segn IEC 68-2-29 Unidad de transmisor aprox. 0.9 a 1.3 kg Unidad de receptor: aprox. 1 a 1.4 kg

Clasificacin del envolvente IP67

2-46

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Seleccin de productos
1a. Gua de Seleccin para margen de 0.5 m a 18 m
Tensin de operacin Corriente suministrada 24 VCC 120 VCA Nmero de catlogo Tipo de conexin Cmara de terminal con prensaestopas de cable (rosca PG13.5) Transmisor 440L-T4F0018-Q 440L-T4F90018-Q Receptor 440L-R4F0018-Q 440L-R4F90018-Q

1b. Gua de Seleccin para margen de 15 m a 70 m


Tensin de operacin Corriente suministrada 24 VCC 120 VCA Nmero de catlogo Tipo de conexin Cmara de terminal con prensaestopas de cable (rosca PG13.5) Transmisor 440L-T4F0070-Q 440L-T4F90070-Q Receptor 440L-R4F0070-Q 440L-R4F90070-Q

2. Interfaces de rel de seguridadOpcional si se requieren salidas adicionales


Tensin de entrada Restablecimiento Supresin flotante Supresin fija Silenciamiento Salidas de seguridad 4 amp 2 N.A. Seguridad 1 N.C. Aux. Ms detalles Nmero de catlogo

PSDI

24 VCC

Manual/ automtico

no

no

no

no

58

440L-M8200

Nota: Para obtener informacin sobre el cableado, consulte la seccin Aplicaciones de proteccin de este catlogo.

3. Interfaces de rel de seguridadOpcional


Salidas de seguridad Salidas auxiliares Fuente de alimentacin elctrica Restablecimiento 24 VCA/CC 1 NC, 2 NC, o cortina de luz Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual 230 VCA Nmero de catlogo 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-N23117 440R-N23116 440R-N23115 440R-N23114 440R-N23113 440R-N23112 440R-N23123 440R-N23122 440R-N23121 440R-N23120 440R-N23119 440R-N23118 440R-C23139 Automtico/manual o manual monitoreado

Rel

Entrada

Terminales

3 N.A.

1 N.C.

Desmontable

115 VCA

MSR127RP
Cortina de luz o un solo canal (MSR126T) Dos canales (MSR126.1T) Cortina de luz o un solo canal (MSR126R) 2 N.A. Ninguna Fijo 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC Cortina de luz o tapete de seguridad 2 N.C. 2 PNP, estado Desmontable slido

Manual monitoreado

Automtico/manual

MSR126

Manual monitoreado

Dos canales (MSR126.1R)

3 N.A.

115 VCA

440R-C23137

230 VCA

440R-C23136

MSR131RTP

2-47

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Accesorios
Descripcin Accesorio para alineamiento de lser Adaptador para accesorio de alineamiento en AAC Nmero de catlogo 440L-ALAT 440L-ALBRK1

Escuadra de montaje central para AAC Espejo de esquina para margen de escn de 0 a 30 m Juego de montaje parar 440L-AMIRR1

440L-AMBRK4 440L-AMIRR1 440L-AMKIT

Escuadra de montaje para espejo 440L-AMIRRI

440L-AMBRK1

Espejo de esquina de vidrio, ngulo de 45, 0 a 30 m

440L-AMIRR2

Espejo de margen largo (15 a 79 m)

440L-AMIRR3

Adaptador, conducto, Pg13.5 a NPT de 1/2 pulg., acero

440A-A17094

2-48

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Dimensiones aproximadasmm (pulgadas)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
50 (1.96) 116 (4.57)

34 (1.33) 65 (2.5)

156 (6.14)

128 (5.03) 65 (2.5)

14 (0.55) Pg 13.5 M6 x 8 (6 lugares)

17.5 (0.68)

Mx. dim. ext. del cable 8-10 mm

2-49

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Dimensiones aproximadasmm (pulgadas) (continuacin)
Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
9 (0.35) 65 51 6.5 (0.26) (2.56)(2.01) 20 64.5 (2.54) 46.5 (1.83) 9 (0.35) 82 (3.23) 39.5 64.5(1.55) (2.54) 40 (1.57) 20 (0.79) 71 (2.80) 20 (0.79) 26 (1.02) M 8 x 30 SW 13

58 (2.28)

60

43 (1.69) 22 (0.87)

M 8 x 45 SW 13

6 (0.23)

6.5 (0.25)

Escuadra de montaje 440L-AMBRK4


16.5 (0.65) 67 (2.64) 33.5 (1.32) 63 (2.48)

M6

160 (6.30) 149 (5.87) 124 (4.88) 177 (6.97) ~7 (0.28)

38 (1.50) 96 (3.78) 100 (3.94) 14 (0.55) 8.5 (0.33)

2.5 (0.10) 10 (.039)

Espejo de esquina

Se muestra con escuadra (440L-AMBRK1) Montada al espejo (440L-AMIRR1)

Nmero de catlogo 440L-AMIRR1

76 (2.99) 40 (1.57)

80 (3.15)

96.5 (3.80)

40.5 (1.59)

63 (2.48)

8.5 (0.33)

146.5 (5.77)

69.5 (2.74)

8.5 (0.33) 80 (3.15)

Nmero de catlogo 440L-AMIRR2

2-50

Dispositivos de seguridad para deteccin de presencia

Cortinas de luz de seguridad


Control de acceso a rea Diagramas de cableado tpicos
Transmisor Receptor

1/2 1/2 3 10 11

PE

24 VCC

0 VCC

PE

Sin conexin

0 VCC

Sin conexin

N.A. Salida

N.C. Salida

Suministro de 24 VCC con cmara de terminales


Transmisor Receptor

1/2 1/2 3 10 11

N.A. Salida

Entrada de prueba

24 VCC

115 VCC

PE

Sin conexin

L1 115 VCA

Sin conexin

N.A. Salida

N.C. Salida

Fuente de alimentacin de CA con cmara de terminales

N.A. Salida

Entrada de prueba

{ { {
2-51

PE

{ { {
9

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Mdulo SafeShield DeviceNet Especificaciones
Categora de seguridad Certificaciones Fuente de alimentacin elctrica Consumo de potencia Entradas Salidas Retardo a la activacin Indicadores LED Voltaje de resistencia de impulso Grado de contaminacin Temperatura de operacin Clasificacin sin seguridad Marca CE para toda las directivas aplicables y cULus 24 VCC 1W RS 233 desde SafeShield DeviceNet 1s Vea la tabla Indicadores 2,500 V 2 5 C a +55 C (+23 F a 131 F) IP40 (NEMA 1) IP20 0.24 mm2 (2412 AWG) 0.40.5 Nm (3.544.43 lb pulg.) Poliamida PA 6.6 Riel DIN de 22.5 mm 320 g (0.71 lbs) N/A 10-55 Hz, 0.35 mm 10 g, 16 ms, 100 choques

Descripcin
La interface SafeShield DeviceNet es un dispositivo clasificado como no de seguridad que comunica informacin de diagnstico desde cualquier sistema de cortina de luz de seguridad SafeShield. Con un envolvente compacto de montaje en riel DIN de 22.5 m, permite un fcil cableado y configuracin de los parmetros DeviceNet.

Proteccin del envolvente Proteccin del terminal Calibre de conductor Ajustes de par/tornillos terminales Material del envolvente Montaje Peso Vida til mecnica Vibracin Choque

Caractersticas
Se conecta directamente a las redes DeviceNet Funcin de autobaudios Cambio de estado y mensajes de estroboscopio Microinterruptores giratorios para MAC ID Envolvente compacto de 22.5 mm Capacidades de diagnstico Seal dbil Alineamiento: nmero de haces, nmero de haces bloqueados, etc. Estado de salida Configuracin de instalacin Indicadores LED de diagnstico Identificacin del sistema: nombre del producto, modelo, etc. Estado del sistema Selecciones del sistema: supresin fija o flotante, encendido automtico, etc. Diagnstico: cdigos de error, causa de bloqueo, sugerencias para resolucin de problemas, etc.

Indicadores
Etiqueta Colores Estado Apagado Encendido de color verde estable Verde parpadeante Rojo parpadeante Encendido de color rojo estable Verde-rojo-verde Apagado Parpadeando Encendido Apagado Rojo Verde Status Interface no activada, o esperando autobaudios Interface activa y asignada por el maestro Interface activa pero no asignado por el Maestro Fallo menor corregible (velocidad en baudios) Fallo bsico (posible duplicacin de direccin) Secuencia de encendido Fallo interno Fallo o advertencia Requiere intervencin del usuario Sin fallos ni advertencias Comunicacin sin seguridad No seguro, OSSD no activo Seguro, OSSD activo

Dnet Status

Rojo/Verde

Comm Status

Anaranjado

OSSD Status

Rojo/Verde

2-52

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Mdulo SafeShield DeviceNet
Datos de E/S Salida de estroboscopio y cambio de estado:
Ensamblaje de entrada = Estado (0) Byte 1, Bit 7 6 Datos de estado Reinicio Fuerza del haz 5 Advertencia de dispositivo 5 Modo de supresin flotante 5 4 Fallo de dispositivo 4 Modo de supresin fija 3 0 3 Modo de resolucin 2 0 2 Modo EDM 1 0 1 0 0 OSSD 0 0

Ensamblaje de entrada = Modos (1) Byte 2, Bit 7 6 Modos Modo de reinicio Modo de margen

Ensamblaje de entrada = Diagnstico (2) Byte 3, Bit 7 6 Cdigo de diag. Ensamblaje de entrada = Haces (3) Byte 4, Bit 7 6 Datos de haces

4 3 Cdigos de diagnstico 4 Conteo de haces 3

Seleccin de productos
Entradas Com. desde SafeShield Salidas de seguridad N/A Salidas auxiliares N/A Fuente de alimentacin elctrica 24 VCC Nmero de catlogo 442L-MDNET

Dimensiones aproximadasmm (pulgadas)


Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
99 (3.89) 22.5 (0.88)

114.5 (4.5)

Diagrama de cableado tpico


24 VCC Cortina de luz Sal1 Sal2 Restablecimiento

L1 L2 L3 A1 S11 S52 S12 13 23 33 41 K1


MSR127RP

K2 S21 S22 S34 A2 14 K1


0V

24 K2

34

42

Cortina de luz, restablecimiento manual, salida monitoreada


Negro Azul Blanco Rojo Malla

Conexin DeviceNet

}
2-53

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Fuente de alimentacin de 120 VCA y rel de seguridad Especificaciones
Alimentacin de entrada Consumo de potencia Entradas Resistencia de entrada mx. Restablecimiento Salidas Capacidad nominal de salida N.A. B300, AC15, 5 A/250 VCA N300, DC13, 3 A/24 VCC Min. corriente/voltaje conmutado 10 mA/10 V 120/230 VCA 2 W/4 W 1 N.C. o 2 N.C. o 2 PNP (cortina de luz) 110 ohms Automtico/manual 3 N. A. Seguridad 1 N.C. Auxiliar no de seguridad

Descripcin
La caja de interface de 120 VCA Guardmaster de Allen-Bradley consta de un envolvente de metal con cierre de llave, clasificacin NEMA 4, una fuente de alimentacin elctrica de 24 VCC, de montaje en DIN de 3 Amp y ya sea uno o dos rel(s) de seguridad de 22.5 mm. El mdulo simple de rel de seguridad proporciona 3 salidas de rel de seguridad N.A. y una salida auxiliar N.C. (no de seguridad) libre de potencial. La configuracin de rel de seguridad doble permite que dos parejas de cortinas de luz de seguridad controlen independientemente una o dos mquinas. El (los) rel(s) de seguridad pueden configurarse para restablecimiento manual o automtico. La funcin de restablecimiento puede realizarse a travs del interruptor de llave montado en la cubierta frontal de la caja de la interface. Los agujeros pretaladrados ubicados en la parte inferior del alojamiento permiten un fcil cableado del sistema.

Retardo a la activacin Tiempo de respuesta Indicadores LED de mdulo de rel

1 segundo 15 ms

K1 Verde = alim. elctrica Verde = K1 cerrado, si slo K1 se enciende, verifique si existe cortocircuito a travs del botn de restablecimiento K2 Verde = K2 cerrado Temperatura de operacin Humedad Proteccin del envolvente Mx. calibre de conductor Peso 5 C a +55 C (+23 a +131 F) 90 % de humedad relativa NEMA 4, IP65 1 x 2.5 mm2 (14 AWG) trenzado 1 x 4 mm2 (12 AWG) macizo 4886/5113 g (10.75/11.25 lbs)

Vida til elctrica 222 VCA/4A/880 VA 100,000 operaciones cos 0 = 0.35 Frecuencia mx. de operacin Vida til mecnica Vibracin Choque Tiempo de recuperacin 1,200 ciclos/hora 2,000,000 operaciones 0.35 mm 10-55 Hz 10 g, 16 ms, 100 choques 100 ms

2-54

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Fuente de alimentacin de 120 VCA y rel de seguridad Seleccin de productos
Salidas de seguridad 3 N.A. 6 N.A. Salidas auxiliares 1 N.C. 2 N.C. Fuente de alimentacin elctrica 24 VCC Nmero de catlogo 440L-M8400 440L-M8500

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
200.0 (7.87) 161.9 (6.37)

301.6 (11.87) 3.17 (0.12) 1.77 (0.07) 63.5 (2.5) 104.7 (4.12)

22.2 (0.87)

2-55

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Fuente de alimentacin de 120 VCA y rel de seguridad Diagrama de cableado tpico
Rel simple M8400

L
N.C. N.C.

L1

Caja de interface de cortina de luz

K3

N.C.

1 2 3

4 5

7 8 9

10 11 12 13 14 15 16 17 18

N.C.

K4
Elementos mviles cebado mquina

Reinicio man. rel (Puente 15 y 16, 17 y 18)

Transmisor

Receptor

Reinicio autm. rel (Puente 16 y 17) Reinicio man. rel con retroalimentacin MPCE (contactos N.C. entre 15 y 16, puente 17 y 18)

L2

K3 K4
PRUEBA TEST PRUEBA TIERRA +24 V

OSSD1 OSSD2 GND

+24 V

PE

K3 K4

Reinicio automtico rel con retroalimentacin MPCE (contactos N.C. entre 16 y 17) Reinicio man. interno a cortina de luz (Puente 16 y 17) A cable rojo del receptor Safe/GuardShield

K3
O

+24V

(Se requiere puente si no se usa mts)

Dispositivos de supresin de arco

K4

2-56

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Fuente de alimentacin de 120 VCA y rel de seguridad Diagrama de cableado tpico
Rel doble M8500
L1

LC1
K3

LC2

K5

Caja de interface de cortina de luz N.C. N.C. N.C.


K5

1 2 3

4 5

7 8 9

10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30

LC1

LC2
Reinicio man. rel

Transmisor

Transmisor

Receptor

Receptor

(Puente 17 y 18, 19 y 20) (Puente 20 y 21, 22 y 23) Reinicio autom. rel (Puente 18 y 19)
K3 K4

(Puente 21 y 22)
K5 K6

TIERRA +24 V PE PRUEBA PRUEBA

TIERRA +24 V PE PRUEBA PRUEBA

OSSD1 OSSD2 TIERRA +24 V PE

OSSD1 OSSD2 TIERRA +24 V PE

Reinicio man. rel con retroalimentacin MPCE

(contactos N.C. entre 17 y (contactos N.C. entre 20 y 18, puente 19 y 20) 21, puente 22 y 23)
K3 K4 K5 K6

(Contactos N.C. entre 18 y 19)

(Contactos N.C. entre 21 y 22)

Reinicio automtico de rel con retroalimentacin MPCE

O
(Se requiere puente si no se usa mts)

O BIEN
K3
(Se requiere puente si no se usa mts) Dispositivos de supresin de arco 100, 2.2F)
+24V A cable rojo del +24V receptor Safe/GuardShield

Reinicio man. interno a A cable rojo del cortina de luz receptor rel autom. Safe/GuardShield (Puente 21 y 22)

K4

LC1

LC2

N.C.
K6

K4

K6

2-57

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Rel de seguridad Especificaciones (continuacin)
mn. Monitoreo de contactores Monitoreo de contactores T 21,T 22 Contactos NC en serie Tiempo de desconexin continua permitido Tiempo de respuesta de contactor permitido Seal de sensor T 3,T 4 Resistencia de entrada (activa) Seal activa a Seal BAJA a Sin restricciones 200 ms Dos canales 606 17.6 V U V 0V 15 ms 15 ms <0.1 mA 4A 240 VCA / 60 VCC 1200 VA/ 50 W 10 7 10 9 40 ms 15 ms UV Regleta de bornes enchufable 2.5 mm 2 2.5 A 2.4 V 674 742 tp. mx.

Descripcin
El rel de seguridad Guardmaster 440L-M8200 de Allen-Bradley est diseado especficamente para hacer interface con los sistemas de cortinas de luz de seguridad. Tiene dos salidas de seguridad normalmente abiertas (control confiable) y una salida auxiliar normalmente cerrada El 440L-M8200 requiere 24 VCC y tiene conexiones convenientes al transmisor y al receptor.

Perodo de tolerancia entre T3 y T4 Salidas Tiempo de respuesta Corriente de conmutacin Voltaje de conmutacin CA/CC Conmutacin CA /CC Vida mecnica esperada (acciones de conmutacin) Vida elctrica esperada (acciones de conmutacin) Retardo a la activacin (contactos N.A.) Retardo a la activacin (contactos N.C.)

Caractersticas
Restablecimiento automtico o manual Monitoreo de MPCE Montaje en riel DIN Indicacin LED de alimentacin en las salidas 2 salidas de seguridad N.A. 1 salida auxiliar N.C. Regleta de bornes extrable de fcil reemplazo

Especificaciones
mn. Normas Certificaciones Clase de proteccin Proteccin del envolvente Voltaje de suministro U V Fluctuacin residual Consumo de potencia (sin carga) Unidad de comandos de entrada T 13,T 14 Perodo de tiempo de actividad de unidad de comandos Llave de inicio Contacto N.A. 30 ms EN 50100 BG y marca CE I IP 20 (gabinete de interruptores, riel estndar) 19.2 V 24 V 28.8 V 5V
SS

tp.

mx.

Voltaje de suministro Conexin Seccin transversal del cable Capacidad de carga de los terminales (C 1 ...4,D 1 ...4) Datos de operacin Categora de seguridad Probado segn Temp. ambiente de funcionamiento Temperatura de almacenamiento Tipo 4

pr EN 50100 Parte 1 y 2 0 C 25 C +55 C +75 C 95 %

0.3 A (6 W)

Humedad relativa (sin condensacin) 15 % Especificaciones sobre vibracin Resistencia al choque Dimensiones aproximadas (ancho x alto por prof.) 5 g,10 ...55 Hz segn IEC 68-2-29

10 g 16 ms segn IEC 68-2-29 152 x 73 x 118 mm 3

Los lmites mximos de voltaje no deben excederse, deben lograrse los niveles mnimos. Tiempo de respuesta sin atenuacin de elementos de conmutacin (rels), por ej., mediante supresores de interferencia. El revestimiento de oro de los contactos se evapora cuando las corrientes conmutadas son >100 mA. La corriente conmutada mnima se convierte a 10 mA.

2-58

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Rel de seguridad Seleccin de productos
Voltaje Restablecimiento Supresin flotante Supresi n fija PSDI Silenciamiento Salidas de rel Nmero de catlogo

24 VCC

Manual/ automtico

no

no

no

no

2 N.A. Seguridad 1 N.C. Contacto 4 amp

440L-M8200

Dimensiones aproximadasmm (pulgadas)


Las dimensiones son aproximadas y no se proporcionan para fines de instalacin.
152 (5.98) 118 (4.65)

70 (2.76) 35 (1.38)

Diagramas de cableado tpicos


Sin inicio/ Comando Monitoreo reinicio Unidad Restablecimiento enclavamiento de contactores 24 VCC 0 V
1) 2)

N.A. Sin entrada N.C. contacto contactor N.A. entrada monitoreo entrada
2)

o bien

o bien

A 1+

A 2-

PE

T0

PE

T 13

T 14

X 11

X 12

T21

T 22

X 21

X 22

1.3

2.3

3.1

24 VCC 0 V Alimentacin de entrada

0V Auto Restablecimiento

N.A. N.A. N.C. Contactos Desactivado Activado Monitor ext. Contactores Salidas Desactivado

Transmisor 24 VCC 0 V
C1 D1 PE

Receptor 24 VCC 0 V
C2 D2 PE T3 T4

24 VCC 0 V
C3 D3 PE

24 VCC 0 V
C4 D4 1.4 2.4 3.2

24 VCC 0 V

24 VCC 0 V

OSSD OSSD 1 2

N.A. salida

N.C. contacto entrada N.A. salida

AOPD tipo 4 Transmisor

AOPD tipo 4 Receptor

1) Ecualizacin potencial, si paquete de alimentacin -0V no conectado con (VDE 0160) 2) Puente de cable

Los puentes X11/X12 para inhibicin de reinicio (inhabilitacin de) y X21/X22 for (inhabilitacin de) monitoreo de contactores no debe encaminarse externamente (slo en cables con cubierta de plstico aislada).

2-59

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control Posibilidades y condiciones de aplicacin
reas de aplicacin El 440L-M8100 con un AOPD se usa como unidad de control en aplicaciones de proteccin para sistemas de guarda de punto de operacin, reas peligrosas y entrada/salida. Ms an, asume responsabilidad por funciones de control tales como el silenciamiento de sistemas de entrada/salida de paletizadora, o frenos de prensa, as como supresin y otras funciones de control en prensas (por ej., operacin de apertura). Las reas tpicas de aplicacin son: Prensas en la industria de trabajos con metal, plsticos, cueros y piedra (funciones: guardas, operacin de apertura, supresin, etc.) Frenos de prensa (funciones: guardas, supresin, silenciamiento antes de centro muerto inferior, etc.) Aplicaciones de paletizadora o entrada(salida (funciones: guarda, silenciamiento, etc.) Reglamentos sobre el uso El 440L-M8100 est diseado para instalarse en el gabinete de control de la mquina (IP 20). Si se utiliza fuera del gabinete de control, deber usarse un envolvente apropiado equipado con perfil de riel DIN, por ej., un envolvente elctrico (IP 54). Lo mismo rige para aplicaciones que se llevan a cabo fuera de salas cerradas (temperatura ambiente 0 C 50 C (32 F 122 F)). Las operaciones tales como programacin o conexin de la unidad, por ej., todas las actividades en el 440L-M8100 que podran afectar la operacin segura de la unidad, slo deben ser realizadas por personal calificado.

Descripcin
La unidad de control de la cortina de luz interface de seguridad programable 440L-M8100 es una unidad de control para dispositivos protectores optoelectrnicos (AOPD), y est diseada como dispositivo de automonitoreo de conformidad con EN 50100. Est diseada par aplicaciones industriales, y tiene las siguientes caractersticas: Alta disponibilidad No tiene piezas que se desgasten Construccin compacta Uso universal

Nota: Este producto slo debe usarse con cortinas de luz de seguridad POC. No puede usarse con dispositivos SafeShield, PAC o AAC.

Caractersticas
Operacin sin desgaste Salidas de semiconductores protegidas contra cortocircuito, seguras Monitoreo de lnea de las salidas Tecnologa de microprocesador de mdem Tiempo de respuesta corto Pantalla LCD para indicacin de funcin de programacin y mensajes de diagnstico Conexin para dos parejas de sensores AOPD tipo 4 o hasta cuatro parejas de sensores AOPD tipo 2 (tambin operacin combinada) Prueba automtica de sensores AOPD tipo 2 Combinaciones de funciones definidas programables por el usuario Funciones estndar preprogramadas: Guarda solamente, apertura simple, apertura doble Contrasea de programacin El monitoreo de contactores y el enclavamiento de reinicio pueden seleccionarse Supresin fija/flotante para AOPD tipo 4 (cortina de luz de seguridad SafeShield) Funcin de silenciamiento con conexin para hasta 4 detectores con silenciamiento Salidas para indicadores de todas las funciones especiales Interface de datos RS 485 para controles y diagnstico de los detectores Conexin para el interruptor selector del modo de operacin Operacin de apertura con hasta 8 aperturas

Estructura del sistema


Descripcin general del sistema El 440L-M8100 tiene un envolvente estndar con dos regletas de bornes enchufables de 33 pines. Cuenta con una pantalla LCD de dos lneas y un conjunto de teclas de control en el panel frontal para la operacin y programacin. Tres indicadores LED integrados muestran las condiciones de salida del 440L-M8100.
indicador LED verde encendido indicador LED rojo encendido indicador LED amarillo encendido salidas activas salidas inactivas mal funcionamiento

El indicador LED amarillo indica un mal funcionamiento operativo del sistema o del equipo perifrico.

2-60

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control
Elementos de conexin y operacin La pantalla LCD tiene dos lneas, cada una con capacidad para 20 caracteres. Adems de los mens de programacin, se muestran todos los estados de operacin del sistema. En el caso de mal funcionamiento operativo o mal funcionamiento del equipo perifrico, aparecern los mensajes de diagnstico apropiados. El teclado de control se usa junto con la pantalla LCD para programacin y diagnsticos en el 440L-M8100. Los detalles sobre la programacin pueden encontrarse en las instrucciones de operacin. Gracias a los terminales de conexin enchufables, el cableado puede prepararse sin el 440L-M8100, lo cual permite que cualquier intercambio pueda realizarse en el tiempo ms corto posible, sin necesidad de recablear los conductores de conexin.
E1 E2 E1 E2 1 pareja de tipo 4 detectores o bien 2 parejas de detectores tipo 2 1 pareja de detectores tipo 4 o bien 2 parejas de detectores tipo 2 1 pareja de detectores tipo 4 o bien 2 parejas de detectores tipo 2

440L-M8100

440L-M8100

Funcin y operacin
Principio de operacin El 440L-M8100 asume responsabilidad de las funciones de control como vnculo operativo entre el sistema de control de la mquina y la funcin de control del AOPD, y conmuta los elementos de control requeridos (contactores) del sistema de control de la mquina mediante salidas de semiconductores de dos canales. Las seales que llegan del 440L-M8100 y del equipo perifrico son procesadas adicionalmente por componentes electrnicos de microprocesador de dos canales. Los detectores tipo 2 (probables) y/o tipo 4 (automonitoreo) pueden operarse con el 440L-M8100. El sistema de control interno puede distinguir entre las diferentes categoras. Los detectores Tipo 2 son automticamente probados cclicamente por el 440L-M8100 cada 60 minutos. El 440L-M8100 est diseado para la conexin de dos parejas de detectores AOPD tipo 4 o hasta cuatro parejas de detectores AOPD tipo 2. (1 pareja = 1 emisor y 1 receptor). Tambin puede configurarse una operacin combinada de detectores OPDS tipo 4 y tipo 2. Los detectores tipo 2 siempre deben usarse en parejas, es decir se usan dos parejas del tipo 2 o 4 parejas del tipo 2. La prueba automtica de los detectores tipo 2 aumenta el nivel de proteccin de todo el sistema protector (no se requieren medidas de seguridad externas). En lugar de un segundo sensor AOPD tipo 4, tambin puede conectarse un 440L-M8100 (tipo 4) adicional, con el objeto de conectar en cadena los 440L-M8100.

E1

E2

E1

E2

440L-M8100

A 440L-M8100

Diversos tipos de conexin al 440L-M8100

2-61

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control
Modo de seleccin externo

Modos de operacin Establecimiento de los modos de operacin Todos los modos de configuracin de operacin del 440L-M8100 pueden llamarse utilizando el interruptor BCD correspondiente. Una conexin en puente o la seleccin directa usando el programa modos de marcha es posible para un modo de operacin fijo. Los modos de operacin estndar, tales como guarda solamente, apertura nica, doble apertura, se proporcionan preprogramados, es decir, la interface puede funcionar sin programacin de usuario.

Entrada

1 0

2 0

3 0 modo de teclado (programacin) operacin de guarda solamente apertura nica apertura doble programa de usuario 1 programa de usuario 2 programa de usuario 3 no se usa)

Adems, 3 posiciones del interruptor selector pueden dedicarse a programas de aplicacin que pueden ser definidos por el usuario. Enclavamiento de reinicio/luces indicadoras La funcin con/sin enclavamiento de reinicio puede establecerse directamente en los terminales 52, 53 y 54. Esto puede realizarse usando puentes o contactos de cambio externos, lo cual hace posible conmutar el enclavamiento de reinicio (RI) sin programacin, por ej., en prensas: En el movimiento peligroso hacia abajo con RI En el movimiento no peligroso hacia arriba sin RI Para conexin directa a las luces indicadoras que muestran las siguientes funciones, las salidas de 24 VCC estn disponibles en los terminales 57 a 64: Botn de restablecimiento requerido

0 0 1 1 1 0 (1 0 1

0 1 0 1 0 1 1

1 0 0 0 1 1 1

entrada no conectada con abierto entrada conectada con

Terminales de conexin para el interruptor selector de modo de operacin, con asignacin


Operacin de guarda solamente Apertura nica Apertura doble Mltiples aperturas (3-... 8 aperturas) Supresin Silenciamiento Resolucin reducida Secuencia de inicio para operacin de apertura Prueba de detector con/sin Reinicio de una carrera Monitoreo de contactores: con/sin Botn de restablecimiento: enclavado/ desenclavado *) Puede programarse o combinarse en los programas de usuario 1, 2 y 3 *) *) *) *) *) *) *) *) *)

Silenciamiento Resolucin reducida/supresin y Acumulacin de suciedad (AOPD) Mx. corriente de salida 0.4 A cada una (corriente mnima 0.02 A para silenciamiento y supresin).

Instalacin
Montaje mecnico, condiciones ambientales El 440L-M8100 se monta en un riel DIN o, si es necesario, en un envolvente externo apropiado (montaje de insercin a presin). El rango de temperatura ambiente permitido es 0 C 50 C (32 F 122 F) (IP 54). Instalacin elctrica El 440L-M8100 funciona con 24 VCC 20 % y tiene un consumo de corriente de 0.5 A (sin carga). La conexin est libre de potencial gracias a dos regletas de bornes enchufables de 33 pines. Esto permite realizar el cableado antes de instalar el 440L-M8100. Los terminales estn diseados para una seccin transversal mxima de cable de: 1 x 2.5 mm2 con manguito, o 1 x 4 mm2 macizo.

Modos de operacin que pueden programarse mediante el men del 440L-M8100

2-62

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control
La extensin del cableado depende de la aplicacin especfica.
A1 y A2 silenciamiento silenciamiento silenciamiento silenciamiento B1 y B2 - (abierto) silenciamiento reinicio de una carrera reinicio con enclavamiento reinicio de una carrera reinicio sin enclavamiento reinicio de una carrera reinicio con enclavamiento reinicio de una carrera reinicio sin enclavamiento

Supresin de indicadores externos/silenciamiento de resolucin reducida Si se usa supresin/resolucin reducida, deben conectarse los indicadores correspondientes. Estos indicadores asociados con la seguridad se monitorean mediante el 440L-M8100 (corriente de salida de 0.02...0.4 A). Los indicadores de reinicio requerido y seal dbil son opcionales (corriente de salida de 0...0.4 A). En caso de usar estas salidas de indicacin NPN en un PLC, debe conectarse una resistencia (por ej., 1 k/1 W) entre los terminales 57-58 y/o 63-64 para la ecualizacin del potencial. La seal de salida se proporciona en el terminal 58 y/o 64 (funcin NPN). El potencial de 0 V de ambas fuentes de alimentacin 440L-M8100 y el PLC deben estar vinculados.

Las funciones dependen de los parmetros del programa. Detectores Tipo 2 Cuando se usan detectores tipo 2, deben conectarse dos parejas a cada circuito de entrada 440L-M8100. Estos son probados automticamente. El comando de prueba al detector (terminales 14/16/26/28) puede seleccionarse mediante una conexin simple a los terminales adyacentes (terminales 15/17/27/29) (prueba con potencial de 0 V o potencial positivo). Las salidas de conmutacin de un solo canal de los receptores tipo 2 se conectan a los terminales 9 y 10 (parejas 1 y 2) y/o a los terminales 21 y 22 (parejas 3 y 4).

2-63

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control
Modos de supresin 440L-M8100
1.

Especificaciones
Fluctuacin de voltaje de suministro Consumo de corriente Entradas Modos de marcha Interface de datos 24 VCC 20 % mx. 5 VSS aprox. 12 W (sin carga) Para 2 ESPD tipo 4, 4 ESPD tipo 2 fijo/ programable, llamado mediante selector o ajuste fijo RS 485 para control y diagnsticos de fallo de detector ESPD, se requiere par trenzado para una longitud de cable de >10 m Monitoreo de contactores: 100 mA dinmico para T<1 ms, 10 mA esttico. Entradas de prueba: 100 mA dinmico para T<1 ms, 10 mA esttico. 2 x PNP, 0.5 A, proteccin contra sobrecarga 5 ms Para dispositivos de comando y funciones especiales, mx. 0.4 A por salida Mediante pantalla para interface RS 485 De conformidad con EN 50100 tipo 4 IP 20 Tipo enchufable 2.5 mm2 con manguito/4 mm2 macizo 0 a 50 C 25 C a +70 C Envolvente estndar para rail superior (montaje a presin) 200 x 123 x 118 mm3 Riel superior de 35 x 15 mm2

Supresin flotante A. Sistema de 14 mm: Mn. = Separacin 0.2" 0.9" Resolucin Mx. = Separacin 4.7" 5.3" Resolucin Estos estn en incrementos de 0.3" B. Sistema de 30 mm: Mn. = Separacin 0 5" 1.7" Resolucin Mx. = Separacin 9.4" 10.6" Resolucin Estos estn en incrementos de 0.6"

Corrientes de entrada

Nota: Puede que no use supresin flotante con le modo PSDI (por ej.: modo de una apertura). 2.

Resolucin reducida A. Sistema de 14 mm solamente Mn. = 0.2" separacin 0.9" RESOLUCIN Mx. = 1.1" separacin 1.8" RESOLUCIN Estos estn en INCREMENTOS DE 0.3"

Salidas Salida de conmutacin Tiempo de respuesta Driver de bombilla

3.

Supresin fija A. 14 mm y 30 mm: Puede suprimir todos los haces excepto el haz #1
Diagnstico Requisito Clasificacin del envolvente Terminales de conexin Seccin transversal de cable, mx. Temp. ambiente de funcionamiento Temperatura de almacenamiento Envolvente ancho x alto x profundidad

Nota: Puede suprimir ms de un rea.

ATENCIN: La distancia de seguridad debe recalcularse y las cortinas de luz de seguridad deben volverse a montar cuando se activa la supresin flotante, la resolucin reducida o la supresin fija.

Interface programable Opcional


Tensin de entrada

Tipo de acople

Restablecimiento

Supresin flotante

Supresin fija

PSDI

Silenciamiento

Salidas

Nmero de catlogo

24 VCC

Manual/ automtico

2 PNP OSSD

440L-M8100

2-64

Dispositivos de seguridad para deteccin de presencia

Interfaces de cortina de luz de seguridad


Unidad de control Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
200 (7.87) 4.5 (0.18) 118 (4.65)

123 (4.84)

34.5 (l.36)

Diagrama de cableado tpico


Circuito de paro de seguridad Voltaje de suministro 24 VCC 20 %

Receptor AOPD

Detector AOPD

K1

K2

24 V mx 0.5 A

PE Entrada 24 VCC Entradas auxiliares

PE Alimentacin Com

Salidas 1 2

Receptor 1

Salidas PE 1 2 Prueba 2 Prueba 1 AlimentaAlimentacin Prueba 3 Prueba 4 Alimentacin cin Receptor 2 Transmisor 2 Transmisor 1 PE PE Indicadores

Sin conex. Sin conex.

K1

K2

1 2 Canales de salida
Estado salidas receptor 12

A1

A2

B1

B2

Contacto Monitoreo Prueba Rel Ciclo Sistema

Selec. Modo Externo

Modo de reinicio

InteSilencia- Resolurruptor Reinicio miento cin reinicio requerido activo reducida

Seal dbil

Ext Int

K1 K2

Ext = Restablecimiento automtico Int = Restablecimiento manual

Cableado para modo 1 definido por el usuario, dejar abierto para modo de teclado

Interruptores de silenciamiento o detectores

(o contacto N.C.)

Monitoreo de rel

Reinicio

Bombilla reinicio (opcional) (24 VCC, 0.4 A mx.) Bombilla de silenciamiento (requerida) (24 VCC, 0.02-0.4 A) Bombilla de supresin (requerida) (24 VCC, 0.02-0.4 A)

24 V mx 0.5 A

Blanco Verde Amarillo Gris Azul Marrn Negro Blanco Verde Azul Marrn

Negro

2-65

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


Descripcin general Principios de operacin
Rango de medicin Campo de advertencia (ejemplo) Campo de proteccin mximo

La configuracin de los campos de advertencia y seguridad del SafeZone se realiza mediante el software para Windows SCD (Safety Configuration and Diagnostic) de Allen-Bradley. Las zonas de advertencia y seguridad se configuran fcilmente con el mouse de la PC. Basta con hacer clic y arrastrar puntos a lo largo del permetro de la zona especfica para formar el contorno del permetro.

reas de proteccin
Campo de proteccin (ejemplo)
6m
7.5 m

El SafeZone es apropiado para aplicaciones de proteccin personal en: Maquinaria estacionaria Celdas de ensamblaje robtico Zonas peligrosasmovimiento en la parte superior vehculos de transporte mvil

60

Aplicacin estacionaria

rea de prueba (objeto de referencia)

El escner de lser de seguridad SafeZone est diseado para uso industrial. Su tarea es detectar el acceso de personas a las reas peligrosas y detener el movimiento peligroso de una mquina en esta rea. Se activa una seal tan pronto como una persona u objeto entra en el rea monitoreada: Si hay una persona u objeto presente dentro del campo de advertencia el escner de lser de seguridad SafeZone conmuta un contacto de rel en la salida de seal correspondiente. Esta seal puede usarse para advertencias acsticas y pticas. Las advertencias indican que debe salirse del rea peligrosa antes de que se active el campo de proteccin, y los OSSD del escner de lser de seguridad SafeZone emiten una seal de paro que causarn un paro de la mquina. Si hay una persona u objeto presente dentro del campo de proteccin el escner de lser de seguridad SafeZone conmuta dos contactos de rel independientes. Esta seal debe causar una desactivacin inmediata del movimiento peligroso de la mquina.

El verstil software del escner de lser de seguridad SafeZone permite la configuracin de zonas de advertencia y seguridad de formas irregulares.

2-66

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


Descripcin general Vehculos autoguiados (AGV)

El escner de lser de seguridad SafeZone est diseado para detectar objetos fijos (paredes, columnas, etc.) as como objetos mviles (personas, AGV, etc.). El SafeZone generalmente se monta en la parte frontal de un vehculo mvilen cada direccin de desplazamiento. Cualquier objeto de resolucin suficiente ser detectado.

El SafeZone puede configurarse con campo de advertencia externo y campo de seguridad interno. El campo de advertencia externo tiene una salida de rel separada que no es de seguridad, la cual puede conectarse a una alarma para indicar cuando se rompe el campo de advertencia. La penetracin al campo de seguridad hace que las dos salidas de rel de seguridad del SafeZone cambien de estado y detengan el movimiento del vehculo. Es necesario montar correctamente el SafeZone y luego determinar el tamao del campo de seguridad segn una frmula de distancia de seguridad. Esta informacin se detalla en el manual SafeZone Installation Instruction.

2-67

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


SafeZone Especificaciones
Normas Categora de seguridad Certificaciones Clase de proteccin de lser Mediciones y margen de tolerancia Margen para una deteccin segura de objetos, el tramo nominal Tiempo de res. del campo protector IEC61496 Tipo 3 ESPE segn EN 61496-1 Marca CE, cULus IEC 60825 Lser Clase 1 (seguridad de los ojos) 0 a 7.5 m (0 a 24.6 pies) 0 a 6 m (0 a 19.6 pies) (incluye suplemento de seguridad) 280 ms 300 905 Nm 5.76 KHz + 5 % 8 Hz + 5 % 300 70 mm (2.8 pulg.) a 6 m (19.6 pies) 0.5 segn IEC 2-6, rango de frecuencia 10-55 Hz, amplitud: 0.35 mm segn IEC 2-29, aceleracin 10 g, duracin de pulsos: 16 ms 15 mrad (0.86) 30 mm (1.18 pulg.) 30 mm (1.18 pulg.) 24 VCC 25 % (mediante un transformador de aislamiento de seguridad, segn IEC 742) 2 A durante 100 ms Total de 24 W Aluminio IP 65 3.0 kg 0 C ... 50 C (32 F a 122 F) 20 C ... 70 C (4 F a 158 F)

Descripcin
El escner de lser de seguridad SafeZone es un dispositivo optoelectrnico que usa reflexin difusa de la luz infrarroja emitida para determinar la intrusin de una persona u objeto dentro de un rea definida. Una unidad de deflexin giratoria emite peridicamente pulsos de luz lser infrarroja Clase 1 sobre un margen angular de 300 para crear una zona de deteccin de dos dimensiones. La luz reflejada es procesada por el SafeZone, el cual enviar una seal de paro conmutando el estado de sus salidas de rel de seguridad, si se determina que una persona u objeto se encuentra dentro de la zona de deteccin predefinida. Pueden crearse dos zonas dentro del margen de escn mximo del SafeZone con el software para Windows del SafeZone. La zona de seguridad puede configurarse para un radio de 6 m (19.7 pies) y la zona de advertencia para un radio de 7.5 m (24.6 pies). El SafeZone puede usarse en aplicaciones estacionarias para deteccin horizontal en una zona de proteccin definida, en aplicaciones verticales para deteccin de acceso de todo el cuerpo y en aplicaciones de seguridad de vehculos mvilesAGV (vehculos autoguiados). El valor mximo de tiempo de paro de la mquina ms el tiempo de respuesta del SafeZone debe calcularse de manera que ninguna persona pueda obtener acceso a un punto peligroso antes que el movimiento peligroso se haya detenido.

ngulo mximo Longitud de onda Frecuencia de pulsos Frecuencia de escn ngulo de escn Resolucin Resolucin de puntos Vibracin Choque

ptica (transmisor coaxial y ptica de receptor) Divergencia de rayo lser Longitud de enfoque Dimetro del lente Voltajes de operacin

Fuente de alimentacin elctrica

Corriente de activacin Consumo de energa Material Clasificacin del envolvente Peso Temperatura de operacin Temperatura de almacenamiento Interfaces Interfaces de datos a computadora Salidas de seal para campo de advertencia, OSSD 1, OSSD 2

Envolvente y resistencia ambiental

Caractersticas
ngulo de escn de 300 Dos zonas programables (seguridad/advertencia) Salidas de rel de seguridad Envolvente IP65 robusto

RS 232: 9600 baudios, 8 bits de datos, 1 bit de paro, sin paridad Salidas de rel libres de potencial, mx. 2 A, mx. 30 V, carga puramente resistiva, nmero de operaciones; 2 millones

2-68

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


SafeZone Seleccin de productos
1. Escner de lser de seguridad
Nmero de catlogo 442L-SSFZN Descripcin Escner de lser de seguridad SafeZone, 24 VCC

2. Conjuntos de cables
Nmero de catlogo Descripcin Nmero de catlogo Descripcin

442L-SCPWR

Aliment. y salidas 5 m (16.3 pies)


Vista del lado soldado del conector de 8 pinesSe conecta al SafeZone. Conductores individuales del extremo opuesto, previamente pelados

442L-SCCFG

Cable de comunicacin para configuracin de zonas 5 m (16.3 pies)

Vista del lado soldado del cable de configuracin con conector de 14 pinesSe conecta al SafeZone. Conector D-Sub de 9 pines del extremo opuesto

Pin # 1 2 3

Seal 24 V GND24 OSSD 2.1

Explicacin Suministro de 24 VCC Tierra Contacto de rel para campo de proteccin 2.1 Contacto de rel para campo de proteccin 2.2 Contacto de rel para campo de proteccin 1.1 Contacto de rel para campo de proteccin 1.2 Contacto de rel para campo de advertencia 1.1 Contacto de rel para campo de advertencia 1.2 Tierra funcional(blindaje)

Marca + S2

Colores Marrn Azul Blanco

Pin # A C E

Seal GND RTS CTS

Explicacin Tierra, RS 232 RS 232: Listo para enviar RS 232: Listo para emitir RS 232: Datos de transmisin RS 232: Datos de recepcin Sin conexin

Direccin --Salida Entrada

Nivel --24 V 24 V

OSSD 2.2 4 OSSD 1.1 5 OSSD 1.2 6 Campo de advertencia 1.1 Campo de advertencia 1.2 FE

Gris S2 Negro S1 Verde S1 Rojo A Rosado A Negro grueso M L J G

TxD

Salida

24 V

RxD

Entrada

24 V

---

---

---

RES

Restablecer (activo BAJO) Sin conexin

Entrada

24 V

---

---

N hasta U

FE

Nota: El escner de lser de seguridad SafeZone es un dispositivo Tipo 3 con dos salidas de rel N.A. Para obtener un sistema de Categora 3, el SafeZone debe conectarse a travs de un mdulo de rel de seguridad que monitoree ambos FSD.

2-69

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


SafeZone Seleccin de productos (continuacin)
3. Rels de seguridadOpcional
Fuente de alimentacin elctrica 24 VCA/CC Dos canales (MSR126.1T) 2 N.A. Dos canales (MSR126.1R) Ninguna 115 VCA 230 VCA 24 VCA/CC 115 VCA 230 VCA 24 VCA/CC 1 NC, 2 NC, o cortina de luz o escner de lser MSR127TP MSR127RP 3 N.A. 1 N.C. 115 VCA MSR127TP MSR127RP MSR127TP 230 VCA MSR127RP Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Automtico/manual Manual monitoreado Monitoreo manual Automtico/manual

Rel

Entrada

Salidas de seguridad

Salidas auxiliares

Tipo

Restablecimiento

Nmero de catlogo 440R-N23114 440R-N23113 440R-N23112 440R-N23120 440R-N23119 440R-N23118 440R-N23132 440R-N23135 440R-N23131 440R-N23134 440R-N23130 440R-N23133 440R-C23139

MSR 126

MSR 127RP
1 N.C. o 2 N.C. o tapete de seguridad o cortina de luz de seguridad o escner de lser 24 VCA/CC 2 N.C. 2 PNP, estado slido

3 N.A.

115 VCA

Automtico/manual o manual monitoreado

440R-C23137

230 VCA

440R-C23136

MSR 131RTP

4. AccesoriosOpcional
Productos Fuente de alimentacin elctrica: Entrada85...265 VCA Salida24 VCC, 3 Amps Nmero de catlogo

1794-PS3

5. Diagramas de cableado tpicos Cableado de salidas SafeZone a un mdulo de rel de seguridad

OSSD SafeZone directamente a FSD (contactores) Sistema de Categora 1


24 V OSSD 2.1

OSSD 1.1 OSSD 2.1

24 VCC

Restablecimiento

L1 L2 L3

A1 Entradas MC 13 23
Escner de lser de seguridad SafeZone Rel de monitoreo de seguridad

OSSD 2.2

K1
OSSD 1.1

K2
OSSD 1.2

* *

A2 Entradas MC 14 24
OSSD 2.2 OSSD 1.2 GND

K1

K2

Diodo de supresin

K1

K2

Diodo de supresin Los rels K1 y K2 deben tener contactos de activacin positiva

*Blindaje para evitar la comunicacin cruzada

0V

2-70

Dispositivos de seguridad para deteccin de presencia

Escner de lser de seguridad


SafeZone Seleccin de productos
5. Diagramas de cableado tpicos (continuacin) Salida del capo de advertencia SafeZone
30 V mx. L

Campo de advertencia 1 Campo de advertencia 2


0V N

Dimensionesmm (pulgadas)
176 (6.9) 56.5 (2.22)

178 (7.0) 137.5 (5.41)


Seal de 24 VCC Interface

158 (6.22)

15 (0.59) 15.5 (0.61) 11 (0.43)

Etiqueta de placa de identificacin

19 (0.74)

Fusible 3.15 AT

Seguridad

Advertencia Diagnstico

Bombillas indicadoras

Conector macho 14 pines

Conector macho 8 pines

Conector hex. 4 mm Tierra del chasis 1 mm2 a 2.5 mm2

10 (0.39)

verde rojo amarillo amarillo

Orificios de montaje

Tapa protectora Conector de cable hembra 8 pines ~ 60 (2.36)

115 (4.52)

Tapa protectora

90 (3.54) radio mnimo de doblez 120 (4.72) radio mnimo de doblez

Conector de cable hembra 14 pines

Mn. 175 (6.88) distancia

176 (6.9)

115 (4.52)

86 (3.38)

Roscado M4 x 10 4 lugares

Superficie de montaje 144 (5.66)

2-71

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Descripcin general Caractersticas
Certificacin tipo EC Certificacin de otros fabricantes segn EN 1760-1, EN954-1 (ISO 13849-1) categora 3 e IEC/EN 60204-1, AS 4024.5, ANSI B11.19, ANSI RIA R15.06 Sensibilidad total, incluida el bordillo de unin Las unidades de control monitorean el estado de cada tapete individualmente Sistema completamente a prueba de fallos con unidad de control de monitoreo cruzado Construccin resistente que resiste la presin de 4,500 psi Construccin de vinilo resistente a la mayora de aceites Sellado segn especificaciones IP67 Garanta de 5 aos para los tapetes

Descripcin
El sistema MatGuard consiste en un nmero de tapetes de seguridad sensibles a la presin interconectados y una unidad de control de monitoreo que proporciona un sistema para deteccin de rea. El tapete ha sido diseado desde el nivel del suelo para cumplir con las rigurosas condiciones de una planta de fabricacin, y utiliza componentes y tcnicas probadas y confiables. Los tapetes estn disponibles en una amplia gama de tamaos estndar para satisfacer la mayora de requisitos. Pueden pedirse tamaos y formas especiales. Cada tapete tiene dos placas conductoras separadas por separadores comprimibles no conductores. Cada tapete para piso de 4 cables, de funcionamiento a 24 VCC, est precableado y conectado en serie con los otros tapetes para formar un sistema completo de proteccin a nivel del piso en zonas peligrosas. El circuito a travs del tapete es monitoreado por la unidad de control MatGuard, la cual proporciona una seal al circuito de control de la mquina cuando no hay personas en la zona. Cuando se aplica presin al tapete, se tocan las placas conductoras y la resistencia en el circuito se baja a cero. La unidad de control monitorea esto, lo cual desactiva la mquina. El proceso de moldeado nico asegura una vida til larga y confiabilidad del tapete. Puesto que est hermticamente sellado (IP67), no se presentan problemas relacionados con el agua, lquidos y refrigerantes. Adems, el vinilo robusto es resistente a la leja, cidos, sales y la mayora de elementos qumicos industriales, excepto los ms corrosivos. Hay una gama de unidades de control disponibles, incluyendo el Mat Manager (Administrador de tapetes) que monitorea el estado de cada tapete o rea de tapetes individualmente. Esto permite la rpida deteccin/reparacin de fallas y la identificacin del rea activada. Resistencia a productos qumicos de la cobertura de vinilo del tapete detector
Substancia Agua Alcohol etlico Cloruro de sodio Leja cido clorhdrico cido sulfrico cido ntrico cido actico Gasolina Etileno de tricloruro Benceno Acetona Resistencia de la cobertura del tapete Excelente Excelente Excelente Excelente Regular a excelente Regular a excelente Regular a excelente Regular Regular Regular a insatisfactoria Insatisfactoria Insatisfactoria

En general, la cobertura tiene excelente resistencia a cidos, lcalis y sales. Los lcalis y cidos calientes, as como los cidos concentrados y orgnicos, tienen un efecto nocivo si la exposicin es prolongada. La cobertura tiene una resistencia regular a los disolventes alifticos, regular a insatisfactoria a los disolventes aromticos y clorinados e insatisfactoria a cetonas y la mayora de steres.
Nota: Las combinaciones de productos qumicos pueden tener efectos impredecibles. En dichos casos se recomienda hacer pruebas. Hay disponibles piezas pequeas del material de vinilo si se requieren pruebas.

Aplicaciones tpicas

2-72

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Descripcin general Anatoma de un sistema de tapete
Diseo de acanalado diferente en el revs (segn la ilustracin) El controlador detecta una presencia en el tapete, un cortocircuito o circuito abierto. En cada una de estas condiciones, los rels de salida de seguridad se desactivan. Cuando se interconectan correctamente, la mquina o movimiento peligroso recibir una seal de paro y se activar un rel de salida auxiliar. Ubicacin de cable STD. 4.5 m

Ubicacin de cable Diseo a cuadros (lado 1) (para mximo antideslizamiento) Diseo de acanalado recto (lado 2) (para facilitar la limpieza en aplicaciones higinicas)

El bordillo unificador activo mantiene activa el rea de deteccin en las juntas de los tapetes. Vinilo acanalado para servicio pesado Placa conductora superior Tapete no presionado Separador comprimible no conductor Placa conductora inferior Vinilo acanalado para uso pesado Tapete activado Cuando el tapete se activa, los separadores no conductores comprimibles (mostrados en rojo) se comprimen hacia su cavidad permitiendo que las dos placas hagan contacto para proporcionar sensibilidad general. El bordillo del permetro fija los tapetes al piso Reborde sellador flexible

Bordillo debajo de canal de cable

2-73

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Descripcin general Normas
El sistema de tapetes MatGuard ha sido diseado para cumplir con la norma europea ms reciente EN 1760-1 Safety of machinery Pressure sensitive devices; mats and floors (Seguridad de maquinaria, dispositivos sensibles a la presin; tapetes y pisos) Esta norma contiene los requisitos para todos los aspectos del diseo. Algunos de los aspectos ms importantes son: (De 4.2.2) Donde una zona de deteccin eficaz consta de ms de un detector (tapete), no debe haber una zona muerta. La norma presenta los detalles relativos al tamao, fuerza y posicionamiento de las piezas de prueba para probar la sensibilidad del tapete. (De 4.5.1) Un solo detector (tapete) debe seguir funcionando despus de un milln de accionamientos por una masa de 76 kg. (De 4.7) Cuando se aplique la fuerza de accionamiento, el (los) dispositivo(s) conmutador(es) de seal de salida cambiar(n) de un estado activado a un estado desactivado. Permanecer(n) en el estado desactivado durante por lo menos la duracin de la aplicacin de la fuerza de accionamiento. (De 4.7.1) Dispositivo con restablecimiento b) Despus de retirarse la fuerza de accionamiento, el (los) dispositivo(s) conmutador(es) de seal de salida cambiar(n) al estado activado solamente despus de la aplicacin de una seal de restablecimiento. (De 4.7.2) Dispositivo sin restablecimiento Para un tapete sensible a la presin sin restablecimiento, el (los) dispositivo(s) conmutador(es) de seal de salida cambiar(n) a un estado activado al momento del encendido y despus de retirarse la fuerza de accionamiento. (De 4.15) Los tapetes sensibles a la presin cumplirn con los requisitos de la categora para la cual estn especificados...
Nota: El sistema de tapetes para el piso MatGuard cuenta con un tapete activo y una unidad de control de monitoreo de dos canales. Esto significa que un solo fallo elctrico en el tapete, cableado o unidad de control se detectar y la unidad de control entrar en una condicin segura (desactivada).

El sistema de tapetes de seguridad para el piso MatGuard tambin est diseado para cumplir con las normas de EE.UU. ANSI/RIA R15.06-1999, Requisitos de seguridad para robots industriales y sistemas robticos y ANSI B11.19, Criterios de rendimiento para dispositivos de proteccin. Estas dos normas de EE.UU. tienen muchos requisitos similares y proporcionan criterios de rendimiento para el diseo, instalacin y uso. Algunos extractos de estas normas son: De RIA R15.06 (De 11.7) Los sistemas de tapetes de seguridad deben disearse, construirse y usarse de manera que un fallo de cualquiera de los componentes no evite la accin de paro del robot. (De 5.3.4) Los tapetes de seguridad deben tener una sensibilidad a objetos mnima que detecte 30 kg (66 lb) de peso de un disco circular de 80 mm (3.125 pulg.) de dimetros en cualquier lugar de la superficie de deteccin; proporcionar un medio de retener la mnima sensibilidad a objetos en el rea donde se unen los tapetes. De ANSI B11.19 (De 11.1.1.4) El tapete de seguridad tendr un tiempo de respuesta mximo no afectado por los ajustes de sensibilidad al objeto ni los cambios ambientales. (De 11.1.1.5) Cuando ocurre un fallo de un componente, mdulo, dispositivo o sistema, la funcin de seguridad debe evitar la iniciacin del movimiento peligroso de la mquina, iniciar un comando de paro inmediato y evitar el reinicio del movimiento peligroso de la mquina. De AS 4024.5 El sistema de tapete de seguridad MatGuard est diseado para cumplir con la norma australiana AS 4024.5, la cual es muy similar a la norma europea EN1760-1. Algunos extractos de esta norma son: (De 3.2.2) Donde una zona de deteccin eficaz consta de ms de un detector, no debe haber una zona muerta. (De 3.7) Cuando se aplique la fuerza de accionamiento, el (los) dispositivo(s) conmutador(es) de seal de salida cambiar(n) de un estado activado a un estado desactivado. Permanecer(n) en el estado desactivado durante por lo menos la duracin de la aplicacin de la fuerza de accionamiento. (De 3.8) Se proporcionar el detector con un medio de ubicacin permanente fija. (De 3.10) Se efectuarn medidas en la parte superior del detector para minimizar el deslizamiento en las condiciones de operacin esperadas.

(Del anexo informativo B.1.1) La superficie superior (tapete) debe ser de un material que pueda funcionar segn la carga de operacin.....La superficie no debe presentar peligro de resbalamiento debido al desgaste o los efectos de lquidos.... (Del anexo informativo B.1.7) En alguno casos, las cargas pesadas (tales como montacargas de horquilla) se pueden aplicar al detector (tapete).... Si se requiere hacer esto, el usuario debe informar al fabricante sobre esta necesidad.
Nota: El tapete estndar MatGuard se puede usar sin problemas con montacargas de horquilla. El sistema de tapetes MatGuard se debe instalar segn los requisitos de la norma EN 999, The positioning of protective equipment in respect of approach speeds of parts of the human body.

2-74

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Descripcin general Detalles de aplicacin
Clculos de distancias de seguridad ANSI/RIA R15.06 La distancia mnima calculada es la distancia mnima horizontal desde el bordillo exterior de la zona de deteccin del tapete de deteccin MatGuard hasta el punto ms cercano de la zona de peligro. La frmula para los tapetes de seguridad para el piso es:
Ds = [K x (Ts + Tc + Tr)] + Dpf

Clculos de distancia de seguridad EN999 La distancia mnima calculada es la distancia mnima horizontal desde el borde exterior de la zona de deteccin del tapete de deteccin MatGuard hasta el punto ms cercano de la zona de peligro. La frmula para los tapetes de seguridad para el piso es:
S = [1,600 x (t 1 + t2 )] + (1,200 0,4H)

Ds representa la distancia mnima de seguridad. K representa una constante mnima de velocidad basada en el movimiento de la mano/brazo y la posicin fija del cuerpo humano. K=1,600 mm/s (63 pulg./s) Ts representa el tiempo de paro en el peor de los casos de la mquina/equipo Ts representa el tiempo de paro en el peor de los casos del sistema de control Tr representa el tiempo de respuesta del dispositivo de proteccin Dpf representa el factor de penetracin de profundidad que es el recorrido mximo hacia la zona de peligro dentro del tapete de seguridad que puede ocurrir antes de enviarse una seal de paro. Dpf=1,200 mm (48 pulg.) El tiempo de respuesta de la mquina y sistema de control usado en los clculos debe representar el peor de los casos. Algunas mquinas tienen tiempos de respuesta variables que dependen del modo de operacin, la naturaleza de la pieza de trabajo y el punto del ciclo de operacin en el cual se inicia el paro. Se debe considerar posibilidad del desgaste de los frenos, la temperatura, el envejecimiento de componentes, etc., si pueden afectar el tiempo de respuesta. Pueden ser necesarias demoras adicionales en el sistema de control de la mquina bajo condiciones determinadas. Ejemplo de clculo En este ejemplo, el sistema MatGuard se usa con una mquina y sistema de control con un tiempo de respuesta en el peor de los casos de 0.485 segundo. El sistema se encuentra en una superficie plana; no se encuentra en una plataforma elevada. Segn la frmula anterior,
T = Ts+ Tc+ Tr 0.035 + 0.485 0.520 s S = (63 x 0.520) + 48 80.76 pulg.

S representa la distancia mnima de seguridad en mm en un plano horizontal desde la zona de peligro hasta el borde de deteccin del dispositivo ms alejado de la zona de peligro. 1,600 representa una constante mnima de velocidad basada en el movimiento de la mano/brazo y la posicin fija del cuerpo humano. 1,600 mm/s = 63 pulg./s t1 representa el tiempo mximo entre el accionamiento de la funcin de deteccin y los dispositivos de conmutacin de seal de salida en el estado desactivado. t2 representa el tiempo mximo de respuesta de la mquina, por ej., el tiempo necesario para parar la mquina o eliminar los riesgos despus de recibirse la seal de salida del equipo de proteccin. 1,200 representa el factor de penetracin de profundidad que es el recorrido mximo hacia la zona de peligro dentro del tapete de seguridad que puede ocurrir antes de enviarse una seal de paro. 1,200 mm = 48 pulg. H representa la distancia por encima del plano de referencia, por ej., el piso, en milmetros El tiempo de respuesta de la mquina y sistema de control usado en los clculos debe representar el tiempo en el peor de los casos. Algunas mquinas tienen tiempos de respuesta variables que dependen del modo de operacin, la naturaleza de la pieza de trabajo y el punto del ciclo de operacin en el cual se inicia el paro. Se debe considerar posibilidad del desgaste de los frenos, la temperatura, el envejecimiento de componentes, etc., si pueden afectar el tiempo de respuesta. Pueden ser necesarias demoras adicionales en el sistema de control de la mquina bajo condiciones determinadas. Ejemplo de clculo En este ejemplo, el sistema MatGuard se usa con una mquina y sistema de control con un tiempo de respuesta en el peor de los casos de 0.485 segundo. El sistema se encuentra en una superficie plana; no se encuentra en una plataforma elevada. Segn la frmula anterior,
T = t1 + t2 0.035 + 0.485 0.520 s S = (1600 x 0.520) + 1,200 832 + 1,200 2,032 mm

Se requieren tapetes de deteccin desde 2,032 mm hasta el borde de la placa base de la mquina.

Se requieren tapetes de deteccin desde 2,032 mm hasta el borde de la placa base de la mquina.

2-75

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Especificaciones
Normas EN1760-1, EN954-1, ISO 13849-1, IEC/EN60204-1, ANSI RIA R15.06, ANSI/B11.19, AS4024.5 Dispositivo de Cat. 1 segn EN954-1 Apropiado para sistemas de Cat. 3 Marca CE y cULus 24 VCC, 20 % +10 % proporcionados por la unidad de control 200 m (656 pies) 4.5 m (15 pies) 27 kg (60 lbs) en un disco circular de 80 mm (3.125 pulg.) de dim. 31,034 kPa (4,500 psi) 100 m2 (1,076 pies2 ) 10,000,000 operaciones 25 C a 55 C (13 F a 131 F) 100 % de humedad relativa IP67 (NEMA 6P) 10 a 200 Hz, 5 g 11 ms 10 g /16 ms 10 g IP20, DIN 0470

Categora Certificaciones Voltajes de operacin

Longitud mxima de los cables de conexin Longitud estndar de cable Peso mnimo de deteccin Mxima presin Aplicada al tapete Dimensin mxima de la zona de deteccin Vida til mecnica Temperatura de operacin Humedad Nivel de proteccin del envolvente Vibracin Choque/golpe Aislamiento del terminal Calibre de conductor

Descripcin
El tapete de seguridad MatGuard es un producto de proteccin sensible a la presin diseado para detectar la presencia de personas en la superficie de deteccin. El tapete de seguridad para el piso MatGuard cuenta con dos placas conductoras de acero endurecido separadas por separadores comprimibles no conductoras. Cada tapete para el piso de 4 cables de funcionamiento a 24 VCC est precableado y conectado en serie con otros tapetes para crear un sistema de proteccin a nivel del piso en zonas peligrosas. El circuito a travs del tapete es monitoreado por la unidad de control MatGuard, la cual proporciona una seal al circuito de control de la mquina cuando no hay personas en la zona. Cuando se aplica presin al tapete para el piso, se tocan las placas conductoras y la resistencia en el circuito se baja a cero. La unidad de control monitorea esto y enva una seal de interrupcin a la mquina. Puesto que el tapete de seguridad MatGuard es hermticamente sellado (IP67), no se presentan problemas relacionados con el agua, lquidos y refrigerantes. Adems, el vinilo robusto es resistente a la leja, cidos, sales y muchos elementos qumicos industriales. El proceso de moldeado nico asegura una vida til larga y confiabilidad del tapete.

Cables 0.75 mm2 (18 AWG) de 2 cables Dim. ext. del forro 3.8 mm x 7.4 mm (0.15 pulg. x 0.29 pulg.) Peso Material y color Tapete Amarillo, negro o marrn disponibles con pedido especial de vinilo Plastisol Bordillo Aluminio 6063 Montaje Grosor Superficie plana 16 mm (0.63 pulg.) 10.9 kg/m2 (2.2 lbs/pie2)

Caractersticas
Construccin con placas de acero endurecido No hay zonas muertas Sistema de 4 cables para detectar aperturas y cortocircuitos Puede resistir una presin esttica de 4,500 psi Clasificacin IP67 (NEMA 6P)

2-76

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Seleccin de productosTapetes estndar
Juego de bordillo de permetro estndar Tapete de seguridad milmetros pulgadas Nmero de catlogo 500 x 500 19.7 x 19.7 440F-T1010 440F-M1010BYNN 500 x 1,500 19.7 x 59.1 440F-T1030 440F-M1030BYNN 750 x 500 29.5 x 19.7 440F-T1510 440F-M1510BYNN 750 x 750 29.5 x 29.5 440F-T1515 440F-M1515BYNN 750 x 1,500 29.5 x 59.1 440F-T1530 440F-M1530BYNN 1,000 x 500 39.4 x 19.7 440F-T2010 440F-M2010BYNN 1,000 x 750 39.4 x 29.5 440F-T2015 440F-M2015BYNN 1,000 x 1,000 39.4 x 39.4 440F-T2020 440F-M2020BYNN 1,000 x 1,250 39.4 x 49.2 440F-T2025 440F-M2025BYNN 1,000 x 1,500 39.4 x 59.1 440F-T2030 440F-M2030BYNN 900 x 1,800 35.4 x 70.9 440F-T1836 440F-M1836BYNN Unidad de control recomendada. Para obtener informacin sobre otras unidades de control, 440R-C23139 vea la pgina 2-85 de este catlogo. Tamao de tapete

Ejemplos de configuracin de sistema estndar


Guarda de barrera fija
Bordillo de permetro

Conocimiento de embarque Nmero de catlogo Descripcin 440F-M2030BYNN Tapete 440F-M1010BYNN 440F-M1030BYNN


Bordillo de permetro

Cantidad 1 2 1

Va de acceso a la mquina

Tapete 500 x 500


Bordillo de permetro

440F-T3210
Guarda de barrera fija

Bordillo de permetro Bordillo de permetro Bordillo de unin Controlador Bordillo de esquina

2 1 1 1 4

440F-T3310 440F-T3220 440F-C4000S 440F-T3012

Tapete 1000 x 1500

Mquina (peligro)

Tapete 500 x 1500

Tapete 500 x 500

Bordillo de permetro Guarda de barrera fija

Nmero de catlogo 440F-M2025BYNN


Mquina (peligro)

Descripcin Tapete Bordillo de permetro Bordillo de esquina Bordillo de unin Controlador

Cantidad 1 1 1 1 1 2 1

440F-M1010BYNN 440F-M1510BYNN 440F-T3310 440F-T3012 440F-T3020 440F-C4000P


Bordillo de permetro

Bordillo de permetro

Tapete 750 x 500 Tapete 1000 x 1250 Tapete 500 x 500


Bordillo de permetro

Conexiones elctricas

El cliente debe cortar el bordillo a la longitud apropiada.

2-77

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Seleccin de productosTapetes configurables
Los nmeros de catlogo de los tapetes de seguridad y juegos de bordillos MatGuard pueden configurarse seleccionando los cdigos apropiados de las tablas siguientes. Tapetes: 440F abcdeab M 13 23 A Y NN Juego de bordillos: 440F T 13 23

A 650 mm

B 1150 mm

a
Dimensin A mm (pulgadas) Cdigo Descripcin Longitud del tapete en milmetros/50 Debe ser en incrementos de 50 (1.97) Mnimo permitido 150 (03); Mx. permitido 1,000 (20) La longitud de A debe ser igual o ms corta que B. La mx. longitud de A es 900 (18) cuando B tiene ms de 1,500 (30) por ej., 750 = 15, 1,000 = 20 Cdigo K T

e
Opciones de bordillo Descripcin Bordillo del canal de cable Bordillo estndar

nmero de 2 dgitos

b
Dimensin B mm (pulgadas) Cdigo Descripcin Longitud del tapete en milmetros/50 Debe ser en incrementos de 50 (1.97) Mnimo permitido 200 (04); Mx. permitido 1,800 (36) La longitud de A debe ser igual o ms corta que B. La mx. longitud de A es 900 (18) cuando B tiene ms de 1,500 (30) por ej., 750 = 15, 1,500 = 30

nmero de 2 dgitos

Haga el pedido del controlador por separado. Vea la pgina 2-85 para obtener detalles sobre la Seleccin.

c
Cdigo A B C D F Salida de cable Descripcin Dos cables de 2 hilos de 4.5 m (15 pies)salida por las esquinas A Dos cables de 2 hilos de 4.5 m (15 pies)salida por las esquinas B Un cable de 4 hilos de 9.1 m (30 pies) con conector M12salida por esquina superior izquierda Un cable de 4 hilos de 9.1 m (30 pies) sin conector salida por esquina superior izquierda Un cable de 4 hilos de 0.76 m (2.5 pies) con conector M12 salida por la esquina superior derecha

d
Cdigo B Y Colores Descripcin Negro Amarillo

2-78

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Seleccin de productos, opciones de bordillo
Tipo Descripcin Dimensiones aproximadas. Extremos cuadrados Longitud de 2 m Nmero de catlogo 440F-T3210

Bordillo de permetro estndar Aluminio Para uso con hasta 3 cables en el canal

Extremos cuadrados Longitud de 3 m

440F-T3310

Bordillo estndar de permetro de esquina externa Aluminio

pgina 2-82

440F-T3012

Bordillo estndar de permetro de esquina interna Aluminio

pgina 2-82

440F-T3013

Bordillo de permetro con canal de cable Aluminio Se usa cuando es necesario pasar hasta 8 cables a travs del canal

Extremos cuadrados Longitud de 2 m

440F-T3211

Extremos cuadrados Longitud de 4 m

440F-T3411

Bordillo de permetro de esquina externa con canal de cable Aluminio

pgina 2-83

440F-T3014

Bordillo de permetro de esquina interna con canal de cable

pgina 2-83

440F-T3015

Extremo biselado, longitudes personalizadas disponibles. Comunquese con la fbrica.

2-79

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Accesorios
Tipo Descripcin Dimensionesmm (pulgadas) 13 x 25 x 2m ( x 1 x 6.6 pies) ngulo recto de aluminio Bordillo de permetro 13 x 25 x 3m ( x 1 x 9.8 pies) 440F-T3316 Nmero de catlogo 440F-T3216

10 (0.39)

Bordillo de permetro, clip angular de acero inoxidable 5 por paquete


7 (0.28)

5,5 (0.22)

45 (1.8)

440F-T102933

20 (0.79)

14,2 (0.56)

20 (0.79) 7 (0.28) 10 (0.39)

45(1.78)

Bordillo de permetro, clip Z de acero inoxidable 5 por paquete

440F-T102935

5,5 (0.22)

Extremos cuadrados de 1 m (3.28 pies) de longitud Bordillo de unin activa Se usa para unir dos tapetes a fin de eliminar zonas muertas Extremos cuadrados de 2 m (6.5 pies) de longitud Extremos cuadrados de 3 m (9.8 pies) de longitud

440F-T3120 440F-T3220

440F-T3320

Gua de cable de vinilo

63.5 (2.5) de ancho 2 m (6.6 pies) de longitud

440F-A3230

Juego de accesorios para 440F-C4000S y 440F-C4000P 4 empalmes a tope, 2 fusibles de 500 mA, 1 bombilla de restablecimiento, 4 terminaciones de cable

N/A

440F-A108433

12 tornillos Phillips de acero inoxidable de cabeza plana para bordillos de canal 440FA-3211 y 440F-T3411 Fija la parte superior a la inferior.

#6 x 9.5 (3/8)

440F-A17143

2-80

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Accesorios (continuacin)
Tipo Descripcin 12 tornillos Phillips de acero inoxidable, de cabeza plana con anclajes para bordillo 440F-T3210,440F-T3310 y 440F-T3510 Dimensionesmm (pulgadas) Nmero de catlogo

#10 x 32 (1.25)

440F-A17141

12 tornillos de acero inoxidable de cabeza plana con anclajes para bordillo de canal 440F-T3211 y 440F-T3411

#10 x 32 (1.25)

440F-A17142

1 4

2 3

Conjunto de cables M12 de 4 pines, hembra, recto 22 AWG 300 V 3 A Forro de PVC amarillo, sobremoldeado de PUR 1 Marrn 2 Blanco 3 Azul 4 Negro

2 m (6.5 pies) 5 m (16.4 pies) 10 m (32.8) 15 m (49.2 pies) 20 m (65.6) 30 m (98.4 pies)

889D-F4AC-2 889D-F4AC-5 889D-F4AC-10 889D-F4AC-15 889D-F4AC-20 889D-F4AC-30

2-81

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin. Sistema de tapetes para el piso Cuando sea necesario ms de un tapete para el piso para proteger una zona, use las dimensiones siguientes para determinar las dimensiones de la superficie cubierta.

Bordillo de unin activo POR FAVOR PROPORCIONE UN ESQUEMA EN CASO DE REQUERIR VARIOS TAPETES
Cuando calcule el esquema del rea total, sume X, Y y Z para incluir el bordillo y las juntas del permetro.

Al aplicarse presin, el bordillo de unin causa la deflexin del tapete y su cambio de estado, proporcionando sensibilidad general incluso en las juntas.

(Y) Aada 10 mm (0.4 pulg.) para la junta (Z) Aada 52 mm (2.0 pulg.) para bordillo de permetro estndar o 99.5 mm (3.9 pulg.) para bordillo de canal. (X) Dim A o B (X) Dim A o B

(Z) Aada 52 mm (2.0 pulg.) para bordillo de permetro estndar o 99.5 mm (3.9 pulg.) para bordillo de canal.

Dimensin general

IMPORTANTE: Use los clculos de distancia que se muestran en la pgina 2-75 para asegurar la cobertura adecuada alrededor de la zona peligrosa.

Bordillo de permetro estndar


Esquinas internas y externas
43 (1.7) 52 (2.0) 14 (0.55) 43 (1.7) 96 (3.8) 52 (2.0) 11 (0.43)

Dimensiones del canal

14 (0.55)

El bordillo de permetro estndar acepta tres cables de tapete de 2 hilos estndar o 2 cables de 4 hilos. Se necesita la equivalencia de dos cables al conectar dos tapetes en serie.

96 (3.8)

2-82

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Tapetes MatGuard Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin. Bordillo de permetro con canal de cable
Esquinas internas y externas Dimensiones del canal 44.5 (1.8) 44.5 (1.8) 99.5 (3.9) 14 (0.55) 9.2 (0.36)

42.2 (1.66)

144 (5.7) 99.5 (3.9)

El bordillo del canal de cable acepta hasta 8 cables estndar de 2 hilos o 7 cables estndar de 4 hilos, hasta en casos de encaminamiento alrededor de las esquinas.

144 (5.7)

Diagramas de cableado tpicos


Opcin de cable de 2 hilos
Forro exterior negro

Aislamiento blanco

Aislamiento negro Aislamiento negro Diseo a cuadros

Aislamiento negro

Aislamiento blanco

Diseo recto

Aislamiento blanco

Opcin de conector M12 micro de 4 pines


Lado con acanalado cuadrado del tapete 43 (1.70)

14 (0.56)

Recto macho
Lado con acanalado recto del tapete

2-83

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Controladores MatGuard Especificaciones
Normas EN1760-1, EN 954-1, ISO13849-1, IEC/ EN60204-1, ANSI RIA R15.06, ANSI B11.19, AS 4024.5 Cat. 3 segn EN954-1 Marca CE, cULus y TUV 24 VCA/CC 110/230 VCA 6 W, 9 VA Demora de tiempo de 2 a 500 mA, (4000S, 4000P) Demora de tiempo de 1 a 500 mA, (4000D) Accin rpida de 5 A 2 N.A. 1 N.C. Manual monitoreado o Automtico/manual 500 2 N.A. Seguridad 1 N.C. Auxiliar A300, CA-15, 4 A/250 VCA P300, CC-13, 2 A/30 VCC 10 mA a 10 V 35 ms Verde Verde Verde Verde Alimentacin elctrica Modo restabl. auto. Modo restabl. manual Mquina habilitada

Categora Certificaciones Voltajes de operacin Consumo de energa Fusible Entrada (interna, de repuesto) Salida (externa)

Entradas: Monitoreo del contactor del tapete de seguridad

Descripcin
La unidad de control MatGuard monitorea todos los tapetes para el piso conectados para crear una zona de seguridad. La zona de seguridad puede comprender hasta 100 mm2 y puede consistir en cualquier cantidad de tapetes para el piso. El controlador est diseado para interconectarse con el circuito de control de la mquina e incluye dos rels de seguridad para asegurar la redundancia de control. El controlador detecta una presencia en el tapete, un cortocircuito o circuito abierto. En cada una de estas condiciones, los rels de salida de seguridad se desactivan. Cuando se interconectan correctamente, la mquina o movimiento peligroso recibirn una seal de paro y se activa un rel de salida auxiliar. El controlador se ofrece en dos estilos diferentes de paquete: una caja de plstico para el montaje en superficies planas o paredes y una caja de acero para el montaje en superficies planas o paredes. Cada estilo ofrece muchas de las mismas caractersticas bsicas. Cada controlador acepta fuentes de alimentacin elctrica de 24 VCA/CC y 110/120 VCA. Los estilos de caja de plstico y caja de acero incluyen botones de restablecimiento. El controlador con caja de acero ofrece proteccin adicional contra los impactos accidentales. Para encontrar alternativas, vea la tabla Seleccin de productos para obtener informacin sobre rels de seguridad que tambin pueden controlar y monitorear tapetes de seguridad.

Restablecimiento Impedancia de entrada Salidas: Seguridad Auxiliar

Capacidad nominal de salida Capacidad mnima de conmutacin Tiempo de respuesta Tapete presionado a salida abierta Indicadores LED

Interruptores selectores internos Dimensin mxima de la zona de deteccin Vida til mecnica Temperatura de operacin Nivel de contaminacin Humedad Proteccin de envolvente: 4000P 4000S Proteccin del terminal Calibre mx. de conductor: 4000P, 4000S Peso: 4000P 4000S Vida til elctrica 220 VCA/4A/880 VA cos=0.35 220 VCA/1.7A/375 VA cos=0.6 30 VCC/2 A/60 W 10 VCC/0.01 A/0.1 W Material Vibracin

Restablecimiento automtico/manual; 110/230 VCA 100 m2 (1076 pies2) 10,000,000 operaciones 25 C a 45 C (-13 F a 113 F) III 90 % de humedad relativa IP65 (NEMA 13) IP62 (NEMA 12) IP20, DIN 0470 1 x 1.5 mm2 (16 AWG) 880 g (1.94 lbs) 3,200 g (7.05 lbs) 100,000 operaciones 500,000 operaciones 1,000,000 operaciones 2,000,000 operaciones Policarbonato o acero 0.15 mm, 1055 Hz

Caractersticas
Suministro de voltaje seleccionable Restablecimiento automtico/manual Sistema de cuatro cables para detectar aberturas y cortocircuitos Aprobacin de otras entidades AMTRI, TUV

Tipos de aplicacin

2-84

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Controladores MatGuard Seleccin de productos
Estilo de envolvente Montaje Material Policarbonato 24 VCA/CC, 110/230 VCA Montaje en superficie (pared) Caja de acero 440F-C4000S Pgina Nmero de catlogo 440F-C4000P

24 VCA/CC, envolvente de 22.5 mm, riel DIN de 35 mm 110 VCA, envolvente de 45 mm, riel DIN de 35 mm MSR23M 24 VCA/CC, envolvente de 55 mm, riel DIN de 35 mm 115 VCA, envolvente de 55 mm, riel DIN de 35 mm 230 VCA, envolvente de 55 mm, riel DIN de 35 mm 24 VCA/CC, envolvente de 45 mm, riel DIN de 35 mm 110 VCA, envolvente de 45 mm, riel DIN de 35 mm 230 VCA, envolvente de 45 mm, riel DIN de 35 mm 24 VCC, envolvente de 45 mm, riel DIN de 35 mm 4-40 4-30 4-24

440R-P23073

440R-P23074

440R-J23102

440R-J23100

MSR121RT

440R-J23099

440R-C23139

440R-C23137

MSR131RTP

440R-C23136

MSR210P

4-72

440R-H23176

Envolvente de 17.5 mm Riel DIN de 35 mml MSR210P/MSR220P

MSR220P

4-76

440R-H23178

24 VCC, envolvente de 22.5 mm Riel DIN de 35 mm Salidas de seguridad de estado slido MSR30RTP

4-26

440R-N23198

Accesorios
Descripcin Fusible de 500 mA Juego de repuesto Pgina 14-6 2-85 Nmero de catlogo 440R-A31562 440F-A108433

2-85

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Controladores MatGuard Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
107 (4.21) 10 (0.39)

157 (6.18)

175 (6.89)

4 x M4 Orificios de

11 (0.43)

125 (4.92)

75 (2.95)

440F-C4000P

230 (9.1)

165 (6.5)

11 (0.43)

33 (1.3) 210 (8.3) 225 (8.9) 143 (5.6)

5.8 x 7.6 (0.23 x 0.30)

440F-C4000S

Diagramas de bloques
A1 A2 +Ve NO MC MC PB 13 23 31

F1 110/ 230

F2 24VDC Auto K4 SW1

K5

K1

K6 K6 K3 K2

K3 K2 Enabled K5

K4

K2

K3

K3

K4

K3 Man Power K1 K6 K4 K2

K3 Logic

K4

K5 K4

-Ve

IND

14

24

32

2-86

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad
Controladores MatGuard Diagramas de cableado tpicos
230 VCA Tapete de seguridad +24 VCC Restablecimiento con bombilla
L1 L2 L3
L
+ve 1 2 3 4 N/O PB R IND 13 23 31
K1 K2 L1 L2 L3

M A Interruptores 110 internos 230


N
-ve

Tapete de A1 S11 S52 S12 X5 Y31 13 23 33 41 seguridad MSR121S


PE A2 S21 S22 S34 S33 Y32 14 24

440F-C4000S 440F-C4000P
MC MC 14 24 32
K1 K2

K1 K2

34 42

Tierra

Salida auxiliar

M
Tierra Restablecimiento

K1 K2

Tapete de seguridad, restablecimiento manual monitoreado, salida de dos canales, salida monitoreada
+24 VCC Tapete de seguridad

Tapete de seguridad Restablecimiento manual monitoreado, salida monitoreada


+24 VCC Restablecimiento
S11 S21 A1 S34 Y41 Y2 L1 L2 L3

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51

L1 L2 L3

MSR30RT/RTP MSR131RTP
K1 K2

K1

K2 S12 S22 A2 14 24 Y32

A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52


K1 K2

M
Tierra

K1 K2

Tierra

Salida activa

Entradas cerradas

Aux a PLC o indicador

Tapete de seguridad, restablecimiento automtico, sin monitoreo de salida


+24 VCC Tapete de seguridad Tapete de seguridad Terminacin o cable de expansin

Tapete de seguridad, salida de dos canales monitoreada, restablecimiento manual, monitoreo de salida

Fusibles

Terminacin o cable de expansin

L1 L2 L3

S12 S22 S32


MSR 220P

A1 S11 S32 S41 S12 S22 S51


MSR210P

Y31 Y40 Y41 Y42 13 23 31

K1 K2

S42 S52 S62

A2 S21 S31 S42 S52 S62 Y30 Y32 Y33 S34 Y1 Y2 14 24 32


K1 K2

Restablecimiento

Tierra

Salida activa

Entradas cerradas

Cuatro tapetes de seguridad monitoreados individualmente, restablecimiento manual monitoreado, dos salidas, monitoreo de salida

2-87

Dispositivos de seguridad para deteccin de presencia

Tapetes de seguridad

Administrador de tapetes MatGuard Especificaciones


Normas EN1760-1, EN 954-1, ISO13849-1, IEC/ EN60204-1, ANSI RIA R15.06, ANSI B11.19, AS 4024.5 Cat. 3 segn EN954-1 Marca CE 24 VCA/CC, 110/230 VCA 0.8 a 1.1 x voltaje nominal, 50/60 Hz 13 W o 13 VA 500 mA interna (2) 6 A accin lenta o 10 A accin rpida 8 tapetes de seguridad de 4 cables con conector micro 100 ohms Manual monitoreado o Auto./Man. Panel frontal o remoto mediante terminales 2 N.A. Seguridad;1 N.C. Auxiliar B300, CA-15, 2 A/250 VCA N300, CC-13, 2 A/24 VCC 10 mA/10 V 35 ms Verde Verde Verde Verde Verde Verde-rojo (Bicolor) Rojo Desactivado 2,500 V 2 25 C a +45 C (13 F a 113 F) IP65 (NEMA 13), acero con placa frontal de policarbonato 0.22.5 mm2 (24-14 AWG) 0.4 Nm (3.54 lbpulg.) Montaje en superficie (pared) 3,160 g (7 lbs) 100,000 operaciones 500,000 operaciones 1,000,000 operaciones 2,000,000 operaciones 2,000,000 operaciones 10-55 Hz, 0.15 mm 10 g, 11 ms semisinusoide

Categora Certificaciones Fuente de alimentacin elctrica Consumo de energa Fusibles Entrada Salida (externa) Entradas de seguridad Resistencia de entrada mx.

Descripcin
El Administrador de tapetes de seguridad est diseado para monitorear varios tapetes de seguridad, cada uno con su propia conexin. El Administrador de tapetes de seguridad acepta hasta 8 tapetes individuales con conectores micro de 4 pines. El Administrador de tapetes de seguridad proporciona una indicacin de estado LED para cada conexin de tapete. Puesto que los indicadores LED indican si el tapete tiene condicin de cortocircuito o abierto, la resolucin de problemas y el reemplazo de un tapete daado en un sistema de tapetes es mucho ms rpida comparado con el sistema de tapetes tradicional donde varios tapetes se cablean en serie. Un interruptor interno permite realizar el ajuste de restablecimiento a automtico/manual o manual monitoreado. Cuando se establece en automtico/manual, el circuito de restablecimiento puede conectarse en puente, conectarse a contactos auxiliares o conectarse a un restablecimiento manual no monitoreado aadiendo un interruptor normalmente abierto momentneo en el lazo de monitoreo. Cuando se establece en manual monitoreado, el circuito de monitoreo debe cerrarse y luego abrirse para que se activen las salidas. Cuando una persona se para sobre cualquiera de los tapetes, se desactivan las salidas de seguridad. Las salidas incluyen 2 salidas de seguridad normalmente abiertas usadas para desactivar la mquina y 1 salida auxiliar normalmente cerrada para indicar el estado del Administrador de tapetes. Las salidas de seguridad cuentan con contactos internos independientes y redundantes que aseguran la funcin de seguridad.

Restablecimiento Seleccionable mediante interruptor interno Botn Salidas Capacidad nominal de salida Mn. corriente/voltaje conmutado Tiempo de respuesta Indicadores LED, Alimentacin elctrica Mquina habilitada Modo de restablecimiento automtico Modo de restablecimiento manual Indicadores LED de estado de los tapetes Condicin de marcha Condicin de paro Clavija cortocircuitadora ausente No se usa Voltaje de resistencia de impulso Grado de contaminacin Temperatura de operacin Proteccin del envolvente Tamao mx. de conductor Ajustes de par/tornillos terminales Montaje Peso Vida til elctrica 220 VCA/4A/880 VA cos=0.35 220 VCA/1.7A/375 VA cos=0.6 30 VCC/2 A/60 W 10 VCC/0.01 A/0.1 W Vida til mecnica

Caractersticas
Acepta hasta 8 alfombras individuales 2 contactos de salida de seguridad 1 contacto de salida auxiliar Restablecimiento automtico/manual o manual monitoreado

Vibracin Choque

2-88

Dispositivos de seguridad para deteccin de presencia Administrador de tapetes MatGuard Seleccin de productos
Entradas Hasta 8 tapetes de 4 hilos con conectores M12 Salidas de seguridad 2 N.A. Salidas auxiliares 2 N.C. 1 N.A. Fuente de alimentacin elctrica 24 VCA/CC, 110/230 VCA Nmero de catlogo 440F-C28013

Tapetes de seguridad

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.

230 (9.1)

135 (6.5) 33 (1.3) 18 (0.7) 143 (5.6)

11 (0.43)

5.8 x 7.6 (0.23 x 0.30)

210 (8.3) 225 (8.9)

Diagramas de cableado tpicos


110 VCA, 230 VCA Conexin de suministro Suministro de +24 VCC

L1
Fusibles

L2

L3

+Ve

13

23

31

MC

Hasta 8 tapetes detectores MatGuard con conectores micro de 4 pines


5

K1

Unidad de control de administrador de tapetes 440F-C28013


6 7 8 N -Ve N/O PB R IND 14 24 32 MC

K2

K2
Tierra del suministro Tierra PE Restablecimiento e K1 indicador

Salida auxiliar

Proteccin de motor, por ej., Salida de corte trmico

Sistema de tapete de seguridad, restablecimiento manual monitoreado, salida de dos canales, monitoreo de salida

Accesorios
Descripcin Dimensiones aproximadasmm (pulgadas)
A la unidad de control de tapetes 24 agujeros de montaje para tornillos #10
1

Cableado
4 3 4 3 2 1 2 1
Tapete de seguridad

Nmero de catlogo

20 (0.78)

38 (1.5)

25 (1)

Cable en Y

Conector A

897D-F4ACDM-B0M3
4 3 2 1
Tapete de seguridad

0.3 m (1 pie)
1

43 (1.7)

Conector B

2-89

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Descripcin general Componentes del sistema
Los sistemas de bordes sensibles Safedge se usan en una variedad de aplicaciones donde el borde de un objeto debe detectarse por contacto. El sistema Safedge consta de tres partes: 1) un riel c, usado para montar el perfil; 2) un perfil, que contiene la superficie de deteccin; y 3) una unidad de control que verifica la operacin del perfil y hace interface con el sistema de control. A continuacin se muestra un sistema tpico.

Superficie de deteccin
El perfil se activa mejor a lo largo de su superficie de deteccin. La superficie de deteccin del sistema Safedge est activa a lo largo de casi toda la longitud del borde. Hay una tramo de 10 milmetros al comienzo y al final que no estn activos.
Superficie de deteccin Unidad de control Riel C ngulo de deteccin

+ Perfil Longitud de deteccin

Una gran ventaja del sistema Safedge es sus esquinas activas. La presin aplicada en las esquinas es detectada por la unidad de control.
GE SAFED OP

Esquinas activas Unidad de control

ST FA UL T RU N

tem ac/dc ng Sys 0r 24V 529 Monitori ctor) 50Hz Cross t to IEC sele Fully ac (see resi stan N/O,C, N/C 2A 240/120V t & Imp act 250V Voltage t tigh Contacts Supply oof , Dus N/O Aux 12V dc 2A Hos epr 250V Volt age IP65 Stri p Contacts Safe dge Safety

Principio de operacin
El perfil funciona con el principio de un diseo de dos hilos con goma conductora. Hay dos cables a todo lo largo del perfil. Los cables estn terminados con una resistencia conocida. Cuando el perfil se deforma, las gomas conductoras entran en contacto entre s y causan que caiga la resistencia total.
La presin requerida es 10 Newtons (2.25 lbs) cuando se aplica en esta direccin Goma conductora

Ncleos de cable flexible

Relacin de desplazamiento de fuerza


Puesto que el sistema Safedge es un dispositivo de contacto, se requiere fuerza para que el dispositivo funcione. Esta fuerza depende de la forma del objeto que aplica la fuerza, la velocidad del objeto y la distancia de deformacin en el perfil. Para ayudar a entender los requisitos de fuerza, la norma europea EN1760-1 proporciona tres objetos de prueba que se desplazan a dos velocidades. En el grfico siguiente se muestra la fuerza aplicada sobre la distancia de deformacin en la superficie del perfil. Observe que la fuerza requerida para que funcionen las esquinas es mayor que la fuerza requerida a lo largo de la seccin recta del perfil. Esta fuerza debe usarse como pauta, ya que el objeto inanimado no puede daarse.

Goma conductora

La unidad de control proporciona una fuente de voltaje a los cables en el perfil. Constantemente verifica la continuidad de los cables para determinar la presencia de cortocircuitos, condicin abierta y cambios en la resistencia. Si el circuito se abre, si existe un cortocircuito, o la resistencia cambia, la salida de la unidad de control se desactiva. La unidad de control tambin puede usarse para monitorear el rendimiento de los dispositivos de conmutacin de salida.

2-90

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Descripcin general
300 250 200
Fuerza (N)

Evaluacin de riesgos
Debe llevarse a cabo una evaluacin de riesgos para determinar el uso correcto del sistema de bordes. Debern utilizarse medidas de proteccin adicionales cuando una persona pueda aproximarse alrededor o sobre el sistema de bordes y obtener acceso a un rea peligrosa. El sistema de bordes est diseado para ser un sistema tipo contacto. Por lo tanto, el factor de compresin es una consideracin importante.

150 100 50 0 0.0 2.0 (0.08) 3.6 (0.14) 5.5 (0.22) 7.2 (0.28) 8.7 (0.34)

Seleccin del factor de compresin


Una de las caractersticas importantes de los sistemas de bordes es el factor de compresin. El factor de compresin es la distancia que se puede presionar el perfil despus de generarse la seal. Esto es importante cuando el perfil est montado en puertas automatizadas. Las puertas automatizadas continuarn cerrndose por un tiempo finito despus que el perfil enva la seal de paro inicial. Esto se conoce como el tiempo de respuesta del sistema. El tiempo de respuesta del sistema es la suma del tiempo de respuesta de la unidad de control Safedge, el tiempo de respuesta del sistema de control y el tiempo de paro mecnico. Los sistemas con un tiempo de respuesta ms largo deben utilizar un mayor factor de compresin. Los usuarios deben validar que una lesin no ocurrir si partes del cuerpo quedan atrapadas, por ejemplo entre el borde de deteccin y la parte fija de una mquina.
3.9 (0.15) 5.4 (0.21) 7.4 (0.29) 8.8 (0.35)

Vp = 10 mm/s Fuerza vs. Distancia

Distanciamm (pulgadas)

300 250 200


Fuerza (N)

150 100 50 0 0.0 1.9 (0.07)

Vp = 100 mm/s

Distanciamm (pulgadas)

Los usuarios tambin pueden considerar una opcin de inversin. Cuando se presiona el perfil, la unidad de control Safedge emite una seal a un rel de inversin. Puesto que el rel de inversin no es un dispositivo de seguridad, el usuario debe confirmar que no ocurrir una lesin si quedan atrapadas partes del cuerpo.

2-91

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Descripcin general Aplicaciones tpicas
Las aplicaciones tpicas para los sistemas de bordes sensibles son: Puertas deslizables Compuertas deslizables Vehculos autoguiados Tablas X-Y Parte superior de cercas Gatos de tijera Plataformas de carga

El perfil se monta sobre el borde delantero del objeto mvil. A medida que el perfil entra en contacto con un objeto, la superficie de deteccin del perfil se deforma. La deformacin causa que las partes de goma conductora hagan contacto y reduce la resistencia del circuito. El control hace contacto. Normalmente, el borde del objeto es el borde delantero y es mvil, tal como una puerta o compuerta deslizante. Los sistemas de bordes tambin se utilizan en los bordes delanteros de tablas X-Y y vehculos autoguiados. En algunas aplicaciones, se necesita un borde o sello contra fuga para reducir el viento y la fuga de la lluvia que entra por una puerta. El sistema Safedge es adecuado para ambos tipos de aplicaciones. El sistema Safedge tiene tres perfiles que incluyen un borde de sellado.

Safedge tambin puede pedirse con cubierta de goma, tal como se muestra a continuacin. Esto permite la compresin del protector de goma sin deformar el perfil.

Riel C

Deteccin

Protector de goma

2-92

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Descripcin general Terminacin de cable
El cable puede terminarse mediante una de cuatro maneras, lo cual proporciona flexibilidad de diseo e instalacin del encaminamiento del cable. Especifique la terminacin izquierda o derecha desde el punto de vista mirando directamente al extremo de los perfiles, tal como se muestra a continuacin.
SETRecto UNDERBajo Conexiones de terminaciones de cable Conexin en serie Conexin en serie Si se usa ms de un perfil, normalmente estos se conectan en serie tal como se muestra.
SAFEDGE
E V A L U A T O R

STOP OPEN RUN

Fully Cross Monitored Safety Control System Supply Voltage 240/120Vac (see selector) 50-60Hz 0r 24Vac/dc IP65 Hoseproof, Dust tight & Impact resistant to IEC 529 Safety Contacts 250V 2A N/O Aux Contacts 250V 2A C/O Safedge Strip Voltage 6Vdc

Usa resistencia de 6 K (amarillo)

Conexin en paralelo

SAFEDGE
E V A L U A T O R

LHTIzquierdo

RHTDerecho

Usa resistencia de 15 K (azul)

STOP OPEN RUN

Fully Cross Monitored Safety Control System Supply Voltage 240/120Vac (see selector) 50-60Hz 0r 24Vac/dc IP65 Hoseproof, Dust tight & Impact resistant to IEC 529 Safety Contacts 250V 2A N/O Aux Contacts 250V 2A C/O Safedge Strip Voltage 6Vdc

Se puede conectar un mximo de dos perfiles en paralelo.

Mtodos de conexin
Los perfiles pueden conectarse de una de las dos maneras siguientes: en serie o en paralelo. Cualquiera de los dos mtodos proporciona el mismo rendimiento. La seleccin del mtodo es determinada por la facilidad de instalacin. El mtodo ms popular es el mtodo en serie.

2-93

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Especificaciones
Normas EN1760-2, EN 954-1, ISO13849-1, IEC/EN60204-1, ANSI B11.19, AS 4024.5 Marca CE, cULus y T V, c-tick no se requiere Funciona con 4 VCC proporcionados por la unidad de control

Certificaciones Fuente de alimentacin elctrica

Temperatura de operacin Material EPDM 5 C a +55 C (23 F a 131 F) Material NBR/CR 0 C a + 55 C (32 F a 131 F) Humedad Proteccin del envolvente Calibre de conductor Materiales EPDM Goma modificada de dieno propileno de etileno NBR/CR Goma de butadieno de acrilonitrilo (nitrilo al 34 %)/goma de cloroprieno Montaje Peso Cualquier posicin usando el tipo de riel C C112 Vea la informacin de pedidos 90 % de humedad relativa IP67 (NEMA 6P) (18 AWG)

Descripcin
El diseo innovador del perfil Safedge permite que este producto sobrepase el rendimiento de los productos de otros fabricantes. Utiliza una combinacin de caucho no conductor y caucho conductor de ncleo de cable flexible unidos para que mantengan su forma aun despus de compresiones repetidas. Los perfiles Safedge se ofrecen con 3 factores de compresin diferentes: 5 mm (0.2 pulg.), 19 mm (0.75 pulg.) y 41 mm (1.6 pulg.). El factor de compresin significa la distancia que se puede presionar despus de generarse una seal. Los perfiles tambin se ofrece con un borde sellador diseado para reducir las corrientes de aire entre el perfil y la superficie opuesta. Los perfiles se fabrican con dos materiales diferentes. Use el material EPDM donde existen fluidos conductivos. El material NBR/CR es ms apto donde existen aceites. Repase la tabla de resistencia a productos qumicos para hacer la seleccin de material ms apropiada. En casos de duda, se debe probar la resistencia al producto qumico de una porcin pequea del perfil antes de hacer una seleccin final. El perfil Safedge no cuenta con piezas internas rgidas que pueden romper la superficie o causar fallos de fatiga debido al uso prolongado. El ncleo de cable de cobre de mltiples hilos presente por toda la longitud de la tira asegura que no hay problemas de acumulacin de resistencia en tramos largos.

Resistencia a productos qumicos del perfil Safedge


Resistencia S Perfil EPDM Buena Buena Buena Insatisfactoria Insatisfactoria Buena Buena Insatisfactoria Buena Insatisfactoria Buena Buena Buena Buena Buena Buena Resistencia Perfil N NBR/CR Buena Regular Buena Insatisfactoria Buena Buena Buena Buena Regular Regular Buena Buena Insatisfactoria Buena Buena Buena

Substancia Acido actico (10 %) Acetona Hidrxido de amonio (35 %) Benceno Aceite diesel Alcohol de etilo (etanol) Acido hidroclrico (10 %) Aceite lubricante Acido ntrico (10 %) Gasolina Fluidos de silicona Cloruro de sodio (25 %) Etileno de tricloruro Aceites vegetales (generales) Agua (destilada) Agua (salada)

Caractersticas
Diversos perfiles Tecnologa de goma conductora Longitudes de hasta 50 m Rieles de montaje de aluminio, plstico o acero con revestimiento de zinc Protector de goma opcional Esquinas activas Borde sellador disponible

2-94

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productosPerfiles
Cdigo (pgina 2-100) Factor de compresin Longitud m (pies) 5 (16.4) 0110S Negro, EPDM, Peso: 463 g/m (0.33 lbs/pies) 5 mm 10 (32.8) 20 (65.6)
28.5 (1.12)

Dimensiones
28.5 (1.12)

Perfil

Descripcin

Nmero de catlogo 440F-E0110S05 440F-E0110S10 440F-E0110S20 440F-E0110N05 440F-E0110N10 440F-E0110N20 440F-E0110R05 440F-E0110R10 440F-E0110R20 440F-E1610S05 440F-E1610S10 440F-E1610S20 440F-E1610N05 440F-E1610N10 440F-E1610N20 440F-E0310S05 440F-E0310S10 440F-E0310S20 440F-E0510S05 440F-E0510S10 440F-E0510S20 440F-E0804S05 440F-E0804S10 440F-E0804S20

24.5 (0.96)

5 (16.4) 0110N Negro, NBR/CR, Peso: 460 g/m (0.31 lbs/pies) 5 mm 10 (32.8) 20 (65.6)

24.5 (0.96)

28.5 (1.12)

5 (16.4) 0110R Rojo, EPDM, Peso: 502 g/m (0.34 lbs/pies) 5 mm 10 (32.8) 20 (65.6)

24.5 (0.96)
28.5 (1.12)

5 (16.4) 1610S Negro, EPDM, Peso: 843 g/m (0.57 lbs/pies) 19 mm 10 (32.8) 20 (65.6) 5 (16.4) 1610N Negro, NBR/CR, Peso: 837 g/m (0.56 lbs/pies) 19 mm 10 (32.8) 20 (65.6)

43 (1.69) 43 (1.69)

14 (0.55) 28.5 (1.12)

14 (0.55)

30 (1.18) 68 (2.68) 36 (1.42)

5 (16.4) 0310S Negro, EPDM, Peso: 1209 g/m (0.81 lbs/pies) 41 mm 10 (32.8) 20 (65.6)

28.5 (1.12)

5 (16.4) 0510S Negro, EPDM con borde sellador Peso: 545 g/m (0.37 lbs/pies) 5 mm 10 (32.8) 20 (65.6) 5 (16.4) 0804S Negro, EPDM con borde sellador Peso: 1013 g/m (0.68 lbs/pies) 19 mm 10 (32.8) 20 (65.6)

D, J

24.5 (0.96) 28-30 (1.10-1.18) 25 (0.98)

14 (0.55)

G, K

43 (1.69) 17 (0.67)

2-95

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productosPerfiles
Cdigo (pgina 2-100) Factor de compresin Longitud m (pies) 5 (16.4) I, L 0210S Negro, EPDM con borde sellador Peso: 1291 g/m (0.87 lbs/pies)
68 (2.68) 36 (1.42)

Dimensiones
30 (1.18)

Perfil

Descripcin

Nmero de catlogo 440F-E0210S05 440F-E0210S10 440F-E0210S20 440F-E0118S05 440F-E0118S10 440F-E0118S20 440F-E1111S05 440F-E1111S10 440F-E1111S20

41 mm (1.61 pulg.)

10 (32.8) 20 (65.6) 5 (16.4)

29 (1.14)

16 (0.63)

0118S
18 (0.71)

Negro, EPDM, Peso: 242 g/m (0.163 lbs/pies)

3.75 mm (0.15 pulg.)

10 (32.8) 20 (65.6) 5 (16.4)

N, O

1111S

Negro, EPDM, Peso: 680 g/m (0.457 lbs/pies)

NA

10 (32.8) 20 (65.6)

2-96

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productosRieles C
Cdigo Dimensinmm (pulgadas)
10 (0.39) 25 (0.98) 10 (0.39) 25 (0.98) 10 (0.39) 25 (0.98) 10 (0.39) 25 (0.98) 10 (0.39) 25 (0.98) 25 (0.98)

Descripcin Tipo aluminio; Tipo C112/A Apropiado para todos los perfiles. 3 m (9.8 pies) de longitud Peso: 258 g/m (0.17 lbs/pies) Acero revestido de zinc; Tipo C112/S Apropiado para todos los perfiles 2 m (6.5 pies) de longitud Peso: 663 g/m (0.45 lbs/pies) PVC negro; Tipo C112/PB Apropiado para todos los perfiles 3 m (9.8 pies) de longitud Peso: 111 g/m (0.07 lbs/pies) PVC rojo; Tipo C112/PR Apropiado para todos los perfiles 3 m (9.8 pies) de longitud Peso: 111 g/m (0.07 lbs/pies) PVC amarillo; Tipo C112/PY Apropiado para todos los perfiles 3 m (9.8 pies) de longitud Peso: 111 g/m (0.07 lbs/pies) Borde de aluminio vertical; Tipo C112/A2 Apropiado para todos los perfiles 2 m (6.5 pies) de longitud Peso: 368 g/m (0.25 lbs/pies) Borde de aluminio horizontal; Tipo C112/A3 Apropiado para todos los perfiles 2 m (6.5 pies) de longitud Peso: 388 g/m (0.26 lbs/pies) Canal profundo de aluminio; Tipo C112/A4 Apropiado para todos los perfiles 2 m (6.5 pies) de longitud Peso: 345 g/m (0.23 lbs/pies) Aluminio; Apropiado para perfil mini solamente 2 m (6.5 pies) de longitud Peso: 150 g/m (___lbs/pies) Aluminio Apropiado para protector de goma solamente ? m (pies) de longitud Peso: 667 g/m (0.448 lbs/pies) Aluminio Placa final para riel C opcin J 2 placas 4 tornillos Phillips de cabeza plana, 10 mm, #6, Peso: 7 g (0.01 lbs)

Nmero de catlogo

440F-R1212

440F-R1112

440F-R1212PB

440F-R1212PR

440F-R1212PY

10 (0.39) 20 (0.79)

440F-R1214

10 (0.39) 25 (0.98) 25 (0.98)

440F-R1215

18 (0.71) 25 (0.98)

440F-R1216

8.5 (0.33) 18 (0.71)

440F-R1219

45 (1.77) 13 (0.51)

440F-R2151

45 (1.77)

NA

10 (0.4)

440F-R2152

2-97

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productosPiezas de componentes
Dimensiones Artculo Descripcin 1m 2m Conector y cable 5m 12 m 15 m Resistencia de 6 k (amarilla) para terminacin en serie Terminacin 15 k (azul) para terminacin en paralelo 440F-A1309 Nmero de catlogo 440F-A1301 440F-A1302 440F-A1305 440F-A1306 440F-A1307 440F-A1308

Material de la cubierta de cierre: EPDM Cubierta de cierre Material de la cubierta de cierre: NRB Para cerrar los perfiles 440F-E0310S y 440F-E1610S. Cubierta de cierre Para cerrar los perfiles 440F-E1610N. Este conector le permite conectar directamente dos perfiles. Se puede usar para los perfiles 440F-E0110S y 440F-E0110R. El juego contiene una pareja de pines que se puede usar en una junta. Al usar el perfil 440F-E0110S, seleccione Al usar el perfil 440F-E0110R, seleccione Conector de ngulo de 90 Al usar el perfil 440F-E0110N, seleccione Al usar el perfil 440F-E0310S, seleccione Al usar el perfil 440F-E1610S, seleccione Al usar el perfil 440F-E1610NS, seleccione Al usar el perfil 440F-E0110N, seleccione Al usar el perfil 440F-E0110S 440F-E0110R, seleccione Al usar el perfil 440F-E1610NS, seleccione Al usar el perfil 440F-E1610S, seleccione Al usar el perfil 440F-E0310S, seleccione Conector de ngulo de 45

440F-A1302S

440F-A1302N

440F-A1303S

440F-A1303N

Conector axial

440F-A0061S

Conector de pin recto

440F-A0004 440F-A0071S 440F-A007IS 440F-A007IN 440F-A0073S 440F-A0074S 440F-A0074N 440F-A0072N 440F-A0072S 440F-A0075N 440F-A0075S 440F-A0076S

Conector de ngulo de 90 (vertical)

Al usar el perfil 440F-E0110N

440F-A0071N45

Conector de ngulo de 60

Al usar el perfil 440F-E0110N

440F-A0071N60

2-98

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productosPiezas de componentes
Dimensiones Artculo Descripcin Usar slo en perfil Mini1 m Conector y cable Usar slo en perfil Mini3 m Usar slo en perfil Mini5 m Usar slo en perfil Mini Resistencia de 8 k (amarilla) para terminaciones en serie Nmero de catlogo 440F-A1181 440F-A1183 440F-A1185

Terminacin

440F-A1186

Cubierta de cierre

Usar slo en perfil Mini Material de la cubierta de cierre: EPDM

440F-A1318

Adhesivo de cianocrilato

Contenido: 3 g. Suficiente para aproximadamente 10 terminaciones.

440F-A0020

Tijeras

Se usan para cortar los perfiles.

440F-A3084

Caja de conexiones

Envolvente de policarbonato de 53 mm X 53 mm X 35 mm con terminal de dos polos y tornillo de tipo trompeta en conector con abrazadera de fatiga y alivio. Se usa con el cable en espiral Cable en espiral flexible (extendido) de 2.5 m (8.2 pies). Cable en espiral flexible (extendido) de 3.5 m (11.5 pies).
Unidad de control

440F-A0116

Cable de conexin en espiral

440F-A2450 440F-A2700

Caja de conexiones

Cubierta de cierre Riel C Caja de conexiones

Cable en espiral

conector con resistencia

Ejemplo de aplicacin de perfil usando un cable en espiral. No se puede conectar el cable en espiral directamente al perfil debido al peso del cable. El uso correcto del cable en espiral supone la conexin del cable en espiral al perfil mediante la caja de conexiones. El cable en espiral se debe conectar a los objetos fijos y mviles para evitar fatiga de las conexiones de las terminaciones.

Conector del cable

Cubierta de cierre

2-99

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productos ensamblados en la fbrica (perfil estndar)

c (continuacin)
Entrada de cable Cdigo
J K L M N O P Q R S T

440F-E

c a

A b a
Perfil

M c

V d

01270 e

Descripcin
Entrada derecha RHT con cable de 10 m Entrada recta SET con cable de 1 m Entrada recta SET con cable de 2 m Entrada recta SET con cable de 3 m Entrada recta SET con cable de 5 m Entrada recta SET con cable de 10 m Entrada UNDER con cable de 1 m Entrada UNDER con cable de 2 m Entrada UNDER con cable de 3 m Entrada UNDER con cable de 5 m Entrada UNDER con cable de 10 m

Cdigo
A B C D E F G H I J K L N O

Descripcin
0110S 0110R 0110N 0510S con borde sellador al lado derecho 1610S 1610N 0804S con borde sellador al lado derecho 0310S 0210S con borde sellador al lado derecho 0510S con borde sellador al lado izquierdo 0804S con borde sellador al lado izquierdo 0210S con borde sellador al lado izquierdo Protector de goma sobre 0110S Protector de goma sobre 1610S

d
Terminacin Cdigo
A B C D E F G H I J K L M N O P Q R S T U V

Descripcin
Salida izq. LHT con cable de 1 m Salida izq. LHT con cable de 2 m Salida izq. LHT con cable de 3 m Salida izq. LHT con cable de 5 m Salida izq. LHT con cable de 10 m Salida derecha RHT con cable de 1 m Salida derecha RHT con cable de 2 m Salida derecha RHT con cable de 3 m Salida derecha RHT con cable de 5 m Salida derecha RHT con cable de 10 m Salida recta fijada con cable de 1 m Salida recta fijada con cable de 2 m Salida recta fijada con cable de 3 m Salida recta fijada con cable de 5 m Salida recta fijada con cable de 10 m Salida UNDER con cable de 1 m Salida UNDER con cable de 2 m Salida UNDER con cable de 3 m Salida UNDER con cable de 5 m Salida UNDER con cable de 10 m Terminacin en paralelo15 k Terminacin en serie6 k

b
Riel C Cdigo
A B C D E F G H J N

Descripcin
Aluminio 1212 para cdigos de perfil A-L Acero con recubrimiento de zinc 1112 para cdigos de perfil A-L PBC 1212PB negro para cdigos de perfil A-L PBC 1212PR rojo para cdigos de perfil A-L PBC 1212PY amarillo para cdigos de perfil A-L Aluminio 1214 con borde vertical para cdigos de perfil A-L Aluminio 1215 con borde horizontal para cdigos de perfil A-L Riel profundo de aluminio 1216 para cdigos de perfil A-L Aluminio 2151 para cdigos de perfil N y O Sin riel C (no se necesita)

c
Entrada de cable Cdigo
A B C D E F G H I J K L

Descripcin
Entrada izquierda LHT con cable de 1 m Entrada izquierda LHT con cable de 2 m Entrada izquierda LHT con cable de 3 m Entrada izquierda LHT con cable de 5 m Entrada izquierda LHT con cable de 10 m Entrada derecha RHT con cable de 1 m Entrada derecha RHT con cable de 2 m Entrada derecha RHT con cable de 3 m Entrada derecha RHT con cable de 5 m Entrada derecha RHT con cable de 10 m Entrada recta SET con cable de 1 m Entrada recta SET con cable de 2 m nmero de 5 dgitos

e
Longitud del borde Cdigo Descripcin
Escriba la longitud del borde en mm por ejemplo: 50 m=50,000; 500 mm=00500 300 mm mnimo

Haga el pedido del controlador por separado. Vea la pgina 2-104 para obtener detalles sobre la seleccin.

2-100

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Seleccin de productos ensamblados en la fbrica (perfil mini)
Cdigo
K M N P R S

c
Entrada de cable Descripcin
Cable de 1 m de entrada recta SET Cable de 3 m de entrada recta SET Cable de 5 m de entrada recta SET Cable de 1 m de entrada UNDER Cable de 3 m de entrada UNDER Cable de 5 m de entrada UNDER

d
Terminacin Cdigo
K M

Descripcin
Cable de 1 m de entrada recta SET Cable de 3 m de entrada recta SET Cable de 5 m de entrada recta SET Cable de 1 m de entrada UNDER Cable de 3 m de entrada UNDER Cable de 5 m de entrada UNDER Terminacin en serie8 k

440F-E

M a

I b a
Perfil

M c

V d

01270 e

N P R S V

Cdigo
M

Descripcin
Factor de compresin 0118S 3.75 mm (0.15 pulg.) negro, perfil Mini

e
Longitud Cdigo
nmero de 5 dgitos

b
Riel C Cdigo
I N

Descripcin
Escriba la longitud del borde en mm por ejemplo: 50 m=50000; 500 mm=00500 300 mm mnimo

Descripcin
Aluminio 1219 para cdigo de perfil M Sin riel C (no se necesita)

Haga el pedido del controlador por separado. Vea la pgina 2-104 para obtener detalles sobre la seleccin.

2-101

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Perfiles Safedge Ejemplos de ensamblaje en la fbrica
440F-EDFHV00490 440F-ECAKV01250

V
Terminacin en serie 6 K

F
Riel de aluminio tipo 1214 con borde vertical

A
Riel C de aluminio Tipo C112/A

H V
Terminacin en serie 6 K RHTEntrada derecha con cable de 3 m

C K
Entrada de cable SET con cable de 1 m

Perfil resistente al aceite Tipo 0110N de 1,250 mm de largo

D
Perfil tipo 0510S con borde sellador de 490 mm de largo Observe la orientacin del borde de sellado con respecto a la entrada del cable

Este es un perfil nico resistente al aceite con una longitud de 1,250 mm. El borde cuenta con una terminacin en serie. Un cable de 1 m entra directamente en la cubierta de cierre desde un controlador montado en riel DIN. El perfil se monta en un riel C estndar de aluminio.

Este perfil nico cuenta con un borde sellador y tiene una longitud de 490 mm. El perfil cuenta con una terminacin en serie. Un cable de 3 m entra en el lado derecho de la cubierta de cierre desde un controlador de plstico montado en superficie. El perfil se monta en un riel de aluminio con un borde vertical, el cual facilita el montaje. El usuario puede invertir la orientacin del borde sellador al borde vertical deslizando el perfil fuera del riel C, girando el riel C 180 y volviendo a insertar el perfil en el riel C.
440F-EBGCU03560

G
440F-ECFGD01250 Riel de aluminio tipo 1215 con borde horizontal

F
Riel de aluminio tipo 1214 con borde vertical

G
RHTEntrada derecha con cable de 2 m

U
Terminacin en paralelo15 K

B C
LHTEntrada con cable de 3 m

D
Salida izq. LHT con cable de 5 m

Perfil tipo 0110R de 3,560 mm de largo

Perfil resistente al aceite Tipo 0110N de 1,250 mm de largo

Este es un perfil nico resistente al aceite con una longitud de 1,250 mm. El borde cuenta con un cable de terminacin de 1 m. Un cable de 1 m entra directamente en la cubierta de cierre. El perfil se monta en un riel C estndar de aluminio. No se incluye una unidad de control.Este borde es para uso en serie con otra longitud de borde, el cual cuenta con una resistencia de terminacin.

Este es un perfil nico de color rojo con una longitud de 3,560 mm. Este perfil es parte de un sistema de perfil en paralelo, el cual facilita el montaje puesto que cuenta con una terminacin en paralelo. Un cable de 3 m entra en el lado izquierdo de la cubierta de cierre desde un controlador de plstico montado en superficie. El perfil se monta en un riel C de aluminio con un borde horizontal, el cual facilita el montaje. El usuario puede invertir el borde horizontal deslizando el perfil fuera del riel C, girando el riel C y volviendo a insertar el perfil en el riel C. Es necesario escribir un nmero de catlogo distinto para el otro perfil.

2-102

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Controladores Safedge Especificaciones
Normas Categora de seguridad Certificaciones Fuente de alimentacin elctrica 251 252 Consumo de potencia 251 252 Fusibles, internos 251D, 251P 251P 252D Fusibles, externos Perfil de entrada de seguridad Monitoreo Impedancia de entrada mx. Perfil Circuito de monitoreo Salidas 251 seguridad 252 seguridad 251, 252 auxiliar Capacidad nominal de salida Mn. corriente/voltaje de conmutacin Mx. tiempo de respuesta Indicadores LED EN1760-2, EN954-1, ISO 13849-1, AS4024.5, EN954-1, ANSI B11.19 Cat. 3 segn EN954-1 Marca CE, cULus, TuV 24 VCA/CC o 110/230 VCA 50/60 Hz 24 VCA/CC 50/60 Hz <6 VA <4 VA Fuente de alim. elc. de 500 mA, reemplazable Salida de seguridad de 2 x 2 A, reemplazable 500 mA, restablecible 4 A en CA, 2 A en CC 6 K, circuito abierto de 12 VCC, condicin de marcha de 4 VCC 1 N.A. 9 K 1 K 2 N.A. 1 N.A. 1 N.C. 2A/250 VCA, 2A/125 VCA 1 A/30 VCC 10 mA/10 V 13 ms Verde = Marcha Amarillo = Circuito abierto Rojo = Paro 2,500 V C de acuerdo con VDE0110 3 10 C a 55 C (14 F a 131 F) 90 % de humedad relativa IP40 (NEMA 1) IP65 (NEMA 13) IP20, DIN 0470 1 x 4 mm2 (10 AWG) trenzado 1 x 4 mm2 (10A WG) slido 1 x 1.1 mm2 (18 AWG) trenzado 1 x 1.5 mm2 (16A WG) slido Policarbonato 181 g (0.4 lbs) 450 g (1.0 lbs) 650 g (1.4 lbs) 0.15 mm 10-55 Hz 10 g, 11 ms semisinusoide

Descripcin
Los controladores Safedge estn diseados para funcionar con los perfiles Safedge. El controlador monitorea continuamente el perfil para detectar el accionamiento y genera una seal de salida cuando se presiona el perfil. El controlador Safedge proporciona un voltaje bajo al perfil. Cuando se presiona el perfil, el controlador detecta un cambio de resistencia y desactiva los rels de salida. Cuando se quita la presin sobre el perfil, los rels de salida del controlador vuelven al estado activado. El controlador cuenta con rels redundantes de salida guiados positivamente sin voltaje, los cuales se pueden usar para interconectarse a un sistema de control de mquina. El controlador 251 tiene capacidad de funcionar a 24 VCA/CC o 120/230 VCA desde terminales individuales. Un interruptor interno cambia el voltaje de funcionamiento de 120 VCA a 230 VCA. El controlador 252 funciona a 24 VCA/CC. Est disponible un rel de salida auxiliar para proporcionar una seal acerca del estado del controlador. Tres indicadores LED indican si el controlador se encuentra en la condicin MARCHA, PARO o ABIERTA. El controlador funciona en el modo de restablecimiento manual o automtico.

Voltaje de resistencia de impulso Grupo de instalacin Grado de contaminacin Temperatura de operacin Humedad Proteccin del envolvente 251D, 252D 251P Proteccin del terminal Calibre mx. de conductor 251D, 252D 251P Material del envolvente Peso 252D 251D 251P Vibracin Choque

Caractersticas
1 N.A. o 2 N.A. Salidas de seguridad 1 N.C. Salida auxiliar 24 VCA/CC 120/240 VCA Monitoreo de salida Indicadores LED para MARCHA, PARO y ABIERTO Restablecimiento automtico/manual

2-103

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Controladores Safedge Seleccin de productos
Tipo de envolvente Descripcin Nmero de catlogo

440F-C251D

Montaje en riel DIN de 35 mm

440F-C252D

Montaje en superficie

440F-C251P

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin. 440F-C251D
120 (4.72) 45.5 (1.79) 130 (5.12) 115 (4.53)

440F-C251P

440F-C252D
22.5 (0.88)

75 (2.95)

118 (4.64)

73 (2.87)

Pg 16/ 21 Pg 16/ 21

86 (3.38)

115 (4.53) 130 (5.12)

Montaje en riel DIN de 35 mm

Orificios de montaje 4 x M4

Diagramas de bloques
L F1 N +Ve X1 X2 Z2 13 23 31

24 VCC
K2 VR 12V K2 K1 K2 G E -Ve K3 R Z1 K1 K2 K3 K1 K3 K1

K1

Lgica
Y

Q1 Q2 K2

14

24

32

2-104

Dispositivos de seguridad para deteccin de presencia

Bordes de seguridad
Controladores Safedge Diagramas de cableado tpicos
L1
Restablecimiento 24 VCC

L1 L2 L3 L +Ve Z1
Safedge

L1 L2 L3 L
Safedge

Z2

X1

13

23

31 K1 K2

+Ve Z1

Z2

X1

13

23

31 K1 K2

440F-C251D 440F-C251P

440F-C251D 440F-C251P

-Ve

X2 14 K1

24 K2

42

- Ve

X2

14 K1

24 K2

42

M
Tierra de 24 V

Terminacin en serie, entrada Safedge, restablecimiento manual, salida de dos canales, salida monitoreada
+24 VCC Restablecimiento

Terminacin en serie, en cascada, entrada Safedge, restablecimiento automtico, salida de dos canales, sin salida monitoreada
+24 VCC

L1 L2 L3

+
Safedge Safedge

L1 L2 L3

Z1

Z2

X1

13

21 K1 K2
Safedge

Z1

Z2

X1

13

21 K1

440F-C252D

440F-C252D

X2

14 K1

22

X2

14 K1

22

Tierra de 24 V

K2

Tierra de 24 V

Terminacin en paralelo, entrada Safedge, restablecimiento manual, salida de dos canales, salida monitoreada

Terminacin en serie, entrada Safedge, restablecimiento automtico, salida de un canal, sin salida monitoreada

Accesorios
Descripcin Fusible de 500 mA Fusible, 2 A Pgina 14-6 14-2 Nmero de catlogo 440R-A31562 440A-A09197

2-105

Dispositivos de seguridad para deteccin de presencia

Notas

2-106

Interruptores con enclavamiento


Interruptores de lengeta
Elf . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-2 Cadet 3. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-6 Trojan T15 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-10 Trojan 5 y 6 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-14 MT-GD2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-20

Interruptores con bloqueo de guarda

Spartan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TLS-GD2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Atlas 5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 440G-MT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Centurion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

3-24 3-28 3-32 3-36 3-40

Interruptores sin contacto


Ferrogard 1, 2, 20 y 21 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ferrogard 3, 4 y 5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ferrogard 6, 9 y 10 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ferrogard GD2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ferrogard GS1 y GS2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Unidades de control Sipha . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Detectores Sipha. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sentinel 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ferrocode. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-42 3-46 3-48 3-50 3-52 3-56 3-60 3-64 3-68

Interruptores con bisagra

Sprite . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-72 Ensign 3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-74 Rotacam . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-76

Interruptores con enclavamiento

Interruptores de lengeta
Elf Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y BG 1 N.C. o 2 N.C., accin de apertura directa

Categora

Certificaciones Contactos de seguridad Designacin/Cat. de utilizacin A600/CA-15 (Ue) (Ie) N600/CC-13 (Ue) (Ie) Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Recorrido de accionador para apertura positiva Radio mnimo de operacin Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color

Descripcin
El Elf es un interruptor de enclavamiento de seguridad con accionamiento de lengeta (o llave) diseado para instalarse en el flanco ascendente de guardas deslizables, abisagradas o extrables. El envolvente miniatura del Elf (slo de 75 25 29 mm) hace que sea el dispositivo de enclavamiento ms pequeo actualmente disponible. Ha sido diseado para mquinas pequeas, tales como impresoras, fotocopiadoras o aparatos electrodomsticos, los cuales no usaron, hasta ahora, enclavamientos de seguridad debido a las restricciones de espacio. El verstil Elf cuenta con dos ranuras de entrada y una cabeza giratoria y puede ofrecer hasta ocho opciones diferentes de entrada al accionador. La operacin del interruptor se realiza mediante la insercin de una llave de perfil especial de acero inoxidable permanentemente montada en la puerta de la guarda. La llave semiflexible permite que el Elf se use en puertas de radios pequeos (60 mm 2.36 pulg.). El Elf est disponible con entrada de conducto y 2 contactos N.C. o 1 N.A. y 1 N.C. de seguridad (1 M16 o tipo conector) sellado segn especificaciones IP67 (a prueba de agua y a prueba de polvo). Se proporciona un tapn ciego para la entrada de llave no usada.

600 V 1.2 A 600 V 0.4 A 10 A

500 V 240 V 120 V 1.4 A 3 A 6 A 500 V 250 V 125 V 0.55 A 1.1 A 2.2 A

5 V 5 mA CC >2 mm (0.078 pulg.) (Uimp) 2,500 V 1 N.A. 3 3.6 mm (0.141 pulg.) 150 mm (5.90 pulg.) 60 mm (2.36 pulg.) con kit GD2 6 N (1.35 lb) 160 mm (6.29 pulg.) por seg. 2 ciclos por seg. Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 1 x M16 o tipo conector 20 C a +80 C (4 F a +176 F) 2 x M4 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 60 g (2.11 onzas) Rojo

Caractersticas
Ideal para las guardas pequeas de peso liviano El interruptor de enclavamiento ms pequeo disponible 2 contactos N.C. o 1 N.A. y 1 N.C. Ocho posibles puntos de entrada al accionador, fciles de instalar Proteccin ambiental: IP67

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

Aplicaciones
Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-2

Interruptores con enclavamiento

Interruptores de lengeta
Elf Seleccin de productos
Nmero de catlogo Contactos de Contactos seguridad auxiliares BBM/MBB Conducto M16/ adaptador de 1/2 pulg. 440K-E33029 440K-E33030 440K-E33031 440K-E33037 440K-E33045 440K-E33046

Accionador Plano 90

Conducto M16 440K-E33036 440K-E33040 440K-E33014 440K-E33080 440K-E33041 440K-E33047

Conector 440K-E33074 440K-E33025 440K-E33075 440K-E33076 440K-E33077 440K-E33024 440K-E33078 440K-E33079

1 N.C.

1 N.A.

BBM

Gua metlica de alineam. GD2 con accionador semiflexible Plano 90

2 N.C.

Gua metlica de alineam. GD2 con accionador semiflexible

Cable de empalme recomendado, 2 m (6.5 pies). Vea la pgina 15-10 para obtener detalles y longitudes adicionales.

889D-F4AC-2

Accesorios
Descripcin Para obtener las dimensiones, vea la pgina Nmero de catlogo

Accionador plano

14-6

440K-A21014

Accionador de 90

14-6

440K-A21006

Gua metlica de alineamiento GD2 con accionador semiflexible

14-6

440K-A21030

Gua de alineamiento

14-6

440K-A21069

Placa de montaje

14-6

440K-A33624

3-3

Interruptores con enclavamiento

Interruptores de lengeta
Elf Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
25 (0.98) Entrada trasera 29 (1.14) 4 (0.16) 12.5 (0.49) 75 (2.95)

75 (2.95)

4.5 (0.18)

6 (0.24) 6 (0.24)

17.5 (0.69)

R 2.1 1 x M16

Entrada frontal

4 (0.16)

4.5 (0.18)

12.5 (0.49) 3 (0.12) 16.5 (0.65)

25 (0.98)

18 (0.71)

34.5 (1.36) 36 (1.42)

Diagramas de cableado tpico (mostrados con la guarda cerrada, accionador insertado)


1 N.C.+ 1 N.A. 2 N.C.

23 24

11 12

21 22

11 12

1 N.C.+ 1 N.A. Configuracin de pines del conector 1 Terminal 11 N.C. 12 23 N.A 4 24


1 N.C.+ 1 N.A.(BBM) 6 11/12 23/24 3.8 0 mm 6 11/12 21/22

2 N.C. Terminal 11 N.C. 12 21 N.C. 22


2 N.C. 4 0 mm

Contacto

Contacto

2 3

1 4

3 2

Accin de contacto
Contacto abierto Contacto cerrado Distancia de retraccin del accionador desde la insercin completa

4.2

3-4

13 (0.51)

6 (0.24)

Interruptores con enclavamiento

Interruptores de lengeta
Elf Detalles de aplicacin

Accionador de 90

Accionador plano

La cabeza gira 360 en incrementos de 90 para proporcionar 8 posibles puntos de entrada al accionador

Posicin de cabeza 1 Entrada superior

Posicin de cabeza 2

Posicin de cabeza 3 Entrada frontal

Posicin de cabeza 4

Entrada frontal

Entrada lateral

Entrada lateral

Entrada frontal

8 posibles puntos de entrada al accionador

Entrada inferior

Gua metlica de alineamiento GD2 con accionador semiflexible

Entrada frontal

3-5

Interruptores con enclavamiento

Interruptores de lengeta
Cadet 3 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus, TUV Nord 2 N.C. o 3 N.C., accin de apertura directa

Categora

Certificaciones Contactos de seguridad Designacin/Cat. de utilizacin A600/CA-15 (Ue) (Ie) N600/CC-13 (Ue) (Ie) Corriente trmica (litio) Corriente mnima Resistencia tpica de contacto Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Recorrido de accionador para apertura positiva Radio mnimo de operacin Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color

Descripcin
El Cadet 3 es un interruptor de enclavamiento de seguridad con accionamiento de lengeta (o llave) diseado para instalarse en el flanco ascendente de guardas deslizables, abisagradas o extrables. Con dos ranuras de entrada y una cabeza giratoria, el verstil Cadet 3 puede ofrecer hasta ocho opciones diferentes de entrada al accionador. El exclusivo envolvente compacto (90.5 x 31 x 30.4 mm (3.56 x 1.22 x 1.19 pulg.)) tiene centros de fijacin de estndar industrial DIN 50047 para facilitar el montaje. La operacin del interruptor se realiza mediante la insercin de una llave de perfil especial de acero inoxidable permanentemente montada en la puerta de la guarda. Una llave semiflexible permite que el Cadet se use en puertas de radios pequeos (60 mm 2.36 pulg.). Disponible con una variedad de configuraciones de contactos, el Cadet 3 est sellado segn especificaciones IP67. Se proporciona un tapn ciego para la entrada de llave no usada.

600 V 500 V 240 V 120 V 1.2 A 1.4 A 3 A 6 A 600 V 500 V 250 V 125 V 0.4 A 0.55 A 1.1 A 2.2 A 10 A 5 V 5 mA CC 5 m (Ui) 500 V (Uimp) 2,500 V 1 N.A. 3 5 mm (0.098 pulg.) 150 mm (5.905 pulg.) (60 mm (2.36 pulg.) con kit GD2) 15 N (3.38 pd) 160 mm ( 6.299 pulg.) por seg. 2 ciclos por seg. Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 1 x M16 o tipo conector 20 C a + 80 C (4 F a +176 F) 2 x M4 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 80 g (0.176 lb) Rojo

Caractersticas
Tamao compacto Ideal para las guardas pequeas de peso liviano Contactos, 2 N.C. + 1 N.A. o 3 N.C. Sellado segn especificaciones IP67 Ocho posibles puntos de entrada al accionador, fciles de instalar Centros de fijacin de estndar industrial segn DIN 50047

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

Aplicaciones
Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-6

Interruptores con enclavamiento

Interruptores de lengeta
Cadet 3 Seleccin de productos
Nmero de catlogo Contactos de seguridad Contactos auxiliares Conducto M16/ adaptador de 1/2 pulg. 440K-C21048 440K-C21057 440K-C21062 440K-C21050 440K-C21058 440K-C21074 440K-C21093 440K-C21094 440K-C21095

BBM/MBB

Accionador Plano 90

Conducto M16 440K-C21096 440K-C21097 440K-C21070 440K-C21098 440K-C21061 440K-C21055 440K-C21052 440K-C21065 440K-C21080

Conector 440K-C21090 440K-C21091 440K-C21092 440K-C21054 440K-C21067 440K-C21088 440K-C21060 440K-C21068 440K-C21089

3 N.C.

Gua metlica de alineamiento GD2 con accionador semiflexible Plano 90

BBM

Gua metlica de alineamiento GD2 con accionador semiflexible Plano 90

2 N.C.

1 N.A.

MBB

Gua metlica de alineamiento GD2 con accionador semiflexible

Cable de empalme recomendado, 2 m (6.5 pies). Vea la pgina 15-11 para obtener detalles y longitudes adicionales.

889R-F6ACA-2

Accesorios
Descripcin Para obtener las dimensiones, vea la pgina Nmero de catlogo

Accionador plano

14-6

440K-A21014

Accionador de 90

14-6

440K-A21006

Gua metlica de alineamiento GD2 con accionador semiflexible

14-6

440K-A21030

3-7

Interruptores con enclavamiento

Interruptores de lengeta
Cadet 3 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
90.5 (3.56) 38.4 (1.51) 36.4 (1.43) 34.4 (1.35) Entrada frontal

13.0 (0.51)

20.0 (0.79)

22.0 (0.87)

31.0 (1.22)

4.5 (0.18) R 2.15 4 (0.16) Rosca M16

25.0 (0.98) 25.0 (0.98) 30.4 (1.2)

13.0 (0.51)

4 (0.16)

4.5 (0.18)

13.0 (0.51)

3-8

Interruptores con enclavamiento

Interruptores de lengeta
Cadet 3 Diagramas de cableado tpico (mostrados con la guarda cerrada, accionador insertado)
2 N.C.+ 1 N.A. 3 N.C.

33 34

21 22

11 12

31 32

21 22

11 12

2 N.C.+ 1 N.A. Configuracin de pines del conector 1 5 2 6 3 4 Terminal 11 12 21 22 33 34 Contacto N.C. N.C. N.A Terminal 11 12 21 22 31 32

3 N.C. Contacto N.C. N.C. N.C.


3 N.C. 3.8 11/12 21/22 31/32 0 mm

Accin de contacto
Contacto abierto Contacto cerrado Distancia de retraccin del accionador desde la insercin completa

2 N.C.+ 1 N.A. (BBM) 3.8 11/12 21/22 33/34 4.5 0 mm

2 N.C.+ 1 N.A. (MBB) 3.8 11/12 21/22 33/34 3.3 0 mm

3-9

Interruptores con enclavamiento

Interruptores de lengeta
Trojan T15 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y TUV Nord 2 N.C. o 1 N.C., accin de apertura directa

Categora

Certificaciones Contactos de seguridad Designacin/Cat. de utilizacin A600/CA-15 (Ue) (Ie) N600/CC-13 (Ue) (Ie) Mx. corriente/voltaje/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Recorrido de accionador para apertura positiva Radio mnimo de operacin Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color

600 V 500 V 240 V 120 V 1.2 A 1.4 A 3 A 6 A 600 V 500 V 250 V 125 V 0.4 A 0.55 A 1.1 A 2.2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 x 2 mm (0.078 pulg.) (Ui) 500 V (Uimp) 2,500 V 1 N.A. 3 6 mm (0.236 pulg.) 175 mm (6.89 pulg.) 60 mm (2.36 pulg.) (con accionador flexible) 30 N (6.7 lb) 160 mm (6.29 pulg.) por seg. 2 ciclos por seg. Tereftalato de polibutileno con relleno de vidrio aprobado por UL Acero inoxidable IP67 3 x M20 o tipo conector 20 C a +80 C (4 F a +176 F) 2 x M5 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 120 g (0.265 lbs) Rojo

Descripcin
El Trojan T15 es un interruptor de enclavamiento de seguridad con accionamiento de lengeta, universal y compacto, diseado para instalarse en el flanco ascendente de las guardas deslizantes, abisagradas o extrables. Las dos ranuras de entrada y la cabeza giratoria, mvil solamente desbloqueando los tornillos de cubierta, el Trojan T15 puede ofrecer cuatro opciones diferentes de entrada al accionador. El Trojan T15 cuenta con un envolvente compacto, de slo 75 x 52 x 32 mm (2.95 x 2.04 x 1.25 pulg.) e incluye contactos de accin de apertura directa y mecanismo resistente a intrusin no autorizada. El Trojan T15 tiene 2 contactos de seguridad N.C. o 1 contacto de seguridad N.C. y 1 contacto auxiliar N.A. La unidad est sellada segn IP67 y cuenta con tres entradas de conducto M20. La operacin del interruptor se realiza mediante la insercin del accionador especial perfilado de acero inoxidable permanentemente fijado en la flanco ascendente de la puerta de la guarda. El T15 estndar tiene una fuerza de retencin del accionador de 30 N. Un mecanismo de retn opcional ayuda a mantener las puertas cerradas en maquinarias que vibran.

Caractersticas
Tamao compacto, envolvente de 75 x 52 x 32 mm (2.95 x 2.05 x 1.26 pulg.) Fuerza de retencin del accionador 30 N Fuerte y verstil, se puede usar en la mayora de las aplicaciones Contactos: 2 contactos de seguridad N.C. o 1 contacto de seguridad N.C. y 1 N.A. Tipo GD2 disponible para aplicaciones exigentes

Aplicaciones

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin. Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-10

Interruptores con enclavamiento

Interruptores de lengeta
Trojan T15 Seleccin de productos
Contactos Tipo de modelo Seguridad Aux. Accionador Estndar 2 N.C. Estndar 1 N.C. 1 N.A. Completamente flexible Estndar Completamente flexible Estndar 2 N.C. Entrada frontal GD2 1 N.C. 1 N.A. Completamente flexible Estndar Completamente flexible Estndar 440K-T11303 440K-T11395 440K-T11269 440K-T11305 440K-T11396 440K-T11270 440K-T11463 440K-T11397 440K-T11280 440K-T11398 440K-T11399 440K-T11279 Conducto M20 Adaptador NPT 1/2 pulg. 440K-T11267 440K-T11273 440K-T11268 440K-T11276 440K-T11288 440K-T11287 440K-T11284 440K-T11283 Conector Entrada trasera 440K-T11307 440K-T11384 440K-T11385 440K-T11386 440K-T11387 440K-T11388 440K-T11389 440K-T11390 440K-T11391 440K-T11392 440K-T11393 440K-T11394

Cable de empalme recomendado, 2 m (6.5 pies). Vea la pgina 15-10 para obtener detalles y longitudes adicionales.

889D-F4AC-2

Accesorios
Descripcin Para obtener las dimensiones, vea la pgina Nmero de catlogo

Accionador estndar (modelo estndar solamente)

14-5

440K-A11238

Accionador estndar GD2 (modelo GD2 solamente)

14-4

440G-A27011

Accionador plano

14-5

440K-A11112

3-11

Interruptores con enclavamiento

Interruptores de lengeta
Trojan T15 Accesorios (continuacin)
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Gua de alineamiento con accionador semiflexible


(Deseche la gua de alineamiento para GD2)

14-5

440K-A11144

Gua de alineamiento con accionador totalmente flexible


(Deseche la gua de alineamiento para GD2)

14-6

440K-A27010

Accionador de perno deslizable

14-4

440G-A27163

Juego de lengeta y retencin (modelo estndar solamente)

14-4

440K-A11094

tems opcionales
Gua de alineamiento y accionador flexible Lengeta y retencin Se usa para mantener cerradas las guardas en maquinarias que vibran. Conexin enchufable

La opcin de conector permite una rpida conexin.

Se usa con el accionador flexible

Flexibilidad de 15 en cualquier direccin

3-12

Interruptores con enclavamiento

Interruptores de lengeta
Trojan T15 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.

20.5 (0.81)

40 52 (1.57) (2.05)

5.5 (0.22) Orificios de fijacin para tornillos M5 5 (0.2) Guas GD2 5 (0.2) 32 (1.26) 15 (0.59) 16 (0.62) 33.4 (1.31) 41 (1.61) 75 (2.95) 5.5 (0.22) 31 (1.22) 13 (0.51) 20.5 (0.81) 15.75 (0.62)

Diagramas de cableado tpico (mostrados con la guarda cerrada, accionador insertado)


1 N.C.+ 1 N.A. (BBM) 2 N.C.

23 24

11 12

21 22

11 12

1 N.C.+ 1 N.A. Configuracin de pines del conector 1 Terminal 11 N.C. 12 23 N.A 4 24


1 N.C.y 1 N.A.(BBM) 20 11/12 23/24 15 10 6 0 mm 20 11/12 21/22 15

2 N.C. Terminal 11 N.C. 12 21 N.C. 22


2 N.C. 10 6 0 mm

Contacto

Contacto

2 3

1 4

3 2

Accin de contacto
Contacto abierto Contacto cerrado Distancia de retraccin del accionador desde la insercin completa

6.5

3-13

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y BG 4 N.C. o 3 N.C. o 2 N.C., accin de apertura directa

Categora

Certificaciones Contactos de seguridad Designacin/Cat. de utilizacin CA (Ue) (Ie) CC

500 V 250 V 100 V 1A2A5A 250 V 0.5 A 24 V 2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 x 2 mm (0.078 pulg.) (Ui) 500 V (Uimp) 2,500 V 1 N.A. o 2 N.A. 3 6 mm (0.23 pulg.) 175 mm (6.89 pulg.) (60 mm) (2.36 pulg.) con accionador flexible) 20 N (4.5 lb) 160 mm (6.29 pulg.) por seg. 2 ciclos por seg. Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 3 x M20 o tipo conector 20 C a +80 C (4 F a +176 F) 2 x M5 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 160 g (0.35 lbs) Rojo

Descripcin
La familia Trojan consta de un interruptor universal de enclavamiento de seguridad con accionamiento de lengeta (o llave) diseado para instalarse en el flanco ascendente de guardas deslizables, abisagradas o extrables. Las dos ranuras de entrada de llave y la cabeza giratoria, mvil solamente desbloqueando los tornillos de cubierta, permiten cuatro opciones de entrada al accionador. El Trojan cuenta con todas las funciones de seguridad, por ej., contactos guiados forzados y un mecanismo resistente a manipulacin indebida, los cuales permiten la seguridad de la mquina segn la directiva de maquinarias pertinente La operacin del interruptor se realiza mediante la insercin de una llave de perfil especial de acero inoxidable permanentemente montada en la flanco ascendente de la puerta de la guarda. El accionador del Trojan incluye un mecanismo autoeyector que impide la operacin del interruptor si el accionador no se monta en la puerta de la guarda (por ej., si el operador usa una llave de repuesto). El Trojan 6 est disponible ya sea con 4 contactos de seguridad N.C., 3 contactos de seguridad N.C. y 1 contacto auxiliar N.A. o 2 contactos de seguridad N.C. y 2 contactos auxiliares N.A. La unidad est sellada segn IP67 y cuenta con tres entradas de conducto M20.

Mx. corriente/voltaje/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Recorrido de accionador para apertura positiva Radio mnimo de operacin

Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color

Caractersticas
Fuerte y verstil, se puede usar en la mayora de las aplicaciones Accionador de auto-eyeccin protegido contra uso por inexpertos, funciona solamente si se monta en la guarda Cuatro posibles puntos de entrada al accionador, fciles de instalar Tipo GD2 disponible para aplicaciones exigentes Cumple con las especificaciones de EN1088, EN292, EN60947-5-1, EN60204-1

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

3-14

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Seleccin de productos

Contactos Tipo de modelo Seguridad Aux. BBM/ MBB Accionador Estndar Gua/semiflexible BBM Gua/totalmente flexible Trojan 5 estndar BBM contactos de oro Estndar Estndar Gua/semiflexible MBB 2 N.C. 1 N.A. Gua/totalmente flexible GD2 estndar Gua/semiflexible BBM Trojan 5 GD2, entrada frontal MBB Gua/totalmente flexible Estndar Gua/semiflexible Gua/totalmente flexible

Conducto M20 Conducto M20 440K-T11090 440K-T11110 440K-T11467 440K-T11089 440K-T11085 440K-T11118 440K-T11123 440K-T11468 440K-T11146 440K-T11336 440K-T11337 440K-T11338 440K-T11147 440K-T11339 440K-T11340 440K-T11341 440K-T11167 Adaptador NPT 1/2 pulg. 440K-T11202 440K-T11203 440K-T11204 440K-T11208 440K-T11209 440K-T11210 440K-T11469 440K-T11211 440K-T11212 440K-T11213 440K-T11470 440K-T11471 440K-T11472

Conector Final 440K-T11205 440K-T11206 440K-T11207 440K-T11129 440K-T11224 440K-T11363 440K-T11364 440K-T11365 440K-T11366 440K-T11367 440K-T11368 440K-T11226 440K-T11369 440K-T11370 440K-T11371 440K-T11372

Cable de empalme recomendado para Trojan 5, 2 m (6.5 pies). Vea la pgina 15-11 para obtener detalles y longitudes adicionales.

889R-F6ACA-2

3-15

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Seleccin de productos (continuacin)

Contactos Tipo de modelo Seguridad Aux. BBM/ MBB Accionador Estndar Semiflexible 3 N.C. 1 N.A. BBM Completamente flexible MBB Trojan 6 estndar BBM Estndar Semiflexible 2 N.C. 2 N.A. Completamente flexible MBB 4 N.C. Estndar Gua/semiflexible 3 N.C. 1 N.A. BBM Gua/totalmente flexible MBB Trojan 6 GD2, entrada frontal 2 N.C. 2 N.A. BBM Estndar Gua/semiflexible Gua/totalmente flexible MBB 4 N.C.

Conducto M20 Conducto M20 440K-T11171 440K-T11436 440K-T11437 440K-T11449 440K-T11450 440K-T11174 440K-T11439 440K-T11440 440K-T11452 440K-T11453 440K-T11441 440K-T11418 440K-T11442 440K-T11443 440K-T11188 440K-T11456 440K-T11445 440K-T11446 440K-T11447 440K-T11459 440K-T11460 440K-T11448 Adaptador NPT 1/2 pulg. 440K-T11435 440K-T11405 440K-T11406 440K-T11408 440K-T11465 440K-T11438 440K-T11412 440K-T11413 440K-T11416 440K-T11454 440K-T11172 440K-T11466 440K-T11420 440K-T11423 440K-T11444 440K-T11457 440K-T11425 440K-T11428 440K-T11429 440K-T11433 440K-T11461 440K-T11432

Conector Entrada trasera 440K-T11403 440K-T11404 440K-T11407 440K-T11409 440K-T11451 440K-T11410 440K-T11411 440K-T11414 440K-T11415 440K-T11455 440K-T11417 440K-T11419 440K-T11421 440K-T11422 440K-T11424 440K-T11458 440K-T11426 440K-T11427 440K-T11430 440K-T11434 440K-T11462 440K-T11431

Cable de empalme recomendado para Trojan 6, 2 m (6.5 pies). Vea la pgina 15-10 para obtener detalles y longitudes adicionales.

889D-F8AB-2

3-16

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador estndar (modelo estndar solamente)

14-5

440K-A11095

Accionador estndar GD2 (modelo GD2 solamente)

14-4

440G-A27011

Accionador plano

14-5

440K-A11112

Gua de alineamiento con accionador semiflexible


(Deseche la gua de alineamiento para GD2)

14-5

440K-A11144

Gua de alineamiento con accionador totalmente flexible


(Deseche la gua de alineamiento para GD2)

14-6

440K-A27010

Accionador de perno deslizable


(modelo GD2 solamente)

14-4

440G-A27163

Juego de lengeta y retencin (modelo estndar solamente)

14-4

440K-A11094

3-17

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Dimensiones aproximadasmm (pulgadas)
Modelo estndar

Entrada trasera

32 (1.26)

5.5 (0.22)

(0.55)

14

9 (0.35)

3 (0.12)

15.75 (0.62)

20.5 (0.81)

3 (0.12)

5 (0.2)

95 (3.74)

24 (0.94)

5 (0.2) 5.5 (0.22) Entrada frontal

52 (2.05)

20.5

(0.81)

15.75 (0.62) 46 (1.81) 7 (0.28) 32 (1.26) Entrada trasera 32 (1.26) 36 (1.42) 6 (0.24) 5 (0.2) 5.5 (0.22) Entrada frontal 52 (2.05)
(0.81) Orificios de montaje

Modelo GD2

para tornillos M5 8 (0.31)

5.5
3

15.75
(0.62)

(0.12)

(0.81)

20.5

(0.12) 24 (0.94)

95 (3.74)

9 (0.35)

14 (0.55)

20.5

15.75 (0.62) 46 (1.81) 7 (0.28) 8 (0.31) Orificios de montaje para tornillos M5

3-18

40 (1.57)

40 (1.57)

Interruptores con enclavamiento

Interruptores de lengeta
Trojan 5 y 6 Diagramas de cableado tpicos
Trojan 5
2 N.C.+ 1 N.A. Configuracin de pines del conector 1 5
34 22 12 33 21 11

Terminal 11 12 21 22 33 34

Contacto N.C. N.C. N.A

Circuito auxiliar (N.A.) Circuito de seguridad 2 (N.C.) Circuito de seguridad 1 (N.C.)

2 6 3 4

Accin de contacto
Contacto abierto Contacto cerrado

2 N.C.+ 1 N.A.(BBM) 20 15 10 5 11/12 21/22 33/34 5.5

0 mm

2 N.C.+ 1 N.A.(MBB) 20 15 10 5 11/12 21/22 33/34 4.8

0 mm

Trojan 6
4 N.C. 3 N.C.+ 1 N.A. 2 N.C.+ 2 N.A.

42 32 22 12

41 31 21 11

Circuito de seguridad 4 (N.C.) Circuito de seguridad 3 (N.C.) Circuito de seguridad 2 (N.C.) Circuito de seguridad 1 (N.C.)

44 32 22 12

43 31 21 11

Circuito auxiliar (N.A.) Circuito de seguridad 3 (N.C.) Circuito de seguridad 2 (N.C.) Circuito de seguridad 1 (N.C.)

44 34 22 12

43 33 21 11

Circuito auxiliar 2 (N.A.) Circuito auxiliar 1 (N.A.) Circuito de seguridad 2 (N.C.) Circuito de seguridad 1 (N.C.)

4 N.C. Configuracin de pines del conector 1 7 6 Terminal 11 12 21 22 31 32 41 42 Contacto N.C. N.C. N.C. N.C.

3 N.C.+ 1 N.A. Terminal 11 12 21 22 31 32 43 44 Contacto N.C. N.C. N.C. N.A

2 N.C.+ 2 N.A. Terminal 11 12 21 22 33 34 43 44 Contacto N.C. N.C. N.A N.A

1 2 3 8 4

7 6 5

5 4 3 8 2

Accin de contacto
Contacto abierto Contacto cerrado

20 11/12 21/22 31/32 41/42

15

4 N.C. 10

3.8

0 mm

3.8

3 N.C.+ 1 N.A.(BBM) 20 15 10 3.8 11/12 21/22 31/32 43/44 4.1

0 mm

2 N.C.+ 2 N.A.(BBM) 20 15 10 3.6 11/12 21/22 33/34 43/44 3.9

0 mm

3 N.C.+ 1 N.A.(MBB) 20 15 10 4.3 11/12 21/22 33/34 43/44 3.2

0 mm

2 N.C.+ 2 N.A.(MBB) 20 15 10 4.3 11/12 21/22 33/34 43/44 3.6

0 mm

3-19

Interruptores con enclavamiento

Interruptores de lengeta
MT-GD2 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y TUV Nord 2 N.C., 3 N.C., 4 N.C., accin de apertura directa CA 15

Categora

Certificaciones Contactos de seguridad Rgimen de utilizacin Designacin/Cat. de utilizacin A600/CA-15 (Ue) (Ie) N600/CC-13 (Ue) (Ie) Corriente trmica (litio) Corriente mnima Voltaje nominal de aislamiento Voltaje nominal de resistencia deimpulsos Contactos auxiliares Recorrido de accionador para apertura positiva Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Peso Color

Descripcin
El MT-GD2 es un interruptor de enclavamiento de seguridad robusto con accionamiento de lengeta diseado para instalarse en el flanco ascendente de las guardas deslizantes, abisagradas o extrables. El MT-GD2 cuenta con dos ranuras de entrada y una cabeza giratoria y ofrece ocho opciones diferentes de entrada al accionador. El MT-GD2 cuenta con un envolvente compacto de slo 117 mm x 40 mm x 43 mm con centros de fijacin estndar DIN 5004 e incluye contactos guiados forzados as como un mecanismo de proteccin contra uso por inexpertos. El MT-GD2 est disponible con una variedad de configuraciones de contactos, lo cual permite que se use como parte de un sistema de aplicaciones de alto riesgo. La unidad est sellada segn IP67 y tiene 1 entrada de conducto. La operacin del interruptor se realiza mediante la insercin del accionador especial perfilado de acero inoxidable permanentemente fijado en la flanco ascendente de la puerta de la guarda. Un accionador flexible opcional permite que el MT-GD2 funcione en puertas de radios pequeos (60 mm) y un accionador plano proporciona opciones de montaje adicionales. La incorporacin de un mecanismo de desbloqueo de enclavamiento permite la retencin manual del accionador en el interruptor hasta que se active manualmente el mecanismo de desbloqueo.

600 V 500 V 240 V 120 V 1.2 A 1.4 A 3 A 6 A 600 V 500 V 250 V 125 V 0.4 A 0.55 A 1.1 A 2.2 A 10 A 5 V, 5 mA CC (Ui) 500 V (Uimp) 2,500 V 1 N.A. o 2 N.A. 6 mm (0.24 pulg.) 12 N (2.7 lbs) 1 m/s 2 ciclos por seg. Cinc pintado Acero inoxidable IP67 1/2 pulg. NPT o M20 o conector 20 C a +80 C (4 F a +176 F) 4 x M5 Todas las posiciones 1,000,000 operaciones 520 g (1.15 lbs) Rojo

Caractersticas
Fuerte y verstil, se puede usar en la mayora de las aplicaciones Ocho posibles puntos de entrada al accionador, fciles de instalar Diversas configuraciones de contactos Estilos de desbloqueo de enclavamiento opcionales Centros de fijacin de estndar industrial segn DIN/EN50041 Cumple con las especificaciones de EN1088, EN292, EN60947-5-1, EN60204-1, EN60204-1

Parmetros de apriete Pernos de fijacin 1.6 Nm Tornillos de cubierta 16.0 Nm Tornillos de terminal 1.0 Nm
Nota: los contactos de seguridad de los interruptores Guardmaster se describen como normalmente cerrados (N.C.), es decir, la guarda cerrada, el accionador en su posicin (cuando es pertinente) y la mquina lista para arrancar.

MT -GD2 tipo desbloqueo de enclavamiento

3-20

Interruptores con enclavamiento

Interruptores de lengeta
MT-GD2 Seleccin de productos
Contactos Tipo Seguridad Auxiliar BBM/MBB Accionador 3 N.C. 1 N.A. BBM Estndar Completamente flexible MT-GD2 2 N.C. 2 N.A. Estndar Completamente flexible 3 N.C. 2 N.C. 4 N.C. 1 N.A. 2 N.A. 3 N.C. 1 N.A. BBM Estndar Completamente flexible MT-GD2, desbloqueo de enclavamiento 2 N.C. 2 N.A. Estndar Completamente flexible 3 N.C. 2 N.C. 4 N.C. 1 N.A. 2 N.A. MBB MBB Conducto M20 440K-MT55002 440K-MT55074 440K-MT55075 440K-MT55005 440K-MT55076 440K-MT55077 440K-MT55004 440K-MT55006 440K-MT55093 440K-MT55039 440K-MT55078 440K-MT55079 440K-MT55063 440K-MT55080 440K-MT55081 440K-MT55082 440K-MT55083 440K-MT55084 Nmero de catlogo Conducto NPT 1/2 pulg. 440K-MT55085 440K-MT55022 440K-MT55029 440K-MT55086 440K-MT55026 440K-MT55087 440K-MT55088 440K-MT55089 440K-MT55090 440K-MT55062 440K-MT55041 440K-MT55045 440K-MT55065 440K-MT55050 440K-MT55051 440K-MT55091 440K-MT55092 440K-MT55060 Conector 440K-MT55094 440K-MT55095 440K-MT55096 440K-MT55097 440K-MT55098 440K-MT55099 440K-MT55100 440K-MT55101 440K-MT55102 440K-MT55042 440K-MT55070 440K-MT55103 440K-MT55066 440K-MT55104 440K-MT55052 440K-MT55106 440K-MT55105 440K-MT55061

Cable de empalme de 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales.

889M-F12X9AE-2

3-21

Interruptores con enclavamiento

Interruptores de lengeta
MT-GD2 Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador estndar GD2

14-4

440G-A27011

Accionador plano

14-5

440K-A11112

Accionador flexible

14-4

440G-A27143

Accionador de perno deslizable

14-4

440G-A27163

Accionador plano extendido

14-5

440K-A17116

Aplicaciones tpicas
Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-22

Interruptores con enclavamiento

Interruptores de lengeta
MT-GD2 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
MT -GD2 4 x orificios de fijacin Espacio libre para M5 60 (2.36) 40 (1.57) 30 (1.18) 5 (0.20) 11.5 (0.45) 8.75 (0.34) 38 (1.5) 20.5 (0.81) 40 (1.57) 30 (1.18) MT -GD2, desbloqueo de enclavamiento 119 (4.68) 118.5 (4.66) 22 (0.86) dim.

10.5 (0.41) 116.5 (4.59) 43 (1.69)

Entrada frontal 30.8 (1.21) 40.7 (1.6)

10.5 (0.41)

60 (2.36) 102.4 (4.03)

24.6 (0.97)

43 (1.69)

30.8 (1.21)

20.5 (0.81)

8.75 (0.34)

51 (2.0)

9.2 (0.36)

74.6 (2.93) 30.8 (1.21)

Entrada trasera 5 (0.20) 67.6 (2.66)

5 (0.20)

20.6 (0.81)

9.2 (0.36)

Diagramas de cableado tpico (mostrados con la guarda cerrada, accionador insertado)


4 N.C. 3 N.C.+ 1 N.A. 2 N.C.+ 2 N.A.

41 42

31 32

21 22

11 12

41 42

31 32

21 22

11 12

41 42

31 32

21 22

11 12

Configuracin de pines del conector 1 3 4 6 7 8 9 10 12

4 N.C. Terminal 11 12 21 22 31 32 41 42 Contacto N.C. N.C. N.C. N.C. 11 12 21 22 31 32 43 44

3 N.C.+ 1 N.A. Terminal Contacto N.C. N.C. N.C. N.A Tierra 11 12 21 22 33 34 43 44

2 N.C.+ 2 N.A. Terminal Contacto N.C. N.C. N.A N.A

8 7 6 5 12

9 11

1 10 2 3 4

Accin de contacto
Contacto abierto Contacto cerrado
11/12 21/22 31/32 41/42 5.2

4 N.C.
20 15 10 5 0 mm

3 N.C.+ 1 N.A.(MBB)
20 11/12 21/22 31/32 43/44 5.2 15 10 5.6 0 mm 11/12 21/22 33/34 43/44

2 N.C.+ 1 N.A.(MBB)
20 15 10 5.6 0 mm

Distancia de retraccin del accionador desde la insercin completa

5.2

3 N.C.+ 1 N.A.(BBM)
20 11/12 21/22 31/32 43/44 5.6 15 10 5.2 0 mm 11/12 21/22 33/34 43/44

2 N.C.+ 1 N.A.(BBM)
20 15 10 5.2 0 mm

5.6

3-23

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Spartan Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y TUV Nord 2 N.C. o 3 N.C., accin de apertura directa CA 15 500 V 250 V 100 V 1A 2A 5A 250 V/0.5 A 24 V/2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 mm 500 V 2,500 V 1 N.A. 3 160 mm/segundo (6.3 pulg./seg.) 1 ciclo/segundo Polister rellenado de vidrio aprobado por UL Acero inoxidable IP 67 1 x M20 o tipo conector 20 C a 60 C (4 F a +140 F) 2 x M5 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 260 g (0.57 lb) Rojo 1.200 N (270 lbs) 175 mm (6.9 pulg.) Indicador LED de monitoreo de solenoide 24 VCA/CC, 110 VCA, 230 VCA (solenoide) Tpicamente 7 W 100 % ED

Categora

Certificaciones Contacto de seguridad Categora de utilizacin CA (Ue) (le) CC Mxima corriente/volt/carga conmutados

Descripcin
El Spartan es un interruptor de enclavamiento con bloqueo de modo positivo con accionamiento de lengeta que bloquea una guarda de mquina en la posicin cerrada hasta que se asla la alimentacin elctrica y asegura que sta permanezca aislada mientras la guarda est abierta. Est disponible en dos configuraciones de contacto: dos contactos de seguridad (N.C.) y un contacto auxiliar (N.A.) o tres contactos de seguridad (N.C.). La cabeza Spartan cuenta con dos ranuras de entrada y se puede girar para proporcionar cuatro puntos de entrada al accionador.Se proporciona tapn ciego para sellar la ranura no usada. La guarda se puede abrir solamente cuando se aplica una seal al solenoide interno de Spartan, el cual desbloquea el mecanismo. Como consecuencia, el Spartan es ideal para las mquinas que no paran inmediatamente o donde la interrupcin prematura de la mquina podra causar daos de herramientas y componentes o causar un peligro adicional. El mecanismo de bloqueo soporta fuerzas de hasta 1,200 N (270 lbs.) y un indicador LED proporciona indicacin visual del estado de interruptor. Se proporciona tambin un juego de lengeta con alineamiento del accionador para aliviar la fatiga en el solenoide de bloqueo y proteger la unidad contra daos del accionador debido al desalineamiento de la guarda. Los puntos de desbloqueo manual con tornillos de seguridad o llave especial permiten que el Spartan se desbloquee en caso de un corte total de alimentacin elctrica a la mquina.

Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color Fuerza de retencin mx. Radio mnimo de operacin Indicador LED Fuente de alimentacin elctrica Potencia de solenoide

Caractersticas
Capacidad de desbloqueo Indicador de estado montado en cubierta Alta fuerza de bloqueo1,200 N (270 lbs.) 2 N.C. y 1 N.A. o 3 N.C. Cabeza giratoria: 4 ranuras posibles de entrada de llave

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

Aplicaciones tpicas
Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-24

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Spartan Seleccin de productos
Contactos Accionador Voltaje del solenoide 24 VCA/CC Seguridad 2 N.C. 3 N.C. Estndar 110 VCA/CC 2 N.C. 3 N.C. 230 VCA/CC 2 N.C. 3 N.C. Aux. 1 N.A. 1 N.A. -1 N.A. Conducto M20 440G-S36001 440G-S36007 440G-S36003 440G-S36009 440G-S36005 440G-S36011 Nmero de catlogo Conducto M20/ adaptador de 1/2 pulg. 440G-S36044 440G-S36047 440G-S36045 440G-S36048 440G-S36046 440G-S36049 Conector 440G-S36058 440G-S36059 440G-S36060 440G-S36061 440G-S36062 440G-S36063

Cable de empalme de 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales.

889M-F12X9AE-2

Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador con retencin de lengeta y gua de repuesto

14-4

440G-A36050

Anulacin de emergencia

14-4

440G-A36026

3-25

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Spartan Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
14.5 (0.57) 35 (1.38) 12 (0.47) 120 (4.72) Entrada de conducto (M20) 31 (1.22) 37 (1.46) 8 (0.31) 3 N.C. Circuito de seguridad 3

40 (1.57) 9 (0.35) Puntos de desbloqueo de emergencia

7 (0.28)

5 (0.2)

58 (2.28) 52 (2.05) 40 (1.57)

Llave

5.5 (0.22)

8 (0.3)

34.5 (1.36)

Diagramas de cableado tpicos


2 N.C.+ 1 N.A. Circuito auxiliar Circuito de seguridad 2

22

34

33

21

Circuito de seguridad 2 Circuito de seguridad 1

20.5 (0.81)

5.5 (0.22)

14 (0.55)

22 32

31

21

Circuito de seguridad 1 CA/CC Potencia de solenoide

12 A2

11 A1

CA/CC Potencia de solenoide

12 A2

11 A1

CA/CC de CA/CC 100 % ED.

CA/CC de CA/CC 100 % ED.

2 N.C.+ 1 N.A. Configuracin de pines del conector 1 3 4 6 7 8 9 10 Terminal A1 A2 11 12 21 22 33 34 Contacto Potencia de solenoide N.C. N.C. N.A
2 N.C.+ 1 N.A. 12 11/12 21/22 33/34 6 0 mm 12 11/12 21/22 33/34

3 N.C. Terminal A1 A2 11 12 21 22 31 32 Contacto Potencia de solenoide N.C. N.C. N.C.


3 N.C. 6 0 mm

8 7 6 5 12

9 11

1 10 2 3 4

Accin de contacto
Contacto abierto Contacto cerrado

Distancia de retraccin del accionador desde la insercin completa

2.5

2.5

3-26

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Spartan Detalles de aplicacin
4 posibles posiciones de entrada al accionador

1 2

Fuerza de bloqueo = 1,200N

3-27

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


TLS-GD2 Especificaciones
Se muestra con el juego opcional de desbloqueo de

Normas

EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus, BG y TUV (TLS 1 y 2) 3 N.C., accin de apertura directa (TLS 3) 4 N.C., accin de apertura directa CA 15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A, 24 V 2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 mm (Ui) 500 V (Uimp) 2,500 V (TLS 1 y 2) 2 N.A. (monitoreo de 1 solenoide) (TLS 3 1 N.A.) 3 7 mm (0.28 pulg.) 12 N (2.7 lbs) 160 mm por seg. (6.3 pulg. por seg.) 1 ciclo por seg. Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 3 x M20 o tipo conector 20 C a + 60 C (4 F a +140 F) 4 x M5 Todas las posiciones TLS1 y 3 potencia para desbloquear TLS2 potencia para bloquear 1,000,000 operaciones 1,000,000 operaciones 400 g (.88 lbs) Rojo 2,000 N (450 lbs.) 100 N (22.5 lbs) 160 mm (6.3 pulg.) (80 mm con accionador flexible) (3.15 pulg.) 24 VCA/CC 110 VCA 230 VCA (solenoide) Tpicamente 7 W 100 % ED

Categora

Certificaciones Contactos de seguridad

Categora de utilizacin CA (Ue) (le) CC

Descripcin
El TLS-GD2 es un interruptor de enclavamiento de bloqueo de guarda de modo positivo con accionamiento de lengeta que bloquea una guarda de mquina en la posicin cerrada hasta que se asla la alimentacin elctrica y asegura que sta permanezca aislada mientras la guarda est abierta. Cuenta con tres contactos de seguridad (N.C.) y dos contactos auxiliares (N.A.). La cabeza del TLS-GD2 cuenta con dos ranuras de entrada y se puede girar para proporcionar cuatro puntos de entrada al accionador. Se proporciona un tapn ciego para sellar la ranura no usada. La guarda se puede abrir solamente cuando se aplica una seal al solenoide interno al TLS-GD2, el cual desbloquea el mecanismo.Como consecuencia, el TLS-GD2 es ideal para las mquinas que no paran inmediatamente o donde la interrupcin prematura de la mquina podra causar daos de herramientas y componentes o causar un peligro adicional. El TLS-GD2 est disponible en tres tipos. Adems del estilo estndar, el TLS-1 GD2 y el TLS-3GD2 incorporan una funcin de potencia de desbloqueo. Tres puntos de desbloqueo manual con tornillos de seguridad permiten que el TSL-GD2 bloqueado se desbloquee en casos de emergencia. Tambin est disponible, opcionalmente, un estilo de desbloqueo de llave montada en la cubierta. Todos los tipos cuentan con cinco conjuntos de contactos en diversas formas y se pueden usar con los PLC. Se instala una gua de accionador de acero inoxidable para proteger la unidad contra daos del accionador debido al desalineamiento o desgaste de la guarda.
Nota: Con el estilo de 'potencia para bloquear', pueden ser necesarias medidas para evitar que los fallos de circuito abierto o cortes de energa causen una condicin peligrosa.

Mxima corriente/volt/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares

Grado de contaminacin Recorrido de accionador para apertura positiva Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Montaje Fijacin Bloqueo Vida til mecnica Vida til elctrica Peso Color Fuerza de retencin mx. Carga mx. de desbloqueo Radio mnimo de operacin Fuente de alimentacin elctrica Potencia de solenoide

Caractersticas
Potencia para desbloquear o potencia para bloquear Alta fuerza de bloqueo de 2000 N (450 lbs.) Cinco contactos: 2 N.C.y 1 N.A. para monitoreo de posicin de la puerta 1 N.C. y 1 N.A. o 2 N.C. para monitoreo del bloqueo Cabeza giratoria: 4 ranuras posibles de entrada de llave Cumple con las normas EN1088 y EN60947-5-1

Nota: los contactos de seguridad de los interruptores Guardmaster se describen como normalmente cerrados (N.C.), es decir, la guarda cerrada, el accionador en su posicin (cuando es pertinente) y la mquina lista para arrancar.

3-28

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


TLS-GD2 Seleccin de productos
Contactos Solenoide Nmero de catlogo Conducto M20/ adaptador de 1/2 pulg. 440G-T27169 440G-T27171 440G-T27172 440G-T27174 440G-T27175 440G-T27177 -440G-T27178 440G-T27180 440G-T27181 440G-T27183 440G-T27184 440G-T27186

Tipo

Seguridad

Aux.

Contactos

Voltaje

Accionador Estndar

Conducto M20 440G-T27121 440G-T27251 440G-T27252 440G-T27124 440G-T27253 440G-T27254 440G-T27123 440G-T27127 440G-T27255 440G-T27256 440G-T27132 440G-T27257 440G-T27258 440G-T27129 440G-T27134 440G-T27259 440G-T27260 440G-T27138 440G-T27261 440G-T27262 440G-T27136

Conector 440G-T27233 440G-T27234 440G-T27235 440G-T27236 440G-T27237 440G-T27238 440G-T27239 440G-T27240 440G-T27241 440G-T27242 440G-T27243 440G-T27244 440G-T27245 440G-T27246 440G-T27247 440G-T27248 440G-T27249 440G-T27250 889M-F12X9AE-2 889M-F12AH-2

24 VCA/CC TLS-1 GD2 potencia para desbloquear 110 VCA/CC

Completamente flexible Estndar Completamente flexible Estndar

1 N.C. y 1 N.A.

230 VCA/CC

24 VCA/CC TLS-2 GD2 Potencia para bloquear

Completamente flexible Estndar

2 N.C.

1 N.A. 110 VCA/CC

Completamente flexible Estndar

230 VCA/CC

24 VCA/CC TLS-3 GD2 potencia para desbloquear

Completamente flexible Estndar

2 N.C. 110 VCA/CC

Completamente flexible

230 VCA/CC

Cable de empalme para TLS-3, 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales. Cable de empalme para TLS-1 y TLS-2, 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales.

Aplicaciones
Nota: Las guardas extrables requieren un buen alineamiento cuando se utilizan interruptores con enclavamiento accionado por lengeta. IMPORTANTE: No debe existir la posibilidad de extraer la guarda sin que se accione el enclavamiento. Es posible que se requiera un enclavamiento a cada lado.

3-29

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


TLS-GD2 Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador estndar TLS-GD2

14-4

440G-A27011

Accionador plano

14-5

440K-A11112

Accionador totalmente flexible

14-4

440G-A27143

Accionador de perno deslizable

14-4

440G-A27163

Para TLS-1 con llave de anulacin externa Para TLS-3 con llave de anulacin externa Para TLS-1 con llave de anulacin conectada Cubierta de bloqueo Para TLS-3 con llave de anulacin conectada

440G-A27140 440G-A27142 440G-A27207 440G-A27208

3-30

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


TLS-GD2 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
Interruptor 43 (1.69) 6 (0.24) 5 (0.2) 20.5 (0.81) 33 (1.3) 25.5 (1) 14 (0.55) 9 (0.35) 126 (4.96) 105 (4.13) 14 (0.55) 22 (0.87) 27 (1.06) 37 (1.46) 5 (0.2) 6.5 (0.26) 17 (0.67) 86 (3.39) 57 (2.24) 73 (2.87) 21 (0.83) 2 x M5 15 (0.59) 30 (1.18) 3 (0.12) 6.5 (0.26) 52.5 (2.07) 60.5 (2.38) 67.5 (2.66) 4 (0.16) Desbloqueo de llave opcional

5 (0.2) 21 17 (0.83) (0.67) 5.5 (0.22) 3 (0.12) 6.5 (0.26) M5

Diagrama de cableado tpico


TLS-1 y TLS-2 Configuracin de pines del conector 1 3 4 6 7 8 9 10 2 5 Terminal A1 A2 11 42 21 22 33 34 53 54
TLS-1 y TLS-2
Contacto cerrado

TLS-3 Terminal A1 A2 11 42 21 52 33 34
TLS-3

Contacto Potencia de solenoide N.C. N.C. N.A N.C.

Contacto Potencia de solenoide N.C. N.C. N.A

8 7 6 5 12

9 11 4

1 10 2 3

Accin de
Contacto abierto

Distancia de retraccin del accionador desde la insercin completa

AC/DC A2 A1 100% ED. 54 42

34 53 22 41 12

33 21 11

AC/DC A2 A1 100% ED. 51 52 42 41

34 22 12

33 21 11

TLS-1 GD2 20 6.6 3 0 mm 41/42 11/12 21/22 33/34 53/54 Cerrado cuando alim. elc. conectada 20 41/42 11/12 21/22 33/34 53/54

TLS-2 GD2 6.6 3 0 mm 20 41/42 Cerrado cuando alim. 51/52 elc. conectada 33/34 11/12 Abierto cuando 21/22 alim. elc. conectada

TLS-3 GD2 6.6 3 0 mm

3-31

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Atlas 5 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN602041, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus y CSA

Categora

Certificaciones Contactos de seguridad

Atlas 5 2 N.C., accin de apertura directa 1 N.A., accin de apertura directa Llave con trampa Atlas 5 2 N.C., accin de apertura directa (izquierda) 1 N.A., accin de apertura directa Categora de utilizacin CA (Ue) (Ie) CC Mxima corriente/volt/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Recorrido de accionador para apertura positiva Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Vida til mecnica Vida til elctrica Peso Color Fuerza de retencin mx. Radio mnimo de operacin Fuente de alimentacin elctrica Potencia de solenoide Capacidad nominal de solenoide CA 15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A, 24 V 2 A 500 V 500 VA 10 A 5 V. 5 mA CC > bloque de contacto de 2 mm (Ui) 500 V (Uimp) 2,500 V 1 N.A. 8 mm (.31 pulg.) 12 N (2.7 lbs) 160 mm por seg. (6.3 pulg. por seg.) 2 ciclos por seg. Aleacin moldeada Acero inoxidable IP65 3 x M20 o 3 x 1/2 pulg NPT o conector 10 C a +60 C (14 F a +140 F) 4 x M5 1,000,000 operaciones 1,000,000 operaciones 1,200 g (2.65 lbs) Rojo 5,500 N (1.236 lbs) Entrada de extremo de 300 mm, entrada frontal de 800 mm 24 VCA/CC 110 VCA 230 VCA (solenoide) 13 W tpico 100 % ED Servicio al 100 %

Descripcin
El Atlas 5 es un interruptor de enclavamiento de bloqueo de guarda de modo positivo con accionamiento de lengeta que bloquea una guarda de mquina en la posicin cerrada hasta que se asla la alimentacin elctrica y asegura que sta permanezca aislada mientras la guarda est abierta. La guarda se puede abrir solamente cuando se aplica una seal al solenoide interno, el cual desbloquea el mecanismo. Un interruptor de servicio pesado, el mecanismo de bloqueo del Atlas 5 resiste fuerzas de hasta 5,500 N (1,236 lbs.), y el envolvente de aleacin moldeado es ideal para uso en ambientes hostiles. Una caracterstica nica del Atlas 5 es la cabeza patentada de alineamiento automtico que tolera el desalineamiento del accionador o guarda, lo cual es muy til para las guardas de mquinas pesadas. El Atlas 5 est diseado para las mquinas que no paran inmediatamente o cuando la interrupcin prematura de la mquina podra causar daos de herramientas y componentes o un peligro adicional. El Atlas 5 cuenta con 2 contactos de seguridad (N.C.) y 2 contactos auxiliares (N.A.) y es ideal para las mquinas controladas por PLC.

Caractersticas
Bloqueo mecnico Alta fuerza de bloqueo5,500 N (1,236 lbs.) Envolvente de aleacin moldeado para trabajo pesado, ideal para los ambientes hostiles La cabeza patentada de alineamiento automtico tolera el desalineamiento del accionador

3-32

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Atlas 5 Seleccin de productos
Contactos Tipo Accionador Seguridad Aux. Solenoide Voltaje 24 VCA/CC Estndar Atlas 5 Bloqueo de llave izq. Estndar 2 N.C. 2 N.A. 110 VCA/CC 230 VCA/CC 24 VCA/CC 110 VCA/CC 230 VCA/CC Nmero de catlogo Conducto M20 440G-L07264 440G-L07263 440G-L07262 440G-L07255 440G-L07254 440G-L07253 1/2 pulg. NPT 440G-L07258 440G-L07257 440G-L07256 440G-L07249 440G-L07248 440G-L07247 Conector 440G-L07298 440G-L07299 440G-L07300 440G-L07301 440G-L07302 440G-L07303

Cable de empalme M23 de 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales.

889M-F12AH-2

Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador estndar

14-3

440G-A07136

Terminacin de tapa final de repuesto

14-3

440G-A07180

Accionador totalmente flexible

14-3

440G-A07269

3-33

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Atlas 5 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
800 (31.5 )

R Min

12 (0.47) 23 (0.91) 5 (0.2) 10 (0.39)

56 (2.2) 23 (0.91) 30 (1.18)

2 bloqueos manuales Puntos de desbloqueo 17 (0.67) Bloqueo Desbloqueo

52 (2) Ctrs 14 (0.55)

4 x M5 5 (0.2) 163 (6.4) Ctrs 184 (7.24) 13 (0.51)

56 (2.2)

25 (0.98) 16 (0.63)

43 (1.69)

12 (0.47)

90 (3.54)

80 (3.15)

56 (2.2)

16 (0.63) Estilo de bloqueo con llave izq. solamente 5 (0.2) 95 (3.74)

25 (0.98)

Entrada frontal Orificio del accionador

Diagramas de cableado tpicos


Guarda abiertaSolenoide desactivado Seguridad Seguridad

Aux.

Aux.

1
1 2 3

2
4 5

2
6 7

Suministro de solenoide de CA/CC


8 A1 A2 E

Configuracin de terminal Mquina en condicin de marcha


A1 A2 CA/CC 100 % ED. 5 7 1 6 8 4

Iluminacin de tapa solamente

Configuracin de pines del conector 1 3 4 6 7 8 9 10 5 2 12

Terminal A1 A2 5 6 7 8 1 2 3 4 Tierra

Contacto Potencia de solenoide N.C. N.C. N.A N.A

Accin de contacto
Contacto abierto Contacto cerrado

8 7 6 5 12

9 11

1 10 2 3 4

Distancia de retraccin del accionador desde la insercin completa 20 12 0 mm 5/6 7/8 1/2 3/4 19 13.5

3-34

R Min 300 (11

.8)

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Atlas 5 Detalles de aplicacin

Unidad de detector de movimiento interrumpido CU 2


Se usa con Atlas para las mquinas con funcionamiento excesivo constante o variable. Enva un retardo temporizado a la seal de bloqueo/desbloqueo. A prueba de fallos y ajustable a un rango de tiempos desde 0.1 segundo hasta 40 minutos. Para obtener ms detalles, vea la seccin acerca de rels de monitoreo de seguridad en este catlogo.

Unidad de temporizador CU 1
Se usa con Atlas para las mquinas con funcionamiento excesivo constante. Enva un retardo temporizado a la seal de bloqueo/ desbloqueo. A prueba de fallos y ajustable a un rango de tiempos desde 0.1 segundo hasta 40 minutos. Para obtener ms detalles, vea la seccin acerca de rels de monitoreo de seguridad en este catlogo.

Unidad de rel de monitoreo de seguridad MSR6R/T Minotaur


Proporciona el mximo nivel de seguridad monitoreando todo el cableado en el circuito de seguridad, incluso los interruptores y contactores. Si se produce un fallo, se interrumpe la potencia a la mquina. Estn disponibles otras unidades Minotaur, vea la seccin acerca de rels de monitoreo de seguridad en este catlogo.

3-35

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


440G-MT Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN602041, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 cULus, TUV 4 N.C., 3 N.C., 2 N.C., accin de apertura directa 1 N.A., 2 N.A. CA 15 250 V 2A 250 V 0.5 A, 24 V 2 A 500 V 500 VA 5A 5 V, 5 mA CC > bloque de contacto de 2 mm (Ui) 500 V (Uimp) 2,500 V 1 N.A. 3 15 mm (0.59 pulg.) 6 N (1.35 lbs) 160 mm por seg. (6.3 pulg. por seg.) 2 ciclos por seg. Aleacin de zinc pintado Acero inoxidable IP67 3 x M20, 3 x 1/2 pulg. NPT o tipo conector 25 C a +60 C (13 F a +140 F) 4 x M5 1,000,000 ciclos 1,000,000 ciclos 1,400 g (3.08 lbs) Rojo

Categora

Certificaciones Contactos de seguridad Contactos auxiliares Categora de utilizacin CA (Ue) (Ie) CC

Descripcin
El interruptor de solenoide 440G-MT es un interruptor de enclavamiento de bloqueo de guarda de modo positivo con accionamiento de lengeta que bloquea una guarda de mquina en la posicin cerrada hasta que se asla la alimentacin elctrica y asegura que sta permanezca aislada mientras la guarda est abierta. La guarda se puede abrir solamente cuando se aplica una seal al solenoide interno, el cual desbloquea el mecanismo. El mecanismo de bloqueo del 440G-MT resiste fuerzas de hasta 1,600 N (360 lbs) y el envolvente de aleacin moldeado es ideal para uso en ambientes hostiles. El interruptor de solenoide 440G-MT est diseado para las mquinas que no paran inmediatamente o cuando la interrupcin prematura de la mquina podra causar daos de herramientas y componentes o un peligro adicional.

Mx. corriente/volt/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Recorrido de accionador para apertura positiva Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Vida til mecnica Vida til elctrica Peso Color

Caractersticas
Bloqueo mecnico Alta fuerza de bloqueo1,600 N (360 lbs.) Envolvente de aleacin moldeado para trabajo pesado, ideal para los ambientes hostiles

Parmetros de apriete Pernos de fijacin 1.6 Nm Tornillos de cubierta 1.6 Nm Tornillos de terminal 1.6 Nm Fuerza de retencin mx. Radio mnimo de operacin Fuente de alimentacin elctrica Potencia de solenoide Capacidad nominal de solenoide 1,600 N (360 lbs) 60 mm (2.36 pulg.) 24 VCA/CC o 110 VCA 230 VCA 13 W tpico 100 % ED 100 %

3-36

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


440G-MT Seleccin de productos
Contactos Voltaje del solenoide BBM/MBB Seguridad Aux. Accionador Estndar 3 N.C. BBM 2 N.C. 2 N.A. 1 N.A. Completamente flexible Estndar Completamente flexible 4 N.C. Estndar 3 N.C. BBM 2 N.C. 2 N.A. 1 N.A. Completamente flexible Estndar Completamente flexible 230 VCA/CC BBM 4 N.C. 3 N.C. 2 N.C. 4 N.C. 1 N.A. 2 N.A. Conducto M20 440G-MT47037 440G-MT47038 440G-MT47007 440G-MT47044 440G-MT47045 440G-MT47010 440G-MT47031 440G-MT47070 440G-MT47071 440G-MT47013 440G-MT47077 440G-MT47078 440G-MT47012 440G-MT47033 440G-MT47016 440G-MT47015 440G-MT47035 Nmero de catlogo Adaptador NPT 1/2 pulg. 440G-MT47039 440G-MT47040 440G-MT47008 440G-MT47046 440G-MT47047 440G-MT47011 440G-MT47032 440G-MT47073 440G-MT47074 440G-MT47009 440G-MT47079 440G-MT47080 440G-MT47014 440G-MT47034 440G-MT47017 440G-MT47024 440G-MT47036 Conector 440G-MT47041 440G-MT47042 440G-MT47043 440G-MT47048 440G-MT47049 440G-MT47050 440G-MT47069 440G-MT47075 440G-MT47076 440G-MT47072 440G-MT47081 440G-MT47082 440G-MT47083 440G-MT47106 440G-MT47107 440G-MT47108 440G-MT47111 889M-F12X9AE-2

24 VCA/CC

110 VCA/CC

Cable de empalme M23 de 2 m (6.5 pies). Vea la pgina 15-13 para obtener detalles y longitudes adicionales.

Accesorios
Descripcin Para obtener las dimensiones, consulte la pgina Nmero de catlogo

Accionador estndar TLS-GD2

14-4

440G-A27011

Accionador plano

14-5

440K-A11112

Accionador totalmente flexible

14-4

440G-A27143

Accionador de perno deslizable

14-4

440G-A27163

Accionador plano extendido

14-5

440K-A17116

Cubierta de repuesto Sin indicador LED Sin llave de anulacin

440G-MT47120

3-37

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


440G-MT Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
4 x M5 144 (5.66) 5 (0.19)

40 (1.57)

30 (1.18)

38 (1.49) 9.2 (0.36) 40.7 (1.60) 46.75 (1.84) 199 (7.83)

20.5 (0.80)

46 (1.81)

8.75 (0.34)

15.5 (0.61) 23 (0.90) 2 x puntos de desbloqueo manual

3-38

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


440G-MT Diagramas de cableado tpicos

+
A2

4 N.C. Alimentacin de solenoide de CA/CC

+
A2

3 N.C.+ 1 N.A. Alimentacin de solenoide de CA/CC

2 N.C.+ 2 N.A. Alimentacin de solenoide de CA/CC

A1 12 22 32 42 11 21 31 41
Solenoid e 100 % ED CA

A1 12 22 32 44
Solenoid e 100 % ED CA

A2 12 22 34 44 11 21 33 43
Solenoid e 100 % ED CA

A1

11 21 31 43

Configuracin de pines del conector 1 3 4 6 7 8 2 5 9 10 12

4 N.C. Terminal A1 A2 11 12 21 22 31 32 41 42 Contacto Potencia de solenoide N.C. N.C. N.C. N.C. A1 A2 11 12 21 22 31 32 43 44

3 N.C.+ 1 N.A. Terminal Contacto Potencia de solenoide N.C. N.C. N.C. N.A Tierra A1 A2 11 12 21 22 33 34 43 44

2 N.C.+ 2 N.A. Terminal Contacto Potencia de solenoide N.C. N.C. N.A N.A

8 7 6 5 12

9 11

1 10 2 3 4

Accin de contacto
Contacto abierto Contacto cerrado

4 N.C. 12 11/12 21/22 31/32 41/42 6 0 mm

3 N.C.+ 1 N.A.(BBM) 12 11/12 21/22 31/32 43/44 6 0 mm

2 N.C.+ 2 N.A.(BBM) 12 11/12 21/22 33/34 43/44 6 0 mm

Distancia de retraccin del accionador desde la insercin completa

3.5

3.5

3.5

3-39

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Centurion Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus, BG y SUVA 2 N.C., accin de apertura directa AC15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A 24 V 2 A 500 V/500 VA 10 A 5 V 5 mA >2 mm (0.078 pulg.) (Ui) 500 V (Uimp) 2,500 V 1 N.C. 2 mm (0.078 pulg.)

Categora

Certificaciones Contacto de seguridad Designacin/Cat. de utilizacin CA (Ue) (Ie) CC


73013

Descripcin
El Centurion es un interruptor de enclavamiento con bloqueo de guarda de mquina y accionamiento de interruptor de regulacin manual de modo positivo que bloquea la guarda en la posicin cerrada hasta que el operador gira el interruptor de regulacin manual, lo cual retrae el eje de la puerta de la guarda. La accin de retraccin del eje inicia dos funciones; asla la alimentacin elctrica a la mquina mientras la guarda est abierta y, debido al principio operativo, proporciona un retardo de 20 segundos antes de permitir que se abra la guarda. Los estilos alternativos con ejes ms largos pueden aumentar el retardo hasta un 50 %. El Centurion es ideal para uso en mquinas simples con tiempos de paro cortos y constantes. Es importante que la unidad se instale y funcione correctamente para asegurar que el eje retrctil no se extienda cuando la guarda est abierta. Para las mquinas con tiempos de paro largos o variables o donde se requiere acceso frecuente, se debe considerar el uso de los interruptores de bloqueo de solenoide, tales como TLS-GD2 y Atlas 5. El Centurion cuenta con 2 contactos de seguridad (N.C.), 1 contacto auxiliar (N.A.) y 1 entrada de conducto (ya sea M20 o desconector). Los estilos EX y Pneumtico del Centurion tambin estn disponibles; vea la seccin A prueba de explosiones en la pgina 16-1 para obtener ms informacin.
Nota: Se deben emplear medidas de seguridad adicionales (por ej., una cubierta) para asegurar que slo se obtenga acceso al interruptor de regulacin manual con la punta de los dedos.

Mxima corriente/volt/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Movimiento del eje para realizar la operacin del contacto Material del envolvente Eje de bloqueo Proteccin Entrada de conducto Temperatura de operacin Montaje Vida til mecnica Vida til elctrica Peso Color

Aleacin moldeada para uso robusto Acero inoxidable IP66 1 x M20 o conector 25 C a +80 C (10 F a +176 F) 2 x M4 1,000,000 operaciones 1,000,000 operaciones 500 g (1.20 lbs) Rojo

Nota: los contactos de seguridad de los interruptores Guardmaster se describen como normalmente cerrados (N.C.) es decir, la guarda cerrada, el accionador en su posicin (cuando es pertinente) y la mquina lista para arrancar.

Operacin del interruptor de regulacin manual Centurion Caractersticas


El retardo de tiempo manualmente accionado permite el paro progresivo de la mquina Operacin e instalacin fciles Envolvente moldeado robusto, ideal para las aplicaciones de uso pesado Contactos, 2 N.C. y 1 N.A. (sellado segn especificaciones IP66)

El eje de enclavamiento se retrae manualmente de la guarda girando el interruptor de regulacin manual.

3-40

Interruptores con enclavamiento

Interruptores con bloqueo de guarda


Centurion Seleccin de productos
Contactos de seguridad Contactos auxiliares Nmero de catlogo BBM/MBB Tipo Derecho Izquierdo 2 N.C. 1 N.A. BBM Perno extendido derecho Perno extendido izquierdo Conducto M20 440K-B04025 440K-B04026 440K-B04039 440K-B04040 Conector 440K-B04046 440K-B04047 440K-B04048 440K-B04049

Cable de empalme recomendado, 2 m (6.5 pies). Vea la pgina 15-10 para obtener detalles y longitudes adicionales.

889D-F8AB-2

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.

Vista del extremo

24 (0.94)

Vista posterior
14 (0.55) 20 (0.79) 35 (1.38)

Vista lateral
16.5 (0.65) 98 (3.86)

86 (3.39) 36 (1.42) 15 (0.59)

6 (0.24) 14 (0.55)

30 (1.18) 64 (2.52)

6 (0.24)

Vista frontal, estilo derecho

Vista frontal, estilo izquierdo

40.5 (1.59)

Diagramas de cableado tpicos


Circuito de seguridad 1 Circuito de seguridad 2 Auxiliar
33 34 11 21 22

12

2 N.C.+ 1 N.A. Configuracin de pines del conector 1 7 Terminal 11 12 21 22 33 34 Tierra Contacto N.C.

Accin de contacto
Contacto abierto Contacto cerrado

Distancia de retraccin del accionador desde la insercin completa 2 N.C. + 1 N.A. (BBM)

1 2 3 8 4

7 6 5

6 5 4 3 8

N.C.

N.A

24.5 11/12 21/22 33/34

0 mm

3-41

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 1, 2, 20 y 21 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE y cULus Seguridad Auxiliar 12 mm (0.47 pulg.) 15 mm (0.59 pulg.) 23 mm (0.91 pulg.) 26 mm (1.02 pulg.) 3.0 ms 0.5 ms 2.1 ms 0.3 ms 0.7 ms 0.7 ms 15 m 0.65 pF 0.2 pF 1 x 106 1 x 106 10 m

Categora

Certificaciones Contactos de encapsulados Distancia de operacin Cierre Distancia de operacin Apertura Tiempo de cierre Tiempo de desactivacin

Descripcin
La gama de interruptores de seguridad Ferrogard de accionamiento magntico ofrece confiabilidad sin contacto as como tolerancia de desalineamiento. Los interruptores han sido diseados para instalarse de manera que, cuando se abre una puerta de guarda, la accin del accionador magntico al retirarse del interruptor abra los contactos de seguridad N.C., los cuales se usan para el aislamiento de la alimentacin elctrica de control a un elemento de control primario de la mquina. El FRS1, FRS2, FRS20 y FRS21 tienen envolventes rectangulares. Estos interruptores Ferrogard han sido sellados segn IP67 (NEMA6P) y son ideales para ambientes hmedos. A diferencia de otros interruptores magnticos, los interruptores Ferrogard cuentan con contactos de seguridad protegidos para asegurar que no entren en fallo en condiciones de peligro. Adems, algunas versiones cuentan con contactos de seales auxiliares independientes para indicar la condicin de la guarda. Todos los interruptores Ferrogard tienen proteccin contra sobrecarga interna no borrable en el contacto de seguridad. Se deben proteger con un fusible externo con clasificacin segn lo indicado en la tabla de especificaciones.

Tiempo de rebote Resistencia inicial de contacto Capacitancia inicial, terminal a terminal Resistencia inicial de aislamiento, terminal a terminal

Capacidad de conmutacin de contacto de seguridad CA 250 VCA 2 A mx. CC 24 VCC 1 A mx. Fusible externo de contacto de seguridad CA <1.6 A accin rpida CC Accin rpida de <0.8 A Capacidad de conmutacin de contacto auxiliar 300 VCC, 250 VCA, 0.5 A, incluye la corriente de entrada al momento del arranque 15 VA/10 W, se pueden usar con circuitos de CA/CC 600 VCA 600 VCA 10 C a +65 C (14 a 149 F) IP67 (NEMA6P)

Voltaje inicial mn. de cierre Temperatura de operacin Proteccin del envolvente Cable FRS 1

2 cables de 0.75 mm2 (18 AWG) Forro con dim. ext. de 5.6 mm (0.22 pulg. 4 cables de 0.50 mm2 (20 AWG) Forro con dim. ext. de 6.5 mm (0.26 pulg.) 4 cables de 0.50 mm2 (20 AWG) Forro con dim. ext. de 6.5 mm (0.26 pulg.) 4 cables de 0.50 mm2 (20 AWG) Forro con dim. ext. de 7.5 mm (0.3 pulg.) M12 x 1, 4 6 pines Plstico ABS rojo moldeado Todas las posiciones Se incluyen tornillos de montaje de seguridad M4 FRS 1 FRS 2 FRS 20 FRS 21 Detector Accionador 35 g (0.08 lbs) 85 g (0.19 lbs) 40 g (0.09 lbs) 85 g (0.19 lbs) 43 g (0.09 lbs) 85 g (0.19 lbs) 43 g (0.09 lbs) 85 g (0.19 lbs) 1 x 106 a la carga nominal 10 x 106 7 g, 10 a 200 Hz 50 g

FRS 2

Caractersticas
Accionamiento sin contacto Alta tolerancia al desalineamiento Alta corriente de conmutacin (hasta 2 A de CA, 1 A de CC) Envolvente rectangular plstico (IP67) Cable o conectores (QD)
FRS 20

FRS 21

Desconexiones rpidas Material del envolvente Montaje

Peso (no incluye el cable)

Vida til elctrica Vida til mecnica Vibracin Choque

3-42

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 1, 2, 20 y 21
Seleccin de productos
Capacidad de conmutacin Contactos de de contacto de seguridad seguridad Contactos auxiliares Conexin Cable de 2 m Cable de 4 m Ninguno Cable de 6 m Cable de 8 m Cable de 10 m Cable de 2 m 1 N.C. Cable de 4 m Cable de 6 m Cable de 8 m 1 N.A. 250 VCA 2 A Cable de 10 m Cable de 15 m Cable de 20 m Conector micro de 4 pines Cable de 4 m Ninguno Conector micro de 4 pines Cable de 2 m 2 N.C. 1 N.A. Cable de 4 m Cable de 6 m Cable de 10 m Conector micro de 6 pines Cable de 2 m 1 N.C. 1 N.A. Conector micro de 4 pines Conector micro de 4 pines Cable de 2 m 2 N.C. 1 N.A. Cable de 4 m Cable de 6 m Conector micro de 6 pines Cable de empalme, recto de 4 pines, 2 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 5 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 10 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 6 pines, 2 m. Vea la pgina 15-11 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 6 pines, 5 m. Vea la pgina 15-11 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 6 pines, 10 m. Vea la pgina 15-11 para obtener detalles y longitudes adicionales. Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador. FRS 21 FRS 2 440N-G02094 FRS 20 440N-G02090 440N-G02058 440N-G02077 440N-G02083 440N-G02099 889D-F4AC-2 889D-F4AC-5 889D-F4AC-10 889R-F6ACA-2 889R-F6ACA-5 889R-F6ACA-10 FRS 21 ABS plstico FRS 20 440N-G02097 440N-G02055 440N-G02061 440N-G02060 440N-G02059 440N-G02098 440N-G02092 FRS 2 FRS 1 Material del envolvente Tipo Nmero de catlogo 440N-G02001 440N-G02004 440N-G02022 440N-G02041 440N-G02015 440N-G02002 440N-G02014 440N-G02038 440N-G02033 440N-G02019 440N-G02043 440N-G02040 440N-G02093 440N-G02085

Ninguno 24 VCC 1 A

Accesorios
Descripcin Accionador de repuesto Nmero de pgina Nmero de catlogo 440N-A02005

3-43

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 1, 2, 20 y 21 Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
Interruptor, versin cable 15-19 (0.59-0.75) 30 (1.18) 4 (0.16) Accionador Interruptor, versin conector

4 (0.16) 15 (0.59) 13 (0.51)

= =

60 (2.36)

76 (2.99)

60 (2.36)

76 (2.99)

5 (0.2)

5 (0.2)

2 (0.08) 7 (0.28)

60 (2.36)

76 (2.99)

5 (0.2)

2 (0.08)

5 (0.2)

5 (0.2)

2 (0.08)

=
8 (0.31) 30 (1.18)

19.5 (0.77)

=
15 (0.59) 8 (0.31) 4 (0.16)

= = =
30 (1.18)

5 (0.20)

19.5 (0.77)

= =

=
19.5 (0.77)

8 (0.31)

15 (0.59)

Diagramas de cableado tpicos


FRS 1 Cable Marrn Seguridad N.C. Fusible externo Azul Azul Negro Aux. N.A Blanco Aux. N.A Cable Marrn Seguridad N.C. Fusible externo FRS 2 Conector

Seguridad N.C. Fusible externo

FRS 20 Cable Marrn Azul Negro Blanco Seguridad N.C. Fusible externo Seguridad N.C. Fusible externo Conector Seguridad N.C. Fusible externo Seguridad N.C. Fusible externo Cable Rojo y azul

FRS 21 Conector Seguridad N.C. Fusible externo

Rojo

Seguridad N.C. Fusible externo Aux. N.A. Seguridad N.C. Fusible externo

Rojo y negro Seguridad N.C. Fusible externo Rojo y blanco Rojo y amarillo Aux. N.A. Verde

3-44

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 1, 2, 20 y 21 Detalles de aplicacin
Principio de operacin

El Ferrogard cuenta con un exclusivo encapsulamiento industrial de alta potencia capaz de conmutar a 15 A. Un fusible de proteccin contra sobrecarga no borrable corrige la capacidad nominal del interruptor. Cuando el accionador se presenta al interruptor, el campo magntico de alta intensidad del accionador hace que se cierren los contactos. Al retirarse el accionador (cuando se abre la puerta), los contactos de seguridad se abren.

Curva de operacin tpica

10 (0.39)

Cuando el accionador se alinea con el interruptor, la distancia de deteccin es 10 mm (0.39 pulg.). A medida que aumenta la cantidad de desalineamiento, disminuye la distancia de deteccin. Ms all de 4 mm (0.16), el interruptor no se activar en presencia del accionador.

4 (0.16)

4 (0.16)

Tolerancia de desalineamiento en materiales no ferrosos

3-45

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 3, 4 y 5 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE y cULus Seguridad Auxiliar

Categora

Certificaciones Contactos encapsulados

Distancia de operacin Cierre FRS3 12 mm (0.47 pulg.) 21 mm (0.83 pulg.) FRS4 12 mm (0.47 pulg.) 13 mm (0.51 pulg.) FRS5 12 mm (0.47 pulg.) NA

Descripcin
La gama de interruptores Ferrogard de accionamiento magntico ofrece confiabilidad sin contacto as como tolerancia de desalineamiento. Los interruptores han sido diseados para instalarse de manera que, cuando se abre una puerta de guarda, la accin del accionador magntico al retirarse de los interruptores abra los contactos de seguridad N.C., los cuales se usan para el aislamiento de la potencia de control a un elemento de control primario de la mquina. Los interruptores FRS 3, 4 y 5 cuentan con conexiones de terminacin. El usuario debe perforar un orificio en el envolvente en un lugar conveniente para permitir la entrada del cableado al envolvente. La cubierta se fija con tornillos de seguridad con proteccin contra manipulacin indebida. A diferencia de otros interruptores magnticos, los interruptores Ferrogard cuentan con contactos de seguridad protegidos para asegurar que no entren en fallo en condiciones de peligro. Adems, algunas versiones cuentan con contactos de seales auxiliares independientes para indicar la condicin de la guarda. Todos los interruptores Ferrogard tienen proteccin contra sobrecarga interna no borrable en el contacto de seguridad. Se deben proteger con un fusible externo clasificado segn se indica en la tabla de especificaciones.

Distancia de operacin Apertura FRS3 23 mm (0.91 pulg.) 24 mm (0.94 pulg.) FRS4 23 mm (0.91 pulg.) 10 mm (0.39 pulg.) FRS5 12 mm (0.47 pulg.) NA Tiempo de cierre Tiempo de desactivacin Tiempo de rebote Resistencia inicial de contacto Capacitancia inicial, terminal a terminal Resistencia inicial de aislamiento, terminal a terminal Capacidad de conmutacin de contacto de seguridad Fusible externo de contacto de seguridad Capacidad de conmutacin de contacto auxiliar 3.0 ms 0.5 ms 2.1 ms 0.3 ms 0.7 ms 0.7 ms 15 m 0.65 pF 0.2 pF 1.x.106 250 VCA 2 A mx. 1.6 A accin rpida 300 VCC, 250 VCA, 0.5 A, incluye la corriente al momento del arranque. 15 VA/10 W, se pueden usar con circuitos de CA/CC 600 VCA 600 VCA 10 C a +65 C (14 a 149 F) IP65 (NEMA 13) Plstico ABS rojo moldeado Todas las posiciones Se incluyen tornillos de montaje de seguridad M4. 1 x 106 a la carga nominal 10 x 106 10 a 200 Hz 50 g 1x106 10 m

Voltaje inicial mn. de cierre Temperatura de operacin Proteccin del envolvente Material del envolvente Montaje

Caractersticas
Accionamiento sin contacto Alta tolerancia al desalineamiento Alta corriente de conmutacin (hasta 2 A) Diversas configuraciones de contactos Conexiones de terminaciones

Vida til elctrica Vida til mecnica Vibracin Choque

3-46

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 3, 4 y 5 Seleccin de productos
Capacidad de conmutacin de contacto de seguridad Material del envolvente Contactos de seguridad Contactos auxiliares 1 N.C. 250 VCA 2 A Terminales ABS plstico 1 N.C. 1 N.A. Ninguno
Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar.

Conexin

Tipo FRS 3 FRS 4 FRS 5

Nmero de catlogo 440N-G02003 440N-G02008 440N-G02009

Accesorios
Descripcin Accionador de repuesto Nmero de pgina Nmero de catlogo 440N-A02005

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor Accionador 30 (1.18) 2 orificios 4 paso 50 (1.97)

6 (0.24)

=
36 (1.41) 4 (0.16)

15 (0.59)

5 (0.2) 57 (2.24) 69 (2.72) 60 (2.36) 76 (2.99) 5 (0.2)

38.5 (1.52)

2 (0.08) 7 (0.28)

38 (1.5)

6 (0.24)

25 (0.98)

=
8 (0.31) 19.5 (0.77)

Diagramas de cableado tpicos


FRS 3 FRS 4 FRS 5

1 2 3 4

Seguridad N.C. Fusible externo Aux. N.C.

1 2 3 4

Seguridad N.C. Fusible externo Aux. N.A.

= =
1 2
Seguridad N.C. Fusible externo

Detalles de aplicacin
Vea la pgina 3-54 para obtener informacin sobre los principios de operacin y ejemplos de montaje.

3-47

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 6, 9 y 10 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE y cULus 1 N.C. Contacto de seguridad 1 x 106 a la carga nominal

Categora

Certificaciones Configuracin de contactos Vida til elctrica

Descripcin
La gama de interruptores de seguridad Ferrogard de accionamiento magntico ofrece confiabilidad sin contacto as como tolerancia de desalineamiento. Los interruptores han sido diseados para instalarse de manera que, cuando se abre una puerta de guarda, la accin del accionador magntico al retirarse del interruptor abre el contacto de seguridad N.C., el cual se usa para el aislamiento de la alimentacin de control a un elemento de control primario de la mquina. Los detectores y accionadores FRS 6, 9 y 10 incorporan envolventes con perfil delgado para montarse en lugares estrechos. Han sido sellados para ofrecer proteccin contra inclemencias ambientales segn IP67 (NEMA6P) y, como consecuencia, son ideales para los ambientes hmedos.Estos interruptores Ferrogard cuentan con dos superficies detectoras activas, las cuales proporcionan opciones de montaje ms flexibles. A diferencia de otros interruptores magnticos, los interruptores Ferrogard cuentan con contactos de seguridad protegidos para asegurar que no entran en fallo en condiciones de peligro. Todos los interruptores Ferrogard tienen proteccin contra sobrecarga interna no borrable en el contacto de seguridad. Se deben proteger con un fusible externo clasificado segn se indica en la tabla de especificaciones.

Capacidad de conmutacin de contacto de seguridad FRS 6 250 VCA 2 A mx. FRS 9 24 VCC 1 A mx. FRS 10 110 VCA 3 A mx. Fusible externo de contacto de seguridad FRS 6 <1.6 A accin rpida FRS 9 <0.8 A accin rpida FRS 10 <2.5 A accin rpida Distancia de operacin Cierre Distancia de operacin Apertura Tiempo de cierre Tiempo de desactivacin Tiempo de rebote Resistencia inicial de contacto Capacitancia inicial, terminal a terminal Resistencia inicial de aislamiento, terminal a terminal Voltaje inicial mn. de cierre Vida til mecnica Montaje 12 mm (0.47 pulg.) 23 mm (0.91 pulg.) 3.0 ms 2.1 ms 0.7 ms 15 m 0.65 pF 1 x 106 600 VCA 10 x 106 Todas las posiciones Se incluyen tornillos de montaje de seguridad M4. Detector Accionador 28 g (0.06 lbs) 70 g (0.15 lbs) 28 g (0.06 lbs) 70 g (0.15 lbs) 28 g (0.06 lbs) 70 g (0.15 lbs) Plstico ABS rojo moldeado 2 cables de 0.75 mm2 (18 AWG) Forro con dim. ext. de 5.6 mm (0.22 pulg. 10 C a +65 C (14 a +149 F) IP67 (NEMA 6P) 7 a 15 g, 10 a 200 Hz 50 g

Caractersticas
Accionamiento sin contacto Alta tolerancia al desalineamiento Alta corriente de conmutacin (hasta 3 A) Dos superficies detectoras Clasificacin IP67 (NEMA 6P) Envolventes con perfil delgado

Peso (no incluye el cable) FRS 6 FRS 9 FRS 10 Material del envolvente Cable Temperatura de operacin Ambiente Vibracin Choque

3-48

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard 6, 9 y 10 Seleccin de productos
Capacidad de conmutacin de contacto de seguridad Material del Conexin envolvente Tipo Cable de 2 m Cable de 4 m Cable de 6 m FRS 6 Cable de 10 m Conector micro de 4 pines Cable de 2 m 1 N.C. Ninguno ABS plstico Cable de 4 m Cable de 6 m FRS 9 Cable de 10 m Conector micro de 4 pines Cable de 2 m FRS 10 Cable de 4 m Cable de empalme, recto de 4 pines, 2 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 5 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 10 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Contactos de seguridad Contactos auxiliares

250 VCA 2 A

Nmero de catlogo 440N-G02023 440N-G02028 440N-G02032 440N-G02013 440N-G02095 440N-G02044 440N-G02075 440N-G02082 440N-G02089 440N-G02096 440N-G02045 440N-G02088 889D-F4AC-2 889D-F4AC-5 889D-F4AC-10

24 VCC 1 A

110 VCA 3 A

Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar.

Accesorios
Descripcin Accionador de repuesto Nmero de pgina Nmero de catlogo 440N-A02025

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor, versin cable Accionador 19.5 (0.77) 4.5 (0.18) 73 (2.87) 7 (0.28) 19.5 (0.77) 13 (0.51) 4.5 (0.18) 73 (2.87) 84 (3.31) 54 (2.13) Interruptor, versin conector

84 (3.31) 46 (1.81)

54 (2.13)

82 (3.23) =

46 (1.81) 12 (0.47)

46 (1.81)

12 (0.47)

6 (0.23)

7 16 (0.28) (0.62)

4 (0.16) 11 (0.43) 19 (0.75)

= =

4.5 (0.18)

4.5 (0.18)

6 (0.24)

7 16 (0.28) (0.63)

4 (0.16) 11 (0.43) 19 (0.75)

Diagramas de cableado tpicos


Cable Marrn Seguridad N.C. Fusible externo Azul Conector

Seguridad N.C. Fusible externo

Detalles de aplicacin
Vea la pgina 3-54 para obtener informacin sobre los principios de operacin y ejemplos de montaje.

46 (1.81)

3-49

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard GD2 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE y cULus Seguridad Auxiliar 12 mm (0.47 pulg.) 15 mm (0.59 pulg.) 23 mm (0.91 pulg.) 26 mm (1.02 pulg.) 3.0 ms 0.5 ms 2.1 ms 0.3 ms 0.7 ms 0.7 ms 15 m 10 m 0.65 pF 0.2 pF 1x106 1x106

Categora

Certificaciones Contactos encapsulados Distancia de operacin Cierre Distancia de operacin Apertura Tiempo de cierre

Descripcin
La gama de interruptores de seguridad Ferrogard de accionamiento magntico ofrece confiabilidad sin contacto as como tolerancia de desalineamiento. Los interruptores han sido diseados para instalarse de manera que, cuando se abre una puerta de guarda, la accin del accionador magntico al retirarse del interruptor abra los contactos de seguridad N.C., los cuales se usan para el aislamiento de la alimentacin de control a un elemento de control primario de la mquina. La versin GD2 cuenta con un envolvente de acero inoxidable que proporciona proteccin adicional contra los impactos accidentales del envolvente. Los contactos han sido completamente sellados segn los requisitos IP68 (NEMA6P) y, como consecuencia, son ideales para uso en ambientes hmedos. El GD2 tambin tiene un ms amplio rango de temperaturas que los interruptores plsticos Ferrogard para satisfacer una ms amplia gama de aplicaciones. A diferencia de otros interruptores magnticos, los interruptores Ferrogard cuentan con contactos de seguridad protegidos para asegurar que no entren en fallo en condiciones de peligro. Adems, algunas versiones cuentan con contactos de seales auxiliares independientes para indicar la condicin de la mquina y guarda. Todos los interruptores Ferrogard tienen proteccin contra sobrecarga interna no borrable en el contacto de seguridad. Se deben proteger con un fusible externo clasificado segn se indica en la tabla de especificaciones.

Tiempo de desactivacin Tiempo de rebote Resistencia inicial de contacto Capacitancia inicial, terminal a terminal Resistencia inicial de aislamiento, terminal a terminal

Capacidad de conmutacin de contacto de seguridad CA 250 VCA 2 A mx. CC 24 VCC 1 A mx. Fusible externo de contacto de seguridad CA <1.6 A accin rpida CC <0.8 A accin rpida Capacidad de conmutacin de contacto auxiliar 300 VCC, 250 VCA, 0.5 A, incluye la corriente al momento del arranque. 15 VA/10 W, se pueden usar con circuitos de CA/CC 600 VCA 600 VCA IP68 (NEMA 6P) 7 cables de 0.50 mm2 (20 AWG) Elastmero termoplstico flexible Forro con dim. ext. de 8 mm (0.2 pulg.) 25 C a +125 C (13 a +257 F) Acero inoxidable; BS3146 ANC4B (316L) Todas las posiciones; se incluyen tornillos de montaje de seguridad M4

Voltaje inicial mn. de cierre Ambiente Cable

Temperatura de operacin Material del envolvente Montaje

Caractersticas
Accionamiento sin contacto Alta tolerancia al desalineamiento Alta corriente de conmutacin (hasta 2 A de CA, 1 A de CC) Amplio rango de temperaturas (25 C a +125 C) Envolvente de acero inoxidable Diversas configuraciones de contactos

Peso (no incluye el cable) Accionador de detector 156 g (0.34 lbs) 168 g (0.37 lbs) Vida til elctrica Vida til mecnica Vibracin Choque 1 x 106 a la carga nominal 10 x106 7 a 15 g, 10 a 200 Hz 50 g

3-50

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard GD2 Seleccin de productos
Capacidad de conmutacin de contacto de seguridad 250 VCA 2 A Contactos de seguridad 1 N.C. 2 N.C. 1 N.C. 24 VCC 1 A 2 N.C. Contactos auxiliares 1 N.A. Ninguno 1 N.A. Ninguno 1 N.A. Material del envolvente Nmero de catlogo 440N-G02112 440N-G02113 440N-G02117 440N-G02118 440N-G02119 440N-G02123

Conexin

Cable de 3 m

Acero inoxidable

Tipo FRS 2 GD2 FRS 20 GD2 FRS 21 GD2 FRS 2 GD2 FRS 20 GD2 FRS 21 GD2

Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador.

Accesorios
Descripcin Accionador Nmero de pgina Nmero de catlogo 440N-A02128

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor 4.4 (0.17) 8 (0.31) 62.5 (2.46) 11.5 (0.45) 8 (0.31) 6 (0.24) 39.25 (1.55) 39.25 (1.55) Accionador 33.5 (1.32) 8 (0.31) 16.75 (0.66) 39.25 (1.55) 39.25 (1.55) 16 (0.63)

78.5 (3.09)

5 (0.20)

7 (0.28) 16.75 (0.66)

19.5 (0.77) 16 (0.63) 33.5 (1.32) 7 (0.28) 19.5 (0.76)

62.5 (2.46)

11.5 (0.45)

4.4 (0.17)

Diagramas de cableado tpicos


FRS 2 Rojo Azul Amarill Verde FRS 20 Rojo Azul Negro Blanco Nota: la unidad se debe conectar a una estructura metlica conectada a tierra o conectarse a tierra mediante el cableado de campo segn los requisitos NEC. Seguridad N.C. Fusible Seguridad N.C. Fusible Aux. N.A Seguridad N.C. Fusible FRS 21 Azul Rojo Negro Blanco Amarillo Verde Aux. N.A Seguridad N.C. Fusible Seguridad N.C. Fusible

Detalles de aplicacin
Vea la pgina 3-54 para obtener informacin sobre los principios de operacin y ejemplos de montaje.

78.5 (3.09)

5 (0.20)

3-51

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard GS1 y GS2 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 GS1 y GS2 Marca CE y cULus GS2 Ex EExd IIC T6 Baseefa Distancia de operacin Cierre GS1 12 mm (0.47 pulg.) GS2 15 mm (0.59 pulg.)

Categora

Certificaciones

Descripcin
La gama de interruptores de seguridad Ferrogard de accionamiento magntico ofrece confiabilidad sin contacto as como tolerancia de desalineamiento. Los interruptores han sido diseados para instalarse de manera que, cuando se abre una puerta de guarda, la accin del accionador magntico al retirarse del interruptor abre los contactos de seguridad N.C., los cuales se usan para el aislamiento de la alimentacin de control a un elemento de control primario de la mquina. Los interruptores GS1 y GS2 estn diseados para aplicaciones de uso pesado. El interruptor GS1 se encuentra en un envolvente de acero inoxidable o latn. El interruptor GS2 ofrece las mismas caractersticas que el interruptor GS1, pero se encuentra en un envolvente EX para uso en lugares peligrosos. A diferencia de otros interruptores magnticos, los interruptores Ferrogard cuentan con contactos de seguridad protegidos para asegurar que no entran en fallo en condiciones de peligro. Todos los interruptores Ferrogard tienen proteccin contra sobrecarga interna no borrable en el contacto de seguridad. Se deben proteger con un fusible externo clasificado segn se indica en la tabla de especificaciones. Vea la seccin A prueba de explosiones en la pgina 16-1 para obtener ms informacin acerca de la versin EX del interruptor Ferrogard GS2.

Distancia de operacin Apertura GS1 23 mm (0.91 pulg.) GS2 26 mm (1.02 pulg.) Tiempo de cierre Tiempo de desactivacin Tiempo de rebote Resistencia inicial de contacto Capacitancia inicial, terminal a terminal Resistencia inicial de aislamiento, terminal a terminal Capacidad de conmutacin de contacto de seguridad Fusible externo de contacto de seguridad Voltaje inicial mn. de cierre Temperatura de operacin Proteccin del envolvente Cable 3.0 ms 2.1 ms 0.7 ms 15 mW 0.65 pF 1 x 106 250 VCA 2 A mx. Accin rpida de <1.6 A 600 VCA 25 C a +125 C (13 a +257 F) IP68 (NEMA 6P)

2 GS1 Latn 2 cables de 0.75 mm (18 AWG) Forro de PVC gris con dim. ext. de 6 mm (0.24 pulg.) Acero inoxidable 2 cables de 0.75 mm2 (18 AWG) Forro de PVC blanco con dim. ext. de 7 mm (0.28 pulg.)

Caractersticas
Accionamiento sin contacto Alta tolerancia al desalineamiento Alta corriente de conmutacin (2 A de CA) Envolventes metlicos (IP 68) Versin EX disponible
Material del envolvente Montaje

GS2 2 cables trenzados de 1.34 mm2 (16 AWG) Forro de poliolefino con dim. ext. de 8.4 mm (0.32 pulg.) Acero inoxidable o latn Todas las posiciones Se incluyen tornillos de montaje de seguridad M3.

Peso (no incluye el cable) GS1 Latn 381 g (0.84 lbs) GS1 Acero 388 g (0.86 lbs) Accionador 116 g (0.26 lbs) Vida til elctrica Vida til mecnica Vibracin Choque Versin Ex 1 x 106 a la carga nominal 10 x 106 15 g, 20 a 1.000 Hz 50 g Vea la seccin A prueba de explosiones

3-52

Interruptores con enclavamiento

Interruptores sin contacto


Ferrogard GS1 y GS2 Seleccin de productos
Capacidad de conmutacin de contacto de seguridad Contactos de seguridad Contactos auxiliares Nmero de catlogo 440N-G02048 GS 1 440N-G02049 440N-H02046 GS 2 Ex 440N-H02047

Conexin Cable de 2 m

Envolvente Latn Acero inoxidable Latn

Tipo

250 VCA 2 A

1 N.C.

Ninguno Cable de 3 m

Acero inoxidable

Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador.

Accesorios
Descripcin Accionador, Alnico Accionador, epoxi pintado Se usa con Interruptor de latn Acero inoxidable Nmero de pgina Nmero de catlogo 440N-A02056 440N-A02057

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor GS1 Accionador GS1 y GS2 Interruptor GS2

19 (0.75) 12 (0.47) 54 (2.13) 67 (2.64) 114.5 (4.51) 11 (0.43) 54 (2.13) 127 (5) 20 (0.79) 17 (0.67) 60 (2.36) 25 (0.98) 7 (0.28) Seguridad N.C. Fusible externo

46 (1.81)

33.5 (1.32)

6.5 19 (0.26)(0.75) 16 (0.63)

13 (0.51)

6.5 22 (0.87) (0.26)

Diagramas de cableado tpicos


Cable Marrn Seguridad N.C. Fusible externo Azul Conector

Nota: La unidad se debe conectar a una estructura metlica conectada a tierra o conectarse a tierra mediante el cableado de campo segn los requisitos NEC.

Detalles de aplicacin
Vea la pgina 3-54 para obtener informacin sobre los principios de operacin y ejemplos de montaje.

30 (1.18)

3-53

Interruptores con enclavamiento

Interruptores sin contacto


Aplicaciones Ferrogard Detalles de aplicacin
Principio de operacin El Ferrogard cuenta con un exclusivo encapsulamiento industrial de alta potencia capaz de conmutar a 15 A. Un fusible de proteccin contra sobrecarga no borrable corrige la capacidad nominal del interruptor. Cuando el accionador se presenta al interruptor, el campo magntico de alta intensidad del accionador hace que se cierren los contactos. Al retirarse el accionador (cuando se abre la puerta), los contactos de seguridad se abren.

Ejemplo de montaje 1 Puerta cerrada, MARCHA de la mquina Puerta abierta, PARO de la mquina, la puerta cubre el interruptor

2 mm Puerta

No hay acceso al interruptor, evitndose as la posibilidad de que se desactive el enclavamiento.

Puerta deslizable

Nota: Siempre que sea posible, las unidades se deben montar de manera que no se pueda obtener acceso al interruptor cuando est abierta la puerta de la guarda, evitndose as la posibilidad de que se desactive el sistema de seguridad.

Ejemplo de montaje 2 Mn. 50 mm

2 mm Interruptor Interruptor Accionador Puerta 2

Accionador Puerta 1

Se aconseja, siempre que sea posible, montar el interruptor y el accionador en materiales no ferrosos, de lo contrario las distancias de operacin pueden verse afectadas. Si se va a realizar el montaje en material ferroso, se recomienda usar un separador de plstico de 5 mm.

3-54

Interruptores con enclavamiento

Interruptores sin contacto


Aplicaciones Ferrogard Detalles de aplicacin
Nota: Segn los requisitos de la directiva de maquinaria, toda maquinaria se debe someter a un anlisis de riesgos para determinar el nivel (o categora) necesario del sistema de control de seguridad o medidas de eliminacin de peligros. El producto Ferrogard cumple con los requisitos EN1088, pero es posible que no sea apropiado para todos los tipos de mquinas o ambientes. Cuando hay presentes materiales magnticos o se prev que a travs del funcionamiento o uso de la mquina, es posible la operacin de Ferrogard por imanes diferentes al accionador suministrado, se recomienda usar un interruptor Guardmaster de Allen-Bradley. Otras opciones sin contacto incluyen: Ferrocode (el cual utiliza tcnicas de codificacin adicionales para evitar la anulacin por medios simples). Como alternativa, se pueden tomar medidas adicionales para evitar que se pase por alto fcilmente Ferrogard. Se recomienda seguir el ejemplo de instalacin proporcionado en estas instrucciones y las de EN1088.

Aplicaciones tpicas
Guarda deslizable Nota: Las guardas extrables que usan interruptores sin contacto pueden requerir dos interruptores, uno a cada lado de la guarda, o el uso de una solapa para evitar que se levante inicialmente el borde sin enclavamiento. Guarda extrable Guarda con bisagras

3-55

Interruptores con enclavamiento

Interruptores sin contacto


Unidades de control Sipha Especificaciones (continuacin)
Entradas de seguridad Sipha 1 1 N.C. y 1 N.A. Sipha 2 y 6 6 x (1 N.C. y 1 N.A.) Resistencia de entrada mx. Terminales 1 4 200 Terminales 2 3 150 Velocidad mn. de aprox. Salidas de seguridad Sipha 1 1 N.A. Sipha 1 2 N.A. Sipha 6 2 N.A. + 1 N.A. retardado (0.6 a 30 seg) Capacidad nominal de salida Corriente/voltaje/carga mn. conmutados Fusible de salida mx. recomendado B300, CA-15, 4 A/250 VCA P300, CC-15, 2 A/30 VCC 10 mA/10 V Accin rpida de 5 A de CA, accin rpida de 3 A de CC 17 mm/s (0.67 pulg./s)

Descripcin
Con aplicaciones de velocidades ms rpidas y mayor complejidad, un interruptor magntico sencillo puede resultar insuficiente para satisfacer riesgos mayores. Como consecuencia, el diseo de Sipha incorpora varios elementos magnticamente sensibles, los cuales se deben activar en una secuencia determinada para funcionar correctamente. El detector Sipha est diseado para funcionar con su propio accionador y ayuda a evitar la posibilidad de desactivacin por un imn sencillo. La unidad de control est disponible en tres tipos:La unidad de control Sipha 1 funciona con 24 VCA/CC y ofrece 1 salida de seguridad N.A. y 1 salida auxiliar de estado slido N.C La unidad de control Sipha 2 funciona con 24 VCA/CC, 110 VCA 230 VCA y ofrece 2 salidas de seguridad N.A. y 1 salida auxiliar N.C. La unidad Sipha 6 tiene terminales de cableado para hasta 6 detectores, una salida retardada para paros de Categora 1 y ofrece la misma amplia gama de capacidades de fuentes de alimentacin elctrica que la unidad de control Sipha 2. Es posible conectar entre 2 y 6 detectores Sipha a la unidad de control Sipha 6. Un microinterruptor interno silencia las conexiones no usadas a los detectores 1, 2, 3 y 4. Esto permite monitorear individualmente cada enclavamiento y proporciona mayor integridad del sistema de seguridad comparado con seis enclavamientos de una sola unidad de control Sipha 2. Las unidades de control Sipha han sido diseadas para funcionar con los detectores y accionadores Sipha. Los controladores cuentan con restablecimiento automtico.

Salidas auxiliares (no para uso de seguridad) Sipha 1 1 N.C. MOSFET fotovoltaico (en resistencia tpica de 36 ) Sipha 2 y 6 1 N.C. Capacidad de conmutacin de salida auxiliar Sipha 1 100 mA/230 VCA, 100 mA/24 VCC Sipha 2 y 6 2 A/230 VCA, 2 A/24 VCC Indicadores LED Indicador LED verde = alim. elc. activada Indicador LED verde = salida cerrada 2,500 V C de acuerdo con VDE 0110 3 10 C a +55 C (+14 a +131 F) 90 % de humedad relativa 1 Nm (8.85 lbpulg.) 0.2-2.5 mm2 (24-14 AWG) Policarbonato rojo Riel DIN de 35 mm Sipha 1 140 g (0.31 lbs) Sipha 2 410 g (0.90 lbs) Sipha 6 675 g (1.49 lbs) Vida til elctrica 220 VCA/4 A 880 VA cos=.35 220 VCA/1.7 A 375 VA/ cos=.6 30 VCC/2 A 60 W 10 VCC/0.01 A/0.1 W Vida til mecnica Vibracin Choque 100,000 operaciones 500,000 operaciones 1,000,000 operaciones 2,000,000 operaciones 2,000,000 operaciones 1 mm, 10 a 55 Hz 30 g, 11 ms medio seno

Voltaje de resistencia de impulso Grupo de instalacin Grado de contaminacin Temperatura de operacin Humedad Ajustes de par Tornillos terminales Calibre de conductor Material del envolvente Montaje Peso

Caractersticas
Accionamiento sin contacto Deteccin magnticamente codificada La unidad de control sirve como rel de seguridad Hay disponibles cuatro tipos de interruptores

Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC60947-5-1, ANSI B11.19, AS4024.1 Sipha 1 y 2 Cat. 3 segn EN954-1 Sipha 6 Cat. 4 segn EN954-1 Certificaciones Marca CE, cULus y TV Fuente de alimentacin elctrica Sipha 1 24 VCA/CC Sipha 2 y 6 24 VCA/CC y 110/230 VCA Consumo de energa Sipha 1 <2 VA Sipha 2 y 6 <4 VA

Categora

3-56

Interruptores con enclavamiento

Interruptores sin contacto


Unidades de control Sipha Seleccin de productos
Envolvente Voltaje de fuente de alim. elc. Contactos de seguridad Contactos auxiliares Envolvente Tipo Nmero de catlogo

24 VCA/CC

1 N.A.

1 N.C. Estado slido

22.5 mm

Unidad de control 1

440N-S32013

24 VCA/CC 110 V/230 VCA

2 N.A.

1 N.C.

45 mm

Unidad de control 2

440N-S32021

24 VCA/CC 110/230 VCA

2 N.A. 1 N.A. Retardo

1 N.C.

90 mm

Sipha 6

440N-S32052

Accesorios
Envolvente Fusible de repuesto de 500 mA Nmero de pgina 14-6 Catalogue Number 440R-A31562

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Unidad de control Sipha de tipo 1 22.5 (0.89) 99 (3.9) 120 (4.72) 45.5 (1.79) Unidad de control Sipha tipo 2

82 (3.23)

75 (2.95)

Montaje en riel DIN de 35 mm

Montaje en riel DIN de 35 mm

Unidad de control Sipha 6

76 (2.99)

83 (3.27) 118 (4.65)

84 (3.31)

90 (3.54)

73 (2.87)

3-57

Interruptores con enclavamiento

Interruptores sin contacto


Unidades de control Sipha Diagramas de bloques
Sipha 1 Sipha 1
L F1 N +Ve F2 K1 K1 K2 K1 X1 X2 13 23 21

A1

A2 K1

X1

X2

13

21

K2

K1

110/230

24 VCC

Alim.

Salida Lgica

K1

K2

K2

Alim.

Salida
K1 K2 K2

Lgica

NC
-Ve 1 2 3 4 14 24 22

14

22

Diagramas de cableado tpicos


24 VCA/CC

Azul Accionador Sipha Detector Sipha Amarillo

L1

L2

L3

1 A1 13 21 X1

K1

Guarda cerrada

Unidad de control Sipha 1

Restableci- K2 miento

3 4 A2 14

22 X2

Verde Rojo

K1 K2

Aux a indicador o entrada PLC

Detector Sipha sencillo, suministro de 24 V, salida de dos canales, restablecimiento automtico, salida monitoreada
L1
110 VCA

Azul Accionador Sipha Detector Sipha Amarillo

L1

L2

L3

A1

13

23

31 X1

K1

Guarda cerrada

Unidad de control 110V Sipha 2 230V

Restableci- K2 miento

A2

14

24

32 X2

Verde Rojo

K1 K2 N

Aux a indicador o entrada PLC

Detector Sipha sencillo, suministro de 110 VCA, salida de dos canales, restablecimiento automtico, salida monitoreada

3-58

Interruptores con enclavamiento

Interruptores sin contacto


Unidades de control Sipha Diagramas de cableado tpicos (continuacin)
24 VCA/CC

Azul Accionador Sipha Detector Sipha Amarillo

L1

L2

L3

Negro

Blanco

1 A1
Unidad de control Sipha 2

13

23

31 X1

K1

Guarda cerrada

Contacto aux. para indicacin Azul

Restableci-K2 miento

3 4 A2
Accionador Sipha Detector Sipha

14

24

32 X2

Rojo Amarillo

Negro

Blanco

Guarda cerrada

Contacto aux. para indicacin Azul

Accionador Sipha

Detector Sipha

Rojo

Guarda cerrada

Contacto aux. para indicacin

Detector Sipha mltiple, restablecimiento manual, salida de dos canales, salida monitoreada Detalles de aplicacin
Vea la pgina 3-62 para obtener los detalles de aplicacin.

Negro

Blanco

Verde

K1 K2

Aux a indicador o entrada PLC

3-59

Interruptores con enclavamiento

Interruptores sin contacto


Detectores Sipha Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC60947-5-1, IEC/EN60947-5-3, ANSI B11.19, AS4024.1 La capacidad nominal depende de la unidad de control y de la aplicacin. Marca CE, cULus y TV Cierre Apertura 5 mm (0.20 pulg.) 11 mm (0.43 pulg.) 9 mm (0.35 pulg.) 12 mm (0.47 pulg.) 5 mm (0.20 pulg.) 12 mm (0.47 pulg.) 10 mm (0.39 pulg.) 13 mm (0.51 pulg.) 300 VCC, 250 VCA, 0.5 A, incluye la entrada al momento del arranque 15 VA/10 W, se pueden usar con circuitos de CA/CC

Categora Certificaciones Distancia mxima de deteccin de seguridad Estilo S1 Estilo S2 Estilo S3 Estilo S4

Descripcin
Con aplicaciones de velocidades ms rpidas y mayor complejidad, un interruptor magntico sencillo puede resultar insuficiente para satisfacer riesgos mayores. Como consecuencia, el diseo de Sipha incorpora varios elementos magnticamente sensibles, los cuales se debe activar en una secuencia determinada para funcionar correctamente. El detector Sipha est diseado para funcionar con su propio accionador y ayuda a evitar la posibilidad de desactivacin por un imn sencillo. El detector Sipha cuenta con abrazaderas moldeadas y un tamao pequeo y es sumamente verstil y fcil de instalar.El detector Sipha se debe conectar a la unidad de control Sipha para proporcionar un circuito monitoreado.En las aplicaciones de alto riesgo, la unidad de control se usa como un detector nico para crear un sistema de alta integridad. En otras aplicaciones, se pueden conectar mltiples detectores (incluso los interruptores mecnicos) a una sola unidad de control Sipha. El detector Sipha ofrece la posibilidad de conectar un botn de restablecimiento automtico y monitorear los dispositivos externos, tales como los contactores. Estn disponibles cuatro tipos de detectores y accionadores, los cuales incorporan diferentes distancias de operacin y tamaos fsicos.

Capacidad de conmutacin de contacto auxiliar

Temperatura de operacin S1, S2, S3 10 C a +55 C (+14 a +131 F) S4 (GD2) 25 C a +125 C (-13 a +257 F) Proteccin del envolvente S1, S2, S31 IP67 (NEMA 6P) S4 (GD2) IP67 (NEMA 6P) Cable
2 S1 4 cables de 0.54 mm (20 AWG) Forro de PVC con dim. ext. de 4 mm (0.16 pulg.) S2 4 cables de 0.54 mm2 (20 AWG) Forro de PVC con dim. ext. de 4 mm (0.16 pulg.)

Cable

S1 4 cables de 0.54 mm2 (0.02 pulg.) (20 AWG), forro de PVC, dimetro exterior 4 mm (0.16 pulg.) 2 S2 4 cables de 0.54 mm (0.02 pulg.) (20 AWG), forro de PVC, dimetro exterior 4 mm (0.16 pulg.) S1, S2 S30 (accionador) S31 (detector) S4 (GD2) ABS moldeado Polister Nylon (Trogamid) Acero inoxidable Todas las posiciones S1 S2 S3 S4 Detector Accionador 18 g (0.04 lbs) 15 g (0.03 lbs) 20 g (0.04 lbs) 30 g (0.07 lbs) 18 g (0.04 lbs) 6 g (0.01 lbs) 150 g (0.33 lbs) 170 g (0.37 lbs) 30 g, 11 ms medio seno 1 mm, 10 a 55 Hz

Material del envolvente

Caractersticas
Accionamiento sin contacto Deteccin magnticamente codificada Cuatro estilos de envolvente Debe funcionar con su propia unidad de control de seguridad

Montaje Peso (no incluye el cable)

Choque Vibracin

3-60

Interruptores con enclavamiento

Interruptores sin contacto


Detectores Sipha Seleccin de productos
Estilo de envolvente Envolvente Contactos de seguridad Contactos auxiliares Ninguno Tipo S11 Conexin Cable de 3 m Cable de 10 m Cable de 3 m 1 N.C. S1 ABS plstico Ninguno S21 S12 Cable de 10 m Cable de 3 m Cable de 10 m Cable de 3 m Cable de 10 m 1 N.C. S2 1 N.C. & 1 N.A. 1 N.A. Polister (accionador) Nylon [Trogamid] (detector) Ninguno S31 Conector micro de 4 pines 440N-S32024 S23 S22 Cable de 3 m Cable de 10 m Cable de 3 m Cable de 10 m Nmero de catlogo 440N-S32014 440N-S32016 440N-S32022 440N-S32032 440N-S32037 440N-S32036 440N-S32015 440N-S32017 440N-S32023 440N-S32033 440N-S32038 440N-S32039

1 N.A.

S13

S3

1 N.C. Acero inoxidable S4

S42 Conector micro de 8 pines

440N-S32047

1 N.A.

S43

440N-S32046

Cable de empalme, recto de 4 pines, 2 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 5 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, recto de 4 pines, 10 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, 8 pines/7 hilos, recto, de 2 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, 8 pines/7 hilos, recto, de 5 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales. Cable de empalme, 8 pines/7 hilos, recto, de 10 m. Vea la pgina 15-10 para obtener detalles y longitudes adicionales.

889D-F4AC-2 889D-F4AC-5 889D-F4AC-10 889D-F8AC-2 889D-F8AC-5 889D-F8AC-10

Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador.

Accesorios
Descripcin Accionador S10 Accionador S20 Accionador S30 Accionador S40 (GD2) Nmero de pgina Nmero de catlogo 440N-A32019 440N-A32020 440N-A32025 440N-A32041

3-61

Interruptores con enclavamiento

Interruptores sin contacto


Detectores Sipha Dimensiones aproximadasmm (pulgadas)
Las dimensiones no se proporcionan para fines de instalacin.
Sipha S1 4.8 (0.19) 24 (0.94) 22 (0.87) 22 (0.87) 68 (2.68) 82 (3.23) 22 (0.87) 48 (1.89) 6 (0.24) M4 13 (0.51) 12 (0.47) Sipha S2 4.2 (0.17) 7 (0.28) 4.2 (0.17) 4.5 (0.18) 7 41 (1.61) 41 4.5 (0.18) 9 (0.35) 7 (0.28)

25 (0.98)

24 (0.94)

82 (3.23) 73 (2.87)

4.2 (0.17) 25 (0.98) Detector 12 (0.47)

41

13 (0.51) 24 M4 (0.94) 4.8 (0.19) Accionador 7 (0.28)

7 (0.28) 5 19 19 (0.2) (0.75) (0.75) Detector

4.5 (0.18)

7 (0.28) 19 (0.75)

41 (1.61) 19 (0.75) Accionador 16.75 (0.66) 16 (0.63) 39.25 (1.55) 39.25 (1.55)

Sipha S3 60 (2.36)

Sipha S4 4.4 8 (0.31) (0.17)

6 8 (0.24) (0.31)

16.75 (0.66) 8 (0.31)

33.5 (1.32)

10 (0.39)

5 (0.20)

30 (1.18) 19.5 (0.77)

7 (0.28) 16.75 (0.66) Accionador 5.1 (0.2) Detector

7 (0.28) 16.75 (0.66)

62.5 (2.46)

16 (0.63) 7 (0.28)

4.4 (0.17) 19.5 7 (0.28)

33.5 (1.32) Accionador

3-62

78.5 (3.09)

Detector

M18

62.5 (2.46)

78.5 (3.09)

11.5 (0.45)

39.25 (1.55) 39.25 (1.55)

11.5 (0.45)

5 (0.20)

Interruptores con enclavamiento

Interruptores sin contacto


Detectores Sipha Diagramas de cableado tpicos
S11, S21 S12, S22 Rojo Seguridad N.C. Azul Amarillo Seguridad N.A. Seguridad N.A. Verde Negro Aux. N.C. Blanco S13, S23 Rojo Seguridad N.C. Azul Amarillo Seguridad N.A. Verde Negro Aux. N.A. Blanco S31 Seguridad N.C. S42 Seguridad N.C. Sin conexin Seguridad N.A. Aux. N.C. Seguridad N.A. S43 Seguridad N.C. Sin conexin Aux. N.A. Seguridad N.A.

Seguridad N.C.

3-63

Interruptores con enclavamiento

Interruptores sin contacto


Sentinel 1 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC60947-5-1, ANSI B11.19, AS4024.1 Cat. 3 segn EN954-1 Marca CE 24 VCA/CC, 48 VCA, 110 VCA, 230 VCA < 2 VA

Categora Certificaciones Fuente de alimentacin elctrica Consumo de energa

Fusibles internos Alimentacin elctrica 250 mA reemplazable N.C. Salida 2 A reemplazable Distancia de operacin Cierre de 7 mm (0.28 pulg.) Apertura de 10 mm (0.39 pulg.) B300, CA-15, 2 A/250 VCA P300, CC-13, 2 A/250 VCC 10 mA/10 V Verde = Guarda cerrada 2,500 V 25 C a +125 C (13 a +257 F) 90 % de humedad relativa IP65 (NEMA 13) 2 cables de 0.75 mm2 cuad. (18 AWG) Forro de PVC con dim. ext. de 7.5 mm (0.3 pulg.) ABS reforzado rojo Todas las posiciones Se incluyen tornillos de montaje de seguridad M4 Detector Accionador 120 g (0.26 lbs) 39 g (0.09 lbs) 100,000 a la carga nominal 1,000,000 sin carga 10 a 55 Hz, desplazamiento de 1 mm 8 g, 11 ms de medio seno

Descripcin
El Sentinel es un enclavamiento autnomo sin contacto y con codificacin electromagntica. Funciona sin un rel de seguridad y proporciona un sistema altamente codificado para evitar el cambio del interruptor por imanes simples. Las funciones autodiagnsticas y de monitoreo se encuentran en la unidad de conmutacin, la cual tambin contiene el indicador LED de estado. El Sentinel cuenta con 1 salida N.A. y 1 salida N.C. y se enva precableado. Se obtiene acceso fcilmente al fusible de repuesto de proteccin contra sobrecargas retirando la parte frontal del interruptor con una broca de seguridad.

Tolerancia al desalineamiento Cierre y apertura de 5 mm (0.2) Capacidad nominal de salida Capacidad mnima de conmutacin Indicadores LED Voltaje de resistencia de impulso Temperatura de operacin Humedad Proteccin del envolvente Cable

Caractersticas
Accionamiento sin contacto Codificacin electromagntica Operacin autnoma Envolvente de estilo caja de plstico (IP65) Conexiones de terminaciones

Material del envolvente Montaje

Peso (no incluye el cable) Vida til elctrica Vida til mecnica Vibracin Choque

3-64

Interruptores con enclavamiento

Interruptores sin contacto


Sentinel 1 Seleccin de productos
Contactos de seguridad Contactos auxiliares Fuente de alimentacin elctrica Conexin Cable de 2 m 24 VCA/CC Cable de 4 m Cable de 6 m Cable de 12 m 1 N.C. 1 N.A. 48 VCA 110 VCA Cable de 2 m Cable de 2 m Cable de 6 m Cable de 2 m 230 VCA Cable de 4 m Cable de 12 m Nmero de catlogo 440N-N15017 440N-N15023 440N-N15021 440N-N15041 440N-N15028 440N-N15015 440N-N15027 440N-N15013 440N-N15024 440N-N15040

Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador.

Accesorios
Descripcin Accionador de repuesto Fusible de repuesto de 2 A Fusible de repuesto de 250 mA Nmero de pgina 14-2 14-2 Nmero de catlogo 440N-A15005 440A-A09197 440A-A09196

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor Accionador 19 (0.75) 5 (0.2) 38 (1.5) 36 (1.42) 4 (0.16) 7 (0.28) 4.5 (0.18) = = 4.5 (0.18)

69 (2.72)

57 (2.24)

73 (2.87)

Montaje 2 x M4

50 (1.97)

5 (0.2) 19 (0.75)

82 (3.23)

3-65

Interruptores con enclavamiento

Interruptores sin contacto


Sentinel 1 Diagramas de cableado tpicos
Detector Sentinel 1 Rojo + Voltaje de fuente de alim. elc. -

Azul Negro Seguridad N.C. Fusible externo

Blanco Amarillo

Auxiliar N.A. Verde

Detalles de aplicacin
Principio de operacin Cuando el accionador se presenta al interruptor, el campo electromagntico de alta intensidad junto con una seal de frecuencia resonante hacen que se cierren los contactos. Al retirarse el accionador (cuando se abre la puerta), los contactos de seguridad se abren, y la mquina queda aislada. El interruptor no ser anulado por imanes, herramientas, etc.

Mtodos de instalar el accionador

3-66

Interruptores con enclavamiento

Interruptores sin contacto


Sentinel 1 Detalles de aplicacin Instalacin, montaje
Guardas con bisagras interruptor Interruptor 2 mm mn. 5 mm mx. Guarda Accionador Accionador 25 mm Interruptor Accionador Paro de puerta Guardas con dos bisagras

Guardas extrables

Guardas deslizantes.

2 mm mn. 5 mm mx. 2 mm mn. 5 mm mx. Interruptor Accionador

Interruptor

Interruptor Guarda

Accionador

Guarda

Accionador

Paro de puerta

3-67

Interruptores con enclavamiento

Interruptores sin contacto


Ferrocode
Especificaciones (continuacin)
Categora de utilizacin (CA) Corriente/voltaje mx. de CC conmutados Corriente/voltaje mn. de CC conmutados Fusible de salida mx. Indicacin Tiempo de desactivacin mx. Voltaje de resistencia de impulso Temperatura de operacin Nivel de contaminacin Humedad 4 A/250 VCA/1000 VA a COS=1 2 A/30 VCC/60 W 10 mA/10 V Accin rpida de 5 A Verde = alim. elc. activada Verde = salida cerrada <50 mS 2,500 V 10 C a +55 C (14 F a 131 F) 3 90 % de humedad relativa IP40 DIN 0470 IP20, DIN 0470 1 x 2.5 mm2 (14 AWG) trenzado con forros pelados de 8 mm,1 x 4 mm2 (14 AWG) conductor slido Tornillos de terminal plus/menos M3.5 Caja de terminal con proteccin de cables 314 g (0.69 lbs) 530 g (1.17 lbs) Policarbonato rojo 16 pos. de prof. = 120 alto = 73 ancho = 45.5 C de acuerdo con VDE 0110 Riel DIN de 35 mm 24 VCC +/ 15 % <1 VA Fusible de salida de 1 A Activado = 7 mm, desactivado = 9 mm Activado = 9 mm, desactivado = 14 mm 1 N.A. y 1 N.C. 0.5 A/120 VCA/60 VA a COS =1 1 A/28 VCC/28 W 10 mA/10 V Accin rpida de 1 A LED 1 2,500 V 10 C a +55 C (14 F a 131 F) 3 90 % de humedad relativa IP67 (NEMA 6P) Verde 1 = guarda cerrada

Descripcin
El Ferrocode es un sistema de dos canales y su configuracin consiste en un accionador y una cabeza de interruptor de seguridad conectada a una unidad de control de monitoreo. El Ferrocode usa codificacin electromagntica, la cual proporciona un mayor nivel de seguridad en comparacin con los sistemas de codificacin magnticos. Para evitar la anulacin posible del sistema, el detector y el accionador cuentan con hardware de proteccin contra manipulacin indebida. La ausencia de piezas movibles y contacto fsico directo entre el detector y accionador elimina el desgaste mecnico. Se puede usar un detector Ferrocode sin la unidad de control para las aplicaciones de baja potencia/bajo riesgo. Sin embargo, se deben estudiar detalladamente los riesgos antes de implementar este mtodo. Se debe usar la unidad de control cuando se requieren monitoreo y verificacin de circuitos.Se pueden interconectar hasta 6 interruptores Ferrocode a la unidad de control de 110/230 V y hasta 15 interruptores Ferrocode a la versin de 24 V. Tambin se puede usar una unidad de control en combinacin con dispositivos de seguridad electromecnicos, tales como interruptores de final de carrera, enclavamientos de compuerta y paros de emergencia con dos contactos, 1. N.A. y 1 N.C.

Nivel de proteccin del envolvente Aislamiento del terminal Calibre mx. de conductor

Terminales

Peso, unidad de 24 VCC Unidad de 110/230 V Material y color Envolvente Grupo de instalacin Detalles de fijacin Cabeza de conmutacin Fuente de alimentacin elctrica Consumo de energa Fusible interno Distancia de seguridad Distancia auxiliar Salidas Categora de utilizacin (CA) Corriente/voltaje mx. de CC conmutados Corriente/voltaje mn. de CC conmutados

Caractersticas
Codificacin electromagntica protegida contra manipulacin seguridad

indebida Se interconecta directamente a una unidad de control de rel de

Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC60947-5-1, ANSI B11.19, AS4024.1 Cat. 3 segn EN954-1 (detectores con controlador) Marca CE y cULus 24 VCA/CC 110/230 VCA <6 VA Lazo de contactor normalmente cerrado 1 N.A. y 1 N.C. de la cabeza Ferrocode Fusible de fuente de alim. elc. reemplazable de 500 mAT Interruptor selector principal 2 N.A. y 1 N.C. con aprobacin de TV

Fusible de salida mx. Indicacin Voltaje de resistencia de impulso Temperatura de operacin Nivel de contaminacin Humedad Nivel de proteccin

Categora Certificaciones Fuente de alimentacin elctrica Consumo de energa Lazo de monitor de contactor X1-X2 Entradas de seguridad Fusible interno Interruptores internos Salida de rel

Peso (no incluye el cable) Interruptor 30 g (0.07 lbs) Accionador 40 g (0.09 lbs) Material y color Detalles de fijacin Cable Plstico ABS rojo moldeado Tornillos M4 6 cables de 0.2 mm2 (24 AWG); trenzado, forro de PVC, dimetro exterior 6 mm (0.23 pulg.)

3-68

Interruptores con enclavamiento

Interruptores sin contacto


Ferrocode Seleccin de productos
Tipo Unidad de control Voltaje de fuente de alim. elc. 24 VCA/CC 110 V 230 VCA Contactos de seguridad 2 N.A. Contactos auxiliares 1 N.C. Conexin Terminales Cable de 2 m Interruptor y accionador 24 VCA/CC 1 N.C. & 1 N.A. Ninguno Cable de 6 m Cable de 8 m Cable de 10 m
Nota: Los contactos se describen con la puerta de la guarda cerrada, es decir, con el accionador en su lugar. El interruptor se enva con un accionador.

Envolvente Policarbonato de 45 mm de ancho

Nmero de catlogo 440N-C02068 440N-C02070 440N-C02067

Rojo, ABS plstico

440N-C02078 440N-C02076 440N-C02079

Accesorios
Descripcin Accionador Fusible de 500 mA Nmero de pgina 14-6 Nmero de catlogo 440N-A02071 440R-A31562

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Interruptor 7 (0.28) Accionador 7 (0.28) 4.5 (0.18) 4.5 (0.18) 45.5 (1.79) 84 (3.31) 82 (3.23) 73 (2.87) Unidad de control

120 (4.72)

73 (2.87)

54 (2.13)

41 (1.61)

7 (0.28) 16 (0.63) 11 4 4 (0.43) (0.16) (0.16) 19 (0.75)

= =
19 (0.75) 4.5 (0.18) 19 (0.75) 4.5 (0.18)

Bloque
A1 A2 X1
S13 S14 S21 S22 X2 Rojo (Negro) (Blanco) (Verde) (Amarillo)13 23

73 (2.87)

35 (1.38) Montaje en riel DIN

31

F1 110/230

24 VCC

K2 K2 K3 K3 VR1
Lgica Alimentacin

K1 K3 K1 K3
Lgica

K2

K2

K1 K2

K3

Salida Azul

14 24

32

3-69

Interruptores con enclavamiento

Interruptores sin contacto


Ferrocode Diagramas de cableado tpicos
+24 VCC Restablecimiento

L1 L2 L3 B1 S13 S21 A1 13 23 31 X1
Accionador Accionador Detector 2 Accionador Detector 3 Detector 1

Ferrocode

K1 K2

B2 S14 S22 A2 14 24 32 X2 K1 K2
Tierra Aux.

Entradas mltiples de detector, restablecimiento manual, salida de dos canales, salida monitoreada
L1

L1 L2 L3 B1 S13 S21 A1 13
Accionador Detector 1

23 31 X1 K1

Ferrocode

K2 B2 S14 S22 A2 14 24 K1 N K2 32 X2
Aux.

Entrada nica de detector, restablecimiento automtico, salida de dos canales, salida monitoreada
Detector Ferrocode
Rojo Fuente de alim. de + 24 VCC

Azul

Negro Segurida d N.C. Blanco

Nota: Se recomienda usar un fusible externo cuando el interruptor no es activado por una unidad de control Ferrocode. Se recomienda usar fusible de 24 VCC o 110 VCA, 300 mA.

Amarillo Segurida d N.A. Verde

3-70

Interruptores con enclavamiento

Interruptores sin contacto


Ferrocode Detalles de aplicacin tpica
Cuando el accionador se presenta al interruptor, el campo electromagntico de alta intensidad junto con una seal de frecuencia resonante hacen que se cierren los contactos. Al retirarse el accionador (cuando se abre la puerta), los contactos de seguridad se abren, y la mquina queda aislada. El interruptor no ser anulado por imanes, herramientas, etc.

Distancia de operacin de contacto de seguridad: cierre 7 mm, apertura 9 mm Distancia de operacin de contacto auxiliar: cierre 9 mm, apertura 14 mm

Detalles de aplicacin
Espacio libre del accionador >25 mm Interruptor Mtodos de instalacin del accionador

Interruptor Accionador

Accionador

En las puertas con bisagras, instale el interruptor en el borde de abertura. Cuando hay dos interruptores montados de manera adyacente, no deben estar a una distancia menor de 25 mm uno de otro. Se recomiendo un espacio libre de 2 mm entre el interruptor y el accionador

Configuraciones tpicas
Se puede usar un interruptor Ferrocode sin la unidad de control en aplicaciones de baja potencia/bajo riesgo. En aplicaciones de alto riesgo, se pueden usar seis interruptores Ferrocode con una unidad de control. Conecte los contactos N.C. (cables blanco y negro) en serie con los contactos N.A. (cables verde y amarillo) en paralelo. Un interruptor Ferrocode usado con una unidad de control proporciona un sistema de mayor integridad.

Wigan WN2 4HR

0942 55166

A1 A2 X1 X2 B1 B2 S13 S14
SUPPLY Red Blue Black White

Wigan WN2 4HR

Wigan WN2 4HR

Wigan WN2 4HR

Wigan WN2 4HR

Wigan WN2 4HR

Wigan WN2 4HR

0942 55166

0942 55166

0942 55166

0942 55166

0942 55166

0942 55166

A1 A2 X1 X2 B1 B2 S13 S14
SUPPLY Red Blue Black White

Wigan WN2 4HR

0942 55166

SEE SIDE FOR SUPPLY


Made in the EC

SEE SIDE FOR SUPPLY


Made in the EC

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Actuator
Wigan WN2 4HR

FERROCODE POWER
Control Unit TAMPER PROOF SAFETY SYSTEM pr EN 1088 EN 60204 pt.1
AUXILIARY SAFETY 1

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

FERROCODE POWER
Control Unit TAMPER PROOF SAFETY SYSTEM pr EN 1088 EN 60204 pt.1
AUXILIARY SAFETY 1

Ferrocode
Safety Switch
1A 28Vdc 0.5A 120Vac IP 67
Made in England

Ferrocode
Actuator
Wigan WN2 4HR

OUTPUT ISOLATE BEFORE REMOVING COVER


SAFETY 2 Green Yellow

OUTPUT ISOLATE BEFORE REMOVING COVER


SAFETY 2 Green Yellow

0942 55166

Made in England

0942 55166

31 32 13 14 23 24 S21S22

31 32 13 14 23 24 S21S22

Made in England

Aplicaciones tpicas
Guarda deslizable Nota: Las guardas extrables que usan interruptores sin contacto pueden requerir dos interruptores, uno a cada lado de la guarda, o el uso de una solapa para evitar que se levante inicialmente el borde sin enclavamiento. Guarda extrable Guarda con bisagras

3-71

Interruptores con enclavamiento

Interruptores con bisagra


Sprite Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus NRTL/C y TUV 2 N.C. o 1 N.C., accin de apertura directa CA 15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A 24 V 2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 mm (0.08 pulg.) (Ui) 500 V (Uimp) 2,500 V 1 N.A. 3 Mximo 11; mnimo 3 (ajustable) 8 cNm (par en el eje) Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 1 M16 o tipo conector 20 C a +80 C (4 F a 176 F) 2 x M4 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 80 g (0.176 lb) Rojo

Categora

Certificaciones Contactos de seguridad Categora de utilizacin CA (Ue) (Ie) CC

Descripcin
Basado en el popular interruptor Ensign, Sprite ofrece las mismas caractersticas de seguridad en un envolvente ms compacto (slo 75 25 29 mm (2.95 x 0.98 x 1.14 pulg.), lo cual hace que sea el interruptor de enclavamiento ms pequeo actualmente disponible. El interruptor Sprite ha sido diseado para mquinas pequeas, tales como mquinas de imprimir, fotocopiadoras o aparatos electrodomsticos, las cuales no usaron, hasta ahora, los enclavamientos de seguridad estndar debido a restricciones de espacio. A pesar de su tamao compacto, el interruptor Sprite incluye las funciones necesarias de seguridad, tales como contactos guiados forzados y un mecanismo a prueba de manipulacin indebida, lo cual permite la seguridad de la maquinaria segn la directiva de maquinarias pertinente. El eje Sprite est conectado al perno de bisagra y se puede ajustar el grado de operacin para satisfacer los requisitos de la aplicacin mediante la leva ajustable en la cabeza del interruptor.
Nota: Despus del ajuste, hay que fijar la leva en posicin usando el perno

Mx. corriente/voltaje/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin Rotacin de eje para operacin del contacto Fuerza mn. de apertura de contacto Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Colores

de bloqueo de leva para asegurar el rendimiento ptimo.

El Sprite est disponible con dos contactos de seguridad N.C. o uno N.A. y uno N.C., en un envolvente IP67 hermtico al agua y al polvo.

Caractersticas
Ideal para las guardas pequeas de peso liviano El interruptor de enclavamiento para bisagra ms pequeo disponible, envolvente de 75 25 mm Se puede personalizar el grado de operacin usando una leva ajustable Contactos, 2 N.C. o 1 N.C. y 1 N.A. Cuatro posibles posiciones de eje, fciles de instalar

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

Cabeza giratoria de cuatro posiciones

Ejes de accionador de 50, 60 u 80 mm de largo

La cabeza gira 360 en incrementos de 90 para permitir cuatro posibles posiciones de operacin del eje.

3-72

Interruptores con enclavamiento

Interruptores con bisagra


Sprite Seleccin de productos
Contactos de seguridad 2 N.C. Dimensiones del eje del accionador mm (pulgadas) 80 x 10 (3.14 x 0.39) 60 x 8 (2.36 x 0.31) 50 x 10 (1.96 x 0.39) 80 x 10 (3.14 x 0.39) 1 N.C. 1 N.C. BBM 60 x 8 (2.36 x 0.31) 50 x 10 (1.96 x 0.39) Nmero de catlogo Conducto M16 440H-S34019 440H-S34020 440H-S34010 440H-S34021 440H-S34022 440H-S34012 Conducto M16/ adaptador de 1/2 pulg. 440H-S34023 440H-S34024 440H-S34017 440H-S34025 440H-S34026 440H-S34018 Conector 440H-S34027 440H-S34028 440H-S34014 440H-S34029 440H-S34030 440H-S34015 889D-F4AC-2

Contactos auxiliares

BBM/MBB

Conjunto de cable estndar recomendado, 2 m (6.5 pies). Vea la pgina 15-10 para obtener informacin sobre longitudes adicionales.

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
25 (0.98) 12.5 (0.49) 29 (1.14) 12.5 (0.49) 75 (2.95) 1 x M16 12.5 (0.49) 17.5 (0.69) Longitud 12.5 (0.49) 3 18 (0.71) (0.12) 16.5 (0.65) 34.5 (1.36) 36 (1.42) R 2.1

5 (0.2)

Dimetro Vea Seleccin de productos, para obtener informacin sobre las dimensiones

Diagramas de cableado tpicos


1 N.C.+ 1 N.A.
23 24 11 12 21 22

2 N.C.
11 12

1 N.C.+ 1 N.A. Configuracin de pines del conector 1 Terminal 11 N.C. 12 23 N.A. 4 24


1 N.C.+ 1 N.A.(BBM) 3 11/12 21/22 11 0 11/12 21/22

2 N.C. Terminal 11 N.C. 12 21 N.C. 22


2 N.C. 3 0

Contacto

Contacto

2 3

1 4

3 2

Accin de contacto
Contacto abierto Contacto cerrado

Rotacin de eje

11

3-73

Interruptores con enclavamiento

Interruptores con bisagra


Ensign 3 Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus, BG y SUVA 2 N.C. o 3 N.C., accin de apertura directa CA 15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A 24 V 2 A 500 V/500 VA 10 A 5 V 5 mA CC >2 mm (0.08 pulg.) (Ui) 500 V (Uimp) 2,500 V 1 N.A. (disponible con 2 contactos de seguridad N.C.) 3

Categora

Certificaciones Contactos de seguridad Categora de utilizacin CA (Ue) (Ie) CC

Descripcin
El Ensign 3 es un interruptor de enclavamiento de seguridad con accionamiento de bisagra diseado para instalarse en los puntos de bisagra de las guardas. El verstil Ensign 3 con cabeza giratoria cuenta con hasta cuatro opciones distintas de montaje. La operacin de la unidad se realiza mediante la accin de bisagra de la guarda. El eje de accionamiento est conectado al perno de bisagra y se puede ajustar el grado de operacin para satisfacer los requisitos de la aplicacin mediante la leva ajustable en la cabeza del interruptor.
Nota: Despus del ajuste, hay que fijar la leva en posicin usando el perno

Mx. corriente/voltaje/carga conmutados Corriente trmica (litio) Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos Contactos auxiliares Grado de contaminacin

de bloqueo de leva para asegurar el rendimiento ptimo.

El interruptor incluye las funciones necesarias de seguridad, tales como contactos guiados forzados y un mecanismo a prueba de manipulacin indebida, lo cual permite la seguridad de maquinaria segn la directiva de maquinarias pertinente. Est sellado segn IP67 y cuenta con una entrada de conducto, M16 o tipo conector.

Rotacin del eje para realizar la operacin de los contactos 3 N.C. Ajustable 12 mximo; 3 mnimo 2 N.C, 1 N.A. (BBM) Ajustable 14 mximo; 5 mnimo 2 N.C., 1 N.A. (MBB) Ajustable 12 mximo; 3 mnimo Fuerza mn. de apertura de contacto Material del envolvente Material del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color 8 cNm (par en el eje) Polister rellenado de vidrio aprobado por UL Acero inoxidable IP67 1 M16 o tipo conector 20 C a +80 C (4 F a 176 F) 2 M4 Todas las posiciones 1,000,000 operaciones 1,000,000 operaciones 100 g (.22 lb) Rojo

Caractersticas
Tamao compactoenvolvente de 90.5 x 31 x 30.4 mm Ideal para guardas pequeas y ligeras Se puede personalizar el grado de operacin usando una leva ajustable Contactos, 2 N.C. y 1 N.A. o 3 N.C. (sellado segn especificaciones IP67) Cuatro posibles posiciones de eje, fcil de instalar

Se produce polucin conductora o polucin seca no conductora, la cual se hace conductora debido a la condensacin.

Ejes de accionador de 50, 60 u 80 mm de largo

La cabeza gira 360 en incrementos de 90 para permitir cuatro posibles posiciones de operacin del eje.

3-74

Interruptores con enclavamiento

Interruptores con bisagra


Ensign 3 Seleccin de productos
Nmero de catlogo Contactos Contactos de seguridad auxiliares Dimensiones del eje del accionador mm (pulgadas) BBM/MBB 80 x 10 (3.14 x 0.39) 3 N.C. 60 x 8 (2.36 x 0.31) 50 x 10 (1.96 x 0.39) 80 x 10 (3.14 x 0.39) BBM 2 N.C. 1 N.C. MBB 60 x 8 (2.36 x 0.31) 50 x 10 (1.96 x 0.39) 80 x 10 (3.14 x 0.39) 60 x 8 (2.36 x 0.31) 50 x 10 (1.96 x 0.39) Conducto M16/ adaptador de 1/2 pulg. 440H-E22050 440H-E22051 440H-E22052 440H-E22053 440H-E22054 440H-E22055 440H-E22056 440H-E22057 440H-E22058

Conducto M16 440H-E22025 440H-E22031 440H-E22047 440H-E22027 440H-E22033 440H-E22048 440H-E22029 440H-E22035 440H-E22049

Conector 440H-E22059 440H-E22060 440H-E22061 440H-E22037 440H-E22039 440H-E22062 440H-E22038 440H-E22040 440H-E22063 889R-F6ACA-2

Conjunto de cable estndar recomendado, 2 m (6.5 pies). Vea la pgina 15-11 para obtener informacin sobre longitudes adicionales.

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
20 22 (0.79) (0.87) Ctrs Ctrs 34.4 (1.35) 36.4 (1.43) 38.4 (1.51) 90.5 (3.56) 25 (0.98) Ctrs 13 (0.51) 12.5 (0.49) Longitud Vea Seleccin de productos, para obtener informacin sobre las dimensiones Dimetro 25 (0.98) 30.4 (1.2) 3 N.C.
31 32 21 22 11 12

31 (1.22)

3 (0.12)

R 2.15

Diagramas de cableado tpicos


2 N.C.+ 1 N.A.

33 34

21 22

11 12

2 N.C.+ 1 N.A. Configuracin de pines del conector 1 5 2 6 3 4 Terminal 11 12 21 22 33 34 Contacto N.C. N.C. N.A. Terminal 11 12 21 22 31 32
3 N.C. 5 11/12 21/22 31/32

3 N.C. Contacto N.C. N.C. N.C.

Accin de contacto
Contacto abierto Contacto cerrado

Rotacin de eje

2 N.C.+ 1 N.A.(BBM) 5 0 11/12 21/22 33/34 6 (MBB) 4 0 11/12 21/22 33/34 3

3-75

Interruptores con enclavamiento

Interruptores con bisagra


Rotacam Especificaciones
Normas EN954-1, ISO13849-1, IEC/EN60204-1, NFPA79, EN1088, ISO14119, IEC/ EN60947-5-1, ANSI B11.19, AS4024.1 Dispositivo de Cat. 1 segn EN954-1 Enclavamiento de dos canales ideal para sistemas de Cat. 3 4 Marca CE, cULus, SUVA y TUV 2 N.C. y 1 N.A., accin de apertura directa CA 15 500 V 250 V 100 V 1A 2A 5A 250 V 0.5 A 24 V 2 A 10 A 5 V 5 mA CC >2 mm (0.08 pulg.) (Ui) 500 V (Uimp) 2,500 V

Categora

Certificaciones Configuracin de contactos Categora de utilizacin CA (Ue) (Ie) CC Corriente trmica (litio)

Descripcin
El Rotacam es un interruptor de enclavamiento de seguridad con accionamiento de bisagra para servicio pesado y se puede usar como el perno de bisagra existente o conectarse al mismo para permitir la operacin directa del interruptor. La alimentacin elctrica de la mquina queda aislada cuando la guarda se abre a tan solo 5. Para aplicaciones que requieren un mayor grado de operacin, la leva interna puede ajustarse de 5 a 11.
Nota: Despus del ajuste, hay que fijar la leva en posicin usando el perno de bloqueo de leva para asegurar el rendimiento ptimo.

Corriente mnima Espacio de contacto de seguridad Voltaje nominal de aislamiento Voltaje nominal de resistencia de impulsos

Rotacin del eje para realizar 11 mximo; 5 mnimo, (ajustable) la operacin del contacto Fuerza mn. de apertura de contacto Velocidad mx. de accionamiento Frecuencia mx. de accionamiento Material del envolvente Eje del accionador Proteccin Entrada de conducto Temperatura de operacin Fijacin Montaje Vida til mecnica Vida til elctrica Peso Color 12 cNm (par en el eje) 160 mm por seg. (6.29 pulg.) 1 ciclo por seg. Aleacin moldeada para uso robusto Acero inoxidable IP66 1 x M20 o tipo conector 25 C a +80 C (13 F a 176 F) 2 x M4 Todas las posiciones >1,000,000 operaciones >1,000,000 operaciones 420 g (0.926 lb) Rojo

El Rotacam est disponible con dos contactos de seguridad N.C. y un contacto auxiliar N.A. El interruptor incluye las funciones necesarias de seguridad, tales como contactos guiados forzados y un mecanismo a prueba de manipulacin indebida, lo cual permite que la maquinaria se proteja segn la directiva concerniente a la seguridad de mquinas. El envolvente moldeado est sellado segn IP66 y cuenta con una entrada de conducto M16 (estn disponibles tambin de 1/2 pulg. NPT y tipo conector). Adems, se pueden especificar dos longitudes diferentes de eje de 30 mm y 85 mm. Los estilos EX y Pneumtico del Rotacam tambin estn disponibles; vea la seccin A prueba de explosiones en la pgina 16-1 para obtener ms informacin.

Caractersticas
Se puede usar como perno de bisagra con puertas de guarda de peso ligero y mediano Asla la potencia a 5 del movimiento de la puerta Se puede personalizar el grado de operacin usando una leva ajustable Envolvente moldeado robusto, ideal para las aplicaciones de servicio pesado Contactos, 2 N.C. y 1 N.A.

Nota: los contactos de seguridad de los interruptores Guardmaster se describen como normalmente cerrados (N.C.), es decir, la guarda cerrada, el accionador en su posicin (cuando es pertinente) y la mquina lista para arrancar. Mtodos de fijacin

Pin de rodillo

Pretaladrado El eje del accionador est pretaladrado, lo cual permite que el perno de bisagra existente se utilice como punto de flexin.

Eje slido El eje slido del accionador puede usarse como perno de bisagra en ciertas guardas.

3-76

Interruptores con enclavamiento

Interruptores con bisagra


Rotacam Seleccin de productos
Tamao tipo (L=Longitud: D-Dim.) mm (pulgadas) L = 30 (1.18) D= 16 (0.63) L = 85 (3.35) D= 12.7 (0.5) Nmero de catlogo Conducto M20/ adaptador de 1/2 pulg. 440H-R03078 440H-R03088

Contactos Contactos de seguridad auxiliares

BBM/MBB

Tipo de eje Pretaladrado Slido

Conducto M20 440H-R03074 440H-R03079

Conector 440H-R03111 440H-R03112

2 N.C.

1 N.C.

BBM

Conjunto de cable estndar recomendado, 2 m (6.5 pies). Vea la pgina 15-10 para obtener informacin sobre longitudes adicionales.

889D-F8AB-2

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
3.5 (0.14) 14.5 (0.57) 24 (0.94) 99 (3.9) 6.5 (0.26) 24.5 (0.96) 38 (1.5) 6.5 (0.26) L

36 (1.42) 52 (2.05)

86 (3.39)

6.5 (0.26) 65 (2.56) D 15.5 (0.61)

25 (0.98) 13 (0.51)

2 x orificios 3.2 (0.13)

5 (0.2) 8 (0.31) 9.5 (0.37)

2 x orificios M4 Nota: Orificios slo en modelos pretaladrados.

3-77

Interruptores con enclavamiento

Interruptores con bisagra


Rotacam Diagramas de cableado tpicos
Circuito de seguridad 1

Circuito de seguridad 2

Circuito auxiliar
33 34 11 21 22

12

2 N.C.+ 1 N.A. Configuracin de pines del conector 1 7 6 5 4 3 8 Terminal 11 12 21 22 33 34 Tierra


2 N.C.+ 1 N.A.(BBM)
Contacto cerrado

Contacto N.C. N.C. N.A.

1 2 3 8 4

7 6 5

Accin de
Contacto abierto

5 11/12 21/22 33/34 6

0 mm

Rotacin de eje

3-78

Qpwipprtifi
{IfFtyf2  ! @ftifpqppypfwfftphfipw tpxfipprtifi ! Gfprfiippwphhtyippwip prtifiFtyf  !! Tytifiipqpypipfwtxpyfhtypwhthf !% Qpwipxytpipprtifi  ! Qpwipxytpipprtifihypfi ipfwtif !! Qpwipixfy !" Tytifipippfyty  !"# Tytifiiphywippxtfhty  !# Fytpipfipxtxtpy  !## Fytpipqpfhyfpwphxt  !$ Qpwipxytpipprtifixiwfp  !$

Qpwipprtifi

{IfFtyf2
Qpwytifipiphyw
/DV XQLGDGHV GH FRQWURO SURSRUFLRQDQ IXQFLRQHV WDOHV FRPR UHWDUGR GH WLHPSR GHWHFFLyQ GH PRYLPLHQWR \ VXSHUYLVLyQ GH FRQWURO GH GRV PDQRV /RV UHTXLVLWRV IXQFLRQDOHV SDUD PRQLWRUHDU ODV XQLGDGHV GH UHOp GH VHJXULGDG WDOHV FRPR OD JDPD GH ORV SURGXFWRV *XDUGPDVWHU 0LQRWDXU GHSHQGHQ GH VX XVR HQ HO VLVWHPD /DV WDUHDV EiVLFDV VRQ  'HWHFWDU IDOORV HQ FLUFXLWRV GH FRQWURO HOpFWULFRV UHODFLRQDGRV D OD VHJXULGDG SRU HM IDOORV HQ VHQVRUHV FDEOHDGR FRQWDFWRUHV HWF  3URSRUFLRQDU XQD DFFLyQ GH FRQPXWDFLyQ VHJXUD SRU HM DFWXDU FRPR UHOp LQWHUPHGLR SDUD DPSOLILFDU XQD VHxDO R GLVWULEXLUOD D P~OWLSOHV GLVSRVLWLYRV  3URSRUFLRQDU IDFLOLGDG GH UHVWDEOHFLPLHQWR PDQXDO /OHYDQ D FDER VX IXQFLyQ PHGLDQWH UHGXQGDQFLD LQWHUQD HV GHFLU GXSOLFDFLyQ \ PRQLWRUHR
6ypwipprtifi Rtypwipprtifi
t tiphtht iph w

Itgwpqfwwip hhtht

Itgwpqfwwip typ

Itgwpqfwwip hyfh

9p pipfwt p fht pwhthf

TytifiFtyf'

B p pip tp fip p prp htfh fhphfgwpfiip hthtipprtifiph

t fpfwtfpw tp ffipp t f tsf qfww p pip hff pwtr

6fgwpfiip typ'

6fgwpfiip hyfh'

t fpfwtfpw tp ff ipp t ftsf qfww p pip hff pwtr

7pipwfqp p

4wfhfrf

t fpfwtfpw tp ff ipp t ftsf qfww p pip hff pwtr t fpfwtfpw tp ffipp t ft sf qfww p pip hff pwtr

Bypp'

6yfhp'

4wthfhtyp
FRQ#QS

6thtipxytpiphyfhp' 6thtiphyxfhtyiphyfhp' Rxtytptyhwpfwhthtiphyxfhty 6yfh FytpfiFtyf



@ftifpqppypfwfftphfipwtpxfipprtifi
Iffippwphhty
5RFNZHOO $XWRPDWLRQ RIUHFH FXDWUR DUTXLWHFWXUDV GH VLVWHPDV GH VHJXULGDG (VWDV VRQ  6LVWHPDV GH FRPSRQHQWHV $O QLYHO PiV EDMR XQD IXQFLyQ GH VHJXULGDG SXHGH UHDOL]DUVH FRQ XQ GLVSRVLWLYR DFFLRQDGRU \ XQ GLVSRVLWLYR GH FRQWURO 3RU HMHPSOR XQ ERWyQ GH SDUR GH HPHUJHQFLD TXH DEUH OD ERELQD GH XQ UHOp GH FRQWURO GH VHJXULGDG UHDOL]D XQD IXQFLyQ GH VHJXULGDG VLPSOH /DV DUTXLWHFWXUDV GH ORV VLVWHPDV GH FRPSRQHQWHV HVWiQ GLVHxDGDV SDUD DSOLFDFLRQHV GH EDMR ULHVJR  6LVWHPDV GH UHOp GH PRQLWRUHR GH VHJXULGDG GHGLFDGRV /RV UHOpV GH VHJXULGDG GHGLFDGRV VH XVDQ SDUD DSOLFDFLRQHV HVSHFtILFDV (VWRV VLVWHPDV XWLOL]DQ PyGXORV GH FRQWURO FRPSDFWRV GLVHxDGRV SDUD KDFHU LQWHUIDFH FRQ GLVSRVLWLYRV GH VHJXULGDG FRPXQHV WDOHV FRPR SDURV GH HPHUJHQFLD FRPSXHUWDV GH VHJXULGDG FRUWLQDV GH OX] GH VHJXULGDG WDSHWHV GH VHJXULGDG $OJXQRV UHOpV GHGLFDGRV SURSRUFLRQDQ IXQFLRQHV HVSHFLDOHV WDOHV FRPR WHPSRUL]DFLyQ FRQWURO GH GRV PDQRV VLOHQFLDPLHQWR H LQLFLDFLyQ GH GLVSRVLWLYR GH GHWHFFLyQ GH SUHVHQFLD 3XHVWR TXH KD\ PXFKRV WLSRV GLIHUHQWHV GH IXQFLRQHV \ GLVSRVLWLYRV GH HQWUDGD KD\ PXFKRV WLSRV GLIHUHQWHV GH UHOpV GH PRQLWRUHR GH VHJXULGDG GHGLFDGRV /RV UHOpV GH PRQLWRUHR GH VHJXULGDG GHGLFDGRV WLHQHQ OD FDSDFLGDG GH SURSRUFLRQDU GLDJQyVWLFRV EiVLFRV PHGLDQWH LQGLFDGRUHV /(' HQ VXV SDQHOHV IURQWDOHV \ FRQWDFWRV DX[LOLDUHV TXH SXHGHQ FRQHFWDUVH D XQ 3/& R D XQD ERPELOOD LQGLFDGRUD /DV DUTXLWHFWXUDV GH VLVWHPDV GH UHOpV GH VHJXULGDG GHGLFDGRV VH XVDQ HQ DSOLFDFLRQHV GH ULHVJR PHGLR D DOWR  6LVWHPDV GH UHOp GH PRQLWRUHR GH VHJXULGDG H[SDQGLEOHV (VWD HV XQD QXHYD DUTXLWHFWXUD TXH VH HVWi LQWURGXFLHQGR HQ HO PHUFDGR GH SURWHFFLyQ GH PiTXLQDV 6H WUDWD GH OD IDPLOLD 065 3URSRUFLRQD OD FDSDFLGDG H[FOXVLYD GH DxDGLU IiFLOPHQWH PyGXORV GH HQWUDGD \ VDOLGD D XQ PyGXOR GH UHOp GH VHJXULGDG EiVLFR 3XHVWR TXH HO VLVWHPD PRGXODU VH EDVD HQ PLFURSURFHVDGRU WDPELpQ WLHQH OD FDSDFLGDG GH SURSRUFLRQDU GLDJQyVWLFRV FRQ FDUDFWHUtVWLFDV PHMRUDGDV PHGLDQWH XQD FRQH[LyQ GH FRPXQLFDFLyQ 3RU HMHPSOR HO HVWDGR GH (6 \ HUURU SXHGH FRPXQLFDUVH PHGLDQWH XQD UHG GH EXV GH FDPSR 3XHVWR TXH HV XQD DUTXLWHFWXUD UHODWLYDPHQWH QXHYD DFWXDOPHQWH DFHSWD HQWUDGDV GH GLVSRVLWLYRV GH VHJXULGDG GH WLSRV FRPXQHV SDURV GH HPHUJHQFLD FRPSXHUWDV GH VHJXULGDG FRUWLQDV GH OX] GH VHJXULGDG \ WDSHWHV GH VHJXULGDG /DV DUTXLWHFWXUDV GH VLVWHPDV GH UHOpV GH VHJXULGDG PRGXODUHV SXHGHQ XVDUVH HQ DSOLFDFLRQHV GH ULHVJR PHGLR D DOWR  6LVWHPDV GH 3/& GH VHJXULGDG /RV 3/& GH VHJXULGDG RIUHFHQ SURJUDPDFLyQ DXWRPiWLFD DOWR FRQWHR GH (6 FRQWURO GLVWULEXLGR \ XQ DOWR QLYHO GH FRPXQLFDFLyQ D ODV DUTXLWHFWXUDV GH VHJXULGDG 7DPELpQ RIUHFHQ DOJXQDV IXQFLRQHV HVSHFLDOHV TXH SUHYLDPHQWH QR HVWDEDQ GLVSRQLEOHV HQ ORV VLVWHPDV GHGLFDGRV FRQWDGRUHV GH DOWD YHORFLGDG \ VHxDOHV DQDOyJLFDV /DV DUTXLWHFWXUDV GH 3/& GH VHJXULGDG JHQHUDOPHQWH VH XVDQ HQ XQD YDULHGDG GH DSOLFDFLRQHV FRPSOHMDV GH DOWR ULHVJR

Qpwipprtifi

6xxfwfiphttyhphf

&RPLHQFH HO SURFHVR GH VHOHFFLyQ HYDOXDQGR ODV QHFHVLGDGHV GH VX DSOLFDFLyQ /D VLJXLHQWH *XtD UiSLGD SXHGH XVDUVH SDUD OOHJDU D OD PHMRU VROXFLyQ $OJXQDV GH ODV SDXWDV OH LQGLFDUiQ FODUDPHQWH XQ WLSR GH DUTXLWHFWXUD 2WUDV QHFHVLWDUiQ PD\RU DQiOLVLV DQWHV GH UHDOL]DU OD GHFLVLyQ ILQDO 'HELGR D ORV GLYHUVRV WLSRV GH JXDUGDV GH PiTXLQDV HV SRVLEOH FUHDU XQ VLVWHPD KtEULGR R XQD FRPELQDFLyQ GH DUTXLWHFWXUDV SDUD SURSRUFLRQDU SURWHFFLyQ DGHFXDGD SDUD XQD PiTXLQD R VLVWHPD GH IDEULFDFLyQ SDUWLFXODU

@ftif 6ffhpthf 4tphf 6xwputifiipwffwthfhty


5fuf pitf f 4wf Qpwipithfi Qpwipithfip f itgwp IE ipprtifi Qpwp f itgwp IE ipprtifi Qpwipithfi Qpwp f itgwp IE ipprtifi

6xythfhty
8fi

7tfryth
5fu pi 4w

6ffhtifiip pfyty
5fuf pi 4wf

Qpwipithfi Qpwp f itgwp IE ipprtifi QpwipithfiIE ipprtifi Qpwipithfip f itgwp Qpwipithfi Qpwp f itgwp IE ipprtifi Qpwipithfip f itgwp IE ipprtifi Qpwipithfip f itgwp IE ipprtifi Qpwipithfip f itgwp IE ipprtifi

Stippyfif
8 phtfw

6ypip8R
5fu pi 4w

Tgthfhtyip8R
p tif 7ttgtif Gt r f

7pfhtfhtyphpyhtfw 6ywipyf
Ih hs



Qpwipprtifi

GfprfiippwphhtyippwipprtifiFtyf
Rfwtiftyxpitff Rfwtifpfifif Uwfupippfhty 6f Rprtifi 4twtf Rprtifi 4twtf pry 8G 8F RRG 8F RR RR 8F 8F RR 8F RR RR ! !    Fipwippw &"! 8yfif G4 4 G6 G6 G4 G4 G6 G4 G6 G6 G4 66 64 64 64 Qpwipxytpipprtifi FRQ%S G   t t t t FRQ"S ! G  G   t t FRQ QSQSI ! G G    t FRQ#QS ! G G E  t t t t FRQ QS ! G G E   t t t t FRQ&S G G4   t t t t FRQ QSQSI ! G G4   t FRQ F !   t t t FRQEF ! G     t FRQ$QISI ! G G E  t t t t FRQ#QS G  G    t t t t FRQQS ! G G    t t t t FRQ QISI !  G  E   t t t t FRQ!QS ! G G E "  t t t t G G  FRQ%S ! "  t t t t G4G  Qpwipxytpipprtifihypfiipfwtif FRQ %77I ! G G    t FRQ"7 G     t t FRQ %7I !  G E  t t t t FRQ %7I !  G E    t t t t FRQQ7 G  %    t t t t Qpwiphywipixfy FRQ "AAI ! G4G    t FRQ"AAI ! G4G   t t t FRQ$Q6 G4G   t t t t Tytifipippfyty FRQ 88I ! G  G  !  t t
FRQ 8787I

RF0Sfppipprtifiip!hfgwpE606tyfipwipprtifi8F08wphxphythRR08fiwtit0tyhwti

FRQ8 FRQ&8

G  G  ! ! G  G  G  G 

# %

 

t t t

t t

t t

t t



Qpwipprtifi
6tpypip Qpfgwphtxtpy hyxfhtyip fwtif4 4yhsipw 4 Fy " ! pywpyp Spxtyfwp Ffy Ffy U64 U66 xx pfgwp Qpwipxytpipprtifi
t t t t t t t t t t t t t t t t t t t t t t t t t t ! $" t t t ! # # ! " ! # "   ! ! " # !   !"" " " " !" !"" " " !" !" " !"" "" !"  & t t t t t t t t t t t t t

6ptqthfhtyp
6thv
t t t t t t t t t t t t t t t t t t t t t t t t t

68
t t t t t t t t t t t t t t t t t t t t t t t t t t t

5@ hTE STU
t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t

Byqxfhty fithtyfw
!! ! !# ! # !  !# !% !! ! ! % ! !  !! ! ! !% !!# !!! !!% !!% !! !" !"! !" !# !# !"% !"#

Fipwip pw FRQ%S FRQ"S FRQ QSQSI FRQ#QS FRQ QS FRQ&S FRQ QSQSI FRQ F FRQEF FRQ$QISI FRQ#QS FRQQS FRQ QISI FRQ!QS FRQ%S FRQ %77I FRQ"7 FRQ %7I FRQ %7I FRQQ7 FRQ "AAI FRQ"AAI FRQ$Q6 FRQ 88I FRQ8 FRQ&8
FRQ 8787I

Qpwipxytpipprtifihypfiipfwtif
t t t t t   " !"" !" !" "   " " !"" " "    &

Qpwiphywipixfy
" ! # # ! $"

Tytifipippfyty

Gf'

4Ffy04xthFfyfwFyFfy0Fytpxfyfw



Qpwipprtifi hytyfhty

GfprfiippwphhtyippwipprtifiFtyf
6f pry 8G Fipwippw &"! 8yfif Qpwipxytpipprtifixiwfp FRQI FRQ FRQI FRQI FRQ I FRQ %I FRQ!I FRQ!"I Tytifipiphyw 6T 6T 6T 6T!

Rfwtiftyxpitff Rfwtifpfifif Uwfupippfhty Rprtifi 4twtf Rprtifi 4twtf 8F RRG 8F RR RR 8F 8F RR 8F RR RR ! !    G4 4 G6 G6 G4 G4 G6 G4 G6 G6 G4 66 64 64 64


    t

7p fif t ip p itp p  G  G4G  7p fif t ip p itp p  G E 7p fif t ip p itp p  G  G4G  7p fif t ip p itp p  G E G4 GIG IGI qfp G  G 

! !   

!  

 

  

 

t t t t t t t t t

t t t t

t t t

t t t

RF0Sfppipprtifiip!hfgwpE606tyfipwipprtifi8F08wphxphythRR08fiwtit0tyhwti



Qpwipprtifi
6tpypip Qpfgwphtxtpy hyxfhty ipfwtif4 4yhsipw 4 Fy " ! pywpyp Spxtyfwp pfgwp Ffy Ffy U64 U66 xx Qpwipxytpipprtifixiwfp
t t t t t t t t " ! ! ! " " " " !" !" $" $" " " $" !! !" !" !" " t t t t t t t t

6ptqthfhtyp
6thv 68

5@ hTE STU
t t t t t t t t t t t t t t t t t t t t

Byqxfhty fithtyfw
!$ !$! !$# !$% !% !% !%! !%# !# !## !$ !#!

Fipwip pw FRQI FRQI FRQI FRQI FRQ I FRQ %I FRQ!I FRQ!"I 6T
6T

t t t t t t t t t t t t

t t t t t t t t t t t t

Tytifipiphyw

Gf'

6T 6T!

4Ffy04xthFfyfwFyFfy0Fytpxfyfw



Qpwipprtifi

Tytifiipqpypipfwtxpyfhtypwhthf
8phtqthfhtyp
G f ptqthfht p 9p pipfwt p fht ip p htf 8 fifipqtgwppp f fwtif B ithfipE87 Uwfupipptp htfipt @ ipt fwfht @fiiph f t fht Sp pffip pfht w pwhthf B8 8G#! fhf 8 ffifwfitphtf f wthfgwp hTE U 4  U 4""A ip)!V Qpfiip" 4 " 4f!U Qu0fwt pwhh phfif U ipfhpih U78 o f"" !9f 9 & ips pifipwftf ipwp wp p ipwp t fw BI!G8 47BG!$ BI7BG!$
!4V@p fi " 4V@ fht !

7phthty
/D IXHQWH GH DOLPHQWDFLyQ 0LQRWDXU FRQYLHUWH  9&$ R  9&$ D  9&& 6H GHEH XVDU FRQ XQ 0657 R XQ LQWHUUXSWRU GH HQFODYDPLHQWR VLQ FRQWDFWR )HUURWHN /D IXHQWH GH DOLPHQWDFLyQ VH SXHGH FRQHFWDU D XQ 0657 \ XVDUVH SDUD LQWHUFRQHFWDU VHxDOHV GH FRQWURO GH LQWHUUXSWRU GH HQFODYDPLHQWR GH SDUR GH HPHUJHQFLD \ GH HQFODYDPLHQWR GH FRPSXHUWD GH  9&$ y  9&$ /D IXHQWH GH DOLPHQWDFLyQ HOpFWULFD VH SXHGH XVDU SDUD KDFHU IXQFLRQDU  XQLGDGHV GH FRQWURO )HUURWHN \ XQ 0657 SDUD OD SURWHFFLyQ GH LQWHUUXSWRUHV GH HQFODYDPLHQWR VLQ FRQWDFWR

A pifi Iphht Iphht

fwtgpiph ih 4upip f tww p t fwp fptfwipwp wp p fup Ip Utgfht s p

G %%"wg wr Iwthfg fu Qtpw7BGip " r!#wg $"   wr th f""A r p tt tip

6ffhpthf

(QWUDGD GH  9&$ y  9&$ 6DOLGD GH  9&& &RQVXPR GH SRWHQFLD GH  9$ (QYROYHQWH GH  PP GH DQFKR



Tytifiipqpypipfwtxpyfhtypwhthf
Rpwphhtyipih 7phthty
9p pipfwt p fht pwhthfip U 4

Qpwipprtifi

Rfwtif
" 4f!U

Gxpiphfwr !!Q4 


"%&

7txpytypxxwrfif
&& &

 " &   " $ fupp tpw7BGip "

    %

7tfrfxfiphfgwpfith 6yptypipU
9pypip fwtxip U64 Ipyp Ipyp Rfwtifip !U64 Rfwtifip !U64 Rfwtifip !U64 Rfwtifip !U64

A1

A3

A2

A4

6yptypip U
9pypip fwtxip  U64 Ipyp Rfwtifip !U64 Rfwtifip !U64 Rfwtifip !U64 Rfwtifip !U64

A1

A3

A2

A4



Qpwipprtifi FtyfFRQ"S

Qpwipxytpipprtifi
8phtqthfhtyp
G f fprf ptqthfht p 9p pipfwt p fht ip p htf 8 fifipprtifi Qptp htfipp fif  Qpfgwpht tp fwtif pwhthf 8G&"!B H %!&B8 8G #!B8 #&!$"4G B 5&4 !! f!pr 8G&"! Sthv fhf 8hTE STU !U 4 )!U4 G   " "#A

4 th f fw G4 prtifi(G 4twtf

7phthty
(O 0657 FXHQWD FRQ XQ VROR FDQDO GH HQWUDGD 1& TXH VH XVD FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ DSOLFDFLRQHV GH EDMR ULHVJR (O 0657 FXHQWD FRQ FDSDFLGDG GH PRQLWRUHR TXH SXHGH DFHSWDU XQD IXQFLyQ GH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O 0657 WLHQH  VDOLGDV GH VHJXULGDG 1$ \  VDOLGD DX[LOLDU 1& /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG /D IXHQWH GH DOLPHQWDFLyQ 0LQRWDXU FRQYLHUWH  9&$ y  9&$ D  9&& 6H GHEH XVDU FRQ XQ 0657 R XQ LQWHUUXSWRU GH HQFODYDPLHQWR VLQ FRQWDFWR )HUURWHN&XDQGR VH XVD FRQ HO 0657 OD IXHQWH GH DOLPHQWDFLyQ HOpFWULFD 0LQRWDXU DFW~D FRPR XQ PyGXOR GH HQWUDGD GH  9&$  9&$ SHUPLWLHQGR TXH XQ FLUFXLWR GH XQ FDQDO GH  9&$  9&$ VH FDEOHH GLUHFWDPHQWH DO FLUFXLWR GH VHJXULGDG

Ttwtfht

ipfwtifpr B8 5 4 " #&!$"t ihtf !4"U 4!4U 4 I 7  4!U tp p thf t fwt h fht  9tgwpfwtif htp pwfup h fi Stp iphfif  w B ithfipE87 Uwfupipptp htfipt @ ipt fwfht @fiiph f t fht Sp pffip pfht f 6f f o6f""6!9f 9  !  f  !    f  f f f !  !4 4hht tifip"4

 4U & Upip0fwtif "U ipfhpih U78

!  "   !

f f f f f  6 !  6  f f f

" f "  f f

6ffhpthf

  ! f   " "   66   66    

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  (QWUDGD GH XQ VROR FDQDO  VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1& (QYROYHQWH GH  PP GH DQFKR 0yGXOR RSFLRQDO GH HQWUDGD GH  9&$

M M

  "        

f f f 

 "   f""  

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

4wthfhtyp
6thtip hyxfhty

--

Rxtyt

6thtipxytpiphyfhp 6thtiphyxfhtyiphyfhp Rxtytptyhwpfwhthtip hyxfhty 6yfh FytpfiFtyf 8w

FRQ"S

xtxffippxtyfwfppyhtf ipfwryqfwwtypy Efqyhtyipprtifiprffytfif pwFtyf 6yfhp'Ihtyf xytpiphyfhptp fyixhyfhp

.435

pxytpff



Rpwphhtyipih
8yfif
 6

Fytpippwipprtifi FtyfFRQ"S
Rfwtifftwtfp
 6

Qpwipprtifi

Rfwtifipprtifi

9pypipfwtxpyfhty pwhthf
! 6 66

Gxpiphfwr !!Q5 

4hhpt
f 9

7phthty
f f   6 " f

Gxpiprtyf
! !

Gxpiphfwr !!Q4  !!Q4 "#


A1 A2 X1 K2 K1 K2 X2 K1 K1 K2 K2 13 23 33 41

7txpytypxxwrfifitfrfxfipgwp
 " 

24VDC K1

 " &   " $

f "

    %

K1

K2

14 24 34

42

7tfrfxfiphfgwpfith
!U66 fgtp Ifip !U66 Qpfgwphtxtpy

L1 L2 L3 A1 13 23 33 41 X1

L1 L2 L3

L1 L2 L3

pxprpyhtf

L1 L2 L3 A1 13 23 33 41 X1 K1 K2 A2 14 K1 24 K2 34 42 X2
4

.435

hpfi

K1 A2 14 K1 24 K2 34 K3 42 X2
4

K2

K3

.435

M
Stpf

Stpf

8yhwffxtpyiphxpfipyhfyfwpfgwphtxtpy fxthfwtifipyhfyfwtyfwtifxytpfif

Ifippxprpyhtfipihfyfwppfgwphtxtpy xfyfwfwtifipihfyfwpfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ#QS

8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$"4GRB5& 4R!! 6fprf 6f pry8G&"! BRH %!& 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6Sthvxfhf68hTESTU !U6466U U64 "#A 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif )!U4 G6 "pryi "

Fytpxfyfxfy G4Rprtifi(G64twtf 5 46"(!4"U64 !4U64 I 76 ( 4!U66

7phthty
(O 06557 FXHQWD FRQ XQ LQWHUUXSWRU LQWHUQR TXH SHUPLWH DO XVXDULR VHOHFFLRQDU  HQWUDGD GH XQ VROR FDQDO 1& TXH VH XVD FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ ODV DSOLFDFLRQHV GH EDMR ULHVJR y  HQWUDGDV GH GRV FDQDOHV 1& SDUD ODV DSOLFDFLRQHV GH DOWR ULHVJR (O 06557 WLHQH XQ LQWHUUXSWRU VHOHFWRU LQWHUQR TXH SXHGH IXQFLRQDU FRQ OD IXQFLyQ GH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R PDQXDO PRQLWRUHDGR (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O PRGR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO SDUD DFWLYDU ODV VDOLGDV (O 06557 WLHQH  VDOLGDV GH VHJXULGDG 1$ \  VDOLGD DX[LOLDU 1& /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

6tpypxthfyxtyfwty hyxfhty 9tgwp 8yfiftypyfppxwf Rfwtifppyf Fyhtpypwfuphyxfi Stpxiphfifx ByithfipE87

!4

Qpfiip"x4 4hhtytifip"4 x4U "x Qu0fwtxpwhhyphfif(Upip0 Dhpfi(Upip0Dhpfi(xgf 0xiipywhfyfw

Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty S pxpffippfhty

"U 6ipfhpihyU78

o6f""6 !9f 9

Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih

& ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx !4V@pyfi !xx 4V@xfht

4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h

G x%%"wg wr Iwthfgyfu Qtpw7BGip "xx "rwg

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  (QWUDGD VHOHFFLRQDEOH FRQ LQWHUUXSWRU  VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1& 5HVWDEOHFLPLHQWR VHOHFFLRQDEOH FRQ LQWHUUXSWRU (QYROYHQWH GH  PP GH DQFKR

U64$4 $"U4h

U664#V U664V Utiftwxphythf Utgfhty

M M

0 " 0#

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A

6sp

rxpxttytip

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp6ywphywf qgthfffgpyptyqxfhtygpwfhffhtifipyxtyfwpyxfif

f ff

f f

f f f f f f f f f f f f f

7pfwwpipfwthfhty
FRQ#QS
6 6 6 f f f f f f f f

9 f f f f f f f f f f f f f f f f f f f f f f f f



Rpwphhtyipih
8yfif
 6 6

Qpwipxytpipprtifi FtyfFRQ#QS
Rfwtifftwtfp
 6

Qpwipprtifi

Rfwtifipprtifi

9pypipfwtxpyfhty pwhthf
! 6 66  6  6

Gxpiphfwr !!Q6 $ !!Q6 % !!Q6 &

4hhpt
9

7phthty
"

Gxpiprtyf
!

Gxpiphfwr !!Q4 "#


A1 A2 X1 X2 T R K3 K2 K3 K2 K1 K3 S14 K1 K4 K5 K6 S13 K1 K5 K1 K4 K1 S24 S23 13 23 33 41

7txpytypxxwrfifitfrfxfipgwp
 !  !" " 

f "

 $ %   $

24VDC K2

S K6 K2

K2

14 24

34 42

7tfrfxfiphfgwpfith
E Qpfgwphtxtpy !U66

L1 L2 L3
fgtp

L1 L2 L3
fgtp

S23 S24 S R

A1

13

23

33

41 X1

S23 S24 S

A1

13

23

33

41 X1

.4335
K1 S14 A2 14 K1 24 34 42 X2
4 hpfi

.4335
K1 S14 A2 14 K1 24 34 42 X2
4

T S13

hpfi

S13

M
Stpf

6xpfipprtifiipyhfyfwpfgwphtxtpy xfyfwxytpfifwtifipyhfyfwfwtifxytpfif
!U66 Qpfgwphtxtpy

6xpfipprtifiipyhfyfwpfgwphtxtpy fxthfwtifipyhfyfwtyfwtifxytpfif
E

L1 L2 L3
fgtp

L1 L2 L3
fgtp

S23 S24 D R

A1

13

23

33

41 X1 K1 K2

S23 S24 D

A1

13

23

33

41 X1 K1 K2

.4335
S14 A2 14 K1 24 K2 34 42 X2
4

.4335
S14 A2 14 K1 24 K2 34 42 X2
4

T
hpfi

hpfi

S13

S13

M
G

Stpf

6xpfipprtifiipihfyfwppfgwphtxtpy xfyfwxytpfifwtifipihfyfwpfwtifxytpfif

6xpfipprtifiipihfyfwppfgwphtxtpy fxthfwtifipihfyfwpfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ%S

8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif TtwtfhtyipfwtifpryB86 #&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty 9tgwp 8yfiftypyf ppxwf Rfwtifppyf Fyhtpypwfuphyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty

7phthty
(O 0657 WLHQH  HQWUDGD 1& GH XQ FDQDO TXH VH XVD FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ DSOLFDFLRQHV GH EDMR ULHVJR (O 0657 WLHQH PRQLWRUHR GH VDOLGD TXH SXHGH DFHSWDU XQD IXQFLyQ GH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O 0657 WLHQH  VDOLGDV GH VHJXULGDG 1$ \  VDOLGDV DX[LOLDUHV 1& /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG /RV FRQWDFWRV DX[LOLDUHV VRQ VDOLGDV VLQ VHJXULGDG GLVHxDGDV SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG 6H SXHGH XVDU HO 0657 FRPR XQLGDG GH H[WHQVLyQ D RWUDV XQLGDGHV 0LQRWDXU R FRPR XQ GLVSRVLWLYR GH HQWUDGD GH XQ VROR FDQDO LQGHSHQGLHQWH &XDQGR VH XVD FRPR XQLGDG GH H[WHQVLyQ ODV VDOLGDV GHO 0657 VH FRQHFWDQ D XQD GH ODV VDOLGDV HQ OD XQLGDG SULQFLSDO /DV VDOLGDV HQ HO 0657 IXQFLRQDUiQ FRPR ODV VDOLGDV HQ OD XQLGDG SULQFLSDO

8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f pry8G&"! BRH %!& 6Sthvxfhf68hTE !U6466 U64 "#A )!U4 G6 : 4xthxfyfw G4Rprtifi(G64twtf 5 46" !4"U64!4U64 I 76 ( 4!U66 !4 Qpfiip"x4 4hhtytifip"4 x4U &x Qu0fwtxpwhhyphfif Upip0fwtiffhtfif "U 6ipfhpihyU78

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   HQWUDGD 1 & GH XQ VROR FDQDO  VDOLGDV 1$ GH VHJXULGDG  VDOLGDV 1& DX[LOLDUHV (QYROYHQWH GH  PP GH DQFKR

o6f""6 !9f 9 Axpifi & ipsxpifipwftf Iphhtyipwpywpyp BI!G8F47BG!$ Iphhtyipwpxtyfw BI7BG!$ 6fwtgpiphyih "xx!4V@pyfi !xx4V@xfht 4upipfytwwpxtyfwp Gx%%"wgwr Ffptfwipwpywpyp Iwthfgyfu Fyfup Qtpw7BGip "xx Ip r!#wg Utiftwpwhthf U64!4%%U4hM0 " pfhtyp U64$4 $"U4hM0# "pfhtyp U664#V pfhtyp U664V pfhtyp Utiftwxphythf pfhtyp Utgfhty $"xx wrth f""A 6sp rxpxttytip
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp



Rpwphhtyipih
St
G6

Qpwipxytpipprtifi FtyfFRQ%S
Rfwtifftwtfp
G6

Qpwipprtifi

Rfwtifipprtifi
G4

9pypipfwtxpyfhty pwhthf
!U6466  U64

Gxpiphfwr !!Q8   !!Q8  

4hhpt
7phthty
9tgwpip"x4

Gxpiprtyf
!#

Gxpiphfwr !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
!$ !""$&
A1 A2 X1 X2 S13 S14 13 23 33 41 51

F1
K2 ~ 24VDC K1 K2 K2 K1 K3 K1

 $ %   $ Fyfuppytpw7BGip "xx

K3

K2

K1

14 24

34 42

52

7tfrfxfiphfgwpfith
E
L1 L2 L3 L1 L2 L3

E
L1 L2 L3 L1 L2 L3

4gtp

S13

A1

13

23

33

41

51

X1

fgtp
K1 K2

S13

A1

13

23

33

41

51 X1 K1

.435
S14 A2 14 K1 24 K2 34 42 52 X2

.435
hpfi
S14 A2 14 K1 24 K2 34 42 52 X2

K2

4

M
Stpf

4

6xpfipprtifiipyhfyfwpfgwphtxtpy fxthfwtifipyhfyfwtyfwtifxytpfif

6xpfipprtifiipyhfyfwpfgwphtxtpy fxthfwtifipyhfyfwfwtifxytpfif

7pfwwpipfwthfhty

Byppwphipwfup !!Q8  wfxpyp 9tgwp ppxwffgwp

 U64 U64



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ&S

8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f pry8G&"! BRH %!& 6Sthvxfhf68hTE !U6466 U64 "#A )!U4 G6G4 "pryi "

7phthty

4xthxfyfw G4Rprtifi(G64twtf 5 46" !4"U64!4U64 I 76 ( 4!U66 !4 Qpfiip"x4 4hhtytifip"4 x4U "x Qu0fwtxpwhhyphfif Upip0fwtiffhtfif "U 6ipfhpihyU78 o6f""6 !9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht Gx%%"wgwr Iwthfgyfu Qtpw7BGip "xx r!#wg

(O 0657 FXHQWD FRQ  HQWUDGD 1& \  HQWUDGD 1$ GH GRV FDQDOHV SDUD XVR FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ DSOLFDFLRQHV GH DOWR ULHVJR (O 0657 VH XVD JHQHUDOPHQWH SDUD ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD LQFRUSRUDQGR OD GLYHUVLGDG GH XQ LQWHUUXSWRU GH HQFODYDPLHQWR GH DSHUWXUD SRVLWLYD \ GH DSHUWXUD QR SRVLWLYD (O 0657 WLHQH PRQLWRUHR GH VDOLGD TXH SXHGH DFHSWDU XQD IXQFLyQ GH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O 0657 WLHQH  VDOLGDV GH VHJXULGDG 1$ \  VDOLGD DX[LOLDU 1& /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV SDUD D\XGDU D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty 9tgwp 8yfiftypyf ppxwf Rfwtifppyf Fyhtpypwfup hyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4 h 0 " U64$4 $"U4 h 0# U664#V U664V

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   HQWUDGD 1& \  HQWUDGD 1$ GH GRV FDQDOHV  VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1& 5HVWDEOHFLPLHQWR DXWRPiWLFR (QYROYHQWH GH  PP GH DQFKR

M M

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

Utiftwxphythf

4wthfhtyp
FRQ&S
6thtipxytpiphyfhp' 6thtiphyxfhtyiphyfhp Rxtytptyhwpfwhthtip hyxfhty 6yfh FytpfiFtyf

Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Rpwphhtyipih
8yfif
G6G4

Qpwipxytpipprtifi FtyfFRQ&S
Rfwtifftwtfp
G6

Qpwipprtifi

Rfwtifipprtifi
G4

9pypipfwtxpyfhty pwhthf
!U6466  U64

6ffwrpGxgp !!Q9 $ !!Q9 %

4hhpt
7phthty
9tgwpip"x4

Gxpiprtyf
!#

6ffwrpGxgp !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
!$ !""$&
A1 A2 X1 X2 S13 S14 S22 S21 13 23 31 F1 110/230 K2

 $ %   $ Fyfuppytpw7BGip "xx

K3 VR1 K2 Logic C1 T1 K3

K3

K1 K1

K1 K1 K2

K1 ~ 24VDC

Logic K2

T2

K2

14 24

32

7tfrfxfiphfgwpfith
E Qpfgwphtxtpy E

L1 L2 L3
hpfi

L1 L2 L3
hpfi

S21 S22

A1

13

23

31

X1 K1 K2

S21 S22

A1

13

23

31

X1 K1 K2

.435
fgtp

.435
fgtp

S13

S14

A2

14 K1

24 K2

32

X2
4

S13

S14

A2

14 K1

24 K2

32

X2
4

M
G

6xpfipprtifiipihfyfwppfgwphtxtpy xfyfwfwtifipihfyfwpfwtifxytpfif

6xpfipprtifiipihfyfwppfgwphtxtpy fxthfwtifipihfyfwptyfwtifxytpfif

7pfwwpipfwthfhty

9tgwpppxwffgwp Byppwphip wfup!!Q9 %  U64 U64



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ%S

8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G #!B86#&!$"4GRB5& 4R!!8G"$! 6f!pry8G&"! BRH %!& Ffhf68hTES U !U6466o  U64o"  !U64o"  #V #U4"$V G6G4G4G6 "pryi  6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 4Y4Y 4Y 4Y 6yxipfwtxpyfh !U6466 U!U64 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif

7phthty
(O 0LQRWDXU 0657 HV XQD XQLGDG GH UHOp GH PRQLWRUHR GH VHJXULGDG FRQ HQWUDGD GH GRV FDQDOHV  VDOLGDV GH VHJXULGDG \  VDOLGDV DX[LOLDUHV(VWi GLVHxDGR SDUD IXQFLRQDU FRQ ODV DSOLFDFLRQHV GH SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG \ FRQWURO GH  PDQRV (O 0657 HV XQD XQLGDG YHUViWLO FRQ XQD DPSOLD JDPD GH GLDJQyVWLFRV 6H SXHGH XVDU FRQ ERWRQHV GH LQWHUUXSWRUHV GH SDUR GH HPHUJHQFLD LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ FRQWUROHV GH GRV PDQRV DVt FRPR UHOpV GH H[SDQVLyQ FXDQGR VH UHTXLHUHQ HQWUDGDV DGLFLRQDOHV &XDQGR VH XVD HQ XQ FLUFXLWR FRUUHFWDPHQWH FRQILJXUDGR HO 0657 SURSRUFLRQD FLUFXLWRV DGLFLRQDOHV FRQ FODVLILFDFLyQ GH VHJXULGDG \ FRQ YHULILFDFLyQ \ PRQLWRUHR GH HVWDGR /RV IDOORV FUtWLFRV GH VHJXULGDG R FRUWHV GH HQHUJtD KDUiQ TXH ORV FLUFXLWRV LQLFLHQ XQ EORTXHR D XQ HVWDGR VHJXUR

4xthFfyFytpfi xfyfw "G4Rprtifi(G64twtf 6 46" $"4"U64 "4U64 P 76 4!U66 %4$4 ""4!"4 "!"4 Stpxippfgwphtxtpyip 9tywpyfip# !U6466x4 x Qu0hhthtippyfif Upip0fwtxpwhthf Upip0xfhsf Qu0qfwwippyfif Qu0qfwwipfwtif U 6ipfhpihyU78  o"6f""6 o 9f 9 &" ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@ %Gx$wgwr I5Sipwtpu Qtpw7BGip "xx &"r%$wg

TtwtfhtyipfwtifpryB86
#&!$"tyihtf

6tpypxthfyxtyfw tyhyxfhty 9tgwp 8yfifpwphtypyf Rfwtifppyf Fyhtpypwfuphyxfi Stpxiphfifx ByithfipE87

6ffhpthf

Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h 0 " U64$4 $"U4h 0# U664#V U664V

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   9&$&& \  9&$ y  9&$ (QWUDGDV GH GRV FDQDOHV  VDOLGDV GH VHJXULGDG 1$  VDOLGDV DX[LOLDUHV 1& $SOLFDFLRQHV GH SDUR GH HPHUJHQFLD \ FRPSXHUWD $SOLFDFLRQHV GH FRQWURO GH  PDQRV  LQGLFDGRUHV /(' SDUD DPSOLRV GLDJQyVWLFRV

M M

pfhtyp "pfhtyp pfhtyp pfhtyp "pfhtyp $"xx wrth f""A "rxpxttytip

Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Rpwphhtyipih
8yfif
G6G4G4 G6

Qpwipxytpipprtifi FtyfFRQ%S
Rfwtifftwtf
G6

Qpwipprtifi

Rfwtifipprtifi
"G4

9pypipfwtxpyfhty pwhthf
!U6466U64 !U6466!U64

Gxpiphfwr !!QY5Q"4Y !!QY5Q"4Y

7txpytypxxwrfifitfrfxfipgwp
 !# & !
A1 A2 B1 T11 T32 T12 T31 T34 IF1 K3 K2 K1 K2 K3 T22 T35 13 23 33 43 53 61 73
IS6

&$ %

!U66

Erthf

6hth 9fwwip tip fwtif Ffhsf

4wtxpyfh

K1

9fwwip pyfif

B2

X1

X2 T33 14 24 34 44 54

62 74

7tfrfxfiphfgwpfith
!U66 fgtp
L1 L2 L3
T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73

!U66

L1 L2 L3
fgtp
T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73

hpfi

FRQ%S
T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 62 74

K1

FRQ%S
hpfi
T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 62 74

K1 K2

Qpfgwp htxtpy Stpf

K1

4

M
Stpf

K1 K2

4

8yfifyhfyfwpfgwphtxtpyxfyfw xytpfifwtifipyhfyfwfwtifxytpfif
E

pyfifipihfyfwpG4G6pfgwphtxtpy fxthfwtifipihfyfwptyfwtifxytpfif
E fgtp

Byp 

L1 L2 L3
T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73 T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73

L1 L2 L3

Byp 

FRQ%S
T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 62 74

K1 K2
hpfi

FRQ%S
T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 62 74

K1 K2

K1 K2
G

4

Qpfgwp htxtpy G

K1 K2

4

6ywipixfypfgwphtxtpyfxth fwtifipihfyfwptyfwtifxytpfif

8yfifipihfyfwpG6pfgwphtxtpyxfyfw xytpfifwtifipihfyfwpfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQEF

8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$"B86#!&#4GRB 5&4R!! 6f!pry8G&"! BRH %!& Ffhf685@ !U66" !V G6Rpwphhtyfgwpxpitfyp typtxthftxth " sx sx "sx Bythtptytht G4Rprtifi(G64twtf 5 46"( 4"U64 4U64 I 76 ( 4!U66 5 46"(4"U64 4U64 I 76 (4!U66 "4 "x4ippfi #4fhhtytif x4U !x x "x Upip0Et Upip0DhpfitDwp pyhtpyip 7ppxtyftptphhthtpypw gyippfgwphtxtpy Upip0Dhpfi o"6f""6"f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht 6ipfhpihyU78 Gx%wgwr Iwthfgyfu Qtpw7BGip "xx r!%"wg 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfif Rtxwfyptifiippyfif Fptpyhtfippyfif RR! RR R R ! Qpfgwphtxtpy Rfwtif

7phthty

(O UHOp GH PRQLWRUHR GH VHJXULGDG 065/0 HVWi GLVHxDGR SDUD PRQLWRUHDU FRUWLQDV GH OX] GH VHJXULGDG FRQ ODV IXQFLRQHV DxDGLGDV GH VLOHQFLDPLHQWR H LQLFLDFLyQ GH GLVSRVLWLYR GH GHWHFFLyQ GH SUHVHQFLD 36',  3URSRUFLRQD XQD VDOLGD D XQ VLVWHPD GH FRQWURO GH PiTXLQD FXDQGR OD FRUWLQD GH OX] HVWi OLEUH GH REVWUXFFLRQHV &XDQGR ODV HQWUDGDV DO 065/0 VH FLHUUDQ FRQGXFFLyQ ORV UHOpV GH VDOLGD VH FLHUUDQ VL HO FLUFXLWR GH PRQLWRUHR IXH VDWLVIHFKR (O 065/0 WLHQH  FRQMXQWRV GH HQWUDGDV GH GRV FDQDOHV (VWR SHUPLWH TXH IXQFLRQH HQ  FRQILJXUDFLRQHV GLIHUHQWHV  0RQLWRUHD KDVWD  FRUWLQDV GH OX] GH VHJXULGDG HQ HO PRGR GH JXDUGD VRODPHQWH  0RQLWRUHD KDVWD  FRUWLQDV GH OX] GH VHJXULGDG FRQ  GHWHFWRUHV GH VLOHQFLDPLHQWR VyOR  FRUWLQD VLOHQFLDGD   0RQLWRUHD  FRUWLQD GH OX] GH VHJXULGDG FRQ  GHWHFWRUHV GH VLOHQFLDPLHQWR  0RQLWRUHD KDVWD  FRUWLQDV GH OX] GH VHJXULGDG FRQ 36', VyOR XQD FRUWLQD LQLFLDGD  (O 065/0 XWLOL]D WHFQRORJtD EDVDGD HQ PLFURSURFHVDGRU SDUD RIUHFHU XQD DPSOLD YDULHGDG GH VROXFLRQHV DYDQ]DGDV HQ XQ HQYROYHQWH GH PRQWDMH HQ ULHO ',1 GH  PP /RV LQWHUUXSWRUHV VHOHFWRUHV LQWHUQRV SHUPLWHQ XQD IiFLO VHOHFFLyQ GH KDVWD  DSOLFDFLRQHV GLIHUHQWHV &XDWUR LQGLFDGRUHV /(' SURSRUFLRQDQ LQIRUPDFLyQ GH HVWDGR GH RSHUDFLyQ DVt FRPR GLDJQyVWLFRV /RV WHUPLQDOHV H[WUDtEOHV UHGXFHQ HO FDEOHDGR \ HO FRVWR GH LQVWDODFLyQ FXDQGR VH QHFHVLWD UHDOL]DU XQ UHHPSOD]R

B86#&!$"tyiht G6

Ttwtfhtyipfwtifpry G4

6tpypxthfyxtyfw tyhyxfhty 9tgwp 8yfifppyf Rfwtifppyf Fyhtpypwfuphyxfi Qpfifwffhtfhty Qpfgwph xfyfw Qpfgwphfxth Stpxipppf ByithfipE87 4wtxpyfhty D D Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty 4upipfytwwpxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h 0 " U64$4 $"U4h 0# U664#V U664V

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  6LOHQFLDPLHQWR GH FRUWLQD GH OX] GH VHJXULGDG y  GHWHFWRUHV ,QLFLDFLyQ GH GLVSRVLWLYR GH GHWHFFLyQ GH SUHVHQFLDKDVWD  DSHUWXUDV (QYROYHQWH GH  PP 7HUPLQDOHV H[WUDtEOHV 9ROWDMH GH VXPLQLVWUR GH  9&& (QFODYDPLHQWR GH LQLFLRUHLQLFLR $SUREDFLyQ GH RWUDV HQWLGDGHV%*

M M

pfhtyp "pfhtyp pfhtyp pfhtyp hthwsf pfhtyp  "xx""A

7pfwwpipfwthfhty

9phpyhtfxippfhty Utiftwxphythf Utgfhty

7phyphpwffwtxpyfhtypwhthfTtwthpyipytwwfiwfy fffgtwfhgtpfpypwtypptypy
6gtpf qyfw
ch1 ch2

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

6 3 6 3

9 0 9 0

6 3 6 3

1
0 9

10
0

Utfipwffptypt



Rpwphhtyipih
8yfif
G6 %!#"

Qpwipxytpipprtifi FtyfFRQEF
G4

Qpwipprtifi

Rfwtifipprtifi
!"$$

Rfwtifftwtfp
G6

9pypipfwtxpyfhty pwhthf
!U66

Gxpiphfwr !!QI $


31

7txpytypxxwrfifitfrfxfipgwp
A1+ A2 S12 S14 S21 S22 S24 S23 S31 S32 S34 S33 S41 S42 S44 S43 M1M2 13 23

PTC

Rpffhtyrfwythf
K1

%#  & Erthf Fytp Erthf Fytp

K2

K1

K1

run1

K2

K2

run2

48

58

X44

14 24

32

7tfrfxfiphfgwpfith
!U66

4wtxpyfhty
5y wfi xfypyti

7pphphy twpyhtfxtpy FR FR

D f

Bytht

D f

L1

L2 L3

p HRR766 h p Q 6tyfipwipprtifi E6oytwpyhtfif IpypRR R R!tE6 ypf

t x y f S

HRR766

If

9tgwp

K3
A1 S12 S14 S21 S22 S23 S24 S31 S32 S33 S34 13 23 31

Qptythtfx E67pph Rtwpyh pr Rtwpyh


A2 M1 M2 48

FRQEF

2 2

2 2

K1 K2
S42 14 24 32

Bythtptytht Stpfip!U ppti Gf'7htyfipwipprtifihyptythtfxthE6twpyhipphp

6tyfipwipprtifi E6Botwpyhtfif

t x y f S

58 X44 S43 S44 S41

p h p Q

HRR766 HRR766

y  t tf tw h f h t f y i t t f h x t 6f wf

K4

Iphhtyip hyfhpu Rfwtifiphp xth

5xgtwwf twpyhtfif

Bytht ptytht
K3 K4

6yfhpipprtifipw iphywipprtifi



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQEF
7tfrfxfiphfgwpfithhytyfhty
!U66

4wtxpyfhty

7pphphy twpyhtfxtpy FR FR FR! FR

Bytht

D f D f
L1 L2 L3

t x y f S

6tyfipw ipprtifi E6oy twpyhtfif

HRR7 p HRR7 h p Q

If

9tgwp

A1 S12 S14 S21 S22 S23 S24 S31 S32 S33 S34 13 23 31

Qptythtfx4 !ipphRtwpyh sRtwpyh 5

FRQEF

4 5

K1 K2
S42 14 24 32

A2 M1 M2 48 58 X44 S43 S44 S41

y  f wtt th f h t f y i t t f h x t 6 wf f

K3

K4

5xgtwwf twpyhtfif

Bytht ptytht

Byp ipwwfp

Iphhty iphyfh puRfwtif iphp xth

Bythtptytht K3 K4 6yfhpipprtifi pwiphywipprtifi Stpfip!U ppti Gf'@pypfwxpyphtyfipwipprtifihyptythtfxthE6twpyh!ipphp !U66


t x y f S HRR7 p HRR7 h p Q

4wtxpyfhty

9tgwp

L1

L2 L3

6tyfipw @fif wfxpyp t x p h y p f Q S 6tyfipw @fif wfxpyp t x p y h f p Q S 6tyfipw IR7B

9tgwp

HRR7 HRR7
A1 S12 S14 S21 S22 S23 S24 S31 S32 S33 S34 13 23 31

HRR7 HRR7

IR7B 4pftytht 67gwp fpf

FRQEF

6 2

6 2

K1 K2 S42 14 24 32

A2 M1 M2 48 58 X44 S43 S44 S41

y  t tf tw h f th i y f t t f h t6 x wf f

K3

K4

6thwip xtyf IR7B

M
K4

Bytht ptytht
Bythtptytht ppti
K3

Iphhtyip hyfh puRfwtifip hpxth

Stpfip!U xytpipfwtif

6yfhpipprtifi pwiphywipprtifi

Gf'8yfifiphtyfipwtythtfhtyipitttipipphhtyipppyhtfpyE6pyhwffxtpyiptythtptythtfwtifipihfyfwp



7pfwwpipfwthfhty

Qpwipxytpipprtifi FtyfFRQEF
6HFXHQFLD GH LQLFLDFLyQ DXWRPiWLFD SRU SDVRV 6H PXHVWUD GREOH LQWHUUXSFLyQ /D LQLFLDFLyQ DXWRPiWLFD SHUPLWH TXH OD PiTXLQD DUUDQTXH \ VH GHWHQJD VHJ~Q HO Q~PHUR GH YHFHV TXH VH LQWHUUXPSHQ \ GHVDSDUHFH OD REVWUXFFLyQ GH ORV KDFHV GH OD FRUWLQD GH OX] GH VHJXULGDG $ FRQWLQXDFLyQ VH LOXVWUD HO 065/0 HVWDEOHFLGR SDUD HO PRGR GH GREOH LQWHUUXSFLyQ GH LQLFLDFLyQ DXWRPiWLFD GHVSXpV GH OD VHFXHQFLD GH SXHVWD HQ PDUFKD LQLFLDO  7DPELpQ VH SXHGHQ VHOHFFLRQDU ORV PRGRV GH XQD R WUHV LQWHUUXSFLRQHV

Qpwipprtifi

FRQEFRpxpfhyphfifhtyfipwip prtifi
+D\ P~OWLSOHV FRQILJXUDFLRQHV GLVSRQLEOHV OR FXDO RIUHFH XQD VHULH GH YHQWDMDV $ FRQWLQXDFLyQ VH GHVFULEHQ ODV WUHV FRQILJXUDFLRQHV PiV FRPXQHV 0RGR SURWHFWRU (O HMHPSOR PXHVWUD XQD SUHQVD SURWHJLGD SRU XQD FRUWLQD GH OX] GH VHJXULGDG FRQHFWDGD DO 065/0

'XUDQWH OD RSHUDFLyQ GH OD PiTXLQD FDGD YH] TXH ORV KDFHV GH OD FRUWLQD GH OX] VRQ LQWHUUXPSLGRV OD SUHQVD VH GHWLHQH LQPHGLDWDPHQWH DVHJXUDQGR TXH QR H[LVWD SRVLELOLGDG GH TXH HO RSHUDGRU VXIUD XQD OHVLyQ &XDQGR ORV KDFHV HVWiQ OLEUHV GH REVWUXFFLyQ OD PiTXLQD SXHGH UHLQLFLDUVH 0RGR GH VLOHQFLDPLHQWR 6H PXHVWUDQ GRV HMHPSORV DPEDV DSOLFDFLRQHV GH WUDQVSRUWDGRU FRQ XQD FRUWLQD GH OX] GH VHJXULGDG SURWHJLHQGR HO iUHD SHOLJURVD 6H XWLOLFH VLOHQFLDPLHQWR GH KD] FUX]DGR \ HQ OtQHD SDUD SHUPLWLU TXH HO PDWHULDO SDVH D WUDYpV GH OD FRUWLQD GH OX] VLQ GHWHQHU OD PiTXLQD /D FRUWLQD GH OX] GH VHJXULGDG GHWHFWDUi FXDOTXLHU RWUR REMHWR R XQD SHUVRQD OR FXDO LQLFLDUi HO SDUR GH OD PiTXLQD
-$ .4 .4 .4 .4

UD LQWHUUXSFLyQPDWHULDO SURFHVDGR UHWLUDGR UD YH] VLQ REVWUXFFLyQFRUWLQD GH OX] VLQ REVWUXFFLyQ /D PiTXLQD SHUPDQHFH HQ PRGR GH SDUR

GD LQWHUUXSFLyQQXHYR PDWHULDO LQVHUWDGR /D PiTXLQD SHUPDQHFH HQ HO PRGR GH SDUR

(O VLOHQFLDPLHQWR HQ OtQHD UHTXLHUH TXH HO PDWHULDO LQWHUUXPSD ORV KDFHV HQ VHFXHQFLD WDO FRPR VH PXHVWUD 6yOR VL ORV FXDWUR KDFHV 06 VH LQWHUUXPSHQ HQ VHFXHQFLD \ OXHJR GHVDSDUHFH OD REVWUXFFLyQ HQ VHFXHQFLD OD FRUWLQD GH OX] SHUPLWLUi TXH SDVH HO PDWHULDO VLQ LQLFLDU HO SDUR GH OD PiTXLQD
-$

GD YH] VLQ REVWUXFFLyQFRUWLQD GH OX] VLQ REVWUXFFLyQ /D PiTXLQD DUUDQFD $O FRPSOHWDU HO FLFOR OD UD LQWHUUXSFLyQ FRPHQ]DUi OD VHFXHQFLD QXHYDPHQWH

.4

(O VLOHQFLDPLHQWR GH KDFHV FUX]DGR UHTXLHUH TXH HO PDWHULDO LQWHUUXPSD ORV KDFHV HQ VHFXHQFLD 06 SULPHUR \ OXHJR 06 6yOR VL ORV KDFHV VH LQWHUUXPSHQ HQ VHFXHQFLD \ OXHJR GHVDSDUHFH OD REVWUXFFLyQ HQ VHFXHQFLD OD FRUWLQD GH OX] SHUPLWLUi TXH SDVH HO PDWHULDO VLQ LQLFLDU HO SDUR GH OD PiTXLQD



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ F

8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G #!B86#&!$"4GRB5& 4R!!" 6fprf 6f!pry8G&"! BRH %!& 6ptqthfhtyp Ffhf685@6R4 !Uwfxpyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfif !U6466U64 V G6fppipprtifiip !hfgwp Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif sx Fytpxfyfxfy G4Rprtifi(G64twtf 5 46"( 4"U64 4"U64 I 76 ("4!U66 G6 5 46"( 4"U644"U64 I 76 (4!U66 6tpypxthfyxtyfwty hyxfhty 9tgwp 8yfifppyf Rfwtifppyf Fyhtpypwfuphyxfi Qpfifwffhtfhty Qpfgwph xfyfw Qpfgwphfxth Stpxipppf ByithfipE87 4wtxpyfhty D x "x Upip0Etu0fppfhtfi Upip0DhpfitDw ippxtyftptphhthtpy gyippfgwphtxtpy D S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih Upip0Dhpfi o"6f""6"9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx !4V@pyfi !xx 4V@xfht @iptyfwfhty @fiiphyfxtyfhty S pxpffippfhty o6f""6 !9f 9 Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx !4V@pyfi !xx 4V@xfht 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h Gx%wgwr Iwthfgyfu Qtpw7BGip "xx r!%"wg 6ipfhpihyU78 Qpfiip"x4 #4fhhtytif x4U !x %4$4

7phthty
/D XQLGDG GH FRQWURO 0650 HVWi GLVHxDGD SDUD PRQLWRUHDU WDSHWHV GH VHJXULGDG GH  FDEOHV FRQHFWDGRV SDUD FUHDU XQD ]RQD GH VHJXULGDG (O WDPDxR GH OD ]RQD GH VHJXULGDG HVWi OLPLWDGR SRU OD LPSHGDQFLD GH HQWUDGD WRWDO  RKPV Pi[LPR FUHDGD SRU HO FDEOHDGR \ ODV FRQH[LRQHV (O FRQWURODGRU HVWi GLVHxDGR SDUD LQWHUFRQHFWDUVH FRQ HO FLUFXLWR GH FRQWURO GH OD PiTXLQD H LQFOX\H GRV UHOpV GH VHJXULGDG SDUD DVHJXUDU OD UHGXQGDQFLD GH FRQWURO (O FRQWURODGRU GHWHFWD XQD SUHVHQFLD HQ HO WDSHWH XQ FRUWRFLUFXLWR R XQ FLUFXLWR DELHUWR (Q FDGD XQD GH HVWDV FRQGLFLRQHV ORV UHOpV GH VDOLGD GH VHJXULGDG VH GHVDFWLYDQ &XDQGR VH LQWHUFRQHFWDQ FRUUHFWDPHQWH OD PiTXLQD R HO PRYLPLHQWR SHOLJURVR UHFLEH XQD VHxDO GH SDUR \ VH DFWLYD XQD VDOLGD DX[LOLDU

Ttwtfhtyipfwtifpry G4

B86#&!$"tyiht

6ffhpthf

&DWHJRUtD  &DWHJRUtD GH SDUR  7HUPLQDOHV H[WUDtEOHV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 'HWHFFLyQ GH WDSHWHV GH VHJXULGDG GH  FDEOHV $SUREDFLyQ GH RWUDV HQWLGDGHV%*

U64$4 $"U4h

M0 " M0#

pfhtyp "pfhtyp pfhtyp pfhtyp hthwsf pfhtyp r""A rxpxttytip

U664#V U664V 9phpyhtfxippfhty Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Rpwphhtyipih
8yfif
Sfppipprtifiip !hfgwp

Qpwipxytpipprtifi FtyfFRQ F
Rfwtifftwtfp
G6

Qpwipprtifi

Rfwtifipprtifi
G4

9pypipfwtxpyfhty pwhthf
!U6466 U64

Gxpiphfwr !!QI $ !!QI $!


S34 13 23 31

7txpytypxxwrfifitfrfxfipgwp
%!#" "%& !"$$
A1(+) A2(-) S11 S12 S22 S33
Iphhtyhyf gpwfup hhtht Erthf Fytp

 &  # %

K1

Fyfuppytpw 7BGip "xx !!QI $

%#  & !!QI $!

24V K2 K1 K2

S21

14

24

32

7tfrfxfiphfgwpfith
U64 Qpfgwp htxtpy
L1 L2L3

U64

Qpfgwphtxtpy

Sfpp ip prtifi

FRQ F

A1 S11 S21 13 23 31 S33 K1 K2

Sfppip prtifi

FRQ F
A

A1 S11 S21 13 23 31 S33

L1 L2L3

M A2 S12 S22 14 24 32 S34

K1

A2 S12 S22 14 24 32 S34

K1 K2

Stpf

K1

8yfifipfppipprtifipfgwphtxtpyxfyfw xytpfifwtifipihfyfwpfwtifxytpfif

8yfifipfppipprtifipfgwphtxtpy fxthfwtifipyhfyfwtyfwtifxytpfif

7pfwwpipfwthfhty

7phyphpwffwtxpyfhtypwhthfTtwthpyipytwwfi wfyfffgtwfhgtpfpypwtypptypy

y thf p fwtxpyfht y

Qpfgwphtxtpy fxthxfyfw Qpfgwphtxtpy xfyfw xyt pf



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ QSQSI


Rpxpfpywpyphy pxtyfwppfgwp

8phtqthfhtyp
Gxf 6fprfipprtifi 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Fptpyhtfippyfif pxttif Rfwtif 8G&"!BRH %!&B86 8G#!4GRB5& 4R!! 6f!pry8G&"! BRH %!& Ffhf686SthvhTESTU !U66R8EU V G6G6fppip prtifiip!hfgwp sx G4Rprtifipfiwti G64pfiwti 4f!U66 "x4f!U66 #4fhhtywpyf4fhhty tif "x x Upip04wtxpyfhtyI Upip0Dhpfi Upip0Dhpfi Bythtfwtfhty Hpfhtyyxfw 6fxgtiphyqtrfhtyifyp wfpfhty 9fwwiptypipfwtifip pfiwti 9fwwtypy o"6f""6!f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$  o"xx!o!4V@ Qtpw7BGip "xx  r%$wg ""A "xx r#xhsp

7phthty
(O 0LQRWDXU 06557573 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG EDVDGR HQ PLFURSURFHVDGRU FRQ FODVLILFDFLyQ GH VHJXULGDG \ VDOLGDV GH HVWDGR VyOLGR /D YHUVDWLOLGDG GH ODV HQWUDGDV 06557573 SHUPLWH VX FRQH[LyQ D LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD GLVSRVLWLYRV GH SDUR GH HPHUJHQFLD \ WDSHWHV GH VHJXULGDG GH  FDEOHV /RV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ GH SDUR GH HPHUJHQFLD SXHGHQ VHU FLUFXLWRV GH XQ FDQDO R GRV FDQDOHV QRUPDOPHQWH FHUUDGRV /D FDSDFLGDG GH UHVWDEOHFLPLHQWR GHO 06557573 SHUPLWH TXH SXHGD FRQILJXUDUVH SDUD LQLFLR \ UHLQLFLR PDQXDO R DXWRPiWLFR /DV VDOLGDV LQFOX\HQ GRV VDOLGDV FRQ FODVLILFDFLyQ GH VHJXULGDG QRUPDOPHQWH DELHUWDV TXH SXHGHQ FRQHFWDUVH D FDUJDV GH KDVWD  $ D  9&& (VWDV VDOLGDV SXHGHQ XVDUVH SDUD HQYLDU XQD VHxDO GH SDUR GH VHJXULGDG D XQD PiTXLQD R VLVWHPD GH IDEULFDFLyQ (O 06557573 WDPELpQ WLHQH XQD VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD GH HVWDGR VyOLGR OD FXDO VyOR GHEH XVDUVH SDUD LQGLFDU HO HVWDGR GHO 06557573

6wftqthfhtyipprtifiip fwtif 4twtf 9tgwpfwtifppyf Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 ByithfiE87ipfwtxpyfhty ffipip 6yfypipitfryth ffip !ffip Iffiphyty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1 &DWHJRUtD GH SDUR   VDOLGDV GH VHJXULGDG GH HVWDGR VyOLGR  VDOLGDV DX[LOLDU GH HVWDGR VyOLGR  1&  1& R HQWUDGD GH WDSHWH GH VHJXULGDG 5HVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R PDQXDO PRQLWRUHDGR

pf f fht f pyxtyfwp pfwt fpywf tyf f fgpyp pfwwp ywphywf g thf f fgpyp ty xfht yg pwfhf fht f p yxtyfwpyx f f

Spxtyfhtypiphfgwpfi
RR RR 4oR ! RoR ! Rfwtifippyipw 6yfhippyfif Bypippfgwphtxtpy Qpfgwphtxtpyfxthpgf ippfpyxfhsftysfgtwtfif RoR ! Qpfgwphtxtpyfxthpgf ippfpyxfhsfsfgtwtfif 4oX 6thtipxytp 4oX! Fytpipqfwwhfi tysfgtwtfi



Rpwphhtyipih
8yfif
G6G6 fppipprtifi

Qpwipxytpipprtifi FtyfFRQ QSQSI


Rfwtifftwtfp
G4 8fiwti

Qpwipprtifi

Rfwtifipprtifi
G4 8fiwti

Spxtyfwp
9tu 7pxyfgwp

Gxpiphfwr !!QG &$ !!QG &%

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
A1 Y41 S1 1 A1 S34

!" !"

FRQ QSQSI
14 A2 14 S12 24 S22 S21 24 Y32 Y32 Y2

7tfrfxfiphfgwpfith
hfyfwp pfgwphtxtpy hfyfwp pfgwphtxtpy hfyfwp pfgwphtxtpy hfyfwp pfgwphtxtpy fxth tyxyt p p xfyfwxyt pf ty xfyfwxyt pf xyt p fxth xyt p p fww p fwwh f ty pgf p h f ty pgf p pf xyt p p fwwh f ty fwwh f ty pgf p pfpyxf h f pyxf h f pgf p pfpyxf h f pfpyxf h f
S11 S21 A1 S11 S21 S11 S11 A1 A1 S21 S11 A1

f pp pp t f pfgwphtxtpyxfyfw xyt pf xyt p p fwwh f ty pgf p pfpyxf h f


S11 S21 A1

S12 S22

S34

S12 S22

S34

S12 S22

S34 Y41

S12 S22

S34 Y41

S12 S22

S34

yhfyfw pfgwphtxtpy yhfyfw pfgwphtxtpyxfyfw xyt pf tyxyt p p fxth tyxyt p p fwwh f ty pgf p fwwh f ty pgf p pfpyxf h f pfpyxf h f
S21 A1 S21 S11 A1

hfyfwp pfgwphtxtpy fxth tyxyt p p fwwh f pgf p pfpyxf h f


S11 S21 A1

yhfyfw pfgwphtxtpy fxth tyxyt p p fwwh f pgf p pfpyxf h f


S11 S21 A1

f pp pp t f pfgwphtxtpyfxth xyt p p fwwh f ty pgf p pfpyxf h f


S11 S21 S11

S12 S22

S34 Y41

S12 S22

S34 Y41

S12 S22

S34 Y41

S12 S22

S34 Y41

S12 S22

S34

!U

Qpfgwphtxtpy

!U
L1 L2 L3 S11 S21 A1 S34 Y41 Y2 L1 L2 L3

S11 S21 A1 S34 Y41 Y2

FRQ QSQSI
S12 S22 A2 14 24 Y32

K1

FRQ QSQSI
S12 S22 A2 14 K1 24 Y32

K1

K2

K1 K2

Stpf

4fIE6 tyithfi

M
Stpf

4fIE6 tyithfi

Ifippxprpyhtfipihfyfwpfwtifpfififipihfyfwp 8yhwffxtpyiphxpfipyhfyfwfwtifipy pfgwphtxtpyxfyfwxytpfixytpipfwtif hfyfwpfgwphtxtpyfxthtyxytpipfwtif



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQ QSQSI


Rpxpfpywpyphy pxtyfwppfgwp

8phtqthfhtyp
Gxf 6fprfipprtifi 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Fptpyhtfippyfif pxttif Rfwtif 8G&"!BRH %!&B86 8G#!4GRB5& 4R!! 6f!pry8G&"! BRH %!& Ffhf686SthvhTESTU 9pypipxtyt pwhthfxpyppffifip !U66R8EUxtyhfrf V G6G4 sx G4Rprtifipfiwti G44pfiwti 4f!U66

7phthty
(O 0LQRWDXU 06557573 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG EDVDGR HQ PLFURSURFHVDGRU FRQ FODVLILFDFLyQ GH VHJXULGDG \ VDOLGDV GH HVWDGR VyOLGR (O 06557573 HVWi GLVHxDGR SDUD IXQFLRQDU FRQ HQWUDGDV GH GRV FDQDOHV GRQGH XQ FDQDO HV QRUPDOPHQWH FHUUDGR \ HO RWUR QRUPDOPHQWH DELHUWR /RV GHWHFWRUHV 6LSKD SXHGHQ FRQHFWDUVH D ODV HQWUDGDV 06557573 6H XWLOL]DQ SXOVRV GH SUXHED SDUD YHULILFDU GLQiPLFDPHQWH ORV FLUFXLWRV GH HQWUDGD 7RGDV ODV HQWUDGDV \ VDOLGDV FXHQWDQ FRQ SURWHFFLyQ FRQWUD FRUWRFLUFXLWR /D FDSDFLGDG GH UHVWDEOHFLPLHQWR GHO 06557573 SHUPLWH TXH SXHGD FRQILJXUDUVH SDUD UHVWDEOHFLPLHQWR DXWRPiWLFR R PDQXDO PRQLWRUHDGR 3XHGH KDELOLWDUVH XQD SUXHED GH SXHVWD HQ PDUFKD VL VH XWLOL]D HO UHVWDEOHFLPLHQWR DXWRPiWLFR /D SUXHED GH SXHVWD HQ PDUFKD UHTXLHUH TXH VH GHVFRQHFWH \ VH YXHOYD D FRQHFWDU OD DOLPHQWDFLyQ HOpFWULFD D ODV HQWUDGDV DQWHV TXH VH DFWLYHQ ODV VDOLGDV (O UHVWDEOHFLPLHQWR \ OD SUXHED GH SXHVWD HQ PDUFKD VRQ GHWHUPLQDGRV SRU HO FDEOHDGR GH FRQH[LyQ /DV VDOLGDV LQFOX\HQ GRV VDOLGDV FRQ FODVLILFDFLyQ GH VHJXULGDG QRUPDOPHQWH DELHUWDV TXH SXHGHQ FRQHFWDUVH D FDUJDV GH KDVWD  $ D  9&& (VWDV VDOLGDV SXHGHQ XVDUVH SDUD HQYLDU XQD VHxDO GH SDUR GH VHJXULGDG D XQD PiTXLQD R VLVWHPD GH IDEULFDFLyQ (O 065 WDPELpQ WLHQH XQD VDOLGD DX[LOLDU QRUPDOPHQWH DELHUWD GH HVWDGR VyOLGR TXH VyOR GHEH XVDUVH SDUD LQGLFDU HO HVWDGR GHO 06557573

6ffhpthf

&DWHJRUtD  VHJ~Q (1 &DWHJRUtD GH SDUR   VDOLGDV GH VHJXULGDG GH HVWDGR VyOLGR 1$  VDOLGD DX[LOLDU GH HVWDGR VyOLGR 1$  HQWUDGD 1$ \  1&

6wftqthfhtyipprtifiip fwtif 4twtf "x4f!U66 Iphhtyhyfhhtht 8yfiffwtif prtifif Qpfifwffhtfhty Stpxipppf "x Stpxipphpfhty x ByithfipE87 Upip04wtxpyfhtyI Upip06Afhtfi Upip06Afhtfi ByithfiE87ipfwtxpyfhty Bythtfwtfhty ffipip 6yfypipitfryth Hpfhtyyxfw ffip 6fxgtiphyqtrfhtyifyp wfpfhty !ffip 9fwwiptypipfwtifip pfiwti Iffiphyty 9fwwtypy Spxpffippfhty o"6f""6!f 9 Axpifi & ipsxpifipwftf Iphhtyipwpywpyp BI!G8F47BGU78!$ Iphhtyipwpxtyfw BI @fiiphyfxtyfhty  6fwtgpiphyih o"xx!o!4V@ Fyfup 8ywpypipxyfuppyfypw BI"! Qtpw7BGip "xx Ip  r%$wg Utgfhty ""A "xx 6sp r#xhsp
pf f fht f pyxtyfwp pfwt fpywf tyf f fgpyp pfwwp ywphywf g thf f fgpyp ty xfht yg pwfhf fht f p yxtyfwpyx f f

Spxtyfhtypiphfgwpfi
RR RR 4oR ! RoR ! Rfwtifityxthfipptqthfhtyipw 6yfhippyfif Bypippfgwphtxtpy Qpfgwphtxtpyfxthpgf ippfpyxfhsftysfgtwtfif RoR ! Qpfgwphtxtpyfxthpgf ippfpyxfhsfsfgtwtfif 4oX 6thtipxytp



Rpwphhtyipih
8yfif
G6G4

Qpwipxytpipprtifi FtyfFRQ QSQSI


Rfwtifftwtfp
G4 8fiwti

Qpwipprtifi

Rfwtifipprtifi
G4 8fiwti

Spxtyfwp
9tu 7pxyfgwp

Gxpiphfwr !!Q9 && !!Q9 

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
A1 Y41 S11 A1 S34

!" !"

FRQ QSQSI
14 A2 14 S12 24 S22 S21 24 Y32 Y32 Y2

7tfrfxfiphfgwpfith
!U Qpfgwphtxtpy !U
L1 L2 L3 S11 S21 A1 S34 Y41 Y2 K1 L1 L2 L3

S11 S21 A1 S34 Y41 Y2

FRQ QSQSI
S12 S22 A2 14 24 Y32

FRQ QSQSI
S12 S22 A2 14 24 Y32

K1

K2

K2

K1 K2

Stpf

4fIE6 tyithfi

M
Stpf

K1 K2

4fIE6 tyithfi

8yfifipipphRtsffwtifipihfyfwp pfgwphtxtpyxfyfwxytpfixytpipfwtif pgfippfpyxfhsftysfgtwtfif


!U

8yfifipipphRtsffwtifipihfyfwp pfgwphtxtpyfxthxytpipfwtif pgfippfpyxfhsfsfgtwtfif


!U

Qpfgwphtxtpy

L1 L2 L3 S11 S21 A1 S34 Y41 Y2

L1 L2 L3

S11 S21 A1 S34 Y41 Y2

FRQ QSQSI
S12 S22 A2 14 24 Y32

K1

FRQ QSQSI
S12 S22 A2 14 24 Y32

K1

K2

K2

K1 K2

Stpf

4fIE6 tyithfi

M
Stpf

K1 K2

4fIE6 tyithfi

8yfifipihfyfwpfwtifipihfyfwp pfgwphtxtpyxfyfwxytpfixytpipfwtif pgfippfpyxfhsftysfgtwtfif

7pyfiftyippyitpypfwtifipihfyfwp pfgwphtxtpyfxthtyxytpipfwtif pgfippfpyxfhsftysfgtwtfif



Qpwipprtifi

Qpwipxytpipprtifi FtyfFRQQS

8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6f!pry8G&"! BRH %!& 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6Sthvxfhf68hTE5@ !U6466" U64 %fwfupyxtyfw "#A 6yxippyhtf 8yfifipprtifi !V G6G6htyfipwip prtififppipprtifi Rtxwfyptifiippyfif Byqtyt !"sx 4Ffyxytpxfy G4RprtifiG64 RRIGI4 Ttwtfhtyipfwtifpry B86#&!$!pttf 46'%4"U64 76E%4!U66 4 46"(#4"U64#4 "U64 G 76 ( 4!U66(# 4!U66f#xty Rfwtifpfiwti 6tpypxthfyxtyfw tyhyxfhty x4f!U66 Upwxtpiphf F4pyyffphtfip htpyp Utifpwhthftwhyptyip gppyty

7phthty

Fptpyhtfippyfifpxttif Qpfgwphtxtpy Rfwtif

(O *XDUGPDVWHU 0LQRWDXU 06557 GH $OOHQ%UDGOH\ HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG TXH RIUHFH WUHV FRQWDFWRV GH VHJXULGDG QRUPDOPHQWH DELHUWRV XQ FRQWDFWR DX[LOLDU QRUPDOPHQWH DELHUWR \ XQD VDOLGD DX[LOLDU GH HVWDGR VyOLGR SDUD XVR FRQ LQWHUFRQH[LyQ D 3/& (O 06557 WLHQH XQD FRQILJXUDFLyQ GH HQWUDGDV YHUViWLO 3XHGH FRQHFWDUVH D XQD FRPSXHUWD GH VHJXULGDG GH XQ FDQDO R GRV FDQDOHV D XQ LQWHUUXSWRU GH SDUR GH HPHUJHQFLD XQD HQWUDGD GH WDSHWH GH VHJXULGDG R XQD FRUWLQD GH OX] GH VHJXULGDG TXH SURSRUFLRQH GHWHFFLyQ GH IDOORV FUX]DGRV (O UHVWDEOHFLPLHQWR \ HO PRQLWRUHR GH VDOLGDV VRQ GHWHUPLQDGRV SRU OD FRQILJXUDFLyQ GHO FDEOHDGR (O UHVWDEOHFLPLHQWR DXWRPiWLFR PDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRUHV H[WHUQRV (O PRGR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO (O 06557 WLHQH  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG 7LHQH XQD VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD DVt FRPR XQD VDOLGD DX[LOLDU 313 GH HVWDGR VyOLGR SDUD LQGLFDU HO HVWDGR GHO 06557 D XQD ERPELOOD LQGLFDGRUD R D XQ 3/&

Ttwtfhtyipfwtifpry

B86#&!$"tyihtf

"U64"4 $"U4h

M0 M0 M0 " "U64"4"U4hM0#


"U64#4"U4h "U64"4#"U4h !U664!%V U664V

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp #4fhhtywpyf4fhhtytif x4U 4rRyH "  "x x

9tgwpfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf !U66 !" U64 Stpxipphpfhty ByithfipE87

"V

6ffhpthf

6fipwxtpiphtpypiphyfh
p i f t h p  f  4 p  i p h f x y y h  p y p t h

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FRQWDFWRV GH VHJXULGDG 1$  FRQWDFWR DX[LOLDU 1&  FRQWDFWR DX[LOLDU 313 GH HVWDGR VyOLGR 2SHUDFLyQ GH XQ FDQDOGRV FDQDOHV 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR $SOLFDFLRQHV GH SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG WDSHWH GH VHJXULGDG R FRUWLQD GH OX] GH VHJXULGDG

x Upip0fwtxpwhhyphfif( Upip0Dhpfi( Upip0Dhpfi

Uwfupipptpyhtfiptxw S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw Iphhtypwphythfhyf hhtht @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip !U66  U64 Utiftwxphythf Utgfhty

"U o"6f""6 f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ 8yfiffwtifippfiwti

200 180 160 140 120 100 80 60 40 20 0 0

 o!xx !o4V@ Qtpw7BGip "xx &r#!wg $r%wg




pfhtyp ""A "xx r#xhsp

6sp

6tpypgp hyfh 6tpypgphyfh

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

Spxpff4xgtpyp6

10

20

30

40

50

60



Rpwphhtyipih
8yfif
G6G6 Sfppipprtifi htyfipwipprtifi

Qpwipxytpipprtifi FtyfFRQQS
Rfwtifftwtfp
G6 RRIGI G4

Qpwipprtifi

Rfwtifipprtifi

9pypipfwtxpyfhty pwhthf !U6466 "U64  U64

Gxpiphfwr !!QC  !!QC  !!QC &&

7txpytypxxwrfifitfrfxfipgwp
A1 (+)

S11

S52

S12

Y31

Y32

13
13

23
23

33
33 41

41

  !  $ %

   ! "  &  

K1 K2
S21 (PE)

.4335
S33 S34 14

14

24

34

42

!" $$

$"&"

!"$

S22

X5

24

34

42

A2 ()

7tfrfxfiphfgwpfith
L1
  !U66 6tyfipw ipprtifi RfwRfw !U66

L1 L2 L3
L1 L2 L3

A1 S11 S12 S52 X5 Y31 13 23 33 41

A1 S11 S52 S12 X5 Y31 13 23 33 41


S fppip prtifi

.4335
PE A2 S21 S22 S34 S33 Y32 14 24
Qpfgwphtxtpy

K1 K2 34 42

.4335
PE A2 S21 S22 S34 S33 Y32 14 24 34 42

K1 K2

K1 K2

M
Stpf Qpfgwphtxtpy

K1 K2

6tyfipwipprtifiip!U66pwipprtifiip " U64 pfgwphtxtpyxfyfwxytpfifwtifxytpfif


!U66

Sfppipprtifi Qpfgwphtxtpyxfyfwxytpfifwtif xytpfif


!U66

Ifip pxprpyhtf

L1 L2 L3 A1 S11 S52 S12 X5 Y31 13 23 33 41

.4335
PE A2 S21 S22 S34 S33 Y32 14 24 K1 K2
Stpf Qpfgwphtxtpy

K1 K2 34 42

i f ti r p hpfi p i A1 S11 S12 S52 X5 Y31 13 23 33 41 f p x .4335 6


PE A2 S21 S22 S34 S33 Y32 14 24 34 42

L1 L2 L3

K1 K2

M
Stpf

K1 K2

Ifippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif

6xpfipprtifiipyhfyfw pfgwphtxtpyfxthtyxytpipfwtif



Qpwipprtifi

Qpwipxytpipprtifi
FtyfFRQ QS 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6f!pry8G&"! 6Sthvxfhf68hTE5@ !U6466" U64 %owfupyxtyfw "#A &o!U66 6yxippyhtf 8yfifipprtifi !V G6G6htyfipwip prtifi Rtxwfyptifiippyfif Fptpyhtfippyfifpxttif Byqtyt !sx 4Ffyfwxfyfwxytpfi G4RprtifiRRIGI4 46'%4"U64 76'%4!U66 4 46" #4"U64#4"U64 G 76 ( 4!U66( #4!U66f#xty 6tpypxthfyxtyfwty hyxfhty Rfwtifpfiwti 9tgwpfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 Upwxtpiphf F4pyyhtht x4f!U66 #4fhhtywpyf4fhhtytif x4U 4rRyH "  "x x Upip0fwtxpwhhyphfif( Upip0Dhpfi Upip0Dhpfi Uwfupipptpyhtfiptxw S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw Iphhtyhyfhhtht @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip !U66  U64 Utiftwpwhthf U64!4%%U4h "U o"6f""6 9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ Rfwtifippfiwti  !xx !4V@ Qtpw7BGip "xx $r " wg "r!$!wg


7phthty
(O *XDUGPDVWHU 0LQRWDXU 06557 GH $OOHQ%UDGOH\ HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG TXH RIUHFH GRV FRQWDFWRV GH VHJXULGDG QRUPDOPHQWH DELHUWRV \ XQD VDOLGD DX[LOLDU GH HVWDGR VyOLGR SDUD XVR FRQ LQWHUFRQH[LyQ D 3/& (O 06557 SXHGH FRQHFWDUVH D XQD FRPSXHUWD GH VHJXULGDG GH XQ FDQDO R GRV FDQDOHV R XQ LQWHUUXSWRU GH SDUR GH HPHUJHQFLD R SXHGH FRQHFWDUVH R D XQD FRUWLQD GH OX] GH VHJXULGDG TXH SURSRUFLRQH GHWHFFLyQ GH IDOORV FUX]DGRV (O UHVWDEOHFLPLHQWR \ HO PRQLWRUHR GH VDOLGDV VRQ GHWHUPLQDGRV SRU OD FRQILJXUDFLyQ GHO FDEOHDGR (O UHVWDEOHFLPLHQWR DXWRPiWLFR PDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRUHV H[WHUQRV (O PRGR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO (O 06557 WLHQH  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG /D VDOLGD DX[LOLDU GH HVWDGR VyOLGR HV XQ FLUFXLWR 313 FRQ SURWHFFLyQ FRQWUD FRUWRFLUFXLWR GLVHxDGD SDUD LQGLFDU HO HVWDGR GHO 06557

Qpfgwphtxtpy Rfwtif Ttwtfhtyipfwtifpry B86#&!$!pttf

Ttwtfhtyipfwtifpry

B86#&!$"tyihtf

P4

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FRQWDFWRV GH VHJXULGDG 1$  FRQWDFWR DX[LOLDU 313 GH HVWDGR VyOLGR 2SHUDFLyQ GH XQ FDQDOGRV FDQDOHV 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR $SOLFDFLRQHV GH SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG R FRUWLQD GH OX] GH VHJXULGDG

6fipwxtpiphtpypiphyfh
140 p i f t 120 h p f  100 4 p  i 80 p h f x 60 y y h  40 p y p t 20 h

U64$4 $"U4h

M0 " M0#

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp ""A "xx r#xhsp

U664#V U664V Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

0 0

Spxpff4xgtpyp6

10

20

30

40

50

60



Qpwipxytpipprtifi
Rpwphhtyipih
8yfif
G6G6 htyfipwipprtifi

Qpwipprtifi

FtyfFRQ QS
Gxpiphfwr !!QC # !!QC ! !!QC 

Rfwtifipprtifi
G4

Rfwtifftwtfp
RRIGI

9pypipfwtxpyfhty pwhthf !U6466 "U64  U64

7txpytypxxwrfifitfrfxfipgwp
A1(+) S11
  !  $ %    ! "  &  

S52

S12

Y31 Y32

13 13

23 23

.4335
S21 (PE)

K1 K2
14 24 A2(-)

!" $$

$" &"

!" $

S22

X5

S33

S34

14

24

7tfrfxfiphfgwpfith
L1

 !U66 

6tyfipwip prtifi RfwRfw

!U66 f p x 6 6pfi
L1 L2 L3

L1 L2 L3

A1 S11 S12 S52 X5 Y31 13 23

A1 S11 S12 S52 X5 Y31 13 23

.4335
PE A2 S21 S22 S34 S33 Y32 14 24

K1 K2

.4335
PE A2 S21 S22 S34 S33 Y32 14 24

K1

Qpfgwphtxtpy
N

K1 K2

M
Stpf

K1

Rxtytip" Uhtyfipwipprtifiip!U66 pfgwphtxtpyxfyfwxytpfifwtifxytpfif

6xpfipprtifiipyhfyfw pfgwphtxtpyfxthtyxytpipfwtif

!U66 Ifip pxprpyhtf


A1 S11 S12 S52 X5 Y31 13 23

L1 L2 L3

.4335
PE A2 S21 S22 S34 S33 Y32 14 24 K1 K2

K1 K2

Qpfgwphtxtpy Stpf

Ifippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifi
FtyfFRQ!QS 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6f!pry8G&"! BRH %!& 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6Sthvxfhf68hTE5@ !U6466" U64 %owfupyxtyfw "#A %"o!U66 6yxippyhtf 8yfifipprtifi V G6G6htyfipwip prtifi Rtxwfyptifiippyfif Byqtyt "sx 4Ffyfwxfyfwxytpfi "G4Rprtifi(G64twtf 5 64"!4"U64 G 66 4!U66 TtwtfhtyipfwtifpryB86#&!$ !pttf 46'4"U64 76'4!U66 4 46" "4"U64"4"U64 4"U644"U64 G 76 !4!U66 4!U66f#xty 6tpypxthfyxtyfwty hyxfhty 9tgwp Rfwtifppyf Ffptfwipwhyfh Fyhtpypwfuphyxfi Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 Upwxtpiphf F4pyyhtht #4fhhtywpyf4fhhtytif 4rRyH " x4U  x x Upip0fwtxpwhhyphfif( Upip0Dhpfi Upip0Dhpfi Uwfupipptpyhtfiptxw @fiiphyfxtyfhty S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty Fyfup Ip !U66  U64 Utiftwpwhthf U64!4%%U4h "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI !xx !4V@ 6ipfhpihyU78  Qtpw7BGip "xx ""rwg $r"$wg


7phthty
(O *XDUGPDVWHU 0LQRWDXU 06557 GH $OOHQ%UDGOH\ HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG TXH SURSRUFLRQD HQWUDGDV YHUViWLOHV \ FDSDFLGDG GH PRQLWRUHR FRQ XQ JUDQ Q~PHUR GH VDOLGDV GH VHJXULGDG HQ XQ SDTXHWH GH  PP (O 06557 SXHGH FRQHFWDUVH FRPR XQD FRPSXHUWD GH VHJXULGDG GH XQ FDQDO R GRV FDQDOHV R XQ LQWHUUXSWRU GH SDUR GH HPHUJHQFLD R SXHGH FRQHFWDUVH D XQD FRUWLQD GH OX] GH VHJXULGDG TXH SURSRUFLRQH GHWHFFLyQ GH IDOORV FUX]DGRV (O UHVWDEOHFLPLHQWR \ HO PRQLWRUHR GH VDOLGDV VRQ GHWHUPLQDGRV SRU OD FRQILJXUDFLyQ GHO FDEOHDGR (O UHVWDEOHFLPLHQWR DXWRPiWLFR PDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O PRGR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO SDUD DFWLYDU ODV VDOLGDV /DV VDOLGDV LQFOX\HQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG \  VDOLGD DX[LOLDU /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG /D VDOLGD DX[LOLDU QR WLHQH FODVLILFDFLyQ GH VHJXULGDG \ VyOR GHEH XVDUVH SDUD SURSyVLWRV GH LQGLFDFLyQ

Fptpyhtfippyfifpxttif Qpfgwphtxtpy Rfwtif 6ffhtifiyxtyfwipfwtif

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

P4

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FRQWDFWRV GH VHJXULGDG 1$ 2SHUDFLyQ GH XQ FDQDOGRV FDQDOHV 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR $SOLFDFLRQHV GH SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG R FRUWLQD GH OX] GH VHJXULGDG

6fipwxtpiphtpypiphyfh
p i f t h p  f  4 p  i h p f x y y h  p y p t h

200 180 160 140 120 100 80 60 40 20 0 0 10 20 30 40 50 60

U64$4 $"U4h

M0 " M0#

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp r""A r#xhsp

U664#V U664V Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

Spxpff4xgtpyp6



Qpwipxytpipprtifi
Rpwphhtyipih
8yfif
G6G6htyfip wipprtifi

Qpwipprtifi

FtyfFRQ!QS
Gxpiphfwr !!Q@  !!Q@ % !!Q@ $

Rfwtifipprtifi
"G4

Rfwtifftwtfp
G6

9pypipfwtxpyfhty pwhthf !U6466 "U64!U66  U64!U66

7txpytypxxwrfifitfrfxfipgwp
   ! "  &  
A1
S11 A3+

S12 S21 S23 S22 S12 A4

13 23 33 43 53 81

  !  $ %

.4335
Y1 Y2 PE X1 X2 X5 X6 A2 14 24 34 44 54 82

 & 

$"&"

!"$ !U66

7tfrfxfiphfgwpfith
!U66
6tyfipw ipprtifi RfwRfw

L1 L2 L3 A3+ S11 S12 S21 S23 S22 13 23 33 43 53 81 X2 K1 K2 A4- PE Y1 Y2 X5 X6 14 24 K1 K2 34 44 54 82 X1 A4- PE Y1 Y2 X5 X6 14 24 K1 K2 34 44 54 82 X1 A3+ S11 S22 S12 S21 S23 13 23 33 43 53 81 X2 K1 K2

L1 L2 L3

.4335

.4335
M

Qpfgwphtxtpy Stpf

Stpf

Rxtytip" Uhtyfipwipprtifiip!U66 pfgwphtxtpyxfyfwxytpfifwtifxytpfif

8yfifipfippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif

E

6tyfipw ipprtifi RfwRfw

E
L1 L2 L3
Ifip pxprpyhtf

L1 L2 L3 A1 S11 S12 S22 S21 S23 13 23 33 43 53 81 X2 K1

A1 S11 S12 S21 S23 S22 13 23 33 43 53

81 X2 K1 K2

.4335
A2 PE Y1 Y2 X5 X6 14 24 K1 K2 34 44 54 82 X1

.4335
A2 PE Y1 Y2 X5 X6 14 24 K1 34 44 54 82 X1

Rxtytip" Uhtyfipwipprtifiip !U66pfgwphtxtpyfxthfwtifxytpfif

8yfifipfippxprpyhtfipyhfyfw pfgwphtxtpyfxthtyxytpipfwtif



Qpwipprtifi

Qpwipxytpipprtifi
FtyfFRQ#QS 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6f!pry8G&"! BRH %!& 6ptqthfhtyp 6Sthvxfhf68hTEphp ytifipip!U645@ 9pypipfwtxpyfhtypwhthf !U6466!" U64 %owfupyxtyfw "#A 6yxippyhtf 8yfifipprtifi !V G6G6htyfipwip prtifi Rtxwfyptifiippyfif Fptpyhtfippyfifpxttif Byqtyt &sx 4Ffyfwxfyfwxytpfi G46thtip 46'#4"U64 76'#4!U66 5 46" #4"U64#4"U64 I 76 4!U66 #4!U66f#xty 6tpypxthfyxtyfw tyhyxfhty 9tgwp Rfwtifppyf FtxfhtpypxthfBp Ftyhtpypwfuphyxfi Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 F#4pyyffphtfip htpyp #4fhhtywpyf4fhhtytif #4!4 x4U x "x x Upip0fwtxpwhhyphfif( Upip0Dhpfi Upip0Dhpfi Uwfupipptpyhtfiptxw S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty Fyfup Ip !U66  U64 Utifpwhthftwhyptyip gppyty "U64#4"U4h "U64"4#"U4h "U64"4 $"U4h "U o"6f""6 f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ !xx !4V@ 6ipfhpihyU78  Qtpw7BGip "xx #r " wg "r!$!wg

7phthty
(O *XDUGPDVWHU 0LQRWDXU 06557 GH $OOHQ%UDGOH\ HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG TXH SURSRUFLRQD ORV HOHPHQWRV PiV EiVLFRV SDUD VLVWHPDV GH FRQWURO GH VHJXULGDG HQ XQ SDTXHWH GH  PP (O 06557 HVWi GLVHxDGR SDUD FRQH[LyQ D XQD FRPSXHUWD GH VHJXULGDG GH XQ FDQDO XQ LQWHUUXSWRU GH SDUR GH HPHUJHQFLD GH XQ FDQDO R XQD FRUWLQD GH OX] GH VHJXULGDG TXH SURSRUFLRQH GHWHFFLyQ GH IDOORV FUX]DGRV (O 06557 HVWi GLVHxDGR SDUD FRQH[LyQ D XQ LQWHUUXSWRU GH SDUR GH HPHUJHQFLD R XQD FRPSXHUWD GH VHJXULGDG GH GRV FDQDOHV SXHVWR TXH UHDOL]D GHWHFFLyQ GH IDOORV FUX]DGRV HQWUH ODV HQWUDGDV (O 0655 \ HO 0655 HVWiQ GLVHxDGRV SDUD DSOLFDFLRQHV TXH UHTXLHUHQ XQ UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR (O UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO SDUD DFWLYDU ODV VDOLGDV (O 0657 \ HO 0657 HVWiQ GLVHxDGRV SDUD DSOLFDFLRQHV TXH UHTXLHUHQ UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SHUPLWH XQ SXHQWH D WUDYpV GHO FLUFXLWR 66 \ SRU OR WDQWR QR UHDOL]D PRQLWRUHR GH VDOLGDV /DV VDOLGDV VRQ VyOR  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

Qpfgwphtxtpy Rfwtif Ttwtfhtyipfwtifpry B86#&!$!pttf

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FRQWDFWRV GH VHJXULGDG 1$ 2SHUDFLyQ GH XQ FDQDOGRV FDQDOHV 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR $SOLFDFLRQHV GH SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG R FRUWLQD GH OX] GH VHJXULGDG

M0 " "U64"4"U4hM0#


!U664!%V U664V

M0 M0

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp r""A r#xhsp

Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifi
Rpwphhtyipih
Rfwtifip prtifi Rfwtifftwtfp Qpfgwphtxtpy 8GSQ474 6tyfipwyw hfyfw FRQ#S 7hfyfwp FRQ#S G4 Gtyryf 6tyfipw ywhfyfw FRQ#Q 7hfyfwp FRQ#Q 9pypip fwtxpyfhty pwhthf !U6466 "U64  U64 !U6466 "U64  U64 !U6466 "U64  U64 !U6466 "U64  U64 Gxpip hfwr !!QG $ !!QG # !!QG " !!QG ! !!QG  !!QG  !!QG  !!QG  !!QG  !!QG  !!QG & !!QG %

Qpwipprtifi

FtyfFRQ#QS

4xthxfyfw

Ffyfwxytpfi

7txpytypxxwrfifitfrfxfipgwp
"%% $"&"
13 A1 K1 K2 14 24 S21 14 S22 S11 A2 S12 23 S33 13 23 24 S34

 ! 

7tfrfxfiphfgwpfith
E HRR7  !U66 
6tyf ip wip prtifi

Qpfgwphtxtpy
L1 L2 L3 A1 S11 S12 S33 13 23 K1 K2

E Ifip pxp rpyhtf

Qpfgwphtxtpy
L1 L2 L3 A1 S11 S12 S33 13 23 K1 K2 A2

.433
A2 S21 S22 S34 14 K1 24 K2

.433
M
G
S21 S22 S34 14 K1 24 K2

HRR7 G

Rxtytip" Uhtyfipwipprtifiip!U66 pfgwphtxtpyxfyfwxytpfifwtifxytpfif


L1

8yfifipfippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif
L1

i f ti $FSSBEP A1 r p p i f p x A2 6
N

L1 L2 L3 S11 S12 S33 13 23 K1 K2 24 K2

.435
S21 S22 S34 14 K1

If ip pxp rpyhtf

L1 L2 L3 A1 S11 S12 S33 13 23 K1 K2

.435
A2 S21 S22 S34 14 K1 24 K2

M
N

6xpfipprtifiipyhfyfw pfgwphtxtpyfxthtyxytpipfwtif

Ifippxprpyhtfipihfyfwp pfgwphtxtpyfxthtyxytpipfwtif



Qpwipprtifi

Qpwipxytpipprtifi
FtyfFRQ$QISI 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6f!pry8G&"! BRH %!& 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf Ffhf68hTE5@ !U6466"U64 U64 %fwfupyxtyfw "#A 6yxippyhtf 8yfifipprtifi V G6G6IGI htyfipw Rtxwfyptifiippyfif Fptpyhtfippyfifpxttif Qpfgwphtxtpy Byqtyt sx 4Ffyfwxfyfwxytpfi G4Rprtifi(G64twtf 46'"4"U64 76'"4!U66 5 46"("4"U64 "4"U64 I 76 ( 4!U66 "4!U66f#xty 6tpypxthfyxtyfw tyhyxfhty Tytifiphyxtytip !U6466' Tytifiphyxtytip " U64' 9tgwpRfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 #4fhhtywpyf4fhhtytif x4U 4rRyH "x4  "x x Upip0fwtxpwhthf Upip06Ahpfi Upip06Ahpfi Uwfupipptpyhtfiptxw @fiiphyfxtyfhty S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw S fxfxiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip!U66 U64 U64 Utifpwhthftwhyptyip gppyty "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI f!xx


7phthty
(O 065573 SXHGH FRQHFWDUVH HQ WUHV FRQILJXUDFLRQHV GH FDEOHDGR GH HQWUDGD GLIHUHQWHV  1&  1& R FRQ  FRQH[LRQHV 313 GHVGH XQD FRUWLQD GH OX] GH VHJXULGDG &XDQGR VH FRQHFWD FRQ HO PRGR GH  1& HO 065573 KDFH XQD YHULILFDFLyQ SDUD GHWHUPLQDU VL H[LVWHQ IDOORV FUX]DGRV HQWUH ODV GRV HQWUDGDV &XDQGR VH FRQHFWD D FRUWLQDV GH OX] GH VHJXULGDG HO VLVWHPD GH FRUWLQD GH OX] GH VHJXULGDG GHEH UHDOL]DU OD GHWHFFLyQ GH IDOORV FUX]DGRV (O 06553 WLHQH UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR (O 06573 WLHQH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO /RV PRGHORV FRQ UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGHQ WHQHU HO UHVWDEOHFLPLHQWR FRQHFWDGR HQ SXHQWH R SXHGHQ FRQYHUWLUVH D UHVWDEOHFLPLHQWR PDQXDO QR PRQLWRUHDGR DxDGLHQGR XQ LQWHUUXSWRU QRUPDOPHQWH DELHUWR HQ HO OD]R GH PRQLWRUHR /RV PRGHORV FRQ UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR SURSRUFLRQDQ YHULILFDFLyQ GHO FLUFXLWR GH PRQLWRUHR GH VDOLGD /DV VDOLGDV LQFOX\HQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG DVt FRPR  VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG /D VDOLGD DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

Rfwtif TtwtfhtyipfwtifpryB86#&!$ !pttf

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

!4"4 4!4"4

6ffhpthf

!4V@

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FRQWDFWRV GH VHJXULGDG  FRQWDFWR DX[LOLDU 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 7HUPLQDOHV H[WUDtEOHV $SOLFDFLRQHV GH FRUWLQD GH OX] GH VHJXULGDG SDUR GH HPHUJHQFLD R FRPSXHUWD GH VHJXULGDG

!Gx "!wgtwr IwtfxtifI4## Qtpw7BGip "xx r!# wg #r"$ wg

"U64"4 $"U4h

M0 M0 M0 " "U64"4"U4hM0#


"U64#4"U4h "U64"4#"U4h !U664!%V U664V

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp ""A "xx r#xhsp

Utiftwxphythf Utgfhty

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifi
Rpwphhtyipih
8yfif Rfwtifip prtifi Rfwtifftwtfp Spxtyfwp 9pypip fwtxpyfhty pwhthf
!U6466 9tu G6 G6 htyfipw "U64  U64 !U6466 7pxyfgwp "U64  U64

Qpwipprtifi

FtyfFRQ$QISI
Gxpip hfwr !!QG # !!QG & !!QG " !!QG % !!QG ! !!QG $ !!QG   !!QG  " !!QG   !!QG  ! !!QG   !!QG 

G4

G6

St FRQ$S FRQ$Q FRQ$S FRQ$Q FRQ$S FRQ$Q FRQ$SI FRQ$QI FRQ$SI FRQ$QI FRQ$SI FRQ$QI

Qpfgwphtxtpy 4xthxfyfw Ffyfwxytpfi 4xthxfyfw Ffyfwxytpfi 4xthxfyfw Ffyfwxytpfi 4xthxfyfw Ffyfwxytpfi 4xthxfyfw Ffyfwxytpfi 4xthxfyfw Ffyfwxytpfi

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
13 A1 S12 K1 23 S11(+) 33 41 S52 S12 13 23 33 41

!" !"

S52 K2 S22 S22 24 14 24 34 42 S34 34 A2 42

S21 S21(-) 14

7tfrfxfiphfgwpfith
L1

6tyfipwip prtifi!U66
RfwRfw

Qpfgwphtxtpy
L1 L2 L3 13 23 33 41 K1 K2

L1

A1

S11

S52

S12

FRQ$QI
S21 S22 S34 A2 14 K1 N 24 K2 34 42

If ip pxp rpyhtf

L1 L2 L3 A1 S11 S52 S12 13 23 33 41 K1

FRQ$SI
S21 S22 S34 A2 14 K1 24 34 42

M
N

6tyfipwipprtifipfgwphtxtpy xfyfwxytpfifwtifxytpfEB
L1

Ifippxprpyhtfipyhfyfwpfgwphtxtpy fxthtyxytpipfwtif
L1

Qpfgwphtxtpy
L1 L2 L3 A1 S11 S52 S12 13 23 33 41 K1 K2 A2 14 K1 24 K2 34 42

Ifip pxp rpyhtf

fgtp

L1 L2 L3 A1 S11 S52 S12 13 23 33 41 K1 K2

FRQ$QI
S21 S22 S34

FRQ$QI
M
hpfi
N S21 S22 S34 A2 14 K1 24 K2 34 42

Ifippxprpyhtfipihfyfwppfgwphtxtpy xfyfwxytpfifwtifxytpfif

6xpfipprtifiipihfyfwp pfgwphtxtpyfxthfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifi
FtyfFRQ QSI 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6f!pry8G&"!BRH %!& 6Sthvxfhf68hTE5@ !U6466"U U64%"f wfupyxtyfw"#A 6yxippyhtf 8yfifipprtifi !V G6G6htyfipwip prtififppipprtifi Rtxwfyptifiippyfif Fptpyhtfippyfifpxttif Qpfgwphtxtpy Rfwtif Byqtyt !"sx 4Ffyfwxfyfwxytpfi G4prtifi(G6ftwtf(RR IGI pyfifhpfif(RRIGI  fwtiffhtf Ttwtfhtyipfwtifpry B86#&!$!pttf 46'#4"U64 76'#4!U66 5 46" 4"U64#4"U64 I 76 ( 4!U66 #4!U66f#xty 6tpypxthfyxtyfw tyhyxfhty Rfwtifpfiwti Iphhtyhyfhhtht ip x4 9tgwpRfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 #4fhhtywpyf4fhhtytif x4U66 4rRyHx4  "x x Upip0fwtxpwhthf(Upip0tytht Upip0pyfif6Ahpfif Upip0pyfif6Ahpfif Upip0fwtif6Afhtf Upip0fwtif6Afhtf Uwfupipptpyhtfiptxw @fiiphyfxtyfhty S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip!U66 U64 U64 Utifpwhthftwhyptyip gppyty "U64#4"U4h "U64"4#"U4h "U64"4 $"U4h "U64"4"U4h "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o!xx !o4V@ !o"Gx "!o!! wgwr IwtfxtifI4## Qtpw7BGip "xx r$wg !"r&&wg #4 "4

7phthty
(O 065573 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG YHUViWLO 3XHGH FRQHFWDUVH HQ FXDWUR FRQILJXUDFLRQHV GH FDEOHDGR GH HQWUDGD GLIHUHQWHV  1&  1&  FRQH[LRQHV 313 GHVGH XQD FRUWLQD GH OX] GH VHJXULGDG R XQ WDSHWH GH VHJXULGDG GH FXDWUR FDEOHV &XDQGR VH FRQHFWD FRQ HO PRGR GH  1& HO 065573 KDFH XQD YHULILFDFLyQ SDUD GHWHUPLQDU VL H[LVWHQ IDOORV FUX]DGRV HQWUH ODV GRV HQWUDGDV &XDQGR VH FRQHFWD D FRUWLQDV GH OX] GH VHJXULGDG HO VLVWHPD GH FRUWLQD GH OX] GH VHJXULGDG GHEH UHDOL]DU OD GHWHFFLyQ GH IDOORV FUX]DGRV (O 065573 WLHQH PRQLWRUHR GH VDOLGD TXH DFHSWD UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR &XDQGR VH FRQILJXUD FRQ UHVWDEOHFLPLHQWR DXWRPiWLFR PDQXDO SXHQWHV HQ ;; \ ;;  HO 065573 SXHGH WHQHU ORV WHUPLQDOHV GH UHVWDEOHFLPLHQWR 66 FRQHFWDGRV HQ SXHQWH R SXHGH FRQYHUWLUVH D UHVWDEOHFLPLHQWR PDQXDO QR PRQLWRUHDGR DxDGLHQGR XQ LQWHUUXSWRU QRUPDOPHQWH DELHUWR HQ HO OD]R GH PRQLWRUHR 66  &XDQGR VH FRQILJXUD SDUD UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR HO 065573 YHULILFD HO FLUFXLWR GH PRQLWRUHR GH VDOLGD D WUDYpV GH OD DSOLFDFLyQ PDQXDO GHO LQWHUUXSWRU GH UHVWDEOHFLPLHQWR /DV VDOLGDV LQFOX\HQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG  VDOLGDV DX[LOLDUHV QRUPDOPHQWH FHUUDGDV \  VDOLGDV GH HVWDGR VyOLGR 8QD VDOLGD GH HVWDGR VyOLGR LQGLFD TXH ODV HQWUDGDV HVWiQ FHUUDGDV /D VHJXQGD VDOLGD GH HVWDGR VyOLGR LQGLFD TXH ODV VDOLGDV GH VHJXULGDG HVWiQ DFWLYDV /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG /D VDOLGD DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  &RUWLQD GH OX] GH VHJXULGDG WDSHWH GH VHJXULGDG SDUR GH HPHUJHQFLD  FRQWDFWRV GH VHJXULGDG  FRQWDFWRV DX[LOLDUHV  VDOLGDV GH HVWDGR VyOLGR 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 7HUPLQDOHV H[WUDtEOHV

M0 " M0#

M0 M0

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp hthw ""A "xx r#xhsp

!U664!%V U664V Utiftwxphythf Utgfhty

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifi
Rpwphhtyipih
8yfif
G6G6 fppipprtifi htyfipwipprtifi

Qpwipprtifi

FtyfFRQ QSI
Gxpiphfwr !!Q6  & !!Q6  $ !!Q6  #

Rfwtifipprtifi
G4

Rfwtifftwtfp
G6 IGIpfiwti

9pypipfwtxpyfhty pwhthf !U6466 "U64  U64

7txpytypxxwrfifitfrfxfipgwp
&& %& !"$$
A1 S33 S34 S52 S11 13 23 51 X3 S11(+) S12 S21(-) S22 41 S12 13 23 33 41 51 33 51

K1

S52

!" !"
X4 A2

S21

K2
S22 Y31 Y2 14 24 34 42 52 Y32 Y35 42 52 X1 X2 14 24 52 34

Y30 Y1

7tfrfxfiphfgwpfith
!U66 6tyfipw ipprtifi RfwRfw Qpfgwphtxtpy
L1 L2 L3

!U66 fgtp

6xpfipprtifi hpfi
L1 L2 L3

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51


K1 K2

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52
K1 K2

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52

K1

M
Stpf Rfwtif 8yfif 4htf hpfif

K1

Stpf

Rfwtif fhtf

8yfif hpfif

6tyfipwipprtifipfgwphtxtpy xfyfwxytpfifwtifxytpfEB
!U66 Ifip pxprpyhtf Qpfgwphtxtpy
L1 L2 L3

6xpfipprtifiipyhfyfwpfgwphtxtpy fxthtyxytpipfwtif
!U66 Sfppip prtifi
A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51
L1 L2 L3

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52
K1 K2

K1 K2

FRQ QSI
M
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52
K1 K2

K1 K2

Stpf

Rfwtif 8yfif fhtf hpfif

Stpf

Rfwtif 8yfif fhtf hpfif

Ifippxprpyhtfipihfyfwppfgwphtxtpy xfyfwxytpfifwtifxytpfif
E 6tyfipw ipprtifi RfwRfw !U66 Qpfgwphtxtpy
L1 L2 L3

Sfppipprtifipfgwphtxtpy fxthtyxytpipfwtif
E 6tyfipw ipprtifi RfwRfw !U66 Qpfgwphtxtpy
L1 L2 L3

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52

K1 K2

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52

K1 K2

Stpfip!U66 Rfwtif fhtf 8yfif hpfif

K1 K2

Stpfip!U66 Rfwtif fhtf 8yfif hpfif

K1 K2

Rxtytip" U64!U66htyfipwipprtifi Rxtytip" U64!U66htyfipwip prtifipfgwphtxtpyxfyfwxytpfity pfgwphtxtpyxfyfwxytpfifwtifxytpfif xytpipfwtif



Qpwipprtifi

Qpwipxytpipprtifihypfiipfwtif
FtyfFRQ7 8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif 8G&"!BRH %!&B868G #!B86#&!$!B86#&!$ "4GRB5&4R!! 6f pry8G&"! BRH %!& 6Sthvxfhf68hTE !U6466 U64 )!U4 G6 " ": 4Ffyfwxfyfwxytpfi %G4prtifityfyypf G4prtifihypfiipf  G6ftwtftyfyypf G6ftwtfhypfiipf  5 46" !4"U64!4"U64 I 76 4!U66 !4 Qpfiip"x4 4hhtytifip"4 x4U tyfyypip"x Qu0fwtxpwhhyphfif Upip0Dhpfi Upip0Dhpfi Upip0pfiipipfhtfhty hpfi "U 6ipfhpihyU78 o6f""6 !9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht Gx%%"wgwr Iwthfgyfu Qtpw7BGip "xx "!r wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

7phthty
(O 0655' FXHQWD FRQ  HQWUDGDV 1& GH GRV FDQDOHV TXH VH XVDQ FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ DSOLFDFLRQHV GH DOWR ULHVJR (O 0655' WLHQH PRQLWRUHR GH VDOLGD TXH DFHSWD UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R PDQXDO PRQLWRUHDGR (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O PRGR PDQXDO PRQLWRUHDGR UHTXLHUH HO XVR GH XQ LQWHUUXSWRU PRPHQWiQHR QRUPDOPHQWH DELHUWR GH RSHUDFLyQ PDQXDO SDUD DFWLYDU ODV VDOLGDV (O 0655' WLHQH  VDOLGDV 1$ GH VHJXULGDG LQVWDQWiQHD \  VDOLGD 1& DX[LOLDU LQVWDQWiQHD DVt FRPR  VDOLGD 1$ GH VHJXULGDG \  VDOLGD 1& GH UHWDUGR DX[LOLDU8Q SRWHQFLyPHWUR LQWHUQR HVWDEOHFH HO UHWDUGR /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

TtwtfhtyipfwtifpryB86 #&!$"tyihtf
6tpypxthfyxtyfw tyhyxfhty 9tgwp 8yfif typyfppxwf Rfwtifppyf Fyhtpypwfuphyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4hM0 " U64$4 $"U4hM0# U664#V U664V Utiftwxphythf Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtDV GH SDUR  \   HQWUDGDV GH GRV FDQDOHV 1&  VDOLGDV 1$ GH VHJXULGDG LQVWDQWiQHD  VDOLGD 1& DX[LOLDU LQVWDQWiQHD  VDOLGD 1$ GH UHWDUGR GH VHJXULGDG  VDOLGD 1& DX[LOLDU GH UHWDUGR 5HVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R PDQXDO PRQLWRUHDGR (QYROYHQWH GH  PP GH DQFKR

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifihypfiipfwtif
Rpwphhtyipih
8yfif
G6

Qpwipprtifi

FtyfFRQ7
Gxpip hfwr !!Q@ & !!Q@ #$ !!Q@ #%

Rfwtifip prtifi
%G4Byfyypf G4Qpfi

Rfwtifftwtfp
G6Byfyypf G6Qpfi

Qpfgwphtxtpy
Ffyfwxytpfi 4xthxfyfw

Qpfiip pxtfhty
f Qpfiqtuip pryi Qpfiqtuip "pryi

4hhpt
7phthty
9tgwpip"x4

Gxpiprtyf
!#

Gxpiphfwr !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
%!#"  $ %   $ ""&%
A1 F1 110/ 230 A2

+ X2

X1 K1 K9 K4 K7 K9 K10 K3 K10 K4 K5 K6 K7 K8 K2 VR1

S13

S14

13 23 33 43 53 63 73 83

91

D13 D21

24V DC K3 K4 K5

K2

K3 K3 K4 K3 K5 K4 K9

T1 S pxtfi K3 K4

K2 K5

K6

Fyfuppytpw 7BGip "xx

K6 K7 K8 K1

K6 K6 K7 K8

K7

K6 K8

K7

K10

S24

S23

14

24 34

44 54

64 74

84

92

D14

D22

7tfrfxfiphfgwpfith
L

Qpfgwphtxtpy @fifhpfif ipgwpfif


A1 42 41 54 53 S13 S14 L1 L2 L3

A1 13 23 33 43 53 63 73 83

91

D13 D21 X1 K1

FRQQ7
K2

A2

12 22

34

SER@7
11 21 33

If

S23 S24

A2 14 24 34 44 54 64 74 84 K1 K2

92

D14 D22 X2

M
4 4

6xpfipprtifihygwpiprfifipihfyfwpipgwpiphxpfpfifi pfgwphtxtpyxfyfwfwtifipihfyfwpfwtifxytpfif

7pfwwpipfwthfhty
Ipyhtxpippxtfhty 9tgwpppxwffgwp Byppwphipwfup  U64 U64 Sfwxpypft Sfwxpypfip Ftx Fytx



Qpwipprtifi

Qpwipxytpipprtifihypfiipfwtif
FtyfFRQ"7 8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f pry8G&"! BRH %!& !U6466 )!U4 G6 " " 6Sthvxfhf68hTESU

4xthxfyfw G4Rprtifi(G64twtf 5 46" !4"U64!4"U64 I 76 (4!U66 !4 Qpfiip"x4 4hhtytifip"4 x4U &x Qu0fwtxpwhhyphfif Upip0Dhpfi Upip0Dhpfi "U 6ipfhpihyU78 o6f""6 !9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht Gx%%"wgwr Iwthfgyfu Qtpw7BGip "xx  r"wg

7phthty
(O 065' FXHQWD FRQ  HQWUDGDV 1& GH GRV FDQDOHV TXH VH XVDQ FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ ERWRQHV GH SDUR GH HPHUJHQFLD HQ DSOLFDFLRQHV GH DOWR ULHVJR (O 065' WLHQH PRQLWRUHR GH VDOLGD TXH SXHGH DFHSWDU XQD IXQFLyQ GH UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (O UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO SXHGH XVDU XQ SXHQWH R SXHGH XVDUVH SDUD YHULILFDU OD RSHUDFLyQ GH ORV FRQWDFWRV (O 065' WLHQH  VDOLGDV 1$ GH VHJXULGDG  VDOLGD 1& DX[LOLDU \  VDOLGD 1$ GH UHWDUGR GH VHJXULGDG 8Q SRWHQFLyPHWUR LQWHUQR HVWDEOHFH HO UHWDUGR /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG

Rfwtif

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 6tpypxthfyxtyfw tyhyxfhty 9tgwp 8yfif typyfppxwf Rfwtifppyf Fyhtpypwfup hyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h 0 " U64$4 $"U4h 0# U664#V U664V

6ffhpthf

&DWHJRUtD GH VHJXULGDG  &DWHJRUtDV GH SDUR  \   HQWUDGDV GH GRV FDQDOHV 1&  VDOLGDV GH VHJXULGDG 1$  VDOLGD 1$ GH UHWDUGR GH VHJXULGDG  VDOLGD DX[LOLDU 1& 5HVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO (QYROYHQWH GH  PP GH DQFKR

M M

EfqyhtyipprtifiprffytfifpwFtyf

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

Utiftwxphythf Utgfhty

6hthtFRQ"7 xytpfhfwtp qfwwppifhff ypwtr 8wFRQ"7pxytpf fxtxff ippxtyfwfppyhtf ipfwryqfwwtypy 6yfhp' Ihtyfxytp iphyfhptp fyix hyfhppyptp

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifihypfiipfwtif
Rpwphhtyipih
8yfif
G6

Qpwipprtifi

FtyfFRQ"7
Gxpip hfwr !!QF !% !!QF "$

Rfwtifip prtifi
G4Byfyypf G4Qpfi

Rfwtifftwtfp
G6

9pypip fwtxpyfhty pwhthf


!U6466

Qpfiip pxtfhty
fpryi f "pryi

4hhpt

7phthty
9tgwpip"x4

Gxpiprtyf
!#

Gxpiphfwr !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
%!#" !""$&
A1 F1 K2 K1 ~ 24VDC K3 K2 K3 K1 K1 K2 K3 K4 K5 Timer K3 K2 K1 VR1 K2 K1 K5 K1 K4 K5 K4 K2 K3 A2 X1 X2 S13 S14 D13 13 23 31

Fyfuppytpw7BG ip "xx

 $ %   $

K4 K5

S24

S23

D14

14

24 32

7tfrfxfiphfgwpfith
!U66
L1 L2 L3

Qpfgwphtxtpy @fifhpfif ipgwpfif


A1 42 41 54 53 S13 S23 A1 13 23 31 D13 X1 K2

A2

12 22

34

FRQ"7
If
S14 S24 A2 14 24 32 D14 X2 K1 K2

K2

SER@7
11 21 33

4

Stpf

6xpfipprtifihygwpiprfifipihfyfwpipgwpiphxpf pfifipfgwphtxtpyxfyfwfwtifipihfyfwpfwtifxytpfif

7pfwwpipfwthfhty
4upip pfiff fwtif 7 7!

Ftx

Fytx

"x4S

9tgwp ippp



Qpwipprtifi

Qpwipxytpipprtifihypfiipfwtif
FtyfFRQ %77I 8phtqthfhtyp
Gxf 6fprfipprtifi Rpxpfpywpyphy pxtyfwppfgwp 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Fptpyhtfippyfif pxttif Rfwtif 8G&"!BRH %!&B86 8G#!4GRB5& 4R!! 6f!pry8G&"! BRH %!& Ffhf686SthvhTESTU !U66R8EU V G6 sx G4prtifi G64 4f!U66 "x4f!U66 #4fhhtywpyf4fhhty tif "x x Upip04wtxpyfhtyI Upip0Dhpfi Upip0Dhpfi Bythtfwtfhty Hpfhtyyxfw 6fxgtiphyqtrfhtyifyp wfpfhty 9fwwiptypipfwtifip pfiwti 9fwwtypy o"6f""6!f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$  o"xx!o!4V@ Qtpw7BGip "xx  r%$wg ""A "xx r#xhsp

7phthty
(O 0LQRWDXU 065''3 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG EDVDGR HQ PLFURSURFHVDGRU FRQ FODVLILFDFLyQ GH VHJXULGDG UHWDUGR \ VDOLGDV GH HVWDGR VyOLGR /DV HQWUDGDV GHO 065''3 VRQ LJXDOHV D ODV GHO 065 3XHGHQ FRQHFWDUVH D LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD GLVSRVLWLYRV GH SDUR GH HPHUJHQFLD R WDSHWHV GH VHJXULGDG GH  FDEOHV /RV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH FRPSXHUWD \ GH SDUR GH HPHUJHQFLD SXHGHQ VHU FLUFXLWRV GH XQ FDQDO R GRV FDQDOHV QRUPDOPHQWH FHUUDGRV /D FDSDFLGDG GH UHVWDEOHFLPLHQWR GHO 065''3 SHUPLWH TXH SXHGD FRQILJXUDUVH SDUD LQLFLR \ UHLQLFLR PDQXDO R DXWRPiWLFR /DV VDOLGDV LQFOX\HQ GRV VDOLGDV FRQ FODVLILFDFLyQ GH VHJXULGDG QRUPDOPHQWH DELHUWDV FRQ UHWDUGR TXH SXHGHQ FRQHFWDUVH D FDUJDV GH KDVWD  $ D  9&& (VWDV VDOLGDV SXHGHQ XVDUVH SDUD HQYLDU XQD VHxDO GH SDUR GH VHJXULGDG D XQD PiTXLQD R VLVWHPD GH IDEULFDFLyQ (O UHWDUGR VH UHDOL]D PHGLDQWH OD FRQILJXUDFLyQ GH SXHQWHV HQ ORV WHUPLQDOHV (O UHWDUGR SXHGH DMXVWDUVH IiFLOPHQWH UHFRQILJXUDQGR ORV SXHQWHV (O 065''3 WDPELpQ WLHQH XQD VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD GH HVWDGR VyOLGR OD FXDO VyOR GHEH XVDUVH SDUD LQGLFDU HO HVWDGR GHO 065''3 /D VDOLGD DX[LOLDU UHVSRQGH LQPHGLDWDPHQWH DO FDPELR HQ HO HVWDGR GH OD HQWUDGD QR WLHQH UHWDUGR

6wftqthfhtyipprtifiip fwtif 4twtf 9tgwpfwtifppyf Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 ByithfiE87ipfwtxpyfhty ffipip 6yfypipitfryth ffip !ffip Iffiphyty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip Utgfhty 6sp

6ffhpthf

&DW  VHJ~Q (1 &DWHJRUtDV GH SDUR  y   VDOLGDV GH VHJXULGDG GH HVWDGR VyOLGR FRQ UHWDUGR  VDOLGDV DX[LOLDU GH HVWDGR VyOLGR  1&  1& R HQWUDGD GH WDSHWH GH VHJXULGDG 5HVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R PDQXDO PRQLWRUHDGR

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

Spxtyfhtypiphfgwpfi
RR RR 4oR ! RoR ! RoR ! 4oX 4oX! Rfwtifippyipw 6yfhippyfif Bypippfgwphtxtpy Qpfgwphtxtpyfxthpgf ippfpyxfhsftysfgtwtfif Qpfgwphtxtpyfxthpgf ippfpyxfhsfsfgtwtfif 6thtipxytp Fytpipqfwwhfi tysfgtwtfi



Qpwipxytpipprtifihypfiipfwtif
Rpwphhtyipih
8yfif
G6G6 fppipprtifi

Qpwipprtifi

FtyfFRQ %77I
Gxpiphfwr !!QF  !!QF !

Rfwtifipprtifi
G4 8fiwti

Rfwtifftwtfp
G6 8fiwti

Spxtyfwp
9tu 7pxyfgwp

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
S21 A1 Y11 Y41 Y12 S11 A1 Y13 S34

!" !"

.43%%1
18 A2 18 S12 28 S22 S21 28 Y32 Y32 Y2

7tfrfxfiphfgwpfith
9HD 065 SiJLQD  SDUD REWHQHU LQIRUPDFLyQ DGLFLRQDO VREUH FRQILJXUDFLRQHV GH FDEOHDGR GH HQWUDGD
!U Qpfgwphtxtpy !U
L1 L2 L3 S11 S21 A1 S34 Y41 Y2 K1 L1 L2 L3

S11 S21 A1 S34 Y41 Y2

.43%%1
S12 S22 A2 14 24 Y32

.43%%1
S12 S22 A2 14 K1 24 Y32

K1

K2

K1 K2

Stpf

4fIE6 tyithfi

M
Stpf

4fIE6 tyithfi

Ifippxprpyhtfipihfyfwpfwtifpfififipi hfyfwppfgwphtxtpyxfyfwxytpfixytpip fwtif

8yhwffxtpyiphxpfipyhfyfwfwtifipyhfyfw hypfipfgwphtxtpyfxthtyxytpip fwtif

7pfwwpipfwthfhtyth
&RORTXH SXHQWHV YtQFXORV HQ ORV WHUPLQDOHV LGHQWLILFDGRV SDUD ORJUDU HO UHWDUGR D OD GHVDFWLYDFLyQ GHVHDGR

Qpfi 
 "  "  ! " #

X
R R R R

X
R R R

X
R R R

Qpfi 
%   " %  #  !

X
R R R R R R

X
R R R R R R

X
R R R R R R

Qpfi 
" # %   #  " 

X
R R R R R R R R

X
R R R R R R R R R

X
R R R R R R R R R



Qpwipprtifi

Qpwipxytpipprtifihypfiipfwtif
FtyfFRQ %7I 8phtqthfhtyp
Gxf 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6fprftyfyypfhypfi 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6f!6f pry8G&"! 6Sthvxfhf68hTE !U6466"U64 U64 %fwfupyxtyfw"#A 6yxippyhtf 8yfifipprtifi !V G6G6htyfipwip prtifi Rtxwfyptifiippyfif Fptpyhtfippyfifpxttif Qpfgwphtxtpy Rfwtif Byqtyt  "sx 4Ffyfwxfyfwxytpfi G4Rprtifi( G4Rprtifihy pfiFRQ %7I(G4Rprtifi hypfiFRQ %7I(G64 hypfiFRQ %7I TtwtfhtyipfwtifpryB86#&!$ !pttf 46'$4"U64 76'$4!U66 5 46" #4"U64#4"U64 I 76 ( 4!U66 #4!U66f#xty 6tpypxthfyxtyfw tyhyxfhty Tytifiphyxtytip !U6466' Tytifiphyxtytip " U64' 9tgwpRfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 #4fhhtywpyf4fhhtytif x4U 4rRyH"x4  "x x Upip0fwtxpwhthf Upip0fwtif6Afhtf Upip0fwtif6Afhtf Upip0fwtif6ASpxtfiffh Upip0fwtif6ASpxtfiffh Uwfupipptpyhtfiptxw @fiiphyfxtyfhty S pxpffippfhty Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip!U66 U64 U64 Utifpwhthftwhyptyip gppyty "U  o"6f""6 9f 9 BI!G8F4 BI o!xx !o4V@ !o"Gx "!o!! wgwr IwtfxtifI4## Qtpw7BGip "xx "r$$wg !&r%wg ""4 "4 F$4pyyffphtfip htpyp " "4 !"4

7phthty
(O 065'3 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG YHUViWLO 3XHGH FRQHFWDUVH HQ FXDWUR FRQILJXUDFLRQHV GH FDEOHDGR GH HQWUDGD GLIHUHQWHV  1&  1& R  FRQH[LRQHV 313 GHVGH XQD FRUWLQD GH OX] GH VHJXULGDG &XDQGR VH FRQHFWD FRQ HO PRGR GH  1& HO 065'3 KDFH XQD YHULILFDFLyQ SDUD GHWHUPLQDU VL H[LVWHQ IDOORV FUX]DGRV HQWUH ODV GRV HQWUDGDV &XDQGR VH FRQHFWD D FRUWLQDV GH OX] GH VHJXULGDG HO VLVWHPD GH FRUWLQD GH OX] GH VHJXULGDG GHEH UHDOL]DU OD GHWHFFLyQ GH IDOORV FUX]DGRV (O 065'3 WLHQH PRQLWRUHR GH VDOLGD TXH DFHSWD UHVWDEOHFLPLHQWR DXWRPiWLFRPDQXDO R UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR &XDQGR VH FRQILJXUD FRQ UHVWDEOHFLPLHQWR DXWRPiWLFR PDQXDO SXHQWHV HQ ;; \ ;;  HO 065'3 SXHGH WHQHU ORV WHUPLQDOHV GH UHVWDEOHFLPLHQWR 66 FRQHFWDGRV HQ SXHQWH R SXHGH FRQYHUWLUVH D UHVWDEOHFLPLHQWR PDQXDO QR PRQLWRUHDGR DxDGLHQGR XQ LQWHUUXSWRU QRUPDOPHQWH DELHUWR HQ HO OD]R GH PRQLWRUHR 66  &XDQGR VH FRQILJXUD SDUD UHVWDEOHFLPLHQWR PDQXDO PRQLWRUHDGR HO 065'3 YHULILFD HO FLUFXLWR GH PRQLWRUHR GH VDOLGD D WUDYpV GH OD DSOLFDFLyQ PDQXDO GHO LQWHUUXSWRU GH UHVWDEOHFLPLHQWR /DV VDOLGDV GHO 065'3 LQFOX\HQ  VDOLGDV GH VHJXULGDG LQPHGLDWDV QRUPDOPHQWH DELHUWDV \  VDOLGDV GH VHJXULGDG FRQ UHWDUGR QRUPDOPHQWH DELHUWDV /DV VDOLGDV GHO 065'3 LQFOX\HQ  VDOLGDV GH VHJXULGDG LQPHGLDWDV QRUPDOPHQWH DELHUWDV  VDOLGDV GH VHJXULGDG FRQ UHWDUGR QRUPDOPHQWH DELHUWDV \  VDOLGD GH VHJXULGDG FRQ UHWDUGR QRUPDOPHQWH FHUUDGD /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG 8Q LQWHUUXSWRU GH UHVWDEOHFLPLHQWR FRQ WHPSRUL]DGRU 1& SXHGH DxDGLUVH SDUD IRU]DU OD DSHUWXUD GH ORV FRQWDFWRV FRQ UHWDUGR DQWHV TXH FRQFOX\D HO FLFOR GH WHPSRUL]DFLyQ 8Q FLUFXLWR GH SURWHFFLyQ HOHFWUyQLFD GHWHFWD ORV FRUWRFLUFXLWRV D WUDYpV GH OD HQWUDGD FXDQGR HO 065'3 HVWi FDEOHDGR SDUD GHWHFFLyQ GH IDOORV FUX]DGRV

TtwtfhtyipfwtifpryB86

#&!$"tyihtf

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtDV GH SDUR  \  (QWUDGDV GH FRUWLQD GH OX] GH VHJXULGDG SDUR GH HPHUJHQFLD FRPSXHUWD GH VHJXULGDG  VDOLGDV GH VHJXULGDG LQPHGLDWDV 6DOLGDV FRQ UHWDUGR  GH VHJXULGDG R  GH VHJXULGDG \  DX[LOLDU 0RQLWRUHR GH IDOORV FUX]DGRV 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 7HUPLQDOHV H[WUDtEOHV

"U64"4 $"U4h

M0 M0 M0 " "U64"4"U4hM0#


"U64#4"U4h "U64"4#"U4h !U664!%V U664V

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp hthw ""A "xx r#xhsp

Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifihypfiipfwtif
Rpwphhtyipih
8yfif Rfwtifip prtifi Rfwtifip prtifihy pfi Stpxippfi
qtu "o G4 FRQ %7I

Qpwipprtifi

FtyfFRQ %7I
Gxpip hfwr !!QF % !!QF ! !!QF ! !!QF ! !!QF !$ !!QF !" !!QF !! !!QF " !!QF !& !!QF !% !!QF %! !!QF % !!QF % !!QF %% !!QF %# !!QF %" !!QF & !!QF & !!QF %&

9pypip fwtxpyfhty pwhthf


"U64 !U6466 "U64  U64 !U6466

"o

"U64  U64 !U6466

G6G6 htyfipwip prtifi

"o  G4 "o G4 G6 FRQ %7I

"U64  U64 !U6466 "U64  U64 !U6466

"o

"U64  U64 !U6466

"o 

"U64  U64

7txpytypxxwrfif7tfrfxfipgwp
&& %& !"$$
A1 (+) A2 (-) S11 (+) X1 X2 X3 X4
Iphhty hyf 64 !U66 4wtx ErthfBytht Erthf 6fyfw
CH1 CHT1 CH2 CHT2

S12

S52
Erthf 6fyfw

13

23

37 47

57

A1 (+) A2 (-) S11 (+) X1 X2 X3 X4


Iphhty hyf ErthfBytht

S12

S52
Erthf 6fyfw

13

23

37 47

55

CH1

CH T1

64

!U66 4wtx

Erthf 6fyfw
CH1 CHT1 CH2 CHT2

CH1

CH T1

CH1

CHT1 CH2

CHT2

!" !"
S21/PE

CH2

CH T2

CH1

CHT1 CH2

CHT2

CH2

CH T2

Stpx

Stpx

S33 S34 Y1 Y2 Y39 Y40

S22

14

24

38 48

58

S21/PE

S33 S34 Y1 Y2 Y39 Y40

S22

14

24

38 48

56

8yfwthfhtyphyxtytip!U66'pwpxtyfwRyipgphyphfpfI8

FRQ %7I

FRQ %7I

7tfrfxfiphfgwpfith
!U66 Qpfgwphtxtpy Ifippxprpyhtf
A1 S52 S11 S12 S21 S22 S33 S34 13 23 37 47 57
K1 K2 L1 L2 L3

E
6tyfipw ipprtifi RfwRfw

!U66
-

Qpfgwphtxtpy
L1 L2 L3

A1 S52 S11 S12 S21 S22

S33 S34 13 23 37 47 55
K1 K2

FRQ %7I
A2 X1 X2 X3 X4 Y39 Y40 Y2 Y1 14 24 38 48 58
K1 K2 D1 D2

FRQ %7I
A2 X1 X2 X3 X4 Y39 Y40 Y2 Y1 14 24 38 48 56
K1 K2 D1 D2

Stpf

Ifippxprpyhtfipihfyfwphyxtytip !U66pfgwphtxtpyxfyfwxytpfifwtif xytpfif

4ywfhtyip pxtfi

Byithfi 7706frfipfwtifpfifif

Byithfi 7706frfipfwtifpfifif

Rxtytip" U64htyfipwip prtifiip!U66pfgwphtxtpyxfyfw xytpfifwtifxytpfif



Qpwipprtifi

Qpwipixfy
FtyfFRQ$QFRQ$6 8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif 8G"$!8G&"!BRH %!& B868G#!B86#&!$" 4GRB5&4R!! 6f pry8G&"! BRH %!& 6fBBBgpry8G"$! 6Sthvxfhf68hTESU !U6466U64 U64 )!U4 G6G4 " "V 4xth G4Rprtifi(G64twtf 5 46" !4"U64!4"U64 I 76 (4!U66 !4 Qpfiip"x4 4hhtytifip"4 x4U "x Qu0fwtxpwhhyphfif Upip0Dhpfi Upip0Dhpfi "U 6ipfhpihyU78 o6f""6 !9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht Gx%%"wgwr Iwthfgyfu Qtpw7BGip "xx "rwg

7phthty
/RV SURGXFWRV *XDUGPDVWHU 0LQRWDXU 0655 \ 065& GH $OOHQ %UDGOH\ VRQ XQLGDGHV OyJLFDV SDUD HO PRQLWRUHR H LQWHUFRQH[LyQ GH GLVSRVLWLYRV GH FRQWURO GH GRV PDQRV FRQ XQ FLUFXLWR GH VHJXULGDG UHODFLRQDGR (O 0655 VH XVD FRQ LQWHUUXSWRUHV PHFiQLFRV \ ORV ERWRQHV WiFWLOHV =HUR)RUFH %ROHWtQ = GH $OOHQ%UDGOH\ (O 065& VH XVD FRQ ERWRQHV GH SDOPD GH GHWHFFLyQ HOHFWUyQLFD SRU HMHPSOR FDSDFLWLYD R IRWRHOpFWULFD SXHVWR TXH HO 065& QR DFWLYDUi OD VDOLGD VL RFXUUH XQD LQWHUUXSFLyQ GH DOLPHQWDFLyQ HOpFWULFD FXDQGR ODV PDQRV HVWiQ HQ FRQWDFWR FRQ ORV ERWRQHV (O 065 WLHQH  VDOLGDV GH VHJXULGDG 1$ \  VDOLGD DX[LOLDU 1& /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O FRQWDFWR DX[LOLDU HV XQD VDOLGD VLQ VHJXULGDG GLVHxDGD SDUD SURSRUFLRQDU XQD VHxDO H[WHUQD DFHUFD GHO HVWDGR GH ODV VDOLGDV GH VHJXULGDG (O 065 UHTXLHUH XQ ODSVR Pi[LPR GH  VHJXQGRV HQWUH OD RSHUDFLyQ GH ORV GRV LQWHUUXSWRUHV \ DXWRUL]DUi HO HVWDGR DFWLYDGR VRODPHQWH FXDQGR DPERV LQWHUUXSWRUHV VH PDQWLHQHQ SUHVLRQDGRV 6L VH GHVDFWLYD XQR GH ORV LQWHUUXSWRUHV OD VDOLGD YD DO PRGR GHVDFWLYDGR \ OD PiTXLQD QR VH SXHGH YROYHU D DUUDQFDU KDVWD TXH ORV GRV ERWRQHV VH GHVDFWLYDQ \ OXHJR VH KDFHQ RSHUDU VLPXOWiQHDPHQWH (O 065 FXPSOH FRQ OD QRUPD (1 OD FXDO LQGLFD UHTXLVLWRV HVSHFtILFRV UHODWLYRV D ODV XQLGDGHV GH FRQWURO GH GRV PDQRV \ GLVSRVLWLYRV OyJLFRV /DV FDWHJRUtDV ,,,% H ,,,& GHSHQGHQ GHO FDEOHDGR

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty 9tgwp 8yfifBypyf ppxwf Rfwtifppyf Fyhtpypwfup hyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4 h 0 " U64$4 $"U4 h 0# U664#V U664V

6ffhpthf

&DWHJRUtD GH VHJXULGDG  VHJ~Q (1  &DWHJRUtD GH VHJXULGDG ,,,E VHJ~Q (1  8QLGDG GH FRQWURO GH GRV PDQRV  VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1& (QYROYHQWH GH  PP GH DQFKR

4wthfhtyp
FRQ$QFRQ$6
Rpxpfhy pfhtyip gyp wfipip ixfy xphythi typp hffhtt

6thtipxytpip hyfhp 6thtiphyxfhtyip hyfhp Rxtytptyhwpfwhthtip hyxfhty 6yfh FytpfiFtyf


6yfhp
Ihtyf ix hyfhppyptp '

M M

pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

Utiftwxphythf Utgfhty

6thtip typ

EfqyhtyipprtifiprffytfifpwFtyf
'

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

FRQ$Qpfwtfpw xytpff ippxtyftsfy qfwwppipy hffypwtr

xytpip hyfhptpfy

8wFRQ$Qpxytpffxtxffippxtyfwfppyhtfiphfwtpqfww



Qpwipixfy
Rpwphhtyipih
Ftyf
FRQ$Q G6G4 FRQ$6 G4 G6 6ffhtt qpwhth

Qpwipprtifi

FtyfFRQ$QFRQ$6
9pypip fwtxpyfhty pwhthf
!U6466 U64  U64 !U6466 U64  U64

8yfif

Rfwtifip prtifi

Rfwtif ftwtfp

5ypip pyfif
Fphyth gwpy%Y

Gxpip hfwr !!Q7  !!Q7  !!Q7  !!Q7 ! !!Q7 " !!Q7 #

4hhpt
7phthty
9tgwpip"x4

Gxpiprtyf
!#

Gxpiphfwr !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
!$ !""$&
A1 A2 X1 K2 K3 ~ 24VDC K4 K1 K5 K1 K5 K2 X2 S13 K4 S14 S23 K3 S24 13 23 33 41 K5A K2 K1

Fyfuppytpw7BG ip "xx

 $ %   $

K5

K1

K4

K2

K3

A1

A2

X1

X2

S23

S24

14 24 34 42 13 23 33 41

K5 ~ 24VDC K5 Timer

K4 K4 K1 K1 K2 K3

K4 K1 K2 K3 K1 K3 K2

Q1 K2

K2 S13 S14

K1

14 24

34 42

7tfrfxfiphfgwpfith
L1

Byp Qpfgwphtxtpy
If ip pxp rpyhtf

Byp
L1 L2 L3 X1 K1 K2
S23 S24 A1 13 23 33 41 X1 K1 L1 L2 L3

L1

S23

S24

A1

13

23

33

41

FRQ$Q
S13 S14 A2 14 K1 N 24 K2 34 42 X2

FRQ$6
S13 S14 A2 14 24 34 42 X2

K2

Byp

Byp

M
N

M
K1 K2

6ywipixfyipihfyfwppfgwphtxtpy fxthfwtifipihfyfwpfwtifxytpfif

6ywipixfyipihfyfwppfgwphtxtpy fxthfwtifipihfyfwptyfwtifxytpfif

7pfwwpipfwthfhty

9tgwpip pp



Qpwipprtifi

Qpwipixfy
FtyfFRQ "AAI 8phtqthfhtyp
Gxf 6fprfipprtifi Rpxpfpywpyphy pxtyfwppfgwp 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Fptpyhtfippyfif pxttif Rfwtif 8G&"!BRH %!&8G"$! B868G#!4GRB5& 4R!! 6f!pry8G&"! BRH %!& 6fBBB6pry8G"$! Ffhf686SthvhTESTU !U66R8EU V G6G4iupr sx G4prtifi G64 4f!U66 "x4f!U66 #4fhhtywpyf4fhhty tif "x x Upip04wtxpyfhtyI Upip0Dhpfi Upip0Dhpfi 9fpiptythtfwtfhty Hpfhtyyxfw 6fxgtiphyqtrfhtyifyp wfpfhty 9fwwiptypipfwtifip pfiwti 9fwwtypy o"6f""6!f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$  o"xx!o!4V@ Qtpw7BGip "xx  r%$wg ""A "xx r#xhsp

7phthty
(O 0LQRWDXU 065++3 HV XQ UHOp GH PRQLWRUHR GH VHJXULGDG GH FRQWURO FRQ GRV PDQRV EDVDGR HQ PLFURSURFHVDGRU FRQ FODVLILFDFLyQ GH VHJXULGDG \ VDOLGDV GH HVWDGR VyOLGR /D HQWUDGD GHO 065++3 DFHSWD GRV LQWHUUXSWRUHV FDGD XQR GH ORV FXDOHV FRQWLHQH XQD QRUPDOPHQWH DELHUWD \ XQD QRUPDOPHQWH FHUUDGD $PERV LQWHUUXSWRUHV GHEHQ DFWLYDUVH HQ XQ LQWHUYDOR GH  HQWUH HOORV /D FDSDFLGDG GH UHVWDEOHFLPLHQWR GHO 065++3 SHUPLWH TXH SXHGD FRQILJXUDUVH SDUD LQLFLR \ UHLQLFLR PDQXDO R DXWRPiWLFR /DV VDOLGDV LQFOX\HQ GRV VDOLGDV FRQ FODVLILFDFLyQ GH VHJXULGDG QRUPDOPHQWH DELHUWDV TXH SXHGHQ FRQHFWDUVH D FDUJDV GH KDVWD  $ D  9&& (VWDV VDOLGDV SXHGHQ XVDUVH SDUD HQYLDU XQD VHxDO GH SDUR GH VHJXULGDG D XQD PiTXLQD R VLVWHPD GH IDEULFDFLyQ (O 065++3 WDPELpQ WLHQH XQD VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD GH HVWDGR VyOLGR OD FXDO VyOR GHEH XVDUVH SDUD LQGLFDU HO HVWDGR GHO 065++3

6wftqthfhtyipprtifi ipfwtif 4twtf 9tgwpfwtifppyf Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 ByithfiE87ipfwtxpyfhty ffipip 6yfypipitfryth ffip !ffip Iffiphyty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip Utgfhty 6sp

6ffhpthf

&DW  VHJ~Q (1 &DW ,,,& VHJ~Q (1  VDOLGDV GH VHJXULGDG GH HVWDGR VyOLGR  VDOLGDV DX[LOLDU GH HVWDGR VyOLGR (QWUDGD GH FRQWURO GH GRV PDQRV

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipixfy
Rpwphhtyipih
8yfif
6ywipixfy

Qpwipprtifi

FtyfFRQ "AAI
Gxpiphfwr !!Q% !!Q%

Rfwtifipprtifi
G4 8fiwti

Rfwtifftwtfp
G4 8fiwti

Spxtyfwp
9tu 7pxyfgwp

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
A1 Y41 S11 A1 S34

!" !"

.4335351
14 A2 14 S12 24 S22 S21 24 Y32 Y32 Y2

7tfrfxfiphfgwpfith
!U
L1 L2 L3 S11 S21 A1 S34 Y41 Y2 S1 S1 S11 S21 A1 S34 Y41 Y2 K1

!U
L1 L2 L3

.43))1
S2 S12 S22 A2 14 24 Y32

.43))1
S12 S22 A2 14 24 Y32

K1

K2 S2

K2

K1 K2

Stpf

4fIE6 tyithfi

M
Stpf

K1 K2

4fIE6 tyithfi

6ywipixfyfwtifipihfyfwp pfgwphtxtpyfxthxytpipfwtif

6ywipixfyfwtifipihfyfwp pfgwphtxtpyfxthxytpipfwtif



Qpwipprtifi

Qpwipixfy
FtyfFRQ"AAI 8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif TtwtfhtyipfwtifpryB86 #&!$!pttf TtwtfhtyipfwtifpryB86 #&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty 9tgwp Rfwtifppyf Fyhtpypwfuphyxfi Qpfifwffhtfhty Qppf Stpxipphpfhty ByithfipE87 Uwfupipptpyhtfiptxw Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip !U66 " U64 Utifpwhthftwhypty ipgppyty "U64#4"U4hM0 "U64"4#"U4hM0 "U64"4 $"U4hM0 " "U64"4"U4hM0# !U664!%V U664V Utiftwxphythf Utgfhty 6sp
yxtyfwpyxfif

7phthty
(O *XDUGPDVWHU 0LQRWDXU 065++3 GH $OOHQ%UDGOH\ HV XQD XQLGDG OyJLFD SDUD HO PRQLWRUHR H LQWHUFRQH[LyQ GH GLVSRVLWLYRV GH FRQWURO GH GRV PDQRV FRQ XQ FLUFXLWR GH VHJXULGDG UHODFLRQDGR (O 065++3 VH XVD FRQ LQWHUUXSWRUHV PHFiQLFRV \ ORV ERWRQHV WiFWLOHV =HUR)RUFH %ROHWtQ = GH $OOHQ%UDGOH\ (O 065++3 WLHQH  VDOLGDV GH VHJXULGDG 1$ /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG (O 065++3 UHTXLHUH XQ ODSVR Pi[LPR GH  VHJXQGRV HQWUH OD RSHUDFLyQ GH ORV GRV LQWHUUXSWRUHV \ DXWRUL]DUi HO HVWDGR DFWLYDGR VRODPHQWH FXDQGR DPERV LQWHUUXSWRUHV VH PDQWLHQHQ SUHVLRQDGRV 6L VH GHVDFWLYD XQR GH ORV LQWHUUXSWRUHV OD VDOLGD YD DO PRGR GHVDFWLYDGR \ OD PiTXLQD QR VH SXHGH YROYHU D DUUDQFDU KDVWD TXH ORV GRV ERWRQHV VH GHVDFWLYDQ \ OXHJR VH KDFHQ RSHUDU VLPXOWiQHDPHQWH (O 065++3 FXPSOH FRQ OD QRUPD (1 &DWHJRUtD ,,,& OD FXDO LQGLFD UHTXLVLWRV HVSHFtILFRV UHODWLYRV D ODV XQLGDGHV GH FRQWURO GH GRV PDQRV \ GLVSRVLWLYRV OyJLFRV (O 065+ WLHQH WHUPLQDOHV ILMRV \ HO 065+3 WLHQH WHUPLQDOHV H[WUDtEOHV

8G"$!8G&"!BRH %!&B86 8G#!B86#&!$!B86 #&!$"4GRB5&4R!! 6f!pry8G&"! BRH %!& 6fBBB6pry8G"$! 6Sthvxfhf68hTE5@ !U66"U64 U64 V G6G4 )" !sx 4xth G46thtip 46'#4"U64 76'#4!U66 5 46" #4"U64#4"U64 I 76 ( 4!U66 #4!U66f#xty #4!4 #4fhhtywpyf4fhhtytif x4U  x "x Upip0fwtxpwhhyphfif( Upip0fwtif6Afhtf Upip0fwtif6Afhtf "U o"6f""6 f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ !xx!4V@ 6ipfhpihyU78  !"Grx "!!! wgtwr IwtfxtifI4## Qtpw7BGip "xx r!# wg #r"$ wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp ""A "xx r#xhsp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH VHJXULGDG ,,,F VHJ~Q (1  8QLGDG GH FRQWURO GH GRV PDQRV  VDOLGDV GH VHJXULGDG 1$ 7HUPLQDOHV H[WUDtEOHV (QYROYHQWH GH  PP GH DQFKR

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip



Qpwipixfy
Rpwphhtypih
8yfif 5ypippyfif Rfwtifip prtifi Spxtyfwp
8fgwp FRQ"AI G6 G4 Fphyth gwpy%Y G4 9tuFRQ"A

Qpwipprtifi

FtyfFRQ"AAI
Gxpip hfwr !!Q7 $ !!Q7 #& !!Q7 #% !!Q7 ## !!Q7 #! !!Q7 #

9pypip fwtxpyfhty pwhthf


!U66 "U64  U64 !U66 "U64  U64

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
A1(+) S11 S12 S13 Y1 Y2 13 13 23 23 A1 S11 S12 S13 Y1 Y2

!" !"
S21

+ A2 A2(-) 14 14 24 24

S21 S22 S23 S22 S23

7tfrfxfiphfgwpfith
L1 S1 L1 S1

A1

L1 L2 L3 S11 S12 S13 Y1 13 23 K1 K2

L1 L2 L3 A1 S11 S12 S13 Y1 13 23 K1

FRQ"AAI
A2 S21 S2 K1 N K2 S22 S23 Y2 14 24

FRQ"AAI
A2 S21 S2 K1 N S22 S23 Y2 14 24

6ywipixfyihfyfwppfgwphtxtpy fxthxytpipfwtif

6ywipixfyihfyfwppfgwphtxtpy fxthxytpipfwtif



Qpwipprtifi FtyfFRQ&8

Tytifipippfyty
8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 4Y4Y 4Y 4Y 6yxipfwtxpyfh !U6466 U!U64 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif TtwtfhtyipfwtifpryB86 #&!$"tyihtf 6tpypxthfyxtyfw tyhyxfhty 9tgwp 8yfifpwphtypyf Rfwtifppyf Fyhtpypwfup hyxfi Stpxiphfifx ByithfipE87 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f!pry8G&"! BRH %!& Ffhf68ffifwfitphtf fwthfgwphTE !U6466o  U64o"  !U64o"  #V #U4"$V G6G6 "  4xth %G4Rprtifi(G64twtf 6 46" $"4!U64 "4U64 P 76 (4!U66 %4$4!#4#"4 %!"4 Stpxippfgwphtxtpyip  9tywpyfip#

7phthty
(O 0LQRWDXU 065( HV XQD XQLGDG GH UHOp GH H[SDQVLyQ GH PRQLWRUHR GH VHJXULGDG FRQ XQD HQWUDGD GH GRV FDQDOHV (VWi GLVHxDGR SDUD IXQFLRQDU FRPR H[WHQVLyQ GH XQ UHOp GH VHJXULGDG PDHVWUR &XDQGR VH FDEOHDQ FRUUHFWDPHQWH ODV VDOLGDV GHO 065( IXQFLRQDUiQ H[DFWDPHQWH FRPR ODV VDOLGDV GHO UHOp PDHVWUR (O 065( WLHQH  VDOLGDV GH VHJXULGDG \ VH SXHGH XVDU SDUD KDFHU IXQFLRQDU P~OWLSOHV FLUFXLWRV GH VHJXULGDG (VWiQ GLVSRQLEOHV GRV FRQWDFWRV DX[LOLDUHV QRUPDOPHQWH FHUUDGRV SDUD LQGLFDGRU HO HVWDGR GHO 065( HO FXDO UHIOHMDUtD HO HVWDGR GHO UHOp GH VHJXULGDG PDHVWUR

6ffhpthf

!U6466x4 x Qu0hhthtippyfif Upip0fwtxpwh Upip0D Upip0D U 6ipfhpihyU78  o"6f""6 o 9f 9 &" ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@ %Gx$wgwr I5Sipwtpu Qtpw7BGip "xx # r!wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

&DWHJRUtD GH VHJXULGDG VHJ~Q HO FDEOHDGR (QWUDGDV GH GRV FDQDOHV  VDOLGDV GH VHJXULGDG 1$  VDOLGDV DX[LOLDUHV 1&

Uwfupipptpyhtfiptxw @iptyfwfhty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h 0 " U64$4 $"U4h 0# U664#V U664V

M M

Utiftwxphythf Utgfhty

6sp
yxtyfwpyxfif

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip



Tytifipippfyty
Rpwphhtyipih
8yfif
G6G6

Qpwipprtifi FRQ&8Ftyf
Gxpiphfwr !!QY58%4Y !!QY58%4Y

Rfwtifipprtifi
%G4

Rfwtifftwtf
G6

9pypipfwtxpyfhty pwhthf
!U6466U64 !U6466!U64

7txpytypxxwrfifitfrfxfipgwp
& !  !#
A1 A2 B1 S4 S3 J1 13 23 33 43 53 63 73 83 91 101 PTC K1

&$ %

&! $

&$ %

!

U66

Erthf 6ht htip pyfif


K2

4wtxpyfhty
B2

S2 S1

J2

14

24 34

44 54 64 74 84 92 102

7tfrfxfiphfgwpfith
fgtp !U66
L1 L2 L3 T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73 K1 A1 B1 S1 S3 J1 13 23 33 43 53 63 73 83 91 101 L1 L2 L3

hpfi

FRQ%S
T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 K1 62 74

FRQ&8
A2 B2 S2 S4 J2 14 24 34 44 54 64 74 84 92 102

K2

4

K2

M
4

Stpf

8yfifiphxpfipyhfyfwpfytyipyhfyfwpfgwphtxtpyfxthip fwtifipyhfyfwxytpippfytytyfwtifxytpfif

fgtp

L1 L2 L3 T11 T12 X1 X2 T22 T35 A1 B1 13 23 33 43 53 61 73 K1 A1 B1 S1 S3 J1 13 23 33 43 53 63 73 83 91 101

L1 L2 L3

hpfi

FRQ%S
K2 T31 T32 IF1 T33 T34 A2 B2 14 24 34 44 54 62 74

FRQ&8
A2 B2 S2 S4 J2 14 24 34 44 54 64 74 84 92 102

K3 K4

Qpfgwp htxtpy

K1 K2 N

4

K3 K4

M
4

8yfifiphxpfipihfyfwppfytyipihfyfwppfgwphtxtpyxfyfw xytpfiipfwtifipihfyfwpxytpippfytyfwtifxytpfif



Qpwipprtifi

Tytifipippfyty
FtyfFRQ8 8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f pry8G&"! BRH %!& 6Sthvxfhf68hTE5@ !U6466"U64 U64 %fwfupyxtyfw "#A %"f!U66 V G6G6 Byqtyt #sx #G4Rprtifi G64twtf G6Fytp 46'4"U64 76'4!U66 4 46" "4"U64"4"U64 4"U644"U64 G 76 !4!U66 4!U66f#xty Upwxtpiphf F4pyyffphtfip htpyp #4fhhtywpyf4fhhty tif x4U 4rRyH"P 4 x Upip06Ahpfi Upip06Ahpfi "U  o"6f"6 9f9 BI!G8F4 BI o!xx!4V@ !Gx "!wgxwr Qtpw7BGip "xx ""rwg pfhtyp $pfhtyp "pfhtyp "pfhtyp pfhtyp pfhtyp "pfhtyp ""A "xx r#xhsp

6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif

7phthty
(O 065( HVWi GLVHxDGR SDUD VHU XQ UHOp GH H[SDQVLyQ SDUD XVR FRQ ORV UHOpV GH VHJXULGDG 0LQRWDXU (O 065( JHQHUDOPHQWH VH XVD HQ DSOLFDFLRQHV GH VLVWHPD GH VHJXULGDG GRQGH VH QHFHVLWDQ FRQH[LRQHV GH FRQPXWDFLyQ GH VDOLGDV DGLFLRQDOHV SDUD D\XGDU D GHVDFWLYDU XQ SURFHVR GH IDEULFDFLyQ GH PDQHUD FRUUHFWD \ FRQ VHJXULGDG (O 065( SXHGH FRQHFWDUVH HQ FRQILJXUDFLyQ GH HQWUDGD GH XQ VROR FDQDO  1& R GH GRV FDQDOHV  1&  /DV VDOLGDV LQFOX\HQ  VDOLGDV GH VHJXULGDG QRUPDOPHQWH DELHUWDV XVDGDV SDUD GHVDFWLYDU HO VLVWHPD GH IDEULFDFLyQ \  VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD SDUD LQGLFDU HO HVWDGR GHO 065( +D\ GLVSRQLEOH XQD VDOLGD QRUPDOPHQWH FHUUDGD DGLFLRQDO SDUD SHUPLWLU TXH HO UHOp SULQFLSDO PRQLWRUHH HO HVWDGR GHO 065( /DV VDOLGDV GH VHJXULGDG DX[LOLDU \ GH PRQLWRUHR FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

Qptpyhtfippyfifx Rfwtif TtwtfhtyipfwtifpryB86 #&!$!pttf

Ttwtfhtyipfwtif

pryB86#&!$"G4 ByihtG6 G4 prtifi 6tpypxthfyxtyfwty hyxfhty 9tgwp Rfwtifppyf Fyhtpypwfup hyxfi Ffptfwipwhyfh Stpxipppf ByithfipE87 Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Fyfup Ip Utifpwhthftwhypty ipgppyty "U644"U4h M0 "U64"4"U4hM0 "U64"4"U4 hM0 " "U64"4"U4hM0# !U664!%V U664V Utiftwxphythf Utgfhty

6ffhpthf

&DWHJRUtD GH VHJXULGDG VHJ~Q HO FDEOHDGR  FRQWDFWRV GH VHJXULGDG  FRQWDFWR DX[LOLDU  FRQWDFWR GH PRQLWRUHR

6fipwxtpiphtpypiphyfh


250

4  h f y h p i f t h p f p i p x y  p y p t h

46U !U

200

150

100

50

0 0 10 20 30 40 50 60

Spxpff4xgtpyp6

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Tytifipippfyty
Rpwphhtyipih
8yfif
G6G6

Qpwipprtifi

FtyfFRQ8
Gxpiphfwr !!Q8 "% !!Q8 "$ !!Q8 "#

Rfwtifipprtifi
#G4

Rfwtifftwtfp
G6

9pypipfwtxpyfhty pwhthf
!U6466 "U64  U64

7txpytypxxwrfifitfrfxfipgwp
13 23 33 43 53 63 81 X1

&" !  %$ !

A2 A3

FRQ8

A2 A4

14

24 34 44

54

64 82 X2

 & 

$"&"

!"$

7tfrfxfiphfgwpfith
E

6tyfipwip prtifi RfwRfw

!U66 Qpfgwphtxtpy

L1 L2 L3

L1 L2 L3

A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51


K1

A1 A3 13 23 33 43 53 63 81 X1
K3

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52
Stpfip!U66

K2

FRQ8
M
A2 A4 14
K3

24 34 44 54 64 82 X2

K1 K2
8yfif hpfif

Rfwtif fhtf

7ttttyhtfwip U64FRQ hypyfifiphtyfipwip prtifiipihfyfwppfytyipyhfyfwFRQhyxytp


E

6tyfipwip prtifi RfwRfw


A1 S52 S11 S12

+
!U66

Qpfgwphtxtpy

L1 L2 L3 S33 S34 13 23 37 47 57 K1 A1 A3 13 23 33 43 53 63 81 X1 D1

L1 L2 L3

S21 S22

FRQ %7I
A2 X1 X2 X3 X4 Y39 Y40 Y2 Y1 14 24 38 48 58

K2

FRQ8
M A2 A4 14 24 34 44 54 64 82 X2

D2

K1
Qpfgwphtxtpyip pxtfi

K2
Byithfi

D1 D2
7706frfipfwtifpfifif

7ttttyhtfwip U64FRQ %hypyfifiphtyfipwipprtifiipi hfyfwppfytypfififipihfyfwpFRQhyxytp



Qpwipprtifi

Tytifipippfyty
FtyfFRQ 8 8phtqthfhtyp
Gxf 6fprftyfyypfhy pfi 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rfwtif TtwtfhtyipfwtifpryB86 #&!$!pttf #&!$"tyihtf 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f!6f pry8G&"! 6Sthvxfhf68hTE5@ !U6466"#A!U66 %"f "V G6 !G4prtifi G64 G6Fytp 46'#4"U64 76' 4!U66 5 46" #4"U64#4"U64 I 76 4!U66 #4 "4!!4 #4fhhtywpyf4fhhty tif x4U 4rRyH4 x "x x Upip0Dhpfi Upip0Dhpfi "U o"6f""6!f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$  o!xx!o4V@ Qtpw7BGip "xx "r!$!wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp ""A "xx r#xhsp

7phthty
(O 0LQRWDXU 065( HV XQD XQLGDG GH UHOp GH H[SDQVLyQ GH VHJXULGDG FRQ PRQLWRUHR FRQ HQWUDGD GH XQR R GRV FDQDOHV \ VDOLGDV LQPHGLDWDV R FRQ UHWDUGR WHPSRUL]DGR (VWi GLVHxDGR SDUD IXQFLRQDU FRPR H[WHQVLyQ GH XQ UHOp GH VHJXULGDG PDHVWUR &XDQGR VH FDEOHDQ FRUUHFWDPHQWH ODV VDOLGDV GHO 065( IXQFLRQDUiQ H[DFWDPHQWH FRPR ODV VDOLGDV GHO UHOp PDHVWUR /DV VDOLGDV LQFOX\HQ  VDOLGDV GH VHJXULGDG QRUPDOPHQWH DELHUWDV XVDGDV SDUD GHVDFWLYDU HO VLVWHPD GH IDEULFDFLyQ \  VDOLGDV DX[LOLDUHV QRUPDOPHQWH FHUUDGDV SDUD LQGLFDU HO HVWDGR GHO 065( +D\ GLVSRQLEOH XQD VDOLGD QRUPDOPHQWH FHUUDGD DGLFLRQDO SDUD SHUPLWLU TXH HO UHOp SULQFLSDO PRQLWRUHH HO HVWDGR GHO 065( /DV VDOLGDV GH VHJXULGDG DX[LOLDU \ GH PRQLWRUHR FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

TtwtfhtyipfwtifpryB86
6tpypxthfyxtyfw tyhyxfhty 9tgwpfwtifppyf 6tpypwfuphfrfxy hyxfi Ffptfwipwhyfh Qpfifwffhtfhty Stpxipppf Stpxipphpfhty ByithfipE87 Uwfupipptpyhtfiptxw Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw @fiiphyfxtyfhty 6fwtgpiphyih Fyfup Ip Utifpwhthftwhypty ipgppyty "U64#4"U4hM0 "U644"U4hM0 "U64!4U4 hM0 " "U64"4U4 hM0# !U664!%V U664V Utiftwxphythf Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtDV GH SDUR  y   FRQWDFWRV GH VHJXULGDG 1$  FRQWDFWRV DX[LOLDUHV 1&  FRQWDFWR GH PRQLWRUHR 1& (QWUDGD GH XQ VROR FDQDO

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Tytifipippfyty
Rpwphhtyipih
8yfif Rfwtifip prtifi Rfwtif ftwtfp 4wtx
!U6466 9tu

Qpwipprtifi

FtyfFRQ 8
Gxpip hfwr !!Q8 & !!Q8 & !!Q8 & !!Q8 &! !!Q8 &" !!Q8 &$ !!Q8 "& !!Q8 # !!Q8 &% !!Q8 # !!Q8 #

Spxtyfwp

Stpxip pfi
 "    "   !

!U66

G6G6

!G4

G6

!U6466

!U66

8fgwp

7txpytypxxwrfifitfrfxfipgwp
A1 Ch1 Ch2 A2 X2 14 24 34 44 52 62 X1 13 23 33 43 51 61

7tfrfxfiphfgwpfith
!U66

Qpfgwphtxtpy Ifip pxprpyhtf

FRQ 87I
A1 S11 S12 S21 S22 S52 S11 Y31 S33 S34 13 23 33 41 51 L1 L2 L3 A1 X1 13 23 33 43 51 61 K3

L1 L2 L3

FRQ QSI
A2 X1 X2 X3 X4 Y30 Y32 Y35 Y2 Y1 14 24 34 42 52 K1 K2

K1 K4 K2 A2 X2 14 24 34 44 52 62

M
K3 K4

M
4

Stpf

Rfwtif 8yfif fhtf hpfif

Ifippxprpyhtfipihfyfwppfgwphtxtpyxfyfwxytpfifwtifipihfyfwp pfytypfififipyhfyfwfwtifxytpfif



Qpwipprtifi 6T

Tytifipiphywippxtfhty
8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6fpry8G&"! BRH %!& 6Sthvxfhf68hTESU !U6466 U64 )!U4 G6 ": 4xthxfyfw G46thtip G64twtf 5 46" !4"U64!4"U64 I 76 ( 4!U66 !4 f!xty Qpfiip"x4 4hhtytifip"4 x4U Qu0fwtxpwhhyphfif Qupip0pxtfhtyfwtif fhtfif "U o6f""6 !9f 9 & ipsxpifipwftf BI!7BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht 6ipfhpihyU78 Gx%wg wr Iwthfgyfu Qtpw7BGip "xx #r$&wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

7phthty
(O &8 HV XQD XQLGDG GH WHPSRUL]DFLyQ FRQ UHWDUGR D OD DFWLYDFLyQ GLVHxDGD SDUD DFWLYDU \ FRPR FRQVHFXHQFLD GHVHQFODYDU ORV GLVSRVLWLYRV GH HQFODYDPLHQWR GH JXDUGD GHVSXpV TXH H[SLUD HO UHWDUGR SUHVHOHFFLRQDGR 3XHGH XVDUVH FRQ SRWHQFLD SDUD GHVEORTXHDU GLVSRVLWLYRV WDOHV FRPR HO *XDUGPDVWHU $WODV 6SDUWDQ *07 R 7/6*' GH $OOHQ%UDGOH\ HQ PiTXLQDV TXH WLHQHQ XQ FLFOR GH SDUR R TXH QR SDUDQ LQPHGLDWDPHQWH 7DPELpQ VH SXHGH LQFRUSRUDU HQ RWUDV SDUWHV GHO VLVWHPD GH FRQWUROHV GH VHJXULGDG VL VH UHTXLHUH XQ UHWDUGR D OD DFWLYDFLyQ FRQILDEOH 8QD FXELHUWD GHVPRQWDEOH SHUPLWH DFFHVR DO LQWHUUXSWRU GH DOLPHQWDFLyQ GH &$ HO IXVLEOH UHHPSOD]DEOH \ ORV PLFURLQWHUUXSWRUHV \ SRWHQFLyPHWUR TXH FRQWURODQ OD WHPSRUL]DFLyQ /D DOLPHQWDFLyQ D OD XQLGDG &8 SXHGH VHU GH  9&$&& WHUPLQDOHV  y   9&$ WHUPLQDOHV $$  6L VH XWLOL]D DOLPHQWDFLyQ GH  9&$ R  9&$ GHEH FRORFDUVH XQ LQWHUUXSWRU LQWHUQR HQ OD SRVLFLyQ DSURSLDGD /RV WHUPLQDOHV ;; HVWiQ GLVHxDGRV SDUD PRQLWRUHDU HO UHQGLPLHQWR GH ORV FRQWDFWRUHV TXH DtVODQ OD DOLPHQWDFLyQ D ODV SLH]DV PyYLOHV GH OD PDTXLQDULD /D WHPSRUL]DFLyQ QR SXHGH FRPHQ]DU KDVWD TXH HO OD]R ;; HVWp FHUUDGR (O OD]R ;; GHEH SHUPDQHFHU FHUUDGR GXUDQWH WRGR HO FLFOR GH WHPSRUL]DFLyQ $EULU HO OD]R ;; GXUDQWH HO FLFOR GH WHPSRUL]DFLyQ FDXVDUi TXH HO WLHPSR VH UHVWDEOH]FD D FHUR 6L QR VH QHFHVLWD PRQLWRUHR SXHGH YLQFXODUVH HO OD]R ;; 8QD RSHUDFLyQ WtSLFD FRPLHQ]D FRQ ODV VDOLGDV GH VHJXULGDG  \  DELHUWDV \ HO OD]R ;; FHUUDGR  &RQHFWH OD DOLPHQWDFLyQ HOpFWULFD D $$ y  D (O LQGLFDGRU /(' GH DOLPHQWDFLyQ HOpFWULFD VH HQFLHQGH \ HO LQGLFDGRU /(' GH VDOLGD VH LOXPLQD GH FRORU URMR E 'HVSXpV TXH H[SLUD HO UHWDUGR GH WLHPSR HO LQGLFDGRU /(' GH VDOLGD FDPELD D YHUGH \ ODV VDOLGDV GH VHJXULGDG  \  VH FLHUUDQ  'HVFRQHFWH OD DOLPHQWDFLyQ HOpFWULFD D $$ y  D ,QPHGLDWDPHQWH VH DEUHQ ORV FRQWDFWRV GH VHJXULGDG  \   HO LQGLFDGRU /(' GH DOLPHQWDFLyQ VH DSDJD \ HO LQGLFDGRU /(' GH VDOLGD VH DSDJD  9D\D DO SDVR  (O HVWDGR GH OD XQLGDG &8 SXHGH VHxDOL]DUVH D OD XQLGDG LQGLFDGRUD UHPRWD PHGLDQWH ORV WHUPLQDOHV 555 R D XQ 3/& X RWUR LQGLFDGRU XVDQGR ORV FRQWDFWRV DX[LOLDUHV 1&  

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty Qpfifwfipfhtfhty pxtfi 9tgwp 8yfifppyf Rfwtifppyf Fhtpypwfup hyxfi ByithfipE87 Uwfupipptpyhtfiptxw Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h M0 " U64$4 $"U4 hM0# U664#V U66V Utiftwxphythf Utgfhty

6ffhpthf

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  6DOLGD GH UHWDUGR D OD DFWLYDFLyQ WHPSRUL]DGR GH  V D  PLQ  VDOLGDV GH VHJXULGDG 1$



Tytifipiphywippxtfhty
Rpwphhtyipih
8yfif
G4

Qpwipprtifi 6T

Rfwtifipprtifi
G4

Rfwtifftwtfp
G6

9pypipfwtxpyfhty pwhthf
!U6466  U64

Gxpiphfwr !!QS$!

4hhpt
7phthty
9tgwpip"x4 Tytifiiptyithfipx6T

Gxpiprtyf
!#

7txpytypxxwrfif7tfrfxfipgwp
Tytifiiphyw !$  $ %   $ !""$&   $   & # Tytifiiptyithfipx #! %"  !    $ "
A1 A2

Gxpiphfwr !!Q4 "# !!Q4$ %

X1 K2

X2 K3 K2 R VR1

13 23

31

F1 110/230 SW1 K2 K1 ~ 24V DC K3

K1 K2 K1

K2 G

Fyfuppytpw 7BGip "xx

Q1 K3 K2

"&$ F hfgwp 6fwtgpiphfgwp#xx

R2

R1

R3

14 24

32

7tfrfxfiphfgwpfith
!U66 Bytht Df Df If @fifhpfif gwpfif

L1 L2 L3

SER@7

A1

42 41 12 22

54 53 34 33

A1 +

13

23 31 X1 K2

A2

6T
A2 R1 R2 R3 14 24 32 X2
Byithfi px

K2

11 K1

21

M
Stpf

K2

4

6xpfipprtifihygwpiprfifipgwpiphxpf pfifipfgwphtxtpyfxthfwtifxytpfif

7pfwwpipfwthfhty

8fgwphtxtpyiptpxrpypfwxpitfypxthtypp
4 5

)prfpr

prf &pr

#prf"xtypr

!%prf!pr

Qpfiiptpxfufgwp
Exthtyppfufypw fxpiptpxrpypfwpw pyhtxpfufhyphtty wfpwphhtypiptpx9tgwp ppxwffgwpipfhhpqhtwip "x4S

8fgwphtxtpyiptpx phtxpitfyppyhtxp
   S fwxpypf tFtx  S fwxpypf ipFytx



Qpwipprtifi 6T!

Tytifipiphywippxtfhty
8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Rfwtif 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6f pry8G&"! BRH %!& 6Sthvxfhf68hTE5@ !U6466"#A %"fwfupyxtyfw "V G6G6 Byqtyt G4Rprtifi(G64twtf 5 46" "4"U64"4"U64 G 76 4!U66 "f  #4fhhtywpyf4fhhty tif x4U 4rRyH"P 4 xpr Upip0fwtxpwhthf Upip06Afhtf Upip06Afhtf "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o!xx!4V@ !Gx "!wgwr Qtpw7BGip "xx #"r #wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp ""A "xx r#xhsp

7phthty
/D XQLGDG &8 HV XQD XQLGDG GH WHPSRUL]DFLyQ GH UHWDUGR D OD GHVDFWLYDFLyQ TXH SXHGH IXQFLRQDU GH PDQHUD DXWyQRPD R FRPR H[WHQVLyQ GH XQ UHOp SULQFLSDO /DV VDOLGDV WHPSRUL]DGDV VH XVDQ HQ DSOLFDFLRQHV GRQGH OD DOLPHQWDFLyQ HOpFWULFD GHEH PDQWHQHUVH GXUDQWH XQ WLHPSR ILMR GHVSXpV TXH VH UHFLEH XQD VHxDO GH HQWUDGD 3RU HMHPSOR DFWLYDU OD SRWHQFLD SDUD EORTXHDU 7/6*' SDUD PDQWHQHU XQD SXHUWD GH JXDUGD HQ SRVLFLyQ EORTXHDGD GXUDQWH XQ WLHPSR ILMR GHVSXpV TXH VH SUHVLRQD XQ ERWyQ GH SDUR 2WUR HMHPSOR VHUtD PDQWHQHU OD FRQH[LyQ GH XQ YDULDGRU D XQ PRWRU KDVWD TXH VH UHDOLFH OD IXQFLyQ GH IUHQR \ OXHJR GHVDFWLYDU XQ FRQWDFWRU SDUD GHVFRQHFWDU OD DOLPHQWDFLyQ HOpFWULFD DO PRWRU /DV HQWUDGDV SXHGHQ FRQHFWDUVH HQ FRQILJXUDFLyQ GH XQ FDQDO R GRV FDQDOHV /DV HQWUDGDV GHEHQ SHUPDQHFHU FHUUDGDV GXUDQWH WRGR HO FLFOR GH WHPSRUL]DFLyQ $EULU ORV FRQWDFWRV DQWHV TXH FRQFOX\D HO FLFOR GH WHPSRUL]DFLyQ FDXVDUi TXH HO WHPSRUL]DGRU VH UHVWDEOH]FD D FHUR /D XQLGDG &8 WLHQH HVWUXFWXUD UHGXQGDQWH FRQ GRV FLUFXLWRV GH WHPSRUL]DFLyQ GH VHJXULGDG LQGHSHQGLHQWHV /DV VDOLGDV LQFOX\HQ GRV VDOLGDV GH VHJXULGDG FRQ UHWDUGR QRUPDOPHQWH DELHUWDV DVt FRPR XQD VDOLGD GH VHJXULGDG QRUPDOPHQWH FHUUDGD /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG &XDQGR VH XVD XQD H[WHQVLyQ GH XQ UHOp SULQFLSDO ORV FRQWDFWRV QRUPDOPHQWH FHUUDGRV GHEHQ XVDUVH HQ HO OD]R GH UHWURDOLPHQWDFLyQ GHO UHOp SULQFLSDO 6L VH XVD HQ XQD DSOLFDFLyQ DXWyQRPD ORV FRQWDFWRV QRUPDOPHQWH FHUUDGRV SXHGHQ XVDUVH SDUD VHxDOL]DU XQ GLVSRVLWLYR DX[LOLDU R 3/& 8QD RSHUDFLyQ WtSLFD FRPLHQ]D FRQ OD DOLPHQWDFLyQ HOpFWULFD FRQHFWDGD D $$ \ ORV FLUFXLWRV GH HQWUDGD DELHUWRV  &LHUUH ORV FLUFXLWRV %% \ %% D /DV VDOLGDV GH VHJXULGDG  \  VH FLHUUDQ LQPHGLDWDPHQWH  $EUD ORV FLUFXLWRV %% R %% D &RPLHQ]D HO SURFHVR GH WHPSRUL]DFLyQ E /DV VDOLGDV GH VHJXULGDG  \  VH DEUHQ GHVSXpV TXH WUDQVFXUUH HO WLHPSR  9D\D DO SDVR 

TtwtfhtyipfwtifpryB86
#&!$"tyihtf Qpfifwfipfhtfhty pxtfi 9tgwp Rfwtifppyf Fyhtpypwfup hyxfi Ffptfwipwhyfh Stpxipppf ByithfipE87 Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw Sfxfxiphyih 4upipfytww pxtyfwp Fyfup Ip Utiftwpwhthf U64!4%%U4hM0 " U64$4 $"U4hM0# U664#V U664V Utiftwxphythf Utgfhty 6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  5HWDUGR D OD GHVDFWLYDFLyQ WHPSRUL]DGR  V D  V  FRQWDFWRV GH VHJXULGDG  FRQWDFWR DX[LOLDU  FRQWDFWR GH PRQLWRUHR



Tytifipiphywippxtfhty
Rpwphhtyipih
8yfif
G6G6

Qpwipprtifi 6T!

Rfwtifipprtifi
G4

Rfwtifftwtfp
G6

Ffrpyip pxtfhty
"o "o "o 

Gxpiphfwr !!QR $ !!QR $! !!QR $"

7txpytypxxwrfifitfrfxfipgwp
"%% $"&"

A1 35 K1 K2 36 18

17 B11 17 27

27 B12 35

  !   

18 28 B21 28

36 B22 A2

7tfrfxfiphfgwpfith
!U66

Ifip pxp rpyhtf

 f t h t6
81 K1 K2 L1 L2 L3 A1 B11 B21 17 27 35
A1
Rwpytip

 f t h t 6
54

A1 S11 S12 S21 S22 S23 X2 13 23 33 43 53

42 41 12 22 34

FRQ!QS
A2 PE Y1 Y2 X5 X6 X1 14 24
Qpfgwphtxtpy

6T!

A2

53

34 44 54

82

A2

B12 B22 18

28

36

11

21

33
SER@7

K1 K2
Stpf

pyhtfff gwpf

6fgwpfiipihfyfwpfpyfif6T!
!U66

Ifip pxp rpyhtf

A1 S11 S12 S21 S22 S23 X2 13 23 33 43 53

81 K1 K2

L1 L2 L3

 f t h t 6
A1 B11 B21 17 27 35
A1
Rwpytip

 f t h t 6
54

42 41 12 22 34

FRQ!QS
A2 PE Y1 Y2 X5 X6 X1 14 24
Qpfgwphtxtpy

6T!

A2

53

34 44 54

82

A2

B12 B22 18

28

36

11

21

33
SER@7

K1 K2
Stpf

pyhtfff gwpf

6fgwpfiipyhfyfwfpyfif6T!



Qpwipprtifi 6T

Fytpipfipxtxtpy
8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfif Qptpyhtfippyfifx Qpfgwphtxtpy Rfwtif 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6fpry8G&"! BRH %!& 6Sthvxfhf68hTESU !U6466 U64 )!U4 GIGIGIyxfwxpyp fgtp ": 4xthxfyfw G4Rprtifi(G64twtf 5 46" "4"U64"4"U64 G 76 4!U66 f!xty Qpfiip"x4 4hhtytifip"4 x4U &x Qu0fwtxpwhhyphfif Qupip0pxtfhtyfwtif fhtfif "U o6f""6 !9f 9 & ipsxpifipwftf BI!G8F47BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht 6ipfhpihyU78 Gx%wg wr Iwthfgyfu Qtpw7BGip "xx #r$&wg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

7phthty
/D XQLGDG GH FRQWURO &8 HV XQ PyGXOR FRPSDFWR GH LQWHUIDFH GH GHWHFFLyQ GH WHPSRUL]DFLyQ \ PRYLPLHQWR LQWHUUXPSLGR 8VDQGR GRV HQWUDGDV LQGHSHQGLHQWHV GH SUR[LPLGDG LQGXFWLYD TXH PRQLWRUHDQ HO PRYLPLHQWR GH GRV SLH]DV PHWiOLFDV GH OD PiTXLQD SRU HMHPSOR GLHQWHV GH HQJUDQDMH OHYDV R YDULOODMH  OD XQLGDG GH FRQWURO GHWHFWD FXiQGR WHUPLQD HO PRYLPLHQWR SHOLJURVR 8QD YH] WHUPLQDGR HO PRYLPLHQWR SHOLJURVR OD XQLGDG HQYLDUi XQD VHxDO SDUD GHVHQFODYDU ORV GLVSRVLWLYRV GH HQFODYDPLHQWR GH JXDUGD 6H KD GHVDUUROODGR SDUD LQWHJUDU LQWHUUXSWRUHV GH HQFODYDPLHQWR GH EORTXHR GH JXDUGD HQ ODV PiTXLQDV TXH WLHQHQ FLFORV GH SDUR YDULDEOHV R LQFRQVWDQWHV 8QD FXELHUWD GHVPRQWDEOH SHUPLWH DFFHVR D ORV PLFURLQWHUUXSWRUHV \ SRWHQFLyPHWUR TXH FRQWURODQ OD WHPSRUL]DFLyQ 6H SXHGH DMXVWDU HO UHWDUGR GH DFWLYDFLyQ HQWUH  VHJXQGR \  PLQXWRV PHGLDQWH XQD VHULH GH  DPSOLRV UDQJRV GH WLHPSR 8Q SRWHQFLyPHWUR HIHFW~D HO DMXVWH ILQDO /RV WHUPLQDOHV << H[DPLQDQ ORV FRQWDFWRUHV DO PRPHQWR GH DUUDQTXH GH OD PiTXLQD (VWH HV XQ HOHPHQWR SHUWLQHQWH VRODPHQWH HQ DSOLFDFLRQHV HVSHFLDOHV (VWRV WHUPLQDOHV VH GHEHQ FRQHFWDU HQ XVR QRUPDO 'HVSXpV GHO SDUR GH WRGR HO PRYLPLHQWR VH FLHUUDQ ORV FRQWDFWRV GH VHJXULGDG 1$ ORV FXDOHV VH SXHGHQ XVDU SDUD DFWLYDU LQWHUUXSWRUHV GH JXDUGD GH EORTXHR GH VROHQRLGH GH RSHUDFLyQ HOpFWULFD $GHPiV VH DEUHQ ORV FRQWDFWRV 1& SDUD LQGLFDU HO HVWDGR GH ODV XQLGDGHV (O LQGLFDGRU /(' HQ OD XQLGDG LQGLFD OD DOLPHQWDFLyQ HOpFWULFD WHPSRUL]DGRU DFWLYDGR \ VDOLGDV

TtwtfhtyipfwtifpryB86
#&!$"tyihtf Qpfifwfipfhtfhty pxtfi 9tgwp 8yfifppyf Rfwtifppyf Fhtpypwfup hyxfi Stpxiphfifx ByithfipE87 Uwfupipptpyhtfiptxw Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h M0 " U64$4 $"U4 hM0# U664#V U66V Utiftwxphythf Utgfhty

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  (QWUDGDV 131 \ 313 6DOLGD GH UHWDUGR D OD GHVDFWLYDFLyQ WHPSRUL]DGR GH  V D  PLQ  VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1&

6sp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Fytpipfipxtxtpy
Rpwphhtyipih
7phthty Uwfupipipph Sfxfip ipph
xx 6ywfi ipphp !U66xtytfi wfytifiiphyw %xx xx

Qpwipprtifi 6T

7tfyhtfip ipphhty
xx "xx xx

Uwfupipytifi iphyw
!U6466  U64 !U6466  U64 !U6466  U64

Gxpip hfwr !!QR$$& !!QR$% !!QR$% !!QR$% !!QR$% !!QR$%!

4hhpt
7phthty
Tytifiiphywwfxpyp

Uwfup
!U66  U64

Sfxf
!"xx xx

Stipfwtif
G4G6 GIG IGI GIG IGI GIG IGI

Rwipph

!U66xtytfi wfytifiiphyw

%xx xx

9tgwpippp

rtyf!#

Gxpiphfwr !!QR$ & !!QR$! %$67 GG8 %$67 GI8 %$67"GG%8 %$67"GI%8 %$67GG 8 %$67GI 8 !!Q4 "#
FfyGpr4w
N P N K3 K1 K2 K1

7txpytypxxwrfifitfrfxfipgwp
!$ !""$&
A1 A2 K1 K2 G ~ 24VDC K3 K2 R K3 K2 Y1 Y2 13 23 31 F1 110/230

Fyfuppytpw7BGip "xx

 $ %   $

Erthf

5FNQPSJ [BEPS

Q1 K2

FfyGpr4w
P N

14 24

32

7tfrfxfiphfgwpfith
Bytht If @fifhpfif gwpfif
A1 42 41 12 22
Rpyip txtifi

Df Df

!U66

L1 L2 L3

TLS1-GD2 54 53 34 33

A1 N

N 13 23 31 Y1 K2

A2

6T
A2 P N P 14 24 32 Y2

K2

11 K1

21

M
Stpf

K2

Rpyip txtifi

4

6xpfipprtifihygwpiprfifipphpipxtxtpyipgwp iphxpfpfifipfgwphtxtpyfxthfwtifxytpfif



Qpwipprtifi

Fytpipfipxtxtpy
7pfwwpipwipph6T 8phtqthfhtyp
Gxf 6ptqthfhtyp Uwfupippfhty 7tfyhtfipipphhty 9fhpiphphhty 4hp pxwfi 4hptytifgwp Efy 4wxtyt 6gp 6frfiphtpyp Rfwtif 6tpypipqrf 6fifipwfup 6ffhtifiipppthty Atpt ByithfipE87 Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtypwhthf B86#&!$" Ffhf68ffifwfitphtf fwthfgwphTE f 66 xx"xxxx  $o% !o"  o! 6o x4 GIGIGIyxfwxpypfgtp x4

7phthty
/RV GHWHFWRUHV GH SUR[LPLGDG LQGXFWLYRV :RUOG3UR[ GH %ROHWtQ & VRQ GLVSRVLWLYRV DXWyQRPRV GH HVWDGR VyOLGR SDUD ILQHV JHQHUDOHV GLVHxDGRV SDUD GHWHFWDU OD SUHVHQFLD GH REMHWRV PHWiOLFRV IHUURVRV \ QR IHUURVRV VLQ HQWUDU HQ FRQWDFWR FRQ ORV PLVPRV (O FXHUSR GHO LQWHUUXSWRU FRQVLVWH HQ XQD SODFD IURQWDO GH SOiVWLFR \ XQ FXHUSR GH ODWyQ UHYHVWLGR GH QtTXHO &XPSOH FRQ ODV QRUPDV GH HQYROYHQWHV 1(0$     3   H ,3 ,(&  /RV FLUFXLWRV HOHFWUyQLFRV HVWiQ FRPSOHWDPHQWH HQFDSVXODGRV FRPR SURWHFFLyQ FRQWUD FKRTXHV YLEUDFLRQHV \ FRQWDPLQDFLyQ (O &8 HVWi GLVHxDGR SDUD IXQFLRQDU FRQ XQ GHWHFWRU GH SUR[LPLGDG LQGXFWLYD 131 QRUPDOPHQWH DELHUWR \ XQ GHWHFWRU GH SUR[LPLGDG LQGXFWLYD 313 QRUPDOPHQWH DELHUWR /DV WHUPLQDFLRQHV GH WDSD ILQDO WUDQVOXFLHQWHV GHO GHWHFWRU VH LOXPLQDQ FXDQGR HVWi HQFHQGLGR HO LQGLFDGRU /(' \ pVWH HV YLVLEOH GHVGH FDVL WRGRV ORV iQJXORV /RV GHWHFWRUHV TXH DSDUHFHQ HQ HVWD VHFFLyQ VRQ DOJXQRV GH ORV GHWHFWRUHV GH SUR[LPLGDG LQGXFWLYD FRQ ORV WDPDxRV PiV SRSXODUHV 9HD HO FDWiORJR GH 'HWHFWRUHV GH 5RFNZHOO $XWRPDWLRQ$OOHQ%UDGOH\ SDUD REWHQHU XQD DPSOLD OLVWD GH GHWHFWRUHV GH SUR[LPLGDG

d#!U d d th
Qu0fwtiffhtfif o"6f$6 o 9f"%9 &" ipsxpifipwftf G8F4 !#I BI#$ 4wtxpyfhtypwhthffhtfifip txwqfwtifytt hhthtipwftifitypf gphfrf xx%4V@pyfi xx!4V@ Iwfhfqyfwipwthhpip wfypptiipypw FF%F  4hwpfwf ipphhtyhygwtyifup rxpxttytip xxtho""A

6fwtgpiphfgwp Eyrtiiphfgwp Ffptfwipwpywpyp Fyfup 6sp

7txpytypxxwrfif

Utgfhty

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

Byithfi E87ttgwp f #

x#"tp

Sfxfiphf
F F% F 

5wtyifi
R

4
!$ %$ %

xxwrfif 5x
"%

6xy
!#$%!



Fytpipfipxtxtpy
7pfwwpipfwthfhty
4hhptipfwthfhty
7pphptyihtIGIGIG ffhywfytifi6T
Eipphpipphfyhfyip iptpyppwxtxtpy xytpfyiiguppytpf xpwthfpyxtxtpy6fyip iptpyppwxtxtpywfytifi 6ThxtpyffpxtfTyfp ppffpwwxtpiptpx ppwphhtyfiwfytifi6T pyfyfpfwppxtppp fgfwfrfifgwpfif

Qpwipprtifi

7pfwwpipwipph6T

Qpfiiptpx fufgwp

8fgwphtxtpyiptpxrpypfwxpitfyp xthtypp
4 1 2 )prfpr 6

Exthtyppfufy pwfxpiptpxrpypfw pwpyhtxpfufhy phttywfpwphhtypip tpx9tgwpppxwffgwpip fhhpqhtwip"x4S

5 prf &pr

1 2 1 #prf"xtypr

7 2 !%prf!xty

7pphtyihtGIG

7pphtyihtIGI

8fgwphtxtpyiptpxpht xpitfyppyhtxp
4 5 7 Sfwxpypf ipFytx 6 Sfwxpypf tFtx

#xx x

Ftxtpy rtftipwf xtyf

#xx x

Tytifiiptyithfhtypxf6T'

Rppiphyphfyfytifiip tyithfhtypxffftyithfpw pfiipwhthtfwfhyptyp 6TQQQ 

7tfrfxfiphfgwpfith
GIGipyfi IGIti

+
 U66 Ffy

+
 U66 Ffy

+ -

+
6frf

Gpr

4w

Gpr 6frf 4w



Qpwipprtifi 6T

Fytpipqpfhyfpwphxt
8phtqthfhtyp
Gxf 6fprf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfif Uwfupipxxtx Qpfgwphtxtpy Rfwtif 8G&"!BRH %!&B868G #!B86#&!$"4GRB 5&4R!! 6fpry8G&"! BRH %!& 6Sthvxfhf68hTESU !U6466 U64 )!U4 UwfupipxYY "U 4xthxfyfw G4Rprtifi(G64twtf 5 46" "4"U64"4"U64 G 76 4!U66 Qpfiip"x4 4hhtytifip"x4 4hhtytifip"4 x4U Qu0fwtxpwhhyphfif Qupip0pxtfhtyfwtif fhtfif 4xftww0qfww Qu0Fpyqyhtyfxtpy "U o6f""6 !9f 9 & ipsxpifipwftf BI!7BG!$ BI7BG!$ "xx!4V@pyfi !xx4V@xfht 6ipfhpihyU78 Gx%wg wr Iwthfgyfu Qtpw7BGip "xx "rwg pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp $"xx wrth f""A rxpxttytip

7phthty
(O &8 HV XQD XQLGDG GH FRQWURO TXH GHWHFWD HO PRYLPLHQWR LQWHUUXPSLGR \ HV LGHDO SDUD XVDU FRQ ORV LQWHUUXSWRUHV GH HQFODYDPLHQWR GH EORTXHR GH JXDUGD (VWi GLVHxDGR SDUD KDFHU LQWHUIDFH FRQ PRWRUHV GH LQGXFFLyQ PRQRIiVLFRV R WULIiVLFRV PLGLHQGR HO YROWDMH GHO YDULDGRU \ HO FDPSR GH IXHU]D FRQWUDHOHFWURPRWUL] HPI GHO PRWRU /D YHQWDQD IURQWDO GHO &8 SXHGH DSDUHFHU SDUD UHYHODU HO IXVLEOH UHHPSOD]DEOH \ HO SRWHQFLyPHWUR (O SRWHQFLyPHWUR HVWDEOHFH HO YROWDMH GH XPEUDO PHGLGR HQ ORV WHUPLQDOHV == (O Pi[LPR YROWDMH GH XPEUDO HV DSUR[LPDGDPHQWH  9 SLFR SRWHQFLyPHWUR WRWDOPHQWH D OD L]TXLHUGD  &XDQGR HO YROWDMH HQ == H[FHGH HO YROWDMH GH XPEUDO ODV VDOLGDV GH VHJXULGDG VH GHVDFWLYDQ \ ORV FRQWDFWRV GH VHJXULGDG HQ ORV WHUPLQDOHV  \  VH DEUHQ &XDQGR VH GHVFRQHFWD OD IXHQWH DOLPHQWDFLyQ HOpFWULFD D XQ PRWRU OD YHORFLGDG GHO PRWRU VH UHGXFH D FHUR 'XUDQWH HO SHUtRGR GH SDUR OD IXHU]D FRQWUDHOHFWURPRWUL] JHQHUDGD SRU HO PRWRU HV PRQLWRUHDGD SRU HO &8 &XDQGR HO QLYHO GH IXHU]D HOHFWURPRWUL] FDH SRU GHEDMR GHO YROWDMH GH XPEUDO ODV VDOLGDV GH VHJXULGDG VH FLHUUDQ (VWR SHUPLWH TXH VH DFWLYH HO GLVSRVLWLYR GH VDOLGD SRU HMHPSOR HO LQWHUUXSWRU GH EORTXHR R GHVEORTXHR GH VROHQRLGH  6L VH DEUH HO FLUFXLWR == HO &8 HQWUD HQ HVWDGR GH IDOOR OR FXDO HV LQGLFDGR SRU HO LQWHUUXSWRU /(' GH IDOR (O IDOOR GHEH FRUUHJLUVH \ OD DOLPHQWDFLyQ DO &8 GHEH GHVFRQHFWDUVH \ YROYHUVH D FRQHFWDU SDUD TXH VH ERUUH HO HVWDGR GH IDOOR /D YHUVLyQ GH  9&& GHEH DFWLYDUVH FRQ XQ VXPLQLVWUR DLVODGR (O &8 QR HVWi GLVHxDGR SDUD XVR FRQ YDULDGRUHV GH IUHFXHQFLD DMXVWDEOH

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 9tgwp 4wtxpyfhtypwhthf typyfppxwf 8yfifipxppyf Rfwtifppyf Fhtpypwfup hyxfi ByithfipE87

Uwfupipptpyhtfiptxw Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih @iptyfwfhty @fiiphyfxtyfhty 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4h M0 " U64$4 $"U4 hM0# U664#V U66V Utiftwxphythf Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   VDOLGDV GH VHJXULGDG 1$  VDOLGD DX[LOLDU 1&

7pfwwpipfwthfhty
4ufprypwtpxip fipwfxtyfwf pytgtwtifiipwx 9tgwp ppxwffgwp

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Fytpipqpfhyfpwphxt
Rpwphhtyipih
Rfwtifipprtifi
G4

Qpwipprtifi 6T

Rfwtifftwtfp
G6

9pypipfwtxpyfhty pwhthfipw6T
!U6466 U64  U64

Gxpiphfwr !!QR " !!QR " !!QR "

8w!!QR "ptppyxtytftwfihfyiqyhtyfhy!U66

4hhpt
7phthty
9tgwpip"x4

Gxpiprtyf
!#

Gxpiphfwr !!Q4 "#

7txpytypxxwrfifitfrfxfipgwp
!"$$ !$
A1 F1
Stop

A2

X1

X2 K2 K2 K1
Sensitivity Run K3 Fault

13 23 K3

31

K3 K2

 $ %   $ Fyfuppytpw7BGip "xx

K1 K1 K1

24VDC

K1 K2

Power

Logic

Q1

K2

Z1

Z2

14 24

32

7tfrfxfiphfgwpfith
!U66 Bytht If @fifhpfif gwpfif
A1 42 41 12 22

Df Df
L1 L2 L3

9tgwpip"x4
TLS1-GD2 54 53 34 33 A1 Z1 13 23 31 X1 K2

A2

6T
A2 Z2 14 24 32 X2

K2

11 K1

21

K2

9tgwpip"x4

M
4 Stpf

6xpfipprtifiipgwpiprfifipphhtyipqpf hyfpwphxtpfgwphtxtpyfxthfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQI
6fprf 6f!pry8G&"! BRH %!& 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi !U66(%fwfupyxtyfw %V G6G6 G6S fppip prtifi Rtxwfyptifiippyfif Fptpyhtfippyfif8yfif Qpfgwphtxtpy Qpfgwphtxtpy Rfwtif Byqtyt  sx sx Fytpxfyfxfy G4Rprtifi(G44twtf RRIGI pyfifhpfif RRIGI fwtiffhtf 5 46" 4"U64 4"U64 I 76 ("4!U66 6tpypxthfyxtyfw tyhyxfhty Rfwtifpfiwti 9tgwpRfwtifppyf Fyhtpypwfuphyxfi Ffptfwipwhyfh 6yfhipwhfgwpwfy Qpfifwffhtfhty StpxipppfFRQ FRQFiippip pyfif Stpxipphpfhty !!"xippyipipwxiwip pfytyfi ByithfipE87 Upip0pyfifhpfif Qu0pyfiffgtpf Upip0pyfifhpfif Qu0pyfiffgtpf Upip0fwtif6Afhtf Upip0fwtif6Afhtf Upip0fwtxpwhthf Upip0xfhsffwtiffhtf Qu0Iffwtifipfhtfif7tfr xgf0Etpyfifhpfif Uwfupipptpyhtfiptxw @fiiphyfxtyfhty S pxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw Iphhtyhyfhhtht 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utifpwhthftwhyptyip gppyty "U64#4"U4h0 "U644"U4h0 "U64!4U4h0 " "U64"4U4h0# !U664!%V U664V Utiftwxphythf Utgfhty 6sp 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6ptqthfhtyp 6Sthvxfhf68hTESU pfhtyp "pfhtyp pfhtyp pfhtyp pfhtyp pfhtyp hthw ""A "xx r#xhsp "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI 8yfif(RfwtifRR o!xx !o4V@ !o"Gx "!o!! wgwr IwtfxtifI4## Qtpw7BGip "xx %r#wg x4f U66 #4fhhtywpyf4fhhtytif x4U66 4rRyH x4 Qpptxtpyip &x !x#xxiw #4!4

7phthty
(O 0653 FRQVWLWX\H XQD GH ODV EDVHV GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 3XHGH FRPELQDUVH FRQ RWURV PyGXORV GH OD VHULH 065 SDUD FRQILJXUDU XQ VLVWHPD GH FRQWURO GH VHJXULGDG FRQ Q~PHURV GH HQWUDGDV \ VDOLGDV TXH FRUUHVSRQGHQ D ORV UHTXLVLWRV GH OD DSOLFDFLyQ HVSHFtILFD GHO XVXDULR DVt FRPR FDSDFLGDGHV GH GLDJQyVWLFR \ FRQH[LyQ HQ UHG 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH HQWUDGD \  PyGXORV GH VDOLGD D XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ ORV PyGXORV GH VDOLGD \ HQWUDGD ILQDOHV (O 0653 WLHQH GRV HQWUDGDV &DGD HQWUDGD SXHGH FDEOHDUVH PHGLDQWH XQD GH FXDWUR PDQHUDV  1&  1&  1&  1& \  1$ R FRQH[LRQHV GH WDSHWH GH VHJXULGDG (O 0653 XWLOL]D PRQLWRUHR GH HQWUDGD GH SXOVRV SDUD GHWHUPLQDU OD SUHVHQFLD GH IDOORV GH DOLPHQWDFLyQ HOpFWULFD WLHUUD R HQWUH HQWUDGDV DQWHV GH TXH VH LPSRQJD XQD GHPDQGD DO VLVWHPD GH VHJXULGDG /D FRQH[LyQ GH XQ VROR GLVSRVLWLYR GHEH WHQHU SRU OR PHQRV GRV FDQDOHV D FDGD HQWUDGD FXPSOH FRQ ORV UHTXLVLWRV GH OD FDWHJRUtD  VHJ~Q (1  (O 0653 WLHQH OD FDSDFLGDG GH UHDOL]DU PRQLWRUHR GH GLVSRVLWLYR H[WHUQR ('0  /D FDSDFLGDG ('0 IXQFLRQD MXQWR FRQ OD RSFLyQ GH UHVWDEOHFLPLHQWR (O XVXDULR VHOHFFLRQD HO ('0 \ OD IXQFLyQ GH UHVWDEOHFLPLHQWR PHGLDQWH SXHQWHV HQ ORV WHUPLQDOHV < < \ < (O 0653 WLHQH GRV VDOLGDV GH VHPLFRQGXFWRU GLVHxDGDV SDUD HQYLDU LQIRUPDFLyQ GH HVWDGR D XQ 3/& (O WHUPLQDO < LQGLFD TXH ODV HQWUDGDV HVWiQ FHUUDGDV HO LQGLFDGRU 5HDG\ HVWi HQFHQGLGR  (O WHUPLQDO < LQGLFD TXH ODV VDOLGDV HVWiQ DFWLYDV /DV VDOLGDV LQFOX\HQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG \  VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

Ttwtfhtyipfwtifpry

B86#&!$"tyihtf

6ffhpthf

8phtqthfhtyp
Gxf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  0yGXOR GH HQWUDGDV GH SXOVRV  FLUFXLWRV GH HQWUDGD FRPSXHUWD SDUR GH HPHUJHQFLD R WDSHWH GH VHJXULGDG  VDOLGDV GH VHJXULGDG  VDOLGD DX[LOLDU  VDOLGDV GH HVWDGR VyOLGR  LQGLFDGRUHV /(' GH GLDJQyVWLFR 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 7HUPLQDOHV H[WUDtEOHV

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
8yfif
G6G6 G6fppip prtifi G4 G6 IGI !U66

Qpwipprtifi

FtyfFRQI
Gxpiphfwr !!QA $#

Rfwtifipprtifi

Rfwtifftwtfp

Rfwtifippfi wti

9pypip fwtxpyfhtypwhthf

7txpytypxxwrfifitfrfxfipgwp
&&!$ !"$$
S12 S11 S32 S31 S51 S41 Y40 133 23 Y41 Y42 3 A1
13 23 31

K1

!" !"

K2
14 24 32 Y31 Y33

Y1 S42

4 2

Y31 Y32 14 24 32

7tfrfxfiphfgwpfith
!U66
wp g f y h t y y f t h f ty p p i x p S
Sfppipprtifi 9tgwp

A1

S32 S41 S12 S51 S22

Y31 Y40 Y41 Y42 13 23 31

.431
S62 S11 S42 S52 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

p wg f y h t y y f th f p y t i xp p S K1
K2

!U66
6xpf ip prtifi
9tgwp

L1 L2 L3

6pfi

A1 S11 S12 S21 S22 S31 S32

Y31 Y40 Y41 Y42 13 23 31

Spxtyfhty hfgwpip pfyty

.431
A2 S42 S52 S62 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

wp g f y h t y y f t h f ty p p i x p S K1
K2

L1 L2 L3

A2 p i i f f ti p r p hpfi x 6

Qpfgwphtxtpy Stpf Rfwtif fhtf 8yfif hpfif

6xpf ip prtifi 6pfi

Stpf

Rfwtif 8yfif fhtf hpfif

Sfppipprtifihxpfipprtifiipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif
!U66
6xpf ip prtifi
9tgwp

7pyfifipphfyfwp pfgwphtxtpyfxthfwtifxytpfif
!U66
6 x p fi p prti fi 6 pfi px t f t f pi p p f t 6 x pf ip prti fi 6 pfi
Stpf Rfwtif 8yfif fhtf hpfif
A1 S41 S12 S22 S32 S51 Y31 Y40 Y41 Y42 13 23 31

6pfi

A1 S41 S12 S22 S32 S51

Y31 Y40 Y41 Y42 13 23 31

pxt f t f pip p f t
6xpf ip prtifi

.431
A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

wp g f h y t y y t f h L1 L2 L3 f y t p p i x p K1 S
K2

.431
A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

wp g f h y t y y th f L1 L2 L3 f ty p p x i K1 p S
K2

6 pfi
Stpf Rfwtif fhtf

Qpfgwphtxtpy 8yfif hpfif

7hxpfipprtifiipihfyfwp pfgwphtxtpyxfyfwxytpfityfwtifxytpfif
7tfrytho8wtyithfiuipfffipf Qrtxpyip ffip 7phthty
 6fxgtpypwhthtX!X!X!ifypwfpfhty 9fwwpyhthtippfwtxpyfhtyppyXX5fpw qfwwiphyphfwpfhyphfwffwtxpyfhtypwhthf ffpfgwphppwxiw 6yty 9fwwtypypygfpxiwippfyty

7hxpfipprtifiipyhfyfw pfgwphtxtpyfxthtyfwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQI
6f!pry8G&"! BRH %!& 9pypipfwtxpyfhtypwhthf !U66(%fwfupyxtyfw 6yxippyhtf %V 8yfifipprtifi G6G6htyfipwip prtifi Rtxwfyptifiippyfif Byqtyt Fptpyhtfippyfif8yfif  sx Qpfgwphtxtpy sx Qpfgwphtxtpy Fytpxfyfxfy Rfwtif G4prtifi(G64twtf RRIGIpyfifhpfif RRIGIfwtiffhtf TtwtfhtyipfwtifpryB86#&!$ 46'#4"U64 !pttf 76'#4!U66 TtwtfhtyipfwtifpryB86 5 46"( #&!$"tyihtf 4"U64 4"U64 I 76 ("4!U66 6tpypxthfyxtyfwty #4!4 hyxfhty Rfwtifpfiwti x4f U66 9tgwpRfwtifppyf #4fhhtywpyf4fhhtytif Fyhtpypwfuphyxfi x4U66 Ffptfwipwhyfh 4rRyH hyphgtxtpyipip xthyp 6yfhipwhfgwpwfy Qphgtxtpyip Qpfifwffhtfhty StpxipppfFRQ "x FRQFRQ x!xpryFRQ Stpxipphpfhty !!"xippyipipwxiwip pfytyfi ByithfipE87 Upip0pyfifhpfif Qu0pyfiffgtpf Upip0pyfifhpfif Qu0pyfiffgtpf Upip0fwtif6Afhtf Upip0fwtif6Afhtf Upip0fwtxpwhthf Upip0xfhsffwtiffhtf Qu0Iffwtifipfhtfif 7tfryth xgf0Etpyfifhpfif Uwfupipptpyhtfiptxw "U @fiiphyfxtyfhty  Spxpffippfhty o"6f""6 9f 9 Axpifi & ipsxpifipwftf Iphhtyipwpywpyp BI!G8F4 Iphhtyipwpxtyfw BI Iphhtyhyfhhtht 8yfif(RfwtifRR 6fwtgpiphyih o!xx!o4V@ 4upipfytwwpx !o"Gx "!o!! wgtwr Ffptfwipwpywpyp IwtfxtifI4## Fyfup Qtpw7BGip "xx Ip %r#wg Utiftwpwhthf U64!4%%U4hM0 " pfhtyp U64$4 $"U4hM0# "pfhtyp U664#V pfhtyp U664V pfhtyp Utiftwxphythf hthw Utgfhty ""A "xx 6sp r#xhsp Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp 6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif

6fprf

7phthty
(O 0653 FRQVWLWX\H XQD GH ODV EDVHV GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 3XHGH FRPELQDUVH FRQ RWURV PyGXORV GH OD VHULH 065 SDUD FRQILJXUDU XQ VLVWHPD GH FRQWURO GH VHJXULGDG FRQ Q~PHURV GH HQWUDGDV \ VDOLGDV TXH FRUUHVSRQGHQ D ORV UHTXLVLWRV GH OD DSOLFDFLyQ HVSHFtILFD GHO XVXDULR DVt FRPR FDSDFLGDGHV GH GLDJQyVWLFR \ FRQH[LyQ HQ UHG 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH HQWUDGD \  PyGXORV GH VDOLGD D XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ ORV PyGXORV GH VDOLGD \ HQWUDGD ILQDOHV (O 0653 WLHQH GRV HQWUDGDV &DGD HQWUDGD SXHGH FDEOHDUVH PHGLDQWH XQD GH WUHV PDQHUDV  1&  1& R  FRQH[LRQHV 313 GHVGH XQD FRUWLQD GH OX] GH VHJXULGDG (O 0653 QR UHDOL]D PRQLWRUHR GH IDOORV FUX]DGRV \ QR GHWHFWDUi XQ FRUWRFLUFXLWR HQWUH  HQWUDGDV 1& &XDQGR VH FRQHFWD D FRUWLQDV GH OX] GH VHJXULGDG HO VLVWHPD GH FRUWLQD GH OX] GH VHJXULGDG GHEH UHDOL]DU OD GHWHFFLyQ GH IDOORV FUX]DGRV (O 0653 WLHQH OD FDSDFLGDG GH UHDOL]DU PRQLWRUHR GH GLVSRVLWLYR H[WHUQR ('0  /D FDSDFLGDG ('0 IXQFLRQD MXQWR FRQ OD RSFLyQ GH UHVWDEOHFLPLHQWR (O XVXDULR VHOHFFLRQD HO ('0 \ OD IXQFLyQ GH UHVWDEOHFLPLHQWR PHGLDQWH SXHQWHV HQ ORV WHUPLQDOHV < < \ < (O 0653 WLHQH GRV VDOLGDV GH VHPLFRQGXFWRU GLVHxDGDV SDUD HQYLDU LQIRUPDFLyQ GH HVWDGR D XQ 3/& (O WHUPLQDO < LQGLFD TXH ODV HQWUDGDV HVWiQ FHUUDGDV HO LQGLFDGRU 5HDG\ HVWi HQFHQGLGR  (O WHUPLQDO < LQGLFD TXH ODV VDOLGDV HVWiQ DFWLYDV /DV VDOLGDV LQFOX\HQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG \  VDOLGD DX[LOLDU QRUPDOPHQWH FHUUDGD /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   FLUFXLWRV GH HQWUDGD FRUWLQD GH OX] GH VHJXULGDG FRPSXHUWD R SDUR GH HPHUJHQFLD  VDOLGDV GH VHJXULGDG  VDOLGD DX[LOLDU  VDOLGDV GH HVWDGR VyOLGR  LQGLFDGRUHV /(' GH GLDJQyVWLFR 5HVWDEOHFLPLHQWR PRQLWRUHDGR R DXWRPiWLFR 7HUPLQDOHV H[WUDtEOHV

8phtqthfhtyp
Gxf 6ptqthfhtyp 8G&"!BRH %!&B868G#! B86#&!$!B86#&!$"4GRB 5&4R!! 6Sthvxfhf68hTESTU



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
Rfwtifippfi 8yfif Rfwtifipprtifi Rfwtifftwtfp wti 9pypip fwtxpyfhtypwhthf Gxpiphfwr

Qpwipprtifi

FtyfFRQI

7pyfif G6G6 htyfipwipprtifi


&& %&

G4

G6

!U66

!!QA $$

7txpytypxxwrfifitfrfxfipgwp
!"$$
S12 S11 S20 S21 S32 S31 S51 S41
13

Y40
23 31

13 23 Y41 Y42

33 A1

K1

!" !"
Y1 S42 Y2 S50

K2
14 24 32 Y31 Y32 Y33

S34 S62

Y31 Y32 Y33 Y30 14 24

A2 32

7tfrfxfiphfgwpfith
wp gy f h t y y t f h f p ty p x i p S
!U66
6 t fip ip prtifi f  f 
A1 S12 S32 Y31 Y40 Y41 Y42 13 23 31

p i f i A2 f ti p r p x 6 6 pfi

FRQI
S42 S62 Y30 Y32 Y33 S34 Y1 Y2 14 24 32 K1 K2

wp g f y h t y y th f f ty p p i x p K1 S
K2

L1 L2 L3

wp g f y h t y y t f h A1 f y t p p i x p S p i i f f ti p r p x 6

!U66
6 t fip i p prti fi f  f 
S12 S32 Y31 Y40 Y41 Y42 13 23 31

FRQI
Y30 Y32 Y33 S34 Y1 Y2 14 24 32 K1 K2

w p gy f h t y y f t h L1 L2 L3 f y t p p i x p S K1
K2

A2 S42 S62

tpf

6tyfipwipprtifihxpfipprtifiipy 6tyfipwipprtifihxpfipprtifiipi hfyfwppfgwphtxtpyxfyfwxytpfifwtifxytpfif hfyfwpfgwphtxtpyxfyfwxytpfityxytpip fwtif


wp g f y h t y y t f h f y t p p i x p S
!U66
6 t fi p i p prti fi f  f 
A1 S12 S32 Y31 Y40 Y41 Y42 13 23 31

f tif f t f

fi f pfif

pf p tx tp

6 pfi tpf f ti f f t f fif pfi f

pf p tx tp

p i i f f A2 ti p r p x 6pfi 6

FRQI
S42 S62 Y30 Y32 Y33 S34 Y1 Y2 14 24 32 K1 K2

p w g f y h t y y th f f p y t i xp p S K1
K2

L1 L2 L3

tpf

f ti f f t f

fif pfif

6tyfipwipprtifihxpfipprtifiipihfyfwp pfgwphtxtpyxfyfwfxthfwtifxytpfif
7tfrytho8wtyithfiuipfffipf Qrtxpyip ffip

 6yty

6fxgtpypwhthtX!X!X!ifypwfpfhty 9fwwpyhthtippfwtxpyfhtyppyXX5fpw qfwwiphyphfwpfhyphfwffwtxpyfhtypwhthf ffpfgwphppwxiw 9fwwtypypygfpxiwippfyty

7phthty



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQI 8phtqthfhtyp
Gxf 6ptqthfhtyp 6fprf 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx ByithfipE87 8G&"!BRH %!&B868G #!B86#&!$!B86 #&!$"4GRB5&4R!! 6Sthvxfhf68hTE5@ 6f!pry8G&"! BRH %!& !U66ipipwfgfp V G6G6 G6G6 G4fpp Byqtyt  sx Upip0pyfifhpfif Qu0pyfiffgtpf Upip0pyfifhpfif Qu0pyfiffgtpf "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o!xx!o4V@ !o"Gx "!o!! wgtwr IwtfxtifI4## Qtpw7BGip "xx &"rwg ""A "xx r#xhsp

7phthty
(O 0653 HV XQ PyGXOR GH H[SDQVLyQ GH HQWUDGD GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 6H SXHGH FRQHFWDU DO 0653 R DO 0653 SDUD SURSRUFLRQDU HQWUDGDV DGLFLRQDOHV 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH HQWUDGD D XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH (O FDEOH SODQR GH FRQH[LyQ SURSRUFLRQD DOLPHQWDFLyQ DO 0653 DVt FRPR YHULILFDFLyQ GH VX HVWDGR /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ HO PyGXOR GH VDOLGD ILQDO /RV PyGXORV GH HQWUDGD D OD EDVH SXHGHQ VHU HO 0653 R HO 0653 HQ FXDOTXLHU FRPELQDFLyQ X RUGHQ (O 0653 WLHQH GRV HQWUDGDV LQGHSHQGLHQWHV ODV FXDOHV SXHGHQ FDEOHDUVH PHGLDQWH XQD GH FLQFR PDQHUDV 1&  1&  1&  1& \  1$ R XQ WDSHWH GH VHJXULGDG &XDQGR VH XVDQ FRQ OD EDVH 065 ORV SXOVRV GH ODV HQWUDGDV DO 065 VRQ FRQWLQXDPHQWH YHULILFDGRV SDUD GHWHUPLQDU OD SUHVHQFLD GH FRUWRFLUFXLWRV GH DOLPHQWDFLyQ WLHUUD \ HQWUH HQWUDGDV /D FRQH[LyQ GH XQ VROR GLVSRVLWLYR GHEH WHQHU SRU OR PHQRV GRV FDQDOHV D FDGD HQWUDGD FXPSOH FRQ ORV UHTXLVLWRV GH OD FDWHJRUtD  VHJ~Q (1 &XDWUR LQGLFDGRUHV /(' SURSRUFLRQDQ LQIRUPDFLyQ GH HVWDGR VREUH ODV HQWUDGDV (O FRORU YHUGH LQGLFD TXH OD HQWUDGD HVWi FHUUDGD \ HO FRORU URMR LQGLFD TXH OD HQWUDGD HVWi DELHUWD

Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR  (QYROYHQWH GH ULHO ',1 GH  PP  FLUFXLWRV GH HQWUDGD FRPSXHUWD SDUR GH HPHUJHQFLD R WDSHWH GH VHJXULGDG  LQGLFDGRUHV /(' GH GLDJQyVWLFR 7HUPLQDOHV H[WUDtEOHV



Qpwipxytpipprtifixiwfp
Rpwphhtyipih 8yfif
7pyfiftyippyitpyp G6G6 G6G6G4fppipprtifi

Qpwipprtifi

FtyfFRQI

Gxpiphfwr !!QA $%


S12 S22 S32

7txpytypxxwrfifitfrfxfipgwp
&& %& $"#% 8yfif FRQI !" !" 8yfif
S42 S52 S62

7tfrfxfiphfgwpfith
4 4 4 4

Sfppipprtifi

7hfyfwp

!U66

wp g f y h t y y f t h f ty p p i x p S

S12 S22

FRQ I

p 6pfi i f i f i t p r p S32 x S12 6

FRQ I

S22 S32

p 6pfi i i f f i t p r p x A1 S11 6

9tgwp
S12 S22 S32 S41 S51 Y31 Y40 Y41 Y42 13 23 31

FRQI
K1 K2

wp g f y h t y y th f f p y t p i x p S

L1 L2 L3

K1 K2

S42 S52 S62

S42 S52 S62

A2 S42 S52 S62 S21 S31 Y30 Y32 Y33 S34 Y1 Y2 14 24 32

Ifip pxprpyhtf
4 4 4

Ifip pxprpyhtf Stpf Rfwtif fhtf

Qpfgwphtxtpy

Sfppipprtifi

Tyhfyfw

8yfif hpfif

FRQIpfyitpyiyFRQI
4 4 4

Sphfyfwp
i f f ti p r p x 6p i y t y f p

Tyhfyfw

!U66

6pfi

4 4 4

f p p i x 6

y th p i f p ty wg f x h p S

S12 S22 S32

f f i 6pfi ti p r p x 6p i

6tyfipw ipprtifi RfwRfw

FRQ I

S12 S22 S32

FRQ I

A1 S12

S32

S31 Y31 Y40 Y41 Y42 13 23 31

FRQI
A2 S42 S62 S11 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32

p wg f y h t y y th f f p y t p i x p S

L1 L2 L3

K1 K2

i f ti r p

6pfi S42 S52 S62 Ifippxprpyhtf 7pphRtsf

S42 S52 S62

Ifippxprpyhtf

K1 K2

Qpfgwphtxtpy Rfwtif 8yfifhpfif fhtf

7hfyfwp

Stpf

FRQIpfyitpyiyFRQI



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQI 8phtqthfhtyp
Gxf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf 8yfifipprtifi Rtxwfyptifiippyfif Qptpyhtfippyfifx ByithfipE87 B868G#!BRHSQ BRH %!&8G&"!5& 4R!! Ffhf686SthvhTESTU !U66ipipwfgfp V G6G6htyfipwip prtifi Byqtyt  sx Upip0pyfifhpfif Qu0pyfiffgtpf Upip0pyfifhpfif Qu0pyfiffgtpf "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o!xx!o4V@ !o"Gx "!o!! wgtwr IwtfxtifI4## Qtpw7BGip "xx &"rwg ""A "xx r#xhsp

7phthty
(O 0653 HV XQ PyGXOR GH H[SDQVLyQ GH HQWUDGD GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 6H SXHGH FRQHFWDU DO 0653 R DO 0653 SDUD SURSRUFLRQDU HQWUDGDV DGLFLRQDOHV 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH HQWUDGD D XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH (O FDEOH SODQR GH FRQH[LyQ SURSRUFLRQD DOLPHQWDFLyQ DO 0653 DVt FRPR YHULILFDFLyQ GH VX HVWDGR /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ HO PyGXOR GH VDOLGD ILQDO /RV PyGXORV GH HQWUDGD D OD EDVH SXHGHQ VHU HO 0653 R HO 0653 HQ FXDOTXLHU FRPELQDFLyQ X RUGHQ (O 0653 WLHQH GRV HQWUDGDV LQGHSHQGLHQWHV ODV FXDOHV SXHGHQ FDEOHDUVH PHGLDQWH XQD GH WUHV PDQHUDV  1&  1& R XQD FRUWLQD GH OX] GH VHJXULGDG &XDQGR VH FRQHFWD HQ OD FRQILJXUDFLyQ GH  1& HO 0653 QR UHDOL]D PRQLWRUHR GH IDOORV FUX]DGRV HV GHFLU YHULILFDFLyQ GH FRUWRFLUFXLWR HQWUH ODV  HQWUDGDV  &XDWUR LQGLFDGRUHV /(' SURSRUFLRQDQ LQIRUPDFLyQ GH HVWDGR VREUH ODV HQWUDGDV (O FRORU YHUGH LQGLFD TXH OD HQWUDGD HVWi FHUUDGD \ HO FRORU URMR LQGLFD TXH OD HQWUDGD HVWi DELHUWD

Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utgfhty 6sp

6ffhpthf

(QYROYHQWH GH ULHO ',1 GH  PP  FLUFXLWRV GH HQWUDGD FRPSXHUWD SDUR GH HPHUJHQFLD R FRUWLQD GH OX] GH VHJXULGDG  LQGLFDGRUHV /(' GH GLDJQyVWLFR 7HUPLQDOHV H[WUDtEOHV



Qpwipxytpipprtifixiwfp
Rpwphhtyipih 8yfif
7pyfiftyippyitpyp G6G6htyfipwipprtifi

Qpwipprtifi

FtyfFRQI

Gxpiphfwr !!QA $&


S12 S20 S32

7txpytypxxwrfifitfrfxfipgwp
&& %& $"#% 8yfif

FRQI
!" !" 8yfif
S42 S50 S62

7tfrfxfiphfgwpfith
p i i f f i t6pfi p r p x 6 S12 S22 S32 FRQI y y th p t i p y f f ty wg xf h p S42 S50 S62 p S RfwRfw 6tyfipw ipprtifi

!U66

6tyfipw ipprtifi RfwRfw

6tyfipw ipprtifi RfwRfw


L1 L2 L3

FRQI
i f i f ti p r p x 6

S12 S20 S32

A1 S12

FRQI

S32

Y31 Y40 Y41 Y42 13 23 31


K1 K2

6pfi p S42 S50 S62

A2 S42 S62 S11 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32

Ifippxprpyhtf Stpf

K1 K2

Qpfgwphtxtpy Rfwtif 8yfifhpfif fhtf

Sfppipprtififippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif
i f f i t p 6pfi 6tyfipw r ipprtifi p x RfwRfw 6p i S12 S22 S32 S12 S20 S32 y y p t t i FRQI FRQI h p f y f ty wg f x h p S42 S50 S62 6pfi S42 S50 S62 p f i S f i RfwRfw p t 6tyfipw r ipprtifi p x 6p i
!U66

p i 6pfi i f f p ti r p A1 x 6

9tgwp

S41 S12 S22 S32 S51

Y31 Y40 Y41 Y42 13 23 31

FRQI
K1 K2

wp g f hy t y y f t h f ty p p i x p S

L1 L2 L3

K1 K2

A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32

Ifippxprpyhtf Stpf Rfwtif fhtf

Qpfgwphtxtpy 8yfif hpfif

6tyfipwipprtififippxprpyhtfhxpfipprtifiipi hfyfwppfgwphtxtpyxfyfwxytpfifwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQ I 8phtqthfhtyp
Gxf 6ptqthfhtyp 6fprf 9pypipfwtxpyfhtypwhthf 6yxippyhtf 9tgwp Rfwtifppyf Rfwtif Ttwtfhtyipfwtifpry B86#&!$!pttf 8G&"!BRH %!&B868G #!B86#&!$!B86 #&!$"4GRB5&4R!! 6Sthvxfhf68hTESU 6f!pry8G&"! BRH %!& !U66ipipwfgfp "V #4fhhtywpyf4fhhty tif !G46thtip 46'#4"U64 76'#4!U66 5 46" 4"U64 4"U64 I 76 "4!U66 #4!4 x4f U66 x4U66 4rRyHP 4 Gffiptpxipppf fithtyfwfwxiwgfp Upip0fwtif6Afhtf Upip0fwtif6Afhtf "U  o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o!xx!o4V@ !o"Gx "!o!! wgtwr IwtfxtifI4## Qtpw7BGip "xx "r!$wg pfhtyp "pfhtyp pfhtyp pfhtyp hthw ""A "xx r#xhsp

7phthty
(O 0653 HV XQ PyGXOR GH H[SDQVLyQ GH VDOLGD GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 6H SXHGH FRQHFWDU D OD EDVH 0653 R 0653 SDUD SURSRUFLRQDU VDOLGDV DGLFLRQDOHV 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH VDOLGD 0653 D XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH (O FDEOH SODQR GH FRQH[LyQ SURSRUFLRQD DOLPHQWDFLyQ DO 0653 DVt FRPR YHULILFDFLyQ GH VX HVWDGR /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ HO PyGXOR GH VDOLGD ILQDO (O 0653 WLHQH FXDWUR VDOLGDV GH VHJXULGDG TXH IXQFLRQDQ HQ SDUDOHOR FRQ ODV VDOLGDV GH VHJXULGDG GH OD EDVH &XDQGR OD VDOLGD GH OD EDVH VH DFWLYD ODV VDOLGDV GHO 0653 WDPELpQ VH DFWLYDQ /DV VDOLGDV VRQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH D\XGDQ D JDUDQWL]DU OD IXQFLyQ GH VHJXULGDG

TtwtfhtyipfwtifpryB86
#&!$"tyihtf 6tpypxthfyxtyfwty hyxfhty Rfwtifpfiwti Fyhtpypwfup hyxfi Ffptfwipwhyfh Stpxipppf ByithfipE87 Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4hM0 " U64$4 $"U4hM0# U664#V U664V Utiftwxphythf Utgfhty 6sp

6ffhpthf

 VDOLGDV GH VHJXULGDG 1$  LQGLFDGRUHV /(' GH GLDJQyVWLFR 7HUPLQDOHV H[WUDtEOHV

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
Rfwtifipprtifi
!G4

Qpwipprtifi

FtyfFRQ I

Gxpiphfwr !!QA %

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
13 23 33 43
13 23 33 43

!" !"

FRQ I

6y 6y
14 24 34 44

14

24

34

44

7tfrfxfiphfgwpfith
!U66

p i i6pfi 9tgwp f f i t p r p x A1 S41 S12 S22 S32 S51 Y31 Y40 Y41 Y42 13 23 31 6 y p y t FRQI t h i f p y y t wf g f x h p p A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32 S
Ifippxprpyhtf Stpf Rfwtif fhtf
K1 K2

FRQ I

13 23 33 43

FRQ I

13 23 33 43

y t h f y t x p S
K1 K2

L1 L2 L3

14 24 34 44
K3 K4 K5 K6

14 24 34 44
K7 K8 K3 K10

Qpfgwphtxtpy 8yfif hpfif Qpwwpytipip hyfhpwwfph

Ifippxprpyhtfhxpfipprtifiipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif
!U66

p i p wg f y h t y y f t h f ty p x p S

6tyfipwip prtifi RfwRfw


A1 S12 S32

9tgwp
Y31 Y40 Y41 Y42 13 23 31

FRQI
A2 S42 S62 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

FRQ I

13 23 33 43

FRQ I

13 23 33 43

y t h f y t x p S

L1 L2 L3

K1 K2

14 24 34 44
K3 K4 K5 K6

14 24 34 44
K7 K8 K3 K10

Ifippxprpyhtf Stpf Rfwtif fhtf

Qpfgwphtxtpy 8yfif hpfif

Qpwwpytipip hyfhpwwfph

6tyfipwipprtififippxprpyhtfipihfyfwp pfgwphtxtpyxfyfwxytpfifwtifxytpfif



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQ % 8phtqthfhtyp
Gxf 6ptqthfhtyp 6fprf 9pypipfwtxpyfhtypwhthf 6yxippyhtf 9tgwp Rfwtif8phxpyifif Rfwtif 8G&"!BRH %!&B868G #!B86#&!$!B86 #&!$"4GRB5&4R!! 6Sthvxfhf68hTESTU 6f pry8G&"! BRH %!& !U66ipipwfgfp "V #4fhhtywpyf4fhhty tif G46thtip G64twtf 46'#4"U64 76'#4!U66 5 46" 4"U64 4"U64 I 76 "4!U66 #4!4 x4U66 4rRyHhyphgtxtpyip ipxthyp Upip0fwtif6Afhtf Upip0fwtif6Afhtf "U  o"6f""6 9f!9 &" ipsxpifipwftf BI!G8F4 BI o"xx!4V@ !o"Gx "!o!! wgwr IwtfxtifI4## Qtpw7BGip "xx "!$wg pfhtyp "pfhtyp pfhtyp pfhtyp hthw ""A "xx r#xhsp

7phthty
(O 065 HV XQ PyGXOR GH H[SDQVLyQ GH VDOLGD FRQ UHWDUGR GH WLHPSR GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 3XHGH FRQHFWDUVH D OD EDVH 065 R 065 R DO PyGXOR GH VDOLGD 065 SDUD SURSRUFLRQDU VDOLGDV FRQ UHWDUGR GH WLHPSR 6H SXHGHQ FRQHFWDU KDVWD  PyGXORV GH VDOLGD XQD EDVH VLPSOHPHQWH GHVPRQWDQGR OD WHUPLQDFLyQ LQFOXLGD FRQ FDGD EDVH \ FRQHFWDQGR ORV FDEOHV SODQRV GHO PyGXOR DG\DFHQWH (O FDEOH SODQR GH FRQH[LyQ SURSRUFLRQD DOLPHQWDFLyQ DO 065 DVt FRPR YHULILFDFLyQ GH VX HVWDGR /DV WHUPLQDFLRQHV GHEHQ LQVHUWDUVH HQ HO PyGXOR GH VDOLGD ILQDO (O 065 WLHQH GRV VDOLGDV GH VHJXULGDG TXH IXQFLRQDQ HQ SDUDOHOR FRQ ODV VDOLGDV GH VHJXULGDG GH OD EDVH &XDQGR OD VDOLGD GH OD EDVH VH DFWLYD ODV VDOLGDV GHO 065 FRQ UHWDUGR GH WLHPSR VHOHFFLRQDGR SRU HO XVXDULR H[SLUDQ (O UHWDUGR GH WLHPSR VH HVWDEOHFH FRQHFWDQGR SXHQWHV D ORV WHUPLQDOHV GH FDEOHDGR /DV VDOLGDV VRQ  VDOLGDV QRUPDOPHQWH DELHUWDV FRQ FODVLILFDFLyQ GH VHJXULGDG /DV VDOLGDV GH VHJXULGDG FXHQWDQ FRQ FRQWDFWRV LQWHUQRV LQGHSHQGLHQWHV \ UHGXQGDQWHV TXH DVHJXUDQ OD IXQFLyQ GH VHJXULGDG /D VDOLGD QRUPDOPHQWH FHUUDGD FRQ UHWDUGR HV XQD VHxDO DX[LOLDU TXH GHEH XVDUVH VyOR SDUD LQGLFDU HO HVWDGR GHO 065

TtwtfhtyipfwtifpryB86 #&!$!pttf #&!$"tyihtf

TtwtfhtyipfwtifpryB86
6tpypxthfyxtyfwty hyxfhty Fyhtpypwfup hyxfi Ffptfwipwhyfh ByithfipE87 Uwfupipptpyhtfiptxw @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw Sfxfxiphyih 4upipfytwwpx Ffptfwipwpywpyp Fyfup Ip Utiftwpwhthf U64!4%%U4hM0 " U64$4 $"U4hM0# U664#V U664V Utiftwxphythf Utgfhty 6sp

6ffhpthf

&DWHJRUtD  VHJ~Q (1  &DWHJRUtD GH SDUR   LQGLFDGRUHV /(' GH GLDJQyVWLFR 7HUPLQDOHV H[WUDtEOHV  VDOLGDV GH VHJXULGDG FRQ UHWDUGR 1$  VDOLGD DX[ FRQ UHWDUGR 1&

Upf6ffhtifipyxtyfwpipfwtifpywfrtyf&ffgpypipfwwp
6ywphywfqgthfffgpyptyqxfhtygpwfhffhtifip yxtyfwpyxfif



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
Rfwtifipprtifihypfi
G4

Qpwipprtifi

FtyfFRQ %

Rfwtifftwtfphypfi
G6

Gxpiphfwr !!QA &#

7txpytypxxwrfifitfrfxfipgwp
&& %& "%%
17 Y3 Y5 27 Y6 35 Y4 17 27 35

!" !"

FRQ %

6y 6y

Y3 18

Y7

Y8 28

18 28 36 Y4 36

7tfrfxfiphfgwpfith
!U66

p 6pfi i i f f i t p r p x 6 A1 S41 S12 S22 S32 S51

9tgwp

Rpxpfpfi ip#pr
Y3 Y4 Y5 Y6 17 23 35

y p t i h f p ty wg xf h p S

Y31 Y40 Y41 Y42 13 23 31

y t y f p

y th f y t x p S

L1 L2 L3

FRQ
A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32 Y3

FRQ %
Y4 Y7 Y8 18 28 36 K9

K1 K2

Ifippxprpyhtf Stpf Rfwtif fhtf

K1 K2

K7 K8

Qpfgwphtxtpy 8yfif hpfif

Qpwwpytipip hyfhpwwfph

7pfwwpipfwthfhtyth
&RORTXH SXHQWHV YtQFXORV HQ ORV WHUPLQDOHV LGHQWLILFDGRV SDUD ORJUDU HO UHWDUGR D OD GHVDFWLYDFLyQ GHVHDGR

Qpfi
 "  "  ! " # $

Ipyp
Gtyry X X" X!X# X X# X!X" X X" X X# Gtyry X X" X!X#

Ipyp
Gtyry Gtyry

Qpfi
% &  " %

Ipyp
X X# X!X" Gtyryf X!X# X X# X!X" Gtyry X X" X!X# X X#

Ipyp
X X$ X X$ X!X% X!X% X!X% X!X% X X% X X% X X% X X%

Qpfi
# %   #  " 

Ipyp
X!X" Gtyry X X" X!X# X X# X!X" X X"X!X# X X#X!X"

Ipyp
X X% X!X$ X!X$ X!X$ X!X$ X!X$ X!X$ X!X$

X!X# X!X" X X$ X X$ X X$

 #  ! "



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQ!I 8phtqthfhtyp
Gxf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf Ihw Upwhtifipipfyxtty @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Ffptfwipwpywpyp Fyfup Ip Utgfhty 6sp B868G#!BRHSQ Ffhf68ffifwfitphtf fwthfgwp !U66ipipwfgfp V QR QR!%" !!%&#&  o"q6f""q6 q9f q9 & ipsxpifipwftf BI!G8F4 BI o!xx!o4V@ !o"Gx "!o!! wgxwr IwtfxtifI4## Qtpw7BGip "xx &rwg ""A "xx r#xhsp

7phthty
(O 0653 HV XQ PyGXOR GH FRPXQLFDFLyQ GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV 3XHGH FRQHFWDUVH D OD XQLGDG EDVH 0653 R 0653 SDUD SURSRUFLRQDU LQIRUPDFLyQ GH GLDJQyVWLFR \ HVWDGR D GLVSRVLWLYRV UHPRWRV WDOHV FRPR OD SDQWDOOD 0653 (O 0653 VH FRQHFWD HQ OXJDU GHO FRQHFWRU GH WHUPLQDFLyQ DO FRQHFWRU GH EXV OLEUH GHO PyGXOR %DVLF R GHO ~OWLPR PyGXOR GH H[SDQVLyQ FRQHFWDGR GHSHQGLHQGR GH OD FRQILJXUDFLyQ GHO VLVWHPD /D WUDQVIHUHQFLD GH GDWRV \ OD IXHQWH GH DOLPHQWDFLyQ HOpFWULFD VH HQFDPLQDQ D WUDYpV GHO PLVPR FDEOH GH EXV \ FRQHFWRUHV 8Q LQGLFDGRU /(' YHUGH XELFDGR HQ OD SDUWH IURQWDO GHO 0653 LQGLFD OD SUHVHQFLD GH YROWDMH GH VXPLQLVWUR 8Q LQGLFDGRU /(' DPDULOOR SDUSDGHDQWH VHxDOD OD DFWLYLGDG GH LQWHUFDPELR GH GDWRV D WUDYpV GH OD LQWHUIDFH 5656 /D YHORFLGDG GH WUDQVPLVLyQ GHO 56 SXHGH HVWDEOHFHUVH FRQ D\XGD GH GRV VHJPHQWRV GH PLFURLQWHUUXSWRUHV D    y  EDXGLRV /D GLUHFFLyQ GH HVWDFLyQ SXHGH HVWDEOHFHUVH PHGLDQWH  VHJPHQWRV GH PLFURLQWHUUXSWRUHV DGLFLRQDOHV 3XHGHQ FRQHFWDUVH KDVWD  HVWDFLRQHV D XQD VROD UHG 56 (O VLVWHPD GH PRQLWRUHR VXSHUYLVRU R DGTXLVLFLyQ GH GDWRV SXHGH SURFHVDU \ DOPDFHQDU GDWRV PRVWUDUORV \ UHJLVWUDU OD UD]yQ GH XQD GHVDFWLYDFLyQ DGHPiV GHO WLHPSR \ IHFKD GH FDGD RFXUUHQFLD (VWR IDFLOLWD PXFKR HO GLDJQyVWLFR

6ffhpthf

7UDQVPLVLyQ GH GDWRV 56 R 56 ,QWHUIDFHV FRQ DLVODPLHQWR JDOYiQLFR (QYROYHQWH GH ULHO ',1 GH  PP  LQGLFDGRUHV /(' GH GLDJQyVWLFR 7HUPLQDOHV H[WUDtEOHV



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
Stiptypqfhp
QR  QR!%" QR QR!%"

Qpwipprtifi

FtyfFRQ!I

Gxpiphfwr !!QA % !!QA % !!QA %

7txpytypxxwrfifitfrfxfipgwp
T
&& %& $"#%
A B @yi TxD @yi

QR!%" QR 

!" !"

FRQ!I

7tfrfxfiphfgwpfith
pfgwphtxtpyxfyfw fwtiffhtfxytp fht87Ffht
FRQ!"

_ < + _

+
!U66

!U66

i 6pfi f f p ti r p x 6p A1 S41 S12 S22 S32 S51 i

9tgwp
L1 L2 L3

FRQI
A2 S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

14 24 34 44
K3 K4 K5 K6

Ifippxprpyhtf Stpf Rfwtif fhtf 8yfif hpfif

Qpfgwphtxtpy

y t p i h p f y t wg f x h p S

Y31 Y40 Y41 Y42 13 23 31

y t y f p

FRQ I

13 23 33 43

B TxD

@yi @yi

FRQ!I

T
K1 K2



Qpwipprtifi

Qpwipxytpipprtifixiwfp
FtyfFRQ!"I 8phtqthfhtyp
Gxf 6ptqthfhtyp 9pypipfwtxpyfhtypwhthf 6yxippyhtf Bypqfhp @fiiphyfxtyfhty Spxpffippfhty Axpifi Iphhtyipwpywpyp Iphhtyipwpxtyfw 6fwtgpiphyih 4upipfytww pxtyfwp Fyfup Ip Utgfhty 6sp B868G#!BRHSQ Ffhf68ffifwfitphtf fwthfgwp !U66 "V QR   o"6f""6 9f 9 & ipsxpifipwftf BI!G8F4 BI o"xx!o!4V@ !o"Gx "!o!! wgxwr 6pipfypwtpw7BGip "xxhtyfw "r""wg ""A "xx r#xhsp

7phthty
(O 0653 HV XQ PyGXOR GH SDQWDOOD GH OD IDPLOLD 0LQRWDXU 065 GH UHOpV GH PRQLWRUHR GH VHJXULGDG PRGXODUHV (O PyGXOR GH SDQWDOOD 0653 VH LQWHUFRQHFWD D XQ VLVWHPD 065 D WUDYpV GH XQ PyGXOR GH FRPXQLFDFLyQ 0653 XVDQGR OD LQWHUIDFH 56 FRQ XQ FDEOH EOLQGDGR GH GRV Q~FOHRV /D SDQWDOOD VH DFWXDOL]D DSUR[LPDGDPHQWH FDGD VHLV VHJXQGRV 0HGLDQWH OD SDQWDOOD /&' GH FXDWUR OtQHDV \ ORV LQWHUUXSWRUHV GH OODYH GH WUHV IXQFLRQHV VH SXHGH YHULILFDU \ FRQVXOWDU OD FRQILJXUDFLyQ GH FLUFXLWRV H[WHUQRV \ HO HVWDGR DFWLYDGRGHVDFWLYDGR GHO VLVWHPD (O PLFURSURFHVDGRU HQ HO PyGXOR EDVH HVFDQHD WRGDV ODV HQWUDGDV FRPHQ]DQGR SRU HO PyGXOR EDVH \ DYDQ]DQGR KDFLD OD L]TXLHUGD /D SULPHUD HQWUDGD HVFDQHDGD HV OD HQWUDGD  GHO PyGXOR EDVH /D ~OWLPD HQWUDGD HVFDQHDGD VHUtD OD HQWUDGD  GHO PyGXOR PiV DOHMDGR GHO PyGXOR EDVH /D SDQWDOOD PXHVWUD OD HQWUDGD HVFDQHDGD PiV EDMD TXH GHVDFWLYy ODV VDOLGDV GH VHJXULGDG VDOLGDV GH VHJXULGDG DELHUWDV  'HVSXpV TXH VH UHVWDEOH]FD OD HQWUDGD HVFDQHDGD PiV EDMD OD SDQWDOOD VH DFWXDOL]DUi \ PRVWUDUi OD VLJXLHQWH HQWUDGD DELHUWD 'H HVWD PDQHUD VH UHVXHOYHQ ORV SUREOHPDV \ VH FLHUUD FDGD FLUFXLWR GH HQWUDGD DELHUWR &XDQGR WRGDV ODV HQWUDGDV HVWiQ FHUUDGDV HO XVXDULR SXHGH GHVSOD]DUVH D WUDYpV GH OD SDQWDOOD (O 0653 UHTXLHUH YROWDMH GH VXPLQLVWUR GH  9&& /D HQWUDGD GH OD IXHQWH GH DOLPHQWDFLyQ HOpFWULFD DVt FRPR OD LQWHUIDFH 56 WLHQHQ DLVODPLHQWR JDOYiQLFR GHO VLVWHPD 065 SHUR SXHGHQ FRQHFWDUVH VLQ DLVODPLHQWR VL HV QHFHVDULR

8upxwipxpyfup
1HJULWD WH[WR HVWiQGDU 1R QHJULWD WH[WR TXH GHSHQGH GH IXQFLyQ 0HQ~ GHO VLVWHPD 0DQXDODXWR UHVHW 2XWSXW DFWLYHGHDFWLYDWHG 0RQLWRULQJ DFWLYHGHYLFH UHDG\ ('0 DFWLYHGHDFWLYDWHG FLUFXLWR GH UHWURDOLPHQWDFLyQ &RQILJXUDFLyQ GH HQWUDGD ,QSXW 0RGXOH  065 HPHUJHQF\ RII ,QSXW  FKDQQHO ,QSXW  FKDQQHO )XQFLRQHV0HQVDMHV GH LQWHUUXSFLyQ ,QSXW 0RGXOH  ,QSXW  FDXVHV LQWHUUXSW VDIHW\ PDWV RU FURVVIDXOW FDXVHV LQWHUUXSW WUDQVPLVVLRQ IDXOW IDXOW ('0 ORRS IDXOW < ORRS PDOIXQFWLRQ 2XWSXW DFWLYHLQDFWLYH

6ffhpthf

/ODPD \ PXHVWUD LQIRUPDFLyQ GHO VLVWHPD 6HOHFFLyQ GH PHQ~V VLPSOHV $OPDFHQD GHWDOOHV GH OD ~OWLPD RFXUUHQFLD GH SDUR UHJLVWUDGD 3DQWDOOD FRQ OX] GH UHWURLOXPLQDFLyQ FODUDPHQWH OHJLEOH 3DQWDOOD DOIDQXPpULFD GH  OtQHDV FRQ OX] GH UHWURLOXPLQDFLyQ ,QWHUIDFH 56



Qpwipxytpipprtifixiwfp
Rpwphhtyipih
7phthty
Fiwipfyfwwf Cpripfiffiipgfpfftpw7BG

Qpwipprtifi

FtyfFRQ!"I

Gxpiphfwr !!QA %! !!QA %"

7txpytypxxwrfif
pfgwphtxtpy xfyfwfwtiffhtf xytpfht 87Ffht

FRQ!"I

_ <
+ _

$ % 

# # #% #$ "$ !

!!"##

6pqyfw'#% % 5fpipxyfupfftpw7BGhtyfw8G" "$"

7tfrfxfiphfgwpfith
FRQ!"I
pfgwphtxtpy xfyfwfwtiffhtf xytpfht 87Ffht

_ < + _

+
!U66

!U66

FRQI
S11 S42 S52 S62 S21 Y30 Y32 Y33 S34 Y1 Y2 14 24 32
K1 K2

14 24 34 44
K3 K4 K5 K6

Ifippxprpyhtf Stpf Rfwtif fhtf 8yfif hpfif

Qpfgwphtxtpy

p i i6pfi f f ti p r p x 6 A1 y y th p t i f p y f ty wg xf h p A2 p S

9tgwp
L1 L2 L3

S41 S12 S22 S32 S51

Y31 Y40 Y41 Y42 13 23 31

FRQ I

13 23 33 43

B TxD

@yi @yi

FRQ!I

T
K1 K2



Qpwipprtifi

Gf



Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-2 Interruptores rotativos . . . . . . . . . . . . . . . . . . . . . . . . . 5-8 Unidades de desbloqueo de solenoide . . . . . . . . . . . . 5-12 Unidades de retardo temporizado electrnico. . . . . 5-14 Unidades de interrupcin de movimiento . . . . . . . . . 5-16 Unidades de intercambio . . . . . . . . . . . . . . . . . . . . . . 5-18 Dispositivos de enclavamiento de perno . . . . . . . . . . 5-20 Dispositivos de enclavamiento de acceso/cadena . . . 5-22 Bloqueo instantneo mecnico . . . . . . . . . . . . . . . . 5-24 Bloqueo instantneo elctrico . . . . . . . . . . . . . . . . . 5-26 Bloqueo de vlvula, carrete de 3 puertos . . . . . . . . . 5-30 Dispositivos de enclavamiento de vlvula en miniatura . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-31 Adaptadores de interruptores . . . . . . . . . . . . . . . . . . 5-32 Accesorios . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-33

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general

Llaves de corte de precisin CNC Soluciones de enclavamiento y control


Por qu usar el sistema de enclavamiento con atrapamiento de llave? En base a la premisa de que una llave no se puede encontrar en dos lugares simultneamente, se pueden configurar los sistemas de enclavamiento con llave para asegurar que se realiza una secuencia predeterminada de eventos o que se ha reducido la posibilidad de peligros antes de que los operadores queden expuestos. Es un sistema mecnico y, por lo tanto, ampliamente usado en aplicaciones, incluso aquellas donde la ubicacin de la planta, el ambiente o las atmsferas explosivas hacen que el uso de los sistemas de enclavamiento elctrico sea inadecuado o de costosa instalacin. Adems, se puede proporcionar codificacin nica, la cual ofrece un mayor grado de seguridad y resistencia a manipulacin indebida. Por qu usar Prosafe? Para aprovechar al mximo las ventajas del sistema de enclavamiento con atrapamiento de llave, los componentes deben ser completamente prcticos, de mantenimiento fcil y disponibles inmediatamente. La llave y cuerpo codificado exclusivos de Prosafe proporcionan la capacidad de efectuar rpidamente pedidos de sistemas complicados de enclavamiento y piezas de repuesto a travs de nuestra red mundial de distribuidores. Es la primera vez que esto est disponible en los sistemas de enclavamiento con atrapamiento de llave.

Probado hasta 100,000 operaciones


4. Llaves de color/texto personalizado y etiquetas de identificacin, cargo adicional nominal. 5. Una gama completa de aisladores, dispositivos de enclavamiento de intercambio de llave, vlvula miniatura y de compuerta, todos con el mismo principio de uso de llave. Marca CEPruebas y aprobaciones Solamente los productos Prosafe llevan la prestigiosa marca GB. Un signo de seguridad de productos probados independientemente por el German Berufsgenossen-schaftliches Institut fr Arbeitssicherneit, BIA. Las pruebas adicionales para los dispositivos de enclavamiento de vlvula incluyen el Certificado de Lloyds para prueba contra incendio y resistencia a nebulizaciones de sal. Los interruptores y los detectores tienen las aprobaciones necesarias de 'BASEEFA' y los interruptores aisladores tienen aprobacin de UL, CSA y TV. Ms de 100,000 operaciones Los productos Prosafe se han sometido a pruebas independientes minuciosas. Con una pequea cantidad de lubricante que se aadi con poca frecuencia, las llaves fueron insertadas, giradas y retiradas a un rgimen de 12 veces por minuto. Despus de 100,000 operaciones (a 10 operaciones por da, lo cual es igual a 27 aos), la unidad funcion adecuadamente y pas solamente la llave original o su nuevo equivalente, lo cual es un factor importante. Fue imposible que las llaves incorrectas operaran el enclavamiento, lo cual resalt la integridad de as como la larga vida til de la unidad.

5 ventajas exclusivas de Prosafe


Compare las ventajas siguientes con las de otros fabricantes de sistemas de enclavamiento con atrapamiento de llave 1. Todas las piezas de enclavamiento y codificacin son de acero inoxidable, incluso el cuerpo con cdigo y los componentes internos sin costo adicional. 2. Tapa contra intemperie estndar, tapas antipolvo y sellos sin costo adicional. 3. Llave con codificacin de color rojo estndar y etiquetas de identificacin, sin cargo adicional.

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-2

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general
La ventaja
Operacin de llave a 90

Llave atrapada Llave libre

Llave contra intemperie, suministrada de manera estndar con etiqueta de codificacin de colores. Cuerpos con cdigo: Ensamblados en la fbrica para garantizar integridad de la seguridad. Los componentes internos son capturados dentro del barril con cdigo.

Operacin de presionar-halar resistente y confiable sin resortes ni levas que puedan fallar.
Tornillos a prueba de manipulacin indebida

Construccin de acero inoxidable

Llaves Prosafe Las llaves compactas, slidas y robustas cuentan con sellos antipolvo y etiquetas de codificacin. Hay otros colores/texto disponibles opcionalmente.

5-3

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general
Cmo disear un sistema de enclavamiento
La planta y los sistemas de enclavamiento de maquinaria
Peligros principales (Aislamiento de la alimentacin elctrica)

Peligros auxiliares

Elemento de control de llave

rea de acceso protegida Bloqueo de perno para guardas deslizantes

Funciones auxiliares

A B

B A C C

Interruptor de llave giratorio

Unidad con retardo

A
Vlvula en carrete de 3 puertos

Unidad de desbloqueo con llave solenoide acoplada a detectores de temperatura o presin Se requiere cuando ms de un elemento de peligro necesita aislamiento, o ms de un enclavamiento de punto de exposicin/acceso.

Interruptor de llave giratorio

Bloqueo de acceso para guardas deslizantes, de bisagra y abatibles de uso general


C
Enclavamiento de cadena para guardas deslizantes, de bisagra y abatibles grandes o incorrectamente alineadas

D
Vlvula en carrete de 3 puertos

Dispositivo de desactivacin con bloqueo de perno para descarga capacitiva y conexin a tierra

Considere desconectar toda la alimentacin que proporciona energa cintica al sistema, por ej., motores elctricos, aire presurizado, etc. Comentarios Considere factores tales como paros y tambin factores ambientales como atmsferas peligrosas (explosivas). Use aislador EEX y unidades con retardo de tiempo cuando sea necesario.

Considere si el peligro se elimina inmediatamente, por ej., a) Marcha de mquina debido al impulso. b) Presurizacin de sistemas hidrulicos o pneumticos. c) Energa almacenada tal como electricidad esttica o capacitancia. d) Temperatura, ya sea caliente o fra, que crea un peligro.

Comentarios Considere enclavar Para obtener acceso a la zona de secuencialmente todas las fuentes primarias de peligro peligro. con el fin de que todas sean C eliminadas. A su vez, liberar D una sola llave para entrada en el elemento de control de llave. En esta etapa se pueden Comentarios Considere el uso de versiones de 2 llaves incorporar funciones para proporcionar adicionales de monitoreo, a) Intercambio de llave para evitar el aislamiento o control, tales bloqueo del operador (aplicaciones como bloqueos de solenoide que requieren acceso de todo el o interruptores, a fin de cuerpo solamente). eliminar otros elementos. b) Dispositivos de bloqueo que requieren la introduccin de 2 llaves de diferentes fuentes para habilitar el acceso controlado.

Requerido cuando se necesitan funciones adicionales tales como programacin/ restablecimiento de la mquina. Comentarios Versiones de dos llaves requeridas en los puntos de acceso para facilitar esta funcin.

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-4

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general
Principios ilustrados del sistema de enclavamiento con atrapamiento de

A ETU Aislador con retardo temporizado de liberacin de llave

ABB KEX Llave atrapada A Bloqueo de ETU, Liberar bloqueo de puerta de acceso, llave B.

B SBL Llave B insertada para retraer el perno de la puerta de guarda.

Secuencia de operacin 1. El aislador ETU tiene dos llaves. Una es la llave no extrable. La otra llave (una llave con codificacin A) puede extraerse despus de un lapso temporizado establecido por un potencimetro dentro del aislador ETU. Gire la llave no extrable para desactivar el movimiento de la mquina peligrosa e iniciar el temporizador. Cuando caduque el tiempo se encender el indicador LED de llave libre. Extraiga la llave A. 2. Inserte la llave A en la unidad de intercambio de llaves (KEX) y grela 90. 3. Gire una de las llaves B 90 y qutela de la unidad KEX. Esto atrapa la llave A en la unidad KEX y evita que vuelva a arrancar la mquina. 4. Inserte la llave B en el dispositivo de bloqueo de perno de una sola llave (SBL) y grela 90 para obtener acceso de cuerpo parcial a la mquina. 5. Gire la segunda llave B 90 y qutela de la unidad KEX. La extraccin de esta llave tambin atrapa la llave A en la unidad KEX y evita que vuelva a arrancar la mquina. 6. Inserte la llave B en la unidad de bloqueo de acceso de dos llaves (DAL) y grela 90. 7. Gire la llave C 90 y extraiga la llave C. Gire la manija de acceso para permitir la entrada de todo el cuerpo en la zona de peligro. 8. Lleve la llave C a la zona de peligro, insrtela en el interruptor de llave giratorio (RKS) y grela 90 para enviar una seal al sistema de control de mquina, para permitir que la mquina funcione en un modo lento o de aprendizaje. 9. Realice el proceso de manera inversa para poner la mquina nuevamente en modo de operacin total.

Conocimiento de embarque
Artculo 1 2 3 4 5 6 Cantidad 1 1 1 1 1 1 Descripcin Llave nica con retardo de tiempo con llave primaria B Unidad de intercambio de llaves, llave primaria A, dos llaves secundarias B atrapadas (incluidas) Bloqueo de perno nico, llave primaria B Bloqueo de acceso doble, llave primaria B, llave secundaria C atrapada (incluidas) Interruptor de llave giratorio, cuerpo con cdigo C primario Llave A Nmero de catlogo 440T -MSTUE110A 440T -MKEXE110A0B0B 440T -MSBLE100B 440T -MDALE100B0C 440T -MRKSE100C 440T -AKEYE100A

Nota: Las llaves primarias se deben pedir por separado si no son proporcionadas por una llave atrapada secuencial previa. En el ejemplo anterior, es necesario pedir slo una llave primaria por separado. Las llaves primarias restantes son proporcionadas por una llave secundaria secuencial previa (atrapada).

C BC DAL Insertar llave B y luego sacar llave C para abrir puerta de guarda. C RKS Para activar el modo de aprendizaje de robot

5-5

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general
Seleccin de cdigos
Para pedir productos con atrapamiento de llave Prosafe es necesario incluir los cdigos en el nmero de catlogo. Los cdigos se aaden al final del nmero de catlogo. Cada cdigo debe tener dos caracteres de largo. Los cdigos de una letra deben ser precedidos por 0 (cero). El primer cdigo(s) es el cdigo primario y el ltimo cdigo(s), si es necesario, es el cdigo(s) secundario. Los cdigos primarios no incluyen la llave. La llave debe pedirse por separado o debe venir de una operacin previa. Los cdigos secundarios vienen con una llave, ya que la llave se atrapa en el cuerpo codificado. Utilice la tabla de la pgina 5-7 para seleccionar y realizar el seguimiento de los cdigos. Ejemplo de pedido 1:

440T

DALE 10

Cdigo secundario de dos caracteres (llave incluida)

Cdigo primario de dos caracteres (llave no incluida) Caracterstica del producto Tipo de producto (bloqueo de acceso de dos llaves) M = Enclavamiento de mquina A = Accesorio Nmero de Boletn (T = llave atrapada)

Pida el nmero de catlogo 440TMDALE100A0B pare recibir un bloqueo de acceso de dos llaves con un cdigo primario A y un cdigo secundario B, con una llave B incluida. Ejemplo de pedido #2:

440T

KEXE 16

Cdigo secundario de dos caracteres (llave incluida)

Cdigo secundario de dos caracteres (llave incluida) Cdigo secundario de dos caracteres (llave incluida) Cdigo primario de dos caracteres (llave no incluida) Cdigo primario de dos caracteres (llave no incluida) Caracterstica del producto Tipo de producto (bloqueo de acceso de dos llaves) M = Enclavamiento de mquina A = Accesorio Nmero de Boletn (T = llave atrapada)

Pida el nmero de catlogo 440TMKEXE160A0B0C0C0C para recibir una unidad de intercambio de llave con cdigos primarios A y B y tres cdigos secundarios C. Las llaves A y B no se incluyen. Se incluyen las tres llaves C, que estn atrapadas en los cuerpos codificados secundarios.

La ventaja Prosafe
Construccin de acero inoxidable Llaves de corte de precisin CNC

5-6

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Descripcin general
Codificacin de llaves
A continuacin presentamos una gua de referencia rpida, til para seleccionar y realizar el seguimiento de cdigos. Comience en la columna 0A avanzando hacia abajo para los cdigos inferiores (generalmente 0A hasta ZA) en inventario. La tabla contina hasta ZZ. Tome nota de que slo se usan 25 letras, la Q no se usa. Los cdigos se piden con letras maysculas. Las etiquetas con cdigos de dos letras mostrarn la primera letra en mayscula y la segunda letra en minscula.

0A 0B 0C 0D

Cdigo 0A

Aplicacin Aplicacin Aplicacin Aplicacin Aplicacin Aplicacin Aplicacin y y fecha Cdigo y fecha Cdigo y fecha Cdigo y fecha Cdigo y fecha Cdigo y fecha Cdigo fecha Aa Ba Ca Da Ea Fa Ga Ha Ia Ja Ka La Ma Na Oa Pa Ra Sa Ta Ua Va Wa Xa Ya Za Ab Bb Cb Db Eb Fb Gb Hb Ib Jb Kb Lb Mb Nb Ob Pb Rb Sb Tb Ub Vb Wb Xb Yb Zb Ac Bc Cc Cc Ec Fc Gc Hc Ic Jc Kc Lc Mc Nc Oc Pc Rc Sc Tc Uc Vc Wc Xc Yc Zc Ad Bd Cd Dd Ed Fd Gd Hd Id Jd Kd Ld Md Nd Od Pd Rd Sd Td Ud Vd Wd Xd Yd Zd Ae Be Ce De Ee Fe Ge He Ie Je Ke Le Me Ne Oe Pe Re Se Te Ue Ve We Xe Ye Ze Af Bf Cf Df Ef Ff Gf Hf If Jf Kf Lf Mf Nf Of Pf Rf Sf Tf Uf Vf Wf Xf Yf Zf

Empiece desde arriba hacia abajo

0B 0C 0D 0E 0F 0G 0H 0I 0J 0K 0L 0M 0N 0O 0P 0R 0S 0T 0U 0V 0W 0X 0Y 0Z

5-7

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Interruptores giratorios
Especificaciones (continuacin)
Peso RPSE 10, 11, 12, 13, 20 RPSE14, 16 RKSE10,11,12,13 RKSE14,16 Operaciones elctricas Prueba climtica 500 g (1.1 lbs) 1000 g (2.2 lbs) 850 g (1.9 lbs) 1250 g (2.8 lbs) >100,000 Constante segn DIN IEC 68 Parte 2-3 Variable segn DIN IEC 68 Parte 2-30 En envolvente: 25 C a +40 C (10 F a +104 F) 690 V
6 kV 60/40/25 % = 1, 3/1, 6/2xlu

Temperatura ambiente Voltaje de aislamiento de impulso nominal (Ui)


Voltaje de resistencia de impulso nominal (Uimp) Factor de servicio de clasificacin intermitente S3 (VDE 0530 Parte 1)

Descripcin
Los interruptores giratorios se usan para el aislamiento elctrico de mquinas para habilitar el acceso seguro. Una vez desconectada la alimentacin elctrica, la llave se puede retirar y usar en la prxima secuencia de operacin, tal como el desenclavamiento de una compuerta de acceso o permitir la operacin de las vlvulas. El interruptor giratorio se puede montar en un panel o se puede comprar en un envolvente IP65. El interruptor giratorio est disponible con 4 polos, 4 N.O. 2 N.C. y 2 N.A. El interruptor 100A de 4 contactos N.A. tiene 3 contactos con capacidad nominal de 100A y 1 contacto con capacidad nominal de 20 A.

Caractersticas
Llaves de acero inoxidable 316L Operacin de control directo, abre positivamente los contactos Envolvente de clasificacin IP65, impermeable y resistente al polvo Se incluye una tapa antipolvo de acero inoxidable Aislamiento de hasta 100 A 4 contactos N.A. 2 N.A. y 2 N.C. Ensamble de cuerpo codificado reemplazable

Especificaciones
Normas EN292-1 y 2, EN1088, IEC/EN60204-1, IEC/EN60947-5-1, ISO12100-1 y 2, ISO14119, GS-ET-19, AS4024.1, UL508, CSA 22.2 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 y 4 BG, cULus en bloque de contacto, marca CE; y no se requiere C-Tick IP65 (RKS solamente) 4 x M20 (RKS solamente) 10 C a +40 C (14 F a +104 F) 100,000 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) 95 % de humedad relativa DIN 57106/VDE 0106 T.100

Categora Certificaciones Clasificacin del envolvente Entradas de conducto Temperatura de operacin Operaciones mecnicas Mx. fuerza de cizallamiento a la llave Mx. par a la llave Humedad Proteccin contra contacto accidental

ltimos dos dgitos del No. de catlogo (Consulte la tabla Seleccin de productos) Corriente ininterrumpida nominal (Iu) IEC/EN/VDE UL /CSA Voltaje de operacin nominal (Ue) IEC/EN/SEV/VDE UL /CSA Voltaje de aislamiento de interr. principal hasta Corriente de operacin nominal (Ie) AC-21A IEC/EN/VDE AC-1 SEV Potencia de operacin nominal a 50-60 Hz AC-23A IEC/EN/VDE 220 a 240 V trifsico 380 a 440 de 3 polos 500 a 690 V AC-3A IEC/EN/VDE 220 a 240 V trifsico 380 a 440 de 3 polos 500 a 690 V Clasificacin DOL de UL/CSA 140 V trifsico 240 V de 3 polos 480 V 600 V Capacidad de interrupcin nominal CA-23/CA-3 220 a 240 V Interruptor de motor 380 a 440 V 500 a 690 V Tamao mx. de fusible (GI) Corriente de cortocircuito nominal de fusible Seccin transversal del terminal Cable nico/mltiples cables: mn. mm2 mx. mm2 Cable de hilo fino mnimo mm2 Con forro mximo mm 2 Calibre de cable norteamericano (AWG)

10 11 16

12

13

14

20 A 16 A 690 V 600 V 750 V 20 A 20 A

32 A 30 A 690 V 600 V 750 V 32 A 32 A

63 A 60 A 690 V 600 V 750 V 63 A 63 A

100 A 100 A 1000 V 600 V 1000 V 100 A 100 A

4 kW 7.5 kW 15 kW 7.5 kW 15 kW 30 kW 7.5 kW 15 kW 30 kW 4 kW 7.5 kW 15 kW 5.5 kW 11 kW 22 kW 5.5 kW 11 kW 22 kW 1.5 HP 3 HP 7.5 HP 10 HP 250 A 250 A 150 A 25 A 15 kA 3 HP 10 HP 20 HP 20 HP 330 A 330 A 220 A 35 A 15 kA 5 HP 15 HP 30 HP 40 HP 500 A 500 A 270 A 63/50 A 15/20 kA

22 kW 37 kW 37 kW 22 kW 37 kW 30 kW 7.5 HP 30 HP 50 HP 50 HP 600 A 600 A 300 A 100 A 25 kA

1 10 0.75 6 8

1 10 0.75 6 8

4 16 2.5 10 6

2.5 3.5 1.5 2.5 2

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-8

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Interruptores giratorios
Seleccin de productos
Tipo Contactos 4 N.A. 2 N.A. y 2 N.C. Montaje en envolvente IP65 4 N.A. 3 N.A. y 1 N.A. 8 N.A. 4 N.A. 2 N.A. y 2 N.C. Montaje en panel 4 N.A. 3 N.A. y 1 N.A. 8 N.A. 4 N.A. Corriente 20 A 32 A 63 A 3 N.A. 100 A y 1 N.A. 20 A 20 A 20 A 32 A 63 A 3 N.A. 100 A y 1 N.A. 20 A 20 A 40 A Nmero de catlogo 440T -MRKSE10 440T -MRKSE11 440T -MRKSE12 440T -MRKSE13 440T -MRKSE14 440T -MRKSE16 440T -MRPSE10 440T -MRPSE11 440T -MRPSE12 440T -MRPSE13 440T -MRPSE14 440T -MRPSE16 440T -MRPSE20

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto, todos excepto 100A Cuerpo codificado de repuesto, 100A Tapa antipolvo de repuesto Agarre de cable, conducto M20 Adaptador, M20 a 1/2 pulg. NPT de plstico Ensamble de contacto suplementario, 20 A 1 N.A. Cierre tardo, apertura anticipada 1 N.C. Auxiliar Ensamble de contacto suplementario, 20 A 2 N.A. Cierre tardo, apertura anticipada Informacin adicional Nmero de catlogo 440T -AKEYE10 Vea la pgina 5-33 440T -ASCBE14 440T -ASCBE11 440T -ASFC10 440A-A09028 440A-A09042 440T -AACA10 440T -AACA11

14-2 14-2 Para uso con RPSE12, RPSE13, RPSE20 Para uso con RPSE12, RPSE13, RPSE20

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


RKSE10 y RKSE11
80 (3.14)

RKSE12 y RKSE13

100 (3.93)

175 (6.88)

39 (1.53) 24 (0.94) 73.4 (2.88) 38 (1.49) 65 (2.55)

2 Off, Orificios de montaje M4 Llave codificada 90CRS (3.54) Tapa contra intemperie 115 (4.52) 2 Off orificios de montaje M4 39 (1.53) 2 Off 20 mm (0.78) 24 (0.94) Pasacables en superficie trasera 60CRS (2.35) 46 (1.81) 80 (3.14) 88.4 (3.48)
4 Off dim. 20 mm (0.78) 61CRS Posicin tpica de pasacables (2.4) 2 Off parte superior y 2 Off parte inferior

44CRS (1.73)

18 (0.7)

Vista de A 4 Off 20 mm (0.78), Posicin tpica pasacables 2 Off parte superior y 2 Off parte inferior

Cuerpo codificado de cubierta Placa de adaptador de ensamblaje 23 (0.9)

125CRS (4.92) 165 (6.49) Centros de montaje

5-9

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Interruptores giratorios
Dimensiones aproximadasmm (pulgadas) (continuacin)
RKSE14 RKSE16
Ensamble de tapa contra intemperie Desactivado 100 (3.98) 60 crs Activado 90 crs 80 (3.15) 2 Off Orificios de montaje M4 externos

60 crs Llave codificada 160 (6.3) Unidad en posicin desactivada, llave retirada Pasacables para entrada de conducto M25/M32 2 por extremo 100 (3.98) Conjunto del cuerpo codificado Placa adaptadora 85 (3.35) 163 (6.42) Vista en 'A' 4 Off Orificios de montaje M4 internos

18 (0.71) 44 crs 250 (9.8) 4 Off 20 (0.79) dim.Posicin tpica pasacables 2 Off parte superior y 2 Off parte inferior

240 (9.4)

100 (3.98)

RPSE10 y 11
Unidad de interruptor 50 (1.96) 46 (1.8) 25 (0.98) 64 placas cuadradas Orificios 4.4 (0.17) 32 (1.26) 16

96 (3.78) 110.5 (4.35) Unidad en posicin activada, llave atrapada

Accesorios M4 para montaje de base

RPSE 12, 13, 14 y 20


32 (1.26) 16 (0.6) Cuerpo codificado

23 Orificios (0.9) 16 20 (0.79) (0.6) 3 mx. Detalles del grosor de 64 (2.5) montaje en panel Bloque de montaje en panel panel Etiqueta Traffalite de alta visibilidad fijada permanentemente con adhesivo Tessa 4970

3 (0.12) mx. grosor de panel 16 (0.6) Unidad de interruptor

2 orificios 4.0 (0.15) Detalles del montaje dim. en panel

Orificio 20 (0.79)

23 (0.9)

Ensamble de tapa contra intemperie Tornillos de fijacin Desactivado

25 (0.98)

Bloque de montaje 71.5 (2.8) 55.5 (2.19)

25 (0.98) Activad 43 (1.69) Placa de inscripcin Adaptador de control Panel

64 placas de inscripcin cuadradas

5-10

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Interruptores giratorios
Dimensiones aproximadasmm (pulgadas) (continuacin)
RPSE16
16 (0.6) 32 (1.26) Cuerpo codificado 3 (0.12) mx. grosor de panel 16 (0.6)

Orificio 20 (0.79) Detalles del montaje en panel

2 orificios 4.0 (0.15) dim.

23 (0.9)

Tornillos de fijacin Ensamble de tapa contra intemperie

25 (0.98)

Unidad de interruptor Bloque de montaje

Desacti

Activad

Placa de inscripcin

Adaptador de variador Panel

Cableado tpico
Diagramas mostrados con la llave libre
1 3 5 7
RKSE10 y RPSE10 RKSE12 y RPSE12 PKSE13 y RPSE13 --------- y RPSE20

2 4 6 8

1 3 5 7
RKSE11 y RPSE11

2 4 6 8

1 3 5 7
RKSE14 y RPSE14

2 (100A) 4 (100A) 6 (100A) 8 (20A)

46 (1.8)

1 3 5 7 9 11 13 15
RKSE16 y RPSE16

2 4 6 8 10 12 14 16

5-11

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de desbloqueo de solenoide


Especificaciones
Normas EN292-1 y 2, EN1954-1, IEC/EN602041, EN1088, IEC/EN60947-5-1, ISO13849-1, ISO12100-1 y 2, ISO14119, GS-ET-19, AS4024.1 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 y 4 BG, cULus y marca CE 24 VCC, 110 VCA, 230 VCA, 110 VCC

Categora

Descripcin
La unidad de desbloqueo de solenoide se usa para el aislamiento elctrico de mquinas para habilitar el acceso seguro. Consiste en un interruptor de alimentacin giratorio (RPS) y un solenoide. La llave atrapada se puede retirar cuando se emite una seal externa al mecanismo interno de enclavamiento de solenoide. Una luz indicadora en la SRU indica cuando se puede retirar la llave atrapada; es decir, cuando se conecta la alimentacin elctrica al solenoide. Es necesario que la seal de solenoide est presente solamente cuando hay que retirar la llave. El solenoide tiene una capacidad de ciclo de servicio del 100 %. Se puede retirar la alimentacin elctrica del solenoide despus de retirar la llave atrapada. El retirar la llave atrapada hace que el interruptor de alimentacin elctrica de aislamiento cambie de estado; los contactos normalmente abiertos se abren y los contactos normalmente cerrados (si corresponde) se cierran. La llave atrapada se puede usar en la prxima secuencia de la operacin.

Certificaciones Voltaje del solenoide Potencia de solenoide Tipos de CC 6.5 W continuos Tipos de CA 6 VA continuos Caractersticas elctricas Vea los interruptores de alimentacin elctrica giratorios Montaje Todas las posiciones Fuerza de cizallamiento mx. 15.1 kN (3398 lbs) a la llave Par mx. a la llave 14 Nm (124 lbpulg.) Material Componentes de llave Acero inoxidable 316L atrapada Cartula Acero inoxidable 316L Caja opcional Plstico ABS Cable Conector con forro de PVC de 2 cables de 0.75 mm2 (18 AWG) Temperatura de operacin 0 C a +40 C (+32 F a +104 F) Humedad 95 % de humedad relativa Condiciones ambientales Con envolvente de plstico IP65 (NEMA 13) opcional Vida til elctrica >100,000 Vida til mecnica 100,000

Caractersticas
Operacin de control directoabre positivamente los contactos Monitoreo de solenoide integral Llave atrapada hasta aplicarse la seal de desbloqueo Versiones de envolvente IP65 montaje en panel Indicador LED o de NEON de llave libre Construccin de acero inoxidable 316L Opciones de solenoides de 24 VCC, 110 VCA/CC 230 VCA La tapa antipolvo de acero inoxidable a prueba de intemperie se proporciona de manera estndar Aprobacin de UL y CSA para los interruptores Llave nica o llaves mltiples disponibles (comunquese con la fbrica) Ensamble de cuerpo codificado reemplazable

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-12

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de desbloqueo de solenoide


Seleccin de productos
Voltaje del solenoide 24 VCC Contactos 2 N.A. y 2 N.C. 4 N.A. 2 N.A. y 2 N.C. 110 VCA 4 N.A. 2 N.A. y 2 N.C. 230 VCA 4 N.A. 2 N.A. y 2 N.C. 4 N.A. 3 N.A. y 3 N.C. Corriente 20 A 32 A 20 A 32 A 20 A 32 A 20 A Nmero de catlogo 440T -MSRUE11 440T -MSRUE10 440T -MSRUE12 440T -MSRUE22 440T -MSRUE20 440T -MSRUE23 440T -MSRUE33 440T -MSRUE30 440T -MSRUE34 440T -MSRUE44 440T -MSRUE40 440T -MSRUE46

110 VCC

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Envolvente de plstico opcional IP65 Informacin adicional Vea la pgina 5-33 Para uso con unidades de 20 A Para uso con unidades de 32 A Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10 440T -AIPB10 440T -AIPB22

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas), diagrama de cableado tpico


Las dimensiones no se proporcionan para fines de instalacin.
Bloque de terminales Interruptor de monitor de estado de solenoide. Los contactos se abren cuando el solenoide se retrae 120 (4.72) 6 orificios 4.5 (0.18) dim.
Bombilla indicadora de estado de solenoide 70

90 (3.54) 82 (3.23) 132 (5.20)

MC MC Tierra

160 (6.30)

150 (5.91)

(2.76) R4 (0.16) mx. Corte de panel

70 (2.76)

90 (3.54)

Llave atrapada (no incluida)

100 (3.93) Envolvente opcional 440T-AIPB10

110 (4.33)

Envolvente opcional 440T-AIPB22

300 (11.81)

230 (9.06)

5-13

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de retardo temporizado electrnico


Especificaciones
Normas EN292-1 y 2, EN1954-1, IEC/EN602041, EN1088, IEC/EN60947-5-1, ISO13849-1, ISO12100-1 y 2, ISO14119, GS-ET-19, AS4024.1 Cat. 3 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 BG y marca CE 0 C a +40 C (32 F a +104 F) 95 % de humedad relativa 100,000 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) Acero inoxidable 316L Acero inoxidable 316L Plstico ABS Tornillos a prueba de manipulacin indebida 2.0 kg (4.4 lbs) 24 VCC, 110 VCA y 230 VCA 0.1 segundo a 40 minutos

Categora Certificaciones Temperatura de operacin Humedad Operaciones mecnicas Mx. fuerza de cizallamiento a la llave Mx. par a la llave Material Componentes de llave atrapada Cartula Caja opcional Fijacin de ensamble Peso Entradas Margen de tiempo

Descripcin
La unidad de retardo temporizado electrnico (ETU) se usa en aplicaciones que requieren que transcurra un lapso de tiempo antes de permitir el acceso a un lugar peligroso. La ETU usa un temporizador de unidad de control CU1 para ejecutar la secuencia de temporizacin. El girar una llave no extrable inicia el temporizador. Cuando la CU1 sobrepasa el tiempo de espera, la salida activa un solenoide interno, el cual permite el retiro de una o dos llaves atrapadas. La unidad de retardo temporizado de llave nica (STU) tiene una llave atrapada. Despus que haya expirado el temporizador CU1, la llave nica atrapada puede extraerse y usarse para continuar con la siguiente secuencia de permitir acceso al peligro. La llave nica debe devolverse a la STU y quedar atrapada para permitir que la llave no extraible reinicie la secuencia de peligro. La unidad de retardo temporizado de dos llaves (DTU) tiene dos llaves atrapadas. Despus que haya expirado el temporizador CU1, ambas llaves pueden extraerse y usarse para continuar con la siguiente secuencia de permitir acceso al peligro. Ambas llaves nica deben devolverse a la DTU y quedar atrapadas para permitir que la llave no extraible reinicie la secuencia de peligro. Vea la unidad de control CU1 para obtener detalles acerca de cmo establecer el tiempo de retardo.

Caractersticas
Salida con retardo temporizado de hasta 40 minutos Una llave o dos llaves Llaves de acero inoxidable 316L Paro de categora 1 Ensamble de cuerpo codificado reemplazable Envolvente IP65 opcional

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-14

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de retardo temporizado electrnico


Seleccin de productos
Tipo Voltaje del solenoide 24 VCC Salida de llave nica Montaje en panel 110 VCA 230 VCA 24 VCC Salida de dos llaves Montaje en panel 110 VCA 230 VCA Conjunto de contactos 1 Conjunto de contactos 2 3 N.A. 40 A 1 N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A 3 N.A. 40 A 1 N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A 3 N.A. 40 A 1 N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A 3 N.A. 40 A 1 N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A 3 N.A. 40 A 1 N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A 3 N.A. 40 A I N.A. 20 A 2 N.A. 20 A 1 N.C. 20 A Nmero de catlogo 440T -MSTUE10 440T -MSTUE11 440T -MSTUE20 440T -MSTUE22 440T -MSTUE30 440T -MSTUE33 440T -MDTUE10 440T -MDTUE11 440T -MDTUE20 440T -MDTUE22 440T -MDTUE30 440T -MDTUE33

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Envolvente de plstico opcional IP65 Nmero de pgina 5-33 Para uso con unidades de 20 A Para uso con unidades de 40 A Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10 440T -AIPB20 440T -AIPB23

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
250 (9.84) 226 (8.90) 216 (8.50) 118 (4.65) 160 (6.30) 150 (5.91) 70 (2.76) 70 (2.76) Caja ABS opcional (440T-AIPB20) para aislador de 20 Amp Una llave para STU (llave no incluida) Llave no extrable Dos llaves para DTU (llaves no incluidas) 98 (3.86) 300 (11.81) 8 orificios 4.6 (0.18) dim. 95 (3.74) 110 (4.33) 90 (3.54)

230 (9.06)

Caja ABS opcional (440T-AIPB23) para aislador de 40 Amp

5-15

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de interrupcin de movimiento


Especificaciones
Normas EN292-1 y 2, EN1954-1, IEC/EN602041, EN1088, IEC/EN60947-5-1, ISO13849-1, ISO12100-1 y 2, ISO14119, GS-ET-19, AS4024.1 Cat. 3 segn EN 954-1 (ISO 13849-1) BG y marca CE 0 C a +40 C (32 F a +104 F) 95 % de humedad relativa 100,000 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) Acero inoxidable 316L Acero inoxidable 316L Plstico ABS Cuerpo de acero inoxidable, frontal de plstico Tornillos a prueba de manipulacin indebida 2.0 kg (4.4 lbs) 24 VCC, 110 VCA y 230 VCA 0.1 segundo a 40 minutos 2x detectores inductivos

Descripcin
La unidad de interrupcin de movimiento (SMU) se usa en aplicaciones que requieren la deteccin de interrupcin de movimiento de piezas mecnicas de una mquina. La SMU usa detectores inductivos de proximidad para detectar el movimiento y la unidad de control CU2 para monitorear los detectores. La CU2 requiere detectores de proximidad con salida tipo PNP y NPN. Cuando los detectores de proximidad ya no detectan movimiento, la CU2 activa la salida, la cual, a su vez, activa un solenoide interno. Una vez activado el solenoide, una o dos llaves atrapadas se pueden retirar de la SMU. Las llaves atrapadas (una o dos) extrables se pueden usar para continuar la prxima secuencia de acceso al lugar peligroso. Vea la unidad de control CU2 para obtener detalles acerca de cmo establecer el tiempo de retardo. Se pueden ver detectores de proximidad adicionales en el catlogo de Sensores.

Categora Certificaciones Temperatura de operacin Humedad Operaciones mecnicas Fuerza de cizallamiento mx. a la llave Par mx. a la llave Material Componentes de llave atrapada Cartula Caja opcional Detectores inductivos Fijacin de ensamble Peso Entradas Margen de tiempo Detectores de velocidad en cero

Caractersticas
Deteccin de interrupcin de movimiento Detectores de proximidad NPN y PNP Salida con retardo temporizado de hasta 40 minutos Paro de categora 1 Ensamble de cuerpo codificado reemplazable Envolvente IP65 opcional

La ventaja Prosafe
Construccin de acero inoxidable Llaves de corte de precisin CNC

5-16

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de interrupcin de movimiento


Seleccin de productos (detectores no incluidos)
Tipo Voltaje del solenoide 24 VCC Salida de llave nica Montaje en panel 110 VCA 230 VCA 24 VCC Salida de dos llaves Montaje en panel 110 VCA 230 VCA Conjunto de contactos 1 3 N.A. 40 A 2 N.A. 20 A 3 N.A. 40 A 2 N.A. 20 A 3 N.A. 40 A 2 N.A. 20 A 3 N.A. 40 A 2 N.A. 20 A 3 N.A. 40 A 2 N.A. 20 A 3 N.A. 40 A 2 N.A. 20 A Conjunto de contactos 2 1 N.A. 20 A 1 N.C. 20 A 1 N.A. 20 A 1 N.C. 20 A 1 N.A. 20 A 1 N.C. 20 A 1 N.A. 20 A 1 N.C. 20 A 1 N.A. 20 A 1 N.C. 20 A I N.A. 20 A 1 N.C. 20 A Nmero de catlogo 440T -MSMSE10 440T -MSMSE11 440T -MSMSE20 440T -MSMSE22 440T -MSMSE30 440T -MSMSE33 440T -MDMSE10 440T -MDMSE11 440T -MDMSE20 440T -MDMSE22 440T -MDMSE30 440T -MDMSE33

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Fusible de repuesto Envolvente de plstico opcional IP65 250 V 500 mA NPN PNP NPN PNP NPN PNP 4-67 NA Para uso con unidades de 20 A Para uso con unidades de 40 A Tamao Tipo Nmero de pgina 5-33 Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10 440R-A31562 440T -AIPB20 440T -AIPB23 872C-D3NN12-E2 872C-D3NP12-E2 872C-D5NN18-E2 872C-D5NP18-E2 872C-D10NN30-E2 872C-D10NP30-E2

12 mm Detectores inductivos de proximidad 18 mm 30 mm

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


250 (9.84) 160 (6.30) 150 (5.91) 70 (2.76) 70 (2.76) 226 (8.90) 216 (8.50) 118 (4.65) 90 (3.54) Caja ABS opcional (440T-AIPB20) para aislador de 20 Amp Una llave para STU (llave no incluida) Llave no extrable Dos llaves para DTU (llaves no incluidas) 8 orificios 4.6 (0.18) dim. 95 (3.74) 110 (4.33)

98 (3.86) 300 (11.81)

230 (9.06) Caja ABS opcional (440T-AIPB23) para aislador de 40 Amp

5-17

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de intercambio
Especificaciones
Normas Categora Certificaciones Temperatura de operacin Operaciones mecnicas Mx. fuerza de cizallamiento a la llave Mx. par a la llave Humedad Material EN292-1 y 2, EN1088, ISO12100-1 y 2, ISO14119, AS4024.1 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 BG, marca CE, y no se requiere C-Tick 40 C a +200 C (40 F a +392 F) 100,000 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) 95 % de humedad relativa Acero inoxidable 316L

Descripcin
La unidad de intercambio de llaves (KEX) se usa en una secuencia de enclavamiento para vincular otros dispositivos de la gama Prosafe y satisface las necesidades de las secuencias de operacin ms complejas. El principio de operacin es tal que no se puede extraer ninguna llave secundaria de la unidad hasta que todas las llaves primarias hayan sido insertadas, giradas y queden atrapadas. Las llaves primarias permanecen atrapadas hasta que todas las llaves secundarias hayan sido reinsertadas, giradas y queden atrapadas. Generalmente se usa en aplicaciones donde hay ms de una va de acceso al rea peligrosa, y cada va de acceso debe estar abierta simultneamente. La unidad de intercambio de llaves realiza esto permitiendo la insercin de una o ms llaves, lo cual a su vez libera mltiples llaves. Un proceso tpico puede requerir un interruptor de llave giratorio para apagar un motor. La llave del interruptor giratorio se retira y se inserta en una unidad KEX. Luego la unidad KEX libera tres llaves lo cual permite acceso simultneo al rea peligrosa a travs de tres compuertas diferentes. Esta unidad KEX se describe como unidad de una llave insertada, 3 llaves retiradas. Las llaves insertadas se consideran cdigos primarios, por lo tanto las llaves no se incluyen en la unidad KEX. Las llaves retiradas se consideran cdigos secundarios, por lo tanto las llaves se incluyen.

Accesorios

Gabinetes opcionales de intercambio de llaves L W No. de mm (pulgadas) llaves Acero Templado pintado 400 300 11 (mx.) (15.7) (11.8) 400 400 15 (mx.) (15.7) (15.7) 600 600 25 (mx.) (23.6) (23.6) 800 800 40 (mx.) (31.4) (31.4) Acero inoxidable 400 400 15 (mx.) (15.7) (15.7) 600 600 25 (mx.) (23.6) (23.6) 800 800 40 (mx.) (31.4) (31.4) D Nmero de catlogo

200 (7.87) 210 (8.26) 210 (8.26) 210 (8.26) 210 (8.26) 210 (8.26) 210 (8.26)

440T -AIPB30 440T -AIPB33 440T -AIPB34 440T -AIPB35

440T -AIPB40 440T -AIPB44 440T -AIPB45

Caractersticas
Hay una variedad de unidades estndar disponible en diversas combinaciones Construccin de acero inoxidable 316L Llave(s) primaria(s) insertadas libera(n) a las llaves secundarias simultneamente en unidades de hasta 6 vas La tapa antipolvo de acero inoxidable a prueba de intemperie es estndar Ensamble de cuerpo codificado reemplazable

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-18

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Unidades de intercambio
Seleccin de productos
Unidades de intercambio de llaves Nmero de llaves 2 3 4 5 6 4 5 6 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 seleccin de cdigos. Llaves insertadas y retiradas 1 llave insertada y 1 llave retirada 1 llave insertada y 2 llaves retiradas 1 llave insertada y 3 llaves retiradas 1 llave insertada y 4 llaves retiradas 1 llave insertada y 5 llaves retiradas 2 llaves insertadas y 2 llaves retiradas 2 llaves insertadas y 3 llaves retiradas 2 llaves insertadas y 4 llaves retiradas 3 insertadas y 3 llaves retiradas 1 llave insertada y 6 llaves retiradas 1 llave insertada y 7 llaves retiradas 1 llave insertada y 8 llaves retiradas 1 llave insertada y 9 llaves retiradas 1 llave insertada y 10 llaves retiradas 1 llave insertada y 11 llaves retiradas 1 llave insertada y 12 llaves retiradas 1 llave insertada y 13 llaves retiradas 1 llave insertada y 14 llaves retiradas 1 llave insertada y 15 llaves retiradas 1 llave insertada y 16 llaves retiradas 1 llave insertada y 17 llaves retiradas 1 llave insertada y 18 llaves retiradas 1 llave insertada y 19 llaves retiradas 1 llave insertada y 20 llaves retiradas 1 llave insertada y 21 llaves retiradas 1 llave insertada y 22 llaves retiradas 1 llave insertada y 23 llaves retiradas Nmero de catlogo 440T -MKEXE10 440T -MKEXE11 440T -MKEXE12 440T -MKEXE13 440T -MKEXE14 440T -MKEXE15 440T -MKEXE16 440T -MKEXE17 440T -MKEXE18 440T -MKEXE19 440T -MKEXE20 440T -MKEXE22 440T -MKEXE23 440T -MKEXE24 440T -MKEXE25 440T -MKEXE26 440T -MKEXE27 440T -MKEXE28 440T -MKEXE29 440T -MKEXE30 440T -MKEXE33 440T -MKEXE34 440T -MKEXE35 440T -MKEXE36 440T -MKEXE37 440T -MKEXE38 440T -MKEXE39

Especifique los cdigos individualmente para cada llave primaria insertada (llave no incluida) y cada llave secundaria retirada (llave incluida). Vea la pgina 5-6 para obtener la Consulte con la fbrica para obtener informacin sobre otras configuraciones de llaves insertadas y llaves retiradas .

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Nmero de pgina 5-33 Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


(4, 5 6) Unidad de intercambio de llaves de 6 vas (2) Unidad de intercambio de llaves de 3 vas 200 (7.87) 169 (6.65) 55.5 (2.18) 185 (7.28) 27.5 (1.08) 4 orificios de fijacin 8.6 (0.33) dim. 87 (3.43) 111 (4.37) 200 (7.87) 169 (6.65) 4 orificios de fijacin 8.6 (0.33) dim. 56 (2.20) L 27.5 (1.08) 185 (7.28) 87 (3.43) A P

Gabinetes de intercambio de llaves (acero templado pintado o acero inoxidable)

5-19

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Dispositivos de enclavamiento de perno


Especificaciones
Normas Categora Certificaciones Temperatura de operacin Operaciones mecnicas Mx. fuerza de cizallamiento a la llave Mx. par a la llave Humedad Peso Material Montaje EN292-1 y 2, EN1088, ISO12100-1 y 2, ISO14119, AS4024.1 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 BG, marca CE, y no se requiere C-Tick 40 C a +200 C (40 F a +392 F) 100,000 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) 95 % de humedad relativa (SBL) 0.60 kg (1.32 lbs) (DBL) 1.10 kg (2.43 lbs) Acero inoxidable 316L

nico

Doble

Descripcin
Los dispositivos de enclavamiento de perno estn diseados para permitir acceso a lugares peligrosos cuando se inserta la llave apropiada en el enclavamiento. Estos dispositivos de enclavamiento de perno se fabrican de acero inoxidable 316L para proporcionar un mtodo industrial robusto de evitar el acceso a travs de las compuertas. Una ventaja de los dispositivos de enclavamiento de perno es que no es necesario encaminar cables de alimentacin elctrica a la compuerta. Un interruptor giratorio con atrapamiento de llave en un panel de control desconecta la alimentacin elctrica y luego el operador lleva en la mano la llave a la compuerta. El dispositivo de enclavamiento de perno nico (SBL) se ha diseado para obtener acceso a lugares peligrosos donde se requiere una exposicin corporal parcial. El SBL no se enva con una llave. Si se requieren dos llaves para el acceso corporal parcial, seleccione el dispositivo de enclavamiento de dos pernos (DBL), el cual requiere que ambas llaves estn atrapadas para funcionar. Esta versin del DBL no incluye las llaves. Cuando se requiere el acceso corporal completo, se debe usar el DBL, con una llave primaria y una segunda llave atrapada (incluida). La llave secundaria realiza la funcin de una llave personal. Este DBL permite al operador llevar la llave personal al lugar peligroso. Cuando el operador vuelve del lugar peligroso y devuelve la llave personal al DBL, se puede invertir la secuencia de bloqueo y reiniciar el proceso.

Perno

SBL 2 x M5 contrataladrado desde la parte superior o 2 x M5 desde el lado inferior con tuercas M5 DBL 4 x M5 contrataladrado desde la parte superior o 4 x M5 desde el lado inferior con tuercas M5 15 mm (0.59 pulg.)

Caractersticas
Construccin de acero inoxidable 316L Unidades de llave nica o dos llaves Diversas extensiones del perno Operacin presionar/halar del control directo Ensamble de cuerpo codificado reemplazable Cuenta con tornillos a prueba de manipulacin indebida La tapa antipolvo de acero inoxidable a prueba de intemperie es estndar

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-20

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Dispositivos de enclavamiento de perno


Seleccin de productos
Tipo Condicin de llave atrapada Llave atrapada para retraer perno Perno retradomm (pulgadas) 0 3 (0.11) 6 (0.23) 12 (0.47) 0 3 (0.11) 6 (0.23) 13 (0.51) 0 mm 3 (0.11) 6 (0.23) 13 (0.51) Perno extendidomm (pulgadas) 14 (0.55) 17 (0.66) 20 (0.78) 27 (1.06) 14 (0.55) 17 (0.66) 20 (0.78) 27 (1.06) 14 (0.55) 17 (0.66) 20 (0.78) 27 (1.06) Nmero de catlogo 440T -MSBLE10 440T -MSBLE11 440T -MSBLE12 440T -MSBLE13 440T -MDBLE10 440T -MDBLE11 440T -MDBLE12 440T -MDBLE13 440T -MDBLE14 440T -MDBLE15 440T -MDBLE16 440T -MDBLE17

Llave nica

Ambas llaves atrapadas para retraer perno Dos llaves Llave primaria atrapada, llave secundaria libre para retraer perno

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo secundario deseado por este smbolo (llave incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Nmero de pgina 5-33 Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin.
Dispositivo de enclavamiento de perno de llave nica
2 x M5 44.5 (1.75) 3.5 (0.13) 44.5 (1.75)

Dispositivo de enclavamiento de perno de dos llaves


4 x M5 15.8 (0.62) 57.7 (2.27)

48.5 (1.90)

48.5 (1.90) Secundario 3.5 (0.13) 30.5 (1.2) Primario 3.5 (0.13) 57.7 (2.27) Tornillos de cuerpo codificado M4 x 8 cabeza Torx

28.5 (1.22) y 30 15 (0.59) dim. (1.18) pasos de perno 20 (0.79) dim. de reborde 36.3 (1.42) Fijador M5 usando
cavidades para tuercas para montaje frontal Tornillo de fijacin con tapa contra intemperie (M5)

15.8 (0.62)
Tornillos de cuerpo codificado M4 x 8 cabeza Torx

28.5 (1.22) y 30 (1.18) pasos

20 (0.79) dim. de reborde


Tornillo de fijacin con tapa contra intemperie (M5)

15 (0.59) dim. de perno

29 (1.14)

5.8 (0.22) 25.4 27.4 (1.0) (1.07)

12 (0.47) 30 (1.18)

25.4 27.4 (1.0) (1.07) 59.7 (2.35) 65.5 (2.57) Llave atrapada para perno retrado 12 (0.47) 30 (1.18)

124 (4.88) mx Fijador M5 usando cavidades para tuercas para montaje frontal

Proyecciones de retraccin estndar 0, 3, 6 y 13 (0, 0.11, 0.23 y 0.51), extensin 14 (0.55)

5-21

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Dispositivos de enclavamiento de acceso/cadena


Especificaciones
Normas Categora Certificaciones Desalineamiento Mx. fuerza de cizallamiento a la llave Mx. par a la llave Temperatura de operacin Humedad Material Montaje SAL y SCL EN292-1 y 2, EN1088, ISO12100-1 y 2, ISO14119, AS4024.1 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 BG, marca CE, y no se requiere C-Tick +/10 mm (0.39 pulg.) 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) 40 C a +200 C (40 F a +392 F) 95 % de humedad relativa Acero inoxidable 316L

nico

Doble

Descripcin
Los dispositivos de enclavamiento de acceso estn diseados para permitir acceso a lugares peligrosos cuando se inserta la llave apropiada en el enclavamiento. Estos dispositivos de enclavamiento de acceso se fabrican de acero inoxidable 316L para proporcionar un mtodo robusto e industrial para evitar el acceso a travs de las compuertas. Una palanca o varilla conectada a una cadena activa los dispositivos de enclavamiento. Una ventaja de los dispositivos de enclavamiento de acceso es que no es necesario encaminar cables de alimentacin elctrica a la compuerta. Un interruptor giratorio con atrapamiento de llave en un panel de control desconecta la alimentacin elctrica y luego el operador lleva en la mano la llave a la compuerta. El enclavamiento de acceso de llave nica (SAL) y el bloqueo de cadena de llave nica (SCL) se han diseado para usarse para obtener acceso a lugares peligrosos donde se requiere una exposicin corporal parcial. Si se requieren dos llaves para el acceso corporal parcial, seleccione el enclavamiento de acceso de dos llaves (DAL) o el bloqueo de cadena de dos llaves (DCL) con ambas llaves atrapadas. Cuando se requiere el acceso corporal completo, se debe usar el DAL o DCL con una llave atrapada y una llave libre. La llave secundaria realiza la funcin de una llave personal. El DAL y DCL permiten al operador llevar la llave personal al lugar peligroso. Cuando el operador vuelve del lugar peligroso y devuelve la llave personal al DAL o DCL, se puede invertir la secuencia de bloqueo y reiniciar el proceso.

2 4 x M5 contrataladrado desde la parte superior o 2 4 x M5 desde el lado inferior con tuercas DAL y DCL 4 6 x M5 contrataladrado desde la parte superior o 4 6 x M5 desde el lado inferior con tuercas

Peso SAL y SCL 0.8 kg (1.8 lbs) DAL y DCL 1.35 kg (3 lbs) Vida til mecnica 100,000

Caractersticas
Construccin de acero inoxidable 316L Unidades de llave nica y dos llaves Operacin de control directo Cuenta con tornillos a prueba de manipulacin indebida La tapa antipolvo de acero inoxidable es estndar Ensamble de cuerpo codificado reemplazable

La ventaja Prosafe

Construccin de acero inoxidable Llaves de corte de precisin CNC

5-22

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Dispositivos de enclavamiento de acceso/cadena


Seleccin de productos
Operacin Llave nica Accionador Palanca Cadena Palanca Dos llaves Cadena Condicin de la llave Llave atrapada para desbloquear palanca Llave atrapada para desbloquear cadena Llave primaria atrapada, llave secundaria libre para desbloquear palanca Ambas llaves atrapadas para desbloquear palanca Llave primaria atrapada, llave secundaria libre para desbloquear cadena Ambas llaves atrapadas para desbloquear cadena Nmero de catlogo 440T -MSALE10 440T -MSCLE10 440T -MDALE10 440T -MDALE11 440T -MDCLE10 440T -MDCLE11

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo secundario deseado por este smbolo (llave incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Accesorios
Descripcin Llave de repuesto Cuerpo codificado de repuesto Tapa antipolvo de repuesto Retn de bloque de repuesto Retn de cadena de repuesto Nmero de pgina 5-33 Nmero de catlogo 440T -AKEYE10 440T -ASCBE14 440T -ASFC10 440T -ACAD10 440T -ACHA10

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo deseado por este smbolo. Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadas.
Las dimensiones no se proporcionan para fines de instalacin.
Dispositivo de enclavamiento de acceso de llave nica
25.4 (1.0) 4 x M5 Mx. 35.3 (1.38) Ensamble de cadena Cadena de 305 (12.0) de largo 12.7 (0.5) 3.5 (0.13)

Dispositivo de enclavamiento de acceso de dos llaves


6 x M5 28.5 (1.22) y 30 (1.18) pasos

28.5 (1.22) y 30 (1.18) pasos 12.7 (0.5) 44.5 (1.75) 48.5 (1.90)

25.4 (1.0) 3.5 (0.13) 3.5 (0.13) 44.5 (1.75) 10 (0.39) 98 (3.86) 30.5 (1.20) 57.7 (2.27) Tornillos de cuerpo codificado M4 x 10 cabeza Torx 57.7 (2.27) 119 (4.65) mx 48.5 (1.90)

Mn. 28.5 (1.22) paso

98 (3.86)

Mn. 10 (0.39) Mx. 13.5 (0.53) 30.5 (1.20)

100 (3.94)

Tornillos de cuerpo codificado M4 x 10 cabeza Torx 100 (3.94) 25.4 (1.0) 27.4 (1.07) 12 (0.47) 60 (2.36) mx Ensamble de retn

12 (0.47) Ensamble de retn

Mn. 28.5 (1.22) paso

Mx. 35.3 (1.38)

25.4 27.4 (1.0) (1.07)

5-23

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Bloqueo instantneo mecnico


Especificaciones
Normas EN292-1 y 2, EN1088, IEC/EN609475-1, GS-ET-19, ISO12100-1 y 2, ISO14119, AS4024.1 Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 BG, marca CE, y no se requiere C-Tick 40 C a +200 C (40 F a +392 F) Ms de 105 operaciones en condiciones de operacin normales 15.1 kN (3398 lbs) 14 Nm (124 lbpulg.) 95 % de humedad relativa 760 gm (0.76 kg (1.68 lbs)) 1332 gm (1.33 kg (2.93 lbs)) Probado hasta 100,000 operaciones 10 C a +50 C (14 F a +122 F) Acero inoxidable 316L SSL 2 x M5 contrataladrado desde la parte superior o 2 x M5 desde el lado inferior con tuercas 4 x M5 contrataladrado desde la parte superior o 4 x M5 desde el lado inferior con tuercas 2.000 N (450 lbs)

Categora

Certificaciones

nico

Doble

Temperatura de operacin Operaciones mecnicas Mx fuerza de cizallamiento a la llave

Descripcin
El sistema de bloqueo instantneo Prosafe combina las caractersticas de llaves atrapadas con enclavamientos de activacin por lengeta. Cuando el accionador se inserta en el enclavamiento (guarda cerrada) la llave atrapada puede girarse y retirarse. Con la llave libre, el accionador no puede retirarse, bloqueando de esta forma la puerta de guarda en posicin cerrada. La llave atrapada debe reinsertarse y girarse 90 para desbloquear la guarda. Los dispositivos de bloqueo instantneo se fabrican de acero inoxidable 316L para proporcionar un mtodo robusto e industrial de enclavar puertas de guarda. Una ventaja de los dispositivos de bloqueo instantneo es que no es necesario encaminar cables de alimentacin elctrica a la compuerta. Una llave atrapada en un panel de control, o una unidad tipo RKS Prosafe, desconecta la alimentacin elctrica y luego el operador lleva en la mano la llave a la compuerta. El dispositivo de bloqueo instantneo de llave nica (SSL) se utiliza para enclavar compuertas, guardas y puertas cuando no se requiere acceso corporal completo. El dispositivo de bloqueo instantneo de dos llaves (DSL) es similar a la versin de una llave, pero tiene una llave secundaria para permitir condiciones de insercin de 2 llaves o intercambio de llaves. La versin de intercambio de llaves puede usarse cuando se requiere acceso corporal completo, ya que la llave secundaria puede usarse como llave personal.

Mx par a la llave Humedad Peso Versin de una llave Versin de dos llaves Cuerpos con cdigo Temp. ambiente de trabajo Material Montaje

DSS

Mx. fuerza de retencin

Caractersticas
Construccin de acero inoxidable 316L Diversos tipos de accionador para seleccionar Versiones de una llave o dos llaves disponibles Operacin de control directo Ensamble de cuerpo codificado reemplazable Cuenta con tornillos a prueba de manipulacin indebida La tapa antipolvo de acero inoxidable a prueba de intemperie es estndar Cumple con las especificaciones de las normas EN 292, EN 1088, GS ET 19

La ventaja Prosafe
Construccin de acero inoxidable Llaves de corte de precisin CNC

5-24

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Bloqueo instantneo mecnico


Seleccin de productos
Tipo Llave nica Condicin de la llave Llave atrapada para desbloquear accionador Llave primaria atrapada, llave secundaria libre para desbloquear accionador Dos llaves Ambas llaves libres para desbloquear accionador Accionador Estndar Flexible Plano Estndar Flexible Plano Estndar Flexible Plano Nmero de catlogo 440T -MSSLE10 440T -MSSLE11 440T -MSSLE12 440T -MDSLE10 440T -MDSLE11 440T -MDSLE12 440T -MDSLE20 440T -MDSLE22 440T -MDSLE23

Sustituya el cdigo primario deseado por este smbolo (llave no incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos. Sustituya el cdigo secundario deseado por este smbolo (llave incluida). Vea la pgina 5-6 para obtener la seleccin de cdigos.

Dimensiones aproximadasmm (pulgadas)


Las dimensiones no se proporcionan para fines de instalacin. Bloqueo instantneo de una llave
38.3 (1.5) 3.5 (0.13)

Bloqueo instantneo de dos llaves


4 x M5 57.7 (2.27) 3.5 (0.13) 3.5 (0.13) 28.5 (1.22) y 30 (1.18) rango de pasos 38.3 (1.5) 43.6 (1.71) 64.1 (2.52) 57.7 (2.27)

48 (1.88) 20.8 (0.81) Entrada superior 43.6 (1.71) 64.1 (2.52)

28.5 (1.22) y 30 (1.18) rango de pasos 2 x M5 Tornillos de cuerpo codificado M4 x 8 cabeza Torx

48 (1.88) 20.8 (0.81) Entrada superior Entrada frontal 5 (0.19) 34 (1.33) 5.5 (0.21) 4 (0.15)

Entrada frontal 5 (0.19) 34 (1.33) 5.5 (0.21)

Tornillos de cuerpo codificado M4 x 8 cabeza Torx Secundario Primario 25.4 (1.0)

25.4 (1.0) 4 (0.15) 93 (3.66) Entrada inferior

20.8 (0.81)

151 (5.94) Entrada inferior

Accionador flexible/ajustable
2 orificios, 5.5 pasantes 18 (0.70) 31 (1.22) 52 (2.04) 40 (1.57) 13 8 (0.51) (0.31) 2 Off 5.5 Ranuras 51 (2.0) 20 (0.78)

Accionador estndar
M5 CSK 40 (1.57) 3.5 (0.13)

20.8 (0.81)

Accionador plano
57.7 (2.27) 25 (1.0) 36 (1.41) 18 (0.70) 3.5 (0.13)

52 (2.04)

18 (0.70)

19 (0.74)

4 (0.15)

36 (1.41)

14.5 (0.57)

5-25

Interruptores de enclavamiento con atrapamiento de llave Prosafe

Bloqueo instantneo elctrico


Especificaciones
EN292-1 y 2, EN1088, IEC/EN60947-5-1, GSET-19, ISO12100-1 y 2, ISO14119, AS4024.1 Categora Cat. 1 segn EN 954-1 (ISO 13849-1) Apropiado para sistemas de Cat. 2, 3 4 Certificaciones BG, marca CE, y no se requiere C-Tick Contacto de seguridad 2 N.C., apertura positiva Categora de utilizacin AC 15 CA (Ue) 500 V 250 V 100 V (Ie) 1 A 2 A 5 A CC 250 V 0.5 A, 24 V 2 A Mx. corriente/voltaje/carga 500 V/500 V A conmutados Corriente trmica (litio) 10 A Corriente mnima 5 V 5 mA CC Espacio de contacto de seguridad >2 x 2 mm (0.07 pulg.) Voltaje de aislamiento nominal (Ui) 500 V Voltaje de resistencia de impulso (Uimp) 2,500 V nominal Contactos auxiliares 1 N.A. Grado de contaminacin 3 Desplazamiento de accionador5 mm (0.19 pulg.) Apertura positiva Radio mnimo de operacin 175 mm (6.88 pulg.) (60 mm (2.36 pulg.) con accionador flexible) Fuerza mn. de contacto de 12 N (2.7 lbs) apertura Mx. velocidad de accionamiento 1 m/s Mx. frecuencia de 2 ciclo/s accionamiento Material del envolvente Polister con relleno de vidrio aprobado por UL y acero inoxidable 316L Material del accionador Acero inoxidable Proteccin de contactos IP67 Entrada de conducto 3 x M20 Temperatura de operacin 20 C a +80 C (4 F a 176 F) Humedad 95 % de humedad relativa Montaje SSS 4 x M5 contrataladrado desde la parte superior o 4 x M5 desde el lado inferior con tuercas DSS 6 x M5 contrataladrado desde la parte superior o 6 x M5 desde el lado inferior con tuercas Vida til mecnica 100,000 Vida til elctrica 1,000,000 Peso (SSSE) 1,160 g (2.6 lbs) (DSSE) 1,700 g (3.7 lbs) Colores Rojo/acero Mx. fuerza de retencin 2,000 N (450 lbs) Mx. carga de desbloqueo 100 N (22.5 lbs) Mx. fuerza de cizallamiento para 15.1 kN (3398 lbs) llaves Mx. par a la llave 14 Nm (124 lbpulg.) Nota: los contactos de seguridad de los interruptores Guardmaster se describen como
normalmente cerrados (N.C.), es decir con la guarda cerrada, el accionador en su posicin (cuando es pertinente) y la mquina lista para arrancar.

Normas

nico

Doble
Descripcin
El dispositivo de bloqueo instantneo Prosafe combina las caractersticas de los enclavamientos accionados por lengeta con atrapamiento de llave y a la vez proporciona conjuntos de contactos de seguridad elctrica y auxiliares. Cuando el accionador se inserta en la cerradura y se retira la llave, el accionador queda atrapado en la unidad y se bloquea la puerta de guarda en la posicin cerrada. En este estado se cierran los contactos de seguridad y se abren los contactos auxiliares. Para abrir la puerta de la guarda debe insertarse la llave y girarse 90, con lo cual se abren los contactos de seguridad, se cierran los contactos auxiliares permitiendo que se libere el accionador y se desbloquea de esta manera la puerta de guarda. Mientras la puerta de guarda est abierta, la llave est atrapada en la unidad. Los dispositivos de bloqueo instantneo con aislamiento elctrico ofrecen las caractersticas de los interruptores de enclavamiento de seguridad elctrica con las ventajas de los sistemas de llave atrapada/secuencia aplicada. Permiten usar una combinacin de ambos mtodos de proteccin de maquinaria y procesos. El dispositivo de bloqueo instantneo de llave nica (SSS) se utiliza para enclavar compuertas, guardas y puertas cuando no se requiere acceso corporal completo. La llave nica bloquea el accionador y opera el interruptor en la misma accin. El dispositivo de bloqueo instantneo de dos llaves (DSS) es similar a la versin de una llave, pero tiene una llave secundaria para permitir condiciones de insercin de 2 llaves o interc