Vous êtes sur la page 1sur 266

4.

'

SOCIT BELGE D'TUDES ORIENTALES

L'ABHIDHARMAKOSA
DE VASUBANDHU
TRADUIT ET ANNOT
PAR

Louis

de la

VALLE POUSSIN

QUATRIME CHAPITRE

PARIS,

PAUL GEUTHNER
J.-B.

LOUVAIN,

ISTAS,

Imprimeur

1924

6G842f
2.^
//.

S7

IU3
V.

CHAPITRE

IV.

Le Karman.
Par qui
est faite (krta) la varit

du monde des

tres vivants (sat-

tvaloka) et du monde-rceptacle (hhjanaloka) qui ont t dcrits

dans

le

chapitre prcdent ?

Ce

n'est

pas Dieu (svara,

ii.

64

d) qui la fait intelligemment

(buddhip7waka).
1
a.

La

varit

du monde nat de

l'acte ^

La

varit du

monde

nat des actes des tres vivants.

Mais, dans cette hypothse,


duisent en

comment

se

fait-il

que

les actes pro-

mme

temps, d'une part, des choses charmantes (ramya),

safran, santal, etc., d'autre part, des corps

(raya) de qualits tout

opposes ?

[xiii, 1 b].

Les actes des tres dont la conduite est mle d'actes bons

et

mauvais (vymirakrin)

(iv. 60),

produisent des corps semblables


et,

des abcs et dont l'impuret s'coule par neuf portes,

pour servir

de remde ces corps, des objets de jouissance (hJioga) charmants,


couleurs et figures, odeurs, gots et tangibles. Mais les dieux n'ont

accompli que des actes bons


sont galement charmants.
Qu'est-ce que l'acte ?

leurs corps et leurs objets de jouissance

1 b. C'est la volition et ce qui est produit par la volition ^

Le Stra

dit qu'il

y a deux actes, la volition (cetan)

et l'acte

aprs

avoir voulu l L'acte aprs avoir voulu (cetayiiv), c'est ce que la


1.

karmajam lokavaicitryam.
cetan tatkrtam ca tat
/

2. 3.

cetanm aham hhiksavah karma vadmi cetayitv ca. Aiiguttara iii. 415 cetanham bhikkhave kammam vadmi, cetayitv
:

CHAPITRE

IV,

1-2 .

karika dsigne par ces mots

ce qui est produit par la volition.

Ces deux actes en font

trois, acte corporel, acte vocal, acte

mental.

Gomment

tablissez-vous cette division ? D'aprs le point d'appui

de l'acte (raya), d'aprs sa nature (svahliva), d'aprs sa cause

motrice ou originaire (samutthna) ?

~ A quoi tend cette question ?


il

Si
oii

l'on tient

compte du point d'appui,

n'y a qu'un acte, car tous

les actes s'appuient sur le corps. Si l'on tient

compte de
de ces
'.

la nature,

a seulement acte vocal (vkkarman),

car,

trois,

corps,

voix et nianas, la voix seule est action de sa nature

Si l'on tient

compte de
les actes

la

cause originaire, on a seulement acte mental, car tous


l'esprit.

ont leur origine dans

Les Vaibhsikas disent que

les trois

espces d'acte [2 a] sont

tablies en raison de ces trois causes, point d'appui, nature et cause


originaire,

dans

l'ordre.

c-d.

La

volition est acte

mental

en naissent deux actes,

le

corporel et le vocal ^

La

volition est ce qu'on appelle acte mental

ce qui nat de la

volition ^ l'acte aprs avoir voulu (cetayitv) \ c'est les


actes, le coiporel et le vocal.

deux autres

hammam

karoti kyena vcya manas.


p.
I

Comparer Atthaslinl

p.

88

Kathvaithii,

393;
...

Madhyamaka,

xvii.

paramarsin
vi.

tatra yac cetanety

karmoktam uktam karma tan mnasam smrtam


2 et 3: cetan cetayitv ca
//

cetayitv ca yat tktam tat tu kyikavcikam


L'action vocale est

Madhyamakfivatfira,

89, cite Bodhicaryavaiarapanjika (v. 3, ix. 73), p. 472.


1.
'

voix

',

vg eva karma. Au

contraire

kyakarma

kyena kyasya va karma.


2.

3.
'

cetan mnasam karma tajje vkkyakarman // Sur cetan, voir ii. 24. Mrs Rhys Davids (Psychology,
'
;

p.

8),

traduit

thinking

Aung

(Compendiuni,
:

p.

IG) traduit 'volition'.

'Volition' n'est

qu' peu prs satisfaisant on verra cetan subsquente j'ai tu .


:

(ci-dessous, p. 22)

que

l'acte

comporte une

On sait que, pour les Jainas, l'acte mental est seulement demi-acte (addhakamma), Majjhima, 372 (Koa, iv. 105), Uvfisakadasfio, ii. App. 2, p. 18, SBE.
i.

XLV, pp. 83, 165, 179, 192, 242, 315.


4.

Koa,

iv.

73

a-b.

cetayitv ceti
1
:

evam cdant karisymti

(Vyttkhya).

Madhyamakav^tti,

307,

evam

caivatft

ca kyavgbhytft pravarti^ya

ity

evam cetas sam-

cintya yat kriyate tat cetayitv karmety ucyate.

Hiuan-tsng,

xiii, fol. 1

b-2 a.

*.

a.

Ces deux actes sont information


vocal
i.

et

non -information

L'acte coi'porl et l'acte

sont
;

information (mjnapti) et

non-information (avijapti,
corporelle,

11, iv. 4)

on a donc

information

information vocale ^ non-information

corporelle,

non-

information vocale.

1.

te
(a)

tu vijnaptyavijnapt.

2.

La vijnapti

est

ce qui fait savoir


corps, soit au
le

(vijnapayati), la manifestation
la voix. Elle est corporelle
le

d'une pense soit au

moyen du

moyen de
:

dans

le

premier cas, vocale dans

second

hyavijnapti, information par

que nous appelons un geste, sarlracest, vispanda (Madhyamakavrtti, p. 307), kyavipphandana ou la bodily suffusion de Mrs Rhys Davids (Dhammasangani, 636, Atthaslin, p. 323) vgvijnapti, information par la voix,
corps, ce
;

parole (Kosa,

iv.

d).
iv.

L'cole tablit (Kosa,

2 b-3 b) que la hyavijnapti n'est pas un geste, un

mouvement du
Mais
faut-il

corps, mais

une disposition, une


c).

figure

du corps. Le Sautrntika

nie que la figure existe en soi (3

considrer la vijnapti

comme

tant,

de sa nature, acte ? C'est


viii. 9, x.

l'opinion des VaibhSsikas et des hrtiques de Kathvatthu,

10 (Mahim-

ssaka, Sammitya, Mahsmghika) qui croient que


constituent
l'acte

le

geste

et la parole
1 b),

aprs avoir voulu

dont parle Bhagavat


39) et

(iv.

un acte
(ci-

distinct de la volition et
p. 88, 96, 323,

rpa de
ii.

sa nature. Mais pour le TheravSdin (Atthaslin,

Anguttara,

157,

Samyutta,
(cetan)
;

ii.

pour

le

Sautrntika

dessous
corporel

p.

12),

l'acte est volition

ce qu'il

faut entendre par

acte

c'est,

une

volition relative

non pas l'information par le corps , mais une kyasamcetan, au corps et qui meut le corps. (La version de Aung, Points of
11, iv. 4) est

controversy, p. 225, n'est pas irrprochable).


(b)

Vavijnapti

(i.

un acte

qui ne fait rien savoir autrui

Vavijiiapti est rpa, mais ne fait pas partie du


le

rpyatana

elle

se classe dans

dharmyatana
Pour prendre
le

et n'est

connue que par

la

connaissance mentale.

cas

le

plus ais comprendre, l'homme qui

commet un meurtre
une

ou qui prend

les

vux de Bhiksu

produit, la suite d'une volition (cetan)

information

corporelle ou vocale

un geste ou une parole


et fait
il

et,

en

mme

temps, un acte invisible, quoique matriel

de grands lments, qui continue


est

exister en

lui et

s'accrotre, en raison duquel


non-information

un meurtrier ou un Bhiksu.
informent
,

Cet acte invisible^ cr par certains actes visibles ou audibles et qui


s'appelle avijnapti,
'
' ;

suivant qu'il

on le considre comme corporel ou vocal est cr par un geste ou par une parole.

Lorsqu'un
le

homme ordonne un
;

assassinat,

il

n'accomplit pas
est seulement

le

geste par lequel


prparatif
.

meurtre est perptr


;

l'ordre qu'il

donne

un

de

meurtre

il

n'est pas coupable de

l'information corporelle de meurtre

Mais,

CHAPITRE
Qu'est-ce que Tact qui est
'

IV,

2 b-3

b.

information corporelle

'

2 b-3

b.

L'cole enseigne que la vijfiapti corporelle est figure


elle

(samsthna) ;

n'est pas

mouvement

(gati), parce

que tous

les
:

conditionns (saniskrta)

sont

momentans,

puisqu'ils

prissent

autrement, rien ne prirait sans cause et la cause cratrice serait en

mme

temps destructrice

[2 b]
c'est
telle

La vijhapti
,

corporelle,

ou

telle

figure

(samsthna,

10 a) du corps en raison d'une volition.


D'aprs une autre cole, les Vatsputrlyas ^ la vijnapti corporelle

est

dplacement (gati) ^ car

elle

lieu

lorsqu'il
*.

y a mouvement

(injita?)f

non pas
:

lorsqu'il n'y

a pas mouvement

L'auteur rpond Non, parce que tous les conditionns sont


tans (ksanika).

momen-

Que faut-il entendre par ksanika ? Ksana, prissant immdiatement aprs avoir acquis son tre (tmalbhd anantaravinl) ksanika, le dharma, ce qui pos;

sde

le

ksana,

comme dandika,
n'existe pas
l'assasin,

qui porte

un bton (danda).

Le conditionn
au moment o meurt
il

au del de l'acquisition de son tre

il

une

non-information

de meurtre nat en

lui

est,

de ce

fait,

coupable de meurtre.

Lorsqu'un homme entre en dhyna ce qui suppose dtachement des passions du Kfimadhfitu il ne prononce pas les vux par lesquels on renonce au meurtre, etc. Il ne produit pas l'information vocale par laquelle le Religieux produit cette non-information qui constitue son tat de Religieux et qu'on appelle discipline {samvara, iv. 13). Mais la pense, en dhyna, est assez forte pour crer, par elle-mme et sans l'intervention d'une information vocale , l'acte de

non-information
1.

la discipline.

[samsthnam kyiksyate / vijnaptir na yatir nst samskrtam ksanikam yatah] // na kaya cid ahetoh [syd] hetur eva vinakali j
2.

Le texte porte apare,


D'aprs
la

'

d'aprs d'autres

*.

La Vyakhyfi veut que


mentionne
les

les

autres

'

soient les V&tsTputrTyas.


3.

La glose de

l'diteur japonais

SammitTyas.

fixer le regard, regarder


4.
:

Dhammasaigan, la vijnapti corporelle, c'est avancer, reculer, de tous cts, avancer le bras, le retirer, etc. Car lorsque le corps se meut, elle se meut en raison de Hiuan-tsang

l'acte .
5.

bien

le

ksanikah ksane bhavah ksano 'systlti va. La Vy&khy& ajoute kana est le minimum de temps (iii. 85 d). Voir ii. 46 a-b.

ou

Hiuan-isang,
prit

xiii, fol.

2 a-3

a.

la place o

il

est

il

ne peut de cette place aller une


pas mouvement.

autre.

Par consquent
dit

la vijnapti corporelle n'est


:

Le VatsTputrTya
admettrons
Il

Si les conditionns sont

momentans, nous

qu'ils

ne sont pas susceptibles de dplacement.

est tabli qu'ils sont


'

momentans,

puisqu'ils prissent nces-

sairement

car la

destruction

des conditionns est spontane


soit

(kasmika)
va)
;

elle

ne procde pas de quoi que ce

(akasnidhhaquelque chose

elle

ne dpend pas d'une cause (ahehika).


est

1.
*

Ce qui dpend d'une cause


faire
'

un

'

effet

',

(krya). La destruction (nsa, vina) est un nant


:

(abhva)

comment un nant

pourrait-il tre

'

faire

'

(krya)?

Donc
2.

la destruction

ne dpend pas d'une cause (akryatvd ahh-

vasya).

La

destruction ne dpend pas d'une cause

donc

le

conditionn
il

prit aussitt qu'il est

s'il

ne prit pas tout de

suite,

ne prira

pas plus tard, puisqu'il reste


qu'il prit,
3.

le

mme.

[3 a] Puisque

vous admettez

vous devez admettre


le

qu'il prit tout

de suite ^
il

Direz-vous que

conditionn change; que, par consquent,

est plus tard sujet

destruction ? Qu'une certaine chose change,

devienne une autre chose, en restant cette

mme

chose que vous dites

qui voit ses caractres modifis, c'est absurde


4.

(ii.

46

a, p.

233).

Direz-vous qu'il n'y a pas de

moyen de connaissance (pramna)


par sa relation (samyoga)

plus dcisif (garistha) que l'exprience directe (drsta, pratyaksa),


et

que

le

monde
feu
;

constate que

le bois prit
il

avec

le

que, par consquent,

est

faux que toutes choses


faire l-dessus.

prissent sans cause ?

H y a bien des remarques


le bois prit

En

fait, le

monde ne

peroit pas directement la destruction du bois

en raison du feu. Si vous pensez que


1.
.

par sa relation

Hiuan-tsang

puisqu'il prit plus tard

Kosa ii. 46; Madhyamakavrtti pp. 29, n. 5, 173, n. 8, 222, 413. Le Saddarsanasamuccaya (d. Suali, 46) cite un Stra des Sautrntikas pancemni bhiksavah samjnmcitram pratijndmtram samvrtimtram vyavahramtram j katamni paiica j atlto 'dhv angato 'dhv sahetuko vinsah kasam pudgala iti j Vedantastra ii. 2, 23;
/2.

La destruction

n'a pas de cause, voir

Nyayavarttikatfitparyatka (Viz. S.

S.),

383.

6
avec
le feu, c'est

CHAPITRE

IV,

2 b-3

b.

parce que, lorsque cette relation a eu


:

lieu,

nous ne

voyons plus

le bois

votre thse repose sur un raisonnement, non

pas sur l'vidence

directe, et votre

raisonnement n'est pas concluant.

Le

fait

que, aprs relation avec le feu, nous ne voyons plus le bois,

est susceptible de

deux interprtations ou bien


le

ou bien

le boit prit

en raison

de cette relation

bois prit

incessamment de lui-mme,
normales, mais

renat de lui-mme

incessamment dans

les conditions

arrte de se renouveler en vertu de sa relation avec le feu.

Vous admettez que

la destruction

de la flamme est spontane


le

(kasmika). Lorsque, aprs relation avec

vent, la

flamme

n'est

plus visible, vous admettez que cette relation n'est pas la cause de la
destruction de la
cette relation,

flamme

vous admettez que

la

flamme, en vertu de

a arrt de se renouveler. De

mme
le

pour

le

son de la

cloche

la main, pose sur la cloche,

empche

renouvellement du

son

elle

ne dtruit pas

le

son que vous admettez qui est momentan.


cette question.

Donc
5.

c'est le

raisonnement qui doit trancher


:

Le Vatslputrlya

Quelles raisons apportez-vous en faveur de la

thse de la destruction spontane ?

Nous avons
tre cause

dj dit que la destruction, tant un nant, ne peut


si

(kryaivd ahhvcisya). Nous dirons encore que,


l'effet

la

destruction tait
Si,

d'une cause, rien ne prirait sans cause.


cause,

comme
elle

la

naissance, la destruction procdait d'une

jamais

n'aurait lieu sans cause.


le

Or on constate que

la

pense

(huddhi)f la flamme,

son, qui sont

momentans, prissent sans


la destruction

que leur destruction dpende d'une cause. Donc


bois, etc., est spontane.

du

Le Vaiseika soutient que


de
la

la pense antrieure [3 b] prit en raison


le

pense postrieure, que

son antrieur prit en raison du son

postrieur.

Mais

les

deux penses en question ne sont pas simulta-

nes (asainavadhtia
toires,

= ayugapadhliva). Des
les

penses contradicet haine,

doute et certitude, plaisir et souffrance,


;

amour

ne se

rencontrent pas

de

mme

penses non contradictoires. Et

supposer rencontre, lorsque pense ou son faibles (apatu) suivent

immdiatement pense ou son


pourraient-ils dtruire des

forts,

comment

des

dharmas
espce ?

faibles

dharmas

forts de

mme

Hiiian-tsang,
6.

xiii, fol.

3 a-4

a.

Quelques-uns,

le

Sthavira Vasubandhu

'

pensent que la

flamme

prit par l'absence d'une cause de dure

(avasthnahetva-

hhvt). Mais une absence ne peut tre cause (krana).

D'aprs les Vaisesikas, la flamme prit en raison du

dharma

et

de

Vadharma,
et

mrite et dmrite. Cette explication est inadmissible.

Le dharma

Vadharma
:

seraient, l'un et l'autre, causes de nais-

sance et de destruction
prir,

le

dharma
;

fait natre

la

flamme

et la fait

suivant que la flamme est avantageuse (anugrahya) ou

Vadharma, suivant qu'elle est dsavantageuse ou avantageuse. Or on ne peut admettre que le dharma
dsavantageuse (apakrya)

Vadharma entrent en activit et ^^ moment (ksana eva ksane) l


et
<

cessent d'tre actifs chaque

D'ailleurs

cette

manire d'expliquer
il

la

destruction vaudra pour

tout conditionn, donc

est inutile de poursuivre la discussion.

Vous

n'avez pas

le

droit de dire

que

le

bois prit par sa relation

avec la

flamme
7.

l
etc.,

Si on maintient que la destruction du bois,

a pour cause la
la

relation

du bois avec

le feu,

on sera forc d'avouer que

cause qui

engendre est en

mme

temps cause de destruction.


relation avec le feu

La cuisson (pka), ou
[4 a].

(agnisamyoga), donne

des produits (pdkaja) diffrents, la couleur de plus en plus fonce

La mme cause

qui produit la premire couleur dtruit cette

premire couleur, ou, du moins


nouvelle relation avec
le feu,

si

vous objectez
le

qu'il s'agit

d'une

puisque

feu est

momentan

la

cause qui dtruit la premire couleur est semblable la cause qui la


1.

D'aprs la

Vykhya

sthaviravasubandhuprabhrtibliir
:

uktah
2.

D'aprs la glose de l'diteur japonais


peut comprendre
: ;

ayam

hetur
.

D'aprs l'Ecole des Sthaviras

ksane ksana eva glos par tasminn eva ksane. Supposons la lumire avantageuse elle nat en raison du mrite, prit aussitt en raison du dmrite renat en raison du mrite Supposons la dsavantageuse elle nat en raison du dmrite, prit en raison du Ou bien ksana eva ksane nmkliye ksane 'naupacrike ksane. mrite 3. Vyakhya akyas caisa kranaparikalpa iti vistarah / dharmd adharmavinsa iti kranaparikalpa iti sarvatra satnskrte dvyanukdau anityesii rUpdisii kartnani ca sakyate kartum ato na vaktavyam etad agnisamyogt ksthdinm vina ity evamdi.
:

On

ksana eva ksane

...

...

8
produit.

CHAPITRE

IV,

2 b-3

c.

Or

il

est impossible

qu'une certaine cause produise un certain


cause, ou une cause pareille, dtruise
xxiii.)

effet et qu'ensuite cette


le dit effet.

mme

(Comparer Tarkasamgraha,

Direz-vous que, les flammes successives tant diffrentes, longues,


courtes, grandes, petites, notre conclusion ne s'impose pas ?

Nous

apporterons un autre exemple. Par l'action prolonge de la cendre,

de la neige, des caustiques, du

soleil,

de l'eau, de la
'

terre, se produi'.

sent et disparaissent tour tour diffrents

produits de cuisson
le

Or

vous n'attribuez pas ces divers facteurs de cuisson

caractre de

momentan.
8.

On demandera pourquoi
'

l'eau s'anantit

quand

elle est

cbauffe

si la relation

avec

le feu

(agni) n'est pas destructrice de

l'eau.

En

raison de la relation avec le feu, par la force du feu, l'lment

ign (tejodhtu)
s'accrot
et,

qui

est
il

prsent dans l'eau


fait

(ii.

22, p. 146)

s'accroissant,

que la masse de l'eau renaisse en

quantit de plus en plus rduite

(ksmaksma), jusqu'
Voil ce que
fait

ce que,

tant tout fait rduite (ahliiksmat), l'eau arrte de se renouveler

(na punah samtnam samtanuta


relation avec le feu ^
9.

iti).

l'eau

la

Concluons.

La

destruction des choses est spontane. Les choses

prissent d'elles-mmes, parce qu'il est de leur nature de prir (hhan-

guratvt).
naissant.

Comme elles prissent Comme elles prissent en


il

d'elles-mmes, elles prissent en


naissant, elles sont

momentanes
;

(ksanika). Donc

n'y a pas de

mouvement, de dplacement

il

y a

seulement naissance une autre place d'un second moment de la


srie
:

comme

c'est le cas,

de l'avis

mme

de notre adversaire, pour

le feu

qui dvore une jongle. [4 b] L'ide de marche est une fausse

conception (abhimna).

Donc

la vijnapti corporelle n'est

pas dplacement, mouvement

donc la vijnapti corporelle

est figure,

samsthna.
pas une chose distincte, une

Le Sautrantika
1.

dit

que

la figure n'est

D'aprs l'diteur japonais,

le SaqiniitTya. xviii. 82.

2,

Comparer AsaAga, Sotr&lamkftra,

Hiuan-tsang,

xiii, fol.

4 a-5

a.

9
le

chose en soi (anyad dravyam). Pour les Vaibhasikas,


fia, le visible, est,

rpyatad'autre

d'une part, varnarpa, couleur, bleu,


figure, long, etc.
(i.

etc.,

part,

sanisthnarpa,

10

a).

Pour

le

Sautrantika,

la figure n'existe

pas rellement (dravyasat), mais seulement

comme

dsignation (prajnapH).

Lorsque

nat,

dans une direction (ekadigmiikhe),

une grande

(bhyasi, bahutare) masse de couleur (varnarpe), on dsigne cette

masse comme
est petite,

'

long

'.

Lorsque, en comparaison, la masse de couleur

on

la dsigne
les

comme

'

court

'.

Lorsque

la

couleur nat en

grande quantit vers


*

quatre directions, on la dsigne

comme

carr \ Lorsqu'elle nat


'

galement en tout sens, on

la dsigne

comme

circulaire

'.

Les autres
:

figures, le haut, le bas, etc., s'expli-

quent de la

mme

manire lorsque la couleur nat en grande quantit

dirige vers le znith,

on

la dsigne

comme
soi,

'

haut

',

etc.

La
1.

figure n'est

donc pas une chose en


la figure tait

un rUpa.
soi,

Premier argument. Si
c.

une chose en

Le rpa

serait peru par

deux organes \
l'ide

En
etc.
;

effet,

voyant par l'organe de la vue, on a


le

de longueur,
si la

touchant par

tact,

on a
tait

l'ide

de longueur.

Donc
le

lon-

gueur ou toute autre figure

une chose en

soi, elle

serait perue

par deux organes. Or, d'aprs la dfinition scripturaire,


na,
le visible, est

rpyata-

seulement peru par

l'il.

Sans doute le Yaibhque la longueur


:

ika rpondra que le tact ne peroit pas la longueur, mais seulement


le

mou,

le dur, etc.

nous avons

l'ide

de longueur relativement au

mou, au
mais

dur, disposs d'une certaine manire, sans

fasse partie
il

du tangible (sprastavyyatana),

C'est trs juste

en va exactement de
:

mme
long
'

du

visible.

La longueur

n'est pas

visible

on dsigne

comme

'

du

visible (couleur)

ou du tangible

(mou,

etc.)

disposs d'une certaine manire.

Le Vaibhasika rpond.

Lorsque

nous avons

l'ide

de longueur

aprs avoir touch, ce n'est pas que nous percevions la figure par le
tact [5 a]
1.
;

nous nous souvenons de

la figure, parce

que

celle-ci est

[dvigrahant]

10

CHAPITRE

IV,

C.

associe au tangible (shacaryt).

De mme lorsque nous voyons


fleur,

la
;

couleur (visible) du feu, nous nous souvenons de la chaleur (tangible)


lorsque nous sentons l'odeur d'une
couleur.

nous nous souvenons de sa

Dans

les

deux cas que vous allguez, on conoit que

la couleur

rappelle le tangible, que l'odeur rappelle la couleur, parce que les

dharmas en
(mou,
etc.)

cause sont strictement eissocis (avyahliicrt)

tout

feu est chaud, certaine odeur appartient telle fleur. Mais le tangible
n'est
:

pas

invariablement

associ (niyata) avec

une

certaine figure
ra-t-elle le

comment donc

la perception

du tangible provoquede
la

souvenir de

telle figure

? Si semblable souvenir se produit

sans

qu'il

ait association invariable entre tangible et figure,

mme

on se souviendra de

la couleur aprs avoir touch.

figure restera indtermine aprs la perception tactile,

Ou bien, comme
Donc,
il

la

couleur reste indtermine aprs la

mme
tel

perception
n'est

on ne connatra
ne

pas la figure aprs avoir touch. Or

pas

le cas.

faut pas dire que la perception du tangible provoque le souvenir de


la figure.
2.

Deuxime argument. Dans un


nombreuses
figures.
Il

tapis bigarr (citrstarana),

on

voit de

y aurait donc, d'aprs vous, plusieurs

rpas, catgorie
impossible,

figure,

dans un

mme

lieu

(ekadesa)

ce qui est
relle,

comme pour

la couleur. [Si la figure est

une chose

ce qui, dans le tapis,

fait partie

d'une ligne longue, ne peut pas en

mme
3.

temps

faire partie d'une ligne courte.]


'

Troisime argument. Tout rpa


i.

rel

',

susceptible de heurt
rels d'une

(sapratigha,

29
:

b),

bleu, etc.,

comporte des atomes


(bleu, etc.) existe

certaine nature

le

rpa couleur
etc.
(ii.

ncessairement

dans l'atome octuple,

22, trad. p. 144).

Or

3
Il

c.

La

figure n'existe pas

dans l'atome

'.

n'y a pas d'atome de longueur.


il

En

eff'et,

lorsqu'une masse longue

diminue,
l'ide

arrive

un moment o nous n'avons plus son gard


l'ide

de long, mais bien


tat.

de court

donc

cette ide

ne procde

1.

na cdnau

Hitian-tsang,
pas d'un rpa
dsignons
'

xiii, fol.

5 a-5

b.

11

figure

'

existant dans la chose.

Donc

ce que nous

comme

long, c'est

un nombre de choses

relles

(dravya),

atomes de couleur, disposes d'une certaine manire.


Si vous soutenez

que

les expressions, long,

etc.,

portent sur des

atomes de figure (samsthnaparamnu) disposs d'une certaine


manire [5
nature,
b], et

que des atomes qui ne seraient pas

'

figure
',

'

de leur

ne pourraient tre dsigns

comme

'

long

etc.

c'est

simplement rpter votre affirmation sans


ment.

la soutenir

d'aucun argu-

En

effet, si

l'existence d'atomes spciaux de figure tait tablie,


ils

vous pourriez soutenir que runis, disposs d'une certaine faon,


constituent la longueur
:

mais l'existence de ces atomes

n'est pas

tabhe

comme

est tablie l'existence des


'

atomes de couleur, comment

pourraient-ils tre runis et disposs ?


4.

Objection du Sarvstivdin.
si la

Si la figure n'est pas distincte

de la couleur,

figure n'est autre chose qu'une certaine disposition

de couleur, la figure ne pourra diffrer quand la couleur est la


or des cruches de

mme

mme
dit

couleur prsentent des figures diffrentes.

N'avons-nous pas

que Ton dsigne

comme

'

long

'

un nombre

de choses relles disposes d'une certaine manire ? Des fourmis,


toutes pareilles, se disposent en

Hgne ou en

cercle, et

donnent

diff-

rentes figures.

De mme

la figure des cruches diffre sans

que leur

couleur diffre.
5.

Objection du Sarvstivdin.

Mais, dans l'obscurit et de loin,

on voit

la figure d'un objet, colonne,

homme,

etc.,

sans voir sa couleur.

Donc

la figure existe
le fait,

part de la couleur.
la couleur d'une

Par

on voit d'abord

manire indistincte

(avyakta); on se forme ensuite


l'ide

par

la

connaissance mentale

de figure, de

mme

qu'on se forme

l'ide

de fde, l'ide d'arme,

1. Hiuan-tsang, que nous traduisons ci-dessus, s'carte de l'original .... c'est simplement rpter votre affirmation, puisque l'existence de semblables atomes n'est pas tablie. Si elle tait tablie, ces atomes pourraient se runir mais la
: ;

nature propre des parties de la figure n'est pas tablie


les parties

comme

c'est le cas

pour

de la couleur (na ca samsthcinvayavnfft varndivat


[c'est--dire les parties

svabhdvah
:

siddhah)

du 'long' ne sont pas 'longues',

etc.]

comment,

ces parties pourront-elles, par leur runion, donner une figure dtermine ?

12

CHAPITRE

IV,

C.

aprs qu'on a vu, d'une manire indistincte, des oiseaux, des fourmis,
des lphants,
il

etc.

Cette

arme

est dispose en cercle ^

Ou

bien

arrive qu'on ne distingue clairement ni la couleur, ni la figure


;

(anirdhryamnaparicclieda)
connaissance mentale
6.

on connat seulement

par la

une masse (samghtamtra).


critique le Sautrantika.

Le Sarvastivadin

Vous
figure

autres, Sautrantikas, qui niez et le dplacement (gati) et la

(samsthna)

[6 a], quelle est donc la chose qui, d'aprs vous,


le

est dsigne

(prajhapyate) par

terme

vijnapti corporelle

'

Nous

disons que la vijnapti corporelle est la figure

nous spa-

rant ainsi des VatsTputrTyas-Sammitlyas

mais

que la figure n'est

pas une chose en soi (dravya)


tivdins.

nous sparant ainsi des Sarvas-

Le Sarvastivadin.
n'est pas

Si vous soutenez que la vijnapli corporelle

une chose

relle,

mais seulement

la figure qui existe

comme

dsignation, quel est donc le

dharma

rel qui, pour vous, constitue

Tacte corporel ?
L'acte corporel, c'est l'acte qui a pour objet le corps (kydlaniha-

nam, kydkisthnam karma)


qui

c'est--dire la

volition (cetan)
:

met

le

corps en activit (vartayati) de diverses manires


le corps,

elle

procde en s'appuyant sur cette porte qu'est

et est

donc

nomme
voix
;

acte corporel. Les autres actes doivent tre dfinis suivant


:

leur nature
l'acte

[l'acte

vocal est l'acte qui a pour objet (adhisthna) la


l'acte
iv.

mental est
voir

du

manas
dit

ou

l'acte associ

(satnpra-

yuMa) au mana^,
aprs avoir voulu

78

c-d].

Le Sarvastivadin.
.

Le Sotra

que

l'acte

est volition et acte

Si l'acte corporel et l'acte vocal sont volition,

quelle diffrence entre les deux espces d'acte dfinies dans le Sotra ?
II

y a deux sortes de

volition.

D'abord
;

',

stade initial ou prpara-

1.

On

voit

Tanne sans

voir les soldats

cela ne prouve pas que l'arme existe

part des soldais.


2.

De mme on

voit la ligure sans distinguer la couleur.


:

D'aprs Hiuan-tsang. Le tibluin porte

D'abord se produit

telle

ou

telle

rsolution (satnkalpa).

l'acUon est

Quand on a ainsi voulu, une volition se produit dont de mettre en mouvement (vartayati), et qui est l'acte aprs avoir

voulu

*.

Hman-tsdng,
toire

xiii, fol.

5 b-6

b.

13
:

(prayoga), on produit une volition qui est volition pure

Il

faut que je fasse telle

ou

telle

action

c'est ce

que

le

Stra appelle

cetankarman,
tion pure,

acte qui est volition. Ensuite, aprs ce stade de volila volition

on produit une volition d'action, que

de faire une

action en conformit avec ce qui a t voulu auparavant,


corps, mettre la voix
:

mouvoir

le

c'est ce

le

Stra appelle cetayitv kar-

man,

acte aprs avoir voulu.

Le Sarvstivdin.
mation
volition
',

S'il

en est

ainsi, l'acte

appel vijiapti,

infor-

n'existe pas
il

l'acte corporel-vocal, d'aprs vous, n'est

que

n'y a pas de place pour la vijhapti, matire (rpa) de sa

nature. Si la

vljnapH

n'existe pas, Yavijnapti,

non information
\ D'o

',

du domaine du Kamadhatu n'existera pas davantage

un grand

nombre de

difficults qui seront


etc.,

numres plus

loin

(samvarsam-

varbhva,
Il

voir ci-dessous

a-b).
-.

y a moyen de rfuter ces

difficults

Vavijfiapti s'explique fort bien dans notre systme.

Nous pouvons dire que Nous admettons


mis-

deux sortes de volitions portant sur

les gestes corporels et les

sions vocales qui sont, pour nous, ce que les vijnaptis corporelle et

vocale sont pour vous. Ces deux sortes de volitions

qui portent

le

nom
[6 b]

d'acte corporel, d'acte vocal

(kyakarmasamahdita)

sont

capables de produire une volition sui generis qui est Vavijnapti.

est la difficult ?

Le Sarvstivdin.

Cette volition stii generis sera subordonne


ii.

la pense (cittniiparivar'in,

31),

comme Vavijnapti

ne du

dhyna de notre systme (samhitvijnaptivat) du Kamadhatu se dveloppe pendant le sommeil, etc.

or Vavijnapti
(i.

11).

Non
et

pas, car cette volition sui generis est projete par

une certaine

volition (cetanviesa) de dcision

(cetan pure), cause lointaine,


et
si

par une certaine volition de geste

de voix, cause prochaine. Et


elle existait, dpendrait,

quoi que vous en ayez, la vijnapti,

pour

corporel et vocal,

Car Vavijnapti du domaine du Kamadhatu dpend de la vijnapti, acte rpa ; elle n'accompagne pas la pense comme Vavijnapti du Rpadhatu. Voir cependant iv. 75 c-d.
1.

2,

anusangnm punah pratyanusangh.

14

CHAPITRE

VI,

3 d-4

b;

la projection de Vavijnapti, de la force de la volition

car elle est

elle-mme inintelligente (jada).

Les Vaibhasikas disent que


corporelle est figure.

la figure existe

en

soi, et

que

la vijhapti

d.

La vijnapti vocale (vagvijnapti),

c'est le

son vocal

*.

Le son (dhvani) qui

est discours de sa nature


(ii.

c'est--dire le

son articul (varntmaka)

47)

c'est la

vijhapti vocale.

Vamjnapti a

t dfinie
dit

(i.

11, ci-dessus p. 3, n. 2).

Le Sautrantika

que Vavijnapti aussi n'existe pas rellement

(dravyatas) : (1) parce qu'elle consiste seulement ne plus faire une action aprs s'tre engag ne pas la faire (ahhytipetya akaranamtratvt);
(2)

parce que l'on dsigne

comme

avijnapti une chose

qui existerait en raison des grands lments passs (attni

mah-

bhtny updya,
(v.

i.

11)

or les

dharmas
est

passs n'existent plus

25)

(3) parce
:

que Vavijnapti n'a pas la nature de rpa (rpala nature


'

laksanbhvt)
pas
'

du rpa

rpyate

Vavijnapti n'tant
(i.

susceptible de heurt

(apratigha) ne peut tre rpa


Vavijnapti
:

13).

Le Vaibhsika

tablit l'existence de

4. a-b. Car l'Ecriture

dit

que

le

rpa

est de trois espces et qu'il


il

de-l'acte

y a un rpa pur, car il y a croissance du mrite, car pour celui qui n'agit pas lui-mme, etc.
^

y a chemin-

Par
1.

le

mot

et

ctera, la karika vise les raisons ci-dessous 5-8.

Le Stra

dit

que

le

rpa

est de trois espces

Le rpa
.

est

compris dans un

triple ritpa

(rpasya rpasamgrahah)
;

il

y a un

rpa

visible et susceptible de heurt (le visible)


;

il

y a un rpa invi-

sible et susceptible de lieurt (l'il, etc.)

il

y a un

rpa
:

invisible et

exempt de heurt
2.

qui ne peut tre que Vavijnapti \ [7 a]

Le Sotra

dit qu'il

y a un rpa pur (andsrava)


jl]

Quels sont

1.

vHgvijUaptis tu [vgdhvanih

2.

3.

trividhmalarpokticrddhyakurvatpath[dUah] / ROpusunigruImsatra. Comparer Dlglia, iii. 217 Vibhaga,


;

pp. 13, 64.

Hiuan-isang,
ls

xiii, fol.

6 b-7

a.

IS
toute

dharmas

purs ?

Tout

rpa

pass, futur, prsent

connaissance passe, future, prsente, au sujet de laquelle ne naissent


ni affection, ni antipathie, ce sont les

dharmas

purs.

(Ekottarga-

ma,

2, 24).
il

Or, en dehors de Vavijnapti,


sible et

n'existe pas de

rpa

qui soit invi-

exempt de

heurt,

il

n'existe pas de

rpa

qui soit pur. [Car


la

l'acte corporel

ou vocal ne convient pas celui qui est entr dans

vrit
3.
...

du Chemin, mrgasalyasampanna],
dit

Le Stra
Il

qu'il

y a croissance du mrite (punyavrddhi)

y a sept uvres mritoires matrielles (atipadhika punya(iv.

kriyvastu)

113)

lorsqu'un croyant (rciddha),

fils

ou

fille

de

famille, en est revtu

(samanvgala),
qu'il veille, le

qu'il

marche,

qu'il se tienne

debout, qu'il

dorme ou

mrite crot (ahhivardhate)


;

avec intensit, incessamment (satatasamita)


tionnant (upajyata eva
matrielles ?
rielles
...

le

mrite va s'addi-

punyam). Quelles
il

sont ces sept uvres

De mme

y a sept uvres mritoires immat-

'

1.

La Vykhy

cile ici

une partie du discours de Bouddha Gunda sur


p. 185-186, et

les

deux

espces d'uvres mritoires (voir Minayev, Recherches,


iv.

ci-dessous

117

a-b), extrait

voir E. Huber, Sources

Par upadhi,
ou au Samgha

il
;

l'iiistoire de Ghosila dans le Vinaya des SarvstivSdins, du DivyvadSna, BEFEO. 190G, p. 18. faut entendre la chose (rma, vihra, etc.) donne un moine le mrite qui procde (tadbhava) de cet upadhi s'appelle

de

aupadhika. Mahcundastra (Madhyama, 2, 4) saptemni Ciinda aupadliikni punyakriyvastni mahdphalni yvan mahvaistrikni yaih samanvgatasya mddhasya kulapnfrasya va kuladuhifur va carato va tisthato va svapato va jgrato va satatasaniitam abhivardhata eva punyam upajyata eva punyam j katamni sapta / iha Cunda srddhah kulaputro va kuladuhit va cturdisya bhiksusamghyrmam pratipdayati / idam Cunda
:

pratliamam

....

Les uvres mritoires immatrielles ne comportent pas d'oifrande


sistent essentiellement

elles con-

que le fidle prouve de la proximit, de la prsence, de l'audition du Tathgata ou d'un Srvaka. La septime comporte la prise du refuge et l'acceptation des dfenses. iha Cunda srddhah kulaputro va kuladuhit va srnoti tathgatam va
dans
la joie

tathgatasrvakam va

amukam grmaksetram

upanisritya

viharatti

rutv ca punar adhigacchati prltiprmodyarn

udram kusalam

naiskra-

16

CHAPITRE

IV,

a-b.

En
citta),

dehors de Vavijnapti, en raison de quel autre

dharma le

mrit

pourrait-il s'accrotre

mme quand

la pense n'est pas bonne (anya-

mme

lorsque l'on est sans pense ?

4. Si

Vavljnapti n'existe pas, celui qui n'agit pas par lui-mme^

qui donne des ordres autrui, ne sera pas revtu du chemin-de-l'acte

(karmapatha)
meurtre,
etc.

(iv. 66).

Car

l'action vocale qui consiste


le

donner un

ordre (jFipanavij fiapti) ne peut constituer


;

chemin-de-l'acte,

cette action

en

effet

n'accomplit pas actuellement l'acte


l'acte est

accomplir. Dira-t-on que, lorsque

accompli, l'action qui


il

consiste donner l'ordre devient chemin-de-l'acte ? Mais

est vident

que la nature de
l'ordre.
5.

cette action n'est

pas modifie par l'excution de

Bhagavat a

dit

Moine,

les
*,

dharmas, source externe de connon comprise dans

naissance (bliyam

yatanam)

les

onze yatais).

nas
pas
Si

[7 b], invisible,
dit

exempte de heurt
soit

(Samyukta,

13,

Il

n'a

que

le

dharmyatana

non-rpa.
est

Bhagavat n'avait pas en vue Vavijhapti, qui


dans

rpa

et qui

le dharmyatana [et non pas dans le rpyatana], rwpa inclus dans le dharmyatana ? 6. Si Vavijnapti n'existe pas, le Chemin n'a plus ses huit membres, car trois membres, samyagvc, samyakkarmnta, samyagjiva

est incluse

quel serait le

(voix, activit,

manire de vivre correctes)

(iv.

86)* sont incompatibles

avec

le

recueillement (samdhi). Si l'ascte, dans l'tat de recueilletrois

ment, possde ces

membres,
(vi.

c'est

que ces

trois

membres sont

de leur nature avljnapti.

67, 68)

myopasamhitam
vastu.

idam Cunda prathamam niraupadhikam putiyakriyp.

Voir Siksftsamuccaya,

137 (RatnarfiisQtra), Madliyamakavftti,

p.

309 et

sources cites dans les notes.

Anguttara, ii. 50, 54 et les discussions dans Kathavatthu, 5 paribhogamayatn punnam vaddhali et x. 9 samadnahetukatn sllatn Le Kathavatthu touche d'autres points en relation avec la doctrine vaddhati. de Vavijnapti, viii. 9, x. 8, 11.12. dharnio bhikso [bhyam 1. D'aprs la Vyftkhya cette citation commence yatanam...] Je pense qu'il faut corriger dharnUi bhikso, voir i. 85 a-b, p. 65 de

Sources plies
:

vii.

notre traduction.

iiian-tsang,
Mais, rpliqiiera-t-on,
il

xiii, fol.

7 a-7 b.

17

le

Stra
le

dit

Lorsqu'il connat ainsi,


le

quand

voit ainsi, la

samyagdrsti,

samyaksamkalpa,

samyagvyy;

la

ma, la samyciksmrti, le samyaksamdhi sont cultivs et achevs samyagvc, le samyakkarmnta et le samyagjlva ont t auparavant purifis. Donc les trois derniers membres sont consi'

drs

comme

vijnapti et

comme

antrieurs au recueillement.

Ce

texte, dit le

Vaibhasika, ne vise pas les trois derniers


l'activit et la

membres
le

du Chemin, mais bien la voix,


l'tat

manire de vivre de

de dtachement (vairgya) qui ont t obtenues par

chemin
ne

mondain (laiikikamrga). Cela n'empche pas que


fasse partie
7.

la voix, etc.,

du Chemin sous forme d'avijnapti.

Si Vavijnapti n'existe pas, la discipline


(iv.

(samvara) de

Prati-

moksa

14 a)

disparat.

Ce dharma

n'existe pas en vertu duquel


les

une personne qui a assum (samdna)

vux

de religion est

Bhiksu ou Bhiksuni, sa pense


8.

fut-elle

mauvaise ou non-dlnie.
est

Le Stra enseigne que

le

renoncement au pch (virati)

une

digue qui arrte l'immoralit l

Une absence
*

'

(ahJiva) ne peut tre

une digue
1.

la virati est

donc un

dharma

rel (avijnapti), et
....

non
I

evant jnata

evam pasyatah samyagdrstih

hhavith paripiirnh

tasya vkJcarmntjlvh prvam parisiiddhh paryavadth j 2. Le Kathavatthu nie que le samvara soit kamma (xii. 1). Comparer Sumangalavi3. viratih setubht dauhslyam pratibadhnti. l&sin, 305, la troisime sorte de virati, propre aux ryas et non susceptible d'tre rompue, setugJitavirati Atthasalin, p. 103, samucchedavirati ; ci-dessous V. 33 a-b. La Dhammasangani, 299, dfinit la parole droite (samnivc) : catlii vacduccaritelii rati virati anatikkamo setughto. D'aprs Buddhaghosa (Atthasalin, p. 219) setum hanatti settiyhto la parole droite est la destruction (ghta) de la digue par o passent les pchs de la voix. La traductrice (Psychology, 87) adopte cette interprtation et renvoie Anguttara i. 220, 261, ii. 145. setu Mais, dans ces passages, on peut entendre setughta setuhandha digue, obstacle Bhagavat a dclar que le maithuna est setughta . Donc, moines, qu'il y ait setughta en ce qui concerne le rire . Le Nigantha enseigne

...

qu'on dtruit les actes anciens par la pnitence et qu'on les endigue (setughta)
par l'abstention (akarana)
d'une digue
torrent
. .

La Mahvyutpatti,
:

255, 9

setusamudghtya ; version

tibtaine

en vue d'arrter
les

les

version chinoise

en vue d'arrter
p.

sniparyiknm passions au moyen passions comme un


du Nirvana
:

Voir aussi Madhyamakavrtti,

525

la

dfinition

jalapravhanirodhabhtasetusthnlyah padrthah.
2

18
pas seulement

Chapitre
le seul fait
le

iv,

a-b;

de ne plus accomplir l'action laquelle


le

oii

a renonc, ainsi que

Sautrantika

soutient (p. 14^ 48).

Le Sautrantika rpond.
l'autre.
1.

Ces arguments sont nombreux


Nous
les
le

et divers

[8 a], mais ne sont pas concluants.

examinerons l'un aprs

Le Stra enseigne que


*

rpa

est de trois espces.

Les Yoga-

caras

disent que

dans

les

dhynas, par
est l'objet

la force

du recueillement

(samdhi), un rpa nat qui

du recueillement (samdhipar la

visaya

= samdher
recueillie,

lamhanam),
vu par

c'est--dire qui est peru


le

personne
(vi.
*

par exemple, dans Vasuhhahhdvan,


l'il
;

squelette

9).

Ce rpa
*

n'est pas

il

est

donc

invisible. Il
:

ne

couvre

pas,

il

n'occupe pas un lieu (desnvarana)


'.

il

est

donc

exempt de heurt

Si vous

demandez comment

cet objet

du

recueil-

lement peut tre rpa, puisqu'il ne possde pas


tuels

les caractres habi-

du rpa, vous oubhez que votre avijhapti donne

lieu

la

mme

question.
2.

Le Stra

dit qu'il

y a un rpa pur (ansrava).


le

Les Yogacaras soutiennent que


1.

rpa
:

qui nat par la force du

mal

hbyor spyod pa dag

(sin-kieu kon-hng ch)

Paramfirtha Les anciens matres de Yogacfira Hiuan-tsang y-kia-ch. Kiokuga a une note
:

dveloppe 7b-8a.
11

rsulte de la Vyfikhyfi

que

le

terme Yogcara ne dsigne pas


:

ici

l'adepte

Le Yogficfira qui se rend prsent le Chemin (tnrgam sammukhlkurvnah) prend possession d'une disposition mentale (aya) et d'un substrat psycho-physique (raya) tels qu'il prend possession de la moralit pure (ansrava la) comme il prend possession de la vue droite cette moralit pure tant acquise, il rside dans la moralit dite naturelle (prakrtiilat). Ou hien(atha u; les Matres soutiennent que, dans le recueillement pur mme, il y a un rpa de mme nature, c'est--dire
d'une certaine cole philosophique mais simplement J'ascte

pur (ansrave

'pi

samdhau tadevamvidham rpam


: .
.

ta

acry

icchanti).

iksfisamuccaya, 138 yadi bhiksavo bhiksur yukto yogcro marna iksytn

pratipannah sarvasamskresv anityadari Sur yogcara dans Mahfivastu, 120, 9, voir


i.

les

remarques de

l'diteur,

i.

469.

Le passage
i.

est obscur.
:

Suivent quelques rfrences releves dans l'Abhidharmakoa


17.

Vy&khyfi

Dans

le

systme (darana) des Yog&c&ras,

le

manodhiu

est distinct des six vijnnas.

Hiiian-tsang,

^iii,

fol.

7 b-8

a.

19

recueillement est pur, lorsque le recueillement est pur \

D'autres docteurs, les Darstantikas ^ soutiennent que le

Arhats (organe de

la vue, etc.) et le
(i.

dire les cinq objets des sens

a),

rpa des rpa externe (hhya), c'est-sont nomms purs (ansrava)

parce qu'ils ne sont pas support (raya) des vices (&rava).

A
tion
est
:

ceci

on peut objecter que


les

le

Stra s'exprime sans faire de distinc?

Quels sont

dharmas impurs (ssrava)


...

Tout ce qui

organe de la vue, tout ce qui est visible


les

Le Drstantika rpond que tous


aux vices
seuls, en effet, les

dharmas

viss dans ce Stra

sont qualifis impurs parce qu'ils ne sont pas opposs (pratipaksa)


:

pense-et-mentaux (cittacaitta) peuvent

s'opposer aux vices et les dtruire.

ceci

on objectera que
et

les

mmes dharmas

seraient la fois

(paryyena)

impurs, parce qu'ils ne s'opposent pas aux vices, et

purs, parce qu'ils ne sont pas support des vices,

avec cette cons-

quence fcheuse que


dus.

les caractres

de pur

et

d'impur seront confon-

Non

pas, rplique le Drstantika, car ces


ils

dharmas ne
si le

sont pas
visible et

purs du point de vue dont


i.

sont impurs. D'ailleurs,

41.

ii.

24.

Le VijMiiavdm dfend la thse vijnnam payati. La Vyakhy cite la dfinition que les yogcraciUas donnent de
:

Vadhhnukti
ii.

(p.

154, n, 5 de notre traduction).

44.

d.

Doctrine des anciens matres sur les sampattis cite par les
(p.

SautrSntikas
iii.

212 de notre traduction).


:

Les anciens matres du Gandharva. Bhasya Vyakhya prvcry yogcr rysangaprabhrtayah.

15

c.

Dfinition

Opinion des anciens matres d'aprs la iii. 63 a-b. Phases de la lune. Vykhya, les Yogacras. Les anciens matres *, c'est--dire, d'aprs la Vyftkhyfi Dans iv. 75. Bhasya le systme (^nayena) des Yogacras. D'aprs les Yogacras ('Hnati), il y a 128 kleas. V. 8. Vykhya V. 43 b-c. Dfinition des avarabhgyas attribue des apare. Ces autres
;
: :
:

docteurs
vi.

sont les Yogacras (Vyakhy).

10 a-b. L'ascte (yogcr) qui pratique Vatibh est de trois sortes,


....

dikarmika
1.

ansravasamdhv ansravam rpatn samdhibalajam.


D'aprs la glose de l'diteur japonais,
p. 14.

2.

Sur ce point de doctrine voir

i.

31 d

et

Vyakhy,

O
les autres

CHAPITRE

IV,

a-b.

yatanas
:

taient exclusivement impurs, [8 b] pourquoi le

Su ira

spcifierait-il

Les rpas impurs


\
..

et

provoquant
et

updna

(ssrava

updmya)

les

dharmas impurs
47)
^

provoquant upd-

na

sont la cause des endurcissements de la pense et de l'iiypocrisie


(v.

(cetahlcMlamrakmvastu)
3.

Le Stra

dit

que

le

mrite s'accrot.
:

Les anciens matres (prvcrya) disent


choses (dharmat)
qui ont reu
le
^

Telle est la nature des

que

le

mrite s'accrot lorsque les personnes

don

utilisent ce

don

en raison des qualits de ces

personnes (giinavisest) (dliyna, recueillement de bienveillance,


etc.),

en raison du bnfice qu'elles tirent du don pour elles-mmes


les tres

ou pour tous

(anugrahavisest

= arravarndbalt),

les

sries mentales

(samtatayas) des donneurs, eussent- ils des penses

mauvaises ou non-dfmies (anyacetasm dtrnm), se trouvent parfumes (parihhvita) par


personne qui reoit
ascendante
et
:

la volition de

don qui a eu pour objet

la

ces sries subissent

une

subtile transformation

arrivent ce stade
la

(sksmam parinmavisesam
dit
le
:

prpnuvanti) qu'
fruits.

fm

elles

sont capables de donner beaucoup de


le texte

C'est dans ce

sens que

Le mrite

s'accrot

*.

d'une manire intense et non interrompue,

mrite s'addilionne
le

Mais comment expliquer l'accroissement du mrite dans


l'uvre mritoire immatrielle (niraupadhika) ? [9 a]

cas de

La

srie

mentale se transforme en raison de la rptition de

voli-

tions ayant pour objet le

Tathagata
durant

et les

Sravakas (tadlambana(svapnesii) ces volitions

cetanhhyst).

Mme

les rves

vont s'enchanant.
1.

L'expression

(dfinition des

ssava updnya dans Samyuita updnaskandhas).


;

iii.

47,

Anguitara

iii.

248

Mahfivyutpalti, 10, 24 vypdakhi2. paiica cetokhila, Dgha, iii. 237, q. v. 3. dharmnm andiklik aktih. ladvesa ; tib. tha-ba. Coiument les qualits et les services Si on dit 4. Hiuan-isang ajoute ici d'une certaine personne produisent>ils une transformation quelconque d'une autre personne qui pense autre chose ? Cette difficull se prsente aussi dans la
: : :

thorie

de Vavijnapti
fontils

comment

les

qualits
soi,

et

les

services d'une certaine

personne

qu'une certaine chose en

Vavijnapti, naisse dans une autre

personne ?

Hhian-tsang,

xiii, fol.

8 a-9
le

b.

21

Par contre, nous ne voyons pas comment

Vaibhasika, partisan
le

de Vavijnapti, peut expliquer la croissance du mrite dans

cas

de l'uvre mritoire immatrielle. Celle-ci ne comporte pas d'acte


corporel ou vocal, vijnapti, mais seulement la joie prouve l'endroit

du Tathgata ou d'un Sravaka

elle

ne comporte pas davantage


le

le recueillement.

Or Vavijnapti ne peut natre, d'aprs


elle est

Vaibhasika,
ici.

que de

la

vijnapti ou du recueillement. Donc

impossible
le

D'aprs d'autres docteurs, une varit de Sautrantikas, dans


aussi des

cas

uvres mritoires matrielles,

le

mrite procde de la

rptition de la volition ayant pour objet la personne qui reoit.

Mais

cette opinion est inadmissible en prsence

du Stra qui

dit

Lorsqu'un Bhiksu nergique, revtu de moralit, possesseur de

bons

dharmas, mange l'aumne du donneur,

entre ensuite

et

rside dans les recueillements

nomms

infinis

'

(bienveillance, etc.),

en raison de ce

fait

se produira

certainement (pratiknksitavi/a)

pour

le

matre d'aumnes qui donne (dyaka dnapati) efflux de


*

mrite, efflux de bien (Jualbhisyanda) et bonheur.

Or

le

matre

d'aumnes dont

le

mrite va ainsi s'accroissant

a-t-il

une

volition
Il

spciale (cetanvisesa) ayant pour objet la personne qui a reu ?

faut donc prfrer l'opinion des premiers matres

dans

le

cas de

l'uvre mritoire matrielle,

le

mrite procde d'une transformation

de la srie du donneur en raison des qualits de la personne qui


reoit.
4.

D'aprs

le

Yaibhasika,

si

Vavijnapti n'existe pas, celui qui

fait

accomplir l'action par autrui ne sera pas revtu du chemin-de-l'acte.

Lorsque
tion subisse

l'missaire charg du meurtre accomplit le meurtre, la

nature des choses veut que la srie mentale de l'auteur de l'instiga-

une certaine

subtile transformation [9 b] en vertu de


Il

laquelle cette srie portera plus tard des fruits.

en va de

mme

lorsqu'on agit par soi-mme

au moment o

le

chemin-de-l'acte

Comparer Anguttara ii. 54 et le Ratnaraistra, cit Siksasamuccaya, La phrasologie de notre Stra diffre de ces deux sources Hiuan-tsang s'carte ici du tibtain il porte Un efflux de mrite mouille sa srie et un sukha sans mesure coule dans son corps ,
1.

p. 138.

22

CHAPITRE

IV,

a-b.

(meurtre, etc.) est achev (kriyplialaparisampimi), ce


la srie subit

une transformation. Cette transformation

moment reoit le nom


l'effet

de chemin-de-l'acte, et par consquent l'homme dont la srie est

transforme est revtu du chemin-de-l'acte


(transformation de la srie)
le

car on donne

nom

qui convient au propre la cause

(chemin de

l'acte),

et cette

transformation est dite corporelle ou

vocale suivant qu'elle rsulte d'un acte du corps ou de la voix. C'est

en vertu des

drent Vavijhapti
corporel ou vocal.

mmes principes que les partisans de Vavijnapti consicomme chemin-de-l'acte, comme chemin-de-l'acte
'

Le Bhadanta
de Vavijhapti
:

(Vibhaa, 118,

le)

tabht diffremment l'inexistence


le

Un homme est touch (sprsyate) par

pch (ava-

dya) de meurtre en raison d'une


(upttesu skandhesUy
je tue, c'est tu.
'

volition tritemporelle (triklay

cetanay) l'gard des skandhas qui constituent un tre vivant


iv. 73), c'est--dire

lorsqu'il

pense
:

je tuerai,

[Le chemin de l'acte est complet

prparatif,
iv.

acte principal, conscutif, et consiste seulement en cetan,

68

c].

Mais, dirons-nous, cette triple volition ne ralise pas l'achvement


du chemin-de-l'acte
;

car, d'aprs la thorie


iv.

du Bhadanta,
qui dirait
fait
:

il

y aurait

pch mortel (nantarya,


est tue , alors

97) pour le

fils

ma

mre

que

celle-ci n'a

pas t tue en

par l'missaire

charg du meurtre. Cependant tout cet exercice de volition (cetan-

samudcra)

je tuerai, je tue, c'est

tu

ne convient (yiiktarpa)
:

qu' celui qui tue lui-mme

(svayam ghnatas)
'.

l'intention

du Bha-

danta est de viser ce type d'assassin


Mais, demande

le

Sarvastivadin, pourquoi cette antipathie qui vous

fait nier l'existence

de Vavijnapti et admettre la transformation de


ii.

la srie mentale

(samtatiparinmaviesa,

36

c-d) ?

le Bhadanta est Dharmatr&ta. (Voir i. 20 a-b). upttesu skandhesu (= sattvasatfikhytesu vartamdnesu skandhesu) trikdlay cetanay prntiptcadyena spryate (ghutaka iti) hanisymi hannti hatam iti crSya yad bhavati.
1.

D'aprs P'ou-kouang,

2.

3.

D'aprs Hiuantsang

Cependant

celui qui a cette triple volition


il

en accom-

plissant lui-mme, sans erreur de personne, l'action de meurtre,


le

est touch par

pch de meurtre. Si Bhadanta vise ce cas, c'est correct

Hiiian-tsang,

xiii, fol.

9 b-10

a.

2S
et la trans-

A
deux

la vrit, et

Vavijnapti, doctrine des Sarvastivadins,

formation de la srie mentale, thse des Sautrantikas, sont toutes


difficiles

constater (duhkhabodha)

je n^ai

donc pas d'anti-

pathie pour la premire. Mais que, au

moment de l'achvement du
celui qui

chemin-de-l'acte par une opration corporelle dpendant d'une pense

(cittnvayakifaprayogena) [10 a] naisse, chez


le

a ordonn

chemin-de4'acte, un certain

dharma, nomm
le

avijnapti, qui n'a

rien voir
soit

(prthaghhta)

soit

avec la pense de celui qui a ordonn,


meurtre, cette hypothse
;

avec

le

corps de celui qui a accompli

ne peut nous satisfaire (na pariioso 'smkam)

que, au

moment de

Tachvement du chemin-de-l'acte par une opration ordonne par


une certaine personne (yatkrtapt'ayogasamhhta), se produise, en
raison de cette opration (tannimitta), une transformation de la srie

mentale de cette personne, cette hypothse nous

satisfait.

Et ceci aussi

nous

satisfait

que

le fruit

naisse de la transformation de la srie et

non pas de Vavijnapti.


Tenez compte aussi des arguments numrs ci-dessus
n'existant pas,
:

\avijnapti

comment y

aurait-il

avijnapti ?

Vavijnapti
Vavijnapti

consiste seulement ne plus faire une certaine action

ne peut dpendre des grands lments du pass


5.

Le dharmyatana

n'est pas dfini

comme

immatriel.
:

La
:

rponse cette objection a t donne plus haut


invisible, non tendu (apratigha), faisant partie du

il

y a un rpa

dharmyatana

ce n'est pas Vavijnapti


et qui nat

c'est le

rpa

qui est l'objet du recueillement

de la force du recueillement

(dhyyinm samdhivisayo

rpam samdhiprahhvd
6.

utpadyate).

Le Chemin,

dit le

Yaibhasika, n'aurait pas huit membres.

De
dans

quelle manire pensez-vous que le saint, lorsqu'il se trouve


le

Chemin (mrgasampanna),
possde parole, activit
qu'il et

lorsqu'il voit

ou mdite

les

vrits,

manire de vivre correctes ? Entenqu'il agisse

dez-vous

prononce une parole correcte,

d'une manire

correcte, qu'il soit correctement

en qute du vtement religieux ?

Telle n'est pas notre pense, rpond le Sarvastivadin.

Le saint

prend possession, dans

le

Chemin, de certaines avijnaptis pureg,

24
telles que, lorsqu'il sort

CHAPITRE

IV,

a-b.

de la contemplation (vipasyan), par la force


il

de ces pures avijnaptis

produira parole, activit et manire de

vivre correctes, et ne produira pas parole, activit et manire de vivre incorrectes.

La cause (nimiita)

reoit le

nom

de

l'effet

[10 b]

on dsigne donc Yavijnapti comme parole,


vivre.
S'il

activit et

manire de

en est

ainsi,

pourquoi ne pas accepter


le saint, lorsqu'il

ma

thoiie ?

Il

n'y a pas

d'avijnapti ; mais
possession de
telle

se trouve dans le Chemin, prend


*

intention (aija) et de telle personnalit (dsraya)

que, sortant de contemplation,


facteurs
il

en raison de la force de ces deux

produira dsormais parole, activit et manire de vivre

correctes.
et

On donne

la cause (aya
le

et

sraya)

le

nom

de

l'effet

nous pouvons donc affirmer que

Chemin possde

les huit

mem-

bres.

D'aprs une autre opinion,

le

membre du Chemin

consiste seulefaut-il

ment dans

la

non-commission (tadakriymtra). Que

entendre

par non-commission ?
acquiert, par la force

L'homme

qui se trouve dans le recueillement

du Chemin, l'abstention certaine ou absolue

(akarananiyama, vi. 33 a-b). Cette abstention, tant acquise en s'appuyant sur le Chemin pur, est pure. C'est le membre du Chemin.
1. aya craya ceti j ayahprntiptdyakaranayah raddhPar intention il faut dyayo va / raya srayaparvrttih (VyfikhyS). entendre l'intention de ne pas commettre le meurtre, ou l'intention de foi. Quand on dit que cet ascte obtient un certain sraya, on veut dire qu'il y a pour lui modification (parvrtti) du substrat psycho-physiologique. {Vraya est dfini

'

'

5, 6, 36 c-d, 44 d.) P'ou-kouang explique h'saya consiste en chanda, ou en adhimukti, ou en chanda et en adhimukti... Vsraya est la cetan qui se produit en mme temps que Vsaya elle sert de support (raya) Vaya Le sens de parvrtti est nettement marqu dans Vyftkhya iv. 14 c Lorsque
ii.
: ; :

le

sexe de la mre ou du pre est parvrtta, c'est--dire lorsque la qualit de mre

ou de pre est dtruite par la parvrtti du sexe. * L'cole d'Asanga a hrit de l'expression rayaparvrtti, Satralamkfira,
ix. 12.

Il s'agit,

comme

dit S. Lvi,

d'une rvolution du fonds


:

mme

de

l'tre,

de

l'apparition d'une nouvelle personnalit

le

Pfthagjana devient un rya,

la

femme

devient homme, l'homme devient animal,

etc.

Sur parivftti, voir

vi.

41.

Hiiian-tsang,

xiii, fol.

10 a-11

a.

25
une
'

Sans doute,
les

le

membre

(parole correcte, etc.) n'est pas


:

chose

'

(dravya), n'tant qu'abstention

mais ce ne sont pas

les

seules

choses relles et distinctes qui constituent des dharnias; par exemple,


huit

dliarmas mondains

*
:

possession,

non-possession, gloire,

non-gloire, louange, blme, plaisir, souffrance.

La non-possession du

vtement, de la nourriture,
iv.

etc.,

n'est pas

une chose. (Anguttara,

157, Dlgha,
7.

iii.

260)

Si Vavijnapti n'existe pas, dit le Vaibhsika, la discipline de

Pratimoksa disparat.

On

rfute cette objection d'aprs les

tat de la force de l'intention (saya). la volition (cetan) qui, aprs qu'elle

mmes principes, en faisant La discipline (samvara) est


com-

a t traduite dans l'affirmation

(vidhi) de l'abstention du pch, dans l'engagement de ne plus

mettre

le

pch, arrte les mauvaises actions et discipline (samvr:

noti) le corps et la voix

c'est ainsi qu'il

faut entendre la discipline


si

de Pratimoksa.

Le

Vaibhsika objectera que,

la discipline de

Pratimoksa
cette

est volition [11 a], le religieux qui


'

pense autre chose que


',

pense de volition cessera d'tre

disciplin

car

il

ne possde

pas alors la volition qui discipline. Cette objection est sans valeur.

En

effet, la srie

mentale est parfume (bhvan) de

telle sorte

que,

lorsqu'une pense de pch vient surgir, la


de l'engagement pris
8.
:

mmoire aussi

surgit

la volition d'abstention se trouve


le

donc prsente.

Et cette volition a

caractre d'une digue. Lorsqu'on s'est

oblig ne pas
la

commettre
(ii.

le

pch, on se souvient de cette obligation,

honte

(Jir)

32) est prsente, on se contient de manire ne

pas violer la moralit.

Dans votre systme, au


mmoire

contraire, si l'immoraht est endigue par


la

une avijnapti indpendante de


fait

mmoire, l'homme

mme

qui la

dfaut (musitasmrti) ne pourrait commettre le pch,


l.

puisque Vavijnapti est toujours

Nous
existe

arrterons

ici

cette discussion.

Les Vaibhasikas disent


siii

qu'il

une certaine chose en

soi (dravya),

generiSj qui

est

r avijhaptirpa,
1.

De nombreuses

et divergentes dfinitions des huit

lokadharntas, Vibhfis,

183,8.

26

CHAPITRE

IV,

-6.

On

a vu

(i.

11b) que Vavijnapti


:

nat en

dpendance (upddya)
si elle

des grands lments

la question se

pose donc de savoir

drive

des grands lments qui sont le point d'appui de la vijnapti, c'est-dire

des grands lments du coi*ps par lequel est accompli l'acte

nomm
ments
'.

vijhapti

(iv. p. 3, 29),

ou

si

elle

drive d'autres grands l-

Vavijnapti drive de grands lments


vent d'appui la vijhapti : car
il

diffrents de

ceux qui ser-

est impossible qu'un

mme complexe

(smagr) des quatre grands lments produise un rpa driv


(hhautika,
sier, la

updyarpa) subtil, Vavijnapti,

et

un rpa driv gros-

vijnapti l
est simultane

La vijhapti
en
va-t-il

aux grands lments dont

elle

drive

de

mme

de Vavijhapti [11 b] ?

La

rgle gnrale est que tout

rpa

driv est simultan ses


et futur, drive

grands lments. Mais certain rpa driv, prsent


de grands lments passs
:

c-d.

Au

del du premier

moment, Vavijhapti du Kamadhatu

nat en drivant de grands lments passs \

Au moment

o nat Vavijhapti,

elle nat

en drivant de grands

lments simultans sa naissance.

Au

del de ce premier

moment,

Vavijhapti du domaine du Kamadhatu


ne de

dhyna

et

Vavijhapti
en

par opposition Vavijhapti pure 28)


(p.

nat, c'est--dire

continue de

renatre,

drivant (updya) des

mmes grands
:

lments du premier moment, qui sont maintenant passs

ces grands

Elle dpend 1. Hiuan-lsang a ici deux pdas qui manquent dans Paramfirtha (updadti) de grands lments diffrents de ceux qui sont le point d'appui (rraya) de la vijnapti. Vibhfisa, 132, 4. 2. Certains matres disent que la vijiapti et Vavijnapti naissent des mmes quatre grands lments. Ils demandent Y a-t-il quatre grands qui produisent deux dyatanas, deux rpas ? Oui, ils produisent rpyatana et dharmyatana, ahdyatana et dharmyatana. Le Bhadanta Ghosaka dit Les matres d'Abhidharma disent que ce n'est pas correct il est impossible que les mmes (Vibhftsfi, 132, 4), quatre grands produisent un fruit subtil et un fruit grossier
: :
:

3.

ksanHd rdhvam avijnaptih kmpttUabhtaj

Ij

Hitian-tsang,

xiii, fol.

11 a- 12

a.

27
le

lments passs constituent, partir du deuxime moment,


d'appui (raya) de Vavijnapti, car
ils ils

point

sont la cause de seipravrtti,


;

sont sa cause projectrice (ksepakrana)

les

grands lments
le

simultans chacun des


port

moments

partir
ils

du deuxime sont

sup-

(samnisraya) de Vavijnapti, car

vrtti, ils

anusupport (adJiisthnakrana). De mme, sont sa cause de


sont la cause de son
la roue et le sol qui supporte la roue, sont causes
et

la

main qui a lanc

de pravrtti

d'amivrtti du

mouvement de

la roue. (Voir p. 37)


et

A
et

quelle

terre (kutastyni),

Kmadhatu

quatre dhynas,

appartiennent les grands lments dont drivent les actes corporels

vocaux des diffrentes terres ?

5
terre

a-c.

Impur,

l'acte corporel et vocal drive des


il

grands lments

de la terre laquelle

appartient

pur, des grands lments de la


le

laquelle appartient la personne qui

produit

*.

L'acte corporel ou vocal du

Kmadhatu

drive de grands lments

du Kmadhatu,
quatrime

et ainsi

de suite jusqu' l'acte corporel ou vocal du


drive

dhyna
a]

qui

de grands lments du quatrime

dhyna. [12
o
est

Pur, l'acte corporel ou vocal drive des grands lments de la terre

ne la personne qui

le

produit

car les

dharmas

purs sont
etc.)
;

transcendants (apaiita) aux sphres d'existence (Kmadhatu,


car
il

n'existe pas de grands lments purs d'o pourrait driver


;

un

acte pur

car l'acte corporel ou vocal pur nat en raison de grands

lments, et non pas par la seule pense, puisqu'il est

rpa

driv

(updyarpa) (Vibha,
Quels sont

140,

i5).

les caractres de ces

deux

actes, vijnapti et
ils

avijnapti ?

quels sont les caractres des grands lments dont


I.

drivent ?

L'auteur examine d'abord Vavijnapti.


d-6.

Uavijnapti
;

n^est pas intgre

l'organisme

elle est

aussi

d'coulement
1.

elle

appartient seulement

aux

tres vivants.

Non
].

zag

ssravam kyavkkarma [svaklyabhtahetukam med gan du skyes pa yin,

ansravam

28
recueillie, elle drive

CHAPITRE

IV,

5 d-6.

de grands lments qui sont d'coulement, qui

sont intgrs l'organisme, qui sont diffrencis.

Ne du

recueille-

ment,

elle drive

de grands lments non diffrencis, non intgrs


'.

l'organisme, d'accroissement
1.
^

Vavijnapti
donc
c).

est
;

un rpa driv exempt de masse (amrta),


elle

intendu (apratigha)

ne peut donc tre support de pense

et

de

mentaux
riel
(i.

elle est

anuptta, non intgre l'organisme senson'est


'

34

U avijhapti
*
;

jamais non dfinie


(i.

(iv.

7 a)

donc

elle n'est

pas

ne de rtribution

37)

elle n'est
(i.

pas d'accroisse-

ment

(i.

36)

reste qu'elle soit d'coulement


(ii.

36), c'est--dire pro-

duite par le

sabhgahetu

52). [Le texte dit: aussi d'coulement ,


(i.

parce que Vavijhapti peut tre aussi ksanika

38

b)

la

premire

avijnapfi pure n'est pas d'coulement.]


2.

Non

recueillie

(asamhita, viksipta) ou, en d'autres termes,


elle

appartenant au Kamadhatu, [12 b]


qui sont d'coulement
^

drive de grands lments

et qui sont intgrs

l'organisme. Ces grands

lments sont diffrencis, parce que chacune des sept avijhapiiSy

renoncement au meurtre,

etc.,

que comporte

la discipline de Prati-

moksa, drive d'un groupe


3.

distinct des quatre

grands lments.
qu'il

Ne du

recueillement (samdhija),

sans

ait

lieu

de

distinguer la discipline de dliyna et la discipline pure qui naissent

respectivement du recueillement impur (ssrava)

et pur,

Vavijhapti

ou discipline (samvara) drive de grands lments d'accroissement

(aupacayika) qui sont produits par

le

recueillement

(i.

37

a),

de

grands lments non intgrs l'organisme. Les sept renoncements


qui constituent la discipline sont distincts, mais tous

au meurtre au renoncement

la parole oiseuse

du renoncement drivent d'un mme


pense qui engendre
jj

groupe des quatre lments. De


1.

mme

que

la

D'aprs Hiuan-tsang.

L'original est plus concis: avijnaptir amipUikd

naisyandikl ca sattvkhy nisyandopttabhfitaj / satndhijnupdUaupacayikdbhinnabhtaj // 2. La version tibtaine omet ce premier paragraphe, que j'tablis d'aprs Hiuantsang et la Vyakhya. 3. Vyakhya samutthpakacittpksatvAd asamhitacittdvijnaptyadhikrac ca na svapnasamdhydyaupacayikamahbhtaj.
:

iliuan-tsang,
ces renoncements est unique, de

xiii, fol.

12 a-13
les

a.

29
les-

mme

grands lments sur

quels s'appuient les renoncements constituent une unit.

IL

En
'.

ce qui concerne la vijnaptL


est d'coulement
;

La vijnapti
nisme

corporelle, elle est intgre l'orga-

On demande

si la

vijnapti

corporelle*,

en naissant, dtruit ou ne
prexistante,

dtruit pas la figure corporelle

(samsthnasamtna)
car
est contraire

qui est rtribution (vipka). Les deux hypothses font difficult.


Qu'elle la dtruise,

impossible

il

aux principes

des Vaibhasikas qu'un rpa, rtribution de sa nature, re-continue

(punahprahandha), aprs avoir


Si,

interrompu

(i.

37, trad. p. 69).

au contraire,

la vijnapti corporelle

ne dtruit pas la figure ant-

rieure,

deux figures (samsthna'dvaya), la premire de rtribution,

la

seconde d'coulement, se trouveront coexister dans un


Il

mme

lieu.

faut admettre que la vijnapti corporelle nat en drivant de


et

nouveaux grands lments, coulement de leur nature,


pas la figure antrieure.
S'il

ne dtruit

en va ainsi,

le

membre au moyen duquel


les

est produite

une

vijnapti corporelle sera plus grand [13 a] qu'il n'tait antrieurement,


tant pntr

(ahhivypana) par

nouveaux grands lments d'o


n'tait pas pntr

drive cette vijnapti. Si le

membre

par ces noupar


le

veaux lments, on ne pourrait dire que Vavijnapti

est faite

membre

tout entier.
le

Nous rpondrons que


pour
les

corps

rtribution de sa nature
:

prsente des vides (siisiratvt kyasya)

il

s'y trouve

donc place

nouveaux grands lments, coulement de leur nature, d'o

drive la vijnapti.

de cette phrase deux pdas La vijnapti est seulement Le Bhsya de Hiuan-lsang ajoute Pour le reste, elle est comme Vavijnapti de non recueillement. On objecte un passage du Sstra ynlmny upsakasya paiica sikspadni esrn katy tipttni katy anupttni / Ciha / sarvny anupttcmi. Cette dfinition n'est pas fautive parce qu'elle vise les ikspadas en tant ({u'avijnapti, ou parce qu'elle est gnrale (bdhulikatvt).
1.

Hiuan-tsang
....

fait

d'coulement

Iapitre
dit

IV,

i'i

Nous avons
porel, vocal

que

l'acte est

de deux espces, cetand et cetand^


;

krta, volition et acte fait par la volition


;

de trois espces, mental, cor-

de cinq espces, cetan, vijnapti corporelle, avijnapti

corporelle, vijnapti vocale, avijnapti vocale.

Que sont
non-dfinis
'

ces actes

au point de vue de

la qualit, bons,

mauvais,

quelle sphre d'existence (dhtu),

quelle terre

(bhmi) appartiennent-ils ?

a.

U avijnapti n'est jamais

non-dfinie

*.

Elle est donc

bonne (kusala), mauvaise (akusala).


;

En

effet, la

volition non-dfinie est faible

elle n'est

pas capable
Yavijnapti,

d'engendrer un
laquelle

acte

puissant (balavat)

comme

est

va se reproduisant aprs que sa cause

initiale

a disparu.

b.

Les autres actes sont des


actes,

trois espces l
et les vijnaptis,

Les autres

savoir la volition

peuvent tre

bons, mauvais, non-dfinis.

7 b-c. L'acte mauvais dans Non pas dans les autres


manquent
et
les trois
(ii.

le

Kamadhatu
(iv.

sphres, car, dans les autres sphres

racines-de-mal
c-d).

8 c-d

et v. 19), la

non-honte

l'impudence

26

La
l'acte

restriction de la stance ne porte

que sur

l'acte

mauvais

donc

bon

et l'acte non-dfini
le

dans

les trois sphres.


'.

c.

Dans
,

Rpadhatu
:

aussi,
le

avijnapti

aussi

c'est--dire
;

dans

Kamadhatu

et aussi les

dans

le

Ropa-

dhatu [13

b]

non pas dans rrpyadhatu, car

grands lments

(mhablita) y manquent dont pourrait driver Y avijnapti (iv. 6 b). L o existent (pravartante) corps et voix, l seulement il y a cette avijnapti qu'est la discipline (samvara) du corps et de la voix.
1.

2.

3.
4.

avykrta, voir ii. 54, iv. 9 c nvykrtsty avijnaptih. [anyad eva tridh] [auhham kdme]
|

in fine.

5.

[rpe 'py avijnaptih]

tiiuan-tsang
Objection.
Il

xiii, fol.

13 a-14

a.

31

n'y a pas de grands lments purs (ansrava) et

cependant

il

y a une avljnapti pure. Vavijnapti pure drive des

grands lments de la sphre o est ne la personne qui produit

Yavijnapti pure.
dhatu
et le

De mme, lorsqu'une personne ne dans


lui

le

Kama-

Riipadhatu entre dans

recueillement 'rpya, elle

produira une avijhapti d'rpyadhatu drivant des grands lments

du Kamadhatu ou du Rpadhatu.

Le cas

n'est pas le

mme, car Yavijnapti pure


;

est transcendante

aux sphres (adhtupatita)

elle

n'a rien de

commun
;

avec

les

passions de la sphre o se trouve celui qui la produit


ni

elle n'est

de

mme

sorte, ni

d'une sorte diffrente (sabhga, visahhga) par

rapport aux grands lments de cette sphre.

Au

contraire une

avijhapti de l'rpyadhatu ne pourrait driver des grands lments,


de sorte diffrente (visahhga), du

En

outre, tournant le

Kamadhatu ou du Rpadhatu. dos (vaimukhya) tout rjxv puisque


est absente

toute notion de

rpa en
dit

le

recueillement d'drpya

n'est pas capable de produire Yavijnapti, qui est

rpa.

Le Vaibhasika
du Kamadhatu
s'y oppose.

La

moralit (slla) existe en opposition avec

l'immoralit (dauhsllyapratipaksena). L'immoralit est du


:

domaine

la moralit, consistant
les

en avijhapti, du Rpadhatu

Mais

rpyas sont

loigns (dura) du

Kamadhatu

par les quatre distances, draya, prakra, lamhana, pratipaksa


(ii.

67, Vibhasa, 96,


d.

e).

7
Il

Vijhapti dans

les

deux terres o

il

y a vicra \
les terres,
-

n'y a de vijhapti, acte corporel


et

ou vocal, que dans


y a vicra
(i.

Kamadhatu

premier dhyna, o

il

32

c, viii. 7).

a.

Dans

le

Kamadhatu

aussi,

manque

la vijhapti dite nivrta \

[14 a] nivrta, c'est--dire nivrta-avykrla


(ii.

66), souille (klista)

mais

non-dfmie.
1.

vijnaptih savicrayoh
D'aprs
le

||

2.

principe vitarkya vicrya

vcam

bhsate,

ii.

33

a-b, p. 174.

3.

kme

'pi

nivrta nsti

32

CHAPITRE
aussi
,

IV,

a-c.

dans

les terres

il

n'y a pas de vicra, et aussi dans

le

Kamadhatu.
Semblable vijnapti n'existe pas dans
le

Kamadhatu, o toute

vijnapii souille (klista) est mauvaise (akiisala), non pas nondfinie.

C'est dire que la vijnapti de la classe anivrtvyJcrta n'existe que

dans

le

monde de Brahm.

Il

est rapport
:

que Mahabrahma produisit


effet,

un acte vocal de tromperie (niy)

en

dans son assemble,


'.

pour viter l'enqute d'Avajit, Mahabrahma se vanta faussement

Mais, si la vijnapti vocale manque au-dessus du premier dhyna, comment le son (sahdyatana) peut-il exister dans le deuxime dhyna et au-dessus ?
Il

existe,

mais ayant pour cause


:

les

grands lments extrieurs


le vent, etc.
(i.

(hhyamalihhtahetika)
D'autres matres disent

le

son caus par

10 b)

'.

La vijnapti
suivants
;

existe

dans

le

deuxime

dhyna
(klista).

et

dans

les

dhynas

elle y est de la classe anivr-

tvykrta,

non-souille-non-dfinie,
effet

non pas

bonne,

ni

souille

En

les

tres qui sont ns

dans ces dhynas ne se

rendent pas prsente (sanimukhlkar) une pense bonne ou souille


d'une terre infrieure, par laquelle pense
ils

pourraient produire une

vijnapti bonne ou souille. Car la pense bonne d'une terre infrieure est d'ordre infrieur

(nyna)

et la

pense souille a t aban-

donne l
1.

Dgha,

i.

18,

221 ci-dessus
; :

ii.

31 ci-dessous
;

v.

49 c, 53c

MahavibhSsfi, 129,

1.

2.

Mais

le
/
'

Sstra dit

pvacarah
sont

sabdadhtun kh samanvgatah / ha/ kniarSi les tres du Rpa ko 'samanvgatah / drpyvacarah /

munis
l'tre

pas

ne peut tre question d'un son extrieur, n'appartenant vivant (asattvasantkhyta). Donc il faut attribuer aux tres du RQpa

du son,

ii

cette sorte de son

que

l'on fait
:

avec les mains,


....

etc.

Pour viter cette critique,


le

d'autres matres disent


3.

La vijnapti

Deux opinions

(1) la

vijnapti qui se produit dans

deuxime dhyna

et

au-dessus est du domaine du premier dhyna, tant produite par une pense du

domaine du premier dhyna, d'aprs la rgle viii. l*. Ceci est l'opinion des Vaibhfisikas (2) celte vijnapti est du domaine du deuxime dhyna et d'audessus. Une vijnapti d'une terre suprieure est donc produite par une pense
;

d'une terre suprieure.


etc.

Lorsque

les tres

de ces
la

dhynas

parlent entre eux,

(parasparasatfibhsandikurvatm)

vijnapti est anivrtvykrta.

liuan-tsang,

xiii, fol.

14

a- 14 b.

33
'.

Mais

les

Vaibhasikas dfendent la premire opinion


soit,

Pourquoi la vijnapti, quelle qu'elle

manque-t-elle au-dessus
la classe souille-

du monde de Brahm ? Pourquoi la vijnapti de

non-dfnie (nivtia-avykrta) manque-t-elle dans le

Kamadhatu

8
i.

b.

Parce que manque la cause qui la produirait ^

C'est la pense associe


:

vitarka

et

vicra qui donne origine


le

la vijnapti

semblable pense manque dans


7 d)

deuxime dhyna

et

au-dessus,
ii.

(iv.

La pense nivrtdvykrta donne naissance vijnapti de mme


'

caractre, lorsque cette pense appartient la classe

abandonner

par la mditation

'

(bhvanheya). (Voir
la seule

p.

38

et suiv.)

Dans

le

Kamadhatu,

pense nivrtvykrta est la pense

associe satkyadrsti et antagrliadrsti. Cette pense appartient

la classe
elle est

abandonner par la vue des vrits


le

'

(daranalieya)
elle

tourne vers

dedans (antarmukhapravrtta). Donc,


(ii.

ne

donne pas naissance vijnapti

67, v. 12). [14 b]

Est-ce seulement en raison de la nature de la pense qui leur donne


origine (saraiitthpaka)

nature bonae ou mauvaise

que

les

dharmas sont bons (kuala) ou mauvais (akusala) ? Les dharmas sont bons ou mauvais de quatre faons absolument
:

(paramrthalas), en soi

(svahhvatas = tmatas)y par association

(samprayogatas), par leur cause originaire (samiitthnatas) l

8
1.

b-c.

La

dlivrance (moksa) est absolument bonne (suhha) K


:

La Bhsya porte prvam eva tu varnayanti


.

Hiuan-tsang
l'avis

La premire
.

opinion est bonne


2.

Glose de l'diteur japonais

Tel est

de l'auteur

[nsty
emploie

utthnam yatah]
il.

3.

Vibhsa, 144,
le

Le Bhadanta dit
:
:

C'est en raison de quatre causes que


origine, absolu-

l'on

mot kusala
par nature
:

bon par nature, par association, par


:

ment.

Bon

quelques-uns disent

la krl et

Vanapatrpya ;
:

quel-

ques-uns disent

les trois

kualamlas
le

Bon absolument

le

Nirvana, appel

bon parce
tion, le

qu'il est

calme (ksema).
etc.

bon par nature, c'est lejnna; bon par associajnna ; bon par origine les actes du corps et de la voix qui en procdent bon absolument le Nirvana. Les dfinitions de l'akiisala sont parallles (mauvais par nature, le mohaj. 4. [ubhah 3 moksah paramatah]
D'aprs les Vibhajyavdins,

vijuna,

associ au
;

ai
Le Nirvana, tant
tranquille-et-heureux

CHAPITRE

IV,

8 b-9

d.

la cessation de toute douleur, est

parfaitement

(ksema)

'

donc

il

est

absolument bon.
i.

Comparaison

l'absence de maladie (rogya) (Majjhima,


le

510).

c-d.

Les racines,

respect et la crainte, bons en soi l


(ii.

Les

trois racines-de-bien, le respect et la crainte

25),

indpensoi.

damment

de leur association et de leur cause, sont


:

bons en

Comparaison

la drogue salutaire
est associ

(ausadha).

a.

Ce qui

aux

racines, etc., est

bon par association

*.

Les dharmas,

volitions,

mentaux

(caittas), qui sont associs

aux

racines de bien, au respect, la crainte, sont bons par association.

Associs ces principes,


ils

ils

sont bons

non associs ces


:

principes,

ne sont pas bons [15 a]

Comparaison

une boisson o on a

ml une drogue salutaire (ausadhapnlya).

b.
*.

Les actions,

etc.

sont bonnes en raison de leur cause origi-

naire

Ayant

leur origine dans les

dharmas bons
(ii.

en soi ou bons par

association, l'acte corporel, l'acte vocal, les laksanas, prptis, niro-

dhasampatti, asamjhisampatti
raison de leur cause originaire.

35

et suiv.) % sont
:

bons en

Comparaison
tre

le lait

d'une vache

qui a bu une boisson mle d'une drogue salutaire.

On

se

demandera comment peuvent

bonnes des prptis qui

ont leur origine dans une pense qui n'est pas bonne (visabhgacitta) ^
1.

2.

Les aksemalenubandhbhvt. [mahrvyapatrpyam tmatah //]


les racines

autres kualas ne sont pas tels.

Divya, 255,
v. 20.

16.

Sur
3.
4. 5.

de bon, de mauvais, de non-dfini,

[samprayogatas tadyuktam] [utthnatah kriydayah /]


D'aprs
le tibtain.

Paranifirtha et Hiuan-tsang
.

L'acte corporel, l'acte


Viblifisfi.
ii.

vocal et les cittaviprayuktasantskras

C'est aussi la lecture de la

Samghabhadra

L'acte corporel, l'acte vocal, la jti, etc. (laksanas,

48

c)

et les

prptis des deux recueillements-sans-pense (nirodha et asafnjnisam'


le

patti).
6.

Lorsqu'on reprend possession des racines de bien par

doute (vicikits)

Hiuan4sang,

xiii, fol.

14 b-15
*.

b.

35

c.

Le mauvais (akusala)
tel qu'il

est le contraire

Le contraire du bon
1.

vient d'tre expos

Le sarnsra

ou existence
:

pour nature

le

processus

(pravrtli) de toute douleur

il

est

donc parfaitement malheureux

(aksma), donc absolument mauvais.


2.

Les racines de mal, l'absence de honte

et

l'impudence

(ii.

26

c-d)

sont mauvaises en soi.


3.

Les

dharmas

associs ces principes sont

mauvais en
dans
les

soi.

4.

Ayant

leur origine dans les racines,


etc., l'acte

etc., et

dharmas

associs ces racines,

corporel, l'acte vocal, les caractres

(naissance,

etc.) et les

prptis des

dharmas mauvais,

sont mauvais

en raison de leur cause originaire.

Comparaison
sadha),
etc.

maladie (vydhi), drogues malsaines (apathyau-

[15 b]

Mais, dira-t-on, tout ce qui est impur (ssrava) est intgr (abhy-

antara,

parypanna) au samsara

donc rien de ce qui est impur

ne pourra tre ni bon, ni non-dfini ?

parler strictement, cela est vrai. Mais on se place au point de


la rtribution

vue de

(vipka)

rtribution

agrable (ista), est


n'est pas
est
dfini

impur qui

le dharma impur qui produit une nomm bon (kuala) le dharma (vydkrta) comme devant tre rtribu
:

(vipkam prati)
Si on

nomm

non-dfini

(ii.

54).
:

demande

ce qui est

absolument non-dfini
^.

d.

Non-dfinis, au sens absolu, deux stables


:

C'est--dire

deux inconditionns (asamskrta,

i.

5),

savoir

(iv.

80) les prptis de ces racines sont bonnes

or elles ne sont pas bonnes en

elles-mmes, ni par association, ni par origine, ni absolument.

De mme,
75 b
17.

les

prptis du bien inn


catgories.
1.

(ii.

71 b) sont bonnes et ne rentrent dans aucune des quatre


cette objection, xxiii. 4,
fol.

2.

Samghabhadra rpond [tadviruddham akualam] paramvykrte dhruve II


;

xiv.

La doctrine du Kathvatthu sur le bon, 8 le Nibbna est avykata, xi. 1, xiii.

le

mauvais,

le

non-dfini, est expose

9, xiv. 8.


Tespace
dfinis.
et

CHAPITRE

IV,

9 d-li

b.

Vapratisankhynirodha, sont, sans amphibologie, non^

Une
une

difficult.

Le Vaibhasika enseigne que


bonne ou mauvaise. La
2 3

Tacte, corporel ou
originaire, savoir

vocal, est

bon ou mauvais en raison de sa cause

volition (cetan)

mme

rgle doit s'applil'acte

quer aux grands lments


corporel ou vocal
(iv.

(mahdblmtas) qui constituent


d).

b,

Non

pas, rpond le Vaibhasika, car l'intention de l'agent se rap:

porte l'action, non pas aux grands lments


action et

il

veut faire

telle

non pas

faire des

grands lments

*.

Mais, dirons-nous,

comment Vavijnapti

produite par le recueille-

ment

(iv.

6 c-d) sera-t-elle bonne ? L'agent, entr en recueillement,


:

n'a pas d'intention l'endroit de Vavijnapti et ne pense pas

Fai-

sons une avijhapti

>

Nous ne pouvons pas non


le le

plus admettre que


la

Vavijnapti produite par

recueillement ait son origine dans

pense non recueillie qui prcde


est d'une autre classe.

recueillement, car cette pense


le

Donc Vavijnapti produite par


si le

recueillement
est

n'est pas
il

bonne

ou bien,

Vaibhasika soutient qu'elle


l'il divin
b, trad. p.

bonne,

devra considrer

comme bons
(ii.

et

l'oue
vii.

divine qu'il

regarde
Il

comme

non-dfinis
difficult

71

320,

45).

y a l une

que

les

Vaibhaikas doivent rsoudre (kar-

tavyo Hra yatnah).

On

dit ci-dessus (iv.

b)

que

la

pense susceptible d'tre aban-

donne par
vijnapti [16

la

vue des vrits (darsana) ne donne pas origine

a].

Cependant Bhagavat a

dit

De

la

mauvaise vue

(mithydrsti) procdent la mauvaise rsolution (samkalpa), la mauvaise parole, la mauvaise action, la mauvaise manire de vivre
.

Or

la

mauvaise vue

est

abandonne par

la

vue des vrits


effet

(v. 4).

Ce Sotra ne

contredit pas la thorie.

En

10

a-b.

Ce qui donne

origine

(samutthna)
et

est de

deux espces
*

qui sont
1.

nommes hettisamutthna
ktirycim
iti

tatksanasamutthna.
idam karma kurym

na mahabhtani

kini tarhi

iti.

samutthnaifi dvidh hetutatksanotthnasamjnitamj

Vibhafl^ 117,

10.

Hiuan-tsang,

xiii, fol.

15 b-16

b.

37

samutthna, ce par quoi


Ce qui
est cause (hetu) et

l'action

prend origine (samiittisthate).


est

samutthna, hetusamutthna. Ce qui


l'action,

samutthna au moment mme de

tatksana^amiitthna.
et

10

c-d.

Qui sont respectivement promoteur


projette

second moteur*.
c'est--dire
b]

Le hetusamutthna
(titpdaka).
Il

(ksepaka),

produit

est

donc promoteur (pravartaka). [16


contemporain l'action
p. 27).
;

Le tatksa-

nasamutthna
Mais quelle

est

il

est

donc second

moteur (anuvartaka) (voir ci-dessus,


est,

sur l'action (vijnapti), l'efficace (smarthya) du


efficace

tatksanasamutthna,
moteur ?
Si le
fut-elle

par laquelle

il

en serait

le

second

tatksanasamutthna manquait,

l'action n'aurait pas lieu,


;

mme projete (ksipta) par le promoteur comme,


)

par exem-

ple, l'action

n'a pas lieu lorsque celui qui a projet une action ( J'irai
vient mourir.

au village

Mais

si

la vijnapti n'a
a-t-il
'

pas lieu en l'absence du second moteur,

comment y

vijnapti pour l'homme exempt de pense qui prend


7).

la discipline ?

(Vibhasa, 113,

On aura donc
claire

recours une autre explication.

La vijnapti
'.

est plus
a,

(sphuta, vyakta) chez celui qui est dou de pense, qui de la vijnapti, la pense
*

au

moment

second moteur

Telle est

l'effi-

cace de cette pense.

11
..1

a-b.
I.

Le vijnna abandonner par


J.

la

vue des vrits

est

seulement promoteur ^
1.

[pravartakam dvayoh prvam dvitlyam] anuvartakam


ParamSrtha
ainsi,
:

//

2.

S'il

en est

ainsi,

lorsqu'un

homme exempt de pense (acittaka)


:

produit Vavijfapti-slla, o sera la pense

en est

atmvartaka ? Hiuan-tsang comment l'homme exempt de pense produira-t-il le sla ? Un homme, pendant qu'il reoit l'ordination (upasampdyamna) et va
(kyavijiaptiin

S'il

lier

l'acte corporel

nirodhasampatti en lui la discipline (samvara), la fin de la crmonie (kannavcanvasna), comment peut avoir lieu l'acte corporel (kyavijnapti) que suppose la discipline
(^antargata)
3.

qui y est ncessaire, entre dans la et devient donc exempt-de-pense. Au moment o se produit

badhnan)

pravartakam drsHheya}n vijnnain.

38

CHAPITRE

IV, 11.

La pense
promoteur de

qui est
la

abandonne par

la

vue des vrits

est

seulement

vijnapti, parce qu'elle est cause (nidna, hetu) du

processus mental (vitarka et vicra) qui donne origine (samutth-

paka)

la vijnapti. Elle n'est

pas second moteur


:

(1)

parce qu'elle

moment o a lieu la vijnapti celle-ci est mise en mouvement par une pense tourne vers le dehors abandonner
n'existe plus au
'

',

par mditation (bhvan),

et qui

est

second moteur
il

(2)

parce que,

supposer qu'elle soit second moteur,


(c'est--dire la vijnapti) cr

s'ensuivrait que le

rpa

par

elle serait lui aussi

abandonner

par la vue

de

mme

que

la

vijnapti cre par une pense aban-

donner par mditation

est

abandonner par mditation. Et cette


(i.

hypothse est en contradiction avec l'Abhidharma

40

c-d).

En
la

effet, le

rpa (= vijnapti)
exact), ni par
la

n'est contredit (virudhyate) ni par (erreur)


'.
:

vidy (savoir

Vavidy

donc

il

ne peut tre

abandonn au moyen de
pt contredit

vue des vrits

Le Sautrantika rpondra que


par la vidy
,

cette affirmation

Le rpa

n'est

doit tre prouve.

Car

celui qui soutient


le

la thse de l'abandon

du rpa par la vue n'admettra pas que

rpa

n'est pas contredit par la vidy.

Le Vaibhasika
la vue, les

dit

Si le

rpa
la

{== vijnapti) qui a son origine dans

une pense abandonner par

vue

est, lui aussi,

abandonner par

grands lments qui servent de substrat (raya) ce

rpa,
car
ils

cette vijnapti, seront,

eux

aussi,

abandonner par

la vue,

tirent leur origine

de la

mme

pense. Et c'est inadmissible,

car ces grands lments appartiennent la classe des

dharmas

non-

souills-non-dfinis (aklistvykrta), et tout ce qui est

abandonner

par la vue est souill (klista)

(ii.

40
'

c-d).
',
*

c'est--dire 1. Le rpa (l'action, vijnapti) n'est pas contredit abandonn au moyen de la vidy, c'est--dire par le chemin de vue, comme c'est le cas pour l'hrsie du personnalisme, etc. (satkyadrsti) : car les personnes mme qui ont vu les vrits sont munies (samanvgata) du rpa. Il n'est pas contredit par Vavidy, comme c'est le cas pour le chemin pur (ansrava), car Vavidy existe tandis qu'on cre des rpas (actions) souills ou non-souills, tandis que se continuent lesprptis (ii. 36 b) de ces rpas; et elle existe aussi dans le cas contraire. Donc, on ne peut pas dire que le rpa soit abandonner par la vue, ni non plus qu'il n'est pas abandonner. Reste qu'il soit abandonner par mditation.
',
' '

Hiuan-tsang,

xiii, fol.

16 b-17

a.

39
effet, les

Nous nions

la consquence,

reprend l'objectant.

En

grands

lments en question ne sont pas bons ou mauvais en raison de la

pense qui leur donne origine, ainsi que c'est


(iv.

le
;

cas pour la vijnapti


les

d).

Ou

bien,

admettons

cette

consquence

grands lments

en question sont abandonns par la vue.

Le Vaibhasika rpte que


non--abandonner. Car
dit ni

c'est impossible.
;

Les grands lments ne


ne sont pas non plus

peuvent tre abandonns par la vue [17 a]


le

ils

dharma non
souill,

souill (aklista) n'est contre-

par la vidy, ni par Vavidy.


effet, le

[En

dharma non

qu'il soit

de la classe anivrt-

vykrta, non-souill-non-dfni, ou de la classe ktisalasrava, bonimpur, n'est pas contredit par la vidy, c'est--dire par
le

chemin pur
du

(ansrava),
fait

comme

c'est le cas

pour

le

dharma

souill qui prit


]

que saprpti
le

est

coupe par

le dit
1.

chemin

Donc

Stra

cit ci-dessus (p. 36,

25) n'invalide pas notre thse


la

La pense

susceptible d'tre
,

abandonne par

vue ne donne pas

origine vijnapti

car ce Stra vise la vue fausse (mithydrsti)

considre

comme promoteur
Le
'.

(pravartaka). (Vibhas, 117,

i3)

11
est

b-c.

manas

susceptible d'tre

abandonn par mditation

double

La connaissance mentale (manovijnna) de nheya est la fois promoteur et moteur ^.


11
d.

la catgorie

bhva-

Les cinq sont seulement moteur l


etc.,
(i.

Les cinq vijnnakyas, connaissance visuelle,


moteur, tant exempts de
117,
Il
10)

sont seulement

rflexion (vikalpa)

33)

(Vibhasa,

y a donc quatre cas

/ heyam eva bhvanay] La Vykhy explique Car il est tourn vers le dedans et vers le dehors (antarbahirniukhapravrtta) . Hiuan-tsang: Car il est accompagn de vikalpa

1.

[ubhayam manah

2.

(savikalpakatva), car
3.
j:.

il

est tourn vers le dehors


//

pancakant

tv

anuvartakam
ils

Hiuan-tsang : Car

sont exempts de vikalpa, tant tourns vers

le

dehors

40
i.

CHAPITRE

IV,

11-12.

Exclusivement promoteur,
d'tre

la

connaissance mentale (manovijnla vue.


etc.

na) susceptible
ii.

abandonne par
les cinq

Exclusivement moteur,

connaissances sensibles,

iii.

Promoteur

et

moteur, la connaissance mentale susceptible d'tre

abandonne par mditation.


iv.

Ni promoteur,
'

ni moteur, la

pense pure (ansrava)


nature

*.

Le
dfini
11

moteur
que
le

'

est-il

de la

mme
:

bon,

mauvais, non-

promoteur ?

n'y a pas de rgle ce sujet


a-b.

12

D'un promoteur bon,

etc.,

un moteur des

trois espces

'.

D'un promoteur bon, un moteur bon, ou mauvais, ou non-dfini.

De mme d'un promoteur mauvais ou

non-dfini.

12
En
dfini,

c.

En

ce qui regarde le Muni,

moteur de

mme

espce ou bon \ espce que le

ce qui regarde Bhagavat, le moteur est de


:

mme

promoteur

d'un moteur bon, un moteur bon

d'un promoteur non-

un moteur non-dfini. [17 b]


bien,
il

Ou
bon
;

arrive que d'un promoteur non-dfini sorte


il

un moteur

tandis que, d'un promoteur bon,


:

n'y a jamais moteur non*.

dfini

l'enseignement des Bouddhas n'est pas sujet diminution


,

D'aprs d'autres Ecoles^


:

la

pense des Bouddhas n'est jamais

Car cette pense est recueillie et tourne vers le 1. La Vyftkhya explique dedans (samhitntarmukhapravrltci) . Hiuan-tsang place ici iv. 12 d Ni promoteur ni moteur, (1) la pense pure, parce qu'elle ne se produit que dans le recueillement, (2) la pense ne de rtribution (vipkaja) parce qu'elle se
:

produit spontanment, sans effort


2.

(anabhisamskravhin)

[pravartakdc chubhder anuvartakam api tridhCt /] 3. [muneh samam ubham va tan] Hiuan-tsang Moteur gnralement de mme espce, quelquefois diffrent . ~ Enseignement , anusani. La 4. anilyamn. Hiuan-tsang pense des Bouddhas, dans l'enseignement du dharma, etc., ou bien grandit ou
:

bien ne diminue pas


5.

D'aprs l'diteur japonais, les Mahasflmghikas,


savoir correct sont fermes
qu'il est libre

etc.

Vibhftsa, 79, 15

Les

VibhajyavR'Jins louent Bhagavat, disant que sa pense est toujours recueillie,

parce que la mmoire et


n'est jamais

le

ils

disent q^ue le

Bouddha

endormi (middha), parce

des obstacles (varanas).

Hiuan-tsang,
non-dfmie
est
:

xiii, fol.

17 a- 18

a.

41

ils

sont toujours en recueillement

leur srie mentale

exclusivement une srie de penses bonnes (kualaikatna).


:

C'est pourquoi le Stra dit

Le Naga
il

est recueilli

quand
il

il

marche, quand
*.

il

se tient debout,

quand

est couch,

quand
:

est assis

Les Vaibhasikas disent

Le Stra s'exprime

ainsi parce

que

la

pense de Bhagavat ne se disperse pas (avisarana) vers


sans
qu'il
le

les objets

veuille

(anicchay) [Bhagavat

est toujours recueilli est chez lui toujours

(nityasamhita) en ce sens que la mmoire


prsente
:

marchant,

il

sait qu'il

marche.]

Mais

ce n'est pas dire


:

que Bhagavat soit exempt de


rtribution (vipkaja),

dharmas
relatifs
(ii.

non-dfnis

dharnias de

dharnias

aux attitudes (rypalJiaJ,

pense-de-cration (nirmnacitta)

66).

Nous avons vu que


ceptible d'tre
et

la

connaissance mentale (manovijnna) susest

abandonne par mditation,

la

fois

promoteur

moteur, et peut tre bonne, mauvaise, non-dfmie.

12

d.

Ce qui nat de rtribution

n'est ni l'un, ni l'autre l

La pense
ni

qui est rtribution (vipkaja,


effort,

i.

36,

ii.

60, iv, 85), se


n'est

produisant sans

spontanment (nirabhisamskravhin),

promoteur, ni moteur.

La vijnapti

est-elle

bonne, mauvaise, non-dfinie, (1) d'aprs


(2)

le

caractre de son promoteur,

d'aprs le caractre de son moteur ?

A
i.

quoi tend cette question ?

Premire hypothse. Les deux drstis de personnalisme (satkya)

[18 a] et de pass-et-futur-de-la-personne (antagrJia) sont promo-

2. Anguttara, iii. 346, TheragStha, 686-697 gacchani samhito ngo tliito ngo samhito / sayam samliito ngo nisinno pi samhito / sabbattha samvuto ngo esa ngassa sampad j La rdaction sanscrite porte caran
: :

samhito.

La Vyakhyfi
Nfiga
:

tablit que,

dans

le

Stra, le

Tathgata Udyin sadevake manas tasmn nga ity ucyate. l. [nobhayam tu vipkajam //]

loke

Buddha Bhagavat reoit le nom de go na karoti kijena vc


...

42
teur
(iv.

CHAPITRE IV 12-14
11 a-b)
elles sont

a.

de la classe souille-non-dfnie (nivrtd-

vykrta). Si la vijnapti laquelle elles donnent origine suit leur


nature, on aura done, dans le
dfinie
(iv.
:

Kamadhatu, une action souille-non-

et

vous regardez cette consquence

comme
iv.

inadmissible

b).

Si vous maintenez, sur ce point, votre opinion, vous

devrez admettre, contrairement votre thse,


les

11 a-b, que toutes

penses susceptibles d'tre abandonnes par la vue ne sont pas


tandis que la satkyadrsti et V antgrhadrsti ne sont
les autres drstis

promoteur

pas promoteur,

sont promoteur.

Seconde hypothse. La vijnapti par laquelle une personne prend


la discipHne de

Pratimoksa ne sera pas bonne,

si cette

personne, tanest de

dis qu'elle reoit l'ordination

(upasampdyamna),

pense

mauvaise ou non-dfinie.
ii.

Le Vaibhasika rpond.

La vijnapti

est de la

mme

nature
d'tre

que son promoteur lorsque

celui-ci est

une pense susceptible

abandonne par mditation. Elle


son promoteur lorsque
celui-ci

n'est pas de la

mme

nature que
d'tre
,

est

une pense susceptible


la

abandonne par
car,

la vue, par

exemple
le

pense

Le moi

existe

dans ce

cas,

prend place entre

promoteur

et l'acte (vijnapti)

un autre promoteur, une pense susceptible

d'tre

abandonne par

mditation, tourne vers le dehors, accompagne de vicra et de

vitarka, par laquelle, par exemple, on prche l'existence du moi.

Le

premier promoteur est non-dfini


est

le

deuxime

est

mauvais

l'acte

mauvais.

Du promoteur

susceptible d'tre

abandonn par

la vue,

un promoteur susceptible

d'tre

abandonn par mditation


;

et qui est

bon, ou mauvais, ou non-dfini


{vijnapti) de
iii.

de ce second promoteur, un acte

mme

nature.

Mais

si l'acte

(vijnapti) n'est pas bon, mauvais ou non-dfini,


(iv.

en raison du moteur, l'explication que vous avez donne

10 a-b)

du Sotra ne
la
'

tient pas.

Vous avez

dit

en

effet

que

le

Sotra considre
affir-

vue

'

(drsti)
la

comme promoteur
que
la

et que,

par consquent, en
le

mant que

vue fausse est gnratrice de vijnapti^

Sotra ne con-

tredit ni le principe

pense susceptible d'tre abandonne


le

par la vue n'engendre pas vijftapti, ni

corollaire que,

dans

le

Hiuan-tsang,

xiii, fol.

18 a-xiv,

fol. 1 b.

43

Kamadhatu,
dfinie. Il

il

n'y a pas de vijnapti


le

de la classe souille-non-

faut dire que

Sotra considre la drsti


le

comme un

pro-

moteur auquel succde,


promoteur qui

sparant de l'acte (vijnapti), un autre

est susceptible d'tre

abandonn par mditation.

En

voil assez sur ce point, [xiv]


a-b.

13

Vavijnapti

est triple, discipline

(samvara), non-discipline
'.

(asamvara),

diffrente de la discipline et de la non-discipline


t dfinie ci-dessus
(i.

Uavijnapti a
Elle
est

Il, iv.

d).

de trois sortes, (1) samvara, discipline, ainsi


le flux

nomm

parce qu'il contraint (samvrnoti)

de l'immoralit (dauhsllyale

prabandha), parce
(2)

qu'il dtruit

ou arrte

flux

de l'immoralit,

asamvara, l'oppos de
ni celui de

la disciplme, la non-discipline (iv.

24

c-d),

(3)

naivasanivaransamvara, une avijnapti


Y asamvara.

qui n'a ni le caractre

du samvara,

13

c-d.

Discipline de Pratimoksa, discipline pure, discipline ne


[1

du dliyna ^
Il

b]
:

y a

trois

espces de discipline
:

(1) la discipline

nomme

Prati-

moksa (prtimoksasamvara)

c'est la moralit (slla)


;

du domaine

du Kamadhatu, la moralit des tres de ce monde


produite par le dhyria, moralit du
discipline pure

(2) la discipline
;

domaine du Rpadhatu

(3) la

(ansrava), qui nat du Chemin, moralit pure.


est de huit espces l

14
Il

a.

Le Pratimoksa

comprend
\ du

les disciplines

du Bhiksu, de

la BhiksunT, de la Siksa-

mana
1.

Sramanera

(novice), de la

Sramanerika, de l'Upasaka

2. 3. 4.

samvarsamvaretar / [samvarah prtimokskhyo 'nsravo dhynajas tath [astadh prtimokskhyah]


avijnaptis trividheti

//]

(I-tsing, p. .38

D'aprs une opinion dont Takakusu Siksaman est la femme qui se soumet aux rgles en vue de devenir Srmanerik elle est comprise (dans la liste plie) parmi les SrmanerikSs. Nous allons voir que la discipline de la SiksamSna est identique la discipline de la Srmanerik. Mais la Siksaman est une candidate

La Siksamna
;

est la

'

probationnaire

'.

97) se lait l'interprte, la

l'tat

de Bhiksuni voir iv. 26 c-d et Cullavagga, x. 1. 4. (Vinaya Texts, i, p. 296). Yogcras On demande pourquoi Bhagavat^ en ce qui concerne la discipline
:

44
(dvot laque,
iv. 28). iv.

CHAPITRE
30),

IV, 14.

de l'Upasika, de l'Upavasastha

(*

jeneur
:

',

Ces huit disciplines sont disciplines de Pratimoksa

donc, au

point de vue des

noms qu'on

lui

donne, la discipline de Pratimoka

est de huit espces.

14

b.

En

fait, le

Pratimoksa est de quatre espces \


:

Quatre espces qui prsentent des caractres distincts

discipline

du Bhiku, du Sramanera, de l'Upasaka

et

de l'Upavasastha. [2 a]

En
la

effet, la discipline

de la Bhikunl ne diffre pas, n'existe pas


;

part de la discipline du Bhiksu

la discipline de la

Siksamana
;

et

de

Sramanerika ne

diffre

pas de la discipline du Sramanera

la disci-

pline de l'Upasika ne diffre pas de celle de l'Upasaka.

14

c.

Le nom change avec

le

sexe

-.

Sexe, vyanjana, c'est--dire linga, ce qui distingue l'homme

et la

femme.

C'est en raison du sexe qu'alternent les

noms, Bhiku, Bhi-

ksunl, etc.

Lorsque leur sexe

est modifi,

le

Bhiku devient BhikunT


;

la

de Bhiksu, tablit deux disciplines, celle de Bhiksu, celle de Sramanera


que, en ce qui concerne la discipline de BhiksunT,
il

tandis

tablit trois disciplines, celle

de BhiksunT, celle de Siksamana, celle de Sramanerika.


ont beaucoup de passions
pline de BhiksunT. Si la
:

Parce que

les

femmes
la disci-

c'est

donc progressivement qu'elles prennent


joie et adhsion

femme montre
il

dans une petite partie des

Siksamana ; si elle montre joie et adhsion dans une grande partie des rgles de la Siksamana, il ne faut pas prcipitamment lui donner la discipline complte il faut qu'elle s'exerce deux ans durant Jnanaprasthana, 13, 34. Le Sramanera, possesseur de dix rgles, est appel prendre la discipline complte. Pourquoi, dans le BhiksunTdharma, y a-t-il une Siksamana ? Du temps de Bouddha, la femme d'un marchand, enceinte sans le savoir, sortit du monde et reut la discipline complte Il fut tabli que les femmes s'exerceraient dans les rgles durant deux ans, prenant six dharmas, et
rgles de la Sramanerika,

faut lui donner les rgles de la

prendraient ensuite

la discipline

complte.
(8, 25) la

D'aprs

le

Vinayamalrka.stra

discipline de
le

Bhiksu comporte 250 dhar-

mas ;ce\\e
si

de BhiksunT, 500 dharmas. D'aprs


;

sun prend 500 rgles

si

on

dtaille,

jAanaprasthana 13, 34, la Bhik80000 rgles le Bhik?u prend 250 rgles


;

on dUille 80000.
1.

2.

[dravyatas tu caturvidhah /] [vyanjandn uAmasai^tcArt]

mthsan

las

min

ni

hpho bahi

phyir,

iiian-tsang, xiv,
BhiksunT, Bhiksu
le

fol. 1

b-2 b.

45
;

ramanera, Sramanerika
;

la ramanerika,
;

comme
sika,

aussi la Siksamana,

Sramanera l'Upasaka, Upsika l'Upa-

Upasaka. Or

on ne peut pas admettre qu'une personne, en

changeant de sexe (parivrttavyahjana), abandonne la discipline


antrieure et en acquire une nouvelle
;

le

changement de sexe ne

peut avoir cette influence

'.

Donc

[2 b] les quatre disciplines fmi-

nines se confondent avec les trois disciplines masculines.

Lorsque

les disciplines

sont prises successivement, discipline d'Upa-

saka, avec ses cinq prceptes, discipline de


dix prceptes, discipline de

Sramanera qui comporte


Taddition

Bhiksu qui comporte deux cent cinquante


diffrent-elles

prceptes,

ces

disciplines

seulement par

successive
diffrent les

de prceptes

(virati,

renoncement) nouveaux,
;

comme
et

nombres

cinq, dix, vingt

comme

diffrent

un denier

deux deniers ?

Ou

bien ces disciplines, produites chacune tout d'une

pice, existent-elles

part l'une de l'autre ?

14

d.

Les discipHnes existent part ^

Elles ne sont pas mles.

Dans

les parties qui leur sont

communes

Upasaka, Sramanera
vol,

et

Bhiksu renoncent (virati) au meurtre, au

Tamour

illicite,

au mensonge, aux liqueurs enivrantes

les

trois disciplines

ont des caractres distincts.


est

Leur diffrence
na).

dans

la ditrence des occasions de

pch (nid-

En

effet,

l'homme qui

s'astreint

l'observation d'un plus grand

nombre de

rgles (sikspada), s'carte par le fait

mme
ii.

d'un plus
c-d) et de
le

grand nombre d'occasions d'orgueil-ivresse (mada,


non-diligence

33

(pramdasthna,
les trois sries

ii.

26

a)

il

s'carte,

par

fait

mme, d'un plus grand nombre d'occasions de pch, meurtre,


Par consquent
pas.

etc.

de renoncements ne se confondent
si

S'il

en tait autrement,
taient intgres

les

disciplines

d'Upasaka

et

de

Sramanera
1.

(antarbhva)

la discipline de Bhiksu,
iv.

Les causes qui dterminent

la perte

d'une discipline sont numres


religieux qui renonce au repas

38.

2.

3.

prthak te. La Vykhya donne un exemple


'

le

'

hors du

temps

est

moins expos commettre

le

meurtre que

le laque.

46
le

cHAPn'R

IV,

14 d-16

b.

Bhiksu qui renonce la discipline de Bhiksu (""samvaram praty-

caksnah) abandonnerait du
thse qu'on n'admet pas.

mme

coup

les trois disciplines

[3 a]

Donc

les disciplines existent


'.

part.

14

d.

Mais

elles

ne se contredisent pas
:

Elles peuvent coexister

en prenant la suivante, on n'abandonne


le fait

pas la prcdente

'.

Ainsi s'explique

que

le

Bhiku qui renonce

sa qualit de Bhiku reste en possession de la discipline d'Upasaka


et

de Sramanera ^

Comment

devient-on Upasaka, Upavastha, Sramanera, Bhiksu ?


le

15. En prenant
dix,

renoncement cinq choses

viter,

huit,

toutes

les

choses viter (varjya), on ohtient la qualit d'Upa*.

saka, d'Upavasastha, de Sramanera, de Bhiksu


1.

En assumant

le

renoncement (viratisamdna) cinq points


2.

1.

meurtre (prntipta),
1.

vol

(adattdna),

3.

amour

illicite

na virodhinah
:

fl

2. Vibhasfi, 124, 4

Celui qui prend une discipline postrieure n'abandonne pas

la discipline antrieure.

L'Upsaka qui prend


de l'Upisaka
;

la discipline

de Sramanera n'aban;

donne pas
il

les cinq points

il

prend

les dix points

possde donc en

mme temps

quinze disciplines

du Sramanera Le Bbiksu possdera donc


la discipline

965 disciplines. D'autres matres disent que l'Upasaka prenant

de

Sramanera n'abandonne pas les cinq points de l'Upasaka et prend cinq points du Sramanera il possde donc dix espces de discipline .... Si un homme possde en mme temps deux disciplines, trois disciplines (Upasaka, Sramanera, Bhiksu), pourquoi est-il nomm d'aprs la dernire, Bhiksu, et non pas Upasaka ? 3. Le Tibtain et Paramartha disent S'il en tait autrement, celui qui abandonne la discipline de Bhiksu ne serait pas Upasaka . Hiuan-tsang Upasaka, etc. L'diteur japonais dit que le Bhiksu qui renonce la discipline de Bhiku devient Sramanera pareillement, le Sramanera devient Upasaka. 4. pacstadaasarvebhyo varjyebhyo viratigraht /
:

...

upsakopavsastharamanoddesabhiksut
Divya, 160
:

//

Rambhaka rmika RddhilamtA


....

iipAsik

ramanoddeik

Cundah ramanoddea Utpalavarn bhiksuni


Anguttara,
ii.

78

bhikkhusu bhikkhunlsu upsakesu upsikesti antamaso


v.

r& m ikasa manuddesesu.


Prfilimoka des Sarvftstivadins,

57

(J.

As. 1914, 515).


la

La Vyfikhyft reproduit ci-dessous iv. 30 d (note) ramanoddea, nom liturgique du Sramanera.

formule prononce par

le

HiUan-isang,

xiv, fol.

2 b-4

H
dans la discipline

(kmamithycra),
d'Upasaka.
2.
3.

4.

mensonge (mrsvda),

5.

liqueurs enivrantes

(siirmaireijapramdasthnavlrati), on

s'installe

En assumant

le

renoncement huit points,


[3
b],

1.

meurtre, 2. vol,
5.

incontinence

(brahmacarya)

4.

mensonge,

liqueurs

enivrantes, 6. odeurs, guirlandes, onguents (gandhamlyavilepaiia),

ballets-chant-musique (nrtyagltavCidU)

',

7.

lit

lev,

grand

lit

(iiccasayana, mahsayana),

8.

repas hors du temps (viklahliO'


*.

jana), on s'installe dans la discipline d'Upavsastha


3.

En assumant

le

renoncement ces mmes points


fait dix,

et,

en outre,

l'or et

l'argent, ce qui

on

s'installe

dans la discipline de
'

Srmanera.

Cela
le

fait
'

dix points, car on compte part


'

odeurs-

guirlandes-onguents
4.

et

danse-chant-musique

'.

En assumant

renoncement tous

les actes

du corps

et

de la

voix qui doivent tre vits, on est Bhiksu.

La

discipline de

Pratimoksa

est

16

a-b. Moralit (la),

bonne conmie

(siicarita), acte

(karman)

et discipline
1.
*

(samvara)

-.

Moralit \ parce qu'elle redresse (pratisamsthpana) ce qui est


'

injuste

(visama), car

les

pcheurs se conduisent d'une manire

injuste l'gard des tres.


(si),

Etymologiquement, parce qu'elle rafrachit


la stance
:

comme

il

est dit

dans

Fortune

est la prise de la

moralit, parce que la moralit ne brle pas.

[4 a]

1.

Voir Mahavyutpatti, 268, o la sixime virati est formule

gandhamlya-

vilepanavarnakadhranavirati. 2. [slam sucaritam caiva karma samvara ity api /] las dan sdom pa zhes bya ho. 3. La Vibhsa (44, 13) donne dix explications du mot la : froid ou rafrachissement sommeil calme, car celui qui observe le slla obtient un sommeil calme,

ayant toujours de bons rves; exercice rpt (abhysa), en raison de


incessante des bons

la

pratique

dharmas
;

recueillement

(samdhi)
la

ornement
:

(comp.
le

Sumangalavilasin,

p, 55)

escalier

ou musoir, d'aprs
le

stance

Dans

pur

tang de la
souillure et
4.

loi

de Bouddha, la moralit est

musoir, les ryas se lavent de toute

amvent l'autre rive des qualits . la dfini [sukham lasatndnam tena kyo na tapyate]

iv.

122.

48
2.

CHAPITRE

IV,

16-17

Bonne

conduite, parce qu'elle est loue par les sage^.


elle est

3. Acte, parce que, de sa nature,

action (kriy).

Objection. Le Stra ne

dit-il

pas que Yavijhapti est

ne pas

faire

(karana)
elle tre

action ? Sans

(voir ci-dessus p. 14, 17, 18)?

Gomment Yavijhapti

peut-

doute, Vavijnapti fait que le disciplin,


;

revtu de honte, s'abstient du pch en raison de l'engagement


est

elle

donc

iti

ne pas faire

Mais

elle est action, d'aprs

l'tymologie

kriyata

kriy

elle est faite (kriijate) soit


'.

par un acte corporel-

vocal (vijhapti), soit par la pense (citta)

D'aprs d'autres, Vavijnapti est action parce qu'elle est cause


effet d'action ^

et

4. Discipline,

parce qu'elle discipline ou contraint

le

corps et la

voix.

L'expression

'

discipHne de Pratimoksa

'

dsigne toute la discipline

de Pratimoksa depuis son origine.

16
1.

c-d.
;

Le Pratimoksa,

c'est la

premire vijhapti

et la

premire

avijhapti

celles-ci sont chemin-de-l'acte

(karmapatha)

L'expression Pratimoksa dsigne la premire vijhapti et la pre-

mire avijhapti de la prise de la discipline.

Le Pratimoka molcsana \
1.

est

nomm
le

Pratimoksa, car par

lui

lieu le prati:

c'est--dire l'abandon (tyga),

du pch (papa)

telle

L'avijnapti qui constitue

satttvara de Pratimoksa rsulte d'une vijnapti.

la pense en tat de recueillement, d'une pense impure du domaine des dhynas, d'une pense

L'avijnapti ne-de-dhyna et Vavijnapti pure naissent de


pure.

Cause d'action, parce que le disciplin (satnvarastha), en vue de garder la (pariraksanrtham), accomplit des actions (kriy) consistant en actes corporels et vocaux. Effet d'action, parce que dans le cas de Vavijnapti de Prfitimok^ elle est le fruit d'une vijnapti; parce que dans le cas de Vavijnapti ne de la pense recueillie elle est le fruit d'une volition (cetanCi) ne du recueillement.
2.

discipline

3.
4.

dye

vijiiaptyavijiaptl

prtimoksah [kriypathah
et

/]
il

D'aprs cette tymologie on attend pratimoksa, mais

vidhna^ comme dans vaikrtam vikrtam


(Vyikhya).

vaiasam
p.

= viasam mranam
[spi-

y a svArthe vrddhi-

Sur

le j*eus

de pratimoksa, Kern, Manual,

74 (something serving as a

Hiuan-tsang,
est l'efficace

xiv, fol.

a-b.

0,

du premier moment (vijnapti

et

avijnaptt) de la prise

de la discipline.
2.

Cette vijiapti et cette avijnapti sont aussi


',

discipline de Pra-

timoksa

parce qu'elles disciplinent

le

corps et la voix.
*

3. Elles

sont chemin-de-l'acte, c'est--dire


'

chemin-de-l'acte pro-

prement

dit

(maula)

(iv. 66).

Au moment
suivent,
il

qui suit le premier

moment

et

aux moments qui


rejet (prati-

n'y a plus Pratimoksa,


le
il

cir le

pch n'est pas

moksyate) par
parle premier;
*

second moment, ayant t rejet (pratimoksita)


y a pr^/wo/Vsasawyara
'

',

c'est--dire discipline
'
;

de l'espce du Pratimoksa

ou discipline

'

ne du Pratimoksa

il

n'y a plus chemin-de-l'acte proprement


conscutif
'

dit,

mais seulement

'

acte

(iv. 68).

[4 b]
trois disciplines ?
le

Qui possde chacune des

17

a.

Huit personnes possdent


le

Pratimoksa'-.
la

Seules huit personnes,

Bhiksu,

Bliiksun... l'Upavasastha,

possdent la discipline de Pratimoksa.


Est-ce dire que les infidles (bhya) ne puissent possder la

moralit dite d'engagement (samdnaslla) ?


ritual] cuirass)
;

Ils

peuvent pos-

Oldenberg, Bouddha (1914)


18,

p.

419, note (Entlastung,

= loslassen, Divya, 94,


aussi
'

137,

15,

Manu,

x. US).

Il

reste qxie

pratimuc pratimuc signifie

lier

'.

Telle est bien la notion,

'

obligation, (Contrainte

Mahvagga-Niddesa lesquels ajoutent


patitth

qu'exprime la dfinition de une explication tymologique slam


',
:

dicaranam santyamo samvaro mukhanipamnkham kusalnm


:

dhammnam
1.

sampattiy. Mais Visuddhimagga, p. 16 ptimokkhatu eca samvaro ptimokkiiasamvaro. 2. so sor thar dai idan pa brgyad ~- [priiinoksnvit astan] 3. Dans l'Abhidhamma (Atthaslin, p. 103), samdnaviraU abstention la suite d'engagement (par opposition sampaitavirati) s'entend de la virati
* '

obtenue par

le

Pratimoksa.
le

On

distingue

samdnaslla, moralit que


:

l'on obtient

en prenant un enga:

gement, une rsolution


moksa), et
le

Je ne ferai ni

ceci,

ni cela

(type

moralit de Prati-

dharmatCipriiambhikasila, moralit acquise sans engagement


:

ou acte vocal

c'est la discipline

acquise soit par

le fait

de la possession d'un

dlyna

(car

on ne prend possession d'un dhyna qu'en se dgageant des passions


4

60

CHAPITRE
ils

IV,

17 a-18

b.

sder cette moralit, mais

ne peuvent possder la discipline de

Pratimoka.

En

effet,

leur moralit d'engagement ( Je m'abstiens

du meurtre
riia)
;

, etc.),

repose sur la notion d'existence (hliavasamniils

mme quand
qu'ils

ont en vue, non pas une renaissance cleste,


'

mais ce

appellent

dlivrance

'

(moksa),

ils

conoivent la
le

dlivrance

comme une

certaine sorte d'existence.


*

Donc

pch ne se

trouve pas absolument

rejet

',

dli

',

par leur moralit d'engage-

ment.

17
du
*

b.

Celui qui possde le


*.

dhyna possde

la discipline qui nat

dhyna
qui nat

du dhyna (dhynaja),
'

c'est--dire qui nat

du dhyna

(ablatif)

ou par

le
il

dhyna

(instrumental).

Par dhyna,
(sniantakaf
ce village

faut entendre

non seulement

les

quatre

dhynas

principaux (maula), mais encore les recueillements qui les avoisinent


viii.

22

a).

un champ de

riz,

De mme que, lorsqu'on dit Il y a dans un champ de bl , on entend parler du


:

village et de ses environs.

17
Les
(iv.

c.

L'rya possde

la discipline pure ^

saints, les oaikas et Asaikas, possdent la discipline


b-c).

pure

26

Nous avons

vu,

dans la dfinition du sahbhhetu


*

(ii.

51) [5 a],
'.

que deux disciplines sont des


sont ces deux disciplines ?

compagnons de

la

pense

Quelles

17

d.

Les deux dernires disciplines sont concomitantes la

pense \
du Kfiinadhftiu, iv. 26), soit par l'entre dans le chemin (discipline pure qui comporte l'abstention certaine de certains actes samucchedavirati d'Attha-

ttfilinl, p.

103).

Voir ci-dessus

p. 17,

note 3 et

iv.

33

a-b.

1.

bsara gtan skyes dan de Idan pa

= [tadvanto dhynajena tu]

seras can dan [anasravenaryasattv&h] samucchedavirati d'AtthasalinT, p. 103; elle comporte Vakarananiyama, l'impossibilit de commettre le pch. 3. tha ma gftis ni seras rjes hbraft [antyau cittnuvartinau //]
2.

zag

med hphags pahi

C'est la

Hiuan4sang,
La
discipline qui nat

xiv, fol.

4 b-5

a.

51
pure sont conco-

du dhyna

et la discipline
;

mitantes la pense (ciUnuvartin)

non pas

la discipline de Prati-

inoksa, car celle-ci continue exister (amivrttl) chez


la

l'homme dont

pense est mauvaise ou non-dfinie ou qui est inconscient (anyai.

cittcittaka,

11).

18

a-b.

Naissant des nantaryamrgas, dans Yangamya, on


sont
'

dit qu'elles

abandon

'

(pralina)

'.

Ces deux disciplines, la discipline d'extase


dans
les

et la discipline pure,
'

nantaryamrgas de Yangamya^ sont disciplineabandon (prahnasamvara abandon et discipline), car on abanneuf


'

donne par

elles l'immoralit

(dauhllya)
(iv.

et les

passions qui produi-

sent l'immoralit
Il

(tatsamutthpaka)

122

a).

y a donc une discipline ne du


:

dhyna

qui n'est pas discipline-

abandon. Quatre cas


i.

Discipline ne du

dhyna, impure (ssrava),


:

l'exception de
discipline ne

celle qui nat des

nantaryamrgas de Yangamya
;

du dhyna qui n'est pas abandon


1.

bar chad

med lam skyes de

gnis

mi Icogs med

la

spon zhes bya

= [prah-

nam ity anganiye tv nantaryamrgajau //] Vangamya (viii. 22 c) est le stade de recueillement
dhyna.
:

prliminaire au premier

du domaine du Kmadhtu il ne se dtache pas de ces passions dans le premier dhyna, car, pour entrer dans le premier dhyna, il doit tre dtach de ces
C'est dans ce stade que l'ascte obtient de se dtacher des passions

mmes
Il

passions.

y a neuf catgories, forte-forte, forte-moyenne, forte-faible, moyenne-forte, de passions du domaine du Kmadhtu ces neufs catgories sont dtruites ou
:

abandonnes par neuf chemins, les nantaryamrgas. La pratique de chacun de ces nirgas comporte donc abandon et en mme temps discipline Les neu vimuktimrg as de Vangamya ne comportent pas abandon (vi. 28, 65 c) les nantaryamrgas et les vimnktimrgas des dhynas proprement dits et du dhynntara (viii) n'ont aucune relation avec les passions du domaine du Kmadhtu, puisqu'ils dtachent des passions propres aux dhynas. Dans les nantaryamrgas et vimnktimrgas, l'ascte ou bien pratique le chemin mondain, et dans ce cas la discipline est dite ne de l'extase ou bien
' ' '

'.

'

pratique

chemin supra-mondain, et dans ce cas la discipline, bien du dhyna, au moyen du dhyna, est dite pure (vi. 49).
le

qu'elle naisse

52
ii.

CHAPITRE
discipline pure, obtenue
:

IV,

18-19.

dans

les

nantari/amrgas de Van-

gamya
iii.

abandon, mais non pas discipline ne du

discipline impure,

dans

les

dhyna ; nantaryamrgas de Vangamya


abandon
;

discipline ne
iv.

du dhyna
pure,

et qui est

[5 b]

discipline
:

ne en dehors des nantaryamrgas de

Vangamya
D'aprs les
la discipline

discipline

non ne du dhyna
on tablira

et qui n'est
les

pas abandon.

mmes

principes,

quatre cas relatifs

pure qui n'est pas abandon, l'abandon qui n'est pas


i?)

discipline pure, etc. (Vibhasa, 44,

Bhagavat a
encore

dit

Bonne

chose, la discipline du corps, la discipline


l'esprit,

de la voix, la discipline de
:

la discipline universelle

'

et
'\

Il vit

disciplin par la discipline de l'organe de la


la nature

vue

On demande quelle est


de
l'esprit, discipline

de ces deux disciplines, discipHne

des organes.

Ni

l'une ni l'autre ne sont, de leur nature, avijhapti. Bien au

contraire,

13

c-d.

La

discipline de l'esprit et la discipline des organes sont,


:

chacune, deux choses

conscience attentive et mmoire l

1. Samyutta, i. 73; Dhammapada, 361 Udfinavarga, vii. 11. kyena samvaro sdhu sdhii vcya samvaro j manas sanivaro sdlni sdhu sabbattha sanivaro. Les traducteurs chinois traduisent sdhu comme une exclamation Bon . Le texte des stances finales du PrStimoksa (L. Finot,
;
:

Journal Asiatique, 1913,


Anguttara,

ii.

543) porte

kyena samvarah sdhuh sdhur vc


:

ca samvarah ; mais Kumfirajva traduit


2.
iii.

Quel bonheur

cakkhundriyasamvarasamvuto viharati. 3. es bzhin dan ni dran dag gnis yid dan dbai po sdom pa smrlih satftprajanyam ca] mana- indriyasamvarah //
387
/

yin =^ [dve

La Vibh&sa

(197, 6)

donne d'autres dfinitions


;

D'aprs les uns, Vindriya-

satftvara est mmoire et conscience attentive d'aprs d'autres, apramda ; d'aprs d'autres, les six attitudes perptuelles (satatavihra) ; d'aprs d'autres,
la

non-possession de
;

Vaparihna

et

de Vaparijnna,

et la

possession du ciiemin
.

qui a'y oppose

d'aprs d'autres, les

dharmas non

souills

Les Mah&sfimghikas considrent Vindriyasantvara


action (Katli&valthu,
xii. 1).

comme

tant, de sa nature,

Sur
p.

les divers

samvaras du Visuddhimagga (palimokkha,

sati,

nna, khanti,
le

viriyasatftvara), voir l'analyse de Warren, JPTS. 1891, 77 et suiv. et

texte

7.U.

Hiuan-tsang,

xiv, fol.

5 a-6

a.

53

Pour que

le lecteur n'aille

pas croire que la premire discipline est

conscience (saniprajna) et la seconde mmoire (smrti), l'auteur


dit

que chacune

d'elles est

deux choses. [6

a]

'

Examinons qui possde vijnapti

et avijfiapt,
(iv.

et

quelle poque

appartiennent celles-ci dans chaque cas

19-22, 23-24 b) ^

19

a-c. Celui qui est plac

dans

le

Pratimoksa possde toujours

Vavijfiapti du

moment

prsent, aussi longtemps qu'il ne rejette pas

Vavijnapti \

Les personnes que nous avons


pline de

dites tre installes

dans la

disci-

Pratimoksa

(iv.

14

a),

aussi longtemps qu'elles ne rejettent


cette

pas Vavijiiapti qui

constitue

discipline

(iv.

38),

possdent

toujours Vavijfiapti prsente.

19

c-d.

Au

del du premier

moment,

il

possde aussi Vavijnapti

passe \

Au

del du premier
(iv.

moment, qui

est

dsign par l'expression

Pratimoksa
antrieure,

16

c-d), ces

personnes possdent aussi Vavijnapti

passe.

Bien entendu, aussi longtemps qu'elles ne

rejettent pas la discipline l

Tel celui qui est plac dans

la discipline de

Pratimoksa,
:

anyatar kila devat 1. Pour tablir cette thse, la VyakhyS cite l'garaa bhiksum visayesv indriyni vicrayantam avocat / hhikso bhikso vranam

ma

krslr

hhikso

itij bhiksiir ha piclhsymi clevate devatliaj kumhhamtram vranam krtv katham pidhsyasi bhiksur ha smrty pidJisymi
I
/

safftprajanyena ca.

Dans Anguttara,
2.

v,

347,

3.50,

l'homme qui ne
...

surveille pas ses organes est

na

vanam paticcJidet.
Possder, possder la prpti de
:

la

prsence, dans le complexe qui

constitue le moi, du
la

viprayuktadharma
ji

qu'est la

prdpti

(ii.

36).

On

peut avoir
rig

prpti d'un
3.

dharma

pass, prsent ou futur


srid

(v. 25).

so sor thar gnas

du

ma

gtan bar rtag da

Itar gyi
j

rnam

min

Idan
4. 5.

= yvan na tyajati [prdtimoksastJio vartamdnay


prvaksand rdhvam atltayd
Hiuan-tsang ajoute
: :

avijnaptyd sad]

Ij

pas Vavijiiapti future

du contexte que ces personnes ne possdent Vavijnapti qui n'est pas de recueillement n'est pas
Il

rsulte

possde

l'tat futur .

54

CHAPITRE

IV,

20-21.
'.

20

a.

Tel celui qui est plac dans l'indiscipline

Celui qui est plac dans l'indiscipline (asamvarastha,

iv.

24

c-d),

aussi longtemps qu'il ne la rejette pas, possde toujours Vavijnapti

du moment prsent

il

possde aussi Vavijnapti passe, partir du

deuxime moment de

l'indiscipline.

20

b-c.

Celui qui possde la discipline ne du

dhyna possde

toujours Vavijnapti passe et future ^


Celui qui possde la discipline ne du
[6
b],

dhyna (dhynasamvara)

aussi longtemps qu'il ne la perd pas, possde toujours Vavi-

jnapti passe, Vavijnapti future, car Vavijnapti en question


savoir la discipline ne du dhyna accompagne la pense
(iv.

17
il

d).

Ds

le

premier

moment o

il

acquiert la discipline de

dhyna,

y a

pour
soit

lui prise

de possession de la discipline de

dhyna

antrieure,

de cette existence, soit d'une existence antcdente, qu'il avait

perdue.

20

c-d.

Pour l'rya, au premier moment,

il

ne possde pas Vavi-

jnapti passe \

L'rya possde Vavijnapti pure, qui constitue sa


possde Vavijnapti ne du
et future.

discipline pure,

de la manire dont celui qui possde la discipline ne du

dhyna

dhyna

il

possde son avijhapti passe

Avec

cette diffrence que,

au premier moment du Chemin,


il

prenant pour la premire fois possession de Vavijnapti pure,


peut, videmment, possder une avijhapti pure passe.

ne

21

a-b.

L'homme
le

qui est en tat de recueillement,

l'homme qui
*.

est plac
1.

dans

Chemin, possdent Vavijnapti du moment prsent

sdom inin^nas pa han de dan hdra [taisaino *samvarastho 'pi] hsam gtan sdom dan Idan pa ni / rtag tu hdas dan ma hons dan dhydnasatftvaravdn sad atltjatay 3. ryas tu prathatne nahhyatitay // 4. samAhitaryamrgasthac [dhunikya]. Le recueilli et celui qui est plac dans le Chemin celte dernire expression fait difficult. Si on entend AryamArgastha dans le sens homme en possession du Chemin (mrgasaman2.

'

vita)f

on arrive

la conclusion

que l'rya,

mme

en dehors du recueillement,

HiuaU'tsang,

xiv, fol. 6 a-7 a.

55
est

L'homme
dans
le

qui est recueilli (samhita),

l'homme qui

voyageant
actuelle,

Chemin (ryamrgam sampannah), possdent,


du recueillement
(vyiitthita), ils

Yavijnapti qui leur est propre, ne du dliyna ou pure. Mais lorsqu'ils sortent

ne possdent pas cette

avijnapti actuelle, car cette avijnapti accompagne la pense.

On

dsignera sous
le

le

nom

d'intermdiaire

(madhyastha) l'homme
le

plac dans

ni-discipline-ni-indiscipline

(naivasanivaransamva-

rastlia), qui

ne possde pas la discipline


le

comme

Bhiku, ni

l'in-

discipline

comme

pcheur.

21

b"C.

L'intermdiaire, au premier

moment, possde, moyenne,


\

Vavijfiapti,

quand Yavijnapti se produit

Moyenne (madhya),
et la future.

c'est--dire prsente, situe entre la passe

L'acte (vijfiapti) ne produit pas ncessairement avijnapti. L'inter-

mdiaire

ne

possde
soit

pas

ncessairement
cre

avijnapti

s'il

avijnapti

Yavijnapti
etc.), soit

par

un

acte

d'immoralit

(dauhsilya, meurtre,
lit

Yavijnapti cre par un acte de mora-

(ilnga, abstention du meurtre), soit encore Yavijnapti que

crent d'autres actes bons ou mauvais, culte d'un Stpa, coups et

blessures

au moment o

elle

nat,

il

possde cette avijnapti,

actuelle. [7 a]

21
dans

d.

Aprs,

il

possde Yavijnapti prsente

et

passe

-.

entendre stha dans


'

normal (prakrtistha), possde Vavijnapti actuelle. Il faut donc le sens tant mont sur' (abhirdha), comme on dii:naustha, plac sur un bateau donc aryamrgastha mrgam abhirdhah santl'tat
'

'

pannah
que dans
Il

= l'rya qui, actuellement, mdite


l'tat

le

Chemin

mditation qui n'a lieu


d'aprs laquelle

de recueillement. de suivre une autre opinion


:

est plus simple

(anyah punar ...)

la

krik

doit s'entendre

le recueilli

et celui qui, tant plac

dans

le

chemin,

est recueilli
ca).
1.

(sanihitryamrgasthmi
la

= sanihitah sanihitamrgasthas
/

bar gnas

yod na dan po bar gyi dan


I

2.

phyin chad dus ni gnis dan ho

56
Ajoutez
:

CHAPITRE
jusqu'au

IV,

22-24.

moment o

il

la rejette.

Le

disciplin

(samvaraslha)

peut-il possder peut-il


les

mauvaise avijhapti ?

L'indisciplin

(cisamvaraMha)

possder bonne avijnapti ?


cas,

Et combien de temps dure, dans

deux

V avijnapti ?
foi

22. Aussi longtemps


violentes,

qu'ils

sont revtus de

ou de passion

aussi longtemps l'indisciplin possde

bonne avijnapti,
'.

aussi longtemps le disciplin possde mauvaise avijnapti

Aussi longtemps que continue (anuvartate), dans

l'indisciplin, la

violence de foi (prasdavega) par laquelle, accomplissant des actions


telles

que

le culte

d'un StQpa,

il

a cr bonne avijhapti

aussi long-

temps que continue, dans

le disciplin, la

violence de passion (klesatelles

vega) par laquelle, accomplissant des actions


enchaner,
il

que

tuer, frapper,

a cr mauvaise avijhapti,

aussi longtemps continue


et passe. [7 b]
'.

V avijhapti, bonne ou mauvaise.

Au moment
actuelle
;

de l'action en question, l'agent possde Vavijhapti


il

ensuite,

possde Vavijhapti actuelle


la

23 a-b.
(vijhapti)^

Ceux qui font une vijhapti

possdent toujours, actuelle


corporelle

Tous ceux qui accomplissent une action


qu'ils

ou vocale

soient

disciplins,

indisciplins,

intermdiaires,

aussi longtemps qu'ils sont accomplissant cette action, la possdent


actuelle.

23

c-d.

partir

du second moment,
ils

ils

possdent la vijhapti

passe, jusqu'au

moment o

la quittent \

A
1.

partir

du second moment,
/

c'est--dire aprs le

premier
/

moment

*.

sdom min gnas pa dge ba dan


ji

sdom

la

gnas pa mi dge bahi

rnani rig min

Idnn

srid

du

rab dad fton nions sugs Idun no

ubhay 'ubhay satftvare sthitah / avijnaptyanvito yvai] prasadaklesavega[van] // 2. raam rig byed ni Iharas cad la / byed pa dag la da Itar Idan [vijnaptikrt kurvann eva sarvatra vartatnanaya /] 3. atllaya k^anad rdhvam atygat 4. La vijiiapti peut 6lre (1) satfivaralaksatUi, par exemple, toutes les actions
[(isaffivaraaihah

Hiuan-tsang,

xiv, fol. 7 a-8 a.

57

23

d.

On

ne possde pas la vijhapti future

*.

Personne ne possde la vijhapti venir, parce que

la vijhapti

n'accompagne pas

la

pense (cittmiparivartim).
les

24
nivrta

a-b.
et

On ne

possde pas

vijhaptis passes

des classes

anivrta \
actions
souilles-non-dfinies,

C'est--dire les
dfnies (voir
ii.

non-souilles-non-

66

et suiv.).
fois qu'elles sont passes,

On
que

ne possde pas ces actions, une

parce

la possession (prpti) d'un

dliarmamhle, tant

faible elle-mme,

ne se prolonge pas (amibandhinl).


non-dfinie, est-il faible ?

Pourquoi ce dharnia, l'action


:

qui lui

donne naissance.

cette pense, elle aussi,

En raison de la faiblesse de la pense Mais alors la possession (prpti) de cas ne se prolongera pas. Non pas
le
effet,

n'est pas
elle

le

mme. La vijhapti, en
elle

est stupide (jada), car


;

ne connat pas un objet (anlamhanatvt)

en outre

elle est

dpendante (paratantra), car

dpend de la pense. Telle n'est

pas la pense elle-mme. Donc la vijhapti produite par la pense


non-dfinie est plus faible que cette pense

mme

la

possession

(prpti) de la vijhapti ne se prolonge pas


se se prolonge.

la possession de la pen-

Nous avons parl de


pline. Qu'est-ce

l'indisciplin, celui qui est plac

dans

l'indisci-

que

l'indiscipline

(asamvara) ?

[8 a]
acte, cfiemin-

24

c-d. Indiscipline,

mauvaise conduite, immoralit,

de-l'acte l
d'un moine qui sont conformes sa discipline. Le moine possde tous ces actes,

moment o il perd la discipline (siksniksepandibhih, iv. 38) asamvaralksand, tous les meurtres que commet un boucher le boucher possde tous ces actes, passs, jusqu'au moment o il renonce l'indiscipline et s'engage ne plus tuer (3) naivasamvaransamvaralaksan, l'adoration
passs, jusqu'au
(2)
;
: ;

d'un Stpa,
foi
1.

etc.

on perd ces

actes, ces vijnaptis,

lorsque cesse la violence de

ma bons med

= [na tv ajtayd
ma

//]

/ hdas pa dag dan Idan pa ban med [nbhyatltbhyftt nivrtnivrthhym samanvitah /] 3. sdom pa min dan fies spyad dn / hcbal bahi thsul khrims las dehi lam [asatnvaro ducaritani dauhlyam karma tatpatkah //]

2.

bsgribs pa dan ni

bsgribs pa

58
1.

CHAPITRE
Indiscipline, parce

IV,

24

c-26.

que non-contrainte du corps

et

de la voix.

2.

Mauvaise conduite (duscarUa), parce que blme par les hommes


Immoralit (danhllya), parce qu'oppose (vipaksa) la mora-

sages, parce que donnant des fruits pnibles.


3.

lit (iv. 122).

4.
5.

Acte, en tant que cre par

le

corps et par la voix.

Chemin-de-racte, en tant qu'incluse l'acte principal (maidaiv.

samgrhitatvcU,

68)

'.

Celui qui possde la vijnapti peut aussi possder Vamjnapti.

Quatre cas se prsentent.

25.

a-b. L'intermdiaire, agissant


^.

avec une volition

faible,

possde

la seule vijfmpti

Celui qui est plac dans

le ni-discipline-ni-indiscipline

[8 b] et qui,

avec une volition

faible, fait

un acte (vijnapti) bon ou mauvais,


\

possde seulement cet acte (vijnapti), ne possde pas d'avijnapti

plus forte raison n'y

a-t-il

pas possession d'avijfiapti pour

l'agent lorsque l'acte est non-dfini (avykrta).

Toutefois,

mme

accomplis avec une volition

faible, (1) les


iv.

oeuvres

mritorres
(2) les

matrielles

(aupadhikapunyakrii/vastu,
(iv.

112) et

chemins-de-racte
c-d.

68) crent toujours avijhapti.

25

L'rya possde
la

la seule avijiapti lorsqu'il n'a


*.

pas produit

ou a abandonn

vijnapti

Lorsque l'rya, ayant chang d'existence, ou bien n'a pas cr


vijnapti (par exemple lorsqu'il se trouve dans
Hiuan>tsang ajoute
l'tat

embryonnaire
moment o

1.

L'indiscipline n'est

karmapatha

qu'au

elle nat .
2.

3.

vijnaptyaivAnvitah kurvan madhyastho mrdticetanah / Mais il produit (samutthapayati) et possde avijnapti quand
forte
(

il

agit avec

une volition

tlvracelana).
/

4. rnara rig btan dan ma skyes pahi hphags pahi gan zag rnam rig min [tyaktdnutpannavijnaptir avijnaptyaryapudgalah II] 11 peut se faire que le Prthagjana aussi possde avijiapti sans possder

vijriapH (Vyakhya).

Hiuan-tsang,
ou
(la

xiv, fol.

8 a-9

a.

n59

lorsqu'il est ren

dans l'rpyadhatu), ou bien a perdu


',

la vijnapti,

vijhapti cre avec une volition non-dfinie)

il

possde seule-

ment avijhapti

(avijfiapti pure acquise dans l'existence antrieure),

non pas vijhapti.


Les deux autres cas, possession de vijhapti
et

d'avijhapti, non

possession de l'une et de l'autre, s'tablissent d'aprs les


principes
'.

mmes

Comment

acquiert-on les disciplines ?


discipline qui nat

26

a-b.

La

du dhyna

est acquise

par une

pense du domaine du

dhyna

l
c'est--dire
(les

C'est par une pense du

domaine du dhyna,

du mau-

ladhyna
c'est--dire

(les

quatre dhynas) et du
les

smantaka

quatre recueil-

lements qui prcdent

quatre dhynas), pense impure (ssrava),

ne faisant pas partie du Chemin, que la discipline de


est acquise
:

dhyna (dhynasanivara)

c'est

une discipline conco-

mitante (sahahhta) cette sorte de pense.

26
rya

b-c.
*.

La

discipline pure,

par la

mme

pense, quand elle est

rya, c'est--dire pure (ansrava), faisant partie du Chemin


(iv.

17

c).

[9 a]
(viii.

On
et

expliquera plus bas

22) que la pense rya existe dans

six terres de

dhyna, savoir
(le

les

quatre dhynas,

le

dhynntara

Vangamya

premier smantaka).
Pratimoksa, par paravijhpana,
etc.
^

26

c-d. Celle qui s'appelle

1. Bhasya yenryapudgalena parivrttajanman bhavati vijnaptatn va punar vihnam ....


:

na tvad

vijnaptatn

2. On a trty samvarsamvaramadhyasths tvray cetanay kusalant akualam vu, kurvantah / cattirthi yena janmntaraparivrUau prthagjanena [na] tvad vijnaptam bhavati vijnaptam va vihnant. 3. bsam gtan las skyes bsam gtan gyi / sa nid kyis thob [dhynajo dhynabhmyaiva labhyate]. 4. zag med ni / hphags des = [ryay tay / nirmalah], 5. so sor thar ces pa / gzhan gyi rnam rig byed sogs kyis prtimokskhyah
:

paravijiipandibhih

//

60

CHAPITRE

IV,

26

c-d.

paravijnpana, information
Le candidat
fait

d'autrui et information par autrui

savoir quelque chose autrui, et autrui lui fait savoir

quelque chose

'.

Autrui est un Samgha, pour Tacquisition des

disciplines de Bhiku, BhikunT,

Siksamana une personne (pxidgala),


;

pour l'acquisition des cinq autres disciplines de Pratimoka.


D'aprs les docteurs en Vinaya (vainayika) de l'Ecole Vaibhaika,

y a dix espces d'ordination (iipasarnpad). Pour les comprendre toutes dans sa dfinition, l'auteur dit ... par l'information d'autrui
il
:

et

ciera.
1.

Ordination par soi-mme ^ dans

le

cas du

Bouddha
vi.

et

du Pra-

lyekabuddha.
2. le

Par

l'entre

dans

le

Chemin (niymvakrnii,
d'jiiatakaundinya
et

26

a),

dans

cas des Cinq,


'.

c'est--dire

de ses com-

pagnons
3.

Par

l'interpellation

Viens, Bhiksu

dans
:

le

cas d'jfiata

*.

La discipline de Prati1. paro vijnpayatiti pratyyayati. Tibtain moksa, si autrui y informe, est aussi acquise en informant autrui . Paramfirtha, dans la kSrika par mutuelle information d'autrui bhasya Si autrui informe
: ;

celui-l, celui-l

informe autrui
.

Hiuan-tsang
:

Information d'autrui. Qui informe

autrui est appel autrui

(On a donc
).

information d'autrui =: information d'un

autrui qui lui-mme informe


2.

svma upasampad, Mahavastu,

i.

p.

2; Mahavagga,

i.

6,

28-29; Milinda,

p. 76, 2G5.

3.

Le texte tibtain porte simplement


jfiatakaundinya,
etc. .

c'est--dire

des Cinq , Paramrtha

la

Vyakhya explique
le

dans

cas des cinq

Bbiki^us, Kaundinya, etc.,

au moment o

ils

obtiennent la

duhkhe dharmajn-

naksnti
i.

(vi.

25 d)
:

Le
:

fragment publi par Hoernle, Manuscript Remains,

p. 13,
4.

porte

pancakntn jnnbhisamayena tipasatnpad.


;
:

dans le cas d'jiata dans Mabavagga, i. 6, 32 tibtain Mais Ajnatakaundinya est ordonn par la formule Viens, Bliiksu . Param&rtha et Hiuan-tsang dans le cas de Yasas, etc. . Le nom technique de cette ordination est ehibhiksukay upasampad ; l'homme interpell par Vehibhiksuk (ehibhiksukay bhsita) devient moine.

D'aprs

le

Cette parole est adresse un

caryam
281,

....

eta bhiksavah carata


ehiti

homme ou plusieurs brahmacaryam

ehi bhikso cara


;

brahma-

elle

est

accompagne du

miracle que la Vyakhyft dcrit (d'aprs un texte voisin de la stance, Divya, 48,

coktas tathgatena tyin I munda ca ksyadharo (Comparer Mahavastu, iii. 4^30 Dhammapada, Commentaire 21-23, Fauboll, 1855, p. 107, Burlingame, i. p. 280, etc.). On a ehibhiksuk dans
342)
:

babhva

....

Hiuan-tsang,
4.

xiv, fol.

9 a-b.
le

61
cas de

En
En En

reconnaissant Bhagavat ponr matre, dans


'.

Mahacas de

kasyapa
5.

satisfaisant
-.

Bhagavat par ses rponses, dans

le

Sodayin
6.

acceptant les obligations spciales aux religieuses, dans


'.

le

cas de MahprajpatT
7.

[9 b]
le

Par un messager, dans Par


l'officiant

cas de

Dharmadinna

*.

8.

en qualit de cinquime, c'est--dire ordination


de cinq Bhiksus, dans les pays de frontire \
le

devant un
9.

Samgha

Par dix Bhiksus, dans

Madhyadesa ^

10.

En

rptant trois fois la formule du refuge, dans le cas des

soixante, les Bhadravargas, ordonns en troupe ^


i. 330, ii, 113, Divya, Kosa; ehibhikstikat dans eJnbhikkupabbajj Dhammapada, 1855, p. 119 ehibinksunlvda, Divya, 616. Voir les formules de Mahvagga, i. 6, 32, Majjhima, iii. 2. Par. i. 8, (Vinayapitaiia, iii. p. 24), On a compar Satapatha, i. 1, 4, 2.

Mahavastu,
le

i.

2,

Avadfinaataka,
;

fragment Hoernle

1.

sttir abliytipagarnn
les idoles

mahkyapasyeti.
;

que Kasyapa saluait se brisaient en morceaux il vint prs de Bhagavat et omit de le saluer, craignant que le corps de Bhagavat ne prt (msya rpavinso bhcl iti). Connaissant son intention, Bhagavat dit Salue . Ksyapa salua, et voyant que le corps de Bhagavat n'tait pas le Tathagata mis mal^ il dit ayant me sst Il est mon matre . Par l, il fut ordonn. Comparer Mahavastu, iii. 51, 446 Strlamkara, trad. Huber, p. 161.
Toutes
:
!

2.

prasnrdJianena

(prasnavisarjanena)....

Bhagavat fut satisfait (rdhita) par les rponses Dans le fragment Hoernle il faut lire [soda]yiiiah
:

pranavykaranena iipasampadi.
3. giridharmbhyupaganiena, Cullavagga, x., Angultara, iv. 76^ BhiksunTkarmavcana (Bulletin de la School of Oriental Studies, 1920). 4. Elle tait enferme dans le harem et envoya un messager au Bouddha pour obtenir la pravrajy. Sur Dhammadinn, Majjhima, i. 299 et Thergalha, 12, o rhistoire est trs diffrente. 5. L'officiant (vinayadhara) est le jnptivcaka. Pays de frontire pratyantikesu janapadesii. Mahvagga, v. 13, il, ix. 41 Divya, 21, 18 (pnityantimesii) Mahavastu pancavargena ganena upasampad. 6. Voir Minayev, Recherches, 272 Takakusu, dans Hastings, vii. 320.
:

aranagamanatraivcikena sasHhliadravargapgopasampdilnm. ParaVjkhy buddham saranam gacchma iti trirvacanenopasampaA. raartha En disant trois fois les trois refuges , traduction confirme par vi. 30 d. Dans Mahvagga, i. 14, les Soixante sont ordonns par la formule Venez!...
7.
:

Voir l'ordination de Subhadda, Dialogues,

ii.

169.

62

CHAPITRE

IV,

27.

On

voit que, d*aprs ces docteurs, la discipline de

Pratimoka n*est

pas ncessairement acquise au


l'ordination du Bouddha,
etc.

moyen d'une

vijnapti, par exemple

Quand on prend (samdna)


combien de temps
la

la discipline

de Pratimoksa, pour

prend-on ?
la

27
nuit
'.

a-b.

On

prend

discipline

pour

la vie

ou pour un jour-et-

Les sept premires catgories de la discipline de Pratimoksa sont


prises pour la vie
;

la discipline de

jeneur (upavsastha) est prise

pour un jour-et-nuit. Telle


Pourquoi ?
Parce
qu'il

est la rgle.

y a deux priodes de temps (klvadhi),

la priode

vie, la priode jour-et-nuit.

Pour

la quinzaine et les autres dures

de

temps, elles consistent en des additions de la priode jour-et-nuit.

Quel

est le

dharma que
temps
'

nous appelons

temps

'

(kola) ? Ce n'est

pas une substance (padrtha) ternelle,


uns.
les

comme

le croient

quelques-

Le mot

'

est

une expression par laquelle sont dsigns


(i.

samskras en
jour, c'est

tant que passs, futurs, actuels


il

7, v. 25).
;

[10 a]

Le
c'est

quand

fait clair
(iii.

dans
c).

les

quatre continents

la nuit,

quand

il

fait

obscur

80

Discussion.
discipline de
vie.

Nous admettons,
soit
si l'on

disent les Sautrntikas, que la


la

Pratimoksa

seulement produite pour la dure de

En

effet,

mme

s'engageait observer les rgles dans une


la discipline

vie venir,
1.
ii.

on ne produirait pas

pour cette autre vie

la

personne (raya) qu'on sera sera diffrente (nikdyasahhga,


;

41)

2. cette

nouvelle personne ne pourra pas s'appliquer aux


;

rgles acceptes

3. elle

ne se souviendra pas de l'engagement ^


les devoirs

Mais
1. ji

si

un

homme assume
ftin

d'un jeneur pour plus d'un

srid

hthso dan

zhag tu

sdoin pa yan dag blan bar bya

= [yvajjivam
satftvarasya.

satnadnam
2. Bliftya
:

ahoratratfi ca] samvrteh / Yy&khySi: samvrter


:

iti

visahhayrayatvat tena ca tatrprayogd asmaranc ca. Vyakhy tena visabhgarayena tatra sanmdne 'prayogt / asmarandc cetarrayena tat samdnatft na smurati.

Hiian-tsang, xiv,
joiir-et-nuit,

fol.

9 b-10

a.

63

pour cinq jours, pour dix jours, quel obstacle ce que

se produisent en lui plusieurs disciplines du jene ?


Il

faut qu'il y ait


le

un obstacle puisque Bhagavat, dans


Bhagavat

le Stra, dit

qu'on prend

jene pour un jour-et-nuit.


se pose pourquoi
s'est

La question
sait-il

exprim

ainsi.

Pen-

que

la discipline

du jene ne peut
il

tre produite

pour une dure


les

plus longue ? Bien plutt

pensait que les


le

hommes, dont

sens

sont

difficiles

dompter, prenant

jene pour un jour-et-nuit,

seraient capables de le bien pratiquer. Car, en vrit, rien ne s'oppose

ce qu'on produise la discipline du jene pour plus d'un jour.

Comme Bhagavat
les

ne parle pas de jene durant plus longtemps,

Vaibhsikas n'admettent pas cette manire de voir. [10 b]


quelle est la dure de l'indiscipline
'.

On demande

(asamvara).

27

c.

Pas d'indiscipline pour un jour-et-nuit

L'indiscipline ne dure jamais

un

jour-et-nuit,

comme

la discipline

du jene, car
entire

elle est

produite par l'acceptation du pch pour la vie

(ppadharmhhyupagama). Comment cela ?


d.

27

Car, dit l'Ecole, on ne la prend pas ainsi K


l'indiscipline,

Personne ne prend
jene, en disant
Il s'agit,
:

la manire dont on prend

le
.

Je veux rester un jour-et-nuit dans l'indiscipline

en

effet,

d'actions honteuses.
l'indiscipline

Objection.
rester

Personne ne prend
dans pour
la vie durant.

en disant

Je veux

ma

vie durant

l'indiscipline .

Donc on ne prendra pas


prend
l'in-

l'indiscipline

Rponse.
discipline.

Ce

n'est pas de cette faon, en effet, qu'on

On ne prend

pas l'indiscipline au moyen d'un

rite.

On

acquiert l'indiscipline en agissant avec l'intention de toujours agir


zhag pa

1.

lin

2.

de de Itar nod

On

ne la

sdom min med := [nhortriko 'satnvarah] med ces grag [sa kilaivam na labhyate 1] Hiuan-tsang prend pas comme on prend la bonne [discipline].
)
i

64
;

CHAPITRE

IV,

27 d-28.

mal on n'acquiert pas l'indiscipline par l'intention d'agir mal pour Dans le cas du jene, l'intention un temps (klntaravipanna). n'est pas pour toujours '[lia]; nanmoins on obtient la discipline par la force de l'acte qui consiste dire Je veux rester un jour-et-

nuit dans

la discipline

du jene

et

on accomplit

cet acte parce


l'indisci-

qu'on dsire acqurir cette discipline. Si quelqu'un dsirait


pline,
il

pourrait sans doute


il

s'engager

l'indiscipline pour une

certaine priode et
le

acquerrait l'indiscipline pour cette priode. Mais


:

cas ne se prsente pas


*

donc nous ne reconnaissons pas

l'indisci-

pline

pour un temps

'.

D'aprs les Sautrantikas, l'indiscipline n'existe pas en soi (dra-

vyaias) part de la volition (celanvyatirikta). L'indiscipline,


l'intention de

c'est

commettre

le

pch (ppakriybhisamdhi),

c'est--

dire

une certaine

volition (cetanvisesa) avec les traces


cette
volition.

(anubandha,

vsan) que
l'homme,

laisse

Et,

aussi

longtemps que cette

volition avec sa trace n'a pas t dtruite par

une

volition contraire,
l'indisci-

mme quand

il

a une pense bonne, reste muni de

pline (asatnvaravnjy indisciplin

(samvarika).

Comment faut-il
du jene ?
^

prendre la discipline d'un jour-et-nuit ou discipline

28.

Il

faut prendre le jene


aprs,
le

(upavsa) dans une

attitude

humble,

parlant

dpouill

d'ornements,
-.

pour jusqu'au lendemain,

complet,
1.

matin, d'autrui

[11 b]

rcitations)

Sur YupavCLsa, voir VVieger, Bouddhisme chinois, i, 149 (Vinaya eu dix Oldenberg, Bouddha, '-^ d., 372 Rhys Davids, Buddhisni, 1907,
; ;

pp. 139-141

Minayeff, Recherches,

p. 166.

Anguttara,

i,

205; Suitanipata, 400.

Upavsa
six jours

contes,

i.

Les d'upavsa, Waiters, Yuan-Chwang, i. 305, Chavannes, Cinq cents 26, n. 2 les quatre jours et leur date, Takakusu, I-lsing, 63, 188.
rpt ou de longue dure.

De

Groot, Code du Mahtlyana, 62.

L'uposadha d'un demi-mois de Bhagavat, Mahvastu,


prolonge
la

iii.

97, est

une abstinence

manire des Jainas (voir l'Introduction de

l'diteur).

2. dmah Lar t.idug smras bzlas pa yis / mi brgyan nam ni naAs par du / bsfien gnas yan lag tlisan bar ni / n& par gzhan las gnod par bya. ParamArtha et Hiuan-tsang, dans la Kfirikfi et le Bh&sya, s'cartent de l'ordre du tibtain.

smras blas pa

yis ^=

murmurant aprs

qu'il

a t parl

(?)

Paramartba

Hiuan-tsang,
1.

xiv, fol.

10 b-11

a.

65

Dans une
* ;

attitude
les

humble, ou accroupi (utkutuka) ou age^

nouill

avec

mains jointes en kapotaka


le

(en plaant les

quatre doigts d'une main entre


disposes en anjali
;

pouce

et l'index

de l'autre) ou

fors le cas de maladie.

Faute d'une attitude


temps.

respectueuse, la discipline n'est pas produite.


2.

Le candidat ne parle pas avant l'ordonnant ou donneur (dlar),


donne
le

la personne qui
c'est d'autrui
tion, ni
3.

jeune

ni

en

mme
il

De

la sorte,

qu'on prend

le

jene

autrement,

n'y aurait ni rcep-

don l
;

Le candidat ne porte pas de parure


parce que, de
celle-ci,

il

porte la parare habi-

tuelle,

on ne

tire

pas vanit \
soleil.

4.
5.

On

s'engage pour jusqu'au lendemain, au lever du

On

prend

le

jene complet, avec ses huit membres,


I-tsing, p. 188,

et

non pas

avec des membres manquant (Takakusu,

Ghavannes,

Cinq cents contes,


6.

p. 136).

Le matin, au lever du

soleil,
7)

puisque

c'est

une

discipline d'un

jour et d'une nuit. (Vibhasa, 124,

Celui qui, antrieurement, a form l'engagement

Toujours

je

= anu pact
il

vdin;

bhfisya

la suite du donneur [de i'upavsa], aprs

parle
1.

....

dmah

bar hdag pa [ncsana

?]

ni tsog cig por

hdug pa ham pus mo btsugs


75).
=r.

nas

On a aussi cog bur hdug pa = titkuhtkastha (Mahfivyutpatti, 281,


et

Paramartha

Hiuan-tsang rendent pus

mo

btsugs

plaant genou [ terre]

par koui, flchir les genoux, tre agenouill.


2. angustharahitasyngulicatuskasya itarahastngusthapradesinyor antarle vinyasant kapotakah. Voir Dict. de S* Petersbourg. De qui faut-il prendre la discipline d'Upavasa ? On 3. Vibhasa (124, g) obtient la discipline en la prenant de sept classes de personnes (ts'i tchong les sept parisads de Takakusu, I-tsing, p. 96 moine, novice, nonne, probationnaire, novice femme, dvot et dvote). Pourquoi ? Les personnes qui n'ont
:

'

pas pris

la discipline (kiai)
'

pour

la vie

durant ne sont pas dignes d'tre

'

matres

de discipline
4.

(kiai-ch).
:

Paramartha

11

rejette les

ornements qui ne sont pas vieux.


'

Pourquoi ?
comme
'

les

Les ornements qu'on use constamment ne produisent pas

la vanit
'

font

ornements neufs

tre

nityaka
'.

Le mot que nous traduisons habituel (nar ma) doit nityaka bJwjana, Mahavastu, i. 602, iii. 253, s'entend de l'ordi.

naire

66
pratiquerai le jene [11

CHAPITRE

IV,

28-29.

b] le huitime jour de la quinzaine, etc.


*.

, il

prendra

le

jene, eut-il

mme mang

7. D'autrui,

non de soi-mme. Rencontrt-on des causes de pch,


les obligations

par honte l'gard du donneur, on ne violera pas


acceptes.

Lorsque ces rgles ne sont pas observes, on

fait

une bonne action


pour l'homme
;

(sucarita), mais on n'obtient pas la discipline du jeune. Lorsque ces


rgles sont observes, le jene est fort utile

mme

qui

commet des pchs de jour


Le jene

et

de nuit (chasse, meurtre

vol,

adultre). [12 a]
i.

est

nomm

iipavsa
celle

-,

parce que,

comportant une
il

manire de vivre conforme

des Arhats (tadanusiksant),

place auprs (upa) des Arhats ^ D'aprs une autre opinion, parce
qu'il place

auprs de la

discipline

pour

la vie durant

'

(Vibhasa,

124,
ii.

11).

Il

a pour

fin

de procurer (dh) la croissance (posa) des racines-

de-bien (kusalamla) des


de-bien.

hommes
*

qui n'ont que de petites racinesdit


:

Comme

il

procure la croissance du bien, Bhagavat a

On V appelle posadha.
La

1.

discipline

du jene nat (pour

lui)

au lever du

soleil, Tefficace

de

faire

natre cette discipline appartenant la pense qu'il a forme de s'obliger prendre


le

jene.

La Vyakhyfi
uttisthate

samvara

hanam

tv

sa bhuktvpi grhnyd iti / sryodaya eva dit samdnaniyamacittasyofthpakatvt j bhuktvgraabhivyaktyartham. Paramrtlia traduit mot pour mot sa bhuktvpi
:

grhnyt.

tyaya ?), 2. Sur

il

obtient

les

si quelque obstacle se rencontre (vighnapraquand mme abstinence complte . diverses lectures et interprtations, uposatha, nposadha (Lalita,
:

Hiuan-tsang

...

Mabftvastu,

ii.

177,

AvadSnakalpalala,
501.

vi.

76),

posadha (Mahavyutpatti,

266),

posaha

(Jaina),
J.

voir S.

Lvi, Observations
ii.

sur une langue prcanonique du

Bouddhisme,

As. 1912,
;

Gso-sbyon s'explique qui nourrit (les mrites], qui lave uposadhik, telle MfiyadevT la descente de l'lphant 74 a-b. - posadhika, Mahavyutpatti, 270, 13.
3.
4.

[les

pchs]

= nlyamavat,
i.

iv.

Voir l'Uposalhasutta (Visuddhimagga, 227), Anguttara,

211.
il

Paramartha

et

Hiuan-tsang citent

la

stance

Comme

accrot la

bonne
.

pure pense de soi et d'autrui, Bhagavat (Bouddha Sugata) l'appellent Posadha

Hiuan-tsang,

xiv, fol. 11 a-12 b.

67
*

Pourquoi la discipline du jene

est-elle prise

avec huit membres ?

29

a-c.

Membre
'.

de moralit (slaj,

membre de

vigilance (apra-

mdda), membre des vux asctiques (vrata), respectivement quatre,


un, trois

membres

Quatre membres,

les

renoncements au meurtre, au

vol,

l'inconti-

nence, au mensonge, constituent le


[12 b] par lequel est

membre de
est

moralit (ilnga)

abandonn ce qui

pch de sa nature (prakr-

tisvadya) l

Un membre,
membre de

le

renoncement aux boissons enivrantes, constitue

le

vigilance par lequel est arrte la non-vigilance (prapris la moralit,


(ii.

mdda). Car l'homme mme qui a

s'il

boit la liqueur

enivrante, sera non-vigilant (pramatta).

25-26,

iv.

34

c-d)

Trois membres, les renoncements aux


repas hors du iemps, constituent le favorables et

lits

levs, musique, etc., et


ils

membre

d'asctisme \ car

sont

conformes au dgot (samvega).

Quelle ncessit de prendre les

membres de

vigilance et d'asc-

tisme ?

29

d.

Pour

viter la dfaillance de la

mmoire

et l'arrogance ^
qu'il

Lorsqu'on boit la liqueur enivrante, la mmoire manque de ce


faut faire et ne pas faire. Lorsqu'on use des
lits

grands

et

levs,

1.

Dans

Ariguttara,

iv.

38S, l'Uposatha comporte neuf

membres

on ajoute
ste

la

mditation de bienveillance.
2.

thsul khrims

yan lag bag yod

palii

yan lag

brtul zhugs

yan lag

bzhi

gcig de bzhin

gsum rim bzbin =: [llngam apramdngam vrafngatn ca


j
:

yathkramam
3.

catvry ekam tath trni] sllam prjikbhvah samghvasesdyabhvah. Sur les expressions prjika (=^ *prcika), samghvasesa, samghdisesa (= *samghtiesa), S. Lvi, Langue prcanonique du Bouddhisme, J. As. 1912, ii. 503-506. Les samghvasesas seraient les pchs qui laissent au dlinquant un reste de communaut en contraste avec les prjikas qui impliquent l'exclusion dfinitive . Sakaki Risaburo (Vyutpatti, 255-256) cite Burnouf, Kern, Lvi. Le chinois tiaduit sng-tsan qui dtruit le Samgha. 4. vratnga niyamdnga. 5. de yis dran nams dregs par hgyur [smrtimosamadan tatah //]
Vykliya

68

CHAPITRE

IV,

29.

lorsqu'on assiste aux ballets, chants et musique, la pense devient


arrogante.
moralit.

Dans

l'un et l'autre

cis,

on n'est pas loin de violer la

Lorsqu'on observe la rgle de manger au temps voulu, lorsqu'on


vite de

manger hors du temps,


et

[13 a] la

mmoire

reste prsente des

obligations du jene, et le dgot

(samvega)

se produit.

dfaut du

huitime membre, mmoire


i.

dgot manqueront.
le

D'aprs certains matres,


dit,

jene ou upavsa consiste dans


;

le

jene proprement

le

renoncement au repas hors du temps

les

membres du jene (tipavsnga). n'est pas un membre donc, afin d'obtenir le L'abstention d'aliment nombre de huit membres, on doit distinguer deux membres dans le
autres renoncements

sont les

septime

membre

d'une part, renoncement aux ballets, chant, musi-

que

d'autre part, renoncement

aux parfums, guirlandes, onguents.

Cette interprtation n'est pas conciliable avec le Stra, [disent les


SautrantiksLs]
;

car, d'aprs le Stra,


le

immdiatement aprs
:

le

renonhuiti
'.

cement au repas hors-du-temps,

jeneur doit dire

Par ce

me membre,
ii.

j'imite la rgle, je

me conforme

la rgle des Arhats

Que sera donc le jene, distinct de ses membres, et comportant membres ? D'aprs les Sautrantikas, c'est de la collection mme des membres qu'on dit qu'elle a des membres c'est la collection
huit
;

mme
bres
* '

qu'on attribue des membres. L'expression


doit s'entendre

jene huit

memchar
*,

comme
'

les

expressions

membre du

arme quatre membres


*

(catiirangahala),

poudre cinq

mem-

bres
iii.

(pahcngapista) ^
D'aprs les Vaibhasikas, l'abstention de nourriture en dehors
est la fois le est

du temps

jene

et

un membre du jene. De
et

mme
et

la

samyagdrsH
gnga)
;

la
le

fois le

Chemin

un membre du Chemin (mrest

de

mme

dharmapravicaya
68)
;

la
le

fois la

Bodhi

un

membre de

la

Bodhi
le

(vi.

[13 b] de
et

mme

recueillement
(viii.

(sam7-8).

dhi) est la fois

dhyna

un membre du dhyna

1.

2.

Comparer Anguttara iv. 248, o l'ordre des membres dififre. Sur pifta, voir Haracarita 45, 2, 123, 2, 273 (F. W. Thomas).

Hitian-tsang, xiv,
iv.

fol.

12 b-13

b.

69
est impossible

Mais, dirons-nous [avec les Sautrantikas],


le

il

que

la

samyagdrsti,

dharmapravicaya,
les
etc.,

le

samdhi

soient

membres

d'eux-mmes. Direz-vous que


sont

samyagdrsti,

etc.,

antrieures,

membres
le

des samyagdrsti^

postrieures ? Ce serait admettre

moment du Chemin n'a pas huit membres. Ce serait admettre que le dernier moment des membres de la Bodhi n'est pas un membre
que

premier

'.

La possession de
Upasakas ?
1.
'

la discipline

du jene

est-elle rserve

aux seuls

Samghabhadra rpond cette objection. les Upasakas et la place qu'ils occupent ct du Samgha, Bumouf, Introduction, 279-282 Spence Hardy, Eastern Monachism Oldenberg, Buddha
2.

Sur

1914, p. 182, 317, 429

Minaiev, Recherches, 296

Foucher, Art grco-bouddhique

du Gandhra,
Cullavagga,
relations

ii.

88

Przyluski, Lgende d'Aoka, p. 207-8.

v. 20,

Anguttara^
et des
le

iii.

36G,

iv.

344, importants en ce qui concerne les

du Samgha

UpSsakas.

Le texte capital est


dans
le

MahanSmastra dont plusieurs passages sont discuts

Kosa. D'autres passages relevs dans les notes de Buddhaghosa, Suman'

galavilsin, p. 235.

L'Upsaka est considr comme un religieux (Anguttara, ii. 8), puisqu'il a de donner l'UpavSsa ( VibhfisS, ci-dessus p. 65, n. 3), puisqu'il est appel Mais Upsaka signifie qui se confesser (iv. 34 a-b) c'est un tertiaire vnre [les trois perles] (Sumangalavilasin, p. 234), et nous verrons que, pour les Sautrantikas, on peut tre UpRsaka sans s'engager aux rgles de moralit
*

le droit

'

'

'.

'

'

(silspada) dont l'observation


Si le lac peut obtenir les

fait le parfait

Up&saka

(p.

70

n.

2 sous

vi).

fruits

de la vie religieuse

(srmanyaphala)

et

notamment la qualit d'Arhat, Kathvatthu, iv. 1, Milinda, 242, 265, 348. D'aprs un groupe de sources, le lac, mme kmabhogin, peut entrer dans le Chemin si, quoique vivant dans le monde, il garde la chastet (brahmacarin ;
;

exemple Ralston, Tibetan Taies, 197), il peut obtenir le fruit d'AnfigScas, il ne devient Arhat [C'est dans ce sens qu'il faut entendre Dhammapada 142 UdSna, vii. 10 Majjhima, i. 466, 483, 490 les textes ne disent pas nettement si le lac kdmahliogin peut obtenir les fruits de SrotaSpanna et de Sakrdgmin]. Mais Anguttara, iii. 451 numre vingt lacs qui ont obtenu la qualit d'Arhat voir Samyutta, v. 410, Milinda, comme le Kosa, croit que le lac peut devenir Arhat au moment o il devient Arhat, il devient moine le jour mme, il entre dans l'Ordre si l'Ordre n'existe pas, il entre dans une confrrie asctique. [Wassilieff, p. 2i8, suivi par Minaiev, Recherches, p. 220, s'est mpris
voir par

min

en aucun

sur le sens de sa source tibtaine, voir Kosa,

vi. 30].

Normalement,
dont

le ciel est la
il

rcompense de l'homme

qui, incapable

d'abandonner

les plaisirs

comprend

70

CHAPITRE

IV,

30

a-b.

30

a-b. Les autres peuvent possder le jene,


le

mais non pas sans

prendre

refuge

'.

Lorsque l'homme qui


rgles

n'est pas
le

Upasaka, avant de s'engager aux


jour-et-nuit, le triple refuge,
est produite en lui.
qu'il n'y ait

du jene, prend, dans

mme
;

alors la discipline du jene

(upavsasamvara)
(iv.

Non

pas sans la prise des refuges

la condition
d).

pas

erreur, etc.

(anyairjhnt)
dit
:

31

Le MahanamasQtra
blancs, mle et

Mahanaman,
le

le lac

aux vtements

muni de l'organe mle,


le

qui, aprs avoir pris refuge

dans

le
:

Bouddha, dans

Dharma, dans

Saipgha, prononce cette


,

parole

Considre-moi

comme Upasaka

[14 a] par cela seul

il

devient

Upasaka

Est-ce dire qu'on devienne

Upasaka par

la

seule prise des refuges ?


l'inanit (Theragfithft, 187), recule

devant l'obligation de la chastet (Suttanipftta,


pentalogue et l'Upavasa.

3%, Divya,

303), se contente d'observer le

Sur l'enseignement donn aux lacs, sermons sur le don, la morale, le ciel, etc., Majjhima, i. 379 Culla, vi. 4, 5, Mahavagga, i. 7, 5, etc. Dgha, ii. 113, Sarpyutta, iv. 314 Divya, 300, 617 Przyluski, Lgende d'Aoka, 196, 353. Senarl, Piyadasi, ii. 208. Voir iv. 112. Le lac malade ou mourant visit par Vvsika (moine rsident), etc., Anguttara, iii. 261, Majjhima, iii. 261 dfaut de moines, par des lacs, Samyutta, v. 408. Le lac rvle des Stras aux Bhiksus, Mahfivagga, iii. 5, 9.
;

du lac (Kosa, iv. 86). gzhan la han bsnen gnas yod mod kyi / skyabs su ma son ba la med =: [upavso 'nyesv api na] aranagatnanair vin j 2. i. Le Mah&nSmasQlra dans la rdaction d' Anguttara, iv. 220 et Samyutta, v. 395 (Sumangalavilasin, 234) a simplement yato kho mahnma buddham
Superstition, cueil
1.
:

saranam gato
hoti ettvat
prise
it

hoti

kho du refuge. Le MahfinaniasQtra sanscrit (Saipyukta,

dhammam saranam gato hoti samgham saranam gato mahnma upsako hoti = On devient Up&saka par la
33, 11) conlient

en outre une courte

. (De upsiktn csmn bhngacn dhrayatu). Ce Stra est partiellement cit dans la VyRkhya kiyatd hhadanta upsako bhavati j yatah khalu mahAntnan grhi avadCitavasanah purusah purusendriyasamafivgatah upsakatft niAnt dhraya iyatopsako bhavati.

formule ajoute la prise des refuges


Divya, 47, o on a
:

Considre-moi connue Upfisaka

mme

grhlty uddeapadam avadtavasana iti nirdeapadam purusa uddeapadam I puritsendriyasamanvAgata iti nirdeapadam). Hiuantsang ajoute la prire du candidat les mots kanmin updya dhraya.
(Vyfikhyft
ity
:

....

iii.

Une formule

plus complte avec de menues variantes, Anguttara,

i.

56,

Hiuan-tsangy
Les Aparntakas rpondent
:

xiv, fol.

13 b-14

a.

71
i)

Oui

(Vibhas, 124,

Les KsmTriens affirment qu'on ne peut tre UpSsaka lorsqu'on


ne possde pas la discipline d'Upasaka.
85 so ahani bhagavantam Samyutta, iv. 113, v. 12, Culla, vi. 4, 5, DTgha, saranam gacchdmi dhammam ca bhikkhusamgham ca upsakam mam bhagav dhretii ajjatagge pnupetam saranam gatam. Commentaire de la Sumangalavilsin matn bhagav tipsako ayam ti evam dhreht jntu Que Bhagavat me connais,se comme tant UpSsaka . pnupetam tipnehi upetam; c'est--dire: Aussi longtemps que ma vie dure, qu'aussi longtemps Bhagavat me considre comme upeta (venu lui), n'ayant pas un autre
i.
:

'

'

matre,

Upsaka ayant

pris le triple refuge, faisant ce qui est

convenable (kapqu'il n'est

piya).

On me

couperait la tte que je ne dirais pas du

Bouddha

pas

Bouddha
iv.

Voir

p.

74

n. 2.

n. 1), et

la
1.

Formule que Vasubandhu dcrit comme celle du Drstasatyastra (voir p. 74 qui est cite, dans sa premire partie, par le Vaibhsika (p. 72 1. 6) avec Xednv^ prnpeta au lieu de prnopeta (lecture interprte et discute p. 72
:

9 et p. 75 1. 6) Upsakam mtn dhraya adygrena yvajjlvam prnpetam [saranam gatam abiiprasannam]


V.

Le formulaire Sarvstivdin (Nanjio, 1166, dit


i.

et

traduit par Wieger,

Bouddhisme Chinois,
vie, je

146-7)

Moi un
le

tel,

d'aujourd'hui jusqu' la fin de la

prends refuge en Bouddha,

meilleur des bipdes

Sachez que je suis

un Upsaka ayant
rjouissant
pris les cinq sllas

pris refuge dfinitivement

en Bouddha, Dharma, Samgha, se


le
'

(abhiprasanna
.

l)

dans

le

Dharma du Bouddha Skyamuni, ayant


Ensuite on explique les cinq sllas et
*

rpter trois

fois.

candidat rpond qu'il les gardera.


(cheou o kii) remplace
vi.

L'expression
la

ayant pris
iv.
: *

les cinq slas

le

prnpeta de

formule

Nous possdons
',

l'original sanscrit

de l'expression

ayant pris

les

cinq

sllas

mita, p.

dans l'Abhisamaylanikrloka, commentant Astasahasrik prajnSpSra137. Nous apprenons que le Vinaya a deux lectures (pilia). D'aprs la
le reoit

premire, le candidat prie le matre (qui

comme UpSsaka)

de

le

considrer

comme un Upsaka comme un Upsaka

qui a pris qui a pris

le triple

refuge

d'aprs la seconde, de le considrer

le triple

refuge et les cinq rgles.

trisaranaparigraht (lire ^gamant) pancasikspadaparigrahc copsakas tathopsiketi dvidhbhedah j trisaranaparigrhtam (lire ^gatam) upsakam wm cryo dhrayatu / tath trisaranagatam pancasikspadaparigrhltain upsakam mm cryo dhrayatv iti vinayadvidhptht. (D'aprs une mauvaise copie du MS. de CalcuUa, Rjendrall, Buddhist
Literature, p. 194).

y a donc deux sortes d'Upsaka

celui qui a pris le refuge sans plus, celui

qui a pris le refuge et s'est engag observer les cinq rgles.


vii.

Formulaire npalais assez confus

(le

la prise des cinq rgles)

dans dikarmapradpa

renoncement aux dix pchs prcde (p. 189 de mon dition dans
p. 296.

Bouddhisme,

1898),

rsum par Minaiev, Recherches,

72

CHAPITRE

IV,

30 c-31

c.

Mais

n'est-ce pas contredire le

Sotra ?

Non

pas

'.

Car
le fait qu'il

30
La

c-d.

Par
'.

accepte la qualit d'Upasaka, la discipline

est produite

discipline

d'Upasaka se produit en
lorsqu'il
dit
:

lui

par la seule acceptation


Considre-moi partir

de la qualit d'Upasaka,
d'aujourd'hui, pour la vie,

comme un Upasaka i^rnpefa

Quel est
Il

le

sens de cette expression prnpeta ?

faut entendre, par ellipse, prntiptpeta,


p. 75, n.
1).

exempt de meurtre,

ayant renonc au meurtre (voir

Donc, en acceptant la qualit d'Upasaka, on prend la discipline


[puisqu'on se prsente

comme

ayant renonc au meurtre]. Cepen-

dant, pour qu'il connaisse les points de la rgle (ikspada), [14 b]

30
Par

d.

On

la lui explique,

comme

c'est aussi le cas

pour

le

Bhiku

*.

l'acte

ecclsiastique (jnpticatiirtha
:

karman)
lui fait

le

Bhiku a
les

acquis la discipline de Bhiku


rgles les plus importantes
cela.
:

cependant on

prendre
ceci,

Vous avez vous abstenir de


le

de

pour

Vos co-religieux vous diront le Sramanera ^ De mme en

reste

De mme en
:

va-t-il

va-t-il

pour l'Upasaka

il

obtient

1.

Paramartha

Non

pas, car

l'homme en question produit

les cinq renonce-

ments . 2. dge bsien nid du khas blans nas j sdompa, qui doit correspondre un [upagamyopsakatm damah]. On a iv. 38 dama pada plus deux syllabes hdul-ba. saffivara, mais le tibtain traduit dama

=
II

3.
4.

Voir ci-dessus

p. 71, n.

2 sous

iv.

uktis tu bhiksuvat

yaihaiva hi bliikstir labdhasamvaro 'pi jndpticaturthena karman ikspaddni yaihdsthlam grdhyate prajnpyate / ita cdmuta ca prdjikdibhyas tava satnvarah / anyni ca te sabrahmacdrinah
5.
:

Vyakhya

kathayisyantiti.
le Sramanera dit aham evatnnm tatn bhagavantam tathdarhantatn samyaksambuddham kyamunim dkydhirjatft pravrajitam anupravrajdmi grhasthaligam parityajmi pravrajydlingant samddadmi / ramanoddeatn mfft dhdraya et rpte cette formule (evam yvat trir api), il acquiert la discipline de Sramanera qu'on lui dtaille ensuite. 6.

Lorsque

gatam

Hitian-tsangy
la discipline

xiv, fol.

14 a-b.

73
refuge

en prenant une

fois,

deux

fois, trois fois le triple


:

ensuite on lui fait prendre (grhyate) les rgles

Abandonnant

le

meurtre, je renonce au meurtre

Donc on

n'est pas

Upasaka sans

possder la discipline d'Upasaka.

31

a-b. Si tout

Upasaka possde

la discipline
etc. ?
*

d'Upsaka, comment

rUpasaka

peut-il tre

ekadesakrin,

Si tous les

Upfisakas sont placs dans la discipline d'Upsaka,


peut-il dcrire quatre sortes

comment Bhagavat
trois

d'Upasaka, l'Upa-

saka d'une rgle (ekadesakrin), de deux rgles (pradeakrin), de

ou quatre rgles (yadhliyaskrin), des cinq rgles (paripr~

nakrin) ?

31

c.

Ces termes,

dit l'Ecole,

visent le fait de l'observation des

rgles \
L' Upasaka qui,

en

fait,

observe (raksati) une des rgles


[Il

[qu'il

acceptes toutes] est dit pratiquer (kar) cette rgle.

ne faut pas

comprendre que Yekadesakrin

soit

un Upasaka qui

s'est

engag

pratiquer une seule rgle]. Cependant tous les Upasakas sont gale-

ment placs dans

la discipline

*.

1. gai te thams cad bsdams yin na / sna gcig spyod sogs ji Ita bu [sarve cet samvrt ekadesakrydayah katham /] 2. La Matiavyutpatti, 84, ajoute apariprnakrin avant paripfirnakrin ; les versions chinoise et tibtaine traduisent pradeakrin qui observe (spyod-

=
I

pa,

Mng) pendant

le

jour (ni-tshe

'

un jour

'

et Russi

pradea).
11)
:

La Vyfikhy

cite le

Stra (Mahanfimastra, Samyukta, 33,

kiyat

bJia-

danta upasaka ekadesakr bhavati pariprnakr iha Mahnmann upasakah prntiptam prahya prantiptd virato bhavati iyat Mahnmann npsakah siksym ekadesakr bhavati dvbhym
I

prativiratah pradesakrl bhavati / tribhyah prativiratas caturbhyo va yadbhyaskrl bhavati / pancabhyah prativiratah pariprnakr bhavati. Chavannes, Cinq cent contes, i. 244, illustre ce texte.
3.

de bsrun ba la gsuns zhes grags =r


:

[te

kila raksakkhyth] ?
,

Para-

martha
4.

Parce

qu'ils observent,

nomms

ainsi

Hiuan-tsang

Nomms

en

visant (yo) l'observation.

appel

Hiuan-tsang poursuit Preneur d'une rgle


'

S'il
....

en

tait autrement,

l'Upasaka d'une rgle serait


s'il

'

La question

est de savoir

n'y a pas des

Upasakas, non munis de

la discipline

avec ses cinq membres, et qui se sont

74 Le Sautrantika objecte
i.

CHAPITRE

IV,

31c.

votre doctrine contredit le Satra (titsiitra).

Vous

dites qu'on acquiert la discipline par le seul fait d'accepter

la (jualit

d'U^^ska prnpeta

Considre-moi

...

comme Upasaka
Stra qui nous

prnpeta.

Tel n'est pas

le texte

du Sotra [15

a].

En

efYet,

le

intresse, c'est le

Mahanamastra

qui donne la dfinition de l'Upale

saka, et

non pas un autre Stra. Et

Mahanamastra
autre

n'a pas cette

expression prnpeta.

Vous prtendez vous

autoriser d'un
vie,

Stra

*,

qui

porte

Depuis aujourd'hui, pour la

[considre-moi

comme Upasaka]
qui ont vu les

risquant

ma

vie (prnopeta)-, ayant pris refuge, croyant parfaite

ment (ahhiprasanna),

Or

ce texte vise les

hommes

engags observer une, deux,

trois,

quatre rgles. Non, d'aprs les Vaibhfisikas

Ykadesakrin est rUpfisaka qui viole quatre des rgles qu'il a acceptes. Dans Anguttara iii. 215, l'Upsaka Gavesin, silesu aparipralrin, dclare
ses camarades
:

A partir d'aujourd'hui
prend une une

considrez-moi

comme

sic^u paripfira-

krin

Ensuite

il

les obligations
iv.
:

du Bhiksu [qui seul est un

homme
1.

de moralit complte].
le

75

Anguttara,

380, v. 131.

D'aprs la Vyfikhya,

Drsjasatyastra
1.

avec raison,

comme

il

rsulte

du

texte

mme

de Vasubandhu,

p.

En

outre

Par Drstasatyastra, j'entends 'le Stra o le candidat la qualit d'UpRsaka un homme qui a vu les vrits . Il s'agit du texte Divya, 75, ou d'ini texte semblable Bhagavat dtruit l'hrsie de personnaHsme du brahmane Indra, qui obtient le fruit de SrotaSpanna .... sa drsfasatyah kathayati / atikrnto ham
est
:
:

bhadanttikrdntah (Le pli lit abhikkantam ...) / eso 'ham hliagavantam buddham saranam gacchmi dliarmam ca bhiksusamyham ca / upsakatn ca mm dhraya adydgrena yvajjvam pranopetam saranam gatam abhiprasannam (Edition gatam / abhiprasauno 'theudro brahmana .... ; mme texte, Divya, 462, avec la bonne lecture). L'diteur japonais du Kosa renseigne comme DrstasatyasQtra le Stra de Srona
:

le fils

de G|-hapati (Sainyukta,
souilhire,

1,

20)

Srona, ayant cart toute poussire,


la h^i,

abandonn toute
loi
...

obtenu
:

le

pur il de

au moment o
sont
le roi
:

il

vit la
...

il

se leva et dit Sfripiitra


l'il,

Moi, partir d'aujourd'hui, je prends refuge


la qualit d'Upfisaka,

Des possesseurs de
cl
fndtft

candidats
:

Udena

Sona (Samyulta, iv. 113) mais ils emploient la fonnule ordinaire iipsakani Bhdradvdjo dhretu ajjatagge pdnupetatft saranaftt gatam, omettant Vabhiprasanna du sanscrit (Sur abhiprasanna, Saipyutta, v. 225, 378). 2, Tel est bien le sens de l'expression prdnopeta srog dan bsho ba risquant la vie abandonnant la vie (Hiuan*tsang). On a vu p. 71, n. 2 sou.s iii, l'interprtation de Buddhaghosa.

Hiuan-tsang,

xiv, fol.

14 b-15

b.

75
vi.

vrits, qui ont acquis la foi d'intelligence


et qui,

(avefyaprasda,

73),

par consquent, adhrent la Bonne Loi

mme
le

au prix de la

vie

Nous sommes incapables d'abandonner


.

Dharma, mme

pour sauver notre vie


discipline d'Upasaka.

Ce

texte ne

donne pas

la dfinition de la

En
le le

outre,

l'expression prnpeta, sur


lit

laquelle

vous tablissez
ni

votre thorie, ne se

nulle part, ni dans le

MahanmasQtra,

dans

DrstasatyasQtra. Qui pourrait admettre semblable expression dont

sens

manque de

prcision ?

'

Qui, sur la foi de cette expression

admettrait que l'Upsaka a pris les cinq renoncements avant de les

prendre rituellement ?
ii.

Si l'expression

ekadesakrin dsigne un
pose dans
le

homme

qui viole la

discipline, la question
tifie, ni

Stra

(p. 73, n. 2) n'est

pas jus-

non plus

la rponse.
et
:

En

effet,

quel est celui qui, connaissant

la discipline

d'Upasaka

sachant qu'elle comporte cinq membres,

sera incapable d'expliquer

Celui qui ne viole pas une rgle observe

une rgle

et le reste

Au
pline

contraire, quelqu'un qui ne connat pas l'tendue de la disci-

d'Upasaka [15
trois,

b], visant les

personnes capables d'observer une,

deux,

toutes les rgles (tannitraiksksami prati), pourra


:

poser la question
rgle....

Que

faut-il

pour qu'on

soit

un Upasaka d'une
les rgles ? .

Que

faut-il

pour qu'on
rplique.

soit

un Upasaka de toutes

Le Vaibhasika

Si on tait

Upasaka sans possder


tre

la

discipline d'Upasaka,

on pourrait aussi bien

Bhiksu ou Srma-

nera avec une discipline incomplte.

Rponse.

Comment
possdant

connaissons-nous l'tendue,

le

nombre des

membres des disciplines d'Upasaka, de Sramanera, de Bhiksu ? Evidemment par l'enseignement du Matre. Or le Matre parle d'Upasakas
ne
pas la discipline dans son entiret
;

il

ne

1.

prnpetam

peut s'expliquer

pmHe6%o 'petam, prnair

apetant, prnla
,

tiptdibhyo 'petam. Cette dernire version exempt du meurtre, etc. justifie doctrine Vaibhasika. Dire Sache que je suis un Upasaka exempt de meurtre c'est s'engager l'abstention du meurtre.
:

76

CHAPITRE

VI,

31 d-32.
discipline incomplte.
'

parle pas de Bhiksus on de

Sramaneras de

Le Vaibhasika du Kasmir n'admet pas

cette opinion.
etc.,

31
La
on

d.

Toutes

les disciplines

sont faibles,

d'aprs la pense'.

faiblesse, la mdiocrit, la force des huit disciplines,

dpend de

la faiblesse, de la mdiocrit, de la force de la pense par laquelle


les

a prises (samdna) [16

a].

S'il

en est ainsi, la discipline


d'un Prlhag-

de Pratimoka d'un Arhat pourrait tre

faible, et celle

jana pourrait tre

forte.

Si on prend seulement la discipline


refuge, devient-on

(samvara) sans prendre

le

UpSsaka

Non

fors

le

cas d'ignorance de celui qui donne et de celui qui

prend (najanyatrj nndt).

En
dans

quoi prend refuge l'homme qui prend refuge dans


le

le

Bouddha,

Dharma, dans

le

Samgha

32. Celui qui prend


d'Asaika qui font
qui font le
1.
i,

le triple

refuge prend refuge dans les


les

dharma^

le

Bouddha, dans
dans
le

dharmas

de deux espces

Samgha,

et

Nirvana \
font pas partie de la discipline, Angutlara,

Les

khuddnukhuddakas ne

231.
2.

3.

chun nu la sogs yid ji bzhin =: [mrdvdayo mauo yath II] buddha[satftgha]karn dharmn asaiksn ubhayms ca sait
JI

nirv-

natn caiti saranam yo yti saranatrayam


Voir dans l'Introduction
xxiii.
4-,

la

traduction du

commentaire de Samghabhadra,
le

fol.

84

et suivants.
7.

Vibhasft, 34,

Quelques-uns disent que, prendre refuge dans


le

Bouddha,

c'est

prendre refuge dans


mre, est
c'est les

corps constitu par la tte, la nuque,

le ventre, le dos, les

mains, les pieds du Tathftgala.

On explique donc que ce corps, n du pre et de la dharmas impurs (ssrava), n'est donc pas le lieu du refuge le refuge, dharmas d'Asaiksa du Bouddha qui font la Bodhi, c'est le dharmakya.
:

Quelques-uns disent que prendre refuge dans


trois vrits [douleur, origine,
dfinis, etc.
;

le

Dharma,
les

c'est

prendre refuge dans

chemin]

ou dans

dharmas bons,
:

mauvais, non-

ou dans

les rgles

imposes aux Bhiksus


ne sont donc pas
le

Il

faut faire ceci, ne pas

faire cela

On

explique donc que tous ces


;

dharmas
la fin

sont conditionns (saffis:

kfta), impurs (sCisrava)

qu'ils

refuge

le refuge, c'est

seule-

ment

la vrit

de

la destruction

(nirodhasatya),
le

de lu

soif, le

Nirvana.

Quelques-uns disent que prendre refuge dans

Samgha,

c'est

prendre refuge

Hiuan-tsang,
i.

xiv, fol.

15 b-16

a.

77

les
les

Bouddha prend refuge dans dharmas d'Arhat qui font un Bouddha (huddhakraka), dharmas causes de la dsignation Bouddha , c'est--dire les
Celui qui prend refuge dans le

dharmas en
personne est

raison desquels,

comme
'

cause capitale, une certaine


les

nomme Bouddha

ou bien

dharmas

par l'acquiest

sition desquels

une certaine personne, comprenant toutes choses,


sont
le

nomme Bouddha, (^es dharmas dajhna et la samyagdrsti (vi. 50,


tent (parivra) ces

ksayajnna, Vanutp-

67) avec les

dharmas
les cinq

qui escor-

jhnas,

c'est--dire

avec

skandhas

purs l

Quant au corps matriel (rpakya)


ne prend pas refuge dans
fait, le

du Bouddha,

il

n'a pas subi

de modification par l'acquisition de la qualit de Bouddha.


le

Donc on
est,

corps matriel du

Bouddha

qui

en

corps matriel du Bodhisattva.


les

Prend-on refuge dans tous

Bouddhas ou dans un Bouddha


Bouddhas ont tous
et

D'aprs la nature des choses, dfaut d'une dclaration explicite


(kanthokti), dans tous les Bouddhas. Car les
le

suivi

mme

chemin, chemin naturel (lankika)

surnaturel (lokottara)

(vii.

34) \ [16 b]

dans

le

Samgha

des Pravrajitas des quatre castes

(se

sing tch'u ki).

On

explique donc que les attitudes (Irypatha), etc. (wi

hng sing) de ce Sam-

gha sont impures (ssrava) : le refuge, c'est les clharmas de Saiksa et d'Asaiksa qui font le Samgha. 1. yesm pradhnyena sa tmabhvo bttddha ity itcyate. La dsignation Bouddha vise d'autres dharmas, d'autres gunas, mais non pas principalement (apradhnyena). 2. C'est le dharmakya, vii. 34 Muson, 1913, p. 266. 3. Hiuan-tsang rpdikya. Voir vii. 31. 4. Vykhya latikikamrgasya piinyajnnasambhralaksanasya lokottarasya ca ksayajnndilaksanasyvilaksanatvt tuyatvt. Vibhas, 34, 11. Si on prend refuge dans un Bouddha, le refuge sera partiel si on prend refuge dans tous les Bouddhas, pourquoi dit-on Je prends refuge dans le Bouddha , et non pas dans tous les Bouddhas ?.. Prendre refuge dans le Bouddha, c'est prendre refuge dans tous les Bouddhas dont le nombre dpasse celui des sables du Gange .... Le mot Bouddha , comprend tous les Bouddhas, parce qu'ils sont de mme espce. Prendre refuge dans le Samgha, est-ce prendre refuge dans un disciple du Bouddha ou dans tous ?

78
ii.

CHAPITRE

IV, 32.

Celui qui prend refuge dans le Sarngha prend refuge dans les
et

dharmaSy
saints

aiksa

et

aaiksa, de non-Arhat

et

d'Arhat, qui font

le

SaiTigha, c'est--dire les

dharmas

par l'acquisition desquels

les huit

(ryapudgala) deviennent un samgha (samghihhavanti),


chemin.
les

deviennent unanimes (samagrarpa) ne pouvant tre diviss (ahhe-

dyatvt) en ce qui regarde

le

Prend-on refuge dans tous

Samghas ou dans un Samgha ?


:

D'aprs la nature des choses, dans tous


les saints est toujours le

car le chemin suivi par


le

mme.

Sans doute,
le

Bouddha a

dit

aux

deux marchands
dans l'avenir
qualits
iii.

Prenez aussi refuge dans

Samgha

qui existera
les

\ mais le Matre s'exprime ainsi


visible

pour exalter

du joyau de Samgha qui sera hientt

aux marchands ^
refuge dans le
(i.

Celui qui prend refuge dans le


le

Dharma prend
le

Nirvana, c'est--dire dans


Il

prcdisamkliynii'odha

5,

ii.

55

d).

prend refuge dans tout Nirvana, car

Nirvana a pour unique


sens du mot

caractre la cessation des passions et de la souffrance de soi et d'autrui

(ntyekalaksanatvt) (Voir

vi.

73

c le

dharma

dans dharme avetyaprasda).


iv.

Discussion.

Si le

Bouddha

n'est pas autre chose


le fait

que
le

les

dharmas

dits

aaiksa

ou d'Arhat, comment

de blesser

Bouddha avec une mauvaise


iv.

pense peut-il constituer un pch mortel (nantarya,

96) ?

Les Vaibhasikas (Yibhaa, 34,


les

9)

rpondent
le

Lorsqu'on blesse

lments matriels (rpa) qui sont

soutien de ces

dharmas

(srayavipdant)j ces dharmas eux-mmes souffrent

injure.

1. Vibhfisfi 34, 12, cite le mme texte tatra bhagavms trapusabhalikan vanijv mantrayate sma / ete ytivm huddhain aranam gacchatam / dharmam ca j yo 'sait bhavisyaty angate 'dhvani satngho nnia tam api aranam gacchatam. (Extrait de riniroductiou au SanighaLliedavastu dont un fragment, retrouv au Turkestan (Miran), a t publi JRAS. 1913, p. 850). Comparer Mahfivagga, i. 4 Mahavaslu, iii, 304 Lalita, p. 386 Dulva, iv. 54 b. Variantes nombreuses.
: ;

S.

tatpratyaksabhvinah satfigharatnasyodbhvanrtham

yai

saifi-

gharatnafft tayos trapusabhallikayor dharmacakrapravartannantarum

pratyaksibhavi^yati tasya gutmtah prakaurtham.

Hiuan-tscmg,
Mais
le

xiv, fol.

16 b-17
le

a.

79
est seule-

Sastra (Yibhasa, 34,

s)

ne

dit

pas que

Bouddha
les

ment dharmas dits asaiksa \ Il dit que le Bouddha est qui font un Bouddha ^ c'est--dire que les dharmas soit

dharmas

naturels, soit

surnaturels (aukika, lokottara), qui sont l'objet de la dsignation

Bouddha

sont

le

Bouddha. Donc Vraya

l'organisme, le

support constitu par les cinq

skandhas

naturels

le

Sastra ne

nie pas qu'il fasse partie de la qualit de

tisedha).

Donc

l'objection tire de la blessure du

Bouddha (huddhatvpraBouddha est sans


n'tait

valeur. [17 a]
S'il

en tait autrement,
si le

si

le

Bouddha

que dharmas

dits

asaiksa,
n'tait

que

Samgha (c'est--dire les saints, Saiksas et dharmas dits saiksa et asaiksa, une personne
*

Arhats)
dont la

pense est actuellement


tre ni

naturelle
Et,

'

(laukikaclttastha) ne pourrait

Bouddha

ni

Samgha.
Bhiksu

en vertu des

mmes

principes,

il

faudrait dire que le

est

uniquement

la moralit, la discipline

du Bhiksu.
Mais,
les
dit le

Vaibhasika,

si

le

corps (sraya)

est, lui aussi,


dit-il
:

parmi
Celui
dits

dharmas

qui font le Bouddha, pourquoi le Sastra


il

qui prend refuge en Bouddha,

prend refuge dans


^

les

dharmas

asaiksa qui font

le Bouddha Nous rpondrons de mme,


:

celui qui

honore

les

Bhiksus, ce qu'il

honore, c'est la moralit qui

fait le

Bhiksu.
le

D'aprs une autre opinion, celui qui prend refuge dans

Bouddha
Bouddha.

prend refuge dans

les dix-huit

venikadharmas

(vii.

28) du

Que

sont, de leur nature, les prises de refuge ?


(iv.

Elles sont vijnapti vocale

d)

*.

Quel est

le

sens de

'

refuge

'

(sarana) ?

Les

trois

refuges sont ainsi

nomms

parce que, en s'y rfugiant,

on obtient
1.

la dlivrance dfinitive de toute souffrance.

2. 3.

aaiks dharm eva buddhah. hxiddhakrakh. yo buddham saranam gacchaty asaiksn asau buddhakrakn dharyacchati.
10.

mn saranam
4.

Plusieurs opinions, Vibhs, 34,

80
Bhagavat
le plus

CHAPITRE
dit

IV,

32-33.
la crainte, les

en

effet

'

Tourments par

hommes,

souvent', prennent refuge dans les montagnes, les forts, les


'.

bosquets, les arbres sacrs

Ce

n'est pas l le

bon

refuge, le refuge

suprme

ce n'est pas en s'y rfugiant qu'on est dlivr de toute

souffrance. Mais xelui qui prend refuge dans le

Bouddha

[17

b], le

Dharma,

le

Samgha,

lorsqu'il voit

par la prajyi les quatre vrits,

douleur, origine de la douleur, passage au-del de la douleur, saint

chemin huit membres qui mne au calme Nirvana,


bon refuge,
c'est l le refuge
.

on

c'est l le

suprme en
;

s'y rfugiant,

est dlivr

de toute souffrance

C'est pourquoi les prises de refuge sont la porte de la prise de

toutes les disciplines.

Les autres disciplines comportent


(ahralimacaryavirati)
le
;

le

renoncement l'incontinence

la discipline
illicite

d'Upasaka comporte seulement


iv. 74).

renoncement l'amour

(kmamithycra,

Pour-

quoi ?

33
nir ^
i.

a-b.

L'amour

illicite,

parce qu'il est trs blm, parce qu'on

s'en abstient aisment, parce que les

ryas ont obtenu de s'en abste-

L'amour

iUicite est trs

blm dans

le

monde parce

qu'il est la

corruption de la

femme
*

d'autrui, parce qu'il est rtribu

dans une

mauvaise destine (apCiyikatvl).


2. Il est facile
il

aux

matres de maison

'

de s'en abstenir [18 a]


:

leur est difficile de s'abstenir de l'incontinence


le

les

matres de

maison ne quittent pas


des choses
1.

monde parce

qu'ils

ne sont pas capables

difficiles

(duhkara). (Divya, 303)


;

Dhammapada
8.

188-192

Udftnavarga,

xxvii.

28-30

DivySvadfina,

p.

164

Vibhfistt, 34,
2.

On

a bahufft ve

saranam yanti

...;

Divya

bahavah aranani

ynti, que

Paramnrtlia traduit.
3.

L'Udanavarga tibtain porte phal cher.


:

caityavrk^a
og

= caiiyakalpitavrksa.
restha
;

Ud&navarga et les versions chinoises principal da / sla phyir mi byed thob phyir ro [mithyOcaro 'tisvadyasukhakaranalabhatah /J
4.
^*-

khema, Divya

^yem

\n tu sniad phyir

Hiuan-tsang,
3.

xiv, fol. 17

a-18

a.

81

l'endroit de l'amour
c'est--dire, ils ont

illicite, les

ryas possdent Vakarana;

samvara,
en
effet,

obtenu de s'en abstenir dfinitivement


ils

dans l'existence venir,

seront incapables de violer

le

prcepte. Tel n'est pas le cas en ce qui concerne l'incontinence.

Par

consquent, la discipline d'Upsaka comporte seulement

le

renonce-

ment l'amour
d'Upsaka

illicite

il

est inadmissible

en

effet

que des ryas,

dans une existence ultrieure, soient susceptibles de violer la discipline


:

ce qui

pourrait arriver

si

elle

comportait
il

le

renonce-

ment

l'incontinence.

Par akaranasamvara,
akriyym
'.

faut comprendre
l'abstention

akriijniyama,

[c'est--dire

ekntat,

certaine d'une action]

L'homme

qui se marie aprs avoir pris la discipline d'Upsaka

avait-il pris le

renoncement l'gard de
;

la

femme
iv.

qu'il

pouse ?

Oui, rpond le Vaibhsika

car,

dans l'hypothse contraire, cet

homme

aurait pris une discipline restreinte (prdeika,


alors cet

36
!

a-b).

Mais
pas

homme

viole la discipline lorsqu'il se


ils

marie

Non

33
ils

c-d.

Gomme

ont accept la discipline, ainsi

l'ont-ils

acquise

ne

l'ont

pas accepte l'gard des personnes ^

dkriyniyamo hy akaranasamvarah. Vyakhyfi akriyym 1. Bhasya akarane niyama ekntat akriyniyamah / so 'karanasamvarah akaranalaksanah samvarah / na samclnikah samvara ity artJiah j sa ca SautrntikanayenvastJivisesa eva Vaibhsikanayena tu llngam avijnaptir
:
:

iti.

Voir

ci-dessLis p. 17, note^

des rfrences aux sources plies, setughtavirati


;

= samucchedavirati,
parfaite.

sampattavirati, samdnavirati

p. 48,

la distinction

du samdnaslla et du dharmatprtilambhikasla. L'Abhidhamma a beaucoup de points de contact avec l'Abliidlianna, mais la concordance n'est pas
Le Vaibhsika attribue l'rya
le

samvara
:

pur

(iv.

17

c)

qui n'est pas simplep.

ment akarana, mais

est

un

certain rpa,

avijnapti, setu (voir


lui la srie

17)

le

Sautrntika n'admet pas ['avijnapti


incapable de certains actes (voir
limines
:

pour

de l'rya est devenue

p.

84

n. 2), les

semences de ces actes ayant t

bhsika,

Vakaranasamvara, Vavijnapti inbranlable que postule le Vain'est pas une chose en soi, est akriyym ekntat, l'abstention
ji

certaine rsultant d'une transformation de la personne.


2.

sdom pa

Itar

khas blans bzhin

thob kyi rgyud las

ma yin no. [samvaro


6

yathopagato labhyate na tu tnatah]

82

CHAPITRE

IV,

33 c-34.
Ils

Comme

ils

ont accept la discipline, ainsi l'ont-ils acquise.


:

se
:

sont engags en disant


Je renonce tout

Je renonce l'amour
toute
:

illicite ,

c'est--dire

commerce avec

femme dendiie(agamya)

ils

ne se sont pas engags en disant

Avec

telle

personne \

je

ne

commettrai pas l'incontinence. l'amour


illicite

[18 b] Par consquent, ayant renonc


ils

et

non pas l'incontinence,

ne violent pas la

discipline en se mariant.

Parmi les pchs de parole, pourquoi le renoncement (tyga) au mensonge constitue-t-il un des points de la rgle (iksnga) de
rUpasaka, tandis que sont omis
de parole ?
les

renoncements aux autres pchs

Pour
dans
le

les

mmes

raisons

parce que

le

mensonge

est trs

blm

monde, parce que

les

matres de maison s'en abstiennent


;

aisment, parce que les ryas ne sont pas capables de mentir


aussi pour une quatrime raison
:

et

34 a-b.
[Si le

Parce que, ayant viol n'importe quelle rgle,


n'tait

il

mentirait K

mensonge
il

pas
:

interdit],

ayant viol n'importe quelle


pas
fait .
:

rgle, interrog,

mentirait

Je ne

l'ai

Par consquent

rUpasaka

doit

renoncer au mensonge, pensant

Comme

j'aurai

transgress, ainsi je confesserai.

1.

atra samtne.
:

Hiuan-tsang

Ils
.

n'ont pas, l'gard de la srie de tous

les tres, dit

Je renonce l'incontinence
:

Paramartha

Ils

n'ont pas, l'gard

de cette srie (asntt samtnt), dit Je renonce .... 2. bslab pa thams cad hdas gyur na / brdzun du tha bar bgyur bahi phyir [sarvaiks atikrnto mrsvdl prasajyate sarvasikstikramane mrs-

vdaprasangatah
les rgles.

Hiuan-tsang traduit

Le mensonge tant autoris, il transgresserait toutes Ayant transgress les rgles, au temps o il est interrog, si le
:

mensonge tait autoris, il dirait Je ne l'ai pas fait , et cause de cela beaucoup de transgressions des rgles. Aussi Bhagavat, dsirant qu'on garde les rgles, place le renoncement au mensonge dans toutes les disciplines, se demandant Comment l'aire que l'Up&saka^ s'il viole la rgle, le dclare lui-mme et
:

empche de nouvelles transgressions ? Comparer le Sotra Rahula sur le mensonge, Majjhima,


bra
;

i.

415

dit

de Bha-

Vijfi&nakaya,

xxiii. 9,

6 b

3.

Hiuan-tsang,
Pourquoi
ils

xiv, fol.

18 a-19

b.

83
'

les

renoncements aux pchs de dsobissance

ne sont-

pas compris dans la discipline d'Upasaka? [19 a]


justifie
c-d.
:

Question

non

34

Renoncement

la liqueur forte, qui est

un pch de ds-

obissance ^

Pourquoi l'Upasaka
sance
et

doit-il

renoncer ce seul pch de dsobis-

non pas aux autres ?


Pour que
les autres rgles soient

34
rgles.
i.

d.

gardes l
les autres

Celui qui boit la liqueur forte

(madya) ne gardera pas

Les bhidharmikas soutiennent que la liqueur forte n'a pas

le

caractre d'un pch de nature.

Le pch de nature
:

n'est

commis que
arrive que,
elle

par l'homme dont la pense est souille (klista)


titre

or

il

de remde, on boive la liqueur forte dans la quantit o

n'est pas enivrante.


telle

La pense
;

est souille si

on boit en sachant que

quantit est enivrante

la pense n'est pas souille lorsqu'on

boit en sachant

que

telle

quantit n'est pas enivrante (aniadanlya-

mtram
ii.

viditv).
l'avis des

Tel n'est pas

Vinayadharas. D'aprs eux, la Hqueur

forte est
1.

pch de nature.
:

A
,

Upali qui lui demandait

Gomment
:

faut-il

soigner les mala-

des ?

de nature
forte

Bhagavat a rpondu [19 b] Except, Upali, par le pch *. Et, d'autre part, Bhagavat n'a pas permis la liqueur
:

(madyapna) aux Sakyas malades

Ceux qui me reconnais-

sent pour leur matre ne doivent pas boire de liqueur forte,


1.

mme

pratiksepanasvadya, pratisedlia^, prajnapti'^, par opposition au pch Pch de celui qui fait un acte dfendu, parce qu'il ne respecte pas la loi (ssHna) de Bhagavat (iv. 122 c). 2. bcad pahi kha na ma tho ba / myos hgyur las praUJcsepanasvady[n
de nature, prakrtisvadya.

madyt]
3.
4.

gzhan bsrun phyir ro

katham bhadanta

....

cikitsyah

prakrtisvadyam Uple sthpayitv.


p.

Sur jalogi, Conciles bouddhiques, Muson, 1905,


p. 508.

290

Lvi, JAs. 1912,

ii.

84

CHAPITRE

IV,

34
*

C-d.

avec la pointe d'un brin de pturin

Puisque Bhagavat n'interdit


et

que

le

pch de nature en cas de maladie (UpalisQtra)


forte,
il

cependant

ne permet pas la liqueur

est

clair

que

la liqueur forte est

pch de nature.
2.

Les ryas,

mme
^

dans l'existence suivante, ne boivent pas la

liqueur forte, pas plus qu'ils ne commettent les autres pchs de


nature, meurtre, etc.
3. L'Ecriture,

dans

le

Nandikastra

et ailleurs,
'*.

range la liqueur

forte
iii.

parmi

les mfaits

du corps (kyadiiscarita)
:

Les bhidharmikas rpondent

1.

En

gnral, le pch de dsobissance est permis


le
:

aux malades,
fait

ainsi

que

prouve

la

rponse Upali. Toutefois la liqueur forte

exception
dite

quoique seulement pch de dsobissance,


et cela

elle est inter-

aux malades,

en vue d'empcher

les

consquences fcheu'%

ses de la liqueur forte

(prasangaparilirrtham)
Madhyamfigama,
:

parce que la

1.

D'aprs
:

l'dileiir

japonais,

38,

9.

Le texte est cit dans

stram uddiadbhih kiigrenpi madyant na ptavyam. Dans Divya, 191, on a mfn bho bhiksavah stram uddisyadbhir madyam apeyam adeyam antatah kugrenpi, que Speyer corrige uddiya
la V^ykhyfi

mm

[bhava]dbhr ... Huber, Sources du Divya, BEFEO. 1906, 31, approuve cette coiTection, et montre la relation du Divya avec le 79' pryaciUika. Bhagavat n'interdit pas seulement la liqueur forte en quantit enivrante (madanya). L'Upfisaka malade qui consent manger de la viande de chien mais non pas boire du vin, et qui cite le Sotra de la maison , Stralamkfira, Huber, 434. Chavannes, Cinq cents contes, iii. 14. Quatre upakkilesas : surmerayapna, methuna, j&tarpa, micchjlva
(Anguttara,
2.
ii.

53, AtthasSlin, 380)


p. 81.

Voir ci-dessus,

Si on leur met dans la bouche


vol,
la

du

lait

ml

d'alcool,

le lait entre,
3. 4.

non pas

l'alcool, Sumaiigalavilasin, p. 305.

Mdo

(Csoma), xxvi, 425.

Quatre kyaducaritas, meurtre,

amour

illicite,

surmaireyapramddes kyadticaritas,

dasthna.
5.

L'alcool

manque dans
:

liste

classique

Mahfivyutpatti, 91, etc.

Hiuan*tsang traduit

parce que, en raison de la transgression de celte


.

rgle,
fois,

on commettrait

le

pch de nature

La

Vyftkhyfi dit

Bue une
dit
:

seule
trlni

la liqueur forte est mortelle

{vyasanlbhavet), car Bhagavat a

sthndni pratisevamdnasya ndsti U'ptir va aatftt va paryptir v> / madyam abrahmacaryam stynamiddhatn ceti. Mme enseignement dans Anguttara, 261 (soppassa bhikkhave patisevanya nutthi titti, surd,merayapdnassa methunadhammasampattiy ...).
i.
,

Hiuan-tsang,

xiv, fol.

19 b-20
'.

a.

85

quantit enivrante n'est pas dtermine


2. Si les

ryas s'abstiennent certainement (anadhycarana) de


pas qu'elle soit pch de nature, mais parce
'
;

la liqueur forte, ce n'est


qu'ils sont

munis de

la force-de-pudeur

[s'ils

n'en boivent pas en

secret

^],

c'est
;

parce que la liqueur forte


s'ils

fait dfaillir la

mmoire

(smrtina)
que
3.

n'en boivent

mme

pas une goutte, c'est parce

la quantit enivrante n'est

pas dtermine,

L'Ecriture considre la liqueur forte

comme pour le poison. comme un mfait corporel


'

(diicarita), parce que la liqueur forte est

cause de non-vigilance

'

(pranidasthna). En

effet,

la

rgle (ikspada) relative


:

la

liqueur forte comporte cette expression

Abandonnant
maireya,
je
les autres

le

prani-

dasthna
ne
dit

qu'est la liqueur forte,


....

sur

et

renonce au
pchs
:

pramdasthna
pas
:

Ce

n'est pas le cas

pour

on
;

Je renonce au

pramdasthna

qu'est le meurtre

et cela,

parce que les autres pchs sont pchs de nature. [20 a]


dit

Le Stra
forte
'\

qu'on renat en enfer par la pratique de la Hqueur


de la liqueur
forte,

En consquence (prasangena)
d'o,

activit

continuelle d'une srie de mauvaises penses

(abhksnam aktialaactivit (vrtti-

samtatipravrttes)
acte

ou bien projection (ksepa, vedha) d'un


enfer,

nouveau rtribuable en

ou bien entre en

lbha), au

moment
le
'

de la mort, d'un acte ancien. de


l'expression

Quel

est

sens

surmaireyamadyapram'
riz

dasthna

La sur
1.

est la boisson

fermente (sava) de

(anna)

le

mailes

La mme quantit de

madya
:

est

madanlya

ou non-madaniya suivant
hr,

circonstances.
2.

Les cinq balas des Saiksas

sraddh, vrya,

apatrpya, prajfi.

L'ordre diffre
3.

Angultara
:

iii.

1,

Vykhya

yadi hrmattvt tadaiiadhycaranam ajntam udakdivat


:

kasmn na pihanti.
Nandikastra dit 4. Le surniaireyamadyapramdasthdnensevitena Comparer bhdvitena bahulkrteua kyasya hhedn narakespapadyate.

Dgha,

iii.

182

surmerayapramdatthnnuyogo apyaniko
iii.

de

mme

le

jtappamdatthna.
5.

Dgha,

iii.

195, 235, Anguttara,

212, Samyutta,

il.

167.

86
reya
est la boisson
etc.)-

CHAPITRE

IV,

34

c-35.

fermente d'ingrdients (dravya

jus de la canne

sucre,

un certain moment,

la liqueur n'est
l'est

pas encore enivrante

un

certain

moment,
enivrant.

elle

ne

plus

c'est

pourquoi est ajout

le

mot

madya,
ils

La noix

d'arec, le paspale
et

(kodrava,

etc.),

quand
con-

enivrent, sont

nomms sur

maireya

'.

La
tient

liqueur forte n'est que pch de dsobissance.

La formule

donc

les

mots pramcidasthna pour

faire entendre qu'on doit

renoncer la liqueur forte parce qu'elle est cause de toutes les dfaillances de la

mmoire (sarvapramdnm spadatvt). [xv]

Les

trois disciplines ont-elles

mme

objet ?

1.

Notes de Palmyr Cordier.

a)

sur

= annsava (zas las sbyar bai btiin ba).


riz.

Vyakhya annsava
:

iti

tandulakrtah. Bire ou alcool de

C'est ce que dit

slipislakrtant madyani. C'est aussi ce que confirme

autocommentaire de Vagbhata, o surd crales, bire de froment, alcool de grains, en conformit avec la Mahavyutpalti, chan). 230, 36 o sur == hhrui chan (Amarakosa, 2, 10, 39, sur

Hemadri ad Astangahrdaya 1, 5, 67 le Vaidryakabhasya ou hbru chat gro chat, bire de


:

sur arack ou rack (eau de vie de riz, mot persan sanscritis sous la forme arka qui manque, dans ce sens, aux dictionnaires non mdicaux). b) maireya dravysava (rdzas las sbyar bai btun bo) tafia. Vyakhya dravysava itiksurasdikrtah. D'aprs Arunadatta, comm. de rAstangahfdaya, 1, 7, 40, maireya kharjalcool de dattes. Le Vaidryakabhasya explique bu ram chan rsava rhum ou tafia tandis que Candranandana (Padarthacandrika) et Ilemadri disent alcool de grains. Mahavyutpatti, 230, 38, sbyar bai chan ; dhanysava Amarakosa, 2, 10, 42, fait de maireya le synonyme de sava (me tog chan), liqueur de fleurs (de Lythrum fruticosum, etc.) et de idhu (bur chan) rhum, tafia. c) pgaphalakodravdayo 'pi Vyakhya diabdena nispvdayo 'pi grhyante [MS. nesyava^] POgaphala, noix d'arec (areca calhecu, palmiers). Synonymes sanscrits, pgiphala kramuka pohala guvka. Mahavyutpatti, 231, 34, pgaphala kramuka, Astangahrdaya, 4, 12, 25 et "nighanlu, 121. gla gor zho a Ama-

rakosa, 3, Vs, 21 go yu.

Kodrava,

tsi isi,

Astanganighan^u, 198; Sarat Candra,

tsi tse tsi tsi

MbX^-

vyutpatti, 228, 14 ci thse,

Nipava, Lablab

commun

(c'est--dire
le

une sorte de

haricot).

Manque dans

la

Mahavyutpatti

et,

du moins dans

sens botanique^ l'Amarakosa.

Hiuan-tsang,

xiv, fol.

20 a-xv,

fol. 1 b.

87

35

a-b.

On

acquiert la discipline de

Kamadhtu relativement

tous les actes, relativement deux sortes d'tres et deux sortes


d'actes, relativement

des choses du prsent \


est la discipline

La

discipline

du Kamadhtu

du Prtimoksa.

Cette discipline est relative tous les actes, acte prparatoire, acte

proprement

dit,

acte conscutif

(iv. 68).

Cette discipline est relative


vivants, par exemple

aux tres-vivants

et

aux non-tres-

l'homme

et l'arbre.

Cette discipline est relative

aux pchs de nature

et

aux pchs de

dsobissance, les uns et les autres pouvant se rapporter aux tres-

vivants (meurtre

toucher la main d'une

femme

lorsqu'on est moine)


;

ou aux non-tres-vivants (couper


l'or

les feuilles

d'un arbre

accepter de

lorsqu'on est moine). [1 b]

Cette discipline est relative aux choses

dhtus

du prsent, car
On

skandhas, yatanas
et

et

les

choses du pass

du futur ne sont

ni

des tres-vivants, ni des non-tres-vivants .

35
ques
*.

c-d.

acquiert la discipline de

dhyna

et la discipline

pure

relativement aux actes proprement dits et aux choses des trois po-

On
dits,

acquiert ces deux disciplines relativement aux actes proprement


et conscutifs,
;

non pas relativement aux actes prparatoires

non

pas relativement aux pchs de dsobissance

relativement aux
et

skandhas, yatanas
Il

et

dhtus du pass, du prsent

du

futur.

y a donc des skandhas, yatanas et dhtus relativement auxhdod glogs thams cad gnis ka dan
D'aprs
le

1.

da

llar

dag

las Ihob
/

par hgyur =: de

\kamaptaJi] sarvobhayebhyo [vartantnebhya pyate]


2.

VaibhSsika,

le prparatif, l'acte
(iv.

proprement

dit et le conscutif

la prise
*

de discipline de Prtimoksa

69

c-d) ont

respectivement pour but de

lier

'

le prparatif, l'acte

proprement

dit et le conscutif

du meurtre,
il
;

etc.

Le

prparatif du Prtimoksa considre le prparatif du meurtre, dont


niste, et lui dit
3.

est l'antago!

en quelque sorte

Je te

lie

(samvrnonn)

ne nais pas

Point important de la thorie de l'existence du pass et du futur,


i.

v.

25 (voir

aussi
4.

34

d, trad. p. 62).

niatilebhyah sarvaklebhyo

dhynnsravasamvarau

//

88

CHAPITRE

IV,

35 c-36

b.

quels on acquiert la discipline de Pratimoksa et non pas les deux


autres.

Quatre cas
proprement

1.

Actes prparatoires

et

conscutifs, pchs

de dsobissance, prsents
de-l'acte
dits

viss par le Pratimoka. 2.


et

Chemins-

du pass

du futur

viss par les deux

dernires disciplines. 3. Chemins-de-l'acte proprement dits du prsent

viss par les trois disciplines. 4. Actes prparatoires et conscutifs


et

du pass

du

futur,

l'gard desquels on ne peut prendre aucune

des trois disciplines.


Objection.

Il

n'est pas correct de dire qu'on prend la discipline


:

relativement au chemin-de-l'acte prsent


discipline,

car, lorsqu'on

prend la

aucun mauvais chemin-de-l'acte


Il

n'est prsent relativement

auquel on puisse prendre la discipline.


discipline relativement

faut dire

On

prend la

aux chemins-de-l'acte dont

l'objet

(adhisth-

na)

est prsent

Je peux m'abstenir d'un acte futur relatif une


;

personne ou une chose existant actuellement je ne peux m'abstenir


d'un acte pass ou prsent. [2 a]

Acquiert-on discipline

et indiscipline

l'gard de tous

les tres,

relativement tous les membres, en raison de toutes les causes ?

36

a-b.

On

acquiert la discipline l'gard de tous les tres

en ce

qui regarde les


1.

membres

et les causes,

il

faut distinguer

'.

On

acquiert la discipline l'gard de tous les tres, non pas

l'gard de quelques-uns.

La
bres
:

discipline de

Bhiksu

est acquise relativement

tous

les

mem-

abstention des dix chemins-de-l'acte. Les autres disciplines

sont acquises relativement quatre

membres abstention du meurtre,


:

du

vol,

de l'amour dfendu, du mensonge, car, par membres de la


il

discipline,
Si,

faut entendre l'abstention des chemins-de-l'acte.


les trois

par cause de l'acquisition de la discipline, on entend

racines-de-bien (non-dsir, non-haine, non-aveuglement), la discipline


est acquise en raison de toutes les causes. Si

on entend par cause


ha yod

1. sdoin pa sems cnn thams cad las / yan lag rgyii sarvasattvebhyo bhedas tv asty angakdrane /]

la Ihye

= [samvarah

Hiuan-tsang, xv,
cause d'origine, samutthpaka
(iv.

fol. 1

b-3
la

a.

89

b)

La

pense par laquelle on

acquiert la discipline, cette cause est considre


forte,

comme

triple

pense

pense moyenne, pense

faible.

discipline est acquise en

raison d'une de ces trois penses.

En

se plaant ce dernier point de vue, quatre alternatives peuvent


4)
:

tre distingues (Vibhasa, 117,


1. Il

y a un

homme

rsidant dans la disciiiline (samvarasthyin)


les tres,

[2 b], disciplin

l'gard de tous

mais non pas disciplin


ou moyenne, ou

relativement tous les membres, non pas disciplin en raison de


toutes les causes
faible,
:

celui qui, par

une pense

forte,

a acquis la discipline d'Upsaka, d'Upavsastha ou de SramaIl

nera. 2.

y a un

homme

rsidant dans la discipline, disciplin

l'gard de tous les tres et relativement tous les

membres, mais
a acquis
faible.

non pas

disciplin en raison de toutes les causes

celui qui

la discipline de
3. Il

Bhiksu par une pense

forte,

ou moyenne, ou

y a un

homme

rsidant dans la discipline, disciplin l'gard

de tous les tres, relativement tous les membres, en raison de toutes


les

causes

celui qui a acquis


et

chacune des

trois disciplines

d'Up-

saka, de
faible,

Srmanera

de Bhiksu par une pense respectivement

moyenne,
disciplin

forte. 4. Il

pline,

y a un l'gard de tous

homme

rsidant dans la disci-

les tres, disciplin

en raison de

toutes les causes, mais

non pas

disciplin

relativement tous les

membres
moyenne,

celui qui
et de

a acquis chacune des

trois disciplines

d'Upsaka,
faible,

d'Upavsastha

Srmanera par une pense respectivement

forte.

Personne ne rside dans la discipline qui ne


de tous les tres
les tres
:

soit disciplin

l'gard

c'est

par une bonne pense ayant pour objet tous


la discipline.

que l'on acquiert

L'homme

qui fait restriction

n'est pas

compltement dbarrass de

l'intention

du pch.
la quintuple

La

discipline de

Prtimoksa comporte l'absence de


[3 a]
:

restriction

(niyama)

1.
;

quant aux tres


2.

Je renonce au pch
la discipline
:

l'gard de certains tres

quant aux membres de

Je renonce certains actes


le

3.

quant au

lieu

Je renonce
:

commettre

pch dans certain lieu

4.

quant au temps

Je

90

CHAPITRE

IV,

36.

renonce au pch pour un mois

5.

quant aux circonstances (sa.

maya)

Je renonce au pch sauf en cas de querelle

Celui
;

qui prend semblable engagement n'acquiert pas la discipline

il

fait
'.

une bonne action (sucarlta) analogue l'acquisition de la discipline


ii.

tres

Comment peut-on acqurir la discipline l'gard de tous les ? Comment peut-on acqurir la discipline l'gard des tres qui
la discipline

sont hors de porte (aakya), l'gard des tres qu'on ne peut tuer ?

Parce que, croyons-nous, on acquiert


de ne tuer aucun
tre

par l'intention

(sarvasattvajivUnupaghtdhyayen'

hhyupagamt).
Le Vaibhasika (Yibhsa, 120, deuximes matres) donne une
expli-

cation diffrente. Si la discipline tait acquise l'gard seulement

des tres qui sont porte, la discipline serait susceptible d'augmentation et de diminution (caya, ax)acaya, vrdhi,

hrsa)

car des

hommes, qui sont


hors de porte
l'gard
;

porte, renaissent

comme

dieux, lesquels sont


serait

La discipline des dieux devenus hommes, perdue


et

inversement.

donc acquise

l'gard des

hommes

devenus dieux, sans

qu'il

ait

aucune cause

soit

de l'acquisition, soit

de la perte de la discipline.
Cet argument ne nous touche pas
:

la transmigration

(samcdra)

des tres porte et hors de porte n'entrane pas l'augmentation ou


la diminution de la discipline.

Car

la discipline qu'on

prend l'gard

des herbes ni ne s'accrot ni ne diminue lorsque naissent les herbes


nouvelles, lorsque schent les herbes anciennes. [3 b]

Le Vaibhasika

nie la valeur de cette comparaison. Les herbes exis-

tent aprs avoir t inexistantes, n'existent plus aprs avoir exist.

Les tres vivants au contraire continuent


tantt dieux. Les

d'exister, tantt

hommes,
;

hommes, devenant

dieux, passent hors de porte

les herbes sont ananties.

Mais, lorsque les tres vivants entrent dans


tent plus

le

Nirvana,

ils

n'exis-

(yad parinirvrtd na santy

eva), tout

comme

les herbes.

1. Comparer YogasQtra, ii. 31. On voit, Divya, p. 10, que le lueur de moutons, prenant rengagement de moralit (lasamdna) pour la nuit, obtient de grands avantages enfer diurne, paradis nocturne.
:

Hman-tsang,
Donc
la discipline acquise

xv,

fol.

3 a-4

a.

91

l'gard des tres vivants est sujette

diminution.
objecte
:

Donc

l'explication

du Yaibhasika

est caduque.

Si on

Au

cas o la discipline de Prtimoksa serait acquise

l'gard de tous les tres, la discipline des

Bouddhas

postrieurs, leur

moralit (la), serait, par comparaison avec celle


antrieurs, rduite
le
:

des

Bouddhas

car elle n'est pas relative aux tres entrs dans


et leurs disciples
'

Nirvana, Bouddhas antrieurs


:

nous rpliqueles tres


;

rons
si les

tous les

Bouddhas ont

discipline

l'gard de tous

Bouddhas antrieurs

existaient encore, les

Bouddhas postrieurs

auraient discipline leur gard.

36
On

c-d. L'indiscipline,

l'gard de tous, relativement tous


les

les

membres, non pas en raison de toutes

causes ^

acquiert l'indiscipline l'gard de tous les tres et relativement


les chemins-de-l'acte.

tous

Personne n'est indisciplin avec une


a].

indisciphne incomplte (vikala) [4

On

n'est pas

indisciplin en

raison de toutes les causes, l'indiscipline tant prise par une pense
faible,

ou moyenne, ou

forte.

Supposons qu'un
et

indisciplin ait pris

l'indiscipline

par une pense faible


:

commette un meurtre par une


faible,

pense forte
vijnapti

son indiscipline reste


d'un meurtre
'

mais

il

est revtu d'une

forte,
'

fort.

Le terme

indisciplin

(samvarika) s'explique tymologiquel'in-

ment

qui rside dans l'indiscipline (asamvara), qui possde


'.

discipline

Sont indisciplins
les tueurs

les tueurs

de moutons (aurabhrika), les oiseleurs,


les

de porcs, les pcheurs, les chasseurs, les bandits,

bour-

reaux, les geliers, les cornacs, les gorgeurs de volaille, les vgurikas.

Il

va de

soi
les

(arthatah) que

les

rois, les
etc.

gens en place

(adhikaranastha),

juges (dandanetrka),
est

sont indisciplins.
la profession

Le tueur de moutons (aiirdblirika)


1.

l'homme dont

sont entrs dans

Le tibtain porte relative aux tres anciens qui, tant devenus Bouddhas, le Nirvana . L'original prvabucldhaparinirvrtebhyah. 2. sdom pa min pa thams cad dan / y an lag kun las rgyus min no =t [asamvaras tu sarvebhyah sarvngai ca na kranaih]
:
:

92
est de tuer les

CHAPITRE

IV,

36

c-37.

moutons (urahhra).
'.

Mme

tymologie pour

les

noms

des autres professionnels


ii.

On comprend que

la discipline,

prise dans

une intention de

bienveillance universelle, soit acquise l'gard de tous les tres. Mais


les tueurs

de moutons n'ont pas l'intention de maltraiter leurs parents,


leurs serviteurs [4 b]
vie.
;

leurs

fils,

ils

ne voudraient pas les tuer,


le

mme

au prix de leur propre


on dire

Comment, [demande

Sautrantika], peutles tres ? (Yibha-

qu'ils sont indisciplins

l'gard de tous

a, 117,5)

Le Vaibhaika.
Mais

Parce
!

qu'ils ont intention

de meurtre l'gard

de leurs parents devenus moutons par la transmigration ^


ils

ne tuent pas leurs parents devenus moutons en sachant


D'ailleurs, si leurs parents obtiennent la

que ce sont leurs parents

qualit d'rya, ces parents ne renatront pas en qualit de

moutons

ou de btes

donc

le

boucher n'est pas indisciplin leur gard.


:

Enfin, l'argument se retourne contre vous

si le

boucher est indisci-

plin l'gard de la personne actuelle de ses parents parce qu'il tuera

ses parents devenus

moutons, on dira aussi bien

qu'il n'est

pas

indiscipHn l'gard des moutons puisqu'il n'est pas dispos tuer


les

moutons qui renatront comme hommes, comme ses propres

fds.

Le Vaibhaika.

Celui qui a
,

l'intention de tuer ses parents deve-

nus moutons est certainement indisciplin leur gard.


1.

Tueur de moutons
,
*

tueur est traduit par gsod.


(Vyftkhyfi)

cornac

ngabandhak hastipakh
i.

glan po che hchor ba


'

ou hthser ba,
le

qui chasse avec un lphant, qui tourmente un lphant

(comp.

gaddhabdkin de CuUa 32). gorgeur de volaille , kukkufn ghnantiti kaukkuHkh


93,

(Vyakhyfi)

com-

parer Mahavyutpatti, 186,

khyi hchor ba ou hthser ba

qui chasse avec


et

des chiens, qui tourmente les chiens

par confusion de

kukkura

kukkuta

(?).

qui chasse au (rgyas hchor ba moyen d'un filet) et Amarakosa, 2, 10, 27 (vgur ri dvags hdzin mrgabandhinl ; vgurika bya rgya pa), signifie brajlika bya brfki ba connier, trappeur . Mais la Vyakhya fait de la vgur un animal pamp (?) nma prnijtir vgurkhy ttfi ghnantiti vgurikh) et notre version tibtaine transcrit (ba gu ri hchor ba). Comparer les listes d'Anguttara i. 251, ii. 207, iii. 303, 383.

vgurika, d'aprs Mahavyutpatti,

186, 92

2.

Chavannes, Cinq cents contes

et apologues,

iii.

p. 117,

n 415 (Nanjio, 1329).

Hiuan-tsang, xv,

fol.

4 a-5

b.

93

Mais, dirons-nous, celui qui n'a pas l'intention de tuer des moutons

devenus des fds n'est certainement pas indisciplin leur gard.

Autre point
est
les

le

boucher qui ne vole pas, qui n'est pas adultre, qui

muet

[5

a],

comment

peut-il tre indisciplin relativement

tous

pchs ?

Le Yaibhsika.
Mais que

Parce

que son intention


gestes.

est

corrompue (vipan-

na). Le muet peut s'exprimer par


dire de

l'homme qui a accept deux ou

trois

membres de
incomplte
ni par-

la moralit ?

Pour

les

Vaibhsikas, l'indiscipline n'est jamais

ni

(vikala), c'est--dire relative seulement certains


tielle

membres,

(prdeika), c'est--dire comportant des restrictions (temps,

lieu, etc.)

dans la pratique d'un certain pch.

Pour

les Sautrantikas,

l'exception de la discipline du Prtimoksa,

la discipline et l'indiscipline

peuvent tre incompltes

et partielles.
l'indisci-

Gela dpend de la manire dont on prend la discipline ou


pline
:

on

'

lie

'

(pratihandha)

telle partie

de l'immoralit,

telle partie

de la moralit.

Gomment

acquiert-on

l'indiscipline ?

Gomment

acquiert-on
[5 b]

les

avijnaptis qui ne sont ni discipHne, ni indiscipline ?

37
Les

a-b.

On

acquiert l'indiscipline par l'action ou par l'acceptation K

hommes
du meurtre

ns

dans une famille

d'indisciplins

(tatkulma)

acquirent l'indiscipline lorsqu'ils accomplissent les actes prparatoires


(iv.

68

c).

Les

hommes
:

ns dans d'autres familles,


aussi,

lorsqu'ils adoptent tel

genre de vie

Nous

nous vivrons de

ce mtier

37

c-d.

On

acquiert les autres avijnaptis en raison du champ, de

l'engagement, d'une action srieusement entreprise l


1. sdom pa min pa bya ba ham / khas len pa las thob par hgyur Paramartha On obtient l'indiscipline par deux action personnelle, accep: :

tation
2.

Ihag mahi rnam rig min

zhiii

dan

len

dan gus par byed pas thob


//

[esvijnaptilbhas tu] ksetrdndarehant

Voir

iv.

41

c-d.

94
1.

CHAPITRE

IV,

37 c-39.

Certaines personnes sont des


etc.,

champs (ksetra) de

telle

nature
ci-des-

qu'en leur offrant un jardin,

on produit avijnapti. Voir

sous

(iv.

112) la doctrine des bonnes uvres matrielles (aupadhi-

kapunyakriyvdstu).
2.

On

produit avijnapti en s'obligeant par des


:

par exemple

Je ne mangerai pas que je n'aie rendu

vux (pratijn), hommage au


, etc.
'

Bouddha
3.

Le jour du jene, pendant une quinzaine, pendant un

mois, pendant une anne, je ferai des

aumnes de nourriture

L'action entreprise avec srieux (dara), avec foi violente, avec


(iv.

passion violente

22

d),

produit avijnapti.

Comment
38. La

se perd la discipHne ? [6 a]

discipline de

Pratimoksa se perd par l'abjuration, par

la

mort, par hermaphroditisme, par la rupture des racines, par l'arrive

son terme de la nuit

'.

La

stance

nomme dama

la discipline de

Pratimoksa parce qu'elle

dompte

les six organes.

En mettant
discipline de

part la discipline du jeneur (upavsastha), la


:

Pratimoksa se perd

1.

par abjuration, renoncement


^

intentionnel

la rgle (ikspratykliyna)
;

en prsence d'une

personne capable de comprendre

2.

par la mort ou abandon du

nikdyasahhga
fminin suivant

(ii.

41)
;

3.

par l'apparition de l'organe masculin ou


(iv. 79).

le

cas

4.

par la rupture des racines de bien


et,

La

discipline

du jeneur se perd par ces quatre causes


fin.

en outre,

lorsque la nuit prend

L'abjuration constitue une vijnapti en contradiction avec l'enga-

gement (samdnaviruddhaj

la

mort

et

l'hermaphroditisme com-

portent l'abandon (tyga) et le bouleversement (vikopana) de la


1.

D'aprs les versions chinoises. L'original porte, semble-t-il


les aliments d'un jour, d'un mois, d'une

Je donnerai

constamment

ijuinzaine (tithbhakta,

ardhamsabhukta).
XyhkUyi.diabdeua mandalakarandi grhyate (voir ci-dessous p. 102, n. 2). pratinwksadamatygah siksniksepanc cynteh / ubhayavyanjanotpatter mlacchedn niatyayat jj 3. Comparer MaliRvagga ii. 36. 1, etc. ParSjika, i. 8,
2.
;

-2.

Hhian-fsang, xv,
personnalit (raya) par laquelle
iv.

fol.

5 b-6

b.

95
t pris (voir

le

Pratimoksa a

27 a) [6 b]

la rupture des racines est la rupture du fondement

mme (nidna)
cre, projete,
la nuit

de la discipline. Enfin la discipline du jeneur a t


et nuit
:

pour un jour

elle arrive

son terme lorsque

prend
a.

fin.

39

Par un patanya, disent quelques-uns

'.

D'aprs une autre cole, les Sautrantikas, la discipline de Bhiksu


et

de Religieux

(sramana)

se perd en outre par n'importe lequel des

quatre patanyas ou pchs entranant chute l

39

b.

Par

la disparition de la

Bonne

Loi, disent d'autres matres \

D'aprs les Dharmaguptas, la disciphne de Pratimoksa se perd

quand disparat
paroisses

la

Bonne Loi

il

n'y a plus de rgles (siks), de

(slmbandha),

d'actes ecclsiastiques
croit

(karmnta).
et

39

c-d.

Le Ksmlrien

que

le

pcheur possde moralit


et

immoralit,
i.

comme un homme

peut avoir des richesses


:

des dettes ^

Les Vaibhsikas du KasmTr disent Le moine coupable (panna)

d'un pch grave (mauli patti), c'est--dire d'un patanlya, ne perd

pas la discipline de Bhiksu. Que, en dtruisant une partie de la discipline (ekadeaksohha), on perde la discipline toute entire, cela n'est

pas admissible l
1.

Celui
16.

qui

commet un

autre pch que le pata-

kha

cig Ituii bar l.igyur bas

2.

Mahvyutpatti, 266,
:

smra = patanyena cety [eke] patanty aneneti patanlyam.

Ce sont

les

quatre prjikas

incontinence, vol d'une certaine importance (yathoktapra-

mnam adattdnam), meurtre d'un bomme (mamisyavadha), mensonge relatit


aux pouvoirs surnaturels (uttarimanusyadharmamrsvda) (Finot, JAs. 1913, ii. 476). Voir dans Wieger, Bouddbisme chinois, i. p. 215 (1910), des gloses instructives. Sur le mot prjika, S. Lvi, JAs. 1912^ ii. 505, VVogibara,

Bodbisattvabhmi,
3.

p. 36.

gzhan dag dam chos nub pa las [saddharmahnito 'pare /] 4. dhanrnavat tu ksmrair pannasyesyate [dvayam] // 5. La Vykby signale un argument tir de l'Ecriture. Il est dit dans le Vinaya Le moine immoral (duhla) qui donne des avis (anussti) une nonne commet (padyate) un pcb samghvaesa . Or par immoral nous devons entendre coupable d'un prjika car le texte oppose au moine immoral le moine
:

',

'

',

96

CHAPITRE

IV,

39

c-d.

nya, n'est pas immoral (duhila). Celui qui


il

commet

le

patanya,

est

la

fois
;

moral

et

immoral

tel

un

homme
tel

qui a des richesses


il

et des dettes

mais lorsque ce pcheur a confess son pch,


il

n'est

plus immoral,
dettes.
ii.

est

seulement moral

l'homme qui a pay ses


n'est pas Religieux
;

Mais Bhagavat a
;

dit

Il n'est

pas Bhiku,
fils

il

(ramana)
qualit de

il

n'appartient plus aux


;

de

Sakya

il

choit de la

Bhiksu
'.

sa qualit de religieux est tue, tomhe, crase,

chue, anantie

Le Vaibhasika.
*

Dans
:

ce texte,

il

faut,
:

par Bhiku, comprendre


pcheur, tant incapable

vrai

Bhiksu (paramrthahhiksu)
'

[7 a]

le

de voir les Vrits, n'est pas un vrai Bhiksu.

Exgse inadmissible
a
faite
*

vous

sollicitez la dclaration
;

que Bhagavat
les

en sens clair

'

(ntrtha)

en outre, vous induisez

hom-

mes passionns Le Vaibhasika.

la pratique de l'immoralit.

Comment

tablissez-vous que cette dclaration

est de sens clair et doit tre prise


:

la

lettre ?

Bhagavat explique lui-mme Il y a quatre Bhiksus. Le samjnhhiksu, Bhiksu de nom, l'homme qu'on appelle Bhiksu sans qu'il
soit

ordonn
;

le

pratijnbhiksu, soi-disant Bhiku, immoral, inconqu'il

tinent, etc.
iti

l'homme nomm Bhiksu parce


-,
;

mendie (hhiksafa
parce

hhiksuh)

un mendiant sans plus l'homme


le

nomm Bhiksu

prakrtisthah sllavn. Donc

peut se rendre coupable de samghvasesa.

moine coupable deprjika reste moine, puisqu'il Vinaya uktatn / duhila ceil

bhiksur bhiksunm annclsti samghvaesam padyata iti / pannaprdjiko hi bhiksur dulilo 'bhipreto nnpannaprjikah prakrtisthah llavn iti

viparyayena vacant j ato 'vagamyate / asty asya diiltlasypi sato bhiksubhvo yasmt safnghvasesam padyata ity uktam iti f 1. Ce texte (Vinaya de dix rcitations, Nanjio, 1115, fasc. 21, 23) a pass dans Mahfivyutpatti 278 abhiksuh, aramanah, akyaputryah, dhvasyate bhiksubhvt, hatam asya bhavati srmanyam dhvastam mathitatn patitatn parjitam, apratyuddhryam asya bhavati rmanyam^ tadyath tlo mastakacchinno 'bhavyo haritatvdya / dithllah ppadharmo 'ntahptir avasrutah kaambakajtah. Comparer Kitigarbhasatra dans Sikflsamuccaya, p. 67. Sur kaambaka,
:

ci-dessous p. 98.
2.

Toutes

les ditions

de

la

Mah&vyutpatti

bhiksuta

iti

bhiksuh.

Hiuan-tsang, xv,
qu'il

fol.

6 b-7

b.

97

a rompu
le

les

passions (bhinnaklesatvt), c'est--dire l'Arhat \

Dans

texte qui
...

nous occupe

'

( Il n'est

pas Bhiksu,

il

n'est pas

Religieux

),

il

s'agit d'un

cinquime Bhiksu, savoir de l'homme

qui a t ecclsiastiquement ordonn et qui, par le patanlya, perd

sa qualit et sa discipline

il

n'y est certainement pas question

du

vrai Bhiksu, de TArhat, car,

mme

avant son pch,

le

coupable de

patanlya
la qualit
iii.

n'tait

pas un vrai Bhiksu, un Arhat, susceptible de perdre

de vrai Bhiksu.
la discipline toute entire

Qu'on ne perde pas

par la perte d'une

partie, cet

argument

est rfut

par

le

Matre lui-mme qui compare


la tte est coupe, dsor^
:

en

effet le

moine criminel au palmier dont


crotre,

mais incapable de verdir, de


c'est dire que,

de se dvelopper, de s'largir

lorsqu'une partie de la discipline, la partie qui est la

racine de la discipline, est coupe, [7 b] le reste de la discipline est

incapable de crotre. Le
tion

patanlya ou maull patti


l'tat

est

en contradic;

avec ce que requiert

de Bhiksu (hhiksuhhvocita)

il

com-

porte une extrme absence-de-crainte dans le pch (anapatrpya,


ii.

32

a-b)

il

rompt

la racine de la discipline

toute la discipline est

perdue.

Le Matre exclut l'homme coupable de patanlya de tout commerce

(samhhoga) avec les Bhiksus,


'*

il

lui

dfend de participer une bouche


Il dit
:

de nourriture,

il

lui interdit

un seul pied du couvent ^

Celui
cette

qui n'est pas Bhiksu et qui a l'aspect de Bhiksu, dtruisez

1;

Mme

Vinaya, fasc.

1, 5.

Mahvyutpatti,
qu'il
3.

270, 3740.
41.

Le Bhiksu rgu-

lirement ordonn (jnpticaturthopasanipanna), 270,

Samghabhadra
sans pudeur,
4.

(xxiii. 4,

85 b) rappelle

y a cinq

samghas

1.

samgha
5.

2.

samgha

des moutons muets,

samgha de

partisans (p'ng-tng),

samgha
2.

au sens vulgaire (lokasamvrtisamgha


propre

gha au sens

(paramrthasamgha
1
:

= sammutisamgha), = dakkhineyyasamgha).
:

sam-

imasmim
3.

Comparer Prjika, i. 8. .... ayam (natticatutthena iipasampanno) Vasubandhu asmims tv arthe atthe adhippeto bhikkh H.

Voir

p.

96

n.

Vibhs, 69,

cette comparaison,

dans Majjhima,

i.

250,

331, 464,
4.
5.

ii.

256, vise les passions.


i.

Comparer CuUavagga,

25.

1,

Vinaya Texts,

iii.

p. 120.

ekagrsaparibhoga hrasya ekaprsxiiparibhogo vihrasya.

9S
ivraie,

CHAPITRE

IV,

39 c-40

b.

arrachez ce bois pourri, chassez cette plante sans grain !

Quelle peut bien tre la qualit de Bhiksu de ce criminel ?


iv.

Le Ka.smTrien rpond.
il

En

quoi que consiste sa qualit de


dit
:

Bhiksu,
il

possde la qualit de Bhiksu. Car Bhagavat a


et
;

Cunda,
le

y a quatre religieux (sramana)


le

non pas un cinquime


le

mr-

gajinay qui triomphe par


le

Chemin
vit

mrgadaisika, qui enseigne


le
.

Chemin

le

mrgajivin, qui
le

dans

Chemin
^

le

mrgadsin,
'

qui souille

le

Chemin,

moine immoral

Nous croyons que Bhagavat donne

le

nom

de

religieux

(sra-

mana) au moine immoral parce que la forme extrieure de religieux lui reste. Ne parle-t-on pas de bois brid, d'tang dessch, de nezde-perroquet (motif de dcoration architecturale), de semence pourrie,

du cercle du
V.

tison, d'tre-vivant (sattva)

mort ?

[8 a]

Rphque du KsmTrien.
le

On ne perd pas
le

la qualit de

moine

par

patanlya, puisque Bhagavat admet

moine coupable d'incon-

tinence en qualit de pnitent, iksdattaka l


1. [abhiks^itn bhiksvkrtim] nayata krandavakam, kamhakam apakarsata, athofplvinam (?) vhayata. kraiidava, Mahvyutpatti, 228, 2:, une herbe qui ressemble au yava.

ksambaka,
p. 67,

Mahfivyutpalti, 278, 16; aussi


p.

Astasahasrika,

181),

kaambaknjta (Sikssamuccaya, kasambka, kasambuka (Wogihara) pti-

kAstham.
utplvl
et

L'original portait

vrlhimadhye 'bhyantaratandtilavihlnah (Vyfikhyfi). atho palvinam, comme le montre le pSli Aiiguttara, iv. 169 Suttanipata, 281, cit Milinda, 414 krandavam niddhamatha kasambum
(?)

nma
:

apakassatha
2.

tato

palpe vJietha assamane samanamnine.


;

Cundasutta dans Uragavagga


i.

Mahfivyutpatti,

223,

55-58.
;

mrgajina

VyakhyS, l'Asaiksa et le Saiksa d'aprs l'diteur japonais, le Bouddha et le Pratyeka mrgadaiika, le Bouddha ou Sfiriputra, etc.; inrgajlvin, Nanda, etc., d'aprs l'diteur japonais (mfirge jivati ilavCm bhiksur mrganimittam jivant). Vibhasa, 66, G. Anguttara, iv. 169, satnanads samanapalpo samanakrandava. le moine qui, par 2. Mahvyutpatti, 270, 10, SQtralanik&ra, xi. 4. Vyakhya passion charnelle excessive, s'est rendu coupable d'incontinence (striy abrahmacaryum krtv) ; aussitt, effray (jtasatnvega) : J'ai commis un acte
(Saniyutta,
187), d'aprs la
;

affreux (kasta)
il

sans qu'une seule pense de cacher son crime naisse en


:

lui,

(upagamya) au Samgha et confesse l'instruction du Samgha (ryasamgliopadet), il dakarma kurvnah) qui consiste s'abstenir du
se rend

J'ai

fait

ce pch

Sur

accomplit sa pnitence (dancontact des Bhiksus (sarva-

Hiuan-tsang, xv,

fol.

7 b-8 b.

99

Nous ne

disons pas que tout Bhiksu coupable d'incontinence est


dtruit.

un prjika, un Bhiksu tomb,


n'est plus Bhiksu. C'est la

Mais quiconque
le

est

prjika

pense de cacher
:

crime (praticchda-

nacitta) qui est

ici

dcisive

si,

grce l'excellence de ses disposi-

tions normales, grce l'excellence


le

de sa

srie (samtativisesa),
le

coupable n'a pas un instant la pense de dissimuler sa faute,

Roi de la Loi l'admet en qualit de pnitent.

Le KasmTrien.
n'est-il

Si le

prjika

n'est plus
*

un Bhiksu, pourquoi

pas admis nouveau l'ordination ?


qu'il n'est

Parce

pas susceptible de la discipline


et

ses dispositions
l'ex-

mentales (samtati) sont ruines


cs de l'impudence

bouleverses (vipdita) par


ii.

(anapatrpya,

32

a-b).

Aussi, et-il

mme

renonc aux rgles (niksiptasiksa,


pch],
il

iv.

38) [postrieurement son

ne peut tre ordonn nouveau.

quoi bon poursuivre

cette discussion ? Si pareil

Bhiksu

est

un Bhiksu, nous rendons homtout acte ecclsiastique devient

mage sa quaht de Bhiksu l vi. Quand la Bonne Loi disparat,


Mais
[8 b]
celui qui possde la discipline

impossible, et par consquent aussi toute acquisition de la discipline.

ne la perd pas (Yibhasa, 117,

e).

Gomment
pure ?

perd-on la discipline de

dhyna

(iv.

17

b) et la discipline

40

a-b.

Le

bon
par

'

du domaine du dhyna se perd par


chute
etc.
'\

le

change-

ment d'tage

et

la

hhiksvanavakrntikahm),
pas un pnitent.
les moines,

On

l'appelle siksdattcika.

Si l'immoralit

dtruisait la qualit de Bhiksu, cet

homme

ne serait plus un Bhiksu, ne serait

noter qu'il n'a pas recevoir une nouvelle ordination.


le

D'aprs les gloses de Yuan-hien (cites par Wieger),

pnitent a place aprs


il

avant les novices


s'il

il

ne prend pas part aux actes ecclsiastiques

sera rhabilit
1.

devient Arhat.
a de curieuses thories sur les privilges que conserve le

nn punah
Milinda,

piavrjyate.

2.

p. 257,

Bhiksu immoral.
3.

bhmisamcrahnbhym dhynptam

tyajyate

subham

Le bon du domaine du dhyna appartient et aux dieux des sphres suprieures et aux asctes qui, ici-bas, pratiquent les dhynas.

100

CHAPITRE

IV,

40-41.
entier, c'est--dire matriel et
:

Le bon du domaine du dhyna, tout


la

immatriel (rpay arpasvahhva), se perd par deux causes

1.

par
:

naissance (upapatfi) dans un tage suprieur ou infrieur

il

s'agit

du

bon
;

'

qui appartient des personnes nes dans les cieux

du Ropadhatu
recueillement.
Il

2.

par la chute (parihni)

lorsque Tascte tombe du

faut ajouter

une troisime cause, d'aprs

vi.

21

le

Prthagjana

perd certains bons

dharma^ par
dans
le

la

mort (nikyasahhgaiyga)
il

mme

lorsqu'il renat
c.

mme

tage cleste o
'.

est mort.

40
Il

De mme

le

bon d'rpyadhatu

se perd par le

changement d'tage

et

par la chute.

A noter

que

la discipline n'existe
c-d.

pas dans cette sphre.


l'obtention d'un fruit, par le perfectionne-

40
l.

Le bon pur par


facults,

ment des

par la chute ^
fruit,

En

obtenant un

l'rya abandonne les bons

dharmas du
prayoga,

chemin de candidat (prafipannakamrga, lequel


nantarya, vimukti,
(indriyasamcra,
faibles
;

est triple,

vi.

65

h)

2. lorsqu'il
il

perfectionne ses facults


le

vi.

29) [9 a],
il

abandonne
le fruit

chemin de
le

facults
fruit

3. lorsqu'il
(vi.

tombe,

abandonne

ou

chemin du

suprieur

32).

41

a-b. L'indiscipline se perd par l'acquisition de la discipline, par

la mort, par l'hermaphroditisme ^


i.

Acquisition de la discipline

soit

qu'on prenne rituellement la


;

discipline

du Prfltimoksa (samvarasamdna)

soit que,
il.

par

l'effi-

cace de la cause intrieure (hefu

= sahhdgahetn,

52) ou de la

cause extrieure (pratyaya == enseignement d'autrui, j)ara/o ghosa),

on obtienne
1.

le recueillement,

qui comporte la discipline de

dhyna

*.

ialhrpyptam.
ryatft tu phalptyuttaptihnibhih
//

2. 3.

sdom min sdom pa thob pa dan / i dan nilhsan gAis byun ba varah aatftvarpiicyutidvivyanjanodayt !]
4.

las

= [asatnd'aban*

On

ne mentionne pas l'acquisition de

la discipline

pure

comme cause

Hiuan-tscmg, xv,

fol.

8 b-9

b.

101

La

discipline de

dhyna rompt

l'indiscipline, tant

charge de forces

hostiles l'indiscipline.

La mort
le

et

l'hermaphroditisme sont, respectivement, l'abandon et


la

bouleversement de

personne (tmahhva, raya) par laquelle

l'indiscipline
ii.

a t prise.

L'indisciplin qui rejette les instruments de son mtier, couteau

et filet,

mme

avec l'intention de ne plus commettre


l'indiscipline
s'il

le

meurtre, ne

rompt pas pour cela


maladie [9
iii.

ne prend pas la discipline. Le


s'il

malade ne gurit pas sans remdes,


b].

mme

vite les causes de la

L'indisciplin qui prend la discipline du jene


lorsqu'il sort

(upavsa)

reste-

t-il

un indisciphn

du jene, ou bien se trouve-t-il dans

l'tat intermdiaire, ni-discipline-ni-indiscipline ?

Les avis

diffrent.

Pour

les

uns

',

il

se retrouve en indisciphn, car

l'homme qui prend

le

jene n'a pas l'intention de renoncer dfinitivefer porte

ment au pch
primitif.

une masse de
-,

au rouge revient son tat


fois sorti

Pour

les autres

l'indisciplin,

une

du jene,

n'est

plus indisciplin, car l'acquisition de l'indiscipline suppose un acte

corporel ou vocal (vijhapli).

Comment
(iv.

perd-on Vavijfiapti qui n'est

ni discipline, ni indiscipline

13 a-b) ?
c-d.

41

\Javijnapti intermdiaire est perdue par la rupture de la


l'objet,

force, de

l'engagement, de l'action, de
(iv.

de la

vie,

des racines l

Nous avons vu

37 c-d^ comment s'acquiert Vavijwpti qui

diffre de la disciphne et de l'indiscipline.

Cette avijnapti est perdue en raison de six causes

(1)

lorsque

prend

fin

la

force (vega) intense de foi

(prasda) ou de passion
:

(klea) qui ont projet Vavijnapti.

Exemple
dhyna

le

mouvement de

la

don de
pure.
1.

l'indiscipline

car la discipline de

prcde toujours

la discipline

Les docteurs du Gandhra

Samghabhadra approuve
5.

cette opinion.

2. 3.

Les Kasmriens.

Vibhs, 117,

vegddnakriyarthdyurmlacchedais tu

madhyam //

102
flche et de la roue

CHAPITRE

IV,

41 c-43.
(2)

du potier [10
:

a]

quand on renonce
je ne
fais plus ce

l'enga-

gement (samdna)

Depuis ce
'

moment,

que

je

m'tais engag faire

(3)

quand on rompt

l'action, c'est--dire

q land on ne fait pas ce qu'on s'tait engag faire, [par exemple vnrer le Bouddha, faire un mandalaka avant de manger (voir
p. 94, n. 1)
]
^
;

(4)

quand

l'objet

(artha) est rompu


lit,

le

caitya, le

jardin (rdma), le couvent (vihra), le


;

le

sige, qu'on s'tait


le filet (jla),

engag vnrer ou donner l'instrument (yantra),


etc.
^'

(5)

quand

la vie est

les racines de bien

rompue (6) quand on commence rompre (sarmicchedaprrambhvadhdym)


;

*.

42

a-b. L'acte

non matriel, bon, du domaine du Kamadhatu,


et

se

perd par la rupture des racines


suprieure
'.

par la naissance dans une sphre

Nous avons

expliqu

comment

est

rompu, perdu,

l'acte qui est

matriel, savoir l'acte corporel, l'acte vocal, Vavijnapti.

L'acte

non matriel, bon, du Kamadhatu,

est

perdu par la rupture des

1.

Quand on

dit

alafft

samdnena ;

en d'autres termes pratykliynava-

canetia.
2.

Vavijnapti

est perdue pour celui qui n'agit pas

conformment son engage-

ment,

yathsamttam akurvatah.
:

tadyath btiddham avanditv mandalakam akrtv va na tadakrtv hhunjnasya .... Dans Bliiksiinkarmavficana, (Shool of Orientai Studies, Bulletin, 1920, p. 128), il est question du trimandala qu'on construit avant la prise du refuge. J'ai pens que ce trimandala est le triratnamandala dont il est question dans le rituel des Bodhisattvas (dikarVyftkhyft

hhoksya

iti

mapradTpa, dans Bouddhisme, Etudes et Matriaux, 1898,


3.

p. 206). etc.

Param&rtha

transcrit

yantra

(yn-toQo-loo).

Par

entendre astra,

visa, etc.
4. Il faudrait dire que la vijnapti, qui a donn naissance cette avijnapti, est abandonne en mme temps qu'elle, car sa prjtti est coupe j)ar ces six causes. Mais il peut y avoir avijnapti sans vijnapti, comme il rsulte de iv. 67 et
;

[d'ailleurs],

en parlant de Vavijnapti,

c'est

comme

si

on parlait de

la vijnapti.

D'aprs d'autres, \& prpti d'une vijnapti incluse au ni-discipline-ni-indiscipline ne se continue pas (anubandhini) ; donc l'auteur n'a pas ici s'occuper de l'abandon de la vijnapti. (Vyftkhyfi).
5.

[kamaptatft]

kualrpam mlacchedordhvajanmatah

Hiuan-tsang, xv,

fol.

9 b- 10

b.

103

racines de bien et par la naissance dans les sphres du

Ropa ou

de

l'rQpya

'.

42

c-d.

Ce qui

est souill et
-

non matriel

est

perdu par la nais-

sance du contrecarrant

[10

b].

Tout ce qui

est souill, de quelque sphre

que ce

soit, est
Il

perdu
s'agit

par la naissance du chemin qui s'oppose cette souillure.

d'un chemin d'abandon (praJidnamclrga, distinct du vimuktimrgaj


vi.

65

b)

qui peut tre de vue (darana), de mditation (hhvan),

qui peut tre

mondain

(laiikika),

supra-mondain (lokottara). Ce
^

chemin
elle,

fait

abandonner une certaine catgorie d'upaklea

et,

avec

tout son cortge de prptis, etc.


et d'indiscipline ?

Quels tres sont susceptibles de discipline

43
pline
;

a-d.

Les

hommes
pour

l'exception
Kurus

des deux catgories d'eunu-

ques, des hermaphrodites et des

sont susceptibles d'indisci-

de

mme

la discipline, qui appartient aussi

aux dieux.

L'indiscipline

existe seulement chez les


et les

hommes. Encore
hermaphrodites
'

faut-il
et les

excepter les

sandhas

pandakas,

les

Uttarakurus.

La
les

discipline chez les


^
:

hommes, avec

les exceptions susdites, et

chez

dieux

donc, dans deux destines.

1.

En

outre,
la

exemple
2.

dans certains cas, par le dtachement du kma (vairgya) bonne dissatisfaction (kusala daurmanasyendriya, ii. 1,
ni

par

trad.

p. 106, n. 4).

non nions pa can gzugs min

gilen po skyes nas


//j

rnam iams hgyur =r

[klistam
3.

arpam

tu

praUpaksotpdd vihlyate
;

(?)

Les kleas sont des upaklesas


V. 46.

tous les tipaklesas ne sont pas des klesas.

Voir

4. za ma ma nih sgra mi snan / mthsan gnis ma gtogs mi rnams sdom pa han de bzhin du / Iha la han nrntn asamvaro hitv sandhapandadvidhdkrtln /

la

sdom min

[kurti ca]
5.

samvaro
13-20.

'py

evam [devnm

ca]

Mahvyutpatti, 271,

6.

Le Theravdin (Kathvatthu,

iii.

10) soutient qu'il n'y a

pas discipline chez


iv.

les

dieux parce qu'il n'y a pas indiscipline.

Voir ci-dessous

44

a-b.

104
1.

CHAPITRE

IV,

43 "45

b.

Les eunuques ne sont pas susceptibles de discipline


a]
:

ceci rsulte

du Stra [11
et

Mabananian,
....

le lac

aux vtements blancs, mle


du Vinaya
:

muni de l'organe mle

(iv.
>.

30

a-b), et

Sembla-

ble

homme,

il

faut l'expulser

Pourquoi ? Parce
;

qu'ils poss-

dent,

un degr extrme,

les

passions des deux sexes

parce qu'ils

sont incapables (aksama) de la rflexion (pratisamkhyna) ncessaire pour combattre les passions
et de la crainte (Itr,
;

parce que la vigueur du respect

apairpya,

ii.

32 a-b) leur

fait dfaut.

Pourquoi ne

sont-ils

pas susceptibles d'indiscipline ?

Parce que

rintention de commettre le pch (ppaya) n'est pas ferme chez

eux parce que


;

l'indiscipline s'oppose

(pratidvandva)

la discipline

qui est susceptible de discipline est seul susceptible d'indiscipline.


2.

Aux Uttarakurus manquent l'engagement (samdmi),


et le recueillement
',

d'o

absence de la discipline de Pratimoksa,


dhi)

(sam-

d'o absence des deux autres disciplines. D'autre part, l'inten-

tion de
3.

commettre
les

le

pch leur

fait dfaut.

Dans

mauvaises destines (pylka) manque


:

la

vigueur de

respect et de crainte

pour
;

qu'il

ait discipline,

il

faut respect et
il

crainte vigoureux [11 b]

pour

qu'il

ait indiscipline,

faut qu'on

dtruise

(vipdana) respect

et crainte (iv.

97

b).

Ni
dans

la discipline, ni l'indiscipline ne
la personne, des

peuvent natre dans


et

le corps,

eunuques, des hermaphrodites


est

des tres des

mauvaises destines, car ce corps


sel

semblable un sol satur de

o ne peuvent
9

crotre ni le bl, ni la
dit
:

mauvaise herbe.
il

Objection.
(iii.

Le Stra
le

Bhiksus,

y a un Naga n de Toeuf
sortant de sa
iii,

a) qui,

chaque huitime jour de

la quinzaine,

demeure, vient prendre

jene huit membres

(Samyutta,
Il

241

Vibhasa, 24, h; comp. Visuddhimagga, 300).

les

s'agit,

pour

les

Nagas, non pas de

discipline,

mais de bonne action (sucarita),

La
dieux.

discipline existe

donc seulement chez

hommes

et

chez les

43
1.

d.

Les

trois disciplines,

chez les

hommes

*.

En

raison de leur
la

2.

mi rnanis

mndya. gsum pa [nruAm trayah

//J

"

Hiiian-tsang xv,

fol.

10 b-12

a.

105
discipline

Discipline de Pratinioka, discipline ne du


pure.

dhyna,

44
dhtu

a-b. Discipline
et le

du dhydna, chez
'.

les

dieux ns dans

le

Kama-

Rpadhatu

Non

pas dans la sphre suprieure.

44

b-d.

La

discipline pure,

en exceptant

les

dieux du

dhyna
'.

intermdiaire et les Asanijnisattvas, et aussi dans l'rQpya


Elle existe dans le

Rpadhatu
le

en exceptant

les

dhynfitari-

kas ou
tvas

tres ns

dans

dhyna

intermdiaire, et les Asanijnisat-

et dans rArpyadhatu. Les


fait

dieux de l'ArQpya ne sont jamais


cette discipline, puisque la

munis en

(sammiikhhJulvatah) de

discipline est matire,


iv.

rpa

mais

ils

peuvent la

possder

(voir

82) \

Poursuivant son examen de

l'acte [12 a], l'auteur

va

dfinir les

diverses catgories qui sont enseignes dans le Stra.


Il

y a trois actes,
a-b. L'acte

le

bon,
est

le

mauvais,

le

non-dfmi (Vibbsa, 51,

i).

45

bon

salutaire, l'acte

mauvais

est pernicieux,

1. hdod dan gzugs skyes Iha jadevcinm cUiynaja h]

rnaiiis la

bsaiii

g tan skyes yod := [kntarpa-

Non pas
2.

la discipline

de PiTitinioksa, parce (jue les dieux sont trangers au

sarniefja, terreur-dgot.

zag nied ni

bsani gtan khyad par hdu ses nied


/

sems can ma gtogs gzugs

nied na
'pi

han

= [ausravah punah
//]

dhyanntarsamjnisaUvn hitvrpye

(satnbhavet)

La version
Par
les

tibtaine

la pratique

du Bhsya saute cette krik. du dhynntara (viii. 22-23) on renat dans

celte

partie

surleve du ciel des Brahniapurohitas, qu'on appelle dhi/ntitarik, o sont

Mahbrahnis (ii. 41 d iii. 2 d). La naissance parmi les inaltbrahninas un obstacle (varana) (iv. 96), car l'entre dans le Chemin et la discipline pure que comporte le Chemin sont impossibles Brahm, lequel croit qu'il est
;

est

scayambh,
3.

crateur
:

etc. (vi.

38

a-b).

Paramrtha

exceptant les

La discipline pure chez les dieux du Kma dhynntarikas et les asamjiiisattvas, et chez
non pas actuellement.

et
les

du Rpa, en
dieux d'r-

pya

Les dieux ns dans l'rpya possdent virtuellement

la discipline d'extase

et la discipline pure,

106
l'acte diffrent

CHAPITR

IV,

4546

b.

du bon

et

du mauvais

est diffrent

du salutaire

et

du

pernicieux

'.

Telle est la dfinition de l'acte bon, etc.


L'acte bon (kitsnla, uhha) est salutaire (ksema), parce qu'il est

de rtribution agrable (istavipka)


souffrance pour un temps
(
:

et

par consquent protge de la

c'est l'acte

bon impur, kusalassrava)


et,

ou bien parce

qu'il fait atteindre le

Nirvana
(
:

par consquent, pro-

tge dfinitivement de la souffrance

c'est l'acte

bon
:

pur).
c'est l'acte

L'acte mauvais (akusala, auhha) est pernicieux


rtribution dsagrable.

de

L'acte dont

Bhagavat ne

dit

pas

qu'il est

bon ou mauvais,

l'acte

non-dfini (avykrta), n'est ni salutaire, ni pernicieux.

45
l'acte

c-d.

Acte mritoire, dmritoire, non-agit


le

les trois actes

dont

-sentir-agrablement est
trois actes, mritoire
Il

premier

-.

11

y a

(punya), dmritoire (apunya), non-

agit (nihjya).

y a trois actes, -sentir-agrablement (stikhave-

daniya), -sentir-dsagrablement (diihkhavedamya), -sentir-nidsagrablement-ni-agrablement (aduhkhsiikhavedaniya),

46

a-b. L'acte mritoire est l'acte

bon de Kamadhtu

l'acte

non-

agit est l'acte

bon d'au-dessus

'.

[12 b]
est ce qu'on appelle l'acte
rtri-

L'acte bon du
*

domaine du Kamadhtu
qu'il purifie,

mritoire

',

pmiya, parce

parce qu'il produit une

bution agrable \
1.

las

bde mi bde dan gzhan


itarat

ni

dge dan mi dge dan gzhan yin


/|

= \kstmam
gsum

aksemam
2.

karma

iiblisubhetarat
/

bsod nams bsod nanis min mi ^yo

bde ba myoh hgyur


II]

la

sogs

[punyam apunyam
3.

nifijyatn stikhavedyAdikam trayant


/

bsod nams hdod kliains dge babi las

mi ^yo gon

ma

las

skyes bahi

[kmadhtuubham karma 2iunyani ninjyam rdhvajam]


L'AbliisamayalanikaiTiloka, ad Astasabasrika, p. 62, cite rAbliidiiarmasamuc-

caya
4.

kniapratisantyuktam knsalam
la version

punyam

rprpyapratisatnytiktam
10.

nmjyam. Commentaire de
Manque dans
:

Bodbicaryavatara,
tibtaine,
est

iii.

mais donn par Paramflrlba.

Hiuan-

tsang

L'acte bon

du Kamadbalu

nomm punya

parce qu'il

fait

du bien

Hhian-tsang, xv,
L'acte

fol.

12 a-b.

107

bon d'au-dessus,

c'est--dire
',

du domaine des deux sphres


'.

suprieures, est

nomm
n'a-t-il

non-agit

ninjya
les trois
le

Mais Bhagavat

pas

dit

que

premiers

dhynas

sont

agiles (sehjlta) ? N'a-t-il pas

dit

que

vitarkita et le vicarita du
?
^

premier dhyna, les ryas disent qu'ils en sont l'agitation


autrui et produit une rtribution agrable
;

l'acte

mauvais

est
.

nomm apunya

parce qu'il
1.

luiit

autrui et produit une rtribution dsagrable

admet deux lectures, nejya de ejr (kanqjane) i. La Vykhya (iii. 101 d) Variantes releves par Wogihara dans son ninjya de igi (gatyarthe). dition de la MahSvyutpatti, 21, 49, 244, 124 aninga, aningya, aninja, anijya, nijya. Opinions des modernes. Lotus, p. 300 Cliilders (inj) Senart, Mahavastu, i. 399 (MSS. nimja) Leurnann, Album Kern, 393 Kern, note dans BodbicarySvatrapanjik, p. 80 (vdique anedya --= anindya) E. Muller, Simplified grammar, p. 8. (V^oir ma note Madhyamakavrtti, p. 335). ii. Action anenja. Les trois abhisamkkhras (punna, apuntia, anenja),
et

Dgha,
'

iii.

217, Saniyutta,
'

ii.

82,

Madhyamakavrtti,
(p.
'

xvi. 1

(dneHjya). C'est
p.

l'acte

leading lo immovabilily
'

de Warren

180, d'aprs

Visuddhimagga,
'

571)

l'acte

of imperturbable character

ou

for

remaining

static

de Mrs Rhys Davids

(trad. du Kathvatthu, p. 358, ad xxii. 2). [C'est sans doute l'acte que dcrit ici Vasubandhu, l'acte du domaine des sphres suprieures.] iii. Pense anenja, cittassa nenjat non agitation de la pense '; pense, recueillement, dhyna, saint, qualifis dnenjappatta, ninjyaprpta : Udna, iii. 3, Nettippakarana,87, Puggalapafmatti, 60, Angultara, ii. 184, Visuddhimagga, 377, Wogihara, Bodhisattvablmmi, 19. C'est la pense dans le 4"ie dliydna o, d'aprs hrtiques Kathvatthu xxii. 3, a lieu la mort de l'Arhat (comp. Kosa, iii. 43, Dgha, ii. 156, Avadnasataka, ii. 199) pense acala, nirinjana. La pense netija, fondement du pouvoir magique (iddhi) est, dans Visuddhimagga, p. 386, une pense qui ne s'incline pas (na injati) vers le rdga, etc. Ce n'est pas la pense du quatrime dhyna, mais une pense bonne et recueillie (samhita). (Sur la rddhi, voir Kosa, vii. 48). Dans Samyutta iv. 202, la pense aninjamna, aphandamdna, etc., est celle dbarrasse des mannitas, injitas, phanditas, papancitas, mdnagatas qui consistent dire Je suis , etc. De mme faut-il comprendre le injUa d'Anguttara, ii. 45. iv. Dans Majjliima, ii. 254, 262, le vintidna devient 1. nanjtipaga, 2. kincannyatanupaga, 3. nevasannnsanndyatantipaga. On obtient Vtianja en abandonnant la notion de kma et de rpa ; Vdkincanna en abandonnant en outre la notion d'dnanja ; le nevasatlndndsannyatana en abandonnant en outre la notion d'dkincanna. Il semble que Vuanja corresponde aux deux
' ;

premiers tages de l'rpyadhtu (voir Kosa,


2.

viii).

yad atra vitarkitam vicaritam idant atrryd injitam ity hiih j yad atra prltir avigat idam atrary injitam ityaliuh yad atra sukhatn stikham iti cetasa blioga idam atrryd injitam ity huh. Madhyama,
I

108

CHAPITRE
dit

IV,

46-47.

Bhagavat
ces

en

effet

que

les

trois

premiers

dhydnas

sont agits,

en se plaant au point de vue du caractre vicieux (spaksalatd) de

dhynas dhynas

(iii.

101

c,

vi.

24 a

et l'expos

complet
',

viii.

11)

leurs

vices sont ce qui les agite.

Mais dans

rifijitasQtra

Bhagavat dclare

ces

non-agits parce qu'il les considre


'.

comme un chemin
^

favorable la non-agitation

Mais pourquoi appeler non-agit ce qui

est agit ?

46

c-d.

Parce que, en ce qui concerne sa rtribution,


'\
.

l'acte

du

domaine des tages suprieurs ne varie pas


L'acte du

domaine du Kmadhtu

est agit (ihjaii)

en ce qui
:

concerne la rtribution. La place de sa rtribution n'est pas fixe

un

acte qui produit, naturellement, telle destine, peut tre rtribu dans
telle

autre
telle

un acte qui produit

telle

destine divine peut tre rtribu


effet,
il

dans

autre destine divine.

En
ils

les actes

produisant force,

taille,

beaut, objets de jouissance,

arrive que, au lieu d'tre rtri-

bus dans une destine divine,

soient, par l'efficace de certaines

causes, rtribus dans une destine humaine, animale, de prta.


contraire,
et

Au

aucune cause ne peut

faire (jue l'acte

du domaine du Rpa

de Trpya [13 a] ne soit pas rmunr dans la terre (hhmi) qui

lui est propre.

50,

10.

vadmil
honti
1.

Comparer Majjhiiiia, i. 454 .... idam kho aham Udyi injUasmim kini ca tattha ijitasmimj yad cva tattha vitakkavicr aniruddh
:

idam

tattha iHJitasmim.

gyo bahi mdo.

Paramartha

et Hiuaii-lsang

Dans rAiiinjyasQtra

pou-

tng-kTng.
2. ini yyo ba dan nilhun par bgro bahi lani las brtsams te =: ninjya-sampresa-gminlm rabhya nmjynujcalahhfjinam kampyniiklabhgiuam mrgam rabhya (Vykhya).

D'apn'-s Hiuaii-tsang
*

Bhagavat
')
:

les dclare non-agits, les considrant (litt.

visant

',

ki

prenant en main

comme

...

produisant une rtribution (cipka)

non-agite

d'aprs Paramrlha
.

visant (yo) le chemin capable de produire


agit peut-il produire une rtribution

un pratyaya de bon non-agit


3.

Hiuan-tsang

non agite ? nanmoins on


4.

Comment le dhyna (Juoique ce dhyna comporte


:

Tagilation dfte ses vices (apaksla)^

l'appelle

non

agit, parce (pie,

en ce qui concerne sa rtribution


jj

...

tadbhmisu yatah karma vipkam prati nenjati


:

Paramartha

avabhfiniisu, iliuan-tsang

svabhmyyatatie.

Hman4sang,
L'acte
et
il

xv,

fol.

12 b-13

a.

109
le

mauvais

est dmritoire. Ceci est bien

connu dans

monde

n'y a pas lieu d'insister sur ce qui est connu dans le monde.
etc.
:

Quant aux actes -sentir-agrablement,

47

a-b. L'acte bon,


'.

jusqu'au troisime dliyna, est -sentir-agra-

blement

La sensation agrable (siikh vedan) n'existe pas au-dessus du troisime dhyna elle a donc pour domaine le Kamadbatu et les
:

trois

premiers dhynas. Donc la rtribution de l'acte bon est -sentir-

agrablement jusqu'au troisime dlnjna. L'acte qui a semblable


rtribution est dit
^

-sentir-agrablement
il

'

(voir iv. 49).

47

b-c.

Au-dessus,

est -senlir-ni*agrablement-ni-dsagrable-

ment l
Les sensations agrable
n'existent pas au-dessus
et

dsagrable (siikli, dnlikh vedan)


la sensation

du troisime dhyna. Reste


bon qui

d'indiffrence, unique rtribution de l'acte

est rtribu au-

dessus du troisime dhyna.

47

c-d. L'acte

mauvais,

d'ici-bas, est -senti r-dsagrablement

*.

L'acte mauvais est -sentir-dsagrablement.

La Karik
le

dit

d'ici

bas ,pour indiquer que cet acte existe seulement dans

Kmadhtu.

Le
1.

fruit

de tous ces actes

est-il

seulement

la sensation ?

Non

pas
2.

Sikhavedyam suhham dlujnd trtlyt


dirions plus clairement
:

D'aprs Vibhs, 115,

Nous
2.

la rtribution

de

l'acte

bon

est sensation agrable

lorsqu'elle

premiers

le Kmadbtu et les deux dhynas la sensation de plaisir (kyika sukha) et la sensation de satisfaction (saumanasya) (2) dans le troisime dhyna, la sensation de satis:

a lieu dans le Kfimadhfitu et dans Par snkh vedan, il faut entendre

les trois
(1)

premiers dhynas.

dans

faction
3.
4.

(ii.

7, viii.

9
/

b).

atah

param aduhkhsukhavedyam.
hdilii

Voir

iii.

43.

sdug bsnal myon ligyur

(Une syllabe
adjectif,

et \\\\ pda). un quivalent de hdipahi


',

mi dge := [duhkhavedyani aihiknhham //] lidilii ne peut tre un gnitif; reste en faire un

= aihika, qu'on a
l'acte

iv.

13 c-d

'

moralit des

tres de ce

monde aihikasllani. ParamSrtba Dans le Kmadbtu,


:

mauvais

est

nomm

sentir dsagra-

blement

....

La krik
.

dit

dans

le

Kmadbtu

pour indiquer que cet acte

n'existe pas ailleurs

110
ils

CHAPITRE

IV,

48

a-b.

ont encore

comme

fruit [de rtribution] ce qui constitue l'appareil


'.

(samhlira) de

la sensation

[13 b]

48

a.

D'aprs quelques-uns, l'acte intermdiaire existe aussi en

dessous ^
D'aprs d'autres, l'acte intermdiaire

c'est--dire l'acte qui a

pour rtribution ime sensation ni-agrable-ni-dsagrable


aussi en dessous du quatrime dhyna, contrairement
iv.

existe
dhynn-

la doctrine

47 a-c (Vibhas,

15,

4).

Deux arguments, 48 b

et

48

c-d.

48
tara \

b.

Puisqu'il y a rtribution en ce qui concerne le

Si l'acle intermdiaire faisait dfaut en dessous

du quatrime

dhyna,

il

n'y aurait pas de rtribution (vipka) de l'acte de

dhy-

nntara
1.

ou bien

"'

il

n'y aurait pas rtribution d'un acte quelconque


ii.

Objets, complexe psycho-somatique (sraya),

57.

adho 'pi madhyam ity ke. Cit VyfikhyS, iii. 43. dhynCintaravipkcith j 3. bsam gtan khyad par rnam smin las i/Le dhynntara est le dhyna intercalaire entre le premier et le deuxime dhyna, ou, comme traduit le tibtain, un dhyna suprieur (khyad par) au
2.

premier par l'absence de vitarka (voir viii. 22 d) premier dhyna. (Voir ci-dessus p. 105).

il

est

une sorte d'annex du

On

distingue le

sanidhidhyna,

le

dhyna

consistant en recueillement,
ciel

l'extase, et

l'upapattidhyna, l'existence dans un certain

correspondant

chaque extase. L'acte de dhynntara (dhynntarakarman) est l'acte par lequel on obtient le dhynntara-e\[ase et le dhynntara-exislence. dhynnii. La karika comporte deux interprtations qu'indique le Bhfisya puisqu'il y a rtribution de l'acte de dhynntara ; tarakarmano vipkatas puisqu'il y a rtribution dans le dhynntara. dhynntare vipkatas Paramartha traduit littralement l'original Hiuan-l sang Parce que l'jacte]
:

= =

intermdiaire produit rtribution


:

.
:

dhynntarakarmano vipko na bhavet (med pa). Vyftkbyfi 4. Bbasya dhynntarakarmano dhynntaropapattau vipkena veditena hhavitavyam tatra s^ikh duhkh va vedan nsti tasmd asydiihkhsukh = L'acte de dhynntara doit, dans l'existence de vedan vipka iti
/

....

dhynntara. avoir une


il

rtribution qui soit sensation. Or, dans le


;

dhynntara,

sensation dsagrable donc la sensation ni-dsagrable-ni-agrable [qui s'y trouve] est la rtribution du dit acte. Donc en dessous du quatrime dhyna existe un acte qui est sentir ni-dsagrablen'y a ni sensation

agrable, ni

laent-ni-agrablement
5. <

ou bien si nous considrons (Note du traducteur).

la

deuxime interprtation de

la kfirikfi.

Hiuan-tsang, xv,
dans
le

fol.

13 a-b.

111

dhynntara

\ car les sensations agrable et dsagrable

y manquent. [Rpondant

cette argumentation,] les

uns disent que la rtribu-

tion de l'acte de

dhynntara

est la sensation de plaisir (siikhen-

driya

ii.

7, viii.

9 b) du dliyna

mme

^
;

d'autres disent que la rtrietc.].


^

bution de cet acte n'est pas sensation, [mais rpa,

Ces deux opinions sont en contradiction avec


(Jnanaprasthana, 11,
^)
:

le h'sivdi (iicclistra)

Arrive-t-il

que

la rtribution d'un acte soit

sensation mentale seulement?

Oui, la rtribution de l'acte

bon

exempt de vitarka

''

dhynntare va kasya cii karmano vipko na syt (rnam par Vykhya dhynntare va kasya cit karmano *nyasya vipko vedan na syt na sambhavati Ou bien, dans le dhynntara,
1.

Bhfisya

smin par mi hgyur).

il

n'y aurait pas de rtribution, sous forme de sensation, de n'importe quel acte

diffrent de l'acte

du dhynntara, car on ne peut pas


le

dire

que

la rtribution

exprimente dans

dhynntara

est le fruit d'un acte sentir


le fruit

agrablement

du domaine du premier dhyna, ni qu'il est blement du domaine du Kmadbtu, ni qu'il


quatrime

d'un acte sentir dsagra-

est le fruit d'un acte

du domaine du

dhyna

.
:

Hiuan-tsang traduit
le

Ou

bien

il

n'y aura pas d'acte [qui soit rtribu dans

dhynntara]
Paramrtha
:

(houo ng o

ye).

S'il

n'en est pas ainsi

[=

si l'acte

intermdiaire

fait

dfaut en
;

dessous du quatrime dhyna], l'acte de dhynnta^'a n'aura pas de rtribution

y aura un acte de diffrente nature [rtribu] , [Or on ne peut pas dire que la sensation du dhynntara soit la rtribution de

ou bien, dans

le

dhynntara,

il

quelque autre
'-2.

acte].

dhynntarakarmano dhyna eva sukhendriyam vipka ity eke brnvate. Hiuan-tsang Cet acte produit comme rlril>ution la sensation de du premier plaisir (sukhendriya) du dhyna principal . [Glose de l'diteur dhyna], Ce qui peut s'entendre l'acte qui produit le dhynntara est rtribu en sensation, mais dans le dhyna principal. 3. Bhfisya naiva tasya vedan vipka ity apare. Ces matres soutiennentils qu'il n'y a pas de sensation dans l'existence de dhynntara (dhynntaro: :

papattau) ? Non. Mais


mais
4.

ils
(ii.

disent que celte sensation n'est pas fruit de rtribution,

fruit

d'coulement

57

c).
....

kusalasykarmanas caitasiky eva vedan vipko vipacyate vitarkasya karmanah. Cet acte bon exempt de vitarka est l'acte qui produit le dhynntara ; sa
[kim]
rtribution est sensation mentale seulement.

Donc

il

est faux

que

la rtribution

de l'acte qui produit

le

dhynntara

soit la sensation

du

plaisir

du dhyna

112

CHAPITRE
c-d.

IV,

48

c-49.

48

Parce

qu'il

est

admis que
'.

la rtribution des trois sortes

d'acte a lieu eu

mme

temps

Deuxime raison d'admettre que


dessous du quatrime dliyna.

l'acte

intermdiaire

existe

en

Le Sstra
en

dit

au

mme

endroit

Arrive-t-il

qu'il

ait

en

mme

temps rtribution des

trois sortes d'acte ?

Oui. Peuvent avoir lieu

mme

temps

(l)

la rtribution d'un acte -sentir-agrablement,

savoir des

dharmas

matriels, [l'organe de la vue, etc.]

(2) la rtri-

bution d'un acte -senlir-dsagrablement, savoir la pense et les

mentaux [en excluant

la dissatisfaction,

ii.

10 b-c]

(3)

la rtribution

d'un acte -sentir-ni-agrablement-ni-dsagrablement, savoir les

dharmas

dissocis de la pense, [organe vital,


les trois sortes d'acte

etc.,

ii.

35)].

Or,
rtri-

en debors du Kamadbatu,

ne peuvent tre

bues simultanment, car la rtribution de

l'acte -sentir-dsagrable-

ment a

lieu

seulement dans

le

Kamadbatu

(Vibhsa,

1 18, lo).

L'acte

-sentir-ni-agrablement-ni-dsagrablement, [lorsqu'il ap-

partient un tage infrieur au quatrime

dhyna],

est-il

bon ou

mauvais ?

Il

est bon,

mais de
dit

faible force.
l'acte

Mais n'avez-vous pas

[14 a] que

bon, jusqu'au troisime

dhyna,

est -senlir-agrablement (iv.

47

a)

Cette dfinition

vise la gnralit des cas (hhulika nirdesa).

Mais comment peut-on


sensation, n'est pas senti

dire

que

l'acte est -sentir-agrablement

(siikhavedanya, sukhavedya) ? L'acte, de sa nature,

n'est

pas

(avedansvabhva) ?

On

s'exprime ainsi parce que l'acte est favorable la sensation


;

agrable (sukhavedaiihita, amikla) bution est sentie agrablement.

ou bien parce que sa


appelle

rtri-

De mme qu'on
est

snnyak;

mme

(du premier

dhyna

dont

le

dhynntara
(Voir
iv.
.'j7

Tannexe suprieure)

taux

aussi que cette rtribution ne soit pas sensation. Car l'acte exempt de viiarka
n'existe qu' partir du

dhynntara.

a-c).

1.

sna phyi med gsuui suiiu hdod


ij]

[>hyir

= [fiYii/as/Jpiirrdcarcwnam [vip6>ka
le plaisir,

inyate yatah
!:!.

Ce que

l'un sent

(anubh)f

c'est le

sukha,

non pas

l'acte.

Hiiian-tsang, xv,

fol.

13 b-14

b.

113

sya, vtement baigner,

le
'

vtement avec lequel on se baigne, de


l'acte

mme

on appelle

'

sentir

(vedamya)

par lequel on sent une

rtribution.

D'ailleurs

49.
soi,

Il

y a cinq manires d'tre vedamya,

sentir

',

'

senti

' :

en

par association, en tant qu'objet, en tant que rtribu, par


'.

fait

de prsence
1.

La

sensation, de sa nature

mme,

est

sentir.
(i.

La sensation
c, ii.

agrable est exprience (aniibhava) agrable,


2.

etc.

14

24).

Le contact (spara)
:

est

sentir parce
etc.

qu'il est associ

la sen-

sation
V.

contact -sentir-agrablement,

(Saniyukta, 13, Saniyutta,

211
3.

Kosa,

ii.

trad. p.

125

et 154)

Les six objets (visaya) des six organes sont sentir en tant

qu'objet

(lamhana)
il

Voyant

la couleur

avec

l'il,

il

prouve,

il

sent la couleur, mais

ne sent pas la couleur avec affection

^ [14 b]

La couleur

est l'objet de la sensation.

4. L'acte est

sentir en tant que rtribu

un acte

sentir

dans

l'existence prsente
5.

(Madhyama,
quand
'
:

3,

i).

La

sensation est sentir par

le fait

de prsence

(sammukh-

hhva).

Quand

il

sent,

il

prouve (annbliavati) la sensation

agrable, deux sensations, la dsagrable et la neutre, se trouvent


alors

empches pour

lui

donc lorsque
/

la sensation agrable est

dmigs pa dan ni rnam smin dan / mnon 1. no bo iiid dan mthsuns Idan dan sum du ni gyur pa las / myon gyur rnam pa Ina yin no. La Vykhya fournit les termes svabhvavedanyat, lambanavedanyat,
:

sammtikhtbhvaveclanyat. {svabhvatah samprayogd lambanavipkatah / samnitkhbJivatas cpi pancadli vedanyat //]


D'aprs Vibhs, 115,
2.
1,

o l'ordre
iv.

diffre (5 devient 2).

[rpam caksus drstv] rpapratisamved no ca rpargapratisamvedl


41.
:

Mme texte Samyulta,


\yB.khy&
/

rpam pratyamibliavati no ca rpargani pratyamibliavatty arthah atha va no ca rpam rgena pratyamibhavaty lambata iti. 3. yasmin samaye snkhm vedanm vedayate dve asya vedane tasmin
samaye niruddhe bhavatah (MahanidanadharmaparySya)
ii.
;

comparer Digha,

66.

114
en exercice (pravartate),

CHAPITRE
il

IV,

50.

n'y a pas d'autre sensation par laquelle


dit

on

la sentirait. Si
c'est

donc on

que
est

cette

sensation est

sentir

'

(vedanya),

parce qu'elle

prsente

(smmmikhhhvena

vedaniyat).

50

a.

Cet acte est dtei-min ou indtermin

'.

[15 a]

1. de yaii ns dan Le problme de la

ma
On

ns pa

[taxi

ca niyatniyatani].

nt^cessil

de la rtribulion de l'acte n'est pas sans prsenter

compte de multiples doimes. V^oir notamment accumul (upacita) : accumul *, s'il est suivi de repentir, confession, etc. compt l'acte ne sera pas En eftet, l'acte n'est complet que par le prstha ou conscutif (iv. 68) la gravit de l'acte dpend de la gravit du prparatif, de l'acte principal, du conscutif Tout acte accumul n'est pas ncessairement rtribu. Le caractre (iv. 119). de la rtribution d'un acte ncessairement rtribu peut changer tel acte sentir en enfer dans la vie prochaine sera rtribu ici bas (Angulimfila est un bon exemple) (iv. 55). En effet, si on excepte les pchs mortels (iv, 97), les crimes n'empchent pas fors le cas de vue fausse coupant les racines de bien (iv. 79) et encore celles-ci peuvent-elles renatre ds cette vie (iv. 80 c-d) de se dtacher du Kamadhtu , et, par consquent, de renatre la prochaine naissance dans
quelques
(iv.

difficults.

doit tenir

1:^) la distinction de l'acte fait (krta) et de l'acte


*

'

'

',

'

'

les cieux

de Rpa

(iv.

55)
s'ils

auquel cas

les

pchs qui ne sont pas de rtribution

ncessaire sont
ici-bas.

comme

n'avaient pas t

commis

les autres sont rtribus

Les crimes, l'exception de ceux qui doivent ncessairement mrir en


:

mauvaise destine, n'empchent pas d'entrer dans le Chemin ds lors l'me, parfume par de puissantes racines de bien (puret de la conduite, respect des joyaux) devient rfractaire la maturation des anciennes actions non dtermines qui pouvaient produire une mauvaise destine L'ignorant, n'eut-il commis qu'un petit pch, va en bas; le sage, et-il commis un grand pch, vite le mal. Une petite masse de fer, compacte, coule le mme fer, en grande masse mais faonn en vaisseau, flotte (vi. 84 a-b, Anguttara, i. 249). En plantant une petite racine de bien dans le champ de mrite que sont les Bouddhas, on supprime la rtribution des actes de rtribution non ncessaire (vii. 34 al finem). -- Le

Koa,
\]i\

iv. 60, traite

de

l'acte

pur

'

(ansrava) qui
ix,

dtruit les autres actes.


:

autre problme est celui de l'ordre dans lequel les divers actes sont rtribus
trait

ils

sont lourds, nombreux, proches (voir Kou,


p. 601).
;

du Pudgala,

la fin

Visuddhimagga,
incomprhensible

il

Le Bouddha a dclar que la rtribution de l'acte dfend de chercher la comprendre (Anguttara, ii.

est 80,

Madhyamakfivat&ra, vi. 42, Miliuda, 189, Jatakamla, xxxiii. 1-3). trs clair pour les Bouddhistes, et pour nous obscur, est qu'il y a acte
tion,

Un

point,

et rtribu-

mais

qu'il n'y

a pas d'agent.

On
(iv.

a discut
b, d, 85)
;

si
si la

toute souffrance tait


rtribution comportait
vii. 10,

rtribution ou provenait de rtribution

58

elle-mme une rtribution (Visuddhimagga, 002, Kathfivatthu,

Madhyama-

Hiuan4sang,

xv,

fol.

14 b-15

a.

115
etc.) est

L'acte que nous venons de dcrire (-sentir-agrablement,

ou bien dtermin (niyata), c'est--dire


tre senti
',

qui doit ncessairement


'

ou bien indtermin (aniyata),


'.

qui ne sera pas nces-

sairement senti

50

b-c. L'acte
'

dtermin est de

trois espces,

sentir dans la vie

actuelle, etc.

L'acte dtermin est

(1)

sentir dans la vie actuelle (drstadhar-

inavedanya),
la vie

(2)

sentir aprs tre ren, en d'autres termes dans


(3)

immdiatement wQmv (upapadijavedanlya),

sentir plus

tard

(aparaparyyavedanya).
ajoutant l'acte indtermin, cela
fait,

En

au point de vue de

la

modalit de la rtribution, quatre espces.

50
En

c-d.

D'aprs une opinion, l'acte est de cinq espces ^


:

divisant l'acte indtermin en deux catgories

celui qui est

indtermin quant l'poque de la rtribution, mais dont la rtribution est d'ailleurs certaine

(myatavipaka)

celui qui est indtermin

quant la rtribution (aniyatavipka), qui peut ne pas tre rtribu.


L'acte sentir dans la vie actuelle est l'acte qui mrit ou est
rtribu dans l'existence

mme

il

a t accompli. L'acte sentir


Deiissen, Vedanta (1883), un chapitre de son trait sur le

kavatra,
497-8)
:

vi.

41,

Karmaprajnapti,

la fin.

Comparer

Vasubandhu consacre

ce problme

Pudgala.
Intressent la
le

bouddhologie

et le

lokottaravda,

les

questions suivantes
(iv.

Bouddha
1.

prouve-t-il la rtribution de ses anciens pchs ?


(vi.

102, la fin)
c)

Gomment

expliquer les naissances animales du Bodhisattva ?


la

23

mthon bahi chos


;

sogs pa la

myon gyur

phyir ua ns

rnam gsum

[(Irstaclharmdivedyatah j tridh niyatani] Voir Childers, 178 b Warren, 245 Visuddhimagga, 601, Compendium, 144.
;

Les anciennes sources opposent


en
enfer (Anguttara,
i.

le

249),

ditthadhamme vedanya Pacte qui mne l'acte sentir plus tard, samparyavedanya

(ibid., iv. 882).

2.

kha

cig las
:

rnams

Ifia

zhes zer

= [eke tu bruvanti karmapaiicakam

//]

Hiuan-tsang
il

Ou

bien on dit qu'il y a cinq actes

Paramfirtha

En

outre,

y a cinq actes

116

CHAPITRE

IV,

50 c-51

b.

aprs tre ren (tipapadya) est l'acte qui est rtribu dans Texistence
qui suit celle o
il

a t accompli. L'acte sentir plus tard est

l'acte

qui est rtribu dans une existence ultrieure, partir de la troisime.

Mais, disent d'autres matres, [les Saulrantikas], on ne peut admettre

qu'un acte trs fort soit de faible rtribution. Par consquent, la

rtribution d'un acte sentir dans la vie actuelle peut se continuer

dans d'autres existences

cependant,

comme

cette rtribution

com-

mence (mpkramhha) dans


*

la vie actuelle, cet acte reoit le

nom
y
a,

sentir dans la vie actuelle

'.

Les Vaibhasikas n'acceptent pas cette manire de


disent-ils, des actes

voir.

Il

dont

le fruit est

proche (samnikrstaphala), des

actes dont le fruit est loign (viprakrsta).

De mme

le lin (siivar-

cala) porte son fruit aprs deux mois et demi,

le bl

(yava)

et le

godhma
51a.

aprs six mois.

'

[15 b]

D'autres distinguent quatre alternatives ^


^

Les Darslantikas

distinguent quatre cas

1.

Acte dtermin quant

l'poque de

la rtribution,
il

indtermin quant la rtribution.


tel

Si

cet acte est rtribu,


il

sera certainement rtribu


:

moment, mais
la rtri-

n'est pas ncessairement rtribu

c'est l'acte

niyata ou niyatave-

daniya, mais aniyatavipka.

2.

Acte dtermin quant

bution, indtermin quant l'poque de la rtribution.


1.

Cet acte

Les traducteurs chinois s'cartent du tibtain Il y a des actes dont le fruit il y a des actes dont le fruit est lointain et grand ... . C'est bien ce qu'enseigne la Vibh5s5, 114, 16 L'acte sentir dans la vie actuelle produit un fruit proche on peut donc dire qu'il est fort comment peut-on dire
:

est proche et petit

que

les autres actes,

de

fruit loign,
fruit

sont trs forts ?


:

vie actuelle produit

un

proche, mais faible

sentir dans la on ne peut pas dire que cet acte

L'acte

soit trs fort .... Le yava a son fruit aprs six mois, fruit plus loign mais plus grand que celui du lin le khadira (k'ia-l-chu) a son fruit aprs cinq, six, douze ans, mais ce fruit est plus grand le tla a son fruit aprs cent ans, mais ce fruit est le plus grand .
; ;

Edition des kfirikas


ni
....

kha

cig

mu
:

ni bzhi zhes zer.

Bhfisya
:

gzhan dag

mu

Paramfirtha et Hiuan-tsang

D'autres matres disent

quatre alter-

natives (kia

= mot)

[ctuskotikam ity anye] 3. drstntikh sautrantikh

(V'yakhyft).

Hiuan4sang,

xv,

fol.

15 a- 16

a.

117
indtermine
:

sera rtribu, mais l'poque de la rtribution

reste

niyaiavipka, mais aniyata, aniyatavedanya.

3.

Acte dtermin

aux deux points de vue


danya.
D'aprs ce systme

niyatavipdka
:

et

niyatavedamya.
et

4. Acte

indtermin aux deux points de vue

aniyatavipka

aniyatave-

il

y a huit sortes d'actes


de rtribution certaine,
de rtribution

1.

acte sentir dans

la prsente existence et
la prsente existence et

2. acte

sentir dans
peut tre

possible.... 7. acte qui

senti

dans n'importe quelle existence (aniyata ou aniyatavedanya)


;

mais de rtribution certaine

8. acte qui

peut tre senti dans n'im-

porte quelle existence et de rtribution possible (aniyatavipka).

Mais
vie
*

les actes dfinis

dans l'Ecriture

comme

sentir dans cette


l'acte dfini
(iv.

',

etc.

sont toujours de rtribution certaine


'

comme
*

indtermin
Arrive-t-il

(aniyata) peut ne pas tre rtribu

50

a-c).

qu'un

homme

produise ou projette (ksipati) en

mme

temps des actes des quatre espces ?


Oui.
vol et
actes,
trs

A supposer qu'un homme fasse commettre


mensonge
;

par autrui meurtre,


;

commette lui-mme adultre

et

que ces quatre

appartenant respectivement aux quatre espces, soient perp-

au

mme

instant,

(iv.

67)

51

b.

Trois espces d'acte projettent l'existence ^

L'acte sentir dans l'existence actuelle ne projette pas l'existence


actuelle

(nikyasahhga,

ii.

41

a)

celle-ci

a t projete par un acte

antrieur.

1. Hiuan-tsang ajoute deux mots La doctrine des quatre actes (50 a-c)

la

kSiik

Quatre, bon

c'est--dire
'

est

bonne
c'est

Bhsya

Les actes
;

sentir

dans l'existence actuelle


le

',

etc.

sont les trois actes dtermins

l'acte ind-

bon [16 a], car, en indiquant seulement ici l'acte dtermin ou indtermin quant l'poque de la rtribution, on explique les quatre catgories d'acte enseignes dans le Stra . Glose de l'diteur japonais En disant que c'est bon, le Sstra ne condamne pas la thorie
termin est
quatrime.
:

Nous disons que

des cinq actes, des huit actes


2.

gsum

gyis

ris ni

hphen par byed

= [nikyah ksipyate tribhih

/]

118

CHAPITRE

IV,

51 c-53

b.

Combien d'espces

d'acte peuvent tre produites dans les diverses

sphres d'existence (dhtu) et dans les diverses destines (gati) ?

51

c.

Quadruple production partout


les trois

'.

Dans

sphres d'existence et dans toutes les destines peu-

vent tre produites les quatre espces d'acte bon ou d'acte mauvais.

Mais
(51 d-53)

cette rgle gnrale souffre des restrictions.

D'une
;

part,

il

n'y a pas d'acte mauvais au dessus du


:

Kmadhatu

d'autre part

51

d.

L'acte bon, dans les enfers, est seulement de trois espces ^


les enfers,

Dans
l'acte

on peut produire

l'acte

bon
bon

sentir dans l'exis-

tence prochaine, l'acte bon sentir dans une existence ultrieure,

bon indtermin
il

mais non pas

l'acte

sentir

dans

l'exis-

tence actuelle, car


ble

n'y a pas, dans les enfers, de rtribution agra-

(manojha, manpa).
a-b.

52

Quand
il

il

est ferme, le sot

ne produit pas d'acte

sentir,

l'tage dont

est dtach,

dans l'existence prochaine l


c'est--dire
vi.

la chute

Quand il est ferme (sthira), (aparihnadharman,

quand

il

n'est pas sujet

56, Puggalapafinatti, p. 12).

Le sot (bdla),

c'est--dire le Prthagjana.

Lorsqu'il est dtach d'un certain tage, lorsqu'il est dlivr d'atta-

chement (virakta) l'gard d'un certain plan de


dhatu, premier d/ii/wa....),
cet tage,
il

l'existence

(Kmadans

ne produit jamais un acte

sentir,

sa prochaine renaissance.

52

c.

L'rya ne produit pas non plus d'acte sentir dans une


*.

existence ultrieure

Quand
1.

il

est ferme, le saint ne produit pas d'acte

sentir,

l'tage

Ihams cad na

ni hplieii

pa bzhi
/

= [sarvatra caturdhksepah]

2.

ubhasya narake tridh

3. gan las lulod chags hral brtaii pahi / byis pa der skyes niyo mi byed yadviraktah sthiro halo [ntropapadyavedyakrt H] 4i. hphags pa gzliaii du han niyon mi byed nnyavedyakrd apy [dryah]

Hinan-tsang, xv,
dont
il

fol.

16 a-b.
soit

119
dans nne

est dtach, soit

dans

la

prochaine existence,

existence ultrieure.

En

effet, le

Prthagjana incapable de chute (aparihnadharman)

ne renat pas, dans la prochaine existence, l'tage relativement auquel


il

est dtach

et le saint

incapable de chute ne renat jamais

cet tage.
L'un
et l'autre produisent, la
relatifs

l'tage o

ils

sont ns, l'acte

sentir dans

prsente existence et l'acte indtermin.

52

d.

L'Arya, non ferme, lorsqu'il est dtach du Kamadhatu ou

du hhavgra, de mme. [16 b]'

L'rya dtach du Kamadhatu

est

l'Anagamin

(vi. 36).

L'rya dtach du hhavgra ou naivasamjnnsamjnyatana,


dernier tage de l'Arripyadhatu, est l'Arhat
(vi. 45).

Mme quand
perdre
ni
le fruit

ils

sont sujets la chute, c'est--dire susceptibles de

obtenu, ces saints ne produisent pas d'acte sentir,


ni
le

dans l'existence prochaine,


le

dans une existence ultrieure,

soit

dans

Kamadhatu,

soit

dans
60)

hhavgra.
le

Nous expliquerons
reconquiert toujours

(vi.

comment

saint, sujet

la chute,

le fruit

avant de mourir.
iii.

L'tre intermdiaire

(antardhhava,
dans

12

c)

produit-il des actes ?

53
deux

a-b. L'tre intermdiaire,

le

Kamadhatu, produit vingt-

espces d'acte

-.

L'embryon passe par cinq

tats, kalala,

arhuda, pesin, ghana,

praskh. L'homme passe par cinq


fait,

tats, enfant, adolescent,

homme

homme

mr, vieillard

'\

L'tre intermdiaire produit des actes dtermins (niyata) sentir

hdod rtsehi mi brtan pa yan min [npi kmgrato 'sthirah] srid pa bar ma hdod khams su / hphen pa rnam pa ni su gnis atidhksipaU kmadhtvantarbhavah /] Vibhasa, 114, 22.
1.

2.

= [dvvitn;

3. Voir ii. 52 a, iii. 19. - Samyutta, i. 206 Buddha's Geburt, 87 et sources cites. Sur

Mahftvyutpatti, 190

Windisch,

la

vie embryonnaire, notre note

sur

prna, Kosa,

iv,

73 a-b.

120

CHAPITRE
tre intermdiaire,
....

IV,

53 c-55

b.

comme

comme

kalala,

adolescent

Soit onze sortes d'acte

arbuda .... comme dtermin. De mme il

enfant,

produit

onze actes indtermins.

53

c.

Ces actes portent leur

fruit

dans l'existence actuelle \ [17a

Les onze actes dtermins de


la catgorie
*

l'tre

intermdiaire appartiennent
'.

sentir dans l'existence actuelle


tats

Pourquoi?

53

d.

Car tous ces

forment avec l'existence intermdiaire

une seule existence ^


L'existence intermdiaire et les dix tats (avasth) qui la suivent

sont projets par un seul acte

(iii.

13).

Aussi ne distingue-t-on pas


' :

un acte
*

sentir

dans

l'existence intermdiaire

celle-ci est projete,

en

effet,

par

l'acte

mme

qui est sentir dans la vie qui suit l'exis-

tence intermdiaire \

En

vertu de quels caractres un acte

est-il

dtermin, c'est--dire

ncessairement rtribu ?

54. L'acte accompli par passion


l'gard d'un

violente ou par foi violente,

champ de

qualits, continuellement, et le
'*,

meurtre du

pre et de la mre, sont dtermins


de ni mthon chos hbras bu yin de ni
ris

1.

2.

gcig kho na yin

= [etad drstadharmaphalam] = [ekanikya eva sah]. L'tre intermdiaire


de
l'tre intermdiaire,
suit,

appartient (avec la vie subsquente) un seul nikya.


L'existence intermdiaire et l'existence qui suit ne forment qu'une existence

(nikyasabhga). Donc
l'existence prsente
11
'.

les actes

mrissant tous dans


*

son existence intermdiaire ou dans l'existence qui


s'agit

sont tous

sentir dans

du

fruit

de rtribution (vipka)
:

voir

ii.

52

a.

3.

Littralement

celle-ci

est projete par l'acte

upapadyavedaviya,
:

l'acte
:

dans l'existence suivante, aprs tre ren [une foisj . Hiuan-tsang ... par l'acte upapadyavedaniya, etc. (Ce qui vaut mieux car une existence intermdiaire peut tre projete par un acte sentir dans une existence ultrieure). 4. non mohs rab dad drag po dan / yon tiin zhin dan i*gyun cliags su / byas pa
sentir

gan

zliig

yin pa dan / pba ma gsod dan de ns so [Hvrakleapras&dena yunaksetre nirantaram j yat kriam nitpitro ca vadho niyatam eva tat

//]

Hiuan-tsang, xv,

fol.

16 b-17

b.

121

L'acte accompli par passion violente, l'acte accompli par foi violente, l'acte
pli

accompli l'gard d'un champ de qualits,

l'acte

accom-

continuellement, cet acte est dtermin.

Par champ de

qualits,

il

faut entendre ou bien les trois joyaux,


les

ou bien certaines personnes, savoir


saints (Srotapanna,
etc.) et les
ii.

possesseurs des fruits ou

possesseurs de certains recueilled,

ments {nirodhasampattif

44

aran,

vii.

35

c,

niaitrl,

viii. 29).

L'acte accompli l'gard de ces champs,

mme

en l'absence d'une
est dtermin,

pense intense de passion ou de


qu'il soit d'ailleurs

foi,

ou de continuit,

bon ou mauvais.
pre ou de la mre, dans (juelque intention

qu'il soit

De mme le meurtre du commis [17 b]


'

Tout autre acte


klea), etc.

celui qui est fait

avec passion faible (manda-

est indtermin.

En

vertu de quels caractres un acte est-il senti dans l'existence

actuelle ?

55
En

a-b. L'acte porte fruit

dans l'existence actuelle en raison de


de l'intention
'.

certain caractre

du champ

et

raison de l'excellence du champ, bien que l'intention puisse


:

tre faible

par exemple
:

le

Bhiksu qui devint femme pour avoir


que des femmes
:

insult le

Samgha

Vous

n'tes

(striyo yiiyam).

En

raison de l'excellence de l'intention

par exemple cet eunuque

qui dlivra les taureaux du danger d'tre chtrs, et reprit son sexe \

Ou

bien encore

Que ce soit par la pense 1. Le texte porte yath tath ceti. Vyakhy que le meurtre est mritoire (punyabucldhy) ou par haine, etc. Le Perse (prasika) qui tue son pre ou sa mre en croyant faire uvre pie ... (voiriv. 68 d). Hiuan-tsang Meurtre ... avec une pense lgre ou lourde . Paramrtha choai eil sin. 2. mthon chos hbras bu can gyi las / zhin dan bsam pahi khyad par las
:

[drstadharmaphalam karma] ksetrsayavisesa[tah


D'aprs Vinaya des dix rcitations, 51,
1
:

/]

Vibhs, 114,

12.

Ceux qui offensent


3.

leur
:

mre sont punis dans

cette vie, Divya, 586.

Hiuan-tsang ajoute

De semblables

rcits sont

nombreux

122

CHAPITRE
c.

IV,

55

c-56.

55

Et aussi, lorsqu'on est dfinitivement dtach l'gard de


'

Ttage auquel l'acte appartient,

Lorsqu'un
tage

homme
il

est dfinitivement dtach

l'gard d'un certain


:

(iv. 52),

ne peut plus renatre cet tage

par consquent,

l'acte rtribuable

cet tage,

mais dans une autre existence, change


dans
la prsente existence, qu'il soit

de nature
d'ailleurs

et devient rtribuable

bon ou mauvais.
L'acte
*

55
Il

d.

dtermin quant la rtribution

'

-.

s'agit

d'un acte de rtribution ncessaire, mais


:

indtermin

quant l'poque de la rtribution


actuelle.

cet acte sera rtribu

dans la vie

Pour

l'acte

dtermin quant l'poque de la rtribution,


il

il

sera
les

rtribu l'poque pour laquelle

est

dtermin

Thomme

dont

actions doivent tre rtribues, sa premire renaissance, dans un


certain tage, ne peut pas se dtacher d'une manire dfinitive de cet
tage. [18 a]

Quant
rtribu.

l'acte

non dtermin quant


si

la rtribution elle-mme,
il

il

ne sera pas rtribu

on se dtache de l'tage o

aurait pu tre

Quel champ confre

l'acte qui

s'y

rapporte la qualit d'tre

ncessairement rtribu dans l'existence actuelle ?


1.

2.

tadbhmyatyantavairgyt. rnam smin ns par gan yin paho


ii.

= [vipke niyatam ca yat


:

//]
'

Majjlima,

220, Anguttara.

iv.

382

l'acte
'

sentir dans cette vie

peut-il

tre transform

en acte

'

sentir dans l'avenir

Le mme problme
huit sortes d'actes
tard,
:

est

(safnparyavedaniya) examin dans Karmaprajnapti, Mdo, 62, 240 b

?
:

II

y a

sentir agrablement, dsagrablement, dans ce monde, plus

sentir petitement, sentir grandement, mr, non mr. L'acte sentir


peut-il,

chang en acte sentir dsagrachang en acte nu'ir ? Oui et non. Quelques-uns, pour oprer cette transtormation, se coupent les cheveux, la barbe, les cheveux et la barbe, se tourmentent par divers chemins et mauvaises
agrablement
par nergie et
L'acte
effort, tre

blement ? Impossible

....

non mr

peut-il tre

pnitences

ils
....

chouent. D'autres, par nergie et


.

effort,

obtiennent

le

fruit

de

Srotaftpanna
autres ? Oui.
actes arrive

Il

y a

trois actes

existence, plus tard. Arrive-t-il

sentir dans cette vie, la prochaine qu'prouvant le premier on prouve aussi les deux
:

Quand on

obtient la qualit d'Arhat, la rtribution des deux autres

Hiuan-tsang, xv,

fol.

17 b-18

b.

123
le

En

gnral,
les

le

Samgha

des Bhiksus ayant sa tte


:

Bouddha

nunirer

personnes, cinq sortes de personnes


soit

56. Les hommes qui sortent


soit

du nirodha,

soit de la maitr,
:

de Varan, soit de la vue des vrits, soit du fruit d'Arhat


'

tout

bien et tout mal leur gard est aussitt rtribu.

L'homme
ii.

qui sort du recueillement d'arrt (nirodhasampatti,


33).

41

c, viii.

Dans

ce recueillement

il

a obtenu une tranquilest

lit

extrme (nti) de la pense, car ce recueillement


il

semblable
tait all

au Nirvana. Lorsqu'il en sort (vyutthita),


au Nirvana
et

est

comme

s'il

en revenait.

L'homme

qui sort du recueillement qui arrte la passion d'autrui


viii.

(aransampattl,
mentale (samtati)
tres
est

35

c).

Dans

ce recueillement, sa srie
l'infinit

s'est revtue

de l'intention d'installer
;

des

dans l'absence de passion (arana)

lorsqu'il

en

sort,

sa srie

pntre d'un mrite intense (atyudagra

tksna) et sans

mesure. [18 b]

L'homme
patti,
viii.

qui sort du recueillement de bienveillance

(maitrlsamen
sa

29).

Dans

ce

recueillement, sa srie s'est revtue de


l'infinit

l'intention

du bonheur de

des tres

lorsqu'il

sort,

srie est pntre d'un mrite intense et sans mesure.

L'homme
chemin,
la
il

qui sort du chemin de la vue des vrits

-.

Dans

ce

a abandonn toutes les passions qui sont abandonnes par


vrits. Lorsqu'il

vue des

en

sort,

sa srie est donc pure, puisque sa


d'tre renouvele (parivrtti).

personnalit (raya

= sarra) vient

L'homme
le fruit

qui sort du fruit d'Arhat, c'est--dire qui vient d'acqurir

d'Arhat.

Il

vient d'achever d'abandonner toutes les passions

qui sont abandonnes par la mditation

(hhvan) des

vrits.

Sa

srie est pure, puisque sa personnalit vient d'tre renouvele.

1.

ye nirodhamaitryarandarsancirhatpkaloUhith
tesu

krpakdrndm sahasd vedyate phalant


:

//
,

Hiuan-tsang traduit
dire
:

L'homme
,

qui sort du chemin de la mditation


car ce fruit

c'est--

qui sort du fruit d'Arhat

marque

le

terme du chemin de
a

la

mditation des vrits.


2,
(vi.

C'est--dire qui sort

du recueillement dans lequel

il

vu

les

vrits

28

d).

124

CHAPITRE

IV,

56-58

b.

C'est pourquoi les actions


et mfaits
fruit

bonnes ou mauvaises, bienfaits (kra)

(apakra), l'gard de ces cinq personnes, portent un


3).

dans l'existence actuelle (Vibbasa, 154,

Quant aux chemins de mditation par lesquels on obtient


de Sakrdagamin et d'Anagamin,
et
ils

les fruits

sont incomplets en

eux-mmes

dans leur

fruit

(apariprnasvahhvaphala). Les hommes qui

sortent de la conqute de ces deux fruits ne sont pas des

champs de

mrite comparables l'Arhat. Leur srie n'est pas pure


nalit n'a pas t

leur person-

rcemment renouvele.
c'est la sensation.

L'lment essentiel de la rtribution {vipka),

La La

rtribution d'un certain acte peut-elle tre exclusivement sensa-

tion mentale (caitasikl),

non pas sensation corporelle (kdyikl)

(ii.

7)

rtribution d'un certain acte peut-elle tre sensation corporelle,


a]

non pas sensation mentale ? [19

57

a-c.

La

sensation, fruit de l'acte bon


'.

exempt de vitarka,

est

exclusivement mentale

Les actes du domaine du dliynntara, entre-deux du premier


du deuxime dhyna
(iv.

et

48

b),

et les actes des tages suprieurs


viii.

sont exempts de vitarka


corporelle,
c'est--dire

(ii.

31,

23

c).

Comme

la sensation

associe aux cinq connaissances sensibles,


et

comporte toujours vitarka

vicra

(i.

32), elle

ne peut tre

le fruit

de rtribution d'un acte exempt de vitarka ^

57
La

d.

La

sensation, fruit d'un acte mauvais, est exclusivement

corporelle \

sensation, fruit de rtribution d'un acte mauvais, est pnible

la sensation pnible mentale est ce qu'on

nomme

sensation de dissaseuis kyi thsor

1.

rnatn par rtog pa

med pa

yi

dge bahi

las ni

rnam smin

ni

ha kho nar hdod.

[kualasyvitarkasya vipkah karmano mata / vedana caitasiky eva] 2. En effet, l'acte exempt de vitarka ne peut avoir une rtribution appartenant un tage infrieur et comportant vitarka et vicra (VyakhyR). [aktialasya tu kyiki //] 3. mi dge ba ni lus kyi yin

Hinan-tsang, xv,
tisfaction

fol.

18 b-l9

b.

125

(daiirmanasifendriya). Nous avons tabli que la dissatis(ii.

faction n'est jamais fruit de rtribution

10 b-c)

'.

Mais

si la

dissatisfaction,

ou sensation mentale pnible, n'est pas

rtribution,

dans quelle connaissance

connaissance visuelle,

etc.,

connaissance mentale

se produit le trouble mental ou Irouble-de-

la-pense (cittaksepa) qui est sensation pnible ? Et en vertu de


quelle cause

(krana) se

produit-il ?

[Apparemment

il

est la rtribu-

tion d'un acte mauvais].

58

a.

Le trouble-mental se produit dans

la

connaissance mentale
'

*.

L'expression qu'emploie la karika, manascitta

pense mentale
'

',

quivaut l'expression

consacre manovijnna,

connaissance

mentale, connaissance du nianas \

Les cinq connaissances sensibles ne peuvent tre troubles (ksipta)


[19 b] parce
qu'elles

sont

exemptes d'imagination (avikalpaka),


et
le

enqute et mmoire (abhinirpana, anusmarana),

trouble
(i.

mental est imagination de ce qui n'existe pas {asadvikalpa)

33).

58

b. Il nat

de la rtribution de l'acte \
nat de la rtribution de l'acte.

Le trouble mental
et des

Celui qui trouble et drange la pense d'autrui par des malfices

formules

qui fait boire du poison ou de l'alcool ceux qui ne


;

dsirent pas en boire

qui effraye le gibier, soit la chasse, soit en

incendiant la jongle

'*,

soit

en creusant des trappes

qui,

par un pro-

cd quelconque, trouble la mmoire et la prsence d'esprit d'autrui,


sa pense sera trouble, prive de l'aide de la mmoire (hhrastasmr-

tikam cittam vartate) par


1.

l'effet

de la rtribution de ces actes ^


l'acte d'attention
le

Vibhasa, 115,

Le daiirmanasya nat de
fruit

(manaskra),
:

comporte forte imagination (vikalpa), est abandonn par


va pas de
2.

dtachement

il

n'en

de rtribution. (/yens pahi sems ni yid sems la i= cittaksepo [manascitte].


(Anguttara).
/

mme

de ce qui est

ciUakkJwpa

r=

unimda
3.

de ni las kyi rnam smin skyes =: sa ca karmavipkajah

4. 5.

dvas trndigahancito deavisesah.


Paramfirtha ajoute
:

Et

il

y a d'autres causes
:

Hiuan-tsang

Le

trouble de la pense nat de cinq causes

1.

rtribution, 2. frayeur, 3. attaque des

dmons

....

126

CHAPITRE
c-d.
le

IV,

58

c-d.

58
ments,
1.

Par

la frayeur, l'attaque des


'.

dmons,

l'irritation

des l-

chagrin
tres

Des
:

dmoniaques (amanusya)
et

-,

d'aspect horrible, s'appro2.

chent

les voir, l'homme s'effraye

sa pense se trouble.

Furieux

de la mauvaise conduite des hommes, les tres dmoniaques les


frappent aux parties vitales
corps sortent d'quilibre
4.
;

(marman).
la pense,

3.

Les grands lments du


et le

le vent, la bile

flegme sont

irrits.
'

Le chagrin trouble aussi


Mais, dira-t-on,
si le

par exemple

VasistliT, etc.

trouble mental, ou trouble de la connaissance


l'acte,

mentale, nat de la rtribution de

[20 a]

comment peut-on

dire

que

la sensation

mentale n'est pas rtribution ?


le

Nous ne
1.

disons pas que

trouble de la pense

la

pense

skrag gnod

tipadrava

= attaque des dmons


8.

ma mnam mya

iian gyis
et

=
97

bhayopadravavikopaokaih.
rsulte,

15.

mal qui en
75
c-d,

comp. JatakamSl,
99 c-d

41,

p.

D'aprs Vibhfis, 126,


2.

Sur les amannsyas, Kosa, 344 de Cosmologie bouddhique.


iii.

iv.

b,

iii.

Karanaprajilapti,

Dgba,
Panini,

203, Milinda, p. 207, Sukbavatvyha, 39, SiksSsamuccaya, p. 351.


p.

Abhisamayalamkrloka (ad Astashasrik,


ii.

383)

pretdir amamisyah.

4, 23.
:

Bliagavn Mitlii3. gnas byed kyi bu la sogs. La Vyakhya cite le Stra Ukyin(?) viharati sma Mithilmravane I tena khalu punah samayena Vasisthasayotry brhmanynh sat putrh kagath / sa tesm klakriyay naynonmatt ksiptacitt tena tevmihindati .... Et le reste jusque, aprs la mort du septime enfant, l'entretien de Vasislli avec son mari Jadis
:

tu t'affligeais de la

mort de tes
fils

fils

maintenant tu n'es pas


te

afflige. C'est
.

sans
quoi

doute que tu as mang tes


elle

(nnam
:

putrs tvay bhaksith)

rpond (comp. Thergatba, 314)

putrapautrasahasrnijntisantghaatni ca / dlrghe 'dhvani maya brahman khditni tath tvayd

//

putrapautrasahasrnm parimnatn

lui vidyate

tsu tspapattisu // paritapyeta parideveta va punah j jdtvA nihsaranafft lokejte ca maranasya ca // sham nilisaranatft jntvA jte ca maranasya ca j na ocmi ia tapymi krte buddhasya sane II Lire V&sitbl (et non Vasistlia) dans le joli morceau o Bhagavat exalte

anyonyam khdyamndnm
ocet

kah

l'uni-

ver:ialil

de sa prdication, Sl^filamkara, trad. Huber, p. 205.

Hmmi-tsang
trouble

xv,

fol.

19 b-20

b.

127

nat de
:

l'acte

titre

de rtribution, mais qu'il nat de la

rtribution de l'acte. Les grands lments l'tat de dsquilibre sont


rtribution
la

pense trouble en procde

elle nat

donc de la

rtri-

bution.

On

dit

que la pense est trouble lorsque, en raison du ds-

quilibre ou de l'irritation des


est

humeurs, qui rsulte de

l'acte, la

pense
?)

drange (prcikopa), anarchique (dba-med

asvatantra

soustraite la direction de la

mmoire (blirastasmrtika).

Quatre alternatives

1.

Pense trouble (ksipta) sans tre dsor;

donne (viksipia)
2.

la

pense non souille (aklista) mais trouble


:

pense dsordonne sans tre trouble

la

pense souille, mais


;

tranquille,

normale

(rnal
;

du hdug pa

= svastha ?)

3.

pense trou-

ble et dsordonne

[4.

pense ni trouble ni dsordonne].


trouble de la pense ?
*.

Chez qui se produit

le

58

d.

Chez
les

les tres

du Kmadhtu, l'exception des Kurus


il

Parmi

dieux du Kmadhtu,

y a des dieux fous (unmattaka)


les

plus forte raison, des fous parmi

hommes,

les

Prtas, les

animaux.
Les damns (nraka) ont toujours la pense trouble
vitales sont
:

leurs parties

incessamment heurtes par des


sont crass

milliers de tourments

diffrents

ils

(parinunna

= paripldita)
:

par la souf-

france

ils

ne se connaissent pas eux-mmes, plus forte raison ne

distinguent-ils

pas ce

qu'il

faut faire et viter.

Donnons comme
!

exemple

le

damn
la

qui se lamente en disant

Ah

pense

l'exception du

Bouddha [20
:

b], les

ryas ne sont pas exempts


dsquilibre des
'

du trouble de
dsquilibre

pense

leur pense peut tre trouble la suite du


le
:

(vaisamya) des lments. Mais

lments n'est jamais, dans leur cas, rtribution

car les actes

dter-

mins

'

dont la rtribution pouvait produire

le

trouble de la pense
*

sont rtribus avant qu'on obtienne le chemin, et les actes

indter-

mins 'ne porteront pas de


1.

fruit,

par

le fait

que

le

chemin

est obtenu.

sgra mi san min hdod Idan rnams

= [akururgisii

jj]

2.

hcittaparidevaka.

128

CHAPITRE

IV,

59-60.

Ni

la frayeur, ni l'attaque des tres

dmoniaques,
ils

ni le chagrin

ne

peuvent troubler la pense des ryas, car


craintes
',

sont au dessus des cinq

ils

n'accomplissent aucun acte dsobligeant (aprasdika)


ils

qui excite la fureur des tres dmoniaques,

connaissent fond la

nature des choses ^

Le SQtra enseigne
du corps, de

qu'il

y a

trois tortuosits (kaniilya), tortuosits


;

la voix, de la

pense

et aussi

trois corruptions

(dosa)

et trois teintures (kcisya).

59
l'acte

a-b.

Ce qu'on

nomme

tortuosit, corruption, teinture ^ c'est

n de l'hypocrisie, de

la haine, de l'attachement.

L'acte du corps, de la voix ou de la pense qui nat de l'hypocrisie

(sthya), procdant du tortueux (kiitilnvaya), est


(kautllya,
v.

nomm

tortuosit

50

b)

l'acte qui nat

de la haine (dvesa), procdant de


;

la haine, est

nomm

corruption (dosa)

l'acte qui nat

de l'attacheteinture

ment (rga), procdant du colorant (rahjana),


(kasya)
\ [xvij

est

nomm
^

59

c-d. L'acte est

de quatre espces, blanc, noir,


l'acte est

etc.

Le Stra * enseigne que


:

de quatre espces

noir, de rtri-

1. Les cinq craintes sont jvikbhaya, aslokabhaya (= akrti), parisacchradyabhaya (= sabhym samkucitya), maranabhaya, dttryatibhaya (VibhasS, 75, 2). Voir MadhyamakavrUi, p. 46. Les lectures de Dharmasam-

graha, 71, sont fantaisistes.


2.

dharmatbhijnatvt

tout ce qui est impur (ssrava) est douloureux,

les dJiarmas sont insubstautiels . yon skyon snigs mar gsuns pa ni / [/yo dan zhe sdaii hdod ehags skyes [kautilyadosakasyoktam thyadvesargajam /J Dans Vildiaiiga, 368, rga, D'aprs Janaprasthana, 11, 6; Vibhasa, 117, 9. dvesa et moha sont kasva. Mais Aguttara, i. 112, distingue le vanka, le dosa et le kasva. 4. La couleur (kasya) est ranjanahetu, cause de teinture, comme l'attache' ment (rga) qui, en eiet, attache et teint (ranjayati). [krsnaukl^ 5. dkar nag la sogs bye brag gis / las ni rnam pa bzhi yin no dibhedena karma bhavec caturvidham] 6. Madbyama, 27, 12; Vibhasa, 114, 1; Agultara, ii. 230; Digha, iii. 230; AtthasaUnT, p. 89 Netippakaruna, 158, 184. AAguttara, iii. 385 akanham

les conditionns sont


3.

impennanents,

'

'

'

asukkam nibbnam

abhijyati.

Hiuan-tsang, xv,
billion noire
;

fol.

20

b-xvi, fol. 1 b.

129

blanc, de rtribution blanche


;

noir-blanc, de rtribution

noire-blanche

ni noir ni blanc,

sans rtribution noire ou blanche, et

qui dtruit les autres actes.

60. Les actes mauvais,

les actes

bons du Rpa,

les actes
;

bons du
qui

Kama, sont respectivement

noirs,

blancs, noirs-blancs
'

l'acte

dtruit les autres actes est l'acte pur. [1 b]

1.

L'acte mauvais, tant souill (klista), est absolument noir; sa

rtribution, tant pnible


2.

(aiuanojna), est noire.

L'acte bon du domaine du Rpadhtu, ne se mlant pas avec le


;

mauvais, est absolument blanc


blanche (Voir ci-dessus
p.

sa rtribution, tant agrable, est

107

l'acte

ninjya).
l'acte

Objection. Pourquoi

ne pas en dire autant de

bon du

domaine de l'rQpyadhtu ?
*

Parce que, dit-on

-,

la qualification

blanc

'

s'applique seulement l'acte qui comporte une double rtri-

bution (dans l'existence intermdiaire et dans une existence propre-

ment
triple,

dite,

ntarbhavika, aupapaUibhavlkavipka

')

et

qui est

corporel, vocal et mental.

Or

l'acte

du domaine de l'rpyale

dhtu ne prsente pas ces caractres.

Mais
et
elle est

Stra dcrit

l'acte

du domaine d'rQpyadhtu

comme

blanc

de rtribution blanche \
se mlant au mauvais,

3. L'acte bon du domaine du

Kmadhtu,

est noir-blanc

sa rtribution est mle,

donc noire-blanche.

Cette dfinition s'entend en se plaant, non pas au point de vue de


la nature de l'acte

lui-mme, mais au point de vue de la

'

srie

'

ou

1. mi fige gziigs dai hdod gtogs pahi / dge ba iiid ni rim bzhin du dkar dan gnis kahi las / de zad byed pa zag med yin [aiibham rpa]kmptam [siibhani eva yathkramam /

gnag dan

krsnastiklohhayam karma tatksayakrcl ansravam Comparer Yogastra, iv. 7.


2.

//]

C'est la rponse des troisimes matres, Vibhs, 114,

4.

3.

Le

mme
(iii.

acte

'

projette

'

une existence

et l'existence intermdiaire

qui y

conduit

13 a-b).

Il

n'y a pas d'existence intermdiaire prcdant la renaissance

dans l'rpya.
asti karma nhlam uklavipkam tadyath 4. La Vyakhy cite le Stra prathame dhyne evatn yvad bhavgre.
:

130
de la personne
l'acte
:

CHAPITRE

IV,

60-62.

dans une
Il

mme

srie mentale, l'acte

bon

se

mle

mauvais.

n'y a pas d'acte qui soit noir-blanc, ni de rtribution


'.

qui soit noire-blanche, ce qui impliquerait contradiction


Objection.

Mais

l'acte

mauvais

se

mle aussi avec


noir-blanc.

l'acte

bon
bon

donc

l'acte

mauvais

doit tre dfini

comme
l'acte

Rpondons
l'acte
;

que

l'acte

mauvais ne se mle pas ncessairement

tandis que, dans le

Kamadhatu,

bon se mle ncessairement

au mauvais, parce que, dans


bien
*.

cette sphre, le

mal

est plus fort

que

le

4. L'acte

pur dtruit
il
*

les

trois autres

sortes

d'acte.

N'tant pas
',

souill [2 a] (aklista),
il

n'est

pas noir
'

n'ayant pas de rtribution

n'est pas blanc,

il

est

non-blanc

(asukla).
est
*

Cette

expression

du Stra, asukla,
l'acte

intentionnelle

'
:

Bhale

gavat veut opposer

pur

l'acte

blanc

mais, parlant dans

MahasQnyatastra
s'exprime ainsi
:

dharmas propres l'Arhat (asaiksa), il Les dharmas d'Arhat, nanda, sont absolument
*

des

blancs, absolument bons, absolument irrprochables


le Trait

Et on

lit

dans

Quels sont les

dharmas

blancs ? Les bons


.
il

dharmas

et les

dharmas

non-souills-non-dfinis

L'acte pur n'a pas de rtribution, car

n'est pas

du domaine des

sphres d'existence

en

effet,

il

arrte le processus de l'existence ^

1. Voir iv. 1. samtnata etad vyavasthnam iti ekasmin samtne kMalam ckualarn ca sanmdcaratiti krtv kualam aknalena vyavaj

kryate. (Vyfikhya)
tara
2.
i.

le

Sur

les

consquences de cette thorie du mlange, Aiigulp. 218).

249 (traduit par Warren,


dfinition,
fait

Par

recueillement (samdhi), qui est l'adversaire du


le

mal

(akuala),
l'on

dfaut dans

Kamadhtu.
la

Il

arrive,

dans

le

seul Kamadhfitu, que


;

coupe

les racines

de bien par

vue fausse (tnithydrsti)

mais jamais on
'

ne peut y arracher la vue fausse par la vue droite (samyagdrsti), 3. Le Theravadin, Kathavatthu, vii. 10, soutient que les actes supramondains
'

comportent rtribution.
4.

tra (Vyakhyfi).

Le texte porte tnahatym nyatym, c'est--dire mahnyatrthiis Madhyama, 49 ekntaukl Ananda aaiksadharm, ekn:

tnavadyh
5.

....

(Majjhima,
G, 9;

iii.

115,

ne correspond pas).
1.

Prakarana,

Vibhasa, 114,

ukladharmh

kaiatne

kual dhar-

ma
C,

avykrt ca dharmah.

avipakam dhatvaputitatvt pravrttivirodhatah.

Les

dharmas

purs

Hiuan-tsang,
Faut-il penser

xvi, fol. 1 b-2 b.

131

que tous

les actes purs, quels qu'ils soienl, dtrui-

sent tous les actes des trois premires catgories, noirs, blancs, noirsblancs, quels qu'ils soient ?

Non.
61. Une
des
volition (cetan) de
et

douze espces

savoir

la volition

dharmaksntis

des huit premiers chemins d'abandon dans le

dtachement du Kmadhtu

tel est l'acte

qui dtruit l'acte noir ^

Quatre volitions correspondant aux quatre dharmaksntis du

chemin de

la

vue des vrits

hiiit

volitions correspondant
le

aux huit

premiers chemins d'abandon (nantaryamrga) dans

dtachement

(vairgya) du Kmadhtu

en tout douze volitions, autant d'actes

purs qui dtruisent l'acte mauvais.

62
La
le

a-b.

La

volition

du neuvime,

c'est

l'acte

qui dtruit l'acte

noir-blanc ^
volition qui correspond

au neuvime chemin d'abandon dans


b], c'est l'acte

dtachement du Kmadhtu [2

pur qui

fait

abandon-

ner l'acte noir-blanc et l'acte noir, car ce

moment on abandonne,
(lequel est noir-blanc)

dans son ensemble,


et la

l'acte

bon du Kmadhtu

neuvime
c-d.

et dernire catgorie

de l'acte mauvais.

62

La

volition qui nat

aux derniers chemins d'abandon du


l'acte

dtachement des dliynas, dtruit

bon \

ne sont ni clhUi, ni intgrs aux dhtus (na dhtur

na
le

dhtupatith).

Sur ce qui engendre (janayati)


voir
1.
ii,-6.

et arrte

(virunaddhi)

processus (pravrtti),

chos bzod hdod chags hbral ba yi


te
/

pa rnam pa bcu gnis

/ bar cbad med lam brgyad kyi gan nag po zad par byed pabi las //

sems

[dharmaksntikmavairgynantaryapathstasu / krsnasya ksayakrt karma dvdaavidhacetati //] Cbaque moment du cbemin est un complexe psychologique qui comporte, parmi
d'autres mentaux, la cetan ou volition D'aprs la dfinition, iv. 1 b, cette cetan est l'acte. Les quatre dharmaksntis, vi. 25 c le dtachement du Kmadhtu, vi. 49. [krsnau2. dgu pahi sems pa gan yin pa / de ni dkar nag zag byed yin klasya ksayakrd y navamasya cetan /]. 3. dkar po bsam gtan chags hbral la / bar chad med lam tha mas skyes
'

'.

uklasya dhynavairgyesv [nantaryapathntyaj

//J

132

CHAPITRE
volition

IV,

62 c-64

c.

La
le

du neuvime

et dernier

chemin d'abandon qui produit


:

dtachement l'endroit de chaque dhyna

quadruple volition

qui dtruit l'acte blanc.


Objection.

Les huit

premiers chemins d'abandon dans


l'acte

le dta-

chement du Kamadhatu dtruisent


concerne les actes noir-blanc
et

noir.

Mais,

en
:

ce

qui

blanc (actes bons et impurs

kusala

ssrava), c'est seulement au neuvime chemin d'abandon que vous


attribuez le pouvoir de les dtruire. Pourquoi ?
Il

n'y a pas, proprement parler,

abandon des dharmas bons,


peut
rapparatre
;

car

mme abandonn
dit

le

dharma bon

mais

lorsque la passion (klesa) qui a pour objet ce

dharma

est dtruite,

on

que ce

dharma

est

abandonn. Donc aussi longtemps que


le

n'est

pas dtruite la dernire catgorie de passion qui peut

prendre pour objet, ce

dharma bon

n'est

pas considr

comme
la

abandonn. [Or

c'est le

neuvime chemin d'abandon qui rompt


relative
fait

prpti de

la

neuvime catgorie de passion


et,

chaque

terre
dis-

(Kamadhatu, dhynas)
connexion
(ii.

par consquent,
'.

qu'on obtient la

57

d)

d'avec cette passion]

63

a-b. D'aprs d'autres, les

deux premiers actes sont


dans

cehii qui
le

est rtribu en enfer et celui qui est rtribu ailleurs

Kama-

dhatu. [3 a]

'

D'aprs d'autres matres (Vibhasa, 114,2) l'acte 'qui doit tre


senti en enfer
'

(narakavedanlya)

est l'acte noir

l'acte qui doit tre

senti

dans

le

Kamadhatu,

ailleurs qu'en enfer, est l'acte noir-blanc.

lii tasya (kualasya) svabhAvaprahnam iti prpficcheilah prahprahnasypi kualasya sammukhlhhvt / tadlambanakJeasya prahnt tasya kualasya prahnam bhavati / tadlambanakleaprahnam ca navamasya tadlambanakleaprakrasya prahne sati bhavatUi navamnantaryamrgacetanaica krsnauklasya karmanah ksayya bhavati I tad hi navamasya Jileaprakrasya prpticchede visamyoyaprptir ntpadyate / tasya ca krsnasnklasya karmano 'uyasypi cCinicrtvy&krtasya ssravasya dharmasya visamyo(juprptir ulpadyate. (Vyakhya) 'i. gzhuii ni dmyul ba iiiyon hgyur du // hdud g/han myoi hgyur gilis su rig =i [nraktyafft (narake vedyam) anye kme 'nyatra vedyam dvayani viduh\

1.

na
j

nam

Hiuan4sang,
La

xvi, fol.

2 b-3

a.

133

rtribution infernale est produite exclusivement par l'acte


:

mau-

vais (akiiala)
est l'acte noir.
l'enfer, est

par consquent,

l'acte qui doit tre senti

en enfer

La

rtribution dans le

Kamadhatu,

l'exclusion de

produite exclusivement par l'acte bon-mauvais (c'est--dire


:

par l'acte bon ml l'acte mauvais)


l'acte noir-blanc.

par consquent cet acte est

63
qu'ils

c-d.

D'aprs d'autres, ns du Kania, les actes sont noirs lors;

peuvent tre abandonns par la vue des vrits


le

ils

sont noirs-

blancs dans

cas contraire

*.

D'aprs d'autres matres (Vibhasa, 114,

*)

l'acte qui est


le

abandonn

par la vue des vrits, n'tant pas ml avec


autre acte du

bon

^,

est noir.

Tout
aban-

domaine du Kamadhatu, savoir

l'acte qui est

donn par
mauvais.

la

mditation, est noir-blanc, c'est--dire bon ml de

Le Stra

dit

Il

y a

trois silences (matinet/a), silence


.
^

du corps,

silence de la voix, silence de l'esprit

64
l'acte

a-c.

Asaiksas, c'est--dire propres l'Arhat,


l'esprit, sont,

l'acte

du corps,
'.

de la voix et

dans

l'ordre, les trois silences

[3 b]

1. drgheyam krsnam [anye] 'nyat krsnasiiklam tu kmajam jj Littralement L'acte abandonn par la vue est noir tout autre est noir-blanc lorsqu'il nat du Kuia . Objection il faudrait dire kmiacaram drgheyam krsnam : L'acte du domaine du Kamadhatu qui est abandonn par la vue, est noir en effet, il y a des actes abandonner par la vue et qui n'ont pas une rtribution Rponse noire, savoir certains actes du domaine du Rpa et de l'rpya. le qualificatif kmaja, n du Kma (c'est--dire du domaine du Kamadhatu), porte
:

sur
2.

le

premier pada.
le

D'aprs

principe
5,

na drstiheyam akUstam,
i.

i.

40

c-d.

3.

Madhyama,
iii,

4; Anguttara,

273; Dgha,
la qualit

iii.

220.

'

Suttanipla, 700,

Mahavaslu,
nit va

387.

moneya, c'est
va)
;

de Muni ou l'acte d'un Muni [mup.

munikarma
Rigveda,
les

Childers (Supplment,

617)

conduct worthy of a

Muni
4.

'

x. 136. 3

Col. Jacob, Concordance,


mana
idam maunam.

p. 748,

pour

la valeur

de

muni dans

Upanishads

et la Gta.

aaiksam kya[vk]karma
s'explique
:

eva [yathkramam]

maunatrayam.
p. 346,

mauna

tnuner

Bodhicaryavatara,

pour-

134

CHAPITRE

IV,

64-65.
la voix, c'est l'acte

Ce qu'on
du corps,
de

nomme

silence

du corps, silence de
'.

l'acte de la voix

propres l'Arhat
-,

Ce qu'on

nomme

silence
:

l'esprit

(manomatma)
est le vrai
sait

c'est l'esprit, la

pense propre l'Arhat

ce n'est pas l'acte de l'esprit

que la pense

(mandhkarman). Pourquoi ? Parce Silencieux, le vrai Muni \ Les Vaibhai-

kas disent qu'on


et

par induction

en raison des actes du corps


que
la

de la voix

que
*

la

pense est

telle,

pense est aaiksa

*.

Mais, dirons-nous, l'acte du corps, l'acte de la voix propres l'Ar-

hat (aaiksa) sont


l'acte

abstention

'

(virati) de leur nature, tandis que


'

de

l'esprit n'est

pas

'

abstention
'.

de sa nature, parce
'

qu'il n'y
'

a pas d'avijnapti de la pense

Or

ce qu'on entend par


;

silence

(mauia),
'

c'est l'abstention
'

(virama

virati)

c'est

donc l'esprit

mme

qui s'abstient

(viraia) qui reoit le

nom

de silence.

Et pourquoi

l'esprit

propre l'Arhat

reoit-il seul ce

nom

? Parce

que l'Arhat
tion de tout

est le vrai silencieux

(paramrthamtmi) par

la cessa-

murmure de passion (sarvaklesajalpoparateh).


dit
:

Le Stra

Il

y a

trois purifications

(auceya), purification
^

du corps, purification de

la voix, purification de l'esprit .

quoi

le

Bouddha
et

reoit le

nom

de tnuni

triple silence, dfini

comme

ici,

ou silence

de

samropa
1.
Il

d'apaoda.

plir,

mais des actes qui

ne s'agit pas de tous les actes corporels et vocaux qu'un Arliat peut accomle caractrisent comme Arhat ou Asaiksa (vi. 45). Les
:

actes en question sont de leur nature avijnapti, non-information

le silence

du

corps est donc Vavijnaptl-du-corps caractristique de l'Arhat. Les actes qui sont

vijnapti (kyavijnapti, vgvijnapti) sont ncessairement impurs (ssrava) et on ne peut leur attribuer la qualit asaksatva. (Voir ci-dessus p. 23 au bas) 2. mana eva manomaunam. Ici matina muni, d'aprs la rgle svrthe

vrddhividhnam.
3.
4.

cittam
D'aprs

M paramrthamunih.
le

Sotra

kathain tathyaio "ntimdtavyah

prantena kya-

karman prantena vkkarman.


5.

cittvijnaptyahhvt.

Paramartha

diffre

L'acte du corps et de la

voix sont abstention de leur nature. L'acte de l'esprit est exclusivement cetan
(volition)
;

comme

il

ne comporte pas de vijnapti, on ne peut pas, en connaissant


qu'il est silence .

par induction qu'il est abstention, dire


6.

Madhyama,

5. H

Anguttara,

i.

272,

DTgha

iii.

219.

Uni soceyyni kaya-

soceyyatfi vacisoceyyam

manosoceyyam

Hiuan-tsang,

xvi, fol.

b4

a.

135

64
cation

c-d.
'.

La

triple

bonne pratique toute

entire est la triple purifi-

Les bonnes pratiques du corps, toutes


corps, impures (ssrava)

les

bonnes pratiques du

ou pures, sont purification du corps, parce


d'une manire dfinitive, elles effacent

que, soit pour

un temps,

soit

la souillure des passions et des

mauvaises pratiques (duscaritama-

lpakarsaka).

De mme pour

la voix et

pour

l'esprit.

Cet enseignement a pour but l'instruction des


nent un faux silence pour
purification
-.

hommes

qui pren-

le silence,

une fausse purification pour la

Le Stra "

dit qu'il

y a

trois

mauvaises pratiques (duscarita).


et

65

a-b.

Les actes mauvais du corps, de la voix

de

l'esprit,
*

sont

regards

comme

tant les trois mauvaises pratiques. [4 a]

Les actes mauvais du corps sont la mauvaise pratique du corps,


et ainsi

de suite

'.

65
1.

c-d.

La

cupidit,

la

mchancet
ni
/

et

la

vue fausse, bien que


gsum
yin no =t

legs spyod gsuni po

thams cad

gtsan byed rnam pa

[triclh
2.

saucam] sarvasiicarita[trayam
arrter, faire cesser.
le

// ]

mithydmaunasaucdhimuktnm vivecanrtham
:

tant.

vivecana,

Hiiian-lsang
la

Arrter les gens qui croient qu'on obtient

puret (suddhidarsin) par


les ablutions
le

seul fait de ne pas parler

(tsnlmbhvamatra)

ou par

(kyamalpakarsana)

Sur

faux silence
ii.

et le

silence des
iv.

ryas

Theragth, 650, Sultani-

pta, 388, Samyutta,

273, Anguttara,

153, 359, v. 266,

Mahavagga,
xxxiii.

iv. 1.

13

Vanaparvan,

42, 60

rnaunn na

so

munir bhavati.
i.

Sur
jhima,

les ablutions,
i.

Thergath, 236, Udfina

9 (Udanavarga,

14),

Maj-

39
iv.

ryadeva, Ciltavisuddhiprakarana.
a-c (superstitiofis
14, 4
;

Kosa,
3.

86

du

lac)

v. 7,

8 (silavrata).
i.

Samyukta,

Dgha,

iii.

214, Anguttara,

49, 52, etc.

Samyutta,

v. 75.

4. lus kyi la sogs mi dge ba /lies par spyod pa gsum astibham duscaritatrayam matant /] 5. La volition mauvaise, ou acte mauvais de l'esprit,

du hdod =r [kyikddikam
est

mauvaise pratique de

l'esprit.

136

CHAPITRE

IV,

65

c-66.

n'tant pas des actes, constituent une triple mauvaise pratique de


l'esprit
'.

En
la

outre,

il

y a

trois

mauvaises pratiques de

l'esprit qui,

de leur

nature, ne sont pas des actes

mentaux

la convoitise (abhidhfj),

mchancet ou nuisance (vypda)

et la

vue fausse (mUliydrsti)


et la

Le Darstantika
fausse sont, en

dit

que la convoitise, la mchancet

vue

fait,

des actes mentaux, car elles sont considres


le

comme

des actes dans

SamcetanyasQtra

'*.

Le Vaibhasika.
seraient la

Dans
chose.

cette hypothse, la passion (klea) et l'acte

mme

Le Darstantika. Le

Quel mal y voyez-vous ? Admettre que la passion Vaibhasika.


donne de
c'est
',

est acte, c'est contre-

dire le Stra et la dfinition qu'il

l'acte (iv. 1 b).

Quant au
qu'il

SamcetanTyasQtra que vous allguez,


entend dsigner lorsqu'il
dit
'

la volition

mme

convoitise

parce que la volition entre

en exercice (pravrtti) sous l'influence (mukliena) de la convoitise.

Parce qu'elles produisent une rtribution pnible, parce qu'elles


sont blmes par les gens de bien, ces pratiques du corps, de la voix
et de l'esprit sont

mauvaises

on

les

nomme

donc mauvaises

prati-

ques.

1. brnab sems la sogs las iiiiii yaii / yid kyi fies spyol yani apy abhidhycU nianoduscaritain tridh II ]

rnaiii

gsiim

mo =

[ofcrt-

2.

L'acte mental,

nianahkarman,

est exclusivement volition, cetan, iv. i b.

3.

drstntikli saiitrCintikavies ity arthah (Vyakhya).

Voir

iv.

78 c-d

o celte doctrine est attribue aux Sautrntikas.


Cette discussion est tire de Vibbasfi,
4.
;

11.3, 14.

Madhyama, 18, 14 comparer Angutlara, v. 21^2, Majjbima, iii. 207. Notre Stra porte isamcetaulyam karma krtvopacitya narakesilpapadyate katham ca bhiksavah sntftcetanlyam karma krtam bltavaty upacitam / iha bhiksava ekatyah samcinfya trividham kyena karma karoty upacinoti caturvidhafn vc trividhatfi manas .... f katham bhiksavas trividham manas satftcetanlyam karma krtatn bhavaty upacitam ihaikatyo 'bhidhylur bhavati vydpanna^citto yvan mithydrsti\ka]h khalu bhiksava ihaikatyo bhavati
I /

viparitadarl

...

Ce SQlra ne signale pas c'est Vabhidhy, etc. qui est

d'acte mental en debors de


l'acte mental.

Vabhidhy,

etc.

donc

Hitian-tsang, xvi,

fol.

a-b.

137

66

a.

La bonne pratique
la

est l'oppos

'.

Le contraire de
non-mchancet

mauvaise pratique
l'esprit
;

est la

bonne pratique

actes

bons du corps, de la voix, de


et la

en outre, la non-convoitise, la

vue droite (samyagdrsti). [4 b]

Comment la vue fausse et la vue droite peuvent-elles tre regardes comme mauvaise, comme bonne (akuala, hiiala) ? En effet, la
-

premire ne comporte pas l'intention de faire du mal, la seconde ne

comporte pas l'intention de

faire

du bien autrui (parmigraliopa-

gJitbhisamdhyahhva).

Sans doute, mais

elles sont la racine

de cette double intention.

66

b-d.

En

prenant, parmi ces pratiques, les plus videntes, on

dfinit les dix cliemins-de-l'acte,

respectivement bons et mauvais \

Le Stra

dfinit dix chemins-de-l'acte

(karmapatha)
les

bons che-

mins, en prenant les plus graves, les plus faciles voir, parmi les

bonnes pratiques

mauvais chemins, en prenant

plus graves

parmi

les

mauvaises pratiques.

Quelles pratiques, mauvaises et bonnes, ne sont pas comprises

dans

les

chemins de

l'acte ?

N'est pas comprise

dans

les

chemins de

l'acte
le

une partie des


prparatif et
le

mauvaises pratiques du corps, savoir

(1)

conscutif des chemins-de-l'acte du corps (prayoga, prsthahhta,


iv.

68

c), (2)

certains actes souills (klista) du corps, par exemple


lier, etc.

boire de l'alcool, frapper,

(Majjhima,

iii.

34)

parce que ces


les

pratiques

ne sont pas extrmement graves. Parmi

mauvaises

pratiques du corps sont chemins-de-l'acte celles qui privent autrui

1.

bzlog pa legs par spyod pa yin


i.

[viparltam sucaritam].

Comparer

Majjliima,
2.

35,

279

Madhyama,

58,

9.

La mithydrsfi
;

est dfinie iv. 78 b-c.

Elle est

le

parama

vajja, Visuddhi-

rnagga, 469

elle

produit tout mauvais


/

3. [tad]audrikasamgraht bhuhhh // ] Madhyama, 3, 16, Samyukta, 37,

dharma, Majjhima, iii. 52. [dasa karmapatha ukt] yathayogam


12
;

[su-

Dgha,

iii.

269.

Manu,

xii. 2-7.

138
de la
vie,

CHAPITRE

IV,

66 b-67.
il

de ses biens, de son pouse, [5 a] car

faut absolument

s'en abstenir.

Ce qui
pour la
le

est trs

grave dans la mauvaise pratique de la voix,

est,

mme

raison, dclar

chemin de

l'acte

non pas

le prparatif,

conscutif et les actes lgers.

Une

partie de la

mauvaise pratique de

l'esprit,

savoir la volition
'.

(cetan) est aussi exclue des mauvais chemins-de-l'acte

Quant aux bons chemins-de-l'acte,


partie de la

ils
:

ne comprennent

i.

ni

une
une
3. ni

bonne pratique du corps


;

prparatif, conscutif; abstenculte,


etc.
^
;

tion de la boisson enivrante, etc.

aumne,

2. ni
'
;

partie de la

bonne pratique de
la

la voix, parole affectueuse, etc.


l'esprit, la

une partie de

bonne pratique de

bonne

volition.

Parmi

les chemins-de-l'acte,

67

a.

Six mauvais peuvent tre exclusivement


l'on
fait

amjnapH \

Lorsque

excuter par autrui


b],

six

chemins-de-l'acte

meurtre, vol, mensonge [5


parole inconsidre

parole maligne, parole injurieuse,

ces six chemins de l'acte

sont seulement
la vijiapii

avijhapti.

celui qui fait excuter ces actions

manque

principale, c'est--dire l'acte

mme

de tuer,

etc.

1.

Hiuan-tsang ajoute

la convoitise lgre, etc.

madyddivirati, c'est--dire madyatdanabandhandivirati ; comparer Digha iii. 176. dnejydi (sbyin, iiichod sbyin) par di, entendre snapanodvartanavisanta(?)hastapradnddi. ijy est presque synonyme de dna ; offrir-nourrir Hiuan-tsang traduit kong-yng pilj snapana et udvartana peuvent tre des actes de pj. Mahavyutpatti, 245, 378-379 (snpana, utsa* dana), dition de VVogihara.
2.
;

3.
4.

priyavacanadi ; par di, entendre dharmadeanmrgakathandi. Toute la discussion qui suit d'aprs Vibhftsft, asubhh sad avijnaptih.

122,3.
5.

La vijnapti (dans

resjSce, acte vocal) par laquelle j'ordonne

un meurtre,
et n'est

jnpanavijnapti,
considre
cipale.

fait partie

du prparatif ('prat/o^aj de ce meurtre

pas

comme

chemin-de-l'acle. Elle n'est pas

maul

vijnapti, vijnapti prin-

L'action de meurtre dont je suis coupable et revtu est

donc seulement

avijnapti.

I
Hiuan-tsang,
xvi, fol.

4 b-5

b.

139
*.

67

b.

Un mauvais

est toujours des

deux sortes

L'adultre est toujours vijhapti et avijnapti, car


ptr en personne.

il

doit tre perautrui,


il

Quand on
plaisir
-.

le

fait

commettre par

ne

procure pas

le

mme

67 b. Des mme \
Lorsqu'on

deux sortes aussi

les six, lorsqu'on

les

excute soi-

les

excute soi-mme,

les

six

chemins
si la

spcifis ci-

dessus (67 a) sont la fois vijnaptl et avijnapti

mort a

'*

lieu

au moment

mme

de la vijhapti (c'est--dire au
;

moment du coup
seulement

par lequel on veut tuer)


avijnapti.

si

la

mort a

lieu plus tard,

Parmi

les

bons chemins de

l'acte,

67

c.

Sept bons sont des deux sortes \


l'acte matriels (rpin), c'est--dire
et

Sept chemins de

du corps

et

de la voix, sont des deux sortes, vijhapti

avijnapti.

En

effet la

moralit d'engagement (samddnalla) dpend d'une vijhapti.

67

d.

Ns du

recueillement,
'

ils

sont seulement avijnapti ^


'

Sont qualifis
pris
et

ns du recueillement
c'est--dire

les

chemins de

l'acte

com-

dans

le

dharmatla,

dans la discipline de

dhyna

dans la discipline pure. Ces deux disciplines dpendent de la seule


:

pense

les

chemins ne sont donc pas vijhapti \

1.

dmdhaikah.
de gslian byed du bcug de dag kyat byed
.

2.
3.

pa

ni de
[te

dan hdra bar dgah ba ma yin


kurvatah
j ].

no.
faits
;

na
:

'pi

Paramrtha
vol, etc.

en
ces

personne
[six],
4.

Hiuan-tsang
s'il

Six mauvais sont certainement avijnapti

accomplis en personne, et l'adultre sont des deux sortes.

Hiuan-tsang
avijiaptih

y a mort,

etc. .

Il

en va du

comme du

meurtre.

5.
6.
7.

dvividhh sapta kualh

samdhijh

//

L'abstention du meurtre est un chemin de l'acte matriel.

Lorsqu'on acquiert

la moralit

d'engagement (samdnaslla),

c'est--dire la discipline

de PrSti-

140

CHAPITRE
va-t-il

IV,

68
et

a-c.

En

du prparatif (prayoga)

du conscutif (prstha)
dit

comme

de l'acte principal ou chemin-de-racle proprement

(maula kar-

mapatha)

68

a.

Les smantakas sont vijhapti

'.

Les smantakas ou prliminaires sont

les actes qui

prparent
Ils

(prayoga)

le

chemin-de-l'acte du domaine du Kainadhatu.


(iv.

sont

toujours vijhapti

b,

d).

68

b. Ils

peuvent tre ou ne pas tre avijhapti ^

Lorsqu'ils sont accomplis avec une grande violence de passion

(paryavasthna,

v.

47, hrikya,
foi

ii.

82, etc.) [6 a], ou avec une


iv.

extrme puissance de
avijnapti. Sinon, non.

(prasdaghanarasena,

22), ils sont

68

c.

Le contraire en ce qui concerne

les conscutifs \

Les conscutifs au contraire sont ncessairement avijnapti.


sont vijnapti lorsque,
le

Ils

cbemin-de-l'acte tant achev, on continue

commettre des actes analogues au chemin-de-l'acte.

moksa, il y a ncessairement vijnapti (dans l'espce, la dclaration Je renonce prise d'autrui au meurtre ), car cette discipline est toujours (parasmd diyate) (iv. 28). Lorsqu'on obtient le dhyna, ce qui suppose l'abandon, au moins provisoire, des passions du Kauia et des actes mauvais on acquiert
: '

'

mme, sans qu'aucune vijnapti soit ncessaire membres du Noble Cbemin). Celle moralit ne dpend pas d'un engagement (samdna) ; elle rsulte de la nature mme des choses (dharmatd) : le possesseur du dhyna possde celle avijnapti qui est l'abstention du meurtre. [Note du traducteur.)
l'abstention

du meurtre par

le fait

de

mme

lorsqu'on obtient la discipline pure (trois

1.

sitiantaks tu vijnaptih
avijnaptir bhavet de
l'acte

2.

na vd

3.

bzlog pa mjug yin no =prsthatti

viparitam= [tadviparyayatah prstham]

proprement dit est cre une avijnapti qui va .se contiaprs nuant et qui est conscutif en outre on peut, aprs avoir commis l'acte frapper la bte avoir tu la bte commettre des actes analogues l'acte morte, couper sa chair, etc. (tasya karmapathasya anudharmam anusadratn
;

Au moment

karma)

cliacun de ces actes est conscutif.

Hiuan-tsang,

xvi, fol.

5 b-6

b.

141

Qu'est-ce qui constitue le prparatif, le chemin de l'acte proprement


dit, le

conscutif ?

'

Un homme,
mne,

dsirant tuer une bte (pasu), se lve de son

lit,

prend

de l'argent, se rend au march, palpe la bte, achte la bte, l'emla tire, la fait entrer, la maltraite,
:

prend

le

couteau, frappe la

bte une fois, deux fois

aussi longtemps qu'il ne la tue pas, aussi

longtemps dure

le

prparatif du meurtre.
il

Au

coup par lequel

prive la bte de la vie

c'est--dire

au

moment o la bte meurt la vijnapti de ce moment et Vavijnapti


qui est simultane cette vijnapti, c'est le chemin de l'acte propre-

ment
le

dit.

Car

c'est

en raison de deux causes que l'on est touch par


:

pch de meurtre
fruit

en raison

du prparatif
-.

et

en

raison

de

l'achvement du

[du prparatif]

Les moments qui suivent, moments de Vavijnapti cre par


meurtre, sont
le

le

conscutif
:

[6 b] sont aussi le conscutif la srie des


le cuir

moments de vijnapti
dre, cuire,

enlever

de la bte, laver, peser, ven-

manger, se

fliciter

(anukirtayati).

De mme
Pour

faut-il expliquer,

avec

les

changements ncessaires,
vue fausse,

les

six autres chemins-de-l'acte

du corps

et de la voix \
et la
:

la convoitise, la

mchancet

il

n'y a pas lieu


elles se

de distinguer prparatif et conscutif


La description qui
il

au moment o

mani-

... si, avec une pense de 1 mauvais acte du corps ffe/avijnapti) et Vavijnapti de ce moment, c'est le meurtre proprement dit ... Le chemin-de-l'acte proprement dit (ou meurtre) 2. phalaparipritas ca. est l'achvement du fruit du prparatif; qui prpare le meurtre (yo lii prayujyate), mais ne produit pas le meurtre (ntaulantkarmapatham na janayati), fruit du prparatif mais non pas achvement, complet ion, de ce il y a pour lui fruit (tasya prayogaphalam astina tu phalapariptirih) 3. iha kascit parasvam hartukmo maicd uttisthati astram grhnti paragrham rjaccliati supto na vety karnayati parasvam sprsati yvan na sthdnt pracyvayati tvat prayogah / yasmin tu ksane sthnt pracyvayati tatra y vijnaptis tatksanik cvijnaptir ayant maulali karmapa1.

suit d'aprs VibhSs, 113,

tuer,

dtruit la vie d'autrui (prnfipta), le

',

tliah

dvbliytn hi

kdranbhym adattdnvadyena
j

tah phalapariprita ca

yvat tat parasvam asya vijnaptiksan api prstham bhavanti (Vyakhy).

sprsyate prayogatatah parant avijnaptiksanh prstham bhavanti / vibhajate vikrnte gopayaty annkrtayati va tvad

142
festent,

CHAPITRE
par
le seul fait

IV,

68

c.

de leur prsence (samniukhlbhvamtrena),

elles sont cheniin-de-l'acte

proprement

dit.

Objection.

dans

Une
le

question se pose. Le chemin-de-l'acte

est-il

constitu par la vijhapti et Vavijnapti du

(prnin)

est

moment o l'animal maranbliava\ c'est--dire du moment o l'anifaut-il

mal meurt ? ou bien

comprendre
le

la vijnapti et

Yavijnapti

du moment o l'animal est dans

mrtahhava,

c'est--dire

du

moment o
un

il

est

mort ?

Si vous acceptez la premire bypotlise,

bomme sera coupable du moment mme o meurt la


dhnta,
avez
dit
iv.

pch de meurtre quand


bte tue
:

il

meurt au

ce que votre systme (sid-

72 a-b) n'admet pas. Et dans la seconde hypothse, vous


:

tort que

au coup par lequel


et

il

prive la bte de la vie, la

vijnapti de ce

moment

Vavijnapti simultane cette vijnapti,


dit
.

c'est le chemin-de-l'acte

proprement
....

[Vous auriez d

dire

mrte prnini y vijhapth mal est mort .... ] [7 a].

La vijnapti

qui a lieu lorsque l'ani-

En

outre, si vous acceptez la seconde hypothse, vous contredisez

l'explication

que

les

Vaibhasikas donnent de la phrase


,

lorsque le

prayoga

n'a pas disparu

qu'on
:

lit

dans

le

MlasOstra (.Tnana-

prasthana, 11, n). Ce Sastra dit

Arrive-t-il

que
'

l'tre

vivant soit

dj tu et que le meurtre ne soit pas pass ?

Oui, lorsque, l'tre


n'a pas

vivant tant dj priv de la vie, le

prayoga [du meurtre]


11,
ii)

disparu^

Les Vaibhasikas (Vibhasa,

expHquent ce texte en

disant que le

mot prayoga

qui

signifie

normalement prparatif

ici

le

sens de conscutif (prstha).

Or vous contredisez

cette

explication puisque, plaant le chemin-de-l'acte principal au

moment
l'animal

o l'animal

est

mort (mrte prnini),

c'est bien le chemin-de-l'acte

principal qui, d'aprs vous, n'a pas disparu au

moment o

Le tnaranabhava est dfini iii. 13 c-d. et que le meuiire ne soit pas dtruit hatah prntipta ctumddhah (ma hgag pa yod dam)
1.

2.

Littralement

syt prani
lia

3. (Iper

na

sroy chngs kyi srog bcad la sbyor ba

med par ma gyur pa


;

buho.

med

par
;

ma

yyur

= n'a pas disparu = aviyata


:

Hiuan-tsang

si

uparata, nivrita

Paramttrtha

wi ch wi

Hiuan-tsang,
est mort.

xvi, fol.

6 b-7

b.

143
le

Vous

interprtez le

mot prayoga du Sastra dans

sens

d'acte principal.

Le Vaibhasika.
question,

Il

faut expliquer le Sastra de telle manire qu'il

ne prte pas la critique.

Et comment cela ? Dans


chemin-de-l'acte
principal
:

le texte

en

prayoga

signifie

[du

moins

lorsqu'on envisage le
l'animal
;

moment
que

qui suit immdiatement la mort de

lorsqu'on envisage les


ainsi
dit la

moments
Yibhasa,

qui suivent ce
le conscutif.]
'

moment,
mort

prayoga signifie, Mais comment


Le Vaibhasika.

la vijnapti

du moment o l'animal

est dj

pourrait-elle tre le chemin-de-l'acte principal ?

Pourquoi ne

le serait-elle

pas ?
:

Parce qu'elle est inefficace. [L'animal est mort

on ne

le fait

pas

mourir nouveau.]

Le Vaibhasika.

Mais

comment Vavijnaptiy
Ce qui
fait

qui est toujours


et

inefficace, est-elle chemin-de-l'acte ?

qu'une vijnapti
;

une avijnapti sont chemin-de-l'acte, ce


le fait qu'elles
'^

n'est pas leur efficacit

c'est

se produisent

au moment de l'achvement du

fruit

du

prparatif.
Arrive-t-il qu'un

chemin de

l'acte soit le prparatif

ou

le

conscutif

d'un autre chemin de l'acte ?


Oui. Par exemple les dix chemins de l'acte peuvent tre le prparatif

du meurtre. L'homme qui dsire tuer son ennemi, [7 b] pour


le

assurer

succs de cette entreprise, prend


sacrifice
;

le

bien d'autrui et offre

une bte en

l'adultre avec la
plice
;

au moyen du mme bien vol, il commet femme de son ennemi pour faire d'elle une comil

par des paroles menteuses, malignes, injurieuses, frivoles,


:

1. Bhsya Vaibhsikair asya stravkyasyaivam artho vykhytah / atra sstre prayogaabdena prstham uMam iti j asyrthasya virodhah / maulasyaiva tadnlni aniruddhatvt j Vaibhasika ha / yath na dosas tathstu I kathant ca na dosah / mania evtra prayogasabdenoktah j 2. Bhfisya vijnaptis tarhi tad katham maulah karmapatho bhavati f
:

kaiham ca na bhavitavyam
I

asmarthyt / avijnaptir idnm katham / bhavati tasnit prayogaphalapariprikle tad iibhayam karmapathah syt /. maiilakarman. Le chemin de l'acte principal prayogaphala a donc lieu prnino mrtvasthym.

144
brouille son

CHAPITRE

IV,

68

c-d.

ennemi avec

les
;

amis qui
il

le

pouvaient dfendre
;

il

convoite

le

bien de son ennemi


qu'il

veut du mal son ennemi


il

en vue

du meurtre

veut commettre,

nourrit la vue fausse.

De

mme les dix chemins de l'acte peuvent tre le conscutif De mme pour les autres chemins de l'acte, vol, etc.
'.

du meurtre.

Mais, dirons-nous, la convoitise, la malignit et la vue fausse ne


sont jamais prparatif, car elles ne sont pas

commencement
elles

d'action

(kriyrcnnhha) ;

elles n'ont

pas de prparatif, car


-.

sont seulement

production de pense (cittotpda)

Le Stra

dit

Il

a,

Bhiksus, trois espces de meurtre, meurtre


la haine,

n de la concupiscence, meurtre n de
ration (lohha, dvesa, molia)
,

meurtre n de l'aber:

et ainsi
.

de suite jusque
[8 a]

Il

Bhiksus, trois espces de vue fausse


quels sont ces diffrents meurtres,
etc.

a,

11

faut expliquer

Tous les chemins-de-l'acte ne sont pas achevs (nisth) remment par concupiscence, haine ou aberration mais

indiff-

68

d.

Le prparatif

nat des trois racines \


les chemins-de-l'acte

Le prparatif de tous

peut natre indiffrem-

ment des
thpaka,
1.

trois

racines.
la

Bhagavat, en s'exprimant

comme nous

avons vu, vise


iv.

cause premire, la cause qui donne origine (samnt-

10 a-b) au chemin-de-l'acte.
(iv.

Meurtre

73) n de la concupiscence

'*.

Meurtre pour prendre


;

telle

ou

telle partie
le

de la bte

meurtre pour s'emparer d'un bien


;

meurtre pour

plaisir

(krd)

meurtre pour se dfendre, pour

dfendre ses amis (imasuhrtpariirnrtliam).

Meurtre n de

la hane,

pour assouvir

l'hostilit

(vairaniryta-

nrtham).
1.

Vyakhyn

yatha parasvatn hartukamah kryasiddhaye parakiyam

hrtv tena paunfi balitn knryt 2. Saraghabhadru rfute ces objections. 3. sbyor ba rtsa ba gsum las skyes
ttliasfilinT, p.
4.
fol.

[prayogas tu IriinQlajah

||

Voir

H)
dtinitions qui suivent est la KarmaprajAapti
14.

Une des sources des


a.
;

(Mdo

72)

210

aussi Vibhfisft, 116,

Hiuan-tsang,
Meurtre n de l'aberration.
action pie et tuer
' ;

xvi, fol. 7 b-8 b.

145

Considrer

le sacrifice

comme une
des actions

quand

le roi,

d'aprs l'autorit des lgistes (dhar:

mapthaka)

tue par pense de devoir

La premire

mritoires du roi est de punir les malfaiteurs

(Praska) disent
[8 b]
;

Il
:

faut tuer pre et

quand les Perses mre gs et malades ^


9i),

quand on

dit

Il

faut tuer les serpents, les scorpions, les


etc.,

mouches tryamhiika (Mahavyutpatti, 213,


btes sont nuisibles
buffles
'^

parce que ces

il

faut tuer le gibier, le btail, les oiseaux, les


\

pour s'en nourrir

Le

meurtre enfin qui est provoqu

1.

C'est l'exemple classique. Voir l'intressante histoire, Chavannes, Cinq cent


iii.

Contes,
2.

287, et les rfrences.


p.

Voir ci-dessus,

121, n.

1.

La KarmaprajMpti
tnchu-skyed.
:

attribue le meurtre des

parents aux brahmanes d'Occident

nomms

tiinda ou ntagh qui est un Naksatra

nichu donne ostha, peut tre Maghaja ou Maghabhava.


nomms Mou-kia
et

Vibhasa, 116,

14. Il

a,

l'Ouest, des Mlecchas


:

qui ont cette

opinion, qui tablissent ce systme

Ceux qui tuent pre

malades obtiennent mrite


les

et

non pas pch.

Pourquoi ?

mre dcrpits et Le pre dcrpit a


;

manger s'il meurt, il obtiendra des organes nouveaux et forts, il boira de nouveau lait tide le malade a beaucoup de sensations douloureuses mort, il sera dlivr. Donc celui qui le tue ne commet pas de pch . Semblable meurtre nat de l'aberration. Maga, proprement Magu et Muga sous l'influence de la labiale Mou-kya
organes ruins
et

n'est plus capable de boire et de

initiale [S. Lvi]

Sur les mmes Mages, ci-dessous p. 148, n. 1. Le Grand Vhicule admet qu'on peut tuer l'homme qui va commettre un pch mortel (nantarya), Sikssamuccaya, p. 168. Nariman dans Revue Histoire des 3. Comparer Jtaka, Fausboll, vi. 208, 210 Religions, 1912, i. 89 et JRAS. 1912, 255 J. Charpentier, dans le Zeitschrift pour l'Indologie et l'Iranistique, ii, p. 145 (Leipsick, 1923), qui compare les Kambojas, pieux tueurs de kltas, pataugas, uragas, bhekas, kimis et makkhiks, aux Zoroastriens du Vendidad 14, 5-6 et d'Hrodote i. 140. 4. D'aprs Hiuan-tsang, c'est l'opinion de certains TTrthikas d'aprs ParamrHiuan-tsang tha, l'opinion du Trthika P'in (Julien 1431)-na-ko (Vinnaka ?). Les serpents ... nuisent l'homme celui qui les tue produit grand mrite les moutons ... sont essentiellement de la nourriture les tuer n'est pas un pch . Sur le meurtre des animaux et l'usage de la viande et du poisson, 1. les cinquime et sixime dits sur piliers 2. les trois purs , aclittha asuta apari;
; ;

sankita, Majjhima,
Life, p.
3.

i.

368 Anguttara,
le

iv.

187, Dulva,

III,

fol.
vi.

28 (apud Rockhill,
31, 14 et

38 note)

pour

poisson seulement, Mahvagga,


;

CuUa,

vii.

15 (schisme de Devadatta)

dans Dulva, IV,

Bouddha

d'autoriser la viande

pure

Devadatta reproche Religieux minents, p. 48, Takakusu,


fol.

453,

10

146

CHAPITRE

IV,

68

d.

(pravartita) par la vue fausse

le

meurtre commis par un

homme
l'objet

qui nie la vie future et que rien n'arrte (nirmanjda).


2.

Vol

(iv.
;

73

c-d)

n de la concupiscence.

Soit qu'on vole

convoit

soit

qu'on vole pour s'emparer ensuite d'un autre objet,


',

acqurir honneurs et respects

se dfendre et dfendre ses amis.


l'hostiHl.

Vol n de

la haine,

ou pour assouvir

Vol n de l'aberration.

Le

roi,

d'aprs l'autorit des lgistes,

s'empare des biens des malfaiteurs.

Les Brahmanes disent


;

Toutes choses ont t donnes aux Brahmanes par Brahma


par la faiblesse des Brahmanes que
le

et

c'est

les

Vrsalas jouissent. Par

consquent, quand

(d) ce qui

lui

appartient
[9

donne du sien
ils

Brahmane drobe (apahar), le Brahmane prend il mange du sien il se vt du sien, il a] et cependant, quand les Brahmanes prennent,
;

ont bien la notion du bien d'autrui.

Le vol provoqu par


soit

la

vue

fausse est aussi un vol n de l'aberration.


3.

Amour

illicite (iv.

74

a-b)

n de la concupiscence.

Commerce

avec la

femme

d'autrui, soit par

amour,
et

pour obtenir honneui*s

et respects^ soit

pour se dfendre

dfendre ses amis.

Amour

iUicite

n de la haine, ou pour assouvir l'hostilit.

I-tsing, p. 46, 58, etc.

La viande d'homme, d'lphant,

etc. est interdite

3.

E. VV.

Hopkins, The buddhistic rule against eating mat, J. Am. Or. Soc. 1906, 455-464. Il est interdit de couper les feuilles d'un arbre (ci-dessus iv. 35 a-b), de fouler les herbes (tinni) vertes, de dtruire les tres vivants un organe (ekindriya
jlva),
1.

Mahavagga, iii. 1. anyalbhasatkrayaortham. svam haranti yathsvahrikdh


2.

VyfikhY&

anyalbhasyrthe para-

L'original nous est fourni par la Syfidvfidamanjar

(Chowkhamba

S. S. 1900,

Ces textes disent na hirnsyt sarvablmtni, et ordonnent le memtre de 597 btes dans l'Asvamedha ils disent nnrtum hryt, et expliquent les cinq mensonges
p.
: ; :

32) qui dmontre le

manque

d'autorit des textes brahmaniques.

mme adattdnam anekadh nirasya pacd uktam yady api brhmano hathena parakyam datte balena va tathpi tasya ndattdnam yatah sarvam idam briimanebhyo dattam brhmanntft tu daurbalyd vrsalh paribliunjate tasmd apaharan brhmanah svam datte svam eva brhmano bhunkte svam vaste svam dadtti. Compapermis
;

de

rer

Manu,

i.

101 (Bhagavatapurfina,
:

4. 22. 46).

La

lecture

daurbalyt (Manu

nrafftsyi) est certaine

dmas pa.

Hiuan-tsang,

xvi, fol.

8 b-9

a.

147
etc.

Amour
gosava
',

illicite

n de l'abeiTalion.
et

avec leur mre


il

autres fennnes interdites

Les Perses, ont commerce Dans


'.

le sacrifice

boit de l'eau [ la

manire d'une

bte], broute de l'herbe,


qu'il

a commerce avec sa mre, sa sur, une


les

femme de son gotra ; o


: :

trouve (labli, vindj, l

il

doit mettre

de la sorte ce taureau

triomphera du monde.
1.

Ceux qui disent

Hiuan-tsang
:

Les femmes sont

comme

Par
la

si

ga pa
etc.

la

sogs pa.

Les Perses louent l'abrahmacarya

avec
2.

mre,

gosava, transcrit par ParamSrtha, traduit par ba lan hbran,


.
:

gnration

du taureau
ryrthe
arthali
j

La Vyakhy porte
/

ninah.

tatra moliaprdJinyd tipaiti mtaram abrahmacanpasvasram upaitti vartate / upasvasram npaiti bliaginm ity upasagotrm upaiti satnnagotrm ity arthah upah (?) yajaj

Il

est visible

que Yasomitra dbrouille mal ce texte vdique.

le Gosava dans Jaiminya tasya vratam upa mtaram iyd tipa svasram upa sagotrm upvahyodakam cnied upvahCiya trnny chindyd yatra yatrainam visth vindet tat tad vitisthetnudtiho ha lokam jayati. Nous avons ici la source de Vasnbandhu. M. W. Caland veut bien m'expliquer et complter la traduction qu'il a donne de ce passage (Jaiminya in Auswahl, p. 157).

L'obligeance de M. Keith m'a permis de dcouvrir


ii.

Brbmana,

113

pastamba Srauta xxii. 13 tenestv samvatsaram pasiivrato bliavet / iipvahCiyodakam un autre Stra porte upanighya pibet M. Caland corrige upanighya, et traduit upvahya, upanighya, par se baisser visth
:

....

'

*.

serait

besoin naturel

',

vitistheta signifierait
le

'

carter les
il

jambes
.

'.

On

aurait

donc

En

quelqu'endroit qu'un besoin

prenne,
.

le satisfait

La finale

signifie

Il

s'empare du monde du taureau

gi nichod sbyin la cho

ba lan hbran ga can gyi chu btun no j j rtsva bcad do j j mahi gan du nal po la hgroho / srin mohi gan du hgroho / rtis gcig pahi gan du hgroho shes bya ba dan j gan dan gan na hdi dag rned pa de dan der hphro bar bya ste j de Ita na ba lan hdi hjig rten las rgyal bar hgyur ro / Seule fait difficult l'expression cho ga can gyi vidhi-mat qui, grammaticalement,
texte est faite sur la version tibtaine
:

La traduction porte au

qualifie l'eau

on ne peut traduire
....

'

l'eau rituelle

'.

Mieux vaut entendre


le
;

Celui

qui a pris

le rite boit l'eau


:

Hiuan-tsang
ta)
;

Les femmes et
;

les

hommes prennent
les dents

vu du taureau {govraou bien restent en place,


la rencontre, ils

ils

hument
;

l'eau

ils

coupent l'herbe avec

ou bien vont
s'unissent.

sans distinguer qui est parent ou loign, suivant

Paramrtha

En

outre,

comme dans
;

le sacrifice

Gosava,

les autres

femmes
fille,

hument

l'eau,

broutent l'herbe

l'homme
sang,

va,

prend sa parente, ou prend

tante, ane, cadette,

femme de mme

etc.

148
le

CHAPITRE
riz,

IV,

68 d-69.
la bouillie
cuite,

mortier
4-7.

la fleur,
(iv.

le

fruit,

la route

'

Mensonge

74

c-d) et autres

pchs vocaux ns de la con-

cupiscence et de la haine,

comme

ci-dessus. [9 b]

roi, le mensonge joyeux, le Mensonge n de l'aberration. mensonge avec les femmes, au mariage, en danger de mort, ne

nuit pas

on

dit

que ces cinq mensonges ne sont pas des pchs


la

Le mensonge provoqu par


Parole maligne
et autres

vue fausse.

pchs vocaux ns de l'aberration.


les

Ceux provoqus par


pralpa) du Veda,
8-10.

la

vue fausse. En outre,

faux discours (asat-

etc.,

sont des paroles frivoles (sambliinnapra-

lapa) nes de l'aberration.

Gomment

la convoitise, la

mchancet

et la

vue fausse

(iv.

II-IS) naissent-elles de la concupiscence, etc. ?

Puisqu'elles n'ont

pas de prparatif, cela

fait difficult

69 a-b. La convoitise et les

deux autres chemins mentaux naissent

des trois racines parce qu'elles apparaissent la suite de ces racines ^


Lorsqu'elles apparaissent immdiatement la suite de la concupiscence, elles naissent de la concupiscence
;

de

mme

pour

les

deux

autres racines.

Nous avons

expliqu les mauvais chemins de l'acte dans leurs


:

rapports avec les racines. Quant aux bons chemins de l'acte

1.

ye chur tidkhalditulyo mtrjanah

c'est

ropinion du TTrlhaka P'in-

na-ko (Paramartha).

Hiuan-tsang ajoute
16
:

escalier, pont, navire.


il

D'aprs Vibhfisa, 116,

Dans

l'Ouest,

y a des Mlecchas nomms Mou-kya

qui ont celte opinion, qui tablissent ce systme qu'il n'y a pas de pch avoir

commerce

Conqjarer Divylvadana,

Pourquoi ? Parce que les fennnes sont comme la bouillie cuite.... panthsnmo p. 257 (xviii. histoire de Dharmaruci)
:

ca mtryrdmah / yatraiva hi tirthe pit snti putro 'pi tasmin sn&ti api ca pratyantesu janapaclesu dharmataivais ym eva pitdhiyacchati tm eva putro 'py adhigacchati ... 2. C'est la stance ttt narmayuktam vacanatn /i/asf/... SySdvadamaftjarT, comparer Gautama, v. 24 Vasisthasmvti, xvi. 30. p. 32; Mbli. i. 82, 16, etc. Max MUer, India, What can it .... p. 272 venial untruths. 3. de yi mjug thogs las byun phyir / brnab sems sogs rtsa gsum las skyes

matrgrmah

tlrthasamo

'pi

[tadanvayata utpadad

(?)

abhidhydi trimlajam

/]

Hiuan-tsang,

xvi, fol.

9 a- 10

a.

149
de non-

69

c-d.

Les bons, avec prparatif

et conscutif, naissent
*

concupiscence, non-haine, non-aberration. [10 a]

Les bons chemins de

l'acte,

avec

le

prparatif et
iv.

le

conscutif, ont

pour cause originaire (pravartaka,

10)

une bonne pense. La

bonne pense, tant ncessairement associe (samprayiikta) aux


trois racines, nat des trois racines.

Le renoncement au prparatif du mauvais chemin de l'acte, c'est prparatif du bon chemin de l'acte le renoncement l'acte proprement dit qui constitue le mauvais chemin de l'acte, c'est le bon
le
;

chemin de

l'acte

proprement

dit

le

renoncement au conscutif du

mauvais chemin de

l'acte, c'est le
:

conscutif du bon chemin de l'acte.

Donnons un exemple
le

l'ordination

du novice. Depuis
^ salue le

le

moment o

novice entre dans

le

nnvsa

Samgha, adresse sa

requte l'Upadhyya, jusqu'au premier, jusqu'au second

cana,

c'est le prparatif \

karmav' l'achvement (parisampti, avasna)


ont lieu une vijnapti et une avijnapti
le

du troisime

karmavcana

simultane cette vijnapti qui constituent

chemin de

l'acte propreles

ment

dit.

Aprs ce moment, lorsqu'on intime au nouveau moine


fait

nirayas, lorsqu'il

connatre qu'il les accepte

'%

et aussi

longtemps
las

1. dge La sbyor dan nijug bcas rnanis / chags sdaii [uhhh saprayogaprstha alobhaclvesanohajdh //]

gti

mug med

skyes

2.

Paranifirtha,

ses

',

nnvsa (^traduit littralement par le lotsava, gnas sua tshogs et par pou ping tchu, traduit par lliiian-tsang Mai Vn, autel des dfenqu'on trouve ailleurs comme quivalent de sm, voir iv. 39 b) est expliqu
*

dans

la

Vykliy

nnvsatn pravisatti mandalam pravisatty artJiah

nnvsa

M tasmin mahsmmandale bhavanti.

3. Pour les sources sanscrites, A Fragment of the Sanskrit Vinaya; Bhiksunkarmavcana, Bulletin of Ihe School of Oriental Studies, I, iii. (1920). Pour les sources plies, voir par exemple K. Seidenstiicker, Pli Buddhismus (Socit plie allemande) Kern, Manual, p. 78. Il faut entendre que le prparatif dure jusqu'au dernier moment, exclusivement, du troisime karmavcana. 4. Le texte porte tata rdkvam yvan nisray {= gnas) rocyante {= bsgo) tadadhisfhnatn (= dehi brten) ca vijnapayati, c'est--dire nisraydhisthnm ca vijnaptim karoti. Paramrtha traduit Jusqu'au moment o l'on dit les quatre nirayas (l), en dpendance () de cet acte principal tout ce qu'il y a
; : : :

de vijnapti et

' avijnapti,

aussi longtemps que la srie n'est pas coupe, c'est le

150

CHAPITRE

IV,

70-72

b.

que se continue la srie d'avijnaptis cre par


c'est--dire aussi

l'acte principal

de

longtemps que

le

moine ne perd pas

la discipline

Pratimoksa

(iv.

38)

c'est le conscutif.

Nous avons vu que


indiffremment
'

les
'

mauvais chemins de

l'acte n'taient

pas

achevs

(nlsth) par les trois racines. [10 b]

70
haine.

a-b. Meurtre,
'

mchancet, parole injurieuse sont achevs par

Par haine seulement.

Ils

sont achevs lorsque se manifeste (sam'

mukhbhvt) une pense de parityga


la

(en ce qui concerne le

meurtre), une pense de violence (pariisacitia) (en ce qui concerne

mchancet

et la parole injurieuse).

70
*

b-d. Adultre, convoitise, vol sont


'

achevs par concupiscence ^


'

Adultre

(parastrlgamana),

c'est--dire

amour

illicite

'

(kma-

mithycra).

71

a.

La vue

fausse, par aberration \

Par une extrme aberration.


conscutif. >

Hiuan-tsang, lui aussi, est obscur

(catvro nirayh) kf (ca) y (sesa, anya) vanti ?).

tch (yvat) choo (roc) se T (nisraya) ts'in (prdurbha-

catvro nisrays ctvarapindaptasayysanaglanapratyayabhaisajyalaksanh (VySkhya). 1. vadhavypdaprusyanisthd dvesena 2. La pense de parityga est la cause tatksanasamutthna (iv. 10) qui est
simultane au chemin de l'acte [Note de l'diteur japonais].
regarder, ngliger
p.

Parityga, yons-su hdor ha, traduit par Hiuan-lsang o soUo ku, ne pas Voir ci-dessous, est un euphmisme pour dtruire, tuer 153, n. 3. Comparer AtthasalinT, p. 91 gabbham ... ppakena manasnu*

',

'

'.

pekkhako
*

Jioti,

n'est pas indiffrent l'gard de l'embryon


'.

'

c'est--dire

sou-

haite sa destruction

pense de violence
:

',

parusa^^itta, Paramftrtlui

clie,

raboteux,

karkaa

Hiuan-tsang
3.

ts'Ou
/

(audrika) connne dans prusya.


fl

lobhatah

parastrgamafibhidhydattdnasampanam

sam-

pana
4.

= nisth, achvement.

mithydrstes tu mohena.

Hiiian-tsangy xvi,

fol.

10 a-Il

a.

151

71

b.

Les autres, par

les trois.
l'acte,

'

Les autres chemins de

mensonge, parole maligne, parole

inconsidre, sont achevs soit par concupiscence, soit par haine, soit

par aberration.
Les chemins de
tions, trois
l'acte,

qui viennent d'tre diviss en quatre sec-

(70 a-b),

trois,

un

et trois, ont

respectivement pour

71
rpay

c-d.
le

Objet

les tres vivants, les objets


^

de jouissance,

le

nmala

nman.

[11 a]
l'objet

Les tres vivants sont

ou
;

la matire
les objets

du meurtre, de

mchancet

et

de la parole injurieuse

de jouissance (bhoga)
;

sont l'objet de l'adultre, de la convoitise et du vol


c'est--dire les cinq
c'est--dire le

le

skandhas,
(ii.

est l'objet de la

vue fausse

nmarpa, le nman^
;

nmakdya

47), est l'objet

du mensonge

et

de deux

autres pchs de la voix \

Lorsqu^on a dcid la mort de quelqu'un


avant, soit aprs
lui,

'%

et

qu'on meurt soit

a-t-il,

oui ou non, pour l'auteur du meurtre,

chemin-de-l'acte principal

(maula karmapatha)

?
il

72

a-b. Si

on meurt avant ou en
"

mme

temps,

n'y a pas chemin-

de-l'acte principal.

C'est pourquoi la
ratif

Yibhasa

dit

du meurtre,

peut-il arriver

Quand un homme a que, au moment o

fait le

prpa-

le fruit le

de ce

prparatif est achev, cet

homme

ne soit pas touch par

pch de

meurtre ^ ?
1.

Oui, lorsque cet

homme meurt

avant ou en

mme

sesndm

tribhir isyate
loiis

//
/

2.

gzhi ni sems can

spyod dan

min dan gzugs dan min yin no


//J

bJioy

adhisthnam nmarilpam ca nma ca

adhisthna

= [sattv = adhikaiti

rana, visaya.
Atthasalin, p. 101.
3.

nmakydhisthn mrsvdddayo vg ndmni pravartata

krtv

(Vyakhya)
4.

Voir Vyfikhya ad
le texte

iii.

30

c-d.

Je crois que

porte

paramarane krtaniscayah

(pha roi po hchi bar

ns par byas nas).


5.
6.

saniam prg va mrtasysti na maulah.


Il

Voir

p. 142.

s'agit

du chemin de

l'acte principal.

152

CHAPITRE
le

IV,

72-73

b.

temps [que

tu]

La

raison est claire

aussi longtemps que

celui qui doit tre tu


le

(vadhya)
ne

est vivant [11 b], aussi


le

longtemps

meurtrier n'est pas touch par


il

pch de meurtre
s'il

lorsque meurt

celui qui doit tre tu,

l'est

pas davantage

meurt en

mme

temps ou auparavant

72

b.

Parce qu'un nouveau corps a pris naissance.

Le corps
accompli,
le

la personnalit

(sraya)

par qui
;

le

prparatif a t

corps du meurtrier, est dtruit

le

meurtrier prend un
(ii.

nouveau corps qui appartient un autre nikyasahhga


ce corps n'a pas fait le prparatif,
il

41
et,

a)

n'est pas

prayoktar

par

consquent, ne peut tre touch par

le

pch de meurtre.
tuer, soit

Lorsque beaucoup d'hommes sont runis en vue de


la guerre, soit
est

pour

pour

la chasse

ou

le

brigandage,

si

l'un d'eux tue, qui

coupable du meurtre ?

72 c-d. Comme les soldats, etc., concourent mme effet, tous sont coupables comme celui qui
Le but tant commun, tous sont coupables
eux qui
par
tue, car tous s'incitent
le fait

la ralisation du
tue
-.

tout

comme

celui d'entre

mutuellement, non par la voix, mais

mme

qu'ils se sont runis

pour tuer ^

l'ar-

Mais l'homme qui a


me,
est-il, lui

t contraint par la force se joindre

aussi, coupable ?
:

Evidemment,
pour sauver

moins

qu'il n'ait

form un

cette rsolution

Mme

ma

vie, je

ne tuerai pas

tre vivant. [12 a]

Que

faut-il

pour que celui qui tue commette

le

chemin de

l'acte ?

Mme
fausse.
1.

question pour les autres pchs juscpie et y compris la vue

anyrayodayt
la sogs

% dmag
<

pa don

gcig phyir

thams cad byed pa po hghin Idan


reffet, tous,

Les soldats,

etc.,

munis [du meurtre]


3.

= [sainikdyekakryatvt sarvesm asti kartrvat


//]

en raison de l'unit de

comme

l'agent, sont

Suppler asti karmapathah,

comme 72

a-l>.

arthato ht
kifft

rah

te 'nyonyatn prayoktra iti na vc te 'nyonyatn prayokttarhiprAntiptakaranbhyupagamd arthataiti darayati.

Hiuan-tsang,

xvi,

fol.

11 a-12 a.

153
faire

73
erreur

a-b.
'.

Le meurtre,

c'est tuer autrui,

consciemmeut, sans

Quand uu homme
cette

tue en pensant
et

Je tue un

tel , et qu'il
il

tue
^

mme

personne

non pas une autre par


tue en doutant
tel
s'il

erreur,

y a meurtre.

Et quand un

homme
frappe un

frappe un tre vivant ou


a-t-il

une chose,

s'il

ou un autre, y
:

meurtre ?

Cet
;

homme
frappe
;

possde la certitude
par consquent,
peut-il
il

C'est certainement ce que c'est


^

il

a pense de parityga.

Comment

y avoir meurtre, destruction du


'*

prna

(prnti-

pta), puisque les

skandhas sont momentans

1. srog gcod pa ni bsams bzhin du / ma nor bar ni gzhan bsad paho / [prntiptah sammntyhhrntyaiva paramranam /] 2. ParamSilha Si un homme a l'intention Je veux tuer un tel si, l'gard d'un tel, il a la notion de un tel s'il tue un tel et non un autre par erreur, en raison de ces trois points le meurtre est chemin de l'acte. samcintya samcicca, Mahvyutpatti, 245, 68 Par. iii. Karmaprajnpti, Mdo 62, chap. xi. Buddhaghosa, Atthasalin, p. 97 (= Su:

'

'

mangalavilasin,

p. 69)

Sp. Hardy, Manual,

p.
;

478

Bigandet

(1914),

ii.

195.

Pour
citta,

le

meurtre cinq choses sont ncessaires

peina, pnasannit, vadhakatre sdliatthika,

upakkama, marana.

Le meurtre peut

nattika,

nissaggika, thvara, vijjmaya, idclhimaya. (Voir la traduction de Maung Tin et Mrs Rhys Davids, Expositor, 129 vijj potency) art, iddhi Aussi quand il y a doute, il y a meurtre 3. Hiuan-tsang un homme, l'en:

=
:

=
:

droit de l'objet qu'il dsire tuer, est en doute


Et, si c'est vivant, est-ce

Est-ce
il

un

tre vivant

ou non ?
:

un

tel

ou un autre ?

alors

prend

la dcision

Que
s'il

ce soit l'un ou l'autre, je tuerai tue

en raison de cette pense de parityga,


.

un tre vivant, ParamSrtha


:

il

commet
ainsi,

le

chemin -de-l'acte

sus, n. 2). S'il

en est
:

pch de meurtre)

trois points, il y a chemin-de-l'acte (ci-desun homme peut tre en doute et tuer (= commettre le Cela est-il un tre vivant ou non ? Cela est-il un tel ou non ?
:

en raison de ces

Cet homme, l'endroit de l'objet tuer, est dtermin tuer

Que

ce soit l'un
il

ou
le

l'autre, je tuerai,

II

a donc produit la pense de parityga.

S'il tue,

obtient

pch de meurtre.

Le tibtain donne
yin no.

de yan gdon mi za bar gan yin pa yin zhes bya bahi


a seulement pense de parityga

fies

pa a

hdi brned nas de la snun par byed pas des na hdor bahi sems su byas pa kho na

Traduisons

Il

ou plutt

Il

bien pense de parityqa.

On ne
4.

voit pas

que parityga

diffre

de fttrana.

Les skandhas sont momentans,

c'est--dire prissent

d'eux-mmes (svara-

154

CHAPITRE
entend par prna,
'

IV, 73.

On
le

souffle vital

',

un vent (vyu) dont

l'exis-

tence dpend du corps et de la pense'. Ce

prna^

celui qui

commet
la

meurtre l'anantit [12 b] (atiptaijaii


la

= vinaijali) de
le

mme

manire dont on anantit

flamme ou

son de la cloche,

c'est--

dire en l'empchant de continuer se reproduire.

Ou
ii.

bien ^ ^tm'
a)
:

prna

il

faut entendre l'organe vital (jivitendriya,


fait
il

45

lorsqu'un

homme
vital,

obstacle la naissance d'un nouveau


il

moment
meurtre.

de l'organe

l'anantit,

est

touch par

le

pch de

Mais qui attribuez-vous l'organe


est

vital ?

De

qui dites-vous qu'il

mort lorsque

la vie

La
dans

valeur vraie de ce
le trait

manque ? pronom
vie, la

qui ? de qui ?

sera examine

de la rfutation du Pudgalavada \ Observons que Bha-

gavat a
le

dit

Lorsque la
il

chaleur et la connaissance quittent

corps,

abandonn

'

gt,

comme un morceau
et c'est

de bois, priv de

sentiment.

Donc,

c'est

du corps qu'on
;

dit qu'il vit, lorsqu'il est


dit qu'il est

muni d'organes (sendriya)


lorsqu'il

du corps qu'on

mort,

en est dmuni (anindriya).


leur destruction serait-elle cause par une cause

sena vinasvara). Comment


trangre ? (Voir
1.
ii.

trad. p. 232, et iv.

b).

entr dans les deux recueillements d'inconscience (ii. 42). La Vyftkhya cite le Ssstra ya ime svsaprasvdsh kim te kyasamnisritd vartanta iti vaktavyam j cittasamnisrit varfanta iti vaktavyam / naivakydcittasamnisrit vartanta iti vaktavyam j kyacittasamnirit vartanta iti vaktavyam / aha I kyacittasamnirit vartanta iti vaktavyam. Atthasftlin, p. 97 pana satta, jivitendriya. 2. Contre la premire dfinition on formule cette objection que Vsvasapravasa manque pendant les quatre premires priodes de la vie embryonnaire. Tuer un embryon ne serait donc pas chemin-de-l'acte. Houi-houi cite le Nanjio 1157 (cole MahTsasaka) qui fait du man%isyavigraha de Pfirajika iii. l'embryon jusqu'au 49"* jour (Voir Prfitimoksa des Sarvflstivfidins par Finot-Huber, J. As. 1913, ii. 477, et BhiksunTkarmavacana, p. 138). 3. kasya tujivitani yas tadabhvn mrtah. En effet, il n'y a pas d'tre vivant, prnin, dont on puisse dire qu'il est mort.
:
:

prno nma vyuh kyacittasamnirito vartate. Le prna dpend de la pense puisqu'il manque chez l'homme

4.

pudgalapratisedhaprakarane (Vyakhya).
;

Il

s'agit

de

la dernire partie

du Ko.4a (Le passage vis par Vasubandhu est traduit par Stcherbatski, The seul Iheory of the Buddhists, p. 853 trad. de Hiuan-tsang, xxx. 8 a). 5. Cit ad IL 45 a (trad. p. 215) et viii. 3 c.

Hiuan-tsang,
D'aprs les Nirgranthas
',

xvi, fol.

12 a-13

a.

155
sans
le savoir,

du meurtre,

mme commis
pour

sans

le

vouloir (ahuddhiprvt), rsulte,

l'agent,

le

pch

(adharma), comme, du contact avec

le feu, la brlure.

ce

compte

-,

on

est
le

coupable (ppaprasanga) quand on


vouloir la

voit,

quand on touche sans

femme
;

d'autrui

[13 a] celui qui

tond les Nirgranthas est coupable

le

matre des Nirgranthas est


;

coupable puisqu'il prche des austrits terribles

celui-l aussi est


le

coupable qui donne au Nirgrantha une nourriture qui provoque


cholra et la mort.

La mre

et

l'embryon qui sont, l'un pour


;

Tautre, cause de souffrance, sont coupables

coupable aussi l'homme


titre

qu'on tue, car


d'objet
fait
:

il

est li

l'action de meurtre

de matire ou
part, celui qui

et le feu
le

brle son point d'appui.

D'autre
le

commettre

meurtre par autrui n'est pas coupable, car on ne se


fait

brle pas

quand on

toucher

le

feu par autrui.

Puisque vous ne
bois et les autres

tenez pas compte de l'intention (hiiddhiviesa),

matriaux, quoique privs de conscience, sont coupables de meurtre


lorsqu'une maison s'croule et que des tres vivants prissent \ Si

vous voulez viter ces consquences, reconnaissez qu'un exemple


l'exemple du feu

lui seul,

non accompagn d'argument, ne peut

prouver votre thse.

73

c-d.

Le vol

prendre ce qui
;

n'est pas

donn (adattddna)
*

c'est s'approprier le bien d'autrui


1.

par force ou en secret.


1.

Milinda, pp. 84, 158


p. 414,),

Kalhavatthu, xx.

Sairakrtfinga,

ii.

6,

26 (Sacred
p. 2.

Books, 45,
n. 3.
2.

aussi

ii.

2 (cinq espces de meurtre).

Voir ci-dessus

nirgrantha
iti

= nagntaka.
nirgranthh
/

adharmah / yathgnisamtesm parastrldarsanasamsparsana esa prasangah / nirgranthasiroliincane va j kastatapodesane va nirgranthasstiih I tadviscikinarane ca dtur esa prasangah / mtrgarbhasthayos cnyonyaduhkhanimittatvt / vadhyasypi ca tatkriysamhandht / agnisvsrayadhavat /
abtiddhiprvcl api prntiptt kartur

sparsd dha

3.

Le tibtain ajoute

De mme

sont coupables les souffrances de la maladie

et les

herbes qui font mourir

(??

rnanis.

Lecture douteuse).

Manque dans les versions chinoises.


/

nadpa

la

gnod pa dan

si

ha na sman pa
byed

4. ma byin len pa gzhan gyi nor mthu dan hjab bus bdag tddnam parasvasvikaranam balacchalt //]

gir

= [adat-

Atthaslin, p. 97-98.

Mahvyutpatti, 281

28-33

adattasya pancamsak-

156

CHAPITRE
rserve
'

IV,

73 c-74
:

b.

La

ci -dessus

vaut toujours

condition

qu'il n'y ait

pas

d'erreur

S'approprier, par force ou en secret, ce qui est possd (svkrla)

par autrui, lorsqu'on ne confond pas avec une autre la personne


qu'on veut voler, qui on veut drober, voil ce qui constitue
[13 b]
Dpouiller un Stilpa, c'est prendre une chose qui n'a pas t donne
le vol.

par

le

Bouddha

car,

au moment du Nirvana, Bha gavt a accept,


-.

s'est

appropri (parlgrlilta) tous les dons faits aux Stnpas

D'aprs d'autres, c'est prendre une chose qui n'est pas donne par les
gardiens du Stupa.
^

Prendre un bien sans matre,


par
le

c'est

prendre ce qui n'est pas donn

matre du pays.
le bien, le

Prendre
c'est

vtement religieux,

etc.,

d'un religieux dfunt ^

prendre ce qui n'est pas donn par


l'acte ecclsiastique

le

Samgha

de la paroisse \
;

au cas o
le

a t accompli (krte karmani)

dans

cas contraire, c'est prendre ce qui n'est pas donn par tous les

disciples

du Bouddha.

manusyagatiparigrhitasya Hatsamjnay haranahraBhiksunkarinav&cana, p. 137-8 .... antatah phalatusam api parakyam ndCLtavyam kahpunar vdah pancamsikam uttarapandeh steyacittena
iiayor dtenpi.

camsikam va
1.
:

....

Vyakhya nnyatra satnjnvihhramt j yadi devadattadravyam haramlti yajnadattadravyam harati ndattdnamify abhipryah. Corriger: Comparer p. 76, 12, anyatrjnnt ; p. 65, anyatra satnjnvibhramdt. 4, anyatra glnyt ; Pfir. 4, anyatrbhimnt, etc. 2. parinirvnakle parigrliltam iti dtrjanapiinynugrahrtham / ananugrahe hi stpe dnam aphalam syt parigrkakbhdvt.

1.

1.

(Voir
3.

iv.

121,

une doctrine

diffrente).
;

Opinion des deuximes matres de

l'admettre, les gardiens

la VibhSsa 113, 7 opinion errone, car, du StQpa ne voleraient pas en prenant ce qui appartient

au SlQpa.
4.
teti,

Vyakhya parivartakam mrtasya bhikso ctvardidravyam (parivat:

changer

',

Culla,

vi.

19
;

?).

D'aprs

le tibtain,

prendre

le

bien d'un mort


le

(si

bahi nor phrogs na)


*

d'aprs Paraniartha et Hiuan-tsang, prendre


17).

bien

d'un hoi-tchon, c'est--dire d'un pratikr an ta (Muhflvyutpatti, 130,


5.
:

Le Samgha de la paroisse ', Hiuan-tsang kii nei sng (limite-intrieurnnavasagatah ; Tibtain Paramartha tch pou kng tchu jen antahslniparypannCih. htshams kyi nan du gtogs i)a rnams
clerg)
;
:

Hman-tsang,

xvi, fol.

13

a-

14

a.

157

74

a-b.

L'amour
laquelle

illicite,

quadruple, c'est le commerce avec une


'

femme avec
1.

on ne peut avoir commerce.


interdite, la

Commerce avec une femme


fille,

femme

d'autrui (para;

parigrlilta), mre,

parente paternelle ou maternelle


interdit
' ;

2.

com-

merce avec sa propre femme par un chemin


lieu
4.

3.
''

dans un
;

non convenable

lieu

dcouvert,

caiti/a,
:

Aranya

[14 aj
est

un moment non convenable (akla)

lorsque la

femme

enceinte, lorsqu'elle nourrit \ lorsqu'elle a pris

un vu (myamaun vu du consen-

vati) \

Quelques-uns disent
la rserve relative
,

lorsqu'elle a pris

tement de son mari.

Gomme

au meurtre

la condition de

ne pas

faire erreur

s'tend l'amour

illicite, il

n'y a pas chemin de l'acte

1.

bgrod min hgro ba hdod pa yis

gamanam kmamithycras
AtthaslinT, p. 98.

Kiokuga,

il

y a six
2.

[agamy/ log par gyem pa rnam pa bzhi caturvidhah /] D'aprs la source de Grand Vhicule (YogacSra) cite par prohibitions 1. avisaya, agamya, mles, femme telle que
:

seul le yonUnrga ; 3. asamaya \ovs>(\\\e la femme a ses rgles (hoi-liia), est enceinte, nourrit, a pris l'Upavasa, est malade pas 4. asfhna ; 5. sans mesure , mnam atikramya gaccJiati ; 6. ayoga conformment aux rgles du monde .

mre, etc.;

amrga, ananga :

2.

Hiuan-tsang ajoute

....

et le reste
251

jusque protge par


etc.).

le roi

Voir

la

liste

classique Mahvyutpatti, 281,


:

(pitrraksit,

3. Mahvyutpatti, 281, 2G-27 pravistah sparasvkrtaii j prasrvakarane prasrvakaranasya imikhe varcomrge va. Comparer SiksSsamuccaya, 9. 3 p. 7G evam svastrsv apy ayonmrgena gacchatah Suttavibbanga,
:
;

i.

angajtena vaccamaggam .... passvamaggam .... 7nukham.... L'diteur japonais 4. snai ba ham mchod rten nam gtsug lag khan nam. glose par a-lin-jo (aranya) le k'iwig (loign, etc.) de Hiuan-tsang Paramr-

tha

lieu

l'on pratique le

brahmacarya

Lieu dcouvert

',

sans doute

abhyavaksa. 5. garbhinlgamane garbhoparodhaJi / pyayantl (? voir iv. 103) stanyopabhogvasthaputrik strl j abrahmacarye hi tasyli stanyatn ksyate / blakasya va pustaye tatstanyam na bhavati (Vyakhya). 6. posadhika, iv. 23 srakkh d'Atthaslin, p. 98. Hiuan-tsang Lorsque la femme a pris Viipavsa . Sikssamuccaya, p. 76 evam iipav-

sasthsu
p. 11,

....

Voir

le

commentaire sanscrit de l'Uvasagadasao,

d.

Hoernle,

sur les lois du mariage chez les Jainas.

158

CHAPITRE
la

IV,

74.

quand on a commerce avec


femme.

femme

d'autrui en la prenant pour sa

Les avis divergent sur un autre point,

s'il

y a chemin de
tel

l'acte

quand on prend
Pour
les

la

femme

d'un

tel

pour la femme de

autre.

uns, oui, car c'est la


;

prparatif de l'acte

c'est aussi

femme d'autrui qui a t l'objet du de la femme d'autrui que l'on jouit.


le

Pour

les autres,
:

non,

comme dans

cas du meurtre avec erreur de


l'objet de la jouissance.
les
^

personne

l'objet

du prparatif n'est pas


le

regard de qui
?

commerce avec

BhikunTs

est-il

amour
le

illicite

l'gard du matre

du pays, qui n'est pas dispos


si

tolrer \

Quant au matre du pays lui-mme,


lui est interdite,

son pouse, lorsqu'elle


les religieuses.

a pris un vu,

plus forte raison


fille

Le commerce avec une jeune

est illicite [14 b]

l'gard de

l'homme qui
du
roi

elle est fiance, et, si elle n'est


;

pas fiance, l'gard

de son gardien (raksitar)

si elle

n'a pas d'auti'e gardien, l'gard


s)

(antato rjnah). (Vibhsa, 113,


c-d.

74

Le mensonge,

c'est le discours tenu,

avec une pense


^

diff-

rente,
1.

une personne qui en comprend


est

le sens.

Le mensonge

un discours tenu, avec une pense diffrente


le sens.

du sens exprim (arthavda), une personne qui comprend

Quand
2.

l'interlocuteur

ne comprend pas, semblable discours

est

parole fiivole (samhliinnapralpa).

Le discours

(ii.

47 a-b)

est parfois constitu par de


l'acte ?

nombreuses

syllabes. Laquelle sera

chemin de

Laquelle sera mensonge ?

La
1.

dernire, qui est


:

mjnapti

et qui est

accompagne d'avijfiapti
mme
si

Hiuan*tsang ajoute
le

Et inversement. De

on se trompe sur

le

chemin,
2.

temps,

etc.

anyusmin vashini prayogo


tasya hi tan
bnlzun

'bhipreto 'nyac ca vastti

parihhuktam

(Vyfi-

khyfi).
3.
4.

na marsanlyam.
:

es gzhan bsgyur bal.ii // Ihsig don miion par go baho. La version de Paramfirllm aulre-pense-dit ce discom-s -comprenant-le-sens vol bien d'autrui.... ) (est) mensonge (alors que dans la kfirika sur le vol on a montre que l'original termine notre krik par le mol mensonge . Hestillisig lidu
:

tuons

anyasamjoditam vakyam

arthabhijfie

mrsvacah

//

Hiiian-tsang, xvi,

fol.

14 a-15

a.

159
le sens.

ou bien

la syllabe

dont l'audition
le

fait

comprendre

Les

sylla-

bes qui prcdent sont


3.

prparatif du mensonge.

Comment

faut-il interprter l'expression


le

arthbhijna,

une

personne qui comprend


cuteur comprend
le

sens

? S'agit-il du

moment o

l'interlo-

sens ? S'agit-il d'un interlocuteur capable de

comprendre

le

sens (abhijntum samartha} ?


a],

Dans

la

premire a lieu

bypotbse [15

vous admettez que

le
;

chemin de

l'acte

lorsque Tinterlocuteur a compris le sens


l'acte est

il

s'ensuit que le

chemin de

seulement avijhapti

car l'interlocuteur comprend le sens

par la connaissance mentale (manovljnna), laquelle est conscutive

la connaissance auditive (rotravijnna)


vocal, prit en

et la

vijnapti, ou acte
Il

mme

temps que

la

connaissance auditive ^

n'y a
la

donc plus vijnapti

au moment o
difficult

l'interlocuteur

comprend. Dans

seconde hypothse, cette


il

ne se prsente pas. Mais que fautle

pour que l'interlocuteur


Est

soit

capable de comprendre
le

sens

'

capable de comprendre
et

sens

l'homme qui connat

la

langue
Il

en qui est ne la connaissance auditive.

faut interprter le texte de manire ce qu'il ne prte pas la

critique.

Le Stra ^ enseigne
1.

qu'il

y a seize

conduites vocales
'

(vyavale

Hiiian-tsang
'

quelle poque se rapporte l'expression


: '

qui comprend
le

sens

(artlihhijna) ? Faut-il entendre


qu'il

qui comprend actuellement [par


: '

ma-

novijiina] ce

a entendu

'

? Faut-il entendre

qui est capable de compren'

dre actuellement ce qu'il entend actuellement [par

le

rotravijnna] ?
la

Quelles
le

consquences dcoulent des deux solutions ?


sens du discours tant l'objet de
la

Dans

premire hypothse,

connaissance mentale et la vijnapti vocale

[qui trompe l'auditeur] disparaissant en

mme temps que

la

connaissance auditive

[qui est trompe], l'acte sera seulement avijapti [puisque la connaissance


tale n'est

mendeuxime hypothse, cette objection ne porte pas, mais comment celui qui ne saisit pas le sens, comment, au moment o il entend, peut-il tre dit capable de comprendre ? La bonne explication est que l'on appelle capable de comprendre celui en qui, les causes de confusion manquant, la connaissance auditive est dj ne. Il faut expliquer le texte de manire
pas encore ne]. Dans
la
'

'

'

',

qu'il
2.

ne prte pas l'objection.

Dgha,

Vibhs, 171, 7 Anguttara, ii. 246, iv. 307 Majjhima, iii. 29 cattro anarlyavolir: aditthe ditthavdit, assiite stUavdit, amute mntavdit, avinte vinitacdit. Apure pi cattro anariyaDrgha,
iii.

8, 13
:

232

160

CHAPITRE
:

IV,

75.

hra), huit mauvaises (anrya)

n'ayant pas vu, dire qu'on a vu


;

n'ayant pas ou, connu, senti, dire qu'on a ou, connu, senti
vu, dire qu'on n'a pas vu
ou,
;

ayant

ayant

ou,

connu, senti, dire qu'on n'a pas


:

connu, senti

huit bonnes (rya)

n'ayant pas vu, dire qu'on

n'a pas vu

On demande quel
connu

est le sens de ces termes

vu (drsta), ou (sruta),

(vijfita), senti

(mata).
par la connaissance visuelle, par la connaistrois connaissances,

75. Ce qui

est peru

sance auditive, par la connaissance mentale, par


s'appelle,

dans
est

l'ordre, vu, ou,

connu, senti

*.

[15 b]
le

Ce qui
vu,
et

peru par la connaissance visuelle reoit

nom

de

ce qui est peru par les connaissances de l'odorat, du got


tact, reoit le

du

nom

de senti (mata).

Comment

justifier cette dernire interprtation ? les odeurs, les

Les Vaibhasikas disent que

saveurs

et les tangibles,
;

tant non-dfinis (avydkrla)^ sont

comme

morts (mrtakalpa)

c'est

pourquoi

ils

sont mata.

Le Sautrantika.
l'expression

D'aprs
il

quelle autorit soutenez-vous que, par

mata,

faut entendre ce qui est flair, got, touch ?

Le Vaibhasika. Le Sotra
volir
:

D'aprs

le Stra,

en vertu du raisonnement.
les visibles

dit

Qu'en penses-tu, MalakTmatar ^


i.

que tu
dans

ditthe aditlhavdU.... (Comparer Majjhima,

135, cit Verbatim

Vijfifinakfiya, fol. 12 b, qui,

comme
la

les

sources plies, place vijnta aprs mata.

Le Boutldhisme emploie
peine l'interprter.
thos
1.

phrasologie traditionnelle (Upanishads) et a grand

raig ma yid kyi rnam ses daii / gsum gyis nams su myoi gan de / mthon rnam par ses pa daii / rtogs pa yin te rim bzliin bsad / [caksuhsrotramanovijnnnubhtam trihhi ca yat tad drstarutavijntamatam uktam
/

yathdkramam
2.
iv,

7j

La Vyftkhyfi

(lecture

peu

claire)

donne Mlliakmatar.

Dans

Samyulta,
:

72, l'auditeur

de ce discours est Malukyaputta (Malunky).


:

Tibtain

tnchod

byed kyi ma can Paranifirtha m-l-ki-mdn, ce qui suppose une lecture MalakTmatar P'ou-kouang mn-mu (mn : cheveux longs, etc.) qui donne tnZ-mre, ou alakl-iure, ou encore Mallikamalar (Mahavyutpatti 240, 14: mU' hoa mallik) ; les diverses Mallika^, Kern, Mauial, p. 40. IIiuan-U:iang qui a pour mre la Grande (mahallakimtar ?) . ta-mu Pour mchod;

Hiuan-tsang,

xvi, fol.

15 a-16

a.

161

n'a pas vus, que tu n'a pas vus auparavant, que tu ne vois pas, dont
tu

ne penses pas

Puiss-je les voir

as-tu,

en raison d'eux,
affection

souhait (clianda), concupiscence (rga), dsir (kma),

(preman), attachement (laya), w^^iii (niknti), recherche (adhye-

san) ?
les

'

Non,

Seigneur.

Les sons que tu n'as pas ous

dharmas
au

que tu n'as pas connus par Tesprit, as-tu, en raison

d'eux, souhait, recherche ?


niatar,

Non, Seigneur.

Pour

toi,
:

MalakT-

sujet de ce qui est vu, tu penseras seulement

c'est

vu

[IG

a],

au sujet de ce qui
:

est ou, connu, senti (mate), tu penseras

seulement

c'est ou,

connu, senti

(matamtram
le

bhavisyati)

Les termes vu,

ou,

connu, se rapportent certainement aux visihles,


:

aux sons

et

aux dharmas

donc

terme

mata

se rapporte

aux

odeurs, aux saveurs et aux tangibles (Opinion de Buddhaghosa,

Visuddhimagga, 451).

S'il

en

tait

autrement, l'exprience (vyava-

lira) relative aux odeurs, aux saveurs et aux tangibles ne serait

pas vise dans cet enseignement de Bhagavat.

Le Sautrntika.
pas dfinir

Ce Stra n'a pas

le

sens que vous croyez

et

ne

confirme pas votre interprtation du terme mata. Bhagavat ne vise


les

caractres des quatre expriences (vyavahra),

avoir vu, avoir ou, avoir connu, avoir mata.

Sa pense

est

videm-

ment

Dans la quadruple exprience, voir,

etc.,

dont chaque espce

porte sur un sextuple objet, visibles, sons, odeurs, saveurs, tangibles

(de

mahil hyed-kyi-ma-can, comparer Sarad Chaiidra Das nichod Idan ma maha, fte religieuse := mchod) [J'utilise pour cette note des remarques de
:

S. Lvi et J. Przyluski].

Majjhima,

i.

135,

iii.

261,

dittham siitam mutant vinntam ajoute pattam

pariyesitam anuvicaritam

manas (na updiyissmi na ca me tannissitam


trois

vinnnam
1.

bhavissati).
iv.

Samyutta,

72,
ti

donne seulement
j

synonymes aWii
:

te

tattha chando
(iv.

va rgo va peman

no lietam bhante.

Les stances qui suivent


; :

72-76),

qui sont Theragth, 794, sont cites par Samghabhadra.

comparer Hiuan-tsang donne en transcription laya et niknti (ni-yen-ti) Dhammapada, 411 et Comm. de 348 (Fausboll, p. 413) layam nikantim ajjhesanam parivuithnam gliam parmsam tanham. Tibtain hdiin pa, hdod-chags, hdod pa, dgali ha, cliags pa, hchnms pa, Ihag par cJiags pa. Hiuan-tsang a trsn au lieu de rga (hdod cJiags) et place trsn aprs preman.
:

11

162
et

CHAPITRE

IV, 75.

dliarmas, tu constateras seulement que cette exprience a


vois, etc.,

lieu,

que tu

sans attribuer (adhyropa)

l'objet les caractris-

tiques (nimitta) de dsagrable ou d'agrable

Que

faut-il

donc entendre par vu,

ou,

mata, connu ?

D'aprs les Sautrantikas, ce qui est peru immdiatement par les


cinq organes matriels, est vu, drsta
est transmise
;

ce dont la connaissance nous


;

(gamita) par

autrui, est ou, ruta

ce qui est admis

en raison d'un raisonnement correct (ynktyanumna), est mata,

admis ce qui
;

est peru par l'organe

mental est connu, vijnta [16


visibles,

b].

'

Donc cinq
tangibles

catgories d'objets

sons,
;

odeurs,

saveurs,

sont vues, dharmas pas


n'est

oues, admises,

connues
est
la

la sixime catgorie

vue
est

telle

quadruple exprience

qu'envisage

le Sotra.

Il

donc faux que, dans l'hypotbse o

mata ne
relative

dsignerait pas les odeurs, saveurs et tangibles, l'exprience


le

ces objets serait omise dans

Stra

l'argument du Vai-

bhasika ne porte pas.


D'aprs les anciens matres (prvcrya)
^, il

faut entendre par vu


;

(drsta) ce qui est peru par l'organe de la vue

par ou

(srtita), ce

qui est peru par l'organe de l'oue et ce qu'on apprend d'autrui

(parata cgamitam) ; par admis (mata), ce qui est personnellement


accept, approuv
^
;

par connu (vijnta), ce que l'on sent en

soi-

mme (pratytmam

pratisamvedita, sensation agrable,


le

etc.),

ce

dont on a l'intuition dans


Celui qui
1.
*,

recueillement (adhigata).
et

au moyen du corps,

non par

la parole, fait

com-

gamitatft tac chrutam


/

yat paicabhir indriyaih pratyaksl[krtam] tad drstam [ yat parafa yuktyamimCmato rucitam ( abhipretam) / yad

tan matant [yan manahpratyakslbhtam (?) hhvandhUjatam pratytmavedyatft tad vijntam] (yid kyi miion siim du gyur La bsgoms nas riogs pa so so ran gis rigs par bya La gaii y in pa de ni inaui par es so), Paramfiiiha et Hiuan-tsang ont seulement yan manahpratyakslbhtam tad vijntam. 2. Les Yogaefiras (Vyfikhytt) yat pratyakslkrtant caksusa .... 3. bdag nid kyis bsam pa gart yin pa. Vyfikhya pratytmam pratisani:

veditatfi

sukhdy asamhitena cittena


/

adhigatam samahitena

lauki-

kenaiva na lokottarena

laukikavyavahradhikrt. - Ce qui est connu dans le recueillement pur ou supramondain nVsl pus vijnta, mais jnta. 4. Le problme discut dans ce paragraphe est trait par Buddhaghosa

Hiuan-tsang,

xvi, fol.

16 a- 17

a.

163
le

prendre ce qui n'est pas dans sa pense \ commet-il


Oui. Le Sstra dit en effet
:

mensonge ?
le

Peut-on tre touch par

pch de

meurtre, sans agir, sans attaquer


Oui,

(parkram) corporellement ?
Peut-on tre touch par
le

quand on

agit

vocalement ^

pch

de mensonge sans agir vocalement?

Oui, quand on

agit corporellele

ment.

Peut-on

tre touch par le

pch de meurtre, par

pch de
;

mensonge, sans agir


exemple

ni corporellement ni

vocalement ?

Oui

par

les Rsis, coupables de meurtre par la colre ^ le Bhiksu,


le silence

coupable de mensonge par


sion

'\

dans la crmonie de

la confes-

(Vibhasa, 118,

19)

Mais, dirons-nous,

comment admettre que


l'acte
le

les

Rsis ou

le

Bhiksu

accomphssent
avljnapti ? Ni

le

chemin de
Rsis ni
il

qui doit tre la fois vijnapti et

les

Bhiksu n'agissent corporellement ou


;

vocalement

donc

n'y a pas vijnapti

et

Vavijnapti du domaine
2
a).

du

Kama

ne peut exister l o
difficult

manque
'

la vijnapti [17 a] (iv.

C'est une
le

rsoudre.

Plusieurs points de contact entre les deux exposs moine ment par le silence, le possesseur du pouvoir magique tue un embryon donc on peut commettre par l'esprit les pchs de la voix et du corps. 1. yak kyencinyathrthafft gamayati. 2. vc pardkratneta vc param mrayet : quand on tue par la parole. 3. C'est l'histoire des forets Dandaka, etc. vides d'tres vivants par la colre des Rsis (Majjhima, i. 378 Uplistra, cit dans Yasubhandhu, Vimsaka, 20, Muson, 1912, i.), qui tablit la gravit de l'acte mental (voir ci-dessous iv. 105 a-b), Pour la mention de cet pisode dans le SaddharmasmytyupaMilinda, p. 130. sthna et les rfrences au Rmayana, voir S. Lvi, Pour l'histoire du Ramyana,
(Atthasalin, pp. 90-95).
:

J.

As. 1918,

i.

97.

Dans

le

Ramyana,

le

Dandaka
que

est dpeupl par la maldiction

du Rsi Usanas. Vasubandhu, Virasaka, 20


pas (voir ci-dessous
4. n. 5).
:

c-d, tablit

les tres

dmoniaques n'intervinrent

Le Bhasya porte posadhanidaranam ctra. En effet, dans le Bhiksu Etes-vous purs ? (kaccit [s]tha le Vinayadhara demande (anusrv) parisiiddliah). Si un Bhiksu ne dclare pas le pch qui existe (satm pattim) et, par le silence mme, acquiesce (adhivsayati), il ment (mrsvdd bhavet). Comparer le Pratimoksa dit par L. Finot, J. As. 1913, p. 476, 488 (avec la lecture tatryitsmatah prcchmi kaccit sthtra parisuddhh). Mahavagga,
posadha,
: :

ii.

3.
5.

une

difficult

Le Bhasya porte kartavyo 'ira yatnali rsoudre par les Vaibhasikas .


:

= kartavyah samdhih. C'est

Samghabhadra explique

En

fait

(arthatas), les Rsis commandent (jnpi-

164

CHAPITRE
a-b.

IV,

76-77

c.

76

La

parole maligne ou mdisance, c'est


'

le

discours d'une

personne de pense souille en vue de diviser.

Le discours qu'on
les autres,

tient,

avec une pense souille, en vue de diviser


l'inimiti, c'est parole
:

en vue de crer

maligne.
l'interlocuteur
,

Les restrictions formules ci-dessus


prend, quand
il

quand

comici.

n'y a pas confusion de personnes

s'appliquent

76

c.

La

parole injurieuse, c'est le discours outrageant.

Le discours prononc avec une pense


par celui qui
ort l'adresse,
^

souille, outrageant,

compris

adress celui qui on veut l'adresser,

c'est la parole injurieuse.

dmoniaques (amanusya), connaissant (avetya) (sattvaparltygapravrtta ppsaya), dvous comme ils sont aux Rsis, agissent corporellement contre les tres en raison de cette action corporelle, il y a chemin de l'acte en ce qui concerne les Rsis. Comment les Rsis manifestent-ils (vijnapU) leur En raison de la colre, il y a certainement chez eux modification du intention ? corps et de la voix s'ils maudissent, il y a certainement mouvement (cest) du corps et de la voix. D'autres matres disent que toute avijnapti de la sphre du Kfima ne dpend pas d'une vijnapti. Par exemple, les Cinq (paiicaka) en obtenant un fruit obtiennent du mme coup la discipline de Prfitimoksa (ci-dessus de mme une mauvaise avijnapti peut natre sans qu'il y ait vijnapti. p. 60) Dira-t-on que les Cinq avaient fait vijnapti auparavant ? Il en sera de mme dans d'autres cas. Voil pour le cas des Rsis. Quant au mensonge la crmonie de la confession (posadhamrsvda), le fait que le moine coupable (apariuddha) entre dans le Samgha, s'assied, s'y tient (svam rypatham kalpayati) et tout ce qu'il peut dire, voil pour lui une vijiajiti antrieure [au moment o Samghabhadra, xxiii, 5, 7 a). il acquiesce par le silence]. (Vyakhyfi 1. phra ma plia roi dbye bahi phyir / non mous can kyi sems kyi thsig
taras)
le

meurtre.

Des

tres

leur intention pcheresse de destruction des tres vivants

paiunyam [parabhedya
2. 3.

thsig rtsub po ni

bhsanam] AtthaslinT, mi snan pa = prusyam [apriyam]


klisfacittasya
;

p. 99.

Dans AtthaslinT

p. 100, la

tion, la parole

par laquelle on

lait

phariis vc est rinq>rcation ou la maldicviolence soi ou autrui (yya attnam

pi param pi pharusam karoti).


dictions contraires la pense
:

Buddhaghosa donne des exemples de malmre souhaite qu'un buffle furieux crase l'enfant qui va dans le bois malgr sa dfense, ou que la maison s'croule sur ses enfants le matre d'cole souhaite la mort de ses coHers paresseux. Dans ces cas, il n'y a pas pharus vc. Au contraire, il y a phattis vc quand on dit Dormezbien , la personne qu'on veut assassiner.
la
; :

Hluan-tsang,

xvi, fol.

17 a-b.
*

165

76

c-d.

Tout discours
porte

souill est parole inconsidre.

La stance
discours.

tout ce qui est souill

mais

il

s'agit ici

du

Tout discours
pralpin)

souill est parole inconsidre

(samhhinnapralpa)
'

celui qui le profre est


;

donc

'

discoureur inconsidr

(samhhinnalieu de

la stance porte

donc hhinnapralpit au

sam-

hhinnapra lapa.

77

a.

D'aprs d'autres docteurs, la parole inconsidre est


^

le dis-

cours souill qui diffre des autres.

Le mensonge,
on rserve
n'est ni
le

la

mdisance
de
ni
*

et l'injure

sont des discours souills


'

nom

parole inconsidre

au discours

souill qui

mensonge,

mdisance, ni injure. [17 b]


la vantardise, le chant, la
^

77

b-c.

Par exemple,

dclamation

par

exemple

les

mauvais

traits.

Par exemple un moine se vante pour obtenir des aumnes,


par frivolit
',

etc.

*
;

d'aucuns chantent

au cours des reprsentations ou


le public,

danses, les danseurs, pour rjouir


inconsidrs
^
;

tiennent des discours


les

adoptant

les doctrines des

mauvaises philosophies,

hrtiques lisent les mauvais traits. Ajoutez les lamentations (pari-

anibaddhapralpa. // Manu, xii. 7 gzhan ni de las gzhan non mons [tato 'nyat klistam anye tu] 3. lapangtantyavat / ktisstravat 4. Ce moine est mithycvjlvin (iv. 86 b). Le mithyjva est dfini par la Vykhya kuhan lapan naimittikat naispesikat. VVogihara (Bodhisaitvabhmi, Leipsick, 1908) a une note tendue sur ces quatre termes et cite la dfinition que la VySkhya donne ici du terme apan : lapanftt karotti lbhayasaskmatay sevhhidyotikcim vcam niscdrayatUy arthah il conviendrait donc de traduire lapan par flatterie comme Paramfirtha et Hiuantsang (gning). Mais les sources cites par Wogihara (Nanjio 1296, etc.) montrent qu'il s'agit du moine qui vante son propre mrite. Voir Majjliima, iii. 75 Vibhanga, 352, comment dans Visuddhimagga, p. 22 et suiv., JPTS. 1891, 79. 5. chags-pa laiilya (Siksasamuccaya, p. 69). 6. zlos gar mkhan rnams zlos gar gyi tshe gzhan dag mgu bar bya bahi phyir hkbyal ba.
1.

sarvam klistam bhinnapralpitci

2.

'

',

166

CHAPITRE

IV,

77 b-78

c.

deva), les bavardages

(samganik)

\ tout propos tenu avec

une
et

pense souille
l'injure.

et qui diffre

du mensonge, de la mdisance

de

Mais

n'est-il

pas vrai que, Tpoque d'un

roi

Cakravartin,

il

des chants sans qu'il y ait parole inconsidre ?


les

y a

cette poque,

chants sont inspirs par


la sensualit ^

l'esprit

de dtachement (naiskramya),

non par

cette

Ou,

d'aprs

une autre opinion,

il

a,

poque, parole inconsidre, puisqu'on parle d'vha, de


etc.
^
;

vivha,

mais

cette parole inconsidre

ne constitue pas

le

chemin de

l'acte

de ce nom.

77

c-d.

La

convoitise est le dsir de s'approprier, par des voies

illgitimes, le

bien d'autrui \
le

Dsirer s'approprier

bien d'autrui d'une manire illgitime (visa-

mena), d'une manire

injuste

(anydyena)

ment
de l'acte

% par force
!

ou clandestinec'est le

Puisse

le

bien d'autrui tre moi

chemin

nomm

convoitise,

abhidhy.
il

D'aprs une autre opinion, par abhidhy


soif

faut entendre toute

(Irm) du domaine du Kamadhatu, car

le

Stra des cinq niva-

1.
iii.

Mahavaslu,

ii.

355

ye samganikrnth
p. 100,

....

Divya, 464,

19

Majjhima,

donne comme exemple de samphappalpa la rcitation du combat des BhSratas et de l'enlvement de Sltfi. 2. Tibtain ... sont munis de naiskramya, ne sont pas munis de stegs snags Hiuan-tsang ... viennent de naiskramya, sont capables de produire naiskramya, ne prparent pas pense souille . Param&rtha traduit l'original de stegs snags par mithy-rasa. nekkhamma s'oppose samganik,
110; Childers,
p. 447.
: ; :

L'Atthasalin,

Majjhima,
3.

iii.

110.

Voir

ii,

p. 106.
:

vhavivhdyabhildpasadbhvt Vykhya vha driky ddraka^ya drikgrhgamanam ; on bien, ; viv>}ia --= praveanaka (union libre ?), vivha parinayana. Comparer Childers, vahana, vivhana, Senart, Piyadasi, i. 203 (mariage d'un fils ou d'une fille) Mahftvyutpatti, 223, 246-7 (vha = bag ma gton ba donner une fille en mariage vivha bag ma len pa prendre femme)

drakagrhgamanam d'aprs d'autres, vha

281, 261-262 (o les sens sont intervertis).


4.

5.
6.

abhidhy y parasve visam sprh // visamennyyenety uddeanirdearpau paryyau. Attliasalini, p. 101. aho vata idam mam 'ass H.

Hiumi-tsang,

xvi, fol. 17

b-18

a.

167
:

ranas

an sujet du kmacchanda, s'exprime ainsi


...

Ayant abanUttarakurus
et

donn abhidhy

Mais, disent d'autres matres, les Cakravartins

et les

ne sont pas coupables du chemin de


ils

l'acte

d'ahhidhy,

cependant

ne sont pas dlivrs de la soif du domaine du Kamadhatu. Admet-

tons que toute soif du domaine du


toute
les

Kamadhatu
l'acte.

est

abhidhy

mais

abhidhy
(iv.

n'est pas
l'acte
b).

chemin de
les

Ne

sont comprises parmi

chemins de
66

que

plus notables parmi les mauvaises

pratiques

78

a.

La mchancet

est la

haine des tres vivants ^

C'est la haine des tres vivants, par laquelle on souhaite nuire


la

personne d'autrui.

78
1.

b-c.

La vue

fausse est l'opinion qu'il n'y a ni bien ni mal. [18 b]

C'est la traduction de Parainfirtha et Hiuan-tsang.

Le texte porte

niva'

rannm adhikrena katnacchandam

adhikrtya..,
/

so 'bhidhyfft loke prahya vigatbhidhyena cetas bahulam viharati vypddam stynamiddham auddhatyakaiikrtyam vicikitsm loke prahya

paca nlvaraxini prahya...

tirnaknkso bhavati tirnavicikitso 'kathamkathl kiisalesu dharmesu j sa Samyukta, 29, 3, Dgha, iii. 49, Majjhima, iii. 3, Angutiara, ii. 210, cit et comment Viblianga, p. 252, o abhidhy est expliqu Il rsulte de ce texte que le terme abhidhy est synonyme rga srga, etc. de kmacchanda, le premier nlvarana. Sur les nlvaranas, Kosa, v. 59. 2. gnod sems sems can la sdan pa [vypdah saftvesu dvesah] Manu, xii. 5 manasnistacintanam. 3. Atthasalini, p. 101. paravinsya manopadosalakkhano.... aho vatyam ticchijjeyya vinasseyy ti. 4. nstidrsUh subhsiibhe / mithydrstih A la nstidrsti s'oppose Vatthikavda (Majjhima, i. 515). Comme le montre le Bhfisya, il faut entendre par mithydrsti la diffhivipatti de Puggalapaiiiiatti, la doctrine condamne dans le Stra comme tant celle d'Ajita Kesakambali (Dlgha, i. 55, Majjhima, i. 515, Samyukta, 16, 1, Jnnaprasthfina, 20, 5, Vibhasa, 98, l, trait du Pudgala, trad. Hiuan-tsang, xxx.)
:

On
Sur

a vu,

iv.

66

a,

pourquoi cette erreur est akiisala.

la mithydr.sfi, la

micchditthi niyat et
xiv.
8-9,
oi

les drstis

en gnral,
cite

iv.

10

(ci-dessus p. 36), 79 c,

80

d, v. 7.

Sources plies, KathSvatthu,

dont

le

commentaire

notamment
le

Majjhima,

i.

388, Samyutta,

iv.

307,

par micchditthi est dsign

lavra-

168

CHAPITRE
il

IV, 78.

Comme
d'oblation,

est dit

dans

le

Stra

11

n'y a pas de don, de sacrifice,


il

de bonne action, de mauvaise action


le

n'y a pas

d'Arhat dans

monde

le

La vue

fausse

comme

le

montre ce
'

Stra, consiste dans la ngation de l'acte, du fruit, des ryas.

La

karika indique seulement

commencement.

Telle est la dfinition des dix mauvais chemins de l'acte [xvii].

Quel

est le sens de cette expression chemin-de-l'acte

(kannapatha)?
-.

78
La
l'acte
1 b).

c-d.

Trois sont chemin

sept sont, en outre, acte

convoitise, la mchancet, la

vue fausse sont des chemins de

des
En

chemins de cet acte qu'on

nomme

volition (cetany iv.

effet,

la volition qui se les associe

(tatsamprayogim) se

meut par

leur

mouvement

\ en ceci que, par leur force, elle veut

taparmarsa

(Kosa,

v. 7)

puni par l'enfer ou une naissance animale. (De


le

mme
les

Theragatha, 1091, Commentaire, sur


acteurs renaissent au
ciel).

destin de l'homme qui croit que


p. 358,

Mais AtthasSlinT,
et,

distingue la micchdifthi

niyat

(=

nstidrsih uhhsubhe de l'Abhidharma) des autres micclidifthis

(voir ci-dessous note

ad

iv. 96),

p.

101, enseigne

que

c'est

seulement par la

ngation de
hoti

l'acte,

etc.

qu'est ralis le

kammapatha
:

de micchditfhi, non

pas par les autres vues inexactes. (L'Expositor traduit

kammapathahhedo
is

na annaditthlhi
:

the distinctive stage of the course of action

reached

by the views

there

is

no resuit

bheda
1.

doit s'entendre

and not by other views kammapatharalisation du chemin-de-l'acte , comme vacibheda


....
;

parole).
(? kramena) karmaphalrypavdik. gsum lam bdun ni las kyan yin / On peut tatra pathah karmpi saptakam

sa kalpena
hdi la
/
/

2.

restituer

trayam

Vibhasa, 113,

21.

Pourquoi ne pas considrer

la volition,

cetan,

chemin-de-racte ?

La cetan est acte. Ce qu'on


De mme on
Le

comme un
roi,

appelle chemin-de-l'acte, c'est

ce par o va la cetan

appelle chemin-du-roi ce par o va le

mais

le roi n'est

pas chemin-du-roi

peut servir de chemin la cetan et chemin-de-racte. Mais au cas o on fait commettre le meurtre par autrui, beaucoup de temps peut se passer entre l'ordre du meurtre et le meurtre la cetan du meurtre a disparu, comment peut-on dire que le dharma (l'acte de meurtre) est le chemin de la cetan ? Disons donc que le dharma qui peut coexister avec la cetan est chemin-de-l'acte. Or deux cetans ne coexistent pas. 3. testft vhena vahati tesm gaty gacchati.
:

dharma qui sera donc nomm

coexiste avec la cetan

Hiuan-tsangj
(abhisamskaroti
leur alle.

xvi, fol.

18 b-xvii,

fol. 1 b.

169
:

= cetayafe)

en conformit avec

elles

elle

va par

Le meurtre

et les six autres

pchs sont acte, car


;

ils

sont, de leur

nature, actes du corps et de la voix


cet acte qu'on

et ils sont aussi des

chemins de

nomme

volition, car la volition qui leur


iv.

donne

naisfin et

sance (tatsamiitihcmacetanyh,

10) a dans ces pchs sa

sa raison d'tre (tn adhisthya pravrtteli).


L'expression chemin-de-l'acte signifie donc simplement chemin de
l'acte lorsqu'on l'applique

la convoitise,

etc.

elle signifie acte et

chemin de
meurtre,

l'acte

(karma karmapatha
compos

ca) quand on l'applique au

etc.

Pareil

est justifi par la rgle


les
i.

asarpnm

apy ekasesah.
un
seul est
Il

Mme quand

termes du compos sont diffrents,


2. 64). [1 b]

maintenu

(Pnini,
les

faut entendre de
etc.,

mme

bons chemins-de-l'acte, renoncement


etc.

au meurtre,
Pourquoi
ils

non-convoitise (anahhidhy),

le YirpsLY?iii

(prayoga)

et le conscutif (pr^f/to^
(iv.

ne sont-

pas considrs

comme
;

chemins-de-l'acte

66

b-d) ?
l'acte

Parce que
dit

le prparatif est

accompli en vue de
le

proprement

(maulakarman)
dit
'.

parce que

conscutif a pour racine l'acte

proprement

En

outre, sont seules chemins-de-l'acte les plus

notables parmi les bonnes et mauvaises pratiques.

Enfin, sont

chemins-de-l'acte les actions dont l'augmentation et la diminution

ont pour rsultat l'augmentation ou la diminution des choses et des


tres vivants
(iv.

85,

iii.

99) ^

Les Sautrntikas ne reconnaissent pas la volition (ceian)


acte mental

comme

(manaskarman) pour
;

eux,
c-d).

il

n'y a pas d'acte mental

en dehors de la convoitise,
ils

etc. (iv.

65

que

le

Stra donne la convoitise,

Comment donc etc., le nom de

expliquent-

chemin-de-

l'acte ? C'est

une question laquelle

ils

doivent rpondre.

1.

c'est

Lorsque prparatif ou conscutif sont chemin-de-l'acte (ci-dessus p. 143), en vertu de leur caractre propre et non par leur connexion avec un autre

acte.
2. yesni utkarspakarsenadhytmikabhynm utkarspakarsau loke bhavatah.

170

CHAPITRE

IV,

78 c-79

c.

La rponse

n'est pas difficile.

La

convoitise, la
et elles
le

mchancet

et la

vue fausse sont acte mental (karman)


de mauvaise destine
;

sont chemin (paiha)

ou bien

elles

sont

chemin

les

unes des

autres, car la convoitise


et la

met en mouvement (vhayati)

la

mchancet

vue fausse,

et rciproquement.
l'acte sont tous

Les dix mauvais chemins de


les

en contradiction avec

bons
a.

dharmas ; mais

[2 a]
les racines

79
La

La vue de ngation rompt

de bien.

'

rupture des racines de bien (kualamlasamuccheda) a lieu


^

par la vue fausse du neuvime degr, forte-forte


Objection.

(iv.

79

d)

Vous

affirmez que seule la vue fausse rompt les


^

racines de bien, mais le Trait

dit

Quelles sont les racines de


les racines

mal

fortes ?

Les racines de
le

mal qui rompent


les

de bien,

les racines

de mal qui sont abandonnes

premires lorsqu'on
.

acquiert le dtachement du

Kamadhtu (kmavairgya)
du mal rompent

Ce

texte

prouve que
de bien.

lobha

et les autres racines

les racines

Rponse.

Seule
est

la

vue fausse rompt

les racines

de bien

mais Ja

vue fausse

amene (adhylirta -= upanta) par

les racines de

mal

le

Trait attribue donc ces dernires l'opration qui appartient

en propre la vue fausse.

De mme on

dit

que

les bandits brident le

village parce qu'ils allument le feu qui brle le village.

Quelles racines de bien sont rompues ?

79
1.

b.

Les racines innes du domaine du Kamadhtu.


:

79 a-b

med par
:

Ita

On peut restituer
trad. p. 184).
2.

bas rtsa ba gcod // bdod glogs skyes nas thob pa rnanis / mlacchedo nastidr. Le second pda dpend gramma*
a.
(ii.

ticalement 4e chiiiatfi de 80

Les racines de bien ne peuvent tre coupes d'une manire dfinitive

36

c-d,

adhimtrapariprn
Jnfinaprasihana,

= adhinitrdhimtrA.
.

3.
4.

Vibh&sa, 35,

c'est--dire kamAptaupapattikni hdod gtogs skyes nas thob pa rnauis (mlni). Paramfirthu le bon (iibha) du K&niadhatu obtenu la naissance kdntaupapaftikatn ubham (??)
:

Hiiian-tsang,

xvii, fol. 1

b-2

b.

171

Ce sont
les racines

les racines

de bien du domaine du

Kamadhalu (kmpta)
;

qui sont rompues lorsque l'on rompt les racines


n'est pas

car celui qui rompt

muni des

racines de bien du Rcipadhatu ou de

l'Arpyadhatu.
S'il

en est ainsi, comment


l sont

faut-il

entendre ce texte de la Prajfiapti

Par

rompues

les

racines de bien des trois sphres de cette


14)

personne (pudgala)

? (Vibhs, 35,

Ce

texte veut dire que,

ce moment, les acquisitions des racines de bien des sphres suprieures deviennent lointaines [2 b], et cela parce que cette personne,

qui auparavant tait idoine


l'tre
Il

(bhjana) ces

acquisitions, cesse de

par la rupture des racines du Kmadhtu.


s'agit

des racines de bien innes (upapatiilbhika)


les

car la

personne qui rompt

racines de bien est dj dchue des racines


ii.

de bien acquises (pryoglka,

71

b, trad. p.

320, Vibhas, 35,


les racines
*

12).

Quel

est l'objet de la

vue fausse qui rompt

79

c.

La vue

fausse qui nie la cause,


la
:

le fruit.

Ngation de Ngation du

cause
Il

Il

n'y a ni bonne, ni mauvaise action

fruit

n'y a pas de rtribution, fruit de la


. (iv.

bonne ou

de la mauvaise action

78

b-c, v. 7)

D'aprs une autre opinion, ces deux vues fausses, celle qui nie la
cause, celle qui nie le fruit, concourent la rupture des racines de la

manire dont Vnantaryamrga


la rupture des passions (vi. 28,

et le
b).

vlnmktimrga concourent
qui rompt les racines a pour

65

Quelques-uns disent

La ngation

objet (c'est--dire nie) le ssrava, l'impur, c'est--dire les deux pre-

mires vrits,

et
;

non pas Vansrava,


elle

le pur, c'est--dire les

deux

dernires vrits

a pour objet la sphre o Ton se trouve (sahhle

gadhcitu), et non pas

Rpadhtu
'

et

l'Arpyadhatu.

En

effet, la

ngation qui porte sur

le

pur

'

ou

les

sphres suprieures est faible,

parce qu'elle n'est en relation avec ces objets que par association,
(v.

17-18).

'

1.

hetiiphalpavdiny.
durbalatvt.

% samprayogamtrnmyitvena

Vyakhya

ansrav-

172

CHAPITRE
les

IV,

79

d.

Mais

Vaibhasikas disent
entire.
^

'

79

d.

Toute

Les racines de bien sont rompues par la vue fausse toute entire,
qu'elle porte sur la cause
le

ou qu'elle porte sur

le fruit, le pur, l'impur,

Kamadhatu,

les

sphres suprieures.
les

Quelques-uns disent que

neuf catgories de racines de bien,

racines de bien faibles -faibles, faibles-moyennes, faibles-fortes,


nes-faibles, etc., sont

moyen-

rompues

la fois

par un

moment
la

de vue fausse,

de

mme

que

les

passions abandonner par la vue d'une vrit sont,

dans toutes leurs catgories, abandonnes par


(vi. 1 c-d).

vue de cette vrit

Mais

les

Vaibhasikas disent
^

79

d.

Graduellement.

Les racines de bien sont rompues de


donnes
les

la

manire dont sont aban-

passions abandonner par la mditation des vrits


vi.

(satyahhvan,

33)

c'est--dire

que

la racine de bien forte-forte


la

(adhimfrdhimtra)

est

rompue par
vue fausse

vue fausse

faible-faible

(mrdumrdu),
faible qui est

[3 a] et ainsi de suite jusqu' la racine de bien faible-

rompue par
le
'

la
:

forte-forte.

Cette thorie
'

est d'accord
et

avec

texte

Quelles sont les racines de bien


'

petites

concomitantes

(antishagata)

? Celles qui sont abandonnes

lamban visahhyadhtvlamhan ca y mithyddrstih sa samprayogatasmd asau nttrena samprayuktesu dharmesv anu^etc nambanatah
/

durbal. 1. Le Bhfisya porte evam tu varnayanti et rpte ci-dessous la mme formule. En employant l'expression Vyflkhya evatn tu varnayanti Vaibhsikh. eiam, l'auteur marque qu'il approuve celle opinion.
:

2.

sarvay.

3.
4.

kramaah.

evam ayam granthah

pariplito bhavati.
;

Paraniftrtha

vi-bha-sfl-g-

ran-ta.
5.

Jnttnaprastlina, 2, 8
la

Vihhn.sa,

i.5,

6.

Les MSS, de
:

Vyakhyfi

lisent

le

Lolsava

phra mo dan Ihan

cig tu

anusahagata que traduisent litlralement gyur ba, Hiuan-tsang wi-ki-hing, et


:

Hiuan-tsang,

xvii, fol.

2 b-3

b.

173
par l'absence
.

en dernier lieu la rupture des racines de bien


desquelles un
Objection.
le texte
:

celles

homme

est dit qui-a-les-racines-de-bien-rompues


est graduelle,

Si la rupture
lesquelles

comment

faut-il

entendre

Quelles sont les racines de mal fortes-fortes ?


il

Les

racines de

mal par

rompt

les racines

de bien

Ce

texte vise l'achvement

(sampti) de

la rupture des racines de

bien, car c'est par les racines de

mal

fortes-fortes

que

les racines

de

bien disparaissent totalement (niravasesaccheda). Aussi longtemps

que

la dernire catgorie des racines


elle

de bien, la faible-faible, n'est


'.

pas rompue,

peut dterminer la rapparition des autres

D'aprs certains matres, la rupture des neuf catgories a lieu en

une

fois,

sans interruption (avi/titthnena


le

^),

l'instar de l'abandon

des passions par

chemin de

la

vue des

vrits.

Mais les Vaibha-

sikas disent qu'elle a lieu soit sans


reprises (Vibhasa, 5,
12).

interruption, soit plusieurs

D'aprs certains matres, l'abandon de la discipline (samvarapra-

hna,

iv.

38) prcde la rupture des racines.

Mais les Yaibhasikes


la

disent que la discipline est perdue (tyga)

quand on perd
i3).
^

pense

dont cette discipline est

le fruit [3 b]

(Vibhasa, 35,
les racines
'*

Quels tres sont capables de rompre

de bien ?

79
Les
tines

d.

La rupture a

lieu chez les

hommes.

hommes

seuls rompent
:

non pas

les tres des

mauvaises des-

(pyika)
:

car leur discernement (prajh), qu'il soit souill

Paramartha

irs-subtil-toujours- la suite

(tsoi-si-Jing-soi)

mais atiu-

sahagata

discussion des

Dans la pratyayas (ii. 61 e), Samghabliadra critique la doctrine des antisahagatakusalamla (soi-ki-Mng) dea Stba viras c'est le terme pli,
est expliqu par la

Vykhy nirdu-mrdu

faible-faible

Samyutta,
1.

iii.

130, Kathvatthu, p. 215.

Kosa,

ii.

trad. p. 245-246.

j^ St^ff'^^^

piinar utpattau hetuh syt. Voir d'ailleurs ii. 36 c-d, p. 184. 2. Sur l'expression vyutthna, ii. 44 a-b, p. 206. 3. L'homme qui a pris la discipline avec une pense faible-faible perd la discipline lorsqu'il perd (tyga), lorsqu'il rompt (satnuccJieda) cette pense faible-faible qui est associe (samprayukta) une racine de bien faible-faible
(Vyfikhya et Hiuan-tsang).
4.

[nrsu

//]

174
ou non

CHAPITRE

IV,

79 d-80

c.

souill (klista, dklista), n'est pas

ferme (drdha)
'.

non pas

les

dieux, car le fruit de l'acte leur est manifeste

Les

hommes

de trois
'

continents,
fait dfaut.

non pas ceux de l'Uttarakuru, car

le

mauvais saya

leur

D'aprs une autre opinion \ seuls les

hommes du JamhudvTpa

rompent

les racines

de hien. Mais cette manire de voir est en contra:

diction avec le texte

Les habitants du JamhudvTpa possdent au


de

minimum

huit organes

mme

les habitants

du Prvavideha

et

de l'AvaragodanTya.

80

a.

L'homme

et la

femme rompent

les racines.

D'aprs une autre opinion, la

femme ne rompt pas


est

les

racines

parce que sa volont (clianda) et son application sont molles (manda).

Mais
d).

cette

manire de voir

en contradiction avec

le texte

Qui possde l'organe fminin possde ncessairement huit organes


18

(ii.

Le sensuel (trmcarita) ne rompt pas

les racines

parce que son

aya

est

mobile (cala)

seul
^

rompt

80

a-b.

Le rationaliste

1. aciropapannasya devaputrasya trlni cittni samudcaranti kuto 'hafn cyutah kutropapanuali kena karman (Vyakhya).

80 d. D'aprs Vibhaiiga, 340, il faut entendre par en gnral, mais l'allitude l'endroit des problmes philosophiques: croire que le monde est ternel croire la survivance du Tathfigata, .... prendre la voie du milieu entre la bhavaditthi et la vibhavaditthi.
2.

ppsaya ;

voir

iv.

aya, non pas

l'intention

3.

Le Bhadanta Ghosaka (glose de


Jnanaprasthana,

l'diteur japonais).

iatra viesena

iarkikatvat (Vyfikhya).
4.
15, 11, Vibhfisfi, 130, 12.

Le texte porte
les facults

evam Paurvafoi, etc.

videhiko Gaudtilyakah.

Le chiffre de huit organes au mininuim (cinq organes


de

de sensation, kya, jvita et manas) montre que exister dans le PQrvavideha.


5.

peuvent

chinatti trl
drsticaritah.

pumn.

Le terme est expliqu dans la Vyakhy ad iv. 100 satkyadrstyddisu paiicasu caritah pravrtto drsticaritah j drstir va caritam asyeti drsticaritah / sa hy hpohasmarthyd anyani strani mryntaratfi ca yrahayitum samartho na tfsncaritah. - Nettippakarana, pp. 7, 109.
C.
:

Hiiian-tsang,

xvii, fol.

3 b-4

a.

175

Parce que son saya est mauvais (papa), ferme (drdha)y cach
(gdlia)
'

[4 a].

En
les

vertu des

mmes

principes, les eunuques, etc. ^ ne

rompent pas
(prajn),

racines de bien, parce qu'ils sont ranger avec les sensuels

(trmcaritapaksatvtj, parce

que

leur

discernement

comme

celui des tres des

mauvaises destines,

n'est pas ferme.

Quelle est la nature de la rupture des racines ?

80

b.

La

rupture est non-possession.

Lorsque

la possession des racines de bien arrte de renatre, de se

continuer, alors nat la non-possession (aprptl), le ne-pas-tre-muni

(asamanvgama)

(ii.

37).
il

Lorsque Vaprpti

est ne,

y a rupture des racines de bien.

Quand
elles

les racines

de bien ont t rompues,

comment reprennent-

naissance ?
c.

80

Renaissance par
'*

le

doute, par la vue de l'existence de la

cause, etc.
Il

arrive que

l'homme dont

les racines

de bien sont rompues pro-

duise, relativement la cause et

au

fruit,

ou doute, ou vue de leur

existence (astidrsti), c'est--dire vue droite (samyagrsti). Lorsque


la

vue droite
',

est ne, alors

on

dit

que

les racines

de bien ont repris

naissance

parce que la possession de ces racines est dsormais

prsente (tatprptisamudcrf). Les racines reprennent naissance

dans leurs neuf catgories


manifesteront.

mais
^

c'est

graduellement qu'elles se
la sant

De mme qu'on reprend d'abord

(rogya)

et

ensuite, graduellement, des forces.


1. 2.

gdha = pracchanna (Vyakhya). Hiuan-tsang traduit pandaka, sandha, ubhayavyanjanaka, avyanjanaka.


de ni mi Idan paho

profond

(clin).
10.

Vibhfis, 35,

3.
4.

= [so

'

samanvayah

/]

mthsams ni the thsom yod Ita bas =: [vimatystidrs samdhili] pratisamdhitni pratisamdhikrtni pratisamdhitni / prtipdika' dhtuli j pratisamhitnty apare pathanti (Vykhya).
5.

6.

Hiuan-lsang
:

Il

arrive que, relativement la cause et

doute

Cause

et fruit existent peut-tre ,

au fruit, ou bien naisse ou bien naisse vue droite Cause et


:

176

CHAPITRE
d.

IV,

80 d-81

c.

80

Non

pas

ici,

pour

le

coupable d'nantarya.
les racines
le

Les autres personnes qui ont rompu


les
(iv.

de bien peuvent

reprendre ds cette vie


97) qui a
:

mais non pas

coupable iXnantarya

rompu

les racines de bien. C'est

au sujet de ce pcheur

qu'il est dit

Cette personne (piidgala) est impropre (bliavya)


;

reprendre les racines de bien dans cette vie (drstadharma)


elle les

mais

reprendra certainement soit en mourant

l'enfer [4 b], soit

en naissant (iipapadyamna)
:

(cyavamdna) de % En nais-

sant

c'est--dire

se trouvant dans l'tat intermdiaire [qui prcde

l'existence infernale].

En mourant

c'est--dire

dispos mourir

[de l'enfer] (narakacyutyahhimikha).

Les racines de bien sont


la force de la

reprises en naissant lorsqu'elles ont t

rompues par

cause (hettibalena)

en mourant, lorsqu'elles ont t rompues par la

force de l'occasion (pratyaya).

Mme
^

diffrence lorsqu'elles ont t


'^

rompues par

la force personnelle,

par la force d'autrui.

L'homme

qui est
le fait

vinasta) par

c'est--dire perdu (vipanna, sayavipanna de vue fausse (mithydrstisammnkhbhva)

reprend les racines dans la prsente existence.

L'homme

qui est

sayavipanna
fruit existent

et

prayogavipanna
il

la

c'est--dire

perdu en outre
.

certainement,

est faux qu'ils n'existent pas

ce

moment

les

racines de bien reprennent naissance.


produit,

Comme

possession (prpti) du bien se

on

dit

que cet

homme

a repris

les racines

de bien.

Certains matres
les

disent que les neuf catgories reprennent naissance successivement. Mais


:

[Vaibhsikas] disent qu'on reprend en une fois les racines de bien c'est cependant
plus lard et peu peu qu'elles se manifestent, de

mme

qu'on expulse

la

maladie

d'un coup et qu'on reprend des forces graduellement,


1.

nehnantaryakrinah
p.

//
:

L'Astasfihasrika,

336,

explique pourquoi

nantaryakr nantaryatac cittam aknoti

cittenvirahito bhavati

yvan maranvasthym na
xiii. 3.

prativinodayitum ... 2. Madhyama, 37.


3.

Kathavatthu,
la

hetubalena,

c'est--dire

sabhyahetiihaena
vue fausse.

(ii.

52

a).

C'est le cas o

ou

adhre spontanment (svayam)

pratyayahnena. c'est--dire

par la force de la parole d'autrui (parato gliosa).

balena, par la force du raisonnement personnel.

svabalena = scatarkaparabalena

= paratah

rutabalena. 4. Voir ci-dessus

p. 174, n. 2.

Hiuan4sang,
par
le fait

xvii, fol.

4 a-5

a.

177

du pch nantarya
'

ne reprend
rompu
].

les racines qu'aprs la

destruction du corps.
ce qui vient d'tre dit
force,

[Ceci est une variante


:

(ayam paryyah)

de

Celui qui a
....

les racines

par sa propre
celui qui

par la force d'autrui

Mme diffrence pour


et celui qui est
le

est

drstivipanna (perdu par


et

la

vue fausse)

la fois

drstivipanna
tarya)
.

lavipanna (perdu en outre par

pch ^nan-

[Ceci est une variante de ce qui prcde immdiatement].

On
mla)
c-d).

peut avoir
et

rompu
1.

les

racines de bien (samiicchinnakusalaiii.

ne pas tre vou la perdition (mithytvaniyata,


:

44

Quatre cas

Prana

et les cinq autres

docteurs ^ 2. Ajta-

satru, 3. Devadatta, 4. les


et qui n'ont

hommes

qui n'ont pas

rompu

les racines

pas commis

le

pch nantarya.

L'homme
dans'l'AvTci

de vue fausse, qui rompt les racines de bien, est puni


;

l'hoinme coupable

'

nantarya

est puni

dans l'Avci

ou ailleurs

*.

La

volition (cetan) est le principe de l'acte.

Nous expliquerons

avec combien de chemins-de-l'acte la volition peut coexister. [5 a]

81

a-c.

En

ce qui regarde les

mauvais chemins,
^

la volition peut

coexister avec huit chemins au

maximum.

La

volition avec

un chemin.

Lorsque se manifeste convoitise,


*

ou mchancet, ou vue fausse, sans qu'aucun chemin


Le Samyutta,
266, distingue le
iv.

matriel

'

1.

v.

micchditthika

et le

micchditthikam-

masamdna.
2.

Voir
cit

96.
p. 21, la dfinition

Voir Puggalapanlatti,

du sllavipanna (sabbam dus106,

sllyam^^sllavpatti) et du ditthivipanna (sabb micchditthi=:rditthivipaUi).

Dans Samadhirja prapanna.


3.
i.

Bodhiearyfivatara

viii.

drstivipanna

= kumrga-

Les six matres (sstar), types du mauvais matre (ayathrtha) (Vyakhy,


7),

p. 8,

sont Prana Ksyapa, Maskarin Goslputra, Samjayin Vairatputra,

Ajita Kesakambalaka,

Mahfivyutpatti, 179 (voir les


ditions

Kakuda Ktyyana et Nirgrantlia Jntiputra. nombreux quivalents tibtains et chinois dans les de Wogihara et Sasaki) Divyavadna, p. 143 (VairattTputra, Kesakam;

bala), Burnouf, Introduction, 162, Lotus, 450.


4. 5.

Manque dans les deux versions chinoises. Voir iv. 99 c. astabhir yvad aubhais cetan saha vartate j yugapat.
12

178
(rpin)
ait

CHAPITRE
lieu

IV,

81.

ou bien lorsque l'homme qui a prpar un des


c'est--

chemins matriels se trouve avoir une pense non-souille,


dire

bonne ou non-dfinie, au moment o, sur son


est perptr.
*

instigation, ce

chemin

La

volition avec

deux chemins.

Lorsqu'un
;

homme

de pense

mchante (vypannacitta) tue (prnivadha)


proie la convoitise (ahhidhyvistaj vole, ou
parle d'une manire inconsidre.
-

lorsqu'un

homme

en

commet

l'adultre,

ou

La

volition avec trois chemins.


et vole
le

Lorsqu'un
'\

homme

de pense

mchante tue
(lohha)

en

mme

temps

Mais,

dira-t-on, n'avons-

nous pas vu que


(iv.

vol n'est achev (nisth) que par le seul dsir

70) ?

Cette restriction vise l'achvement (parisa-

mptaii) du vol (adattdna) commis par un


seulement voler (apaharana)
*.

homme

qui pense

La

volition encore avec trois chemins.

Lorsque la convoitise est


sont

prsente

(sammukhhhva) au moment o
fait

consomms deux

chemins matriels qu'on

commettre par

autrui. [5 b]

La

volition avec quatre chemins.


injurie

Lorsqu'on menl (anrtavacana)


Sivec l'intention

ou lorsqu'on
1.

(parusavacana)

de diviser

il

aklistacetaso vpi tasya prayogena

rpinm anyatamasya nisthpane.


une pense

11

faut exclure l'amour illicite toujours accompli en personne et avec

souille.
2.

On
il

peut critiquer cette rdaction. S'agit-il d'actes commis en personne ?


est inutile de spcifier

Alors

que
le

le

meurtrier est de pense mchante, que


lii

le

voleur est en proie au dsir, d'aprs


S'agit-il

principe vyabhicre

visesanam

isyate.

d'actes qu'on fait


la

commettre par autrui ? Alors


le

la

convoitise, ou la
le vol, etc.

mchancet, ou

vue fausse peut coexister avec

meurtre, avec

nous spcifions, ce n'est pas vrai dire spcifier, mais seulement expliquer quels sont les deux chemins. Soit, mais il y a aussi deux chemins dans l'hypothse de l'homme qui fait com:

Rponse

Il

s'agit d'actes

commis en personne,

et si

mettre

le

meurtre avec pense de convoitise.


;

Rponse

Oui

ce cas devrait

tre signal

mais l'auteur veut seulement donner un exemple.


:

3. vypannacittasya prdniniranpaharane yugapat. Vyttkhy yutra m&ranenaivpaharanatn sidhyati / tatra hi vypdaprntvadhdattdnakarmapath yuyapad bhavanti. 4. ananyacittasya tatparisapiptau sa niyamah. \ y Hkhy a uinyacittasya tu mranaciltasya nyam niyamah la restriction n'est pas justifie quand
:

il

s'agit d'un

homme

qui vole en vue de tuer.

Hiuan-tsang,
a un chemin mental
et

xvii, fol.

a-b.

179

trois

chemins vocaux
etc.

*.

Ou

bien,

quand

la

pense est en proie la convoitise,

(ahhidhydigata), au moment

o sont consomms

trois

chemins matriels.

La

volition avec cinq, six, sept chemins.


etc.,

Quand

la

pense est

en proie la convoitise,
cinq, six

au moment o sont consomms quatre,

chemins matriels.

La

volition avec huit chemins.


etc.
;

Un homme

fait le

prparatif

de six chemins, meurtre,

au moment o ces six chemins sont

consomms,

il

est

en proie la convoitise et commet l'adultre.

La

volition ne peut coexister avec neuf chemins, avec dix chemins,

parce que la convoitise, la mchancet, la vue fausse ne sont pas


simultanes.

81
avec

c-d.

En

ce qui concerne les bons chemins, la volition coexiste

dix.

Les dix bons chemins peuvent tre simultans la

volition.
^

81
1.

d.

Elle ne coexiste pas avec un, huit, cinq chemins.

On

mensonge, qui est paisunya (parole maligne) puisque

le

menteur

a l'intention de diviser, qui est parole inconsidre puisque toute parole souille
est parole inconsidre (iv. 76 c-d).

De mme pour l'injure.


ou mchancet
;

Pour

le

mensonge,

chemin mental peut mental est mchancet.


le

tre convoitise

pour

l'injure, le

chemin

C'est la

mme

parole qui est mensonge, parole maligne, parole inconsidre

la distinction

des trois chemins vocaux est donc purement verbale, non relle.
la distinction est relle, car
il

D'aprs une autre opinion,

y a lieu de distinguer

trois vijnaptis. [Les interlocuteurs sont tromps, diviss, etc.]


2.

dge ba bcu

yi

bar dag da
jj

= [dasabhir yvac chubhair]


un
seul

3.

naikstapancabhih

La
tre

volition ne peut se trouver avec

chemin

le

chemin unique ne peut

pense bonne est toujours accompagne de non-abliidhy et de non-vydipcida ; il ne peut tre un chemin matriel compris dans la discipline, car les disciplines comportant au moins le renoncement au

un chemin mental, puisque

la

meurtre, au vol, l'amour

illicite,

La

volition ne peut se trouver avec cinq

au mensonge. chemins

ce qui supposerait les quatre

chemins des disciplines les plus troites (Upsaka, etc.), plus un bon chemin mental or la nou-abhidhy et le non-vypda sont insparables. La volition ne peut se trouver avec huit chemins. En effet, le-Bhiksu de pense mauvaise ou non-dfinie ne possde que sept bons chemins, et, lorsque la pense
;

est bonne,

il

en possde au moins neuf.

180

CHAPITRE
volition avec

IV,

81 d-82

b.

La

deux chemins.

Un homme

dans un recueille-

ment d'rQpya, en possession du ksayajnna ou de Vamitpda-

jnna

(vi.

45, 50)
:

les cinq

connaissances sont bonnes.


*

Il

y a donc

deux chemins

non-abhidhy, non-vypda.
vue

La volition avec trois chemins. tale (manovijnna) est associe


que
les sept

Lorsque
la

la connaissance

menet

droite

(samyagdrsii)

bons chemins matriels manquent.


avec quatre chemins.

La

volition

Lorsque,

avec une pense

mauvaise ou non-dfinie, on prend


meurtre,

la discipline

d'Upasaka ou

celle

de Sramanera qui comportent quatre bons chemins matriels, nonetc.

La

volition avec six chemins.

Lorsque,
disciplines

les cinq
:

connaissances

tant bonnes, on prend les

mmes

quatre bons chemins

matriels, non-convoitise, non-mchancet.

La

volition avec sept chemins.


les

Lorsque, avec une connaissance


disciplines
:

mentale bonne, on prend

mmes
:

ajouter la vue droite.

Ou
prend

bien quand, avec une pense mauvaise ou non-dfinie, on


la discipline

de Bhiksu

sept chemins matriels sans plus.

La

volition avec neuf chemins.

[Trois
;

cas

:]

On

prend la

disci-

pline de Bhiksu, les cinq connaissances (connaissance visuelle, etc.)

tant bonnes

la

vue droite manque

on prend

cette

mme

discipline

un

moment
:

o, dans

un recueillement d'rpya, on possde ksaya


le

ou anutpdajnna [C'est

cas,

examin

ci-dessus, des

deux cheici

mins

il

faut ajouter les sept chemins de la discipline, qui


;

ne sont

pas avijhapti]

au cours d'un recueillement de dhyna, on possde


droite

ksaya ou anutpdajnna [La vue


(avijhapti)].
*

manque

les sept

chemins

matriels existent en tant que partie de

la discipline de

dhyna

ne sont pas drsti (vii. 1) donc la accompagne de samyagdrsH. Dans les recueillements d'rpyadhalu manquent le rpa, et, par cons(juent, la discipline avec les sept bons chemins corporels et vocaux. 2. Le texte porte kualesu paicasu vijnesii tatsamCidne ksaynntpdajnnasatnprayukte ca manovijfine tasminn eva ca dhynasafngrhite.
1,
;

Le ksayajiina

et V anutpdajnna

volition de cet

homme

n'est pas

Hiuan-tsang distingue nettement

les trois cas

Lorsqu'on prend

la discipline

Hiuan-tsang,

xvii, fol.

5 b-6

b.

181

La

volition

avec dix bons chemins.

Dans

les cas diffrents

lorsqu'on prend la discipline de Bhiksu avec une connaissance


tale bonne,

men;

hormis

le

cas de Usayaj flna et

d'anutpddajnna

toute volition concomitante (sahavartin) la discipline de


et

dhyna

la discipline

pure lorsque cette volition n'est pas associe au

ksaijajhna ou Vamdpdajnna.

Nous avons montr dans


avec
les

quelles

conditions la volition coexiste

bons chemins-de-l'acte inclus aux disciplines (sanivara-

sanigrhlta). Si on envisage les bons chemins de l'acte indpendants


des disciplines, la volition peut aussi se trouver avec un chemin, avec

cinq chemins, avec huit chemins


1.

Lorsqu'on renonce un pch (ekngaviratisamdna) et qu'on


celle qui

a une pense diffrente de


-dire

provoque ce renoncement,
;

c'est-

une pense souille ou non dfinie


et

2.

lorsqu'on renonce
:

deux pchs

qu'on a une connaissance mentale bonne


les

cette

bonne
dans

connaissance mentale comporte


s'ajoutent
les

trois

actes

mentaux auxquels
;

deux renoncements, deux actes matriels

8. lorsque,

mmes

conditions, on renonce cinq pchs. '[6 b]


les

Quels sont

chemins de

l'acte qui existent, soit

en

fait, soit

par

possession ^ dans les diverses destines ?

82

a-b.

Dans

l'enfer,

parole inconsidre, parole injurieuse, mchan^

cet, des

deux manires.
les cinq

de Bhiksu
Ceci

connaissances tant bonnes


les cinq
Il

[Kiokiiga

la

vue droite

manque parce qu'on admet


1.

mauvaises

drsfis].

titre

d'exemple.

souille
2.

ou non-dfinie
fait
,

on renonce cinq pchs.

y a aussi cinq chemins lorsque

la

pense tant

En

par possession

sammukibhvatas (mnon sum du hgyur ba), svayatn (dhos su) , sanianvganmt, sainanvayt, prptitah, Idbhatas (Idan
;
;

pahi sgo nas, Idan pas, brned pas, tcheng-tsieou).

Les tres de l'enfer n'ont pas convoitise

la convoitise n'existe la convoitise


:

pas en enfer

mais
3.

ils

n'ont pas coup la prpti

(ii.

36 b) de

ils

possdent, passe,

la convoitise qu'ils ont

eue dans une existence antrieure.

dmyal ba na ni bkyal ba dan / thsig rtsub gnod sems rnam gnis so Vibhsa^ 113, 5. [bhinnapralpaprusyavypd narake dvidhd /]. lieu o naissent mauvais, naraka naraka : nara homme, ka agrable (comp. DhtupStha, 10, 197), naraka mchants; ou bien raka

=
les

lieu

o rien n'est agrable (VibhsS, 112,

4).

182

CHAPITRE

IV,

82-83

b.

Parole inconsidre, car les damns se lamentent (parideva)


parole injurieuse, car les
injurieux (nigrha)
'

damns

se font mutuellement des reproches


qu'ils se hassent mutuelle?)

mchancet, parce

ment dans

la duret de leurs

mes, (cittasamtnaprusyt
^

82

c-d.

Convoitise et vue fausse, par possession.


et
:

Les damns possdent convoitise


n'existent pas actuellement en enfer

vue fausse, mais

celles-ci

par suite de l'absence de tout

objet auquel on puisse s'attacher (ranjanlyavcisiu) [7 a] ^ parce que


le fruit

de l'acte est manifeste.

manque le meurtre, car les damns meurent par puisement de l'acte (karmaksaya, ii. trad. p. 217-9) manquent le vol et l'adultre, car les damns n'ont en propre ni objet de proprit, ni femme (dravyastrlparigrahbhvt) ; manque le mensonge, qui serait sans utilit manque la parole maligne, qui serait sans utilit, car les damns sont d'avance et toujours diviss.
enfer
;

En

82

d.

Trois dans l'Uttarakuru.

Convoitise, mchancet et vue fausse existent dans

le

Kuru en

ce

sens que les habitants du Kuru sont en possession de la convoitise,

de la mchancet

et

de la vue fausse. Mais, en


rien en propre
;

fait,

la convoitise
la

manque, car on n'y possde

de

mme
;

y mchancet,

parce que les mes sont douces (snigdhasamtdnatvt), parce que


fait

dfaut toute cause de dplaisir (ghtavastu)

de

mme

la

vue

fausse, parce que fait dfaut le


(iv.

mauvais aya (appsayatvt)

80

d).

1.

nigraha; Hiuan-isang, ma, maudire,


'J.

injurier; Vyutpatti, 255,

4,

brgyad gag

Udftnavarga, xx.
2.

3.

brnab sems log Ita Idan pas so [samanvgamato 'bhidhyniithyddrsH] Vibhasa (172, 5) Dans l'enfer Samjlva (iii. 59, Lokaprajnfipli, dans Cosmo:

logie bouddhique, p. 324, Mahftvastu,

i,

10) le vent

froid pii ressuscite les

damns
de-l'acte
4.

excite la convoitise

(abhidhy)

mais

il

n'y a pas, pour cela, le chemin-

nomm

convoitise.
II]

[kurau trayant

Hiuan-tsang

xvii, fol.

6 b-7

b.

183
'

83
La

a.

Le septime chemin y

existe en fait aussi.

parole inconsidre y existe en fait

car, quelquefois, les habi-

tants du

Kuru chantent avec une pense


fait

souille.

Parce qu'y
vie

dfaut le mauvais aya, parce que la dure de la


(iii.

y est dtermine
meurtre

78

ii.

trad. p. 219), parce qu'on n'y pos-

sde en propre ni objet de proprit, ni femme, et encore par


d'utilit, le

manque
le

et les autres chemins-de-l'acte

manquant dans

Kuru.
Si les

hommes du Kuru
soit la

n'ont pas une

ha),

comment donc

s'unissent-ils

femme en propre (parigra(katham esm ahrahmacaryam) ?


laquelle
ils

Quelle que
sir, ils la

femme avec
et

dsirent goter le plai-

prennent par la main

vont vers un arbre. Si cette


le

femme
;

est

permise (anaganiya), l'arbre recouvre


le

couple de ses branches


^

dans

cas contraire, l'arbre ne recouvre pas le couple.


Ailleurs dans le

83

b.

Kamadhatu,

les dix

mauvais chemins.
dans
le

'

Les dix mauvais chemins existent en


exceptant l'enfer et l'Uttarakuru [7
b].

fait

Kamadhatu en
mau-

En

ce qui concerne les animaux, les Prtas et les dieux, les

vais chemins ne sont pas intgrs l'indiscipline (asanivaranir-

miikta, voir

iv.

24

c)

en ce qui concerne

les

hommes,

les

mauvais

chemins sont ou intgrs, ou non intgrs

l'indiscipline.

Le meurtre
Prtas, etc.

existe-t-il
ils

chez les dieux ? Les dieux ne se tuent pas

entre eux, mais

tuent des tres appartenant d'autres destines,

D'aprs une autre opinion, les dieux aussi meurent


'*

par la rupture de la tte ou de la

taille.

de na bduii pa dnos su yan [saptamo 'tra] svayam api. Pas de mariage dans l'Uttarakuru, Mahabhrata, i. 122, 7. 3. hdod pa gzhan na mi dge bcu [knie 'nyatra dasubhh /] devo 4. dev api iromadhyacchedn mriyanta iti. On vient de dire devant na mdrayati, un dieu ne tue pas un dieu *, ce qui implique la conclusion les dieux ne peuvent tre tus (avadhya). En effet leurs membres et sousmembres, coups, renaissent. Cependant leur tte, leur taille ne repoussent pas quand elles sont coupes donc les dieux peuvent tre tus.
1.

2.

184

CHAPITRE
c-d.
'

IV,

83 c-85

b.

83
en

Trois bons chemins existent partout, et par possession

et

fait.

Partout, dans les trois sphres d'existence et dans les cinq destines, la non-convoitise, la non-mchancet et la vue droite existent
et

par possession

et

en

fait.

84

a-b.

Dans

les

rQpyas, chez

les Inconscients, sept,

par posses-

Chez
les sept

les tres de

l'rOpyadhatu

et

chez les Asanijfiisattvas (ii.41


et

d),

bons chemins matriels, corporels


qu'ils sont possds.

vocaux, existent seule-

ment en tant

En

effet,

les

ryas qui renaissent dans rArpyadhatu possdent


la discipline

(samanvgata)
les Inconscients

ou moralit pure, passe

et future, et
c)

possdent la discipline de

dhyna

(iv.

13

dans

les

mmes
La

conditions.

discipline pure, passe,

que possde l'rya ren dans l'rQles tages (quatre


;

pyadhatu, a pour point d'appui (sraya) l'tage ou

dhynas) auquel ou auxquels

il

Ta produite
'

et dtruite

la discipline

pure, future, qu'il possde, a au contraire pour point d'appui les cinq

tages (Kamadhatu et quatre dhynas).

84
naux

b-d.
et les

Pour

le reste,
*

en

fait aussi,

en exceptant

les tres infer-

Kurus.

1. dge ba gsum ni thams cad na / rned dan mnon du gyur sgo nas [stibhatrayam tu sarvatra sammiikhtbhvalbhatah //J [rpysatnjni2. gzugs med hdii ses med sems can / rned pas bdun yod sattvesu lbhatah sapta] 3. yadbhmysrayam ansravatn silam ryenotpditatn nirodhitam pancabhilmysrayena tv tenrpyesv atitena samanvgato bhavati andyatena. Par xUpdita, il faut entendre vartamnant adhvnam gamifam; par nirodhita, atiiam adhvnatft gamitam. Problme discut dans

Vibhasa, 132,
4.

6.
/

Ibag byas na (=: Ihag mar byas pas na)

ninon du gyur bahi sgo nas kyaA


j

dmyal bcas sgra mi sfian ma gtogs n>rakakuruvarjUe //]

[esite

satfttntikhlbhCtvata cdpi

Hiuan-tsang,

xvii, fol. 7

b-8

a.

185

Le

reste, c'est--dire

dans

les autres

sphres d'existence, dans les

autres destines.

Chez

les

tres

infernaux et chez les Kurus


les sept

manque

la moralit

d'engagement (samdnalla). Ailleurs


riels existent
11

bons chemins mat-

en

fait.

[8 a]

faut tablir une distinction.

Chez

les

animaux

et

chez les Prtas,


;

les

bons chemins ne sont jamais intgrs


ils

la discipline
;

dans

le

Ropadhatu,

sont toujours intgrs la discipline

ailleurs ils

peuvent tre de l'une ou de l'autre catgorie.

85
ment,

a-b.
fruit
et

Tous

les

chemins ont
*

fruit

de rtribution, fruit d'coule-

de souverain.

Bons
1.

mauvais,

les dix

chemins de

l'acte portent

un

triple fruit.

Par chaque mauvais chemin pratiqu (sevita),


sarve 'clhipaUnisyandavipkaphalad ntath
19.
ii.
/

,\\\\.\\(hlmvita),

1.

Les explications de Vasubandhu reproduisent, avec de menues variantes, celles


de Vibhs, 113,

Ces

trois fruits ont t dfinis


fruit,

5(5 et

suivants.

Comment

l'acte,

tant pass,

peut porter un
et suivantes.

voir le trait sur le

Hiuan-tsang, xxx, 13 b) et

Pudgala qui termine le Kosa (trad. de l'importante discussion dans Madhyamakavrtti, p. 316

Tout ce que l'homme sent n'a pas pour cause les actes anciens (Majjhima, ii. de Ksyapa-le-Nu (mme dbut que Samyutta, ii. 18) qui constitue un chapitre de la KarmaprajnSpti (Mdo, 62, 241 a), la souffrance est produite par soi (lorsqu'on se coupe les cheveux, la main, etc.), par autrui (lorsqu'un autre coupe la main), par soi et par autrui (lorsque, avec autrui, on se coupe la main), ni par soi ni par autrui, mais par des causes et conditions comme, par exemple, le vent se levant, la pluie tombant^ la foudre frappant, ou les maisons
214). D'aprs le Stra
:

s'croulent,

ou

les arbres
le

sont briss, ou les sommets de rocher sont prcipits


...
:

quelques-uns ont
par

pied coup

la souffrance

dans ce cas est produite par des


toute souffrance sont produits
:

causes et conditions.
soi,

Ksyapa, tout
et autrui,

plaisir et

(rtti) .... en hiver par le grand grande chaleur, en t par le froid et le chaud, se produisent plaisir et souffrance . Mais le problme n'est pas rsolu par ces dfinitions nous savons en effet que le trouble mental (qui est sensation pnible) nat du trouble des lments et n'est pas de rtribution, mais que le trouble des lments est rtribution (iv. 58). De mme en va-t-il de la maladie, etc. Sur le

par autrui, par soi


plnij^s

par la saison

froid,

en saison des

par

la

utuja, comparer Milinda, p.271, Visuddhimagga, 451, Compendium,

p.

161 (l'origine

de
ilc

la

douleur n'est pas envisage)

utuparinmaja
Dlgha,
iii.

figure

parmi

les huit sortes

souffrances, Milinda, 134-135.

139.

186

CHAPITRE
le

IV,

85

a-b.

dvelopp (hahulkria) \
de rtribution.
2. Si le
tre,
il
^

coupable renat en enfer

~.

Tel est

le fruit

coupable renat dans une existence humaine, par

le

meur-

est de vie brve


;

(alpyur hhavati)
illicite,
il il

par

le vol,

pauvre (hlioga-

vyasanin)
dra); par

par l'amour

a une pouse

infidle

(sasapatnab];

le

mensonge,

est

calonmi (ahhykhynahahiiln) [8

par la parole maligne, ses amis deviennent ennemis (hhinnapari-

vra)

par la parole injurieuse,

il

n'entend que des discours odieux


parole n'obtient
il

(amandparavana) ; par la parole inconsidre, sa pas crance (andeyavacana) ; par la convoitise,


dsirs

est de

grands
;

(maheccha,

vi.
il

6)
est

par la mchancet,

il

est de

grande haine

par la vue fausse,

de grande aberration, car l'aberration est


est le fruit d'coulement.
rtri-

grande dans

la

vue fausse. Tel

Mais, dira-t-on, une existence humaine, fut-elle brve, est la


bution d'un acte bon.

Comment

peut-on la regarder

comme

le fruit

d'coulement du meurtre ?
1.

D'aprs

le

commentaire,

le

Stra indique, par ces

trois termes, le prparatif

proprement dit (mailla), le conscutif (prsUia). Cette interprtation n'est pas admise par toutes les coles comme on verra ci-dessous, p. 187-S. la 2. La renaissance infernale est donne comme exemple de rtribution
(prayoga),
l'acte
;

renaissance animale, la renaissance

l'tat

de prta

etc.,

sont aussi rtribution.

3. [prnUptensevitena bhvitena bahulikrtena narakespapadyate] saced itthamtvam gacchati manusynm sablmgatm prntipaten- Karmaprajiiftpti Ipyur bhvati j adattdnena bhogavyasani bhavati (Mdo. 72, fol. 206 a) ... par le meurtre fort, on renat cliez les tres infernaux par le meurtre moyen, parmi les animaux; par le meurtre faible, parmi les Prtas. Mme doctrine dans Dasabhmaka, ii (cit Madhyamakavatfira, ii. 7, traduit Muson, 1907, p. 290). Comparer Anguttara, iv. 247 pntipdto bhikkhave sevito bhvito bahulikato nirayasantvattaniko tiracchnayoni^atftvattaniko pittivisayasaiftvattaniko j yo sabbalahuso pntijyta^sa vipko manussabhtassa appyukasamvattaniko koti ; Jfttaka, i. p. ^Ih: pndtiptakammam nma niraye tiracchdnayoniyam pettivinaye asurakye ca
:

manussesu nibbattatihne appyukasamvattanikatn hoti. Fragments du Kandjour (Karmavibhanga) Saddliarmasmj-tyupasthana (Lvi, Pour l'histoire du Itamayana, J. As., 1918, i. 9) cit Siksasamuccaya, 69 et suiv. Chavannes, Cinq cents contes, i. 198 etc. La quasi-impossibilit d'une naissance humaine pour le bla une fois qu'il
uibbatteti,
Feer,
;

est n en enfer

v,

les

nouveaux pchs que l'ancien damn commet, Majjhhna, voir J. Przyluski, Lgende d'Aoka, p. 120).

fcheux caractres de cette naissance (caste, etc.) et les i. 169 (Balapanditasutta;

Hitian-tsang,

xvii, fol.

8 a-9

a.

187

Nous ne
du meurtre

disons pas que celte existence soit


le

le fruit

du meurtre

nous disons que


:

coupable de meurtre sera de vie brve en raison

le

meurtre est la cause qui rend brve une existence

humaine qui
3.

d'ailleurs est cause par

un acte bon.
(alpau-

En
'

raison de la pratique intense du meurtre, les choses extles plantes,


;

rieures

jas

= alpavlrya)
de

le

sol, etc.

sont de
elles

petite vitalit

en raison du vol,
de
poussire
illicite,

sont accables par des


;

pluies

pierres,

ou d'acide (asanirajohahida)

en raison de l'amour

elles

sont couvertes de poussire ou

d'acide (rajovaklrna) ; en raison du mensonge, elles sont de

mauvaise
en

odeur (durgandha)

en raison de la parole maligne,

elles sont

fosse et en bosse (utkidanikida

= unnatanimna)
sol

en raison de la

parole injurieuse, elles sont imprgnes de sel et striles (sarajan-

gala)

il

s'agit des terres,

du

elles

sont dtestables (vipra-

kruda

= vigarhita)
sont petits

et pernicieuses

(ppika)

il

s'agit des plantes

en raison de la parole inconsidre, les saisons sont bouleverses

(visamartuparinmd hhy hhvh)


les
fruits
; ;

en raison de la convoitise,
les fruits

en raison de la mchancet,
les fruits

sont

acides

en raison de la vue fausse,

sont peu

nombreux ou

manquent. Tel

est le fruit de souverain. [9 a]

Est-ce en raison du meurtre


et,

mme

que

le

coupable renat en enfer

ensuite, ne jouit

que d'une courte vie humaine ?

D'aprs les uns, c'est en raison du meurtre

mme.

L'existence

infernale est le fruit de rtribution, la brivet de la vie est le fruit

d'coulement du meurtre. [En


tion,

effet, la

rtribution est toujours sensa-

vedan].
d'avoir une vie brve vient de l'acte proprement
'

D'aprs les autres, l'existence infernale vient du prparatif du

meurtre
Il

le fait

dit.

est vrai

que

le

Stra parle du meurtre

comme

cause d'existence
provoquent
70-71),
la

1.

Que

les

pchs rduisent
plantes,

dtrioration des

la dure de la vie humaine CakkavattisThanadasutta (Dgha,

et
iii.

Loka-

prajnSpti, xi (traduit
2.

aanih silvrstih
Le texte porte
;

3.

dans Cosmologie bouddhique, p. 309 et suiv.). / rajo dklivrsHh ksravrstir va (Vykhy). tatra prayogeneha maulenety apare.

188
infernale,
le

CHAPITRE

IV,

85-86

c.

mais

il

entend par meurtre, non pas

le

meurtre

seul,

mais

meurtre avec

le

cortge des actions qui l'accompagnent (sapariici


Il

vra). Ce qu'on appelle fruit d'coulement n'existe pas

part
reoit

(ntivartafe) du
le

fruit

de rtribution et du

fruit

de souverain.

nom

d'coulement en raison de la ressemblance entre la cause

et l'effet (tuer, avoir

une

vie brve

voler, tre pauvre, etc.).

Pourquoi
Celui qui

le fruit

des chemins de l'acte


le

est-il triple

commet

meurtre (prncitipta)
fait

fait souffrir celui qu'il

va tuer (vadhya)^
vigueur (ojas)
:

le

mourir

(maranam

krtamj, dtruit sa

85

c-d.

Le

fruit est triple,

parce qu'on
'

fait souffrir,

parce qu'on

fait

mourir, parce qu'on dtruit la vigueur.

Parce qu'on
nales
;

fait souffrir, fait

fruit de

rtribution

souffrances infer:

parce qu'on

mourir, fruit d'coulement

la vie est brve


:

parce qu'on dtruit la vigueur ^ fruit de souverain


rieures sont de petite vigueur.

les

choses ext-

De mme pour

les autres

chemins de

"^

l'acte.

De mme
dieux [9 b]
vie longue.

trois fruits des

bons chemins de

l'acte

par

le

renonce-

ment au meurtre
;

pratiqu, cultiv, dvelopp, on renat parmi les


ici-bas

si

on revient

dans

la condition

humaine, on a une
oppos celui des

Pour tous
la

les actes bons, le fruit


21)

actes mauvais. (Vibhasa, 113,

Bhagavat distingue
acte

mauvaise parole (mithyvc),


la

le

mauvais

(mithykarmnta),

mauvaise manire de vivre (mithy-

1.

duhkhann [inrand] ojonsant trividham phdlam


ii.

Comparer

Yogastra,
2.

34.
:

La vigueur rside dans le cur ojo hrdayapradee bhavati. adattdnafn ht kurvat dravyasvdmino duhkham utpditatn bhognvyasanam krtam ojo nitam / ato 'sya duhkhand bJiogatyajanad ojonsant ca trividhatn phalam // evam paradram abhigacchat parasya duhkham lUpditam sasapatnadrat krt ojo nitam yenaujas tejasvti
3.

loke nirucyate.

Hinan-tsang, xvu,
jiva)
et
'.

fol.

a- 10 a.

189
de la mithyvc

Est-ce dire que

le

mithyjva

soit distinct

du mithi/karmnta ?
Il

n'existe pas part


a-c.

86

Les actes corporels


la

et

vocaux qui naissent de

l'attache-

ment sont

mauvaise manire de vivre


difficile

elle constitue

une

cat-

gorie part, parce que

purifier.

L'acte corporel et l'acte vocal ns de la haine et de l'aberration

sont respectivement ce qu'on appelle

le

mauvais acte (mithykarl'un

mnta),

la

mauvaise parole (mithyvc). Ns de l'attachement,


que

et l'autre constituent la

mauvaise manire de vivre (mithyjva),


la

ainsi distingue parce

manire de vivre

est difficile

purifier.
:

L'attachement (rga), de sa nature, est un bandit (apahar)

on

garde difficilement la pense des actes que provoque l'attachement.

Par consquent,
vit, est difficile

comme

la

manire de

vivre, aussi

longtemps qu'on

purifier, afin

qu'on s'applique la purifier, Bhaga-

vat fait de la mauvaise manire de vivre une catgorie part. [10 a]


Il

y a une stance
1.

Le

lac

purifie

difficilement l'opinion,

tant

Saipyukta, 28,

13

VlbhasS, 116,

11.

Ce sont

trois

des mithyngas, Dlgha,

iii.

254.
iv.

h'jlva, d'aprs l'opinion rfute


la

86

c-d, est

seulement

le

moyen

d'existence,

manire de se procurer
2.

vivre, vtement, etc.


/

lus

dan nag

las

chags las skyes

log hthso sbyan dkalii phyir logs sig


j

bstan te

= [rgajam kyavkkaruta mithyjlvah prthakkrtah


p.

duhstiddheh]
244-245
:

Voir Vjvaprisuddhi, Visuddhimagga,


siijlvam ahirkena

22.

Dhammapada,

Le mithyjva est dcrit Astasahasrika, p. 334. atrha. Vibhasa, 116, 13. [duhsodh drstir grhina nityam] vividhadrstin / [bhiksun tv jva eva] paresv yattavrttin // Les superstitions du lac sont numres dans la Vyakhy kautukamangala3.

tithimuhrtanaksatrdidrsti.

Dict. de S* Petersbourg,
;

kautukamangala.
i.

Sur

les

mangalas,

voir Childers

neuvime

dit sur roc (Senart,

203)

Suttanipata, 258; Jataka, 87; Huber, Sotralainkara, 302.

- Mahavyutpatti, 266,

19
;

Waddell, Lamaism, 392 mangalaposadha. Lalita, 378, 9, mangalaptirna kumbha.

Grnwedel, Mythologie, 47

Le moine, qui dpend d'autrui pour la nourriture, etc., est port pratiquer kiihan lapan naimittikat naispesi[ka]t et lbhena lhhaniciklrs qui
sont autant de mithyjvas.

Voir

iv.

77

b-c.

190

CHAPITRE

IV,

86 C.87
;

b.

toujours la proie de multiples opinions


la

le

moine

purifie difficilement
.

manire de vivre, car sa subsistance dpend d'autrui

86

c-d. Si

on

dit qu'elle est

seulement
la vie,

l'acte issu
;

de l'attacbement

aux ressources ncessaires


contradiction avec
le

non

car cette opinion est en

Stra.

'

Si quelqu'un pense que danser, chanter,


plaisir n'est

<tc.,

pour son propre

pas mauvaise manire de vivre, parce que la mauvaise


les actes corporels et

manire de vivre comprend seulement


inspirs par l'attachement

vocaux

aux moyens de subsistance ^ nous rpon'\

dons

Non. En

effet,

Bhagavat, dans la Slaskandhika


dai hgal phyir

a enseign

1.

gai te yo byad la

ehags slan imlo


//]
;

min

= [vasltirgottha

cen cen
2. 3.

na stravirodhatah
...

littralement pariskra,

npakaranargotthas

jiviiopakarana, Mahvyutpatti, 289,

3-2.

llaskandhikym iti llaskandhiknm samnipte (Vykhyfi) il faut sllaskandhnfn .... La SlaskanJhika est la collection des sldcorriger
: :

skandhas. D'aprs le tibtain et Iliuan-tsang SlaskandhasQtra; Paramfrtha kidi tsi king : Slasamnipfitastra.
:

L'diteur japonais renvoie Sarnyukta 18,

21,

qui correspond Samyulla,


le texte vis

iii.

228 (l'homme qui mange


est
6,

la

bouche en bas,

etc.):

mais

par Vasubandhu

65

une rdaction sanscrite des slas de Brahmajla et Samannaphala (Dgha, i. Lotus de la Bonne Loi, 465 Rhys Davids, Dialogues, i. 17 0. Franke,
;
; ;

Dgha

in

Auswahl,

p. 5).

Le texte fourni par


le

la

Vykhyfi s'carte du
:

pli

comme

des versions chinoises du Dlrgha. Nous

copions tout au long

yathd Tridandinn

^^

eke

sratnanabmhmanh sraddhdeyam paribhujya

amiyukt viharanti j tadyath hastiyuddhe 'svayuddhe ratliayuddhe pattiyxiddhe yas iyuddhe mustiyuddhe srasayuddhe vrsabhayuddhe mahisayuddlie ajaytiddhe mesayuddhe kukktitayuddhe vartakayuddhe lbakayuddhe stryuddhe purusayuddhe kumraynddhe ktimrikytiddhe ndgrane ttdytkikdym b dhvajgre bagre senvyhe anikasamdarsane mahsamjam va pralyannbhuvuniy

vividhndarsanasamrambhnuyogam

evamrpc chramano vividhadaranasamrambhmiyogt pratiyath Tridandinn eke sruntanabrhmanh sraddh// deyam paribhujya vicidhasabdasravanasamrambhnuynkt viharanti / tadyath rathasabde pattisabde unkhsabde bhersabde dambaraabde
eke
I

ity

virato bhavati

nrttaabde gltabde geyuabde ^ ucchatsabde pnisvare kimbhatnre citrksare c citrapadavyanjane Jokyatapraiisamyukte d khyyik va rotum icchanty eke ity evamrpc chramano vividhasabdaravanasamrambhmtyoyt prativirato bhavati jj
'
/

Hiian-tsang,

xvii, fol.

10 a-b.
est

191

que

la

vue des combats d'lphants,


pourquoi ? Parce que

etc.,

mauvaise manire de

vivre. Et

c'est jouir

de mauvais objets (mithyci'

visayaparibh oga).

Nous avons vu

(ii.

56) qu'il y a cinq fruits, fruits de souverain

(adhipati), d'activit virile (purusakra), d'coulement (nisyanda),

de rtribution (vipaka), de disconnexion ou de libration (visamyo-

gaphala).

On demande combien

de fruits comportent les

diff-

rentes espces d'acte.

87
fruits.

a-b.

Impur, dans
^

le

chemin d'abandon,

l'acte

comporte

les cinq

[10 b]

Le chemin d'abandon (prahnamrga)


qu'il

est ainsi

nomm

parce

a pour but l'abandon (pralinrtham) ou parce que les passions

sont abandonnes grce lui (prahyante 'nena). C'est le chemin

nomm nantarya
deux
sortes,

qui sera dfini plus loin


et

(vi.

28, 49) et qui est de

pur (ansrava)

impur (ssrava).
une rtribution agrable qui
;

L'acte qui fait partie du chemin d'abandon impur, comporte les

cinq fruits

1.

fruit

de rtribution

appartient au

mme

tage que l'acte

2.

fruit
l'acte,

d'coulement
postrieurs
:

des

dharmas
Sur

ns du recueillement, pareils
;

(sam-

dhij dtare sadrs dharmh)


a.

3. fruit

de disconnexion
la liste

la discon-

les Tridandiiis

(tedandika, traidandika) voir


iii.

des confrries et

asctes htrodoxes dans Angiittara, niddesa, 89, 310, 416


;

276, Majjhima, 57, Milinda, 191,


i.

Maha-

les

notes de Rliys Davids, Dialogues,


ii.

220, Bendall,

Siksasamuccaya, 331
b.

Foucher, Gandhra,

262.

MS. ndylavase utsatikym


Thomas).

(lecture

de Cambridge communique par


51 et 53.
ii.
:

E. J.

Correction d'aprs Mahvyutpatti, 261,

Comparer

Pratimoksa, Pc. 48-50


c.

= Ptayantik 47, Finot,


kacite cUrksare.

J.

As. 1913,
iii.

512.

MS. ayysabde

...

Dglia,
v. p.

183

nacca glta vdita

akkhna pnissara kumbhathna

(Jatuka,

506,

vi. p.

276: ktimbhathna,

thnika ; Mahavastu, ii. 150, iii. 113: kumbhatni, tuna, tnika, thnika ; cakrikavaitlikanatanartakarlamallapnisimrik obhik langhakktimbhatiinik
d.
1.
...).

Lire praiisamyiikt
drir

(?)
/

bcas spon bahi lam dag gi

l'acte^ c'est--dire

las ni liia yis hbras


/]

bur bcas

= [prahna
ParamarLes

mrge samaam] saphalam [karma pancabhih


2. Pareils

qui ne sont ni purs, ni non-dfinis.


ii.

tha et Hiuan-tsang, d'aprs les dfinitions de


postrieurs, pareils,

52, traduisent

dharmas

gaux ou suprieurs

192
nexion d'avec
virile
(a) le
:

CHAPITRE
les passions,

IV,

87-89

b.

l'abandon des passions

4. fruit d'activit

les

dharmas que

cet acte fait natre (taddkrsta), savoir


vi. 28), (b) les

dharmas dharmas futurs dont cet acte fait obtenir la possession (yac cngatam hhvyate), (d) l'abandon luimme ' 5. fruit de souverain tous les dharmas conditionns en exceptant l'acte en question, en exceptant les dharmas dj ns
chemin de dlivrance (vimuktimrga,
',

qui coexistent (sahahhj

(c) les

(ii.

59).
c.

87

Pur,

il

comporte quatre

fruits

Les prcdents, en exceptant

le fruit

de rtribution.
*.

87

c-d.

De mme

aussi tout acte diffrent, impur, bon ou mauvais

L'acte qui ne fait pas partie du

chemin d'abandon, qui

est

impur,

qui est bon ou mauvais, comporte aussi quatre fruits, en exceptant


le fruit

de disconnexion.

88
Le

a-b.

Le

reste de l'acte

pur

et l'acte non-dfini, trois fruits.

reste de l'acte

pur

c'est--dire

l'acte

pur non inclus dans

le

chemin d'abandon, mais faisant partie des prayoga-vimuMi-visesa-

mrgas

(vi.

65

b)

ne comporte
fruits

ni fruit

de disconnexion, puisqu'il

n'est pas cause d'abandon, ni fruit de rtribution, puisqu'il est pur.

Les deux
soit

mmes

manquent aussi
anivrtvykrtaj.

l'acte non-dfini, qu'il

ou non

souill (nivrta,

Quelle peut tre la nature, bonne, mauvaise ou non dfinie des


fruits des diffrents actes ?
1.

Vyfikhya
les

C'est--dire les

dharmas associs
;

la

pense

et les

soci de la pense (jii, etc.)

voir

ii.

35.

D'aprs VihhfisS

(9, 11) les

dharmas dissaha-

bhs sont
2.

rpas

et les

viprayuktas concomitants (annvartin).

purusakraphalam tadkrst dharmas tadyafh vimiktimrgah sahabhuvo yac cngatam bhvyate tac ca prahnam. Le prahna est donc
la fois fruit
3. dri
4.

de disconnexion

et fruit d'activit virile.

med

bzhi yis =r [catiirbhir


/

amalam]

zag bcas gzhan


II

dge da

nii

dge ga yin pa ha

= [anyat ssravafit] yac


/

chubhnbham
5.

ansruvatn punah esam avykrtam ca yat tribhih

Hiuan-tsang,

xvii, fol.

10 b-11

b.

193

88
Les

c-d.

Des dharmas bons, mauvais, non-dfinis, constituent


'

quatre, deux, trois fruits de l'acte bon.


fruits

d'coulement, de disconnexion, d'activit virile et de

souverain de l'acte bon sont de bons dharmas. Le fruit de rtribubution, de sa nature, est non-dfini
(ii.

57).

Les

fruits

d'activit

virile et

de souverain de l'acte bon sont de

mauvais dharmas.

Le
fruit

fruit

d'coulement d'un acte bon est ncessairement bon

le

de disconnexion est bon de sa nature.


fruits

Les

de rtribution, d'activit

virile

et

de souverain de l'acte

bon sont des dharmas non-dfinis.

89

a-b.

Des dharmas bons, mauvais, non-dfinis, constituent,


trois,

dans Tordre, deux,


L'expression

quatre fruits de l'acte mauvais.


signifie

anukramam

yathakramam.
de matrise, de l'acte mauvais

Deux

fruits, fruits d'activit virile et

sont de bons

dharmas.

Trois fruits

en cartant

les fruits

de rtribution et de discon-

nexion

sont de mauvais
fruits

dharmas.

Quatre

en

cartant le fruit de disconnexion

sont des

dharmas non-dfinis. On admet donc que le fruit d'coulement (nisyandaphala) de dharmas mauvais peut tre constitu par des dharmas non-dfinis. Deux non-dfinis, la croyance la personnalit Comment cela ?
'

(satkyadrsti)

et la

croyance au pass
[11
b]

et

au futur d'un moi (anta-

grahadrsti)
1.

(v.

b),

sont fruit d'coulement de

dharmas

catvri dve tath trni kualasya [ubhdayah]

//

Supplez

anukramam,

clans l'ordre

d'aprs

le

quatrime pda, 89 b

(Bhsya).
trlni catvry amikramam j y avoir ressemblance entre le sahiigahetu et son fruit, qui est le nisyandaphala. Or le dharma mauvais diffre du diiarma non-dfini (dans l'espce du dharma souill-non-dfini, nivrtvylcrta), puisqu'il comporte rtribution. Mais l'un et l'autre sont souills (klista), ce qui constitue ressem2.

asubhasya uhhdy dve


doit

3.

Il

blance.

13

194
:

CHAPITRE

IV,

89 c-91

c.

mauvais savoir des passions universelles (sarvatraga,


passions de la classe rga,
douleur.

ii.

54, v. 12)
et des

qu'on abandonne par la vue de la douleur et de l'origine,


etc.,

qu'on abandonne par la vue de la

89

c-d.

Les

mmes dharmas,

des

dharmas

bons, mauvais,
'

non-dfinis

constituent deux,

trois, trois fruits

de l'acte non-dfini.

Deux

fruits,

fruit d'activit virile et

de souverain, sont de bons

dharmas.
Trois fruits

en
etc.,

cartant les fruits de rtribution et de discon-

nexion

sont de mauvais dharmas. En effet des dharmas mauvais


(ii.

des cinq catgories

52

b),

abandonner par

la

vue de la vrit

de la douleur,

sont

le fruit

d'coulement de deux non-dfinis,

savoir de la saikyadrsti et de Vantagrhadrsti.

Trois fruits

les

mmes que

ci-dessus

sont non-dfinis.

En

ce qui concerne l'poque, l'tage, etc.


a.

90

Des dharmas de toute


*

sorte constituent quatre fruits de

l'acte pass.

Tous
l'acte

les

dharmas ou
Il

des

dharmas

de toute sorte, c'est--dire

passs, prsents et futurs> peuvent constituer quatre des fruits de

pass \

faut excepter le fruit de disconnexion qui est hors du

temps.

90

b.
*

Des dharmas futurs constituent quatre

fruits

de l'acte

mdian.
1.

avykrtasya dve trlni trlni caite uhhadayah II hdas pahi tliams oad bzhi yin no [catvry atitasya sarv] 3. Soit un acte pass. Le tlharma pass, n aprs cet acte, et qui en est la rtribution, est son fruit de rtribution les dharmas qu'il a attirs (krsta),
2.

que ces dharmas soient ns en mme temps que lui ou immdiatement aprs lui, sont son fruit d'activit virile tous les dharmas qui sont ns avec lui ou qui, ns depuis, sont maintenant passs, sont son fruit de souverain; tous les dharmas pareils, ns aprs lui et maintenant passs, sont son fruit d'coulement. De
;

mme des dharmas prsents et futurs 4. madhyamasypy angath /

constituent quatre fruits de l'acte pass.

Hiuan-tsang,

xvii, fol.

11 b-12

b.

195

L'acte mdian, c'est--dire prsent, a quatre fruits


le fruit

de disconnexion

qui sont des dharmas


dharmas
fruit

en cartant

futurs. [12 aj

90

c. Il

en a deux qui sont des

mdians.

Des dharmas prsents sont


virile

de souverain et fruit d'activit

de l'acte mdian.
c-d.

90

Pour

l'acte qui n'est

pas encore n,

il

trois fruits consti-

tus par des

dharmas

futurs.

Les

fruits

de rtribution, de souverain, d'activit


(ii.

virile.

L'acte

futur n'a pas de fruit d'coulement

57

c).

91 a-b. Des dharmas du mme tage des dharmas d'nn autre tage constituent

constituent quatre fruits


trois

ou deux

fruits.

en cartant qui sont des dharmas de son tage (svahhfruit de disconnexion


Un
acte d'un certain tage produit quatre fruits

le

mika).

Des dharmas purs appartenant un tage


l'acte constituent trois fruits

diffrent de celui de

de cet acte

fruits d'activit virile,


ii.

de

souverain

et aussi

d'coulement, d'aprs la rgle

53.

Des dharmas impurs appartenant un tage


l'acte constituent les fruits d'activit virile et

diffrent de celui de

de souverain de cet acte.

91

c.
^

Des dharmas aiksa,


[12 b]
'

etc.

constituent trois fruits de l'acte

saiksa.

Des dharmas

caractristiques du saint qui n'est pas

Arhat
et

'

(saiksa) constituent les fruits d'coulement, d'activit

virile

de

souverain de l'acte saiksa.


bar

ma

gnis so =^ [dve
/

2.

ma

skyes pahi
//]

hbras bu

madhyam] ma bons gsiim

yin no

= [ajtasya phalatrayam =

angath
3.

ran gi sa pa bzbi yin no


slob pahi slob

tu catvri trlni dve


4.

[svabhmiks gzban gyi sa pa gsum dan giis / cnyabJmmikh] la sogs pa gsum =: [saiksasya trlni saiksdyh]. La

disconnexion n'est ni saiksa ni asaiksa.

Voir

vi.

45,

ii.

38

a.

196

CHAPITRE
*

IV,

91 c-94

b.

De mme des dharmas caractristiques de l'Arhat (aaiksa). Des dharmas ni'Saiksa'm-asaiksa constituent les fruits d'activit
'

virile,

de souverain
b.

et

de disconnexion de l'acte saiksa.


etc.
*

91 d-92
fruits,

Des dharmas aiksa,


de l'acte aaiksa,
fruit

constituent un

fruit, trois

deux

fruits

etc.

Des dharmas saiksa sont

de souverain de cet acte. de souverain, fruit d'coulement,

Des dharmas asaiksa sont


fruit d'activit virile

fruit

de cet acte.
fruit

Des dharmas m-saiksa'm-asaiksa sont


d'activit virile de cet acte.

de souverain

et fruit

92
fruits,

c-d.

Des dharmas saiksa,

etc.

constituent deux fruits, deux


^

cinq fruits de l'acte diffrent des deux prcdents.

Il

s'agit de l'acte ni'Saiksa-ni'asaiksa


et des

(naivasaiksansaiksa).
sont fruit d'activit

Des dharmas saiksa


virile et

dharmas asaiksa

de matrise de cet acte.


les cinq fruits

Des dharmas ni-saiksa-n-asaiksa sont

de cet acte.
la

93

a-b.

Des dharmas susceptibles

d'tre

abandonns par

vue

des vrits (darsanaheya), susceptibles d'tre abandonns par la

mditation (hhvanheya), non susceptibles d'tre abandonns (%)r-

heya), constituent trois


tible d'tre

fruits,

deux

fruits,

un
'

fruit

de l'acte suscep-

abandonn par

la

vue des

vrits.
fruit

[13 a]

Des dharmas darsanaheya sont


virile et

de souverain, d'activit

d'coulement de l'acte darsanaheya.


fruits

Des dharmas hhvanheya sont quatre


le fruit

de cet acte

carter

de disconnexion.
slob las kyi hbras bu ni
slob pa yi ni cbos la sogs
}

1.

ini

gftis
2.

yin no

= [aaiksasya tu karmanah
/

de las gzhan pahi bbias bu ni

slob

dan / gcig dan gsum aiksadJiarmddayas sogs gfiis dan gilis dan Ina [aiks'

dayas tadanyasya dve dve phalni panca ca //J 3. nitlion bas span byabi de la sogs / gsum daii bzhi da daranaheyasya catvry ekam] tadfidayah / tadadayah daranaheydayah

gcig yin no

= [trlni

Hiuan-tsang,

xvii, fol.

12 b-13

a.

197

Des dharmas aprheya sont

fruit

de souverain de cet acte.


trois fruits

93

c-d.

Les mmes dharmas constituent deux, quatre,

de l'acte susceptible d'tre abandonn par la mditation (hliva-

nheya).

Des dharmas darsanaheya sont


souverain de l'acte hhvanheya.

fruit d'activit virile et fruit

de

Des dharmas hhvanheya sont quatre


le fruit

fruits

de cet acte

carter

de disconnexion.
fruit d'activit virile,

Des dharmas aprheya sont


et

de souverain

de disconnexion de cet acte.

94
deux

a-b. Les

mmes dharmas

constituent, dans l'ordre,

un

fruit,

fruits,

quatre fruits de l'acte non susceptible d'tre abandonn


-

(aprheya).

Des dharmas darsanaheya sont aprheya.

fruit

de souverain de l'acte

Des dharmas hhvanheya sont


virile

fruits

de souverain

et d'activit

de cet acte.

Des dharmas aprheya sont quatre


fruit

fruits

de cet acte

carter le

de rtribution.

Le texte porte yathkramam,


ci-dessus
(iv.

respectivement
le

de

mme

que

89 b)
ici

il

porte

aniikramam dans

sens de yathkra-

mam.

Il

rpte

respectivement

on en conclura que ce mot


Tel
est,

doit tre suppl

dans chaque

dfinition.

en

effet, le

procd

des rsums (ahhisamksepanyyah)

Dans l'expos de

la doctrine

de l'acte se pose encore la question

1. bsgom pas span bar bya las kyi / de dag gnis dan bzhi dan gsum dve catvri trni bhdvanheyakarmanah II]

[te

tu

te
2.

= darsanaketfdayah
span bya min pahi de dag gcig
te tv
/

gnis dan bzbi ste go rim bzhin


/

= aprahequi

yasya
3.

ekam dve

catvri

yathkramam

Le

fruit d'activit virile

abandonner par

bhvan
pur.

de bons

dharmas

se produisent la sortie (vyutthne)

du chemin

198
suivante
:

CHAPITRE
le

IV,

94 c-95

b.

Trait (Jnanaprasthna)

distingue

l'acte

convenable

(tjogavihita), l'acte non-convenable (ayogavihita), l'acte ni-conve-

nable-ni-non-convenable. Quelle est la dfinition de ces trois actes ?


[13 b]

94

c-d. L'acte

non-convenable est
'

l'acte souill

d'aprs quelques-

uns, aussi l'acte irrgulier.

Quelques-uns disent que

l'acte

non-convenable est

l'acte

souill

(klista) parce que celui-ci procde d'un


d'autres, l'acte irrgulier

jugement vicieux ^ D'aprs

(vidhiprabhrasta) est aussi acte non-contient,

venable

lorsqu'une personne marche, se

mange, se vt autre-

ment

qu'elle

ne

doit, ces actes

qui sont non-souills-non-dfinis


cette

(anivrtvykrta)

sont
ou bien

non -convenables (ayogaviMia), car

personne agit contrairement l'usage reu (ayoga).

Mme
ou bien

divergence de vue en ce qui regarde l'acte convenable


l'acte

c'est

l'acte bon,

bon

et l'acte rgulier

(avidhipra-

hhrasta). L'acte qui diffre du convenable et du non-convenable est

ni-convenable-ni-non-convenable.

Un

acte projette-t-il (ksipati) une naissance ou plusieurs nais-

sances ? Plusieurs actes projettent-ils une naissance ou plusieurs


naissances ?

D'aprs

le

systme de l'Ecole (siddhnta)


acte projette une naissance.
il
^

95

a.

Un

Par naissance, jamnan,


proprement
dite (jti),

faut entendre, non pas la naissance


ii.

mais une existence (nikyasbliga,

41

a).

Celui qui arrive une existence, on dit qu'il est n.


1.

rigs

Variante
bhrastam
'

min bakyed pa non mous eau kha ciy cho ya narns pa han sites cho ga nams pa ehe ho. [ayogacihitam klislam vidhipra'
j j
:

...

ity

ParaniRiiha
2.

api H] ayogavihita

fei-li-ls

Hiuan-tsaiig

jou-Tng-tso.

ayoniomanaskra
...

ayonya anyyena klesayogena yah pravrtto

manaskrah
3. ekafft

(Vyakhya).

janmksipaty ekam.

D'aprs Vibha:^,

19, 16-20,

14.

Mme

doctrine dans YogasQtra,

Hiuati-tsang,
1.

xvii, fol.

13

a-

14

b.

199

Un

acte projette une naissance et

non pas

plusieurs.

Le Sautrantika.
le

Cette thse est en contradiction avec ce que dit


:

Sthavira Aniruddlia

Par

la

rtribution de cette seule


fois

aumne
riches

(pindapta), aprs tre n jusqu' sept


trois,

chez les dieux Trente-

finalement (yvat) je suis


'

n dans la famille des

Skyas

Rponse.
prosprit

Aniruddha,
;

par cette aumne, a obtenu une grande

(samrddhi)

il

a obtenu

le

souvenir des anciennes nais:

sances

il

a accompli beaucoup de nouvelles uvres mritoires

s'exprimant
dpart
'.

comme

il

fait,

il

prtend indiquer ce qui a t

le

point de

C'est ainsi qu'un

homme

acqurant une
:

somme

de mille au

moyen d'un

seul denier, peut dire


.
^
:

C'est par un denier que j'ai

acquis cette fortune

On rpond
au

[14 b] encore

Aniruddha, en raison de son aumne,


volitions

sujet de son

aumne, a produit de nombreux courants de


fruit.

chaque volition appartient un


2.
s'il

Plusieurs actes ne projettent pas ensemble une naissance


tait ainsi, la projection

car,

en

des existences aurait lieu par fractions

(hhgasah). Mais on admet que, une existence tant projete par un


seul acte,

95

b.

Plusieurs actes compltent, remplissent une existence.

Par la rtribution d'une seule aumne de nourriture dans le 1. Paramartha temps pass, je suis sept fois revenu natre chez les Trente-trois-dieux sept fois, j'ai t roi Cakravartin et maintenant je suis n dans la riche famille des Sfikyas .
:

Hiuan-tsang^ dont
et sept

le

texte est plus dvelopp, a aussi sept naissances divines

naissances humaines en qualit de Cakravartin.


le

au Pratyekabuddha TagaraDhp. 355) d'aprs Theragath, 910 (voir trad. p. 329), Uparittha qui reoit l'pithte de Yasassin Uparittha et Yasassin figurent d'ailleurs comme des Pratyekas distincts dans la
D'aprs la VySkhya,

don d'Aniruddha
iii.

fut fait

sikhin (un des Pratyekas de Majjhima,

69, Jtaka, 390,

du Majjhima. hdi des hbyor pa rned nas tshe rabs dran pa dan yan bsod nams gzhan byas pas ... sa tena sanircldhim labdhv jtismrtim anyni ca punyni krtv tadutthnam darsayati .... 3. yan smras pa. Hiuan-tsang En outre, certains disent ... .
liste
2.

4.

anekam pariprakam

200

CHAPITRE

IV,

95 b-96.

De mme qu'un

peintre dlimite d'un seul trait le


'

champ de

l'image,

et remplit ensuite cette image

de mme, bien que leur qualit

d'homme membres
certains

soit la et

mme,

certains
;

sous-membres

certains

hommes ont, au complet, organes, hommes sont beaux par l'excelcela.


-

lence du teint, de la figure, de la taille et de la force, tandis que,

hommes, manque
seulement

ceci

ou

Ce

n'est pas

l'acte qui projette

une existence projettent


:

aussi tous les dharnias qui comportent rtribution (savipka),

savoir la sensation,

etc.

Cependant [15 a]

95

c-d.

Ne
*

projettent ni les deux recueillements d'inconscience ni

les prptis.

Bien

qu'ils
(ii.

comportent rtribution,

les

deux recueillements

d'in-

conscience

42) ne projettent pas, parce qu'ils ne coexistent pas


l'acte.

(saha na bhavatah) avec


elles coexistent.
'

Les prplis
fruit

(ii.

36) ne projettent
l'acte

pas, parce qu'elles n'ont pas le

mme

que

avec lequel

1.

dper na

ri

mo mkhan

gyis

ri

lu (?) gcig gis gziigs kyi sa

bcad nas yons su

rdzogs par byed pa dan hdra


d'un

sle.

Paramariha

Comme un

rpa
Si

dessine l'image d'un

homme

et la remplit

peintre au moyen au moyen de nombreux

rpas.

homme

un homme possde au complet les organes (sakalendriya), si un autre ne les possde pas au complet (vikalendriya), cela ne tient pas la diversit de l'acte de remplissage (pariprka karman), car l'il et les autres organes sont fruit de l'acte qui projette l'existence (ksepakakarmaphala) Les six organes (sadyatana) sont projets (ksipyate) . Mais le teint
2.
'

'

'

'

(varna), la
3.

figure, etc.,
:

sont

le fruit

de

l'acte

de remplissage (Vyakhya).

Hiuan-tsang Ce n'est pas seulement l'acte qui projette et remplit une existence, mais encore tous les dharmas comportant rtribution. Mais, en raison de l'importance capitale de l'acte, on ne parle que de l'acte. Cependant ces dharmas, lorsqu'ils ne coexistent pas avec l'acte (saha), sont capables de remplir
et
ni les

non de projeter, parce que leur force est petite. Deux catgories Ne projettent La sensation et les autres mentaux associs deux recueillements ....
:

la
4.

cetan, volition, qui est acte, projettent avec

elle.

sems med sfloms par hjug pa dag / hphen byed ma yin thob pa han min [acUtakasampaUl nksipato na cptayah /J tadaksepakena karmana saha5. karmananekaphalatvat - Vyakhya
:

Hiiian-tsang,

xvii, fol.

14 b-15

a.

201
:

Bhagavat

dit

qu'il

y a

trois

varanas ou

obstacles

l'obstacle

constitu par l'acte, ou obstacle d'acte

(karmvarana),

l'obstacle

constitu par la passion (klesdvarana), l'obstacle constitu par la


rtribution

(vipkvarana).

Quels sont

les trois obstacles ?

96. Les actes iVnantarya

la passion chronique

les

mauvaises
^

destines, les Asarnjnisattvas et les Kurus, tel est le triple obstacle.

L'obstacle qui consiste en acte, c'est les cinq pchs mortels (nantarifa)
:

le

matricide, le parricide, le meurtre d'un Arhat, le schisme,


^

blesser le Tathgata avec une pense de haine.

bhavantyo 'pi prptayo na tenaica saphalh. Voir Vibhsa, 19, 13, l'opinion de Ghosaka les prptis ne sont pas capables d'attirer la sabhgat, etc.
:

Hiuan-tsang ajoute
et remplissent
1.
.

Les autres [dharmas comportant rtribution] projettent


4, 6, etc.

Mme

doctrine Bodhisattvabhrai,

i.

Dans

les sources plies,

comme ici, Vvarana est ce qui empche l'entre dans le Chemin, ce qui fait qu'un homme est ahhavya. Les trois varanas sont nomms Anguttara, iii. 436, Vibhanga, 341, mais associs trois autres dharmas (asaddho ca hoti acchandiko ca duppaniio ca). [Les varanas de Samyutta, v. 77, Dgha, 246,
i.

sont des obstacles au Vinaya, des

nvaranas

(voir Kosa, v. 59)].

la

Le Grand Vhicule, par klesa ei jileyvarana, dsigne non pas les obstacles bkavyat, la qualit de pouvoir entrer dans le chemin, mais les obstacles
de la pense.

la dlivrance

De mme, Kosa,
l'

vi.

77, la

pense est
iv. 30.

couverte

par une vrti, except la pense de

Arhat.

Yogastra,

Le karmvarana de Sikssamuccaya, 280, etc. est le karmvarana de les aksanas, auxquels s'opposent les quatre roues, correspondent partiellement au vipkvarana. (Mahvyutpatti, 120, 83 Nanjio 728 et autres sources, Religieux Eminents, 70, Cinq cents contes, i. 32, 231, etc.). 2. mthsams med pa yi las rnams dan / non mons sas chen nan hgro dan / hdu ses med pahi sems can daii / sgra mi siian sgrib gsum du hdod / [nantaryxii karmny abhksnakleso ditrgatayah / asamjnisattvh ktirava varanatrayam matam //] Comparer les dfinitions de Visuddhimagga, 177. 3. C'est l'ordre de Vibhanga, p. 378 dans Mahvyutpatti, 122, le meurtre de l'Arhat prcde le parricide; dans Dharmasamgraha, 60, la blessure du Tathfigata
l'Abhidharma
; ; ;

prcde
i,

le

schisme.
vi.)

Suttanipta, 231 (Khuddakapatha,

six
3.

choses impossibles un rya, savoir


4,

arahantaghta,

lohituppda,

5.

abhithnas Anguttara, i. 27 1. mtughta, 2. pitughta, samghabheda, 6. anfiasatthu-uddesa


:

six

202

CHAPITRE

IV, 96.

L'obstacle qui consiste en passion, c'est la passion chronique.

La
:

passion est de deux sortes, chronique [15 b] et violente (livra)

la

passion chronique est la passion continuelle, la passion violente est


la passion
forte

(adhimtra).
c'est le cas,

La passion

chronicpie constitue

obstacle,

comme

par exemple, chez les eunuques. La


ft-il terrible,

passion qui surgit de temps en temps, son lan


tre vaincue,

peut

mais non pas

la passion continuelle,

mme
;

languissante.

L'homme en
devient forte

qui elle se continue ne trouve pas le temps de faire effort


petite,
elle

pour la vaincre. De
:

devient mdiocre

de mdiocre,

elle

donc

elle fait obstacle.

[6. signifie
ii.

sans doute
iii.

reconnatre un autre matre que

le

Bouddha

].

numre six choses qui rendent un homme abhavya, incapable d'entrer dans le Chemin .... A savoir 1-5 de la liste prcdente, plus duppanno hotijalo elamgo. iii. Cullavagga, vii. 3,9: idam devadattena pathainam nantarikakammam upacitam yam dutthacittena vadhakacittena tathdgatassa rtidhiram uppditam ; vi. 17, 3, les cinq nantaryas de la liste classique numrs ple mle
Anguttara,
436,

avec
iv.

le viol

d'une Bhiksun, la qualit d'animal,

etc.

Dhammasangani, 1028
:

(AtthasSlin, p. 358) dfinit les six

dharmas

qui
iii.

causent ncessairement une mauvaise destine (micchaUaniyata, voir Kosa,

paiica kamntni anantarakni yd ca micchdiithi niyat les cinq actes nantarya et la vue fausse niyata . Puggalapannatti dfinit comme vous la perdition (niyata) : paiica puggal nantarik yeca micchdiiihikd
44
c-d)

les

cinq coupables

d'nantarya

et les

hommes de vue
?

fausse

Que

faut-il

entendre par
explique

vue fausse niyata

L'Atthasfilin

natthikavdesu annatar
those

micchdiithi niyat ti ahettivda-akiriyavda one or other of the assuredly vvrong views of


:

who do
et

not believe in cause, deny the eflicacy of action, are nihilists

(Maung Tin
iii.

Rhys
de

Davids). Traduisons plutt

La vue fausse niyata


ngation

des vues de ngation de la cause, ngation de


78).
11

l'acte,

une (Voir Majjhima,


est

s'agit

la

vue fausse (ci-dessus

p. 167) qui,

l'exclusion des autres


:

vues fausses, constitue le chemin-de-l'acte nomm vue fausse, AtthasalinT, p. 101 natthikhetuakiriyadiithlhi eva kammapathabhedo hoti na annaditthhi. [Parmi les autres vues fausses, par exemplela satkyadrsti]. Est donc niyata
la

vue fausse proprement


iv.

dite, laquelle,

dans

le
'

Koa, rompt les racines de bien


signifie

(n^stidrsfi,

79).

Vue

fausse niyata

vue fausse comportant

niyama,
avons vu
V.

certitude, c'est--dire
:

celui qui l'adopte


(iv.

micchattaniyama, certitude de perdition , pour d'aprs l'Abhidhamma ce mcrant est vou la perle nous
;

80 d) que la doctrine de l'Abhidharma diffre. Vibhanga, p. 378, numre les cinq kammni nantarikni.

Hiiian-tsang,
L'obstacle qui consiste en
destines

xvii, fol.

15 a-i6
c'est

a.

203
mauvaises

rtribution,

les trois

et

existence infernale, existence animale, existence de prta une partie des bonnes destines existence bumaine dans
faut-il
fait

rUttarakuru, existence divine chez les dieux inconscients.

Que

entendre par obstacle ?


obstacle au

Ce qui

Chemin

et

aux racines-de-bien prparatoires


etc. (vi. 17).

(pryogika) au Chemin, usmagatas,


Objection.

On devrait mentionner comme obstacle d'acte, comme


la naissance de l'uf,

actes faisant obstacle, d'autres catgories d'actes ct des pchs

mortels. Les actes qui produisent ncessairement les mauvaises destines, etc.

(apmjdiniyata) \ qui produisent

la naissance de la sueur, la naissance

en qualit de femme, huit nais-

sances, font obstacle.

Rponse.

Ne

sont mentionns

ici

que

les actes

aisment discer-

nables par les autres (sudaraka) et par l'agent lui-mme (supra-

jnaka),

et cela

cinq points de vue. L'acte en quoi consistent


c'est
;

les

pchs mortels,
fruit est pnible

meurtre, mensonge, prparatif de meurtre


;

son

la destine qu'il produit, est Tenfer


;

l'poque de sa
le

rtribution est l'existence prochaine

le

coupable lui-mme reoit


l'acte qui est

nom

de parricide

...

cinq points de vue,


-

pch mortel

est ais

discerner.

Parmi

les obstacles, le plus

grave (sarvappidha) est l'obstacle de

passion, ensuite l'obstacle d'acte. Car ces deux obstacles rendent

incapable de salut (ahhavya), non seulement dans la prsente existence,

mais encore dans l'existence prochaine.

D'aprs
il

les

Vaibha-

1.

Les mauvaises destines,

etc. >
(ii.

Par et ctera
41
b-c), la

faut entendre les actes

qui produisent l'tat d'inconscience


(iv.

naissance en qualit de

Brahma

ou androgyne. Toute personne qui entre dans le chemin obtient la dlivrance aprs sept naissances au maximum (vi. 34 a-b) donc la personne qui a fait un acte produisant une huitime
44 b-d,
vi.

38

a-b), la

naissance

comme eunuque

(astama bhava) ne peut entrer dans le Chemin (Voir SuttanipRta, 230). 2. Le texte porte [2)ancaclh] sudarsakni suprajnakni j adhisthnatah phalato gatita upapatUtah pudgalafa ca. On peut entendre .... la le coupable est homme destine o ils se produisent est la destine humaine
existence
:

....

ou femme, ni eunuque, ni androgyne

204

CHAPITRE

IV,

96-97.

sikas (Vibhasa, 115, n), robstacle de passion est le plus grave parce,
qu'il

produit l'obstacle d'acte

l'obstacle d'acte est plus lourd que

l'obstacle de rtribution parce qu'il produit cet obstacle.

Quel est

le

sens du terme

nantarya

'

Les cinq pchs mortels sont


peuvent tre
'

nomms nantarya

parce qu'ils ne

traverss

'

(antarita), c'est--dire

empchs (ahM-

hhta), dans leur rtribution par des actes qui devraient tre rtribus

dans la prochaine existence


renat, aprs cette vie,

-.

Ou

bien le coupable du pch mortel


;

immdiatement (anantaram) en enfer


*

le

coupable est donc un anantara, un

sans-intermdiaire

' ;

on

nomme
est

donc nantarya

dharma par la possession duquel le coupable anantara, comme on nonmie rmanya le dharma qui fait quelqu'un un ramana (vi. 51)
le

de

Dans

quelles sphres d'existence se trouvent les obstacles ?

97
des
le

a.

Pch mortel dans

trois continents

[16 b]

Les habitants de l'Uttarakuru

et les tres vivants qui

ne sont pas
forte raison

hommes

ne sont pas capables du pch mortel.


les

A plus

pch mortel manque-t-il dans


les hommes, femme
:

sphres suprieures.

Et,

parmi
et la

seuls peuvent commettre le pch mortel

l'homme

1.

Vibhasa, 119,
:

4.

Pourquoi ce

(pratyaya) ni dans cette


prochaine
;

(1)

ces cinq pchs sont ainsi

nom iVnantarya? Pour deux raisons nomms parce cju'ils ne sont rtribus
ultrieure,

vie, ni

dans une existence

mais seulement dans l'existence

(2)

parce qu'ils sont rtribus seulement en enfer et non pas dans une

autre destine. C'est pour deux motifs qu'un acte est

nantarya:

(1)

parce

(ju'il

nuit des bienfaiteurs, (2) parce qu'il nuit un champ de qualits. Deux conditions sont requises pour qu'il y ait pch mortel (1) prparatif et (2) consommation du
:

fruit

et-on fait
;

le prparatif, si le fruit n'est

pas consomm,

il

n'y a pas pch

mortel
mortel
2.

le fruit ft-il

consomm,

si

on n'a pas

fait le prparatif,

il

n'y a pas pch

.... (Comparer Kathavatthu, xiii. 3). Comparer AtthasalinT, p. 358. Certain coupable ^'nantarya

prcipit

dans
3.

l'AvTci,

Kosa,

iii.

12

d.

(Mara)

Devadatta

et quatre autres, Milinda, p. 101,

Kern, Manual,

p. 36.

trisu dvlpesv Cinantaryant


:

Pas dans l'Uttarakuru


bhvCic ca.

7iiyatyuskaivt prakrtiilatv&t tatra C^and'

Hiuan-tsangy

xvii, fol.

6 a-xviii, foL
etc.

1 a.

205

97

b.

On n'admet

pas que

les

eunuques,

soient capables de ce
*

pch, cause de la mdiocrit du bienfait et du respect.

Pour

les

mmes

raisons qui rendent les eunuques,

etc.,

incapables

de l'indiscipline

(iv.

43

c), et,

en outre, parce que les parents, n'ayant

donn l'eunuque qu'un corps (tmahhva) incomplet (vikala) et n'ayant pour leur fils qu'une mdiocre affection (sneha), sont de
mdiocres bienfaiteurs
pas pour ses parents
ii.
;

parce que, d'autre part, l'eunuque n'prouve

le violent respect (lajjitva

= hrlvyapatrpyay
le rendrait

32) dont la destruction (vipdana, vikopana)

coupable

du pch mortel.

Pour

les

mmes
que

raisons, les Prtas et les

animaux, tuassent-ils

leurs parents, ne sont pas capables de pch mortel. Toutefois, le

Bhadanta

dit

les

animaux dont
le

l'intelligence est vive (patu-

huddhi), par exemple

cheval jneya, sont capables de pch

mortel (Viblisa, 119,6).='

Pour les mmes raisons, l'homme issu de parents dmoniaques (amanusya) ne commet pas de pch mortel en les tuant.

97

d.

Les deux autres obstacles dans

les cinq destines.

[17 a]

La naissance dans l'Uttarakuru


qui concerne les

est l'obstacle de rtribution en ce

hommes

la naissance

parmi

les

Asamjnisattvas en

ce qui concerne les dieux, [xviii]

Que sont de
1.

leur nature les divers actes de pch mortel ?


tu nesyate
p.

sandhadlnm
Voir ci-dessus
;

alpopakralajjitvt

2.

incomplet {vikala)

Le corps (tmahhva) de l'aveugle-n est mais on envisage ici le vaikalya qui rend l'homme incapable
204
n. 1.

En outre l'aveugle-n est aim de ses parents. Vykhy ryate yath kacid eva visistsi^a jneyo mtaram na gacchatti vsas mukham pracchdya mtaram gamitah j iena pascj jnatv svam angajtam utptitam ity evam jneyo 'svah patnbuddhih I asynantaryam syd ity abhipryah j La Vibhsa raconte cette histoire hei long en d'autres termes. Elle traduit jneya par ts'ng (oue fine)
du
salut.
3.
:

(nga).
4.

Paramfirtha et Hiuan-tsang ont seulement ts'ng hoi. Voir Mahfi-

vyutpatti, 213 (ling

= bon).

Ihag

ma

hgro ba Ina dag na

= [esau gatim pancasxi

fl]

206

CHAPITRE

IV,

98-99.
trois sont

Quatre sont acte corporel

un

est acte vocal

meurtre

un

est

mensonge
',

un

est prparatif de

meurtre (prntipta-

prayoga)
d'autrui.
-

car les Tathagatas ne peuvent mourrir par l'attaque

[1 b]
le

Nous
ce

disons que

schisme (satnghahheda) est mensonge,

et

que

mensonge

est le

quatrime pch mortel.

Comment

cela ?

Si

nous faisons du schisme un pch mortel,


nons, par hypallage, le

c'est

parce que nous don-

nom
:

de schisme au mensonge qui est la cause


;

du schisme (hetuphalopacra)
hJieda, doit s'expliquer
*

ou bien

le

mot schisme
'

',

samgha'

ce par quoi le

Samgha

est divis

(kra-

nasdhana).

En

fait,

98 a-c. Le schisme est, de sa nature, non-concorde dharma dissoci de la pense, non -souill-non-dfini.
^

c'est

un

Le schisme,
dfini

c'est--dire la non-concorde, est


(ii.

un samskra non-

associ la pense

35, trad. p. 178, n. 2, et 304), non-souill-non:

(univrivy krt a) comment donc pourrait-il tre pch mortel ?


le

D'autant que l'homme qui divise


n'est pas

Samgha,

le

schismalique(6/e/^ar^,

en possession du schisme.
C'est le

Au
le
le

contraire

98

d.

Sarngha qui possde

schisme.

C'est ce qui est divis, et


le

non pas

schismatique, qui
'.

possde

samskra nomm
Mais que possde

division

du Sanigha

le

schismatique ? [2 a]
est

99

a-b.
^

Le pch de schisme

mensonge

il

appartient au schis-

matique.

1.

Hiuan-tsang met en kfirikS ces dAnitions.

2.

anupakramadharmno
vii.

hi tathgath
:

(Comparer

la

phrasologie de
ity

CuUavajga,

3,

lo),

Vyfikhyfi

aparopakramamaranadharmna
/

arthah.
aklistvykrto 3. samghabhedas tv asmayrsvubhvo viprayuktakah dharmah. D'aprs Vibhsa, 0(), IG. 4. de dan dge hdun yaii dag Idan = [tena satnghah samanviiah //] de dun hbyed po yan dag Idan ^= [tadavadyam 5. de yi kha na ma llio brdzuii mrsvdas tena bhett samanvitah /] ou tatkilbisatft
/
; :

....

Hiuan-tsang,

xviii, fol. 1

a-2

a.

207

Le schismatique possde ghahhedasahaja)

le

pch (avadya) de schisme, lequel est

mensonge. Ce mensonge nat en


; il

mme

temps que
et

le

schisme (sam-

consiste en

vijnapH

avijnapti vocales.

Revtu de ce mensonge

99
Il

c.

Le schismatique
dans
le

cuit

dans l'AvTci durant un kalpa.

cuit

grand enfer AvTci pendant une priode intermdiaire


83).
^

(antarakalpa,

iii.

Les coupahles
si

des autres pchs mortels

ne sont pas ncessairement punis dans TAvTci.

Cependant tout pch mortel


chaine
:

est rtribu

dans l'existence pro-

qu*arrivera-t-il

un

homme

se rend coupable de plusieurs

pchs mortels ?

99
1.

d.

La souffrance

crot

en raison du pch supplmentaire.


ligyur :^ [avTcau

bskal par mnar


:

med par smin

pacyate kalpam]
...

% Itivultaka, 18 pfiko nerayiko Jcappattho samghahhedako samgham samaggam bhitvna kappam nirayamhi paccati. Aiiguttara, 402....
iii.

pyiko Devadatto nerayiko kappattho atekiccho et v. 75 (= Cullavagga, vii. 5, 4) .... samgham bhetv .... kappatthiyam kibbisam pasavati / kimpana kappattliiyam kibbisan ti / kappam Ananda nirayamhi paccatti payiko nerayiko .... samgham samaggam bhetvna kappam nirayamhi paccatti. La stance de l'Itivuttaka est discute Kathavatthu, xiii. 1. Les Rjagirikas croient qu'il s'agit d'un [grand] kalpa entier (sakalam kappam) ; pour Buddhaghosa, il faut entendre la quatre-vingtime partie du [grandj kalpa [c'est--dire un antarakalpa, ce qui est la dure normale de la vie, yukappa, dans l'AvIci, voir Kosa iii. 83 b]. La Vibhsfi (85, 15, 116) signale de nombreuses opinions. Les uns croient que, par kalpa, Bhagavat entend parler de quarante petits kalpas (antarakalpa), ce qui fait un kalpa de disparition (vivarta) plus un kalpa vide, ou un kalpa de cration (samvarta) plus un kalpa de dure (Kosa, iii. 90 b) d'autres comd'autres comprennent prennent grand kalpa (quatre-vingt petits kalpas) En outre, il y a un texte du Vinaya annonant que Devadatta ])etit kalpa renatra parmi les hommes un moment o la vie humaine sera de 40000 ans. On peut donc entendre par kalpa la priode d'accroissement ou de diminution de la vie c'est--dire la moiti d'un petit kalpa (voir iii. 92 a-b). D'aprs Milinda, 111, Devadatla a commis le crime de schisme la fin de la premire des
; '

'

'

'.

six parties
l'enfer,

du prsent fcapa ;

il

passera les cinq autres en enfer,

et,

dlivr de

deviendra un Pratyeka.

Les sources du Grand Vhicule, cites par l'diteur japonais, mritent aussi
d'tre tudies.
3.

Ihag pas gnod pa Ihag par hgyur

= [adhikd adhik vyath

//]

208

CHAPITRE

IV,

100.

Le coupable de plusieurs pchs mortels revt dans


corps grand et de chair trs tendre par lequel
il

l'AvTci

un

sent double, triple,

quadruple, quintuple, et les tourments sont extrmement nombreux


et insupportables.

Qui est capable de diviser

le

Samgha ?
est

100
C'est
etc.
il
*

a-b. Divise le

Bhiksu qui
divise,

un

intellectuel, qui est vertueux.


lac,

'

un Bhiksu qui

non pas un
un

non pas une

religieuse,
^
;

[2 b]

Ce Bhiksu
le

doit tre

intellectuel,

non pas un sensuel


:

doit tre vertueux (lavn),

non pas immoral (slavipanna)

car

les paroles

du Bhiksu immoral manquent d'autorit.


schisme ?

a lieu

100
Non

b. Ailleurs.

pas dans l'endroit o se trouve


le

le

Tathagata. Le schisme est

impossible l o se trouve

Matre, car le Tathagata ne peut tre

vaincu (duhprasaha) et sa parole est pleine d'autorit.

Quels sont ceux que divise

le

schismatique ?

100

b.

Les

sots.
et

Les sots (bla) seulement


d'une vue directe
le

non pas

les

ryas, car ceux-ci voient


le

Dharma.

D'aprs une opinion,


:

schismatique
*

ne peut pas non plus diviser

les possesseurs de la ksnti,

La premire ligne de la kSrik 100 est traduite dge slon Ha spyod thsul bhiksur drsticaritah ilavn / hbyed do gzhan dulio byis pa rnams bhinatty anyatra bln. La Vyakhya commentant le BliSsya donne les mots bhiksur bhinatti drsticaritah ... Paramartha lit bhiksur drsti-su-caritah (kin-hO'hng) bhinatty anyasmin dee bln, et sa version du Bliftsya oppose le moine de mauvaise pratique (mithycarita) au moine de conduite droite (samyak). On peut donc restituer bhiksur drstisucarito bhinatty anyatra blakn j S. Le Bhiksu seul, car le Bouddha est un Bhiksu et le schismatique se pose
1.

Idan pas

...

comme son
3.

rival.
p. 174.

trsncarita, voir ci-dessus

4.

Hiuan-tsang

Il

divise seulement les Pfthagjanas,

non pas

les

ryas parce

Hiuan-tsang,

xviii, fol.

2 a-2

b.

209

Que

faut-il

pour que

le

Sarngha

soit divis ?

100
divis.
'

c-d. Lorsqu'il

admet un autre Matre, un autre chemin,

il

est

Lorsqu'ils

admettent

lorsque
et
le

les

sots admettent
le

un autre

Matre que

le

Tatlmgata

un autre Chemin que


est divis.

Chemin enseign

par

le

Tathagata, alors
fois divis
d. Il

Sarngha

Une

combien de temps

reste-t-il divis ?

100
la

ne dpasse pas

nuit du

mme

jour.

Lorsque

le

Sarngha

est divis, infailli-

que ceux-ci voient directement le Dharma. D'aprs certains matres, les possesseurs de la ksnti ne peuvent pas non plus tre diviss. Pour runir les deux opinions,
l'auteur dit
:

les sots
il

Par Dharma,
39
a-b),

faut entendre

Vgamadharma

et

Vaclhigamadharma

(viii.

d'une part l'Ecriture, d'autre part les bodhipksikadharmas.


est le

La ksnti
dans
la

vue des

vrits, vi.
'

(prtliagjanaj, est

deuxime des nirvedhabhglyas, ou prparatifs de l'entre 18 b. Le possesseur de la ksnti, quoique sot rput semblable celui qui a vu les vrits (drstasatya'

kalpa).
2.

ston dan lam gzhan la bzod pa

forme plus ou moins correcte de hhyed,

byed paho de ni mi gnas ouvrir, rompre '.]


'

so.

[byed est une


C'est un Bouddha,

Le sujet de
des sots
suit
:

la

phrase prcdente (100 a-b) est

le

schismatique

Bhiksu, hrtisant, moral, qui divise, dans un lieu o ne se trouve pas

le

hhiksur drstisucarito hhinatty anyatra blakn. L'auteur pouril est divis il ne passe pas la nuit [dans cet tat de division] . Par il , nous devons entendre le Sarngha, un Sarngha compos de sots. On peut restituer

Acceptant un autre matre, un autre chemin,

[anyasstrmrgaksanio bhinno] na vivasaty asau


:

//

Paramrtha Par quoi (kiyat) le Sarngha obtient-il division ? Au temps o il admet autre matre-chemin, il est dj divis (\ p'oo) ... Sur le schisme, voir les rfrences dans l'article Councils de l'Encyclopdie de Hastings, iv. p. 180 b. La dfinition plie du schisme, des diverses sortes de PrStischismes, Cullavagga, vii. 5, Mahvagga, x. 1, 6 5, 4, Anguttara, i. 19. moksa, Finot, J. As. 1913, p. 22. Traditions relatives au concile de Vaisal (vsakappa), Muson, 1905, p. 277, 318. L'pisode de Devadatta, Rockhill,
;

Life.
3.

dit de Srnth, d. Oertel, Ep. Indica,


:

viii. p.

166.

Vykhy na vivasaty asau na tm rtrim parivasatlty arthah. Bhasya da nid kyi nub gcig tu / de ni mi gnas so.
:

14

210

CHAPITRE

IV,

101-102.
le

blement, au lever du jour (pratyse),


concorde.

Sarngha sera de nouveau en

Le schisme que nous venons de

dcrire, et qui est

pch mortel
*

',

101

a. C'est

ce qu'on entend par rupture de la roue.

La roue de la loi de Bhagavat est alors rompue, parce que la marche du Chemin est empche (mrgapravrttlvisthdpant) K Par consquent il y a, la fois, et rupture de la Roue (cakrahheda) et
division

du Sarngha (samghabheda).

se produit la rupture de la
b.

Roue
*

? [3 a]

101

Dans

le

Jambudvpa.

Non

pas dans les autres continents o

les

Bouddhas n'apparais-

sent pas.

Par combien de Bhiksus ?

101
Le
divis

b.

Par neuf

et plus.

'

chiffre

maximum

n'est pas fix.

Le Sarngha susceptible
;

d'tre

compte au minimum huit Bhiksus

le

neuvime moine ncesil

saire est le schismatique.

Pour

qu'il

ait

schisme,

faut qu'un Sarnle

gha se
le

divise en
le

deux partis

le

premier tenant pour

Bouddha,

second pour

schismatique

le

formant ainsi deux Saniglias de

quatre Bhikus chacun, ce qui est

minimum

requis pour constituer

un Sarngha (Vibhasa, 116,

4).

Une

autre sorte de schisme, diffrent de la rupture de la

Roue

et

qui ne comporte pas pch mortel, rsulte de la division relative aux


[ayant] cakrabhedo [matait] yvat santgho na pratisamdhlyate tvan wrgapravrttir visthit bhavati j na kasya cit samtne mrgali santmukhbhavatty arthah. rupture de la roue parce qu'il est la cause de 3. Ce schisme reoit le nom de
1.

de ni hkhor lohi db(y)en du hdod

2.

'

'

la

rupture de la roue.
4. 5.

hdzam Luhi glin naho [jambudvpe] navdibhih / Vibhttsa, 116, 5. 6. Le texte porte [astau bhiksavah satnghah / navamo bhett] hi aantghena dvayoh paksayoh sthtavyam samghadvayena ca /
:

avayam

Hiuan-tsang
actes ecclsiastiques

xviii, fol.

2 b-3

b.

21

(karmabhedd hhavati)
posadha,
etc.
*

lorsque, daus une

paroisse (shn), les moines se divisent (vyagra


faire les actes ecclsiastiques,

= nnmati) pour

101

c.

Schisme

rituel

dans

trois continents.

L seulement o

existe la religion.
plus.
^

101
Il
il

d.

Ce schisme suppose huit Bhiksus ou

faut que se forment

deux groupes de quatre Bhiksus

mais,

ici,

n'y a pas de schismatique qui se dclare Matre.

A
lieu.

six poques, le

schisme de la rupture de la Roue ne peut avoir

102. Au commencement, la fin, avant l'abcs, avant une paire, quand le Muni est teint, quand la paroisse n*est pas dlimite, la rupture de la Roue est impossible. ^

Au commencement,
mise en mouvement de

lorsque peu de temps s'est coul depuis la


la

Roue

la

fin,

Tpoque du Nirvana de

Bhagavat

[3 b]

ces deux poques

le

Sanigha

est pntr d'un

mme

sentiment

'\

Dans l'intervalle, la rupture est impossible avant


"
;

l'apparition
las kyi

de l'abcs (arbuda)
dbyen
ni glin gsiim
14.15

aussi longtemps que n'ont pas

Mahvyutpatti, 276,

Voir [karmabhedas trisu dvpesu] na (karmabhedavastu). 2. astbhir adhikais ca sah // 3. da po mtha skyon zun gcig gi / sna roi thub pa nous pa dan / mthsams ma bcad pa dag tu yan / hkhor lohi dbyen ni mi hbyun no / [dv ante] 'rbudd [ekayugt prr nirvrte munau /] abaddhfm [ca] slmym [na cakrabhedasambliavah H] Voir Divya, 150, parmi les uvres que doit accomplir le Bouddha ... tribhga yusa utsrsto bhavati j slmbandhah krto bhavati j rvakayiigant agratym nirdistam bhavati. 4. ekarasa =^ avyagra ekamati. Joie au dbut, terreur et angoisse la
1.
:

fin.

Hiuan-tsang traduit p'a, pustule, ampoule. Le tibtain traduit dosa, skyon. i. 43, les brigands sont Varbuda du monde. Samantapasadika, ... ssanassa abbudam ca nialam ca .... (Rfrences de pp. 294, 295, 307
5.

Dans Samyutta,
JPTS.

Morris,

1886).

212-

CHAPITRE

IV,

102-103

c.

apparu dans l'Eglise (ssana) l'abcs de la moralit (lrhuda),


l'abcs de la doctrine (drstyarbuda). Elle est aussi impossible avant

l'apparition d'une paire

(ekayuga)

aussi longtemps que n'a pas

apparu la paire d'excellents

disciples, parce
l'tat

que

le

Samgba ne
et

doit

pas passer la nuit (parivasali) dans


cette paire de disciples a

de division

parce que

pour tcbe de rtablir la concorde. La rup-

ture est impossible lorsque le

Muni

est teint, car, le Matre

une

fois

entr dans le Nirvana, le schismatique n'aurait pas d'antagoniste

(prafidvandvabhvt). Enfin, lorsque

la paroisse n'est pas dlimite


le

(slmym abaddhym)
lorsqu'il

',

car on dit que

Sanigha

est divis

y a deux partis dans une paroisse.


les

Tous
pue
:

Bouddhas n'ont

pas,

comme Sakyamuni,
^

leur roue rom-

cela dpend de leurs actes anciens.


les

Pourquoi

pchs numrs ci-dessus, matricide,

etc. sont-ils

des

pchs mortels Texclusion des autres pchs ?

slmym abaddhym iti mandalasmym ekasym hi 1. Vyakhya slmym prthakkarmakarant sarnghadvaidham hhavati nanu ca pra:

krtislmsti grmanagcjrdi satyam asti / jnaptislmym tu satym sa prakrtislm vyavasthpyata iti / tasy api bandho vyavasthpyata eveti veditavyam. 2. Sakyamuni, lorsqu'il tait Bodliisattva, divisa la compagnie (parsadbheda) Ceci est d'un Rishi possesseur des cinq abhijns (Vyakliy Vibhasa, 116, 17). en contradiction formelle avec Milinda, 161, d'aprs lequel ce n'est pas un acte ancien du Bodliisattva qui provoqua le schisme de Devadatta. Il existait une vieille formule tathgato abhejjapariso. Le Bouddha n'a pas franchi la rtribution de ses anciens pchs, Divya, 416 < N'as tu pas appris cette parole du Muni que les Jinas eux-mmes ne sont pas dlivrs de leurs actes ? Bhagavat, dans sa tourne d'aumnes, fut bless au pied par une pine, et dclara ita ekanavate kalpe akty me puruso hatah / tatkarmano vipkena pde viddho 'smi bJiiksavah (Saddaranasaingraha, d. Suali, p. 26). Sur le morceau de rocher qui blessa Bhagavat au pied, Chavannes, Religieux minents, 155 Fa-hien, Legge, 83. Bhagavat souffre du dos parce qu'il a jadis rompu l'pine dorsale d'un lutteur dloyal, Vinaya des Sarvastivfidins, Comparer Milinda, 134, 179. dans Chavannes, Cinq cents contes, ii. 424. D'aprs Majjhima, ii. 227, le Tathagata n'a que des sensations agrables et pures (ansav sukh vedan) : Si les tres prouvent plaisir et peine en raison de leurs actes anciens, le Tathagata a accompli jadis de bons actes puisqu'il
I
;

sent maintenant de telles pures agrables sensations. Si les tres prouvent plaisir
et peine en raison de l'acte crateur de Dieu (issaranimmnahetn), a t cr par un Dieu bienveillant ....
le

Tath&gaia

Hiuan-tsang,

xviii, fol.

3 b-4

a.

213

103
teur,

a-b.

Parce

qu'ils dtruisent

ou blessent un champ de bienfai-

un champ de

qualits.

Le matricide
ont donn la
tuant.
-

et le parricide

sont pchs mortels parce qu'ils dtrui-

sent un bienfaiteur.

La mre et le pre sont bienfaiteurs parce qu'ils naissance. Comment le meurtre les dtruit-il ? En les
et les

Le meurtre de l'Arhat

deux derniers pchs mortels sont


le

pchs mortels parce que l'Arhat,

Sariigha et le

Bouddha sont des


le

champs de

qualits

[4 a].

On

ne dtruit pas

Samglia

et le

Bouddha
Mais

mais on
le

les blesse

(vipdana
et

= vikopa).
si la

si

sexe de la mre

du pre a chang,
et

qualit de

mre

et

de pre n'existe plus chez la mre


c.

chez

le

pre ?
*

103
tuer
Il

Mme

si le

sexe change,

il

y a pch mortel

celui qui tait la mre, celle qui tait le pre.

est dit en effet

(Vibhsa 119.

7)

Arrive-t-il

qu'un

homme

soit

coupable de pch mortel en tuant un


qui n'est pas Arhat ?

homme

qui n'est pas son pre,


le

Oui,

s'il

tue sa
soit

mre dont

sexe a t

chang.

Arrive-t-il qu'un

homme

coupable de pch mortel en

tuant une
Oui,
s'il

femme

qui n'est pas sa mre, qui n'est pas ArhatT ?

tue son pre dont le sexe a t chang.

Lorsque l'embryon (kalala) d'une femme tombe (cyu


autre
1.

?) et

qu'une

femme

le

verse (hlugs,

pur

?)

dans sa matrice
j

'%

laquelle de ces
faut

iipakrigunaksetranirkrtivipclant
nirkrti
=r.

i.

D'aprs la Vyakhya,

il

entendre upakdriksetrasya nirkrteh.


2.

parityga

(voir ci-dessus p. 153).

Comment les pre et


194, 204

mre

sont des bienfaiteurs, Divya, 51, Avadnasataka,

(pyyikau posakau
qu'ils sont

samvardhakau stanyasya ddtrau


3.

....)

Itivuttaka, p. 110.

gunaksetratvt.

Ils

sont

champ de

qualits

ou bien parce

le

point d'appui de qualits

(gundnm
ils

de leurs qualits (gunaih),


blja)

srayatvt), ou bien parce que, en raison sont un champ toute semence de mrite (punya:

seme dans ce champ porte un grand fruit. [vyajannyathbhve 'pi] 4. mthsan ni gzhan du gyur kyan hgyur Si l'embryon est vivant^ il ne tombe pas 5. Le Sthavira n'admet pas ce cas s'il tombe, c'est qu'il est mort car un tre vivant ne peut pas aller travers

214
deux femmes

CHAPITRE
est rpute tre la

IV,

103

d.

mre dont

le

meurtre constitue un

pch mortel ?

103

d.

La mre

est la

femme du sang
les offices

de laquelle on est n.
;

La seconde femme remplit kj posikj samvardhik.


^

d'une mre

elle est

pyyi-

Point de pch mortel


autre personne
;

si,

voulant tuer sa mre, un


si,

homme

tue une

point de pch mortel


tue sa
lit

voulant tuer une autre

personne, un

homme

mre \ Par exemple, l'homme qui tua sa


il

mre tendue sur un


endormi,
et le fils

(mahcatalvalna) o

croyait

un

homme

du blanchisseur qui tua son pre en voulant tuer


^

un moustique, ne furent pas coupables de pch mortel.


Si,

du

mme

coup, un
Mais

homme
il

tue sa

mre
le

et

une autre personne,

toutes les ordures

...

est rapport

dans

Stra que KumSrakasyapa


la matrice,
le boit
...

(t'ng-ts-kia-y) naquit ainsi.

Puisque

la

seconde femme place l'embryon dans

la porte-de-la-naissance et l'aspire (In)

dire
1.

jusque dans que l'embryon traverse des ordures. Ou bien elle

on ne peut pas

(Samghabhadra).

[mt] yacchonitodbhavah // [dvitypi] sarvakrtyesv avaloky. Vyakhy sarvamtryogyesu kryesu drastavyety abhipryo tnCUrkalpatvt Hiuan-tsang: Tous les offices [propres la mre], on les constatera dans la seconde mre . Vpyyik est la kadvhik, qui conduit terme la grossesse \a posik (gso bar byed pa) est la stanyadyik, qui donne son lait; \r sarnvardhik (skyed par byed pa) est Vaudrikhrakalpik, qui rgle l'alimentation assimilable (traductions de P. Cordier). Ou bien, d'aprs une autre interprtation, pyyik stanyadhtrik, noun-ice posik, parce qu'elle donne l'aliment
2.

solide

samvardhik, parce
;

qu'elle

baigne et carte les aliments nuisibles


2).

(visamaparihra). (Vyakhyfi

ci-dessus p. 213, n.

On

a Divya, 303, pyyitah positah samvardhitah.

pyyika

= nu zlio Idud

et

nu zho

ma

blud (Mlanges Asiatiques,


130.
1,

viii.

149)

pyyana
3.

=^ yots su rgyas bya, MahSvyutpatti, 197,


est discut Kathvatthu, xx,
et

Ce problme

dans Karmaj)rajnapti.
(ou
etc.,

Les

Uttarfipathakas croient qu'un


le

homme

devient

nantarika
i.

anantarika) par
ii.

meurtre inintentionnel (asatncicca) de sa mre,

tant donne la gravit


1, 2,

des anantariyavaithus.
JainasQtras,
4.
ii.

:'

Comparer SQtrak|-tanga,
(tir

6, 2G

(Jacobi,

242, 414)

Voir Cliavannes, Cinq cents contes, n" 339

du Che sony
lit

lu,
'.

Nanjio

1115).

Nous traduisons

blanchisseur

',

Cliavannes

:' teinturier

Le

texte porte

dhvdka que

la

Vyakhya

explique rajaka.

Hiuan-tsang,

xviii, fol.

a-b.

215

il y a deux avijhaptis, avijtiapH de meurtre simple, avijnapti de pch mortel mais la vijnapti est seulement de pch mortel, en raison de la force du pch mortel [4 b]. Toutefois, d'aprs Ghoaka
;

(Vibhsa, 18,

18),

il

y a deux mjnaptis, car la vijfiapti est

faite

d'atomes.

L'homme

qui tue

un Arhat sans connatre sa quaht

est coupable
:

de pch mortel, car l'objet du meurtre est dtermin


tel , pense-t-il.

Je tue un

L'homme

qui tue son pre, quand ce pre est

un Arhat,

n'est cou:

pable que d'un pch mortel, savoir du meurtre d'un Arhat


pre et l'Arhat ne font qu'une seule personne.

car le

Objection
fils

'.

[L'Arhat Rudryana, assassin sur l'ordre de son

Sikhandin,

dit

l'assassin

:]

Va

Dis Sikhandin qu'il a comet le

mis deux pchs mortels,

le parricide

meurtre d'un Arhat

Comment
fils

expliquer cette parole ?

Rudryana
'

veut dire que son

a commis pch mortel par deux causes de pch mortel (dv;

bhydm kranbliym) ou
tels
'

bien Rudryana dit

deux pchs morfils.

pour rprouver doublement la conduite de son


S'il

1.

I*aramrtha
....

en est
:

ainsi,
S'il
:

comment l'Avadna
ainsi,
il

dit-il

Va

Dis

Hiuan-tsang {= pH-y-king = avacliia) dit


Sikhandin

deux pchs mortels


peut-il obtenir

....

.
:

comment le y Le Bouddha dit Sikhandin Tu as commis La Vibhs (119, 7) attribue aussi au Bouddha cette
en est
faut expliquer
:

Comment Sikhandin, en dtruisant une seule vie^ deux pchs mortels ? Il n'obtient qu'un pch mortel, parce que le bienfaiteur ou pre et le champ de qualits ou Arhat sont ensemble dans une personne. Le texte devrait dire Tu as obtenu pch mortel par deux causes, deux pchs pour blmer Sikhandin parricide, meurtre de l' Arhat , et il dit

dclaration et poursuit

'

',

en raison de deux pchs. D'aprs d'autres matres, bien


mortel, la rtribution de douleur est accrue
:

qu'il n'y ait

qu'un pch

Vykh) Eaiiruke nagare Mudryano nma rj Sikhandinam ndma putram abhisicya pravrajitah pravrajyrhattvatn adhigatavn / sa Kaurukbhysam gatavn / pun rjyam knksatity matyaprakrmitena tena Sikhandin rjn svapit mritah tena tu mryamnvasthdym sa mrako manusya ukto gaccha Sikhandinam hrhi.
j /

Vinaya des Mlasarvstivdin, Tokio, xvi. 9, viii. 109, Huber, BEFEO., 1906, p. 14), il y a plusieurs assassins. Dans Nanjio 1329, le roi Udasena (?), Arhat, est tu par un candala sur l'ordre de son fils Rajasena (Chavannes, Cinq cents contes, iii. 131).

Dans Divya, 567 (comparer


92-99, cit Lvi,

le

fol.

T'oung Pao,

Les Janas ont des histoires analogues (Maharastr Erzahlungen,

p. 33).

216

CHAPITRE
qui,

IV,

104-105

b.

L'homme
Il

dans une pense mauvaise,

fait

couler le sang du

Tathagata, commet-il ncessairement pch mortel ?

commet pch mortel


a.

lorsqu'il

a l'intention de tuer

104

Non

pas, avec l'intention de frapper le

Bouddha.

'

L'homme

qui blesse mort un


est-il

homme

qui devient Arhat aprs

avoir t bless,

coupable de pch mortel ?

104
aprs
le

b.

Non
^

pas, en ce qui concerne

l'homme qui devient Arhat

coup.

Suppler, d'aprs ce qui prcde, pas de pch mortel


effet, le

En

prparatif du meurtre a eu pour objet un

homme

qui n'tait

pas Arhat.

L'homme

qui a fait

le

prparatif d'un pch mortel, peut-il, l'arret le fruit ?


^

tant, obtenir le

dtachement
celui qui

[5 a]
le

104

c-d.

Pour

fait

le

prparatif de pch mortel,


'*

dtachement
Pourquoi ?

et le fruit

sont impossibles.

Parce qu'il y a contradiction absolue entre l'intention


fruit.

de pch mortel et l'acquisition du dtachement ou d'un

Para1. sans rgyas brdeg par sems la min =: [na bucldhatddacittasya]. martha et Hiuan-tsang ont ta, frapper. 2. bsnun hog dgra bcom pa la min [na vedhd rdhvam arhati /] 3. ci mtshams med pahi sbyor ba byas te / de yan bzlog par hdod chags dan bral bali hbras bu lithob par hgyur ba kitn krtnantaryaprayogas tatn

nivartayan vairgyaphalam prpsyati.


Hiuan-tsang
diffre
:

Celui qui fait le prparatif de pch mortel,


arrt (tchoan, nivart), peut-il devenir
*

dtach

un prparatif non susceptible et obtenir un fruit ?


'

d'tre

104 c-d. Celui qui fait un prparatif dterminant (tiny) de pch mortel, pas de dtachement, pas obtention du fruit. Au cours du prparatif de pch mortel, si celui-ci doit ncessairement s'accomplir, il n'y a certainement pas dtachement. Au cours du prparatif des autres

mauvais chemins-de-l'acte
4.

....

mthsams med sbyor ba byas pa la / hdod chags bral hbras mi srid do [nnantaryaprayuktasya vairgyaphalaaatnbhavah II] Ce point de doctrine est discut Kathttvatlhu, xiii. 3. Les Uttarfipathakas
nient que l'instigateur du parricide puisse entrer dans
le

Chemin.

Hiuan-tsang,

xviii, fol.

4 b-5

b.

217
fait le

L'homme

qui entre dans le

Chemin aprs avoir


le

prparatif

d'un chemin-de-l'acte diffrent du pch mortel,

chemin-de-l'acte

ne se produit pas pour

lui,

en raison de l'absolue contradiction entre


'

sa nouvelle personnaht

et le chemin-de-l'acte.

Quel

est le plus
a-b.

grave parmi

les

pchs mortels ?
est considr

105

Le mensonge en vue du schisme


^

comme

le

plus grave pch.

L'homme

qui,

sachant ce qui est

le

Dharma

et le

non-Dharma,
il

ment en vue de

diviser le

Samgha
il

et

enseigne faussement, par l

se rend coupable du plus

grave pch (svadya) parmi tous


blesse le corps de
et

les

mfaits (diicarita).
gatas,
il

En

effet,

Dharma

des Tatha-

fait obstacle

au bonheur temporel

la dlivrance des

cratures. Aussi longtemps que la concorde ne sera pas rtabhe dans


le

Sanigha,

il

y a empchement l'entre dans

le

Chemin (niym
l'acquisition

vakrdnti,

vi.

26

a) [5 b],

l'acquisition des

fruits,

du

dtd.chemeni(vairgya),L la destruction des ipassions (sravaksaya):


tous les actes relatifs au

dhyna, Ttude,
dieux, des

la rflexion (cint)
et des
12

sont aussi arrts


1.

^
;

les

mondes des

Ngas

hommes

rayasytyantam tadviruddhatvt.
est-il

Vibhs,

119,

Dans

le

au cours du prparatif (prayogdQuelques-uns disent dans le meurtre vasthym), d'entrer dans le Chemin ? des animaux, non pas dans le meurtre des hommes. Quelques-uns disent aussi dans le meurtre des hommes, en excluant seulement celui qui a fait le prparatif de pch mortel. Par consquent ils disent on peut faire prparatif de meurtre
meurtre de quels tres vivants
possible,

et

dans l'entretemps obtenir

la

La Vykhy

cite

comme

vue du Dharma * exemple le ChekvadSna. Par crainte de Virdhaka

Vidadabha, Kern, Manual, 40) un certain Skya nomm Cheka se rfugie dans la fort et vit de chasse avec ses enfants. Bhagavat, qui passait alors trois mois chez les Trente-trois, descend pour le convertir et lui fait obtenir le fruit de Srotapanna. Ds lors Cheka n'est plus touch par le meurtre des animaux qui

(=

'

continuent prir dans les trappes ou


2.

filets.

/ kha na ma tho rab chen hdod [santghabhedamrsvdah svadyam sumahan matant /] 3. bsam gtan dan / klog pa dan kha ton dan sems pahi las rnams kyan mi mjug cin. Hiuan-tsang wnn (tide, repasser dans sa mmoire ce qu'on a appris) sng (rcitation) ParamSrtha tou-song (tudier et rciter, ou svdhyya, ou ptimokkhuddesa).

dge hdun dbye phyir brdzun smra ba

...

...

218

CHAPITRE

IV,

105-107

b.

sont troubls, attrists (durmanas), non matres d'eux-mmes (asvatantra), gars (musitasnirti).

C'est pourquoi la rtribution de ce

crime dure un ge cosmique et a lieu dans l'Avci.

Parmi

les autres

pchs mortels,

le

cinquime,

le

troisime et le
est

premier sont, en ordre dcroissant,


le

les plus lourds.

Le parricide

plus lger.
Objection.

'

Bhagavat

dit

que
trois

le

ble

(mahsvadyatara) des
le

danda mental est le plus coupadandds il dit que la vue fausse


;

(mithydrsti) est
Il

plus grave parmi tous les pchs.

faut entendre que, parmi les pchs mortels, le schisme est le


;

plus grand pch


trois actes
;

que

le

danda mental

est le plus

grave parmi
les

les

que la vue fausse est la plus grave parmi


si

mauvaises
on

vues.

Ou

bien le schisme est le plus grave pch


;

on considre
si si

l'tendue de la rtribution (vipkavlstara)

le
^
;

manodanda,
la

considre le

nombre des personnes

dtruites

vue fausse,

on

considre les racines-de-bien que seule rompt la vue fausse.

Parmi
fruit ?

les

bonnes actions (sacarita), laquelle porte

le

plus grand

105
vgra

c-d.

Parmi

les

bons

dharmas mondains,
*

la volition

du hha-

porte le plus grand fruit.


il

Par volition du hhavgra,

faut entendre l'acte mental par lequel


le

on renat dans

l'tage le

plus lev de l'rQpyadhtu. Cet acte est

plus fructueux des bons actes mondains, car sa rtribution est une
parfaite tranquillit de quatre-vingt mille priodes cosmiques
(iii.

81).

Ceci s'entend au point de vue du fruit de rtribution.


le fruit

envisager

de disconnexion

(ii.

57 d)

l'acte le plus

fructueux est la voli-

1. La mre est cent fob plus vnrable que le pre (Roth et Bhtlinck, s. voc. satayuna). 2. Vihhfisa, 115, 17. Majjhima, i. 372 (danda, dans la langue des Nirgranlhas,

est l'quivalent de
3.

Comment lu

fort

karman). Dandaka
/

fut vide par la colre des Rishis, ci-dessus, p. 163.

4. hjig

rien pa yi dge ba la

srid rtselii
//

sems

librus rab lu che

bhavdgracetana phalavattatna

?]

Comparer Majjhima,

= [laukika^ubhe
265.

ii.

Hiuan-tsang,
tion associe
cette volition
la

xviii, fol.

5 b-6

a.

219

au Vajropamasamdhi
a pour
:

(vi.

44 d

voir iv. 112 b), car

fruit la

rupture de tous les liens. C'est pourquoi


....

Karika

dit

Parmi

les

bons dharmas mondains

[6 a]

Est-ce seulement par les pchs mortels que l'homme renat nces-

sairement en enfer?

L'homme
tent

renat aussi ncessairement en enfer par les pchs sem-

blables aux pchs mortels (nantari/asahhga).


:

D'autres ajou'

mais non pas immdiatement (anantaram).


b.

106-107

Souiller sa mre, souiller une Arhant


;

tuer

un Bodhice

sattva prdestin

tuer

un Saiksa
^

voler les biens du


;

Samgha,

sont les pchs semblables aux pchs mortels


destruction d'un Stupa.
1.

le

cinquime est la

narake 'vasyam utpattyd tant tatsdryt tatsabhgny j anyath hy nantaryny eva syur ity aparesm abhipryah / anantarabhvitve 'pi na tny nantaryny eva sambhavanty atulyaklavipkatvd ifi prathamapksiknm pari:

Vykhy
j

iicyante

na

tu tatrnantarotpatty

hrjah.
2. ma dgra bcom ma sun byas dan / byan chub sems dpa ns gnas dan / slob pa gsod dan dge hdun gyi / hdu bahi sgo ni hphrog pa dag / mthsams med pa dan cba hdra ste / Ina pa mchod rten hjig pa yin.

dsanam nmtur arhanty

[bodhisattvasya]

mranam
jl

[niyatisthasya] saiksasya sanighyadvraharik

cLuantaryasabhgni pancamain stpabhedanam j Comparer Mahvyutpatti, 123. Conjecture de Wogihara upnantarya presque pch mortel pch mortel mineur (mthsams med pa dan ne ba sio o kin tsoi). Les MSS. de la Vykhya ont arhanty ; Minaev-Mironov, arJiaty Wogihara,
: *

',

'

'

bhikkhundsaka. Mahvyutpatti niyatabhmisthitasya bodhisattvasya mranam (ns pahi sa la gnas pa); V}khy: niyatipatitabodhisattvamrana. Le ns gnas
arhanty.
vi. 17,
:

Dans Culla,

de notre Krik est glos ns


M&hi\yui]pa.iii:
'

voler la porte
*

par rtogs pa. samghyadvraharana. Bhasya samghyadvrahrik expliqu dans Vyakhya aksayanides revenus du Samgha
:

',

vyapahra
inscriptions)
la

voler les biens de main-morte

'

(aksayanv
:

est

connu par

les

une des versions chinoises de la Vyutpatti [proprit] perptuelle. - Takakusu, I-tsing, p. 193.
;

voler le tch'ng-tchou,

Vasumitra explique

mukhyadvrahriketi yan mukhopabhogikam yena samgho jvikm payati tasypahra iti (Vyakhya).
Sur
le

kal-

stpabhedaka, Mahvastu,
p.

i.

101, Nettippakarana, p.

92

et les

remarques

de Hardy,

xxv.

220
Ces cinq pchs, dans
souiller sa mre, souiller

CHAPITRE

IV,

107-108.

l'ordre, sont

semblables aux pchs mortels

une Arhantl
;

(=

matricide)

tuer un Bodhi-

sattva prdestin

{=
;

parricide)
;

tuer

un saint qui

n'est pas

Arhat
subsis-

(=

meurtre d'un Arhat)

voler au Sanigha ses

moyens de

tence

(=

schisme)

dtruire

un Stupa

(=

blesser le Tathagata).
trois

Les autres actes comportant rtribution sont entravs en


circonstances
:

107

c-d.

l'acquisition de la ksnti, de la qualit


il

d'Anagamin,

de la qualit

d' Arhat,

entrave absolument les actes.

'

Ds que, sortant du stade

nomm mrdhmias,

il

obtient le stade

nomm
dans
les

patience (ksnti)

(vi. 23), les

actes qui doivent tre rtribus

mauvaises destines, tant entravs, restent en dessous


:

(m

bar gnas

upatidhanti) [6
actes.

b],

parce qu'il dpasse l'tage de rtribu-

tion de ces

De mme

se lvent (tittisthante) les cranciers de

l'homme qui migr de son pays (desatygam kurvatah).


Ds
qu'il obtient la qualit

d'Anagamin

(vi.

36

d), les

actes qui

doivent tre rtribus dans le Kmadhatu, tant entravs, restent en


dessous,

l'exception
dans
le

de ceux qui doivent tre rtribus dans la

prsente existence.

De mme, ds
tre rtribus

qu'il obtient la qualit d'Arhat, les actes qui

doivent

Rpadhatu
le

et

l'rQpyadhatu.
est

Nous avons vu que


quasi-mortel
:

meurtre d'un Bodhisattva

un pch

108

a.

Depuis quand

est-il

Bodhisattva?

partir de quel

moment

reoit-il le

nom

de Bodhisattva ?
*

108

b.

Depuis

qu'il fait les actes

producteurs des marques.

1. ksntyangamitrhattvaprdptau karmCitwighnakrt // Cit dans Vyakhya vi. 36 a-c. Voir ci-dessus p. 1 14. 2. bodhisattvah kuto yvat laksanakarmakrd yatah Cette ligne est cite dans la Vyakhya ad iii. 41 a-d (p. 11)7 de Cosmologie
j

bouddhique), pour expliquer l'expression samnikfstabodhisattva,

le

Bodhisattva

Hman-tsang,

xviii, fol.

6 a-6

b.

221
pour

partir

du moment o

il

commence
il

faire les actes qui ont


.

rtribution les trente-deux marques,

est prdestin

Gomment

cela ?

partir de ce
c-d. Il

moment, toujours
il

108
il

a de bonnes destines,
les

nat

dans des familles nobles


;

possde tous

organes
;

il

est

un mle

il

se souvient de ses

naissances anciennes
proche, c'est--dire
*

il

ne se dsiste pas.
la

proche de

Bodhi

',

sannbhisambodhi.
ii.

= ns par rtogs pa (niyatipatita ?)


Sur
94,
le

prdestin

'

Bodhisattva et sa carrire, Kosa,


23
c-d,

44 a-h

iii.

14, 21, 28, 41,

53

c-d, 85,

96

d, vi.

24

a-b, vii. 34.

Kranaprajnpti^ dans Cosmologie boudle

dhique, p. 327, 332, 336.


Vibhfis, 176,
14.

Aussi
le

longtemps que

premier asanikhyeya n'est pas


difficiles et

achev,

le

Bodhisattva, bien qu'il accomplisse diverses tches

doulou-

reuses, cependant n'est pas capable de savoir en lui-mme avec certitude qu'il

sera Bouddha.

Quand

en lui-mme avec certitude


troisime

deuxime asamkhyeya est achev, le Bodhisattva sait qu'il sera Bouddha, mais cependant il n'ose pas
la parole
:

proclamer sans crainte (vaisraclya)

Je serai Bouddha

Quand

le

asamkhyeya

est achev, lorsque le Bodhisattva pratique les actes qui


il

qu'il sera Bouddha, du Matre Au temps o il pratique les actes qui produisent les marques, il abandonne cinq mauvaises choses et obtient cinq bonnes choses 1. il abandonne les mauvaises destines et nat toujours dans de bonnes destines 2. il abandonne les familles humbles et nat toujours dans des familles opulentes 3. il abandonne le corps non-masculin et

produisent les marques,


et
il

sait
le

en lui-mme avec certitude


fils

proclame sans crainte

rugissement du

obtient toujours

un corps masculin

....

Les marques sont expliques dans TAbbisamayalainkra,


la

viii,

vabhQmi, Camb. Add. 1702, 138 b-141 b (laksannuvyanjanapatala).

dans BodhisattDepuis

suddhclhysayahhmi

(voir Hastings, Encyclopdie,

art.

Bodhisattva, et

S. Lvi^

Strlamkara, Introduction), toute la prparation de


produit (nrvartaka) les marques
:

la

Bodhi (bodhisous-marques

sambhra)
est de

et

sous-marques. Cette prparation


et

deux natures

lointaine, aussi

longtemps que' les marques

ne sont pas obtenues (yo 'pratilabdhesti vipkato laksannuvyanjanesu) ; proche, depuis l'instant o, pour la premire fois, les marques sont obtenues et Les aussi longtemps qu'elles se purifient et se perfectionnent de plus en plus

marques sont
phala),

le fruit
il

comme

est expliqu

de diverses bonnes actions (vicitrakarmbhisamskradans le Laksanastra parce qu'il est solidement


;

install (pratisthita)

dans

la moralit, la patience et la gnrosit, le

Bodhisattva

(D'aprs Lakkhanasuttanta, Dgha, marque supratisthitapdatva iii. 146, la marque n'apparat que dans la dernire existence du Bodhisattva) 1. bde hgro(r) rigs mthor skye dban tshan / pho(r) hgyur tshe rabs dran mi
obtient la

222

CHAPITRE
dit qu'il est
il

IV,

108 c-109.

On
Il

suga
nat

(?),

parce que ses destines sont excellentes


les

(prasasta), car

parmi

dieux

et
'

parmi

les

hommes.

[7 a]

nat dans des familles opulentes

de Ksatriyas, de Brahmanes,

de Grhapatis, non pas dans des familles humbles.

L'homme dont
driya
;

les

organes ne sont pas au complet est vikalenil

ses organes tant au complet,


^

est

prnksa
et,

(?),

synonyme

de aviklendriya.
Il

est toujours mle,

jamais de sexe fminin,


etc.).
il

plus forte raison,

jamais insexu (sandha,

Dans
sances.

toutes ses existences,

se souvient de ses anciennes nais-

En

cdant, on se dsiste

comme

il

ne cde pas,
:

il

est avivrt

(?),

synonyme de avaivartika, ne
d'tre utile

se dsistant pas

en

effet,

dans

le

but de

aux cratures,

il

n'est pas abattu

par toutes

les sortes

souffrance, par tous les outrages \ Celui qu'on

nomme
:

l'esclave non-

achet

dii

monde

*,

c'est

bien le Bodhisattva

ce

magnanime, qui

Idog.

L'dition des Krikas


:

lit bde hgro et pho hgyur. [sugoccakrilaimrnksah pumn jdtismaro 'vivrt

Paramfiriha

chn-ttio

(sumrga

//]

sugati) koi-kia (uccaktila) ki (sa-

kala) nn (pum) -siu (jtismara) pou-t'oi (avinivartanya, Mahavyutpatti, 24. 4, avivartana, 133. 20). Hiuan-tsang a le mme terme ki pour sakalendriya ; il traduit les deux derniers mots, mi-ldog, par kin-ku, ferme,

drdha, dhlra.

L'expression avaivartika est consacre.


1.

Vyakhya

mahslakulaja

iti

mahprakrakulaja
6.

triyamahslakulajo yvad grhapatimahslakulaja


kiilaja ity arthah.

Mahavyutpatti, 187.

arthah / ksamahgrhapatiksatriyamahlakulam 9.
ity
iti
....
' ;

tcaktilam .... 11. nlcakulam. Voir Childers et le Dict. de S* Petersbourg. Paramrtha traduit simplement grande famille Hiuan-tsang transcrit le mot 8la ; les versions chinoise et tibtaine de la Mahavyutpatti et la traduction tibtaine du Koa ont famille semblable au grand arbre sala . 2. Mahavyutpatti, 245. 957-960 7ia kundo bhavati ... na vikalendriyo bhavati.
:
' : :

kadarlhanA. Vyakhya kadarthan mahparihhavaprvik vihethan j yayoh kyavcoh pravrtty parasya duhkhadaurntanasye bhavatah / tadapeksay tannigraho yantrunety ucyate (?) 4. Le Bodhisattva est le sattvadsa de cinq manires, Satralainkara, xix. 19 ... ksamo bhavati paribhsanatdanadlnm / nipuno bhavati sarvakryakarant. Comparer Sikfisamuccaya, pp. 35, 143.
3.

log par sgrub

Hiuan-tsang,
cependant possde
les plus

xviii, fol.

6 b-7

b.

223
vii. 34),

sublimes perfections (sampad,

agissant par pure compassion, se tient sans gosme,

comme un
;

chien \ en prsence de toutes les cratures

il

supporte, de la part
il

de toutes les cratures, outrages


toute tche fatigante et pnible.

et

mauvais traitements

assume

Les actes qui ont pour rtribution

les

marques,

109.

Il

les projette

dans

le

Jambudvpa, tant un mle; en prsence

des Bouddhas, pensant aux

Bouddhas

provenant de rflexion
^

au

cours des cent ges cosmiques supplmentaires.

Le Bodlisattva
le seul

projette les actes qui mrissent en

marques dans
du Jambu-

Jambudvpa, non pas


vif

ailleurs, car les habitants


^

dvpa sont d'esprit

(patuhuddhi)

tant

un mle

et

non pas une


p. 35.

1.

2.

Comparaison du Bodhisattva et du chien, Sikssammuccaya, [jamhudvl^e punin eva sammnkhabucldhacetanah / cintmayam kalpaate ese (tad) ksipaty asau //]
gliii

de ni hdzam
las

phor hgyur nid


/

mnon sum sans

rgyas

la

sems pa

bsam pa

byun bskal pa brgya

lus

pa dag tu hphen par byed


:

Paramrtha, dans le deuxime pda, rpte le mot Bouddha toi-fo f-kou-i := hiiddhapratyalcsam buddhacetanah ; et traduit le Bhasya A quelle poque eultive-t-il ces actes ? A l'poque o les grands Matres sont prsents (malistrsammukhlbhvakle), parce que la volition [dans ces actes] a pour objet les Bouddhas , Vibhsa 177. 1. Les actes mrissant en marques sont-ils sriitamaya, cintmaya, bhvanmaya, issus de l'enseignement, de la rflexion, du recueillement ? Ils sont seulement cintmaya. Pourquoi ? En raison de l'importance
:

spciale

(prdhnya) de

cette sorte d'acte (de l'acte n de rflexion)


le

l'acte issu

de l'enseignement existe seulement dans

Kmadhtu

Quelques-uns disent

que l'acte qui mrit en marques est issu et de l'enseignement et de la rflexion, non pas du recueillement. Dans quel lieu est produit l'acte mrissant en marques ? Dans le seul Kmadhtu, dans la seule destine d'homme, dans le seul Jambudvpa, seulement avec un corps d'homme et non pas de femme, etc. A quelle poque ? A l'poque o apparaissent (utpda) des Bouddhas non pas une poque vide de Bouddhas. Avec quoi pour objet ? Portant directement sur le Bouddha, car la volition (cetan) et la rsolution-vu (pranidlina) spciales [qui crent cet acte] ne portent pas sur un autre objet. 3. Astashasrika, p. 336 le Bodhisattva renat dans le Jambudvpa et gn-

ralement dans

le

Madhyadea.

224
femme, car
il

CHAPITRE
a dj dpass
l'tat

IV,

109.

de

femme

en prsence des Matres

seulement, car sa volition a pour objet les Bouddhas. Ces actes pro-

viennent de rflexion (cint), non pas d'audition ou de recueillement


(ruta,

hhvanmaya). Le Bodhisattva
',

les

accomplit au cours des

cent ges cosmiques supplmentaires

et

non pas pendant un temps

plus long.
1.

kalpaate

ese, lecture

confirme par VyfikhyS,

iii.

13 a

(p.

147 de Cosmolo-

gie bouddhique).
Il

s'agit des cent

kalpas (grands kalpas, mahkalpas, Kosa,


trois

iii.

94 a) qu'un

kalpsamkhyeyas qui font le gros de sa carrire au cours de ces cent kalpas, il mrite vraiment le nom de Bodhisattva et ralise la Bodhi (Mahavastu, iii. 249 te bodhim kapasatena samudnenti narottam). Souvent on nglige ces cent kalpas et on dit que la qualit de Bouddha est obtenue par trois kalpsamkliyeyas (iii. 94 b-c), c'est-dire par trois asamkliyeyas fou asamkhyas) de mahkalpas. h'asamkhyeya
Bodhisattva doit normalement durer au del des
:

incalculable

est

varie d'aprs les

un chiffre dtermin, calculable, mais norme, dont la valeur modes de comput (cinquante-neuvime terme d'une srie 1, 10,
:

100

...

ou d'une

srie

1, 10,

100, 10.000, 10.000

10.000,

....

voir Kosa,

iii.

94)

On
pas

peut croire que cette thorie a remplac celle des Asamkhyeyakalpas, kal-

incalculables, expression qui demeure ct du nouveau comput kalpsamkhyeya, Religieux Eminents, p. 150, etc. Tout kalpa est sans mesure aparimita) et cependant les kalpas sont nombreux (Mahavastu, i. 78, comparer Samyutta, ii, 181 et suiv.). Dans l'Abhidharma, on entend par Asanikhyeyakalpa le quart du grand kalpa , la priode de cration, de dure, de destruction
et

de chaos.

du Bodhisattva est de quatre asamkliyeyas kalpas fChilders, sub voc. asamkhyeya ; Cariyapitaka, i. 1 Jataka, Anguttara, commentaire dans PTS. 1883, p. 98; Nettippakarana, p. ICI i. p. 2 Visuddhimagga, .302). Le Sarasamgaha (premier chapitre, d. Neumann, 1891, p. 12) distingue les Bodhisattvas en qui domine la sapience, la foi, l'nergie leur carrire est de 4, de 8 et de 16 asamkliyeyas (plus 100.000 kalpas). Aux rfrences classes dans Cosmologie bouddhique p. 264, il convient d'ajoula seconde, ter l'Abhisamayalamkaraloka, viii, o sont exposes deux thories d'aprs cet ouvrage, est la thorie de Vasubandhu 1. La carrire du Bodiiisattva est de trois asamkliyeyas de kalpas (kalpsamkhyeya, non pas asamkhyeyakalpa). Le premier comprend la carrire du Bodhisattva depuis la terre

Dans
;

les sources plies, la carrire

et cent mille

prparatoire

(samskrabhmi) jusqu'
la

la

premire terre proprement dite


;

le

second, dep\iis la deuxime terre jusqu' la septime

le

troisime, depuis la

huitime terre jusqu' l'entre dans

terre des

Bouddhas (buddhabhmi

samantaprabh).

on a un kalpsamkhyeya pour la saniskdrafew ; deux pour Vadhimuklicaryfibhmi, trois pour la premire terre proprement dite (pramudit) et trois pour chacune des dix terres. Ayant parcouru
2.

Mais, en

fait,

Hiuan-tsang,

xviii, fol.

7 b-8

a.

225

Cependant Bhagavat Sakyamimi, par


franchit neuf de ces cent ges cosmiques

la purification de l'nergie,
'

et projeta les actes mrissant en marques au cours des quatre-vingt-onze ges cosmiques

(ekanavatym kalpesu)

qui, de la sorte, restrent des cent. C'est


il

pourquoi, parlant Asibandhaka,

dit

Chef de

village,

me

rem-

morant quatre-vingt-onze ges cosmiques


bde ha) ou mise mal (upahata) par

partir de maintenant, je
ait t

ne vois pas (nbhijnmi) qu'aucune famille


le

appauvrie (mi
cuits .
^

don d'aliments

Bhagavat s'exprime

ainsi parce

que

c'est

sur ce nombre de priodes


vii.

cosmiques que porte sa mmoire naturelle. (Voir


Les anciens Matres
^

30, 37, 42) [8 a]


le

disent

C'est

quand
le

il

a achev

premier

sa carrire en trente-trois kapsamkJiyeyas,

Bodhisattva arrive la terre des

Bouddhas
triniat

samantaprabhm huddliahlimim sdayatlty evam trayaskalpsamJcliyeyair buddhatvam prpyata ity ryavasubandhii....

pdh. 1. [Bhagavat] nava ca kalph pratyiidvartith


Le futur Skyamuni, en purifiant son nergie comme il est expliqu iv. 112 a, effort d'nergie (vryarmbha), obtint de complter sa perfection (pramit) d'nergie et ses autres perfections en quatreen d'autres termes, par un grand
vingt-onze kalpas.

Le Mahavastu
Przyluski,
J.

(iii.

249) est d'accord

vlryakyena sampanno
j

....

nava

kal-

pani sthyesi vryena puriisottamah


As. 1914,
ii.

De

mme

Nanjio 430 traduit par

p.

586

(trs intressant).

par Kiokuga et qu'il faudrait kalpas onze en nourrissant la tigresse, huit en tendant ses cheveux dans la boue (Divya, p. 252), neuf en louant Pusya, douze en cherchant au pril de sa vie une demi-stance. 2. Comparer Samyutta iv. 354. La Vykhy rsume le Stra Asibandhakena grmany nirgranthasrvakena bhagavn uktah / kim anarthysi bho Gautama kulnm pratipanno yas tvam drse durbhiksa iyat bhiksusamghena srdliam asanivad utsdayan bhiksm atasi j sa bhagavatbhiD'aprs certaines autorits du
(cites

Mahyna

tudier), le futur

Skyamuni a

franchi quarante

hitah

ito
].

'ham grmani ekanavatam kalpam updya samanusmar;

mi
Il

faut expliquer

ekanavateh pranam kalpa ekanavatah.


;

Les passages sont nombreux o Bhagavat semble limiter 91 kalpas son exprience du monde, par exemple Majjhima i. 483 cette poque rgnait Vipasyin, Dgha, ii. 2, Divya, 282, dont l'avnement marque la fin du troisime asamkhyeya
de la carrire de Skyamuni (ci-dessous
3.
iv.

110 b-c)

Les anciens matres, prvcryas.


:

D'aprs la glose de l'diteur japonais,


15

ajouter

parmi

les

Sautrntikas
:

Les quatre dfauts (dosa) sont

mauvaise destine (durgatidosa), mdiocrit

226
ge cosmique que
le

CHAPITRE

IV,

110

a-c.

Bodhisattva abandonne quatre dfauts

et obtient

deux

qualits.

Des marques

110
de

a.

Chacune

nat de cent mrites.

la famille

(aknlnatdosa), organes incomplets (vikalendriyatdosa), sexe


:

fminin (strlhhvadosa). Les deux qualits (guna) sont

souvenir des existences

passes (jtismaratguna), qualit de ne pas reculer ou se dsister (anivarta-

katguna). Paramartha
il

et

Hiuan-tsang spcifient que, par premier ge cosmique (kalpa),

faut entendre le premier

asamkhyeya.
vi.

Sur
1.

les

naissances animales du Bodhisattva et ses pchs, voir


cent mrites ? La

23.

ekaikam punyaafajam. Comment faut-il entendre ces


cations.
a.

VykhyS
lieu,

fournit trois expli-

Cinquante volitions (cetan) se produisent lorsqu'


ayant pour ohjet
.

chez

le

Bodhisattva,
;

l'acte d'attention

le

Bouddha (bnddhlambana)
:

cinquante

autres volitions quand le Bodhisattva pense

Puiss-je,

moi

aussi, tre

un Boud-

dha
b.

{aham apJttliam sym)

Le Bodhisattva a des penses de piti (kamn^itta) l'endroit des quarantemonde (20 places dans le Kmadhatu, 16 dans le Kpa, 4 dans l'rpya, plus 8 enfers froids) ces penses sont associes autant de volitions plus une quarante-neuvime volition ayant pour objet le Bouddha De la manire dont il dlivre les tres ; plus une cinquantime volition Puiss-je de la mme En rptant ces cinquante volitions, le Bodhisattva a manire les dlivrer !
huit parties du
:

cent mrites.

Le renoncement au meurtre est pris sous un quintuple mode (voir ci-dessous, purification du chemin de l'acte proprement dit (maulakarmapatharenoncement l'acte proprement dit) purification du prparatit pariuddhi et du conscutif ('swan^afca, iv. 68 a); vitarknupaghta, le renoncement n'est pas troubl par les [trois] vitarkas [mauvais] smrtyamiparigrhtatva, le renoncement est gard par le souvenir du Bouddha, du Dharma et du Sanigha nirvnaparinmitatra, le mrite du renoncement est appliqu la conqute du Nirviina. Cela fait cinq volitions quand le Bodhisattva renonce au meurtre, cinquante volitions pour les dix renoncements, cent volitions en rptant les cinquante premires volitions (VySkhya) Samghabhadra Cent mrites, c'est--dire cent volitions (cetan). Au moment o il va produire l'acte produisant une marque, le Bodhisattva produit d'abord cinquante volitions qui purifient le rceptacle du corps ensuite il produit l'acte qui attire une marque plus tard, il produit cinquante bonnes vf!iti(uis qui affermissent et perfectionnent l'acte de manire ce qu'il obtienne plnitude (paripri). Les cinquante volitions ont pour objet les dix chemins-de-l'acte il y a
c.

iv.

123 a-b)

Hiiian-tsang,

xviii, fol.

8 a-8

b.

227

Quelle est la mesure de chacun de ces cent mrites ?

D'aprs les uns,

il

est gal

au mrite qui a pour

fruit les jouissan-

ces de tous les tres, en exceptant le Bodhisattva proche de la Bodhi

c'est--dire accomplissant les actes qui

mrissent en marques.

D'aprs d'autres,
lequel,

il

est

gal l'acte collectif de tous les tres,


(ii.

par sa souverainet

56

b),

produit la cration du monde.

D'aprs d'autres, les Bouddhas seuls connaissent la mesure de ce


mrite.

Combien de Bouddhas a vnrs (pari/upsaymsa) Bhagavat quand il tait Bodhisattva ?

Au
mille

cours du premier

asamkhyeya,

il

a vnr soixante-quinze
;

Bouddhas

[8 b]

soixante-seize mille au cours du second


^

soixante-dix-sept mille au cours du troisime.

Quels furent

les

Bouddhas

la fin de

chaque asamkhyeya ?

Dans

l'ordre inverse de l'numration,


b-c.

110
khin.
'

la fin des trois

asamhhyeyas, Pasyin, Dpa, Ratnasi-

cinq volitions pour chacun

(Mahvyutpatti, 245, 428)


4.

amimodancetan
taire

5.

prntiptaviraticetan ; 2. samdpanacetan samuttejanacetan (tsn-mi, comparer 245, 429) ;' parindmancetan : volition de renoncer au meurtre,
t.

3.

de

prendre aux autres ce renoncement, de


d'appliquer
il

le

louer et prcher, de se rjouir

qu'il

soit accept,

le

mrite acquis l'acquisition du NirvSna.


l'acte,

D'aprs d'autres matres,


tions, faible, etc.,

y correspondant aux cinq dliynas


a,

pour chaque chemin de


(?)

cinq honnes

voli-

2.

D'aprs d'autres matres,

pour chaque chemin de


uddhi,
tatva.
3.

l'acte:

i.prayogaparisuddhi,
4.

prsthaparisuddhi,

maulakarmapathaparivitarknupaglita, 5. smrtyannparigrMle

D'aprs d'autres matres, tous les actes qui mrissent en marques sont

des volitions nouvelles, extraordinaires (n'i-ts'ng-s), ayant pour objet

dha lorsque cent sont ensemble (npasohhita ?)


:

ralises, le

Bodhisattva est orn [de

la

Boudmarque]
ii.

1.

yena sarvasattvakarmdhipatyena trishasrko nirvartate


cette
;

fVoir

56

b).

Saipghabhadeuxime opinion aux Yaibhasikas. dra expose cinq opinions la Vibhs (177, 9) en signale onze. 2. Ce sont les chiffres de la Vibhs, 178, 2. - Dans le MahSvastu, Ckyamuni se souvient d'avoir honor et servi huit mille Buddhas du nom de Dparakara ... trois cent millions de kyamunis, et ainsi de suite travers des pages

Paramrtha attribue

(I,

57
3.

et suiv.)

Barth,

J.

des Savants, aot 1899.

rnam gzigs mar me rin ehen gtsug / grans med gsum gyi tha mar byu [asamkhyeyatrayntajah / Payl Dlpo Batnaikhl]

228

CHAPITRE

IV,

110 b-112

a.

A
fut

l'poque du parfait et complet

Bouddha Ratnasikhin

fut

com-

plt le premier

asanikhyeya
second
;

l'poque de Bhagavat DTparnkara

complt

le

l'poque du Talhagata Vipasyin fut com-

plt le troisime.

De

tous les
d.

Bouddhas

qu'il

vnra,
*

110
Un
vu

Le premier

fut

Sakyamuni.

ancien Sakyamuni (Vibhasa, 177,

i5),

parfait

Bouddha, sous

lequel Bhagavat, alors Bodhisattva, formula pour la premire fois le

de Bodhi en disant
!

Puiss-je,

moi

aussi, devenir
le

un Bouddha

tout semblable lui

Ce Sakyamuni, comme
;

ntre, apparut

pendant un mauvais ge du monde


ans. [9 a]

aussi sa loi ne dura que mille

De

quelle

manire

le

Bodhisattva

remplit-il

chaque Paramita

(p. 231, 1.3)?

111

a-b. Il remplit le

don en donnant tout tous, par


tous, jusqu' ses

piti

^
;

Lorsqu'il

donne tout

yeux
il

et

la moelle de

ses os, par piti, sans souhaiter quelque flicit,

remplit la vertu

de don.

111

c-d.

La

moralit et la patience en ne s'irritant pas, brist-on


*

ses membres, bien qu'il soit engag dans le dsir.


1.

dan po sa kyar thub pa yin. kalaliaynga, kaliyuga. poque de dispute rtsodpahi dus kho na la okntakle ; Hiuan-isang (Sarad Chandra Das). Paramartha mo-che-ch mo-ki kalpnte, c'est--dire apakarsakalpe : dans un temps o la vie diminue de dure (iii. 92). A cette poque, le futur Sakyamuni tait un kumbhakrakaknmra du nom
2.

de Prabhasa (Vyakhyfl).

pas

Le Mahavastu connait un Sakyamuni qui vcut il y a un nombre infini de kalincalculables (asatnkhyeya) (i. 47), lui aussi de Kapilavastu, et qui reut l'aumne de notre Sakyamuni, alors un marcband (pratham pranidhi tad
asi).
3. kun la thams cad sflin rje yis / sbyin par byed pas sbyin pa rdzogs == [dnasya prih krpay sarvebhyo sarvadnatah /| Exemple Sibi. 4. chags bcas yan lag bcad kyan ni / mi kbrug bzod dan tbsul khrims kyi
:

Hiuan-tsang,

xviii, fol.

8 b-9

a.

229
il

Lorsque, bien qu'il ne soit pas dtach (vltarga),

ne

s'irrite

aucunement

mme quand
et

on brise ses membres, alors

il

remplit les

Vertus de moralit

de patience.
'

112

a.

L'nergie, en louant Pusya.

Bhagavat,

lorsqu'il tait Bodhisattva, vit le

Tathagata Puya

qui,
II

l'intrieur d'une grotte de

montagne

-,

se rendait incandescent l

[ksdntislasyngacchede sargasypy] akopatah // Exemple le bhiksu Ksnti tortur par le roi Kali [= Kalbu] (Jnanaprasthana) c'est le Rishi Ksnti [Ksntivdin] du Stralamkra (Huber, p. 325, 383), le hros de Jtaka, 313 (Visuddhimagga, 302), Jtakaml, 2-8, Avadnakalpalata 38, Chavannes, Cinq cents contes, i. 161, Przyluski, A(^'oka, 358, Watters, i. 227. D'aprs Mahvastu, i. 170, le futur Skyamuni est dgag du dsir (vUarga)
: ;

depuis Dpamkara.
1.

skar rgyal bstod pas brtson hgrus kyi


14 (quelques variantes), o le

= [vryasya ptisyastavanat]
(ii,

Cette histoire est raconte dans Avadnasataka, 97

176) et dans

Romantic

Legend,

p.

Bouddha

est
;

nomm

Pusya.

Para-

martha et Hiuan-tsang ont, en transcription, Tisya notre version tibtaine a skar rgyal que le Dr. P. Cordier, (d'aprs Astiigahrdaya 2. 1. 38) traduit Pusya. Dans Mahvyutpatti on a rgyal Pusya (le Naksatra) (165. 6) Tisya (le

Cakravartin), (180.

54)

47.

17,

Tisya

(le

Srvaka)

= hod

Iclan avec la glose

pu

sa (sus) clan (ma) hclom na skar rgyal du gdags : tant exhort par Pusya (?), Dans Mahvastu, iii. 240. 6, Pusya reoit la il est appel skar-rgyal (?). prophtie de Tisya. D'aprs Romantic Legend, Tisya vint 4 kalpas avant Pusya, 95 kalpas avant kyamuni. dans la grotte du Ratnagiri 2. Paramrtha Avadnasataka: himavantam parvatam abhiruhya ratnaguhm pravisya 3. tejodhhim sampadyamnam. Paramrtha et Hiuan-tsang traduisent
: ; :

entr dans le recueillement de tejodhtu


fait

(hoo kidi ting

c'est l'expression
le

dont Eitel

agnidhtusamdhi).

Les interprtes chinois emploient


*

plus

souvent la formule hoo kong ting,

samdhi de

l'clat

de feu

'

(Chavannes,

iii. 155, 264), qui corrrespondrait k jyotisprahhasamdhi. de cette manifestation de rddhi par laquelle un saint rend son corps incandescent, met flammes et fume, Mahvyutpatti, 15. 14 dhmayati prajva-

Cinq cents contes,


Il

s'agit

layaty api tadyathpi nma ntahn agniskandJiah (Voir Dgha, iii. 27 Kosa vii. 48 et suiv. sur la rddhi). Le pouvoir de Tascte sur les lments, lment aqueux, lment ign, est acquis par une mditation dans laquelle il considre cet lment. Ainsi s'explique l'explication de Childers (s. voc. tejo) tejodhatum sam having entered upon jhna by tejokasina (sur les krtsnyatapajjitvci nas, Kosa, viii. 36) que Senart (Mahvastu, i. 556) compare celle de Beal
;

causing their bodies to ascend into space and mit

ail sorts

of brilliant appearan-

230
le

CHAPITRE

IV,

112.
b], se

loua pendant sept jours et sept nuits [9


:

tenant sur un pied,

rptant la stance

Ni au

ciel

ou sur la

terre, ni

dans ce monde,

ni

dans
les

le sjour

de Vaisravana, ni dans

le palais

des Marus, ni dans

autres lieux clestes, ni dans les directions et sous-directions


:

cardinales

o trouver, chef des hommes, un ascte qui


si

soit ton

gal ? Qu'on parcoure,

Toi; veut, la terre entire, si peuple, avec

'

ses montagnes et ses forts.

Alors, d'aprs l'Ecole, se trouva

remplie la vertu d'nergie et neuf ges cosmiques furent franchis

(pratyudvartita).

112
ces
.

b.

Le recueillement

et l'intelligence,

immdiatement avant.

L'homme, entrant en dhyna par la contemplation du feu (tejokasina), On verra Divya, mme, au cours du dhyna, de crer des flammes, etc. proclam par Bouddha le meilleur pratiquer le p. l&S, la lutte de Svgata recueillement ign, tejodhtum sampadyamnnm agrah (Anguttara, i. 25) avec le Nfiga enflamm par la colre. Dans un grand nombre de sources le satndhi de feu ou tejojjhna accompagne le Nirvana (Udna, viii. 9 Przyluski, Lgende d'Aoka, p. 26, Mahvamsa, v. 220, Mahvastu, i. 550, etc.). 1. fia divi bhuvi va nsmiml loke na vaisravanlaye na marubhavane divye sthne na diksu vidiksu ca / caratu va^udham sphltm krtsnm saparvataknanm purusavrsabha tvattulyo 'nyo mahramanah kutah If Le MS. de l'Avadanasataka donne purusavrsabha stutulo nyo fnahsramanah kutuvh //
est

'

'

que Speyer corrige

purusavrsabhsty anyas tulyo inahsramanas tava. h jeu tng tsun yeu san (eul) te. La version tibtaine finit par ga la yod, qui donne kutah. Vyfikhyfi na divi bhuvi ceti vistarah j divi bhuvi cety uddesapadanyayefioktam II ndsmin loke na vaisravanlaye na marubhavane divye sthna iadvyaktyartham nirdesapadni / asmin loka iti manusyaloke / vaisravatilaya ili cttirmahrjikasthne / marubhavana iti marudbhavane tryastrimabhavana ity arthah / divye sthne ymdisthne II lokadhtvantaresv api tatsudfsasybhvajnpanrtham ha na diksu vidiksu ceti // aiha na sraddhiyate j caratu kacid vasudhm imm krtsnm sphilffi bahusattvdhyasitm svayam pratyaveksatm ity abhipryah / 2. satndhidhyor anantaram jl Cest par le samdhi et la prajn (= dhi) que sont acquis les fruits. Pour
Paramfirtha
:

...

rAbhidliarma,
sous l'arbre

le

Bodhisattva reste Pfthagjana jusqu'au

(iii.

41).

Les coles ne sont pas d'accord l-dessus

moment o il s'installe comme on peut


le

voir daiui les traits de

Vasumitra

et de

Bhavya. D'aprs Madhyamakfivatara,

Hiiian-tsang,

xviii, fol.

9 a-b.

231
la Bodhi,

Au moment
il

du vajrasamdhi

',

immdiatement avant

remplit les vertus de

dhyna et Les Pramits reoivent le nom


d'elles.

de praji. de

pramit

parce qu'elles sont

parvenues l'autre bord de l'ensemble des perfections (sampad)


propres chacune

Le Stra enseigne
mditation.

qu'il

y a

trois

punyakriyvasttis, celui qui

consiste en don, celui qui consiste en moralit, celui qui consiste en

Comment

le

don, la moralit, la mditation sont-ils

punyakriyvastu ?

112

c-d.

Trois sont mrite, action, lieu d'exercice de l'action


le

comme dans

cas des chemins-de-l'acte \ [iO a]

Bodhisattva, ds la premire

tierre,

abandonne
le

les

vues errones (satkyadrsti,


le

sllavrata, vicikits).
1.

Le vajropamasamdhi
le

(vi.

44 d) est

recueillement par lequel

candidat

la qualit d'Arhat rompt

les derniers liens et obtient la

Bodhi, laquelle consiste


passions sont dtruites,
confre

dans

ksayajnna

et

Vanutpdajna

(savoir

que
le

les

savoir qu'elles ne renatront plus).


la qualit

Au

Bodhisattva,

vajropamasamdhi
la qualit

de Bouddha

car

un Bodhisattva n'acquiert
vi.

d'Arhat qu'aprs

avoir rempli les Pramits (voir

24 et

ii.

44

a-b, trad. p. 206).

Hiuan-tsang ajoute
53
b.

prenant place sur

le

vajrsana

,
11.

ou bodhimanda

(Minaiev, Recherches, 177), qui est dcrit dans Vibhs, 13,


iii.

Le Kosa en parle

2.

Sur
i.

les traductions
p. 2.

chinoises du

mot pramitd, Chavannes, Cinq cents


i.

contes,
(trad.

Etymologie, Candrakirti dans Madhyamakvatra,

16 a-b

Muson, 1907, p. 29), F. W. Thomas, JRAS. 1904, 547. 3. gsum po bsod nams bya ba dan / dehi gzhi dper na las lam bzhin nyam kriy ca tadvastu trayam karmapatho yath //]

= [puiii.

Madhyama,
218
;

11, 14
iv,

Vibhs, 126,
:

4,

112, 11

Mahvyutpatti, 93.

Dgha,

Anguttara,

241

dnamayam

punnakiriyavatthu, slamayam, bh-

vanmayam.
347-348, examine la place du dna dans ii, which conlains a good deal more of the milk for babes than the other three of the great Nikyas , consacre un vagga la charit, laquelle ne figure pas parmi les ailes de la Bodhi , laquelle est ignore dans le Dhammapada. Mais l'enseignement du dna, par dfinition, s'adresse aux Upsakas voir ci-dessus p. 70 et ci-dessous p. 235 cependant le dna est utile

Rhys Davids, dans Dialogues,


;

l'criture

l'Anguttara,

au Nirvana,

iv.

117

d.
riz,

Louange du don de

Mahavagga,

vi, 24. 5,

du don d'un vihra, Culla,

vi. 1. 5.

232
Ces
trois,

CHAPITRE

IV,

112 c-113.

don, moralit, mditation, chacun suivant sa nature,

sont mrite (punya), action (kriy), lieu d'exercice (vastu), soit

combins, soit isols

de

mme que les chemins-de-l'acte sont


l'acte,

ou bien
l'acte.
il

la fois acte et

chemin de

ou bien seulement chemin de

A
un

considrer d'abord le punydkriyvastu


:

qui consiste en don,

faut distinguer

1. l'acte
:

corporel et vocal qui est

punyakriyvastu
;

triple titre

mrite, parce que sa rtribution est agrable


qu'il est acte

action

(punyakriyjy parce

de sa nature

lieu d'exercice

ou
;

objet (vastUj adhisthna) de la volition de donner qui le provoque


2. la volition

(cetan) de donner, qui est mrite (punya)


;

et action

(punyakriy)

3. les

dharmas

(sensations, etc.) qui

accompagnent

l'acte corporel et vocal, et qui

sont seulement mrite.


est exclusivement
et lieu

Le punyakriyvastu qui consiste en moralit


acte corporel et vocal
;

il

est

ncessairement mrite, action

lieu d'exercice de l'action.

Pour

le

punyakriyvastu qui
elle

consiste en mditation, considrons


:

la mditation de bienveillance (maitrl, viii. 30)

1.

cette mditation

est mrite

est

aussi lieu d'exercice

d'une

action

mritoire

(punyakriyys ca vastu), savoir de


veillance, car cette volition

la volition associe
le

la bien-

prend forme dans

moule de
;

la bienveil-

lance

'

2. la volition

en question est mrite

et action

de

mme

aussi

la moralit qui constitue le

dhyriasamvara,

discipline de

dhyna,
;

que possde l'homme qui pratique la mditation de bienveillance


3.

les autres

dharmas

(foi,

etc.)

concomitants la mditation sont

seulement mrite.

Ou

bien l'expression

punyakriy

signifie

punyakrana, punyaon entreprend


le

prayoga. Le don,

la moralit et la mditation sont le vastu de la


les

punyakriy, parce que, en vue de


prparatif du mrite.
1.
^

raliser,

[10

b]

2.
*

Hiuun*tsang

maitrlmukhena abhisafftskarant Ou bien punyakriy


:

= maitrlvaena abhisatficetant
signifie faire

punya
le

c'est--dire

prparatif de

punya

(punyaprayoga). Le mot vastu


le

signifie point d'appui

(Araya, adhisthna)

don,

la

moralit et la mditation sont


le

vastu,

le

point

d'appui du prparatif du

punya, parce qu'on produit


.

prpoxatif du

punya

en

vue de ralier don, moralit et mditation

Hiiian-tsang,

xviii, fol.

10 b-11
est,

a.

233

D'aprs une autre opinion, lapimyakriy


la

parler exactement,
le

bonne

volition

le

don, la moralit et la mditation sont

vastu,

le lieu d'exercice

de cette volition.

Qu'est-ce que le don, clna ?

Sans doute, par dna on entend en gnral ce qui


(deya), mais
ici

est

donn

113

a.

Le don,

c'est ce qui

donne.

'

Mais on donne par

crainte, par espoir de rciprocit, par attacheil

ment (rga),

etc.

or

ne s'agit pas
dit
:

ici

de ce genre de don. Par


c'est ce qui
-

consquent, pour prciser, l'auteur

Le don,

donne

113

b.

Par dsir de rendre hommage ou

service.

Qu'est-ce qui donne ?

113
Une
nent.

c.

C'est

un acte corporel

et

vocal et ce qui produit cet acte.

collection

(kalpa) de pense-et-mentaux (cittacaitta) donne


:

origine

un acte corporel ou vocal


dit

cette collection et cet acte

don-

Comme

la

stance

Lorsqu'un homme, avec une bonne


lui
^

pense (manas), donne ce qui

appartient, alors

on

dit

que

les

bons skandhas donnent.

[11 a]

113

d. Il

a pour

fruit

de grandes jouissances.

"

Le punyakryvastu qui consiste en don (dnamaya) porte pour


fruit

de grandes jouissances.
dlyate yena

t.

que
2.

le

tacl dnam. Dans Kathvatthu, vii. 4, le Theravdin soutient dna est seulement ce qui est donn. Par le don on rend hommage aux Caityas, aux pjnugrahakmay
/
.

tres nirvns (parinirvrta).

dan iiag las slon dan bcas [kyavkkarma sotthnafn] Les traducteurs chinois comprennent les bons skandhas de ce moment donnent ... . L'acte corporel et vocal de don est rpa ; les pense-et-mentaux
3. lus 4.
:

sont les quatre


5.

skandhas
et ailleurs

immatriels.

de hbras Ions spyod chen po can

mahbhoga
(kmaguna)
.

[tan mahbhogavatphalam //] udrabhoga on peut entendre grande jouissance


:

d'aliments, de vtements, etc.

ou

jouissance de grands objets de jouissance


393.

Voir Anguttara,

iv.

234;

CHAPITRE
suffixe

IV,

114-115.

Le

maya, que nous


ayant pour nature

traduisons
,

qui consiste en

doit

s'entendre
faite

de

mme
fait

que

l'on dit
.

'

maison

d'herbe
a-b.
*

(trnamaya grha),
est

vase
soi,

de feuilles

114

Le don

avantageux

autrui,

aux deux, aucun

des deux.

Le don
celui qui

fait

un Caitya n'est pas

utile

autrui

mais

il

est utile

donne lorsque

celui-ci est

un rya non dtach du

dsir

(amtarga, avirakta, sarga) ou un Prthagjana dtach ou nondtach. (Voir


iv.

121)

Le don que

fait

autrui un rya dtach


la

l'exception du cas
utile

o ce don mrirait dans

prsente existence n'est pas

cet

rya, car l'rya dtach a dpass dfinitivement la sphre (Kmadhatu) o pourrait avoir
rtribution
lieu,

dans une existence postrieure,


utile

la

du don. Ce don
fait

est

seulement

autrui.

Le don que
Le don que

autrui un rya non-dtach, un Prthagjana


b], est utile

dtach ou non-dtach [11


fait

soi et

autrui.

un Caitya un rya dtach

cas o ce don mrirait dans la prsente


soi, ni

l'exception du existence
n'est utile ni
effet

autrui. Ce don a seulement pour

d'exprimer

hommage

et

reconnaissance.

Nous avons

dit,
:

d'une manire gnrale, que

le

don produit de

grandes jouissances

114
l'objet

c-d.

Le don

est excellent par l'excellence


'

du donneur, de

donn, du champ.

1. svabhve caisa mayad iti na vikrdisu. La maison n'est qu'herbes non modifies (nirvikdra) ; elle n'est pas une transfoiiuation des herbes. maya a une valeur diffrente dans rutamayl prajn (vi. 5 c). 2. bdag gzlian don phyir gnis don pliyir / gnis kahi don du min phyir sbyin

svaparrthobhayarthya [nobhayrthaya diyate /J 3. de yi kliyad par sbyin bdag dan / dnos dan zhin
vieso dfiapativastuksetraviesatah
// ]

gi

khyad par
le

las

= [tad'

Kath&vallhu,

xvii. 1 1, les

Uttarfipathakas soutiennent que

donneur (ddyaka),
celui qui est

non pas

le

champ,

purifie le don.
fol.

Karmaprajiiapti (Mdo 02,

246 b)

11

y a quatre dons

pur du

Hiuan-tsang,

xviii, fol.

11 a-12

a.

235

115

a.

Le donneur

est excellent par la foi, etc.

'

Le donneur (ddnapati)
moralit,

est excellent lorsqu'il est revtu

de

foi,

de

de science (sruta), de

gnrosit (tyga),
etc. le

de sapience

(prajn), de sobrit (alpecchatd),


excellent, le

Quand

le

donneur
son

est

don

est excellent

quand

don

est excellent,

fruit

est excellent.

115

b. Il

donne avec

respect, etc.

Semblable donneur donne avec respect (satkrtya), de sa main


(svahastena), au

moment voulu
;

(kle), sans faire de

mal personne

(parn aniipahatya

comparer Milinda,

276).

115

b-d.

D'o

il

obtient des honneurs, des jouissances suprieures,


l'abri

au moment convenable,

de tout

dommage.

Le donneur qui donne avec respect obtient des honneurs


de sa main,
il

donnant

trouvera satisfaction dans des jouissances suprieures


;

(udrebhyo hhogehhyo rticim lahhate)


il

donnant au moment voulu,

obtiendra ces jouissances en temps convenable et non pas lorsqu'il


;

ne peut en jouir
indestructibles
:

donnant sans

faire de mal, ses jouissances seront


le feu, etc.

elles

ne seront pas drobes, annihiles par

Nous avons expliqu en quoi consiste l'excellence du donneur et comment le don est excellent par l'excellence du donneur. Com-

ment
fait

l'objet

donn

est-il

excellent ?

du donneur, impur du
.

fait

du

rcipient, et le reste

comme dans

le

Saragltipa;

ryya
tara,

C'est le texte cit par l'auteur de Kathvatthu (Dgha,

iii.

231

Angut-

ii.

80
iv.

Majjhima,

iii.

256 (dakkhinvibhangasutta)

Voir
1.

121 c-d.

sbyin bdag khyad hphags dad sogs kyis

2.

gus

la
ii.

sogs par sbyin par byed

= [sraddhdimsisto data] = aatkrtydi dadti [M]


j

Dgha,

357

sakkaccam dnam, sahatth, cittikatam, anapaiiddham

dnam.
Sur ls traits du don, de la moralit et du ciel , voir ci-dessus p. 70. Un spcimen de dnakath, Anguttara, iv. 393 le Vimnavatthu appartient celte
;

cule (trente-sept qualits

Divyvadna xxxiv est de Grand Vhidu don kle ... satkrtya ....) 3. de phyir bkur sti rgya chen dan / dus dan bar chad med par rned [satkran udrn kle] 'nacchedyn lahhate tatah //
littrature (MinayefF, Recherches, 165)
:

236

CHAPITRE
a.

IV,

116-117
*

b.

116

L'objet parfait de couleur, etc.


:

Supplez

est

excellent

L'objet est excellent lorsque ce qu'on

donne

est parfait de couleur,

d'odeur, de saveur, de contact.

Qu'oblient-on par

le

don de semblable objet ?


gloire, joie,
^

116

b-d.

D'o beaut,

grande dlicatesse du corps

et

contacts correspondant la saison.

Celui qui donne un objet parfait de couleur sera beau.


Celui qui donne un objet parfait d'odeur [12 b] s'tendra de toute
part par sa rputation, de

mme

que se rpand une odeur.

Celui qui donne un objet parfait de saveur sera joyeux,

comme
trs

une saveur douce.


Celui qui donne
dlicat,

un objet

parfait

au toucber, son corps sera


et ses

comme

le

joyau de femme d'un Cakravartin,

membres

n'auront que des contacts agrables, chauds ou froids suivant la


saison (rtusukhasparsni csyngclni).

Comment

le

champ

est-il

excellent ?

117

a-b.

Le champ
'

est excellent

par la destine, la souffrance,

le

bienfait, les qualits.

Champ

excellent par la destine.

Bhagavat a

dit

Il

faut atten;

dre une rtribution cent fois plus grande du don fait un animal
faut attendre une rtribution mille fois plus grande du don fait

il

un

homme
1.

immoral.

varndisafftpannam vastu.
la foi

Que

l'intention importe,
p.

donn, voir par exemple Huber, Slrfilamkfira,


<

122, Minayeff, p. 167

non pas l'objet au bas


:

Les pauvres, qui ont


2.

de las gzugs bzan grags Idan dan


lus

bgyur arayas tatah jj


Aguttara,
3.
4.
iii.

na bde

= [surpah
J
:

/ dga dan sin tu gzhon sa dan / dus su reg klrtimn ratah / atisukumra rtusukhaspar-

50

manpadyi labhate manpam.


iii.

gatiduhkhopdkaraxiayunaih ksetram visisyate / C'est le Sotra cit Kosa iii. 41 la fin. Comparer Mujjhima,

255

tiraC'

Hiuan-tsang,

xviii, fol.

12 a-13

a.

237

Champ

excellent par la souffrance.

Bhagavat,
le
',

parmi

les
le

sept

atipadhika pnnyakrii/vastus, numre


l'infirmier, le

don au malade,
et
il

don
:

don pendant
fille

les

temps

froids, etc.

poursuit [13 a]

Le

fils

ou

la

de famille qui est revtu de ces sept uvres mri-

toires matrielles,

on ne peut dire

la

mesure de son mrite.

Champ
(Divya,

excellent par les bienfaits.

Don au

pre, la
:

mre

p. 52),

au matre, aux autres bienfaiteurs. Exemple


etc.
^

le

Jataka

de l'ours, de l'antilope,

Champ
clinajate
chisslle
1.
....

excellent par les qualits l

Bhagavat

dit

Une

rtri-

dnam

clattv satacjini dakJchinrx pCttikankifabb, puthtijjana-

sahassagun....
ici la

Yasiibandhu mentionne

sixime et la septime
:

uvre mritoire mat-

rielle (voir ci-dessus p. 15).

On

a
...

5.

fjcintnkya

gamikya va dnam da-

6. .... glnya glnopasthpakya va dnam ys ta bhavanti sltalik va vtalik va varsalik va tadriipsi ltaliksii yvad varsaliksu bhaktni va tarpyni (tarpanni) va yavgpnni va tni samgliybhinirhrtya atmprayacchaU j idam ry asmkam anrdragtr anabhivrstacvarli paribJmjya sukham sparsam viharantu / idam Cunda saptamam atipadhikam pimyakriyvastu. D'aprs l'diteur japonais du Kosa, Madhyama, 2, 4 diffre un peu. La version de Hiuan-tsang porte Dans les sept aiipadhikapunyakriyvastus, il dit qu'on doit donner Vgantuka, au gamika, au glana, au glnopasthyaka, Vupadliivrika (yun-ln-tch'ng) qu'il faut rchauffer celui qui a froid. Hiuan-tsang numre donc les cinq bnficiaires des tyayikapindaptas (Divya, 50, Burnouf, 2G9 Sixime dit, Bhler, Beitrage 2G9) le moine qui arrive, qui part, qui est malade et l'infirmier (liste de Mahvagga, viii. 15. 7,

dti

idam paricamam
...

dadti

7.

...

comp. Angutlara,
lequel nous
t'ng che)
;

iii.

41) et Viipadhivrika, le

bedeau, gardien du Vihra

sur

sommes insuffisamment
Divya, 54, 542
;

renseigns. (Malivyutpatti, 274, 12 (tch'ng


;

Sarad Chandra Das, dge skyos


ii.

S. Lvi,

Quelques

titres nigmatiques...

JAs. 1915,

193)

Nos textes se proccupent peu des pauvres . On peut signaler l'Avadna du Nirvana de Mahksyapa .... Dans les rues du village, les malheureux sont affligs et affaiblis. Les pauvres, il a toujours eu piti d'eux et les a secourus. Maintenant cette multitude de misrables a perdu son protecteur.... (Przyluski, Lgende d'Aoka, p. 232).
:

2.

C'est l'ours auquel

il

est fait allusion,

Huber, Strlamkra,

p. 383.

La

VykhyS explique que l'ours a sauv un homme gtthm pravisya gtrosmastpanayena d'aprs Vibhs (114, 9) On raconte qu'un homme cherchant du bois s'gare dans la neige . Pour le mrga, c'est l'animal qui fait traverser
; :

....

la rivire
3.

un

homme
iii.

qui se noie,

uhyamnanadyuttranena

...

npakrin.
fol.
8(>),

Majjhima,

253, ou

Gautamstra (Samghabhadra,

xxiii. 4,

est

238

CHAPITRE

IV,

117

c-d.

bution cent mille fois plus grande du don


et le reste.

fait

un

homme

moral...

Parmi tous

les dons,

117
me

c.

Le meilleur,

le

don du dlivr au

dlivr.

Le don donn par l'homme dtach (vltarga, vlrakta) un homdtach,

Bhagavat a

dit

que

c'est le meilleur des

dons matriels

(misadna).

117
Ou

d.

Le don du Bodhisattva.
don que donne
difficile.
:

bien, le

le

Bodhisattva pour

le

bien de tous les

d'interprtation

Mah5praj5palT offre une paire de vtements au Gautam, donne au Samgha en donnant au Sauiglia, tu m'Iionoreras et tu honoreras le Samgha . De ce texte et des passages o le Samgha (les quatre paires ou huit personnes , Arhat .... Srotafipannaphalapratipannaka) est dfini comme le champ de mrite par excellence (Dgha, iii. 255, Silltaniplita, 569, etc.), certains docteurs concluent que le don au Samgha est

Bouddha qui

refuse

don au Bouddha. Samghabhadra rfute cette thorie. [Le champ, Majjhima, iii. 254 Kosa, vii. 34 Divya, 71, Chavannes, Cinq cents contes, i. 394. Mais voir dans Vasumitra-Bhavya-VinTtadeva (Wassilieff, 251, 283) l'opinion des MahsSsakas (don au Samgha trs fructueux, non pas le don au Bouddha culte des Stupas peu fructueux), l'opinion des Dharmaguptas (don au Bouddha trs fructueux, non pas le don au Samgha). Un problme connexe si le Bouddha fait partie du Samgha.] Lorsqu'on prend refuge dans le Bouddha et dans le Samgha on prend refuge dans les dharmas de Saiksa et d'Asaiksa qui font le Bouddha, qui font le Samgha (voir Kosa, iv. .32). Or on ne peut pas donner des dharmas de Saiksa et d'Asaiksa, mais seulement des personnes (pudgala) ; donc le don au Bouddha et au Samgha ne porte pas de fruits. Thse discule Kathavatthu, xvii. G-10, et Samghabhadra loc. cit. [Le Samgha au sens propre, paramrthasamgha, c'est les dharmas des Saints et les huit personnes qui leur servent de rceptacle on prend refuge dans les dharmas, mais on donne aux personnes ]. 1. mchog ni grol bas grol ba la han [sresthatn muktasya mitktya]. D'aprs Madhyama, 47, 14. Voir les menus cadeaux que se font les novices arhats dans Divya. Majjhima, iii. 257 yo vltargo vitaryesu dadati ... tam ve dnafft Amisamritoire,

non pas

le

Bouddha

est le meilleur

dnaffi vipulatft
2.

brmi. [bodhisattvasya ca]. Le don du Bodhisattva a pour but


ti

la parfaite

Bodhi

et le bien

de tous les tres.

Hiuan-tsang,
tres
;

xviii, fol.

13 a-b.

239

ce don, bien

que donn par un

homme

non-dtach des non-

dtachs, est le meilleur don.

En

exceptant
d.

le

don du Bodhisattva,
*

117

Le huitime

Le huitime parmi
Quels sont

les huit

dons qu'enseigne Bhagavat.


^

les huit

dons?
pour

1.

Le don sadya ;
m'a donn

2. le

don par

crainte [13 b]; 3. le don parce qu'il


iti

(cidn

me dnam
;

dnam)

4. le

don

qu'ij

me donne

(dsyati)

5. le

don

parce que mes pres

et

mes grands
ceti

pres donnaient

(dattaprvam
Jtaka, 444.
;

me pitrhhis
vol. iv,

ca pitmahais
6. le

dnam) (Comparer
le ciel
;

52,

34)

don pour obtenir

(svargrtham)

7. le

don en
pense
48)
;

vue de

la rputation

(klrlyartliam)
(c'est--dire

8. le

don pour orner


les

la

(cittlamkrrthamj
min,

pour obtenir

rddkis,

vii.

pour munir la pense (cittapariskrrtham) [des memln-es du che-

mrgnga,

vi.

67 b]

pour l'quiper en vue du yoga (yoga;

samhhrrtliam
hat ou

= ^nidnrtham)
le

pour acqurir
pour obtenir

le

but suprme

(dtamrthasya prpfaye)
le

(c'est--dire

la qualit d'Ar-

Nirvana).
entendre par

Que

faut-il
:

don sadya ?

Les anciens matres

expliquent

Don

instantan ceux qui sont proches, s'approchant

1.

[asiamam
Dlglia,
:

Ij]

2.

iii.

2.58,

huit

dnavattlms

1-4 sont formuls


/

comme dans

notre

dnam ti dnam deti aham pacmi ime na pacanti 7. idam me dnam dadato kalyno kittisaddo abbhuggacchati 8. ciUlamkracittaparikkhrattham dnam deti.
texte

et

6 diffrent (slin
:

... )

La
liste
:

liste

des dnavattlms d'Anguttara,

iv.

236, fournit les n^^ 5 et 6 de notre

dinnapubbam katapubbam pitupitmahebi na arahmi pornam kulavamsam Jipetnm ti dnam deti saggalokam upapajjisdatv smi 3. sna ma dag na re nam fie bar gyur ciii ne bar Ihags pa dag la sbyin paho. Pammrtha y tch ki ts'Tn kin j'en = Don aux sanna et aux proches.
I
...

...

...

...

Hiuan-tsang
ner

soi kin

tch fng nng ch y


(Jtaka,
v.

suivant qu'on s'approche, don-

tara, iv.

Commentaire de l'Angutpatv dnam deti gatam disvva tam muhuttam yeva nisldpetv sakkram katv dnam deti.
-^

sajja
236

upagantv
:

p. 342).

(d.

Siamoise)

sajja

dnam

detti

240

CHAPITRE
crainte, c'est le
:

IV,

118-119.
fait

Le don par
l'objet

don que donner


:

un homme qui
'

voit

que

va prir
dit

Mieux vaut

le

, pense-t-il.

Le Sntra

(Madhyama,

47,

3)

Du don

fait

un srotapanna;

phcUapratipannaka procde une


Mais

rtribution incalculable

du don
.

un sroiapanna procde une rtribution encore plus incalculable


il

y a aussi cinq personnes qui, bien que Prthagjanas, confrent


fait

l'offrande qu'on leur

une rtribution incalculable

118. Bien

qu'ils

ne soient pas des ryas,

les offrandes faites

pre et mre, au malade, au prcheur, au Bodhisattva sa dernire


naissance, sont sans mesure.
^

Ces offrandes sont sans mesure au point de vue de

la rtribution.

Par

Bodhisattva sa dernire

naissance

(anfyajanman),

Fauteur veut dire


hhavika). [14 a]

Bodhisattva sa dernire existence

(carama?

quelle catgorie appartient le prcheur


faut-il le

(dharmdbhnaka)

Parmi quels champs


des bienfaiteurs
:

ranger ?

il

11 fait

partie de la catgorie

il

donne

l'il

de la sapience (prajhcaksus) aux


;

multitudes aveugles par l'ignorance


qui est bien

proclame (praksayitar) ce

(sama

= dharmaj
la loi
il
:

et
'"

mal (visama
en un mot,

= adharma)
il

'

il

difie le corps

immacul de

accomplit toute

l'uvre d'un Bouddha

donc

est

un grand

ami

spirituel

(mah-

kalynamitra).
1. Comm. de l'Anguttara bhay ti ayam adyako akrako ti garahabhay apdyabhay va 2. hphags pa min yan pha ma dan / nad pa dan ni clios smra ba dan / [mtpitrbhym glnya bhnakyntyajanmane] j bodhisattvya cmey anryebhyo 'pi daksinh //
:

....

Cette seconde ligne est cite Vyakhya, ad


3.

iii.

41,

in

fine.

D'aprs l'ditenr japonais

sama,

ce qui produit

une naissance divine

viaama, ce qui produit une mauvaise destine. 4. La version tibtaine porte chos smra ba
palti, 138. 5.

t il

difie
le

= mnon par sgrub. Hiuan-tsang traduit


pur

= dharmabhnaka, Mabfivyut^
:

Il

fait
le

que

les tres

produisent

dharmakdya

Paraniflrlba

Il

produit

corps de la

loi.

Voir ci*dessus p. 77.

Hiuan4sang,
Pour apprcier
stance, tenir

xviii, fol.

13 b-l4

b.

241
on
doit,

la lgret et la gravit des actes,

en sub-

compte de

six causes

119.
tion
petit
:

Conscutif, champ, adhisthna, prparatif, volition, inten-

suivant que ces causes sont petites ou grandes, l'acte aussi est

ou grand.
:

'

Conscutif

aprs avoir

fait l'acte,

agir en consquence.
.

Champ

ce quoi on fait du bien ou du mal.


:

adhisthna
Prparatif
:

le

chemin-de-l'acte proprement

dit.

action corporelle ou vocale en vue du prcdent.


:

Volition Y^etan)
(nisthd). [14 b]

ce par

quoi

le

chemin-de-l'acte est achev

Intention (aya)
ensuite ceci ou cela.
Il

projeter
'^

Je leur ferai ceci ou cela

je ferai

arrive que l'acte soit grave en raison du seul conscutif (prsthaeva), lorsque celui-ci confre la rtribution le carac-

parigrahd
soit

tre de ncessit

(vipkanaiyamyvasthnt).
:

II.

arrive que l'acte

grave en raison du champ


Il

le

parricide est plus grave que le

meurtre.

arrive que, le

champ
est

tant le

rende l'acte grave tandis qu'un autre


exemple, tuer pre
leur mentir,
etc.,

mme, certain adhisthna adhisthna le fait lger par


:

et

mre

un acte grave
'"

voler pre et mre,

n'est pas grave en comparaison.

On

expliquera de

mme
elles

la gravit rsultant

du prparatif,

etc.
;

Quand

toutes ces causes sont grandes, l'acte est trs grave

quand

sont petites, l'acte est trs lger.

chun

mjug dan zhin dan gzhi daii ni / sbyor dan sems pa bsam pa ste / de dag daii che ba las / las kyan chun dan che ba nid [prstham ksetram adhisthnam prayogas cetanSayah / tadalpanahattvd alpamahattvam api karmanah // ] 2. byas palii rjes la byed pa krtmikarana. Tous les projets Je dois faire ainsi, ainsi je ferai ainsi, 3. Hiuan-tsang ainsi . Note de l'diteur C'est le prparatif loign. 4. Comparer Milinda, 193, sur le mensonge grave ou lger en raison de l'objet (catthuvasena) ; de mme le meurtre est sans importance quand l'animal est
1.

petit, Atthasalin, p. 97.

16

242

CHAPITRE
distingue Tacte
*

IV,

120.

On

fait

'

(krta) et l'acte

accumul

'

(upacita).

'

Quelles sont les caractristiques et les conditions de l'acte accumul ?

120.

L*acte est dit

accumul

',

en raison de son caractre inten-

tionnel, de la compltion, de l'absence de regret et de contrecarrant,

de l'escorte, de la rtribution.

[15 a]

En
fait

raison de son caractre intentionnel (samcetantas).


'

L'acte

volontairement ou intentionnellement (samcintya)


;

est accu-

mul

non pas
\

l'acte fait

involontairement ou inconsciemment (ahudl'acte


fait

dhiprvam)
volontaire.

non pas

en hte (salias krtani),

ft-il

1.

D'aprs Paramfirtha et Hiuan-tsang

d'actes, l'acte kria, l'acte

upacita
(?)

...

Le Stra dit qu'il y a deux sortes D'aprs l'diteur japonais, ce Stra est le
:

KarmavipfikavibliangasQtra

kim so vediyati. Anguttara, v. 292 nham samcetaniknm kammnam katnam upacitanam appatisantiiditv vyantibhvam vadmi. Divya, passini na karMajjhima,
iii.

(y-pao-tch'-pi-king)

Voir Koa,
...

v. 1

207
:

satncetanikam

katnmam katv

mni krtny upacitni prthivdhtau vipacyante


Madhyainakavrtti,
p. 303.

Kathfivatthu,

xv.

11;

Pour
tasfira,

la thorie vdantique, voir les

sources indiques par G. A. Jacob, Vedfin-

Bombay, 1911, p. 160 (samcitakarmatt upacita'^, kriyamnni karnmni, rabdhaphalni karmni). 2. bsam bzhin pa dan rdzogs pa dan / mi hgyod giien po med pa dan / hkhor dan rnam par srain pa las / bsags palii las ses bya ba yin (oh bzhin) / [samcetansamptatvkankrtypratipaksatah j parivravipkc ca karmopacitam ucyate jj ]
Voir ci-dessus,
3. p. 114.

samcintya

= samcicca, Mahavyutpalti, 245.


le

68.

Manu,

xi. 90,

prescrit des

pnitences pour

meurtre involontaire, akntatas, (ce qui ressemble beaucoup

asamcintya) d'un brahmane. Pour le meurtre volontaire, il est inexpiable. 4. Vyakhya nbuddhiprvam na sahasakrtam iti / atha va nbuddhiprvam krtam idam kurym ity asanicintya krtam / tan nopacitam / avykrtam hi tat karma / na sahas krtam iti buddhiprvam api na salias krtam j yad abhysena bhsydksepn mrsvddyanusthnam krtam tad akualam na punar upacitam : Ou bien il faut entendre L'acte abuddhic'est--dire l'acte qu'on lait sans dcider Je ferai cela , n'est pas prva,
:

accumul, car cet acte est non-dfini. L'acte


sion, n'est

fait

en hte,

fut-il

prcd d'une dci-

pas accumul, par exemple

le

mensonge profr par habitude verbale

dans l'entrainement du discours. Cet acte, mauvais, est fait, mais n'est pas accumul . C'est par bhsyksepa que l'auteur d'un trait rpte, dans une num-

Hiuan-tsang,

xviii, fol.

14 b-15

a.

243

En

raison de la

'

compltion

'

(samptatva).

Quelques-uns vont
;

dans une mauvaise destine par un mfait (duscarita)


par deux
;

quelques-uns
;

quelques-uns par trois (mfait corporel, vocal, mental)


....

quelques-uns par un chemin-de-l'acte, par deux, par trois

par dix.

Etant donn qu'un

homme
;

doit aller

dans une mauvaise destine par

une certaine quotit


est fait,

d'actions, si cette

mesure

n'est pas remplie, l'acte


il

non pas accumul

quand

elle est remplie,

est

accumul.

En
pa,
ii.

raison de l'absence de regret (kaukrtya) et de contrecarrant

(pratipaksa).

Lorsque

28j, lorsque

manque le remords (vipratisra, anutmanque le contrecarrant, confession, etc. ^


mots qui ne sont pas
justifis telle place. (Voir
ii.

ration strotype, des


p.

trad.

259)
:

La Vykhy, exposant les caractres de l'acte bon qui est accumul, dit evam kusalam api yojyam iti kathatn samcetancitah / samcintya krtam biiavati j nhuddhiprcakrtam bhavati tadyath vyakrtacitteiia psnam dadmlti suvarnapindam dadyt krtam tan na punar upacitam / avykrtam yath hhsyksept satyavacanam / hi tat karma / na sahas krtam krtam tat kusalam na punar iipacttam. 1. kas cid ekena duscaritena durgatim yti kacid yvat tribhih / kacid ekena karmapatliena kas cid yvad dasabltih tatra yo yvat gacchati tasminn asampte krtam karma nopacitam j sampte tpacitam. Comj / j /

parer Anguttara,
2.
Il

i. 249 ci-dessus note ad iv. pratidesandipratipaksbJmvataJi.


;

50.

y a

ppassa kammassa samatikkamo,

'

passage au del du pch


la

',

par

l'abstention (virati

= prise de
iv.

la discipline),

par

mditation de bienveillance

(maitrl), Samyutta,

317.

Prtimoksa (Finot,
vrir
;

J.

As. 1913,
il

ii.

16)

s'tant dcouvert,

sera tranquille
n. 2, et

...

Qui se rappelle une faute doit se dcou viskrtvsya phsam bhavati

(voir ci-dessus iv. 39, p. 98,

sur

le

mensonge

silencieux,

iv. p.

163, n. 4).

Ptimokkha, dans Vinaya Texts, i. 2 et Culla, ix. 1. 4 (Vinaya Texts, iii. 305, note 1) Confession dans le Grand Vhicule, Bodhisattvabhmi, I, x. Divya, passim Reconnais ton pch (atyayam atyayato deaya) ; cette
:

(apy evaitat karma taniitvam pariksayani parydnam gaccheta) [Majjhima, iii. 247 yato ... accayam accayato disv yathdhammam putikarosi tan te rnayam patiganhma ; Dgha,
action sera rduite, dtruite, anantie
:

i.

85

Anguttara,

i.

238, Burnouf, Introduction, p. 299

Bodhicaryvatra,
il

ii.

66,

etc.].

En
le

reconnaissant son pch (avoir insult un Arhat dont

ignorait la qua-

lit)

vaiyvrtyakra de Divya,
fois

54-55, vite l'enfer,

mais cependant renat


le

cinquante

comme

fils

d'esclave.

Sikssamuccaya, 160

et

Bodhicaryvatra,

v.

98 citent

Caturdharmakastra,

244

CHAPITRE
raison de l'escorte.

IV,

120-121
l'acte

b.

En

Lorsque

est

mauvais
:

et

a une

mauvaise escorte (akualam akusalaparivram ca)


rjouit de Tavoir

lorsqu'on se

commis.

En

raison de la rtribution.

Est accumul l'acte qui donne


(iv. 50).

ncessairement rtribution (vipkadne nlyatam)

De mme pour
accumul.

l'acte bon.
fait,

L'acte qui ne prsente pas ces caractres est

mais

n'est

pas

Nous avons vu

(iv.

114

a)

que

le

don

fait

un Caitya par un
le

homme non
fait.

dtach du dsir est un don avantageux pour celui qui


la chose

Mais personne ne jouit de

donne

comment

ce

don

peut-il tre mritoire

Le mrite du don
don (tygnvaya),
2.

est de
le

(punya) ? [15 b] deux sortes

1.

mrite produit par l'abanfait

mrite qui rsulte du seul

d'abandonner
',

mrite produit par la jouissance (parihliognvaya)

le

mrite qui

rsulte de la jouissance, par la personne qui reoit, de l'objet donn.

121
don.
*

a.

Le mrite du don au Caitya

est mrite produit

par l'aban-

les quatre

dharmas

par lesquels

le

Bodhisattva triomphe du pch

fait et

aceu-

mnl
bien),

vidsansamudcra

(repentir),

pratypattibala (prise de la Bouddha, etc.) Doctrines analogues, Subhasitasamgraha, 1900) ad fineni. Theragatha 872 Dhammapada 173: ppam katam

pratipaksasamiidcra (pratique du discipline ou virati), ruyahala (refuge en


d.

Bendall (Muson,

kammam

kiisalena

pithiyati.

Seul

le

plants dans

tathgataprasda peut le Bouddha (lire avec


..

laver
le

dharmnm

praksanam)
p.

la foi

les mauvais dharmas que Mara a MS. buddhvaropitnm akualntn (raddh), la dvotion (bhakti) de Mara

l'gard du Bouddha lave toutes ses perfidies (vrjina), Divya, 359, Przyluski,

Lgende d'Aoka,
1.

358.

Voir ci-dessus

p.

15 et 20.
/

mchod punyam.]
2.

rten la btan rgyus byuii bahi

bsod nams

= [caitye

tygnvayam
Caityas.
plusieurs

On

a vu

(iv.

73)

que

le

Le mrite des dons

faits

Bouddha a accept d'avance les dons laits aux au Bouddha et au Samgha est contest par

sectes, voir ci>dessus p. 237, n. 3.

Sur

le culte

du Bouddha dfunt, Milinda,

p. 100-101, Bodhicar>'fivatara, ix. 36.

Hiuan-tsang,

xviii, fol.

15 a-16

a.

245
reoit ?
le

Comment

le

don

peut-il produire mrite

quand personne ne
pourquoi

cette objection,

nous rpondrons en demandant pourquoi


reoit,
il

don

produirait mrite

quand quelqu'un

ne produirait

pas mrite quand personne ne

reoit.
satisfait, favoris

Parce que, dans ce second cas, personne n'est


par
le

don (kasya cid anugrahdbhvt).


la satisfaction

'

Si

de la personne qui reoit est la condition du

mrite, niez donc que les mditations incommensurables (mditation

de bienveillance,

etc.,

viii.

29) et la mditation de la vue droite


!

(samyagdrstibhvan) soient mritoires


donc mrite,

Le don au Caitya produit

121

b.

Bien que personne ne reoive,


-

comme

c'est le cas

dans

la

bienveillance, etc.

Dans
la force

la mditation de bienveillance,

personne ne
nat,

reoit,

personne
par

n'est satisfait, et

cependant un mrite

pour

le bienveillant,

mme

de sa pense de bienveillance.

De mme, bien que


fait

l'Etre excellent ait pass

(abhyatUa),

le

don au Caitya
mritoire,

par dvo-

tion son gard (tadbhaktikrta)

est

en raison de la

pense

mme

du

fidle

(svacittd eva

pmiyam).
la dvotion qui produit

Faut-il en conclure que les actes matriels d'offrande et de culte

(dnamcmakriy) sont
ces actes l'emporte
et

superflus ?

Non, car

beaucoup sur
^

la dvotion de

l'homme qui adore


qui a l'intention

donne en

esprit seulement.

Lorsqu'un

homme

de tuer son ennemi continue sur son ennemi mort [16 a] les actes
corporels et vocaux que provoque cette intention, pensant
:

C'est

mon ennemi
mort

c'est--dire

pensant

Cet ennemi n'est pas encore


qu'il

il

obtient

un dmrite bien plus grand


est enseigne devient
le culte

ne

ferait

par

Le lieu o la Prajnpramit (caityabmtah krtah), parce que


tion de mrite

semblable un Caitya

qu'on

lui

rend est cause de l'accumula-

(vandandinCt ptmyopacayaheUitvat) (Abhisamayalamkrloka


p. 57).
/

ad Astashasrik,
1.

sati

M pratigrahitari yuktam tygnvayam punyam


/
j

tatra hiprtya-

nugrahena grahtd yujyata iti % maitrydivad agrhnati

246
rinlention seule
'

CHAPITRE
de

IV,

121 c-123

b.

mme,

bien que le Matre ait pass, l'homme

qui fait les actes de don et de culte inspirs par la dvotion, obtient

un mrite bien plus grand


Si la
faut-il

qu'il

ne ferait par la dvotion seule.


fruit agrable,

semence donne un bon champ porte un


elle

penser que, donne un mauvais champ,

donne un

fruit

pnible ?

121
graine.
^

c-d.

Mme sem
il

dans un mauvais champ,

le

don porte des

fruits agrables, car

n'y a jamais opposition entre le fruit et la

De

la graine
fruit

de la vigne (mrdvik)
;

'

nat seulement le

doux (ma-

dhura)

de la vigne

de la graine du

nimba
:

(Azadirachta Indica)

nat seulement le fruit

mauvais champ,
cette
utile

la

amer (tikta) du nimba mme seme dans un graine porte le fruit qui lui convient. De mme,
le

semence qu'est

don d'une personne qui a

l'intention d'tre

autrui, ft-elle place

dans un mauvais champ, ne peut pro-

duire qu'un fruit agrable. Mais, par le vice du champ, le fruit sera
petit

ou

nul.

Nous avons

expliqu, avec les questions connexes, l'uvre mri-

toire qui consiste


Il

en don

(dnamaya punyakriyvastu).
punyakriyvastu

[16 b]

faut expliquer maintenant le

qui consiste en

moralit.

yath hi atrum hanmti krtbhipryasya tatsamutthitam kyavk'pi kurvato baliutaram apunyam atrusamjnay doit s'entendre atrur ayant na tvan mriyata ity anay
1.

karma atrusatnjnay tasmin mrte


:

...

samjnay (Vyakhya).
2.

kuksetre 'pstaphalatphalahljviparyayt
le

jj

don fait des voleurs, etc., porte de mauvais fruits. Mais nous n'admettons pas que la qualit du champ rende le fruit agrable (ista) : elle fait que le fruit est important, minent dans son genre (visistaj
Les Nirgranthas pensent que
(Vyakhya).

Dans

Majjhima,

i.

371),

le

Bouddha

conseille Upali de continuer

ses gnrosits aux Nirgranthas

mais

celui-ci se

garde de planter ses dons dans


iii.

un mauvais champ.
gieux

D'aprs Milinda, 258 (qui cite Majjhima,


'

257), le reli-

(suvipanna) et de mauvaises murs (dusslla) purifie le don car on peut se laver dans de l'eau sale. 3. mrdvlk, attest par la Vyakhya Hiuan-tsang m-tu-kia ; rgun. Paramarlhu p'oj* (jonc)-rAo (pche) raisin.
parfaitement tomb
:

(samana) mme

'

Hiuan-tsang,

xviii, fol.

16 a-b.

247
c'est

122
le

a-b. L'immoralit, c'est le


*

mauvais rpa. La moralit,

renoncement l'immoralit.

On donne

le

nom

d'immoralit (daiihslya) an mauvais rttpa. Le


est la moralit, est

renoncement l'immoralit, qui

122

b.

De deux

sortes.

Le renoncement (virati)
et

est vijnapti, l'acte

par lequel on renonce,

avijnapti,

le fait

de s'abstenir. (Ci-dessus pp. 14, 18, 48).

La moralit

n'est pas

seulement

le

renoncement l'immoralit.
est

122

c.

C'est en outre le
^

renoncement ce qui

dfendu par

le

Bouddha.

Renoncer ce

qui,

sans tre en soi immoralit, est dfendu par

Bouddha Bhagavat, par exemple renoncer au repas hors du temps,


c'est aussi moralit.

Ce renoncement

est aussi vijnapti et avijnapti.

Celui qui s'est engag observer les rgles (siks) et qui les viole,

commet immoralit. La moralit que nous venons de

dcrire en

rsum

est
*

122

d.

Pure, quand elle est munie de quatre qualits.


qualits est pure
;

La moralit munie de quatre


dans
le

elle est

impure

cas contraire.
a-b.

123
ralit
;

Non

trouble par l'immoraht, parles causes de l'immoles adversaires

s'appuyant sur

de l'immoralit et sur la

'

paix
;

'."

Non

trouble par l'immoralit telle que nous l'avons dcrite

non

trouble par les causes de l'inmioralit, c'est--dire par les klesas


hchal bahi thsul khrims mi dgehi gzugs

i.

de spon thsul khrims


:

lyam asiibham rpam sllam


et

tadviratih]

Le mauvais rpa

= [dauhs-

actes du corps

de la voix.
2.

rnam gnis

so

= [dvidhd

j ]

3.
4.

sans rgyas kyis ni bcad pa yan

rnam dag yon tan bzhi Idan no [parisiiddham caturgunam // 5. hchal khrims dehi rgyus hphan ma byun / dehi gnen po dan zhi [dauhslyataddhetvaksiptam tadvipaksasamr ayant j ]

= [buddJiena pratisiddhc ca] =

la

rten

248

CHAPITRE

IV,

123-124

b.

[17 a] et upaklesas (v. 41)


ralit,

s'appuyant sur les adversaires de l'immo(vi.

parce qu'elle s'appuie sur les quatre smrtyupasthnas


'

14)

s'appuyant sur la

paix

',

non pas sur des naissances

clestes, parce

qu'elle est applique

au Nirvana.

D'aprs une autre opinion, cinq causes font que la moralit est

pure

1.

puret des chemins-de-l'acte proprement dits (maulakar-

mapatha) [renoncement aux mauvais chemins], 2. puret de leurs annexes (smantaka) [renoncement au prparatif ou moyens du
meurtre,
etc.], 3.

absence de trouble par


et

les

vitarkas (vitarknupa4. surveillance

ghta) [kma^ vypda

vihimsdvitarka],

par la

mmoire (smrtyanuparigrhltatva) [buddha, dharma, ^amghnusinrti

ce

qui comporte le renoncement aux actes non-dfinis],

5. application

au Nirvana (nirvnaparinmitatva)

'

D'aprs une autre opinion, la moralit est de quatre espces


1.

moralit de crainte, celle qu'on observe par crainte du

manque des
;

ressources ncessaires la vie, par crainte de la mauvaise rputation,

par crainte du chtiment, par crainte des mauvaises destines


2.

moralit mercantile (amssila), celle qu'on observe par attache;

ment des existences agrables, aux jouissances, aux honneurs


3.

moralit propice (amikla)

aux membres de

la

Bodhi,

celle

qu'observent, en vue de la dlivrance, les

hommes

qui possdent la

vue droite (samyagdrsti)

4.

moralit pure (pariuddha), celle qui,

tant exempte de taches (nirmala), est libre des vices (ansrava).

Nous avons

expliqu la moralit.
*

123
c'est la
1.

c-d.

Le

bon

recueilli

'

ou bon de Tordre du recueillement,


b]
^

hhvan, mditation, imbibition, imprgnation [17


la

Les quivalents sanscrits sont fournis par


p.

Vykhyri dcrivant
;

les cent

mrites qui produisent les marques (ci-dessus


cite par Tditeur japonais.

226)

l'inierprtation (que

nous
8,

placions entre parenthses) d'aprs Nanjio 1287, le trait de Dharniairaia, 8,

prayofjapariuddhi, maulapariuddhi, prsthaparisuddhi, vitarknupaghata, smrtyanuparigrhitatva. 2. ajivikabhaya, aslokabhaya, dandabhaya, durgatibhaya. Les numrations de bhayas sont nombreuses en combinant Angultara, ii. 121 et iv. 364 (Dharmasangraha, 71), on peut reconstituer notre texte. 3. satnhitafn tu kiialatft [bhvand]
177, 9
:

Viblis,
;

Bha.<;ya

[tiamahitam

iti

kim

idatft]

samdhisvabhavaaahabhu yat

[kas'

Hiuan-tsang,

xviii, fol.

17 a-b.

249

Que

faut-il

entendre par smnhita, recueilli ?


ii.

Ce qui est recueille


'

lement (samddhi,

24,

viii.

i)

de sa nature, ce qui coexiste avec ce

qui est recueillement de sa nature.


reoit-il le

Pourquoi

bon

'

recueilli

nom

de

hhvan ?
parfume, imprgne la pense.
*

123

d.

Parce

qu'il

Le bon de
se, parce

l'ordre

du recueillement imprgne extrmement la penprend


les

que

celle-ci

qualits de ce

bon

de

mme

que

des grains de ssame sont imprgns par des fleurs en prenant l'odeur
des fleurs

(puspagcmdhamaylkarant)
dit (iv.

Nous avons
ces

113

d)

que

le fruit

du don consiste en jouissanpar la moralit et par la

(mahbhoga). Quel

fruit obtient-on

mditation ?

124

a-b. Essentiellement, la moralit

a pour rsultat
-

le ciel

la

mditation a pour rsultat la disconnexion.

Le don aussi a pour

rsultat le ciel,

mais

la moralit

en est la
(ii.

cause normale, principale. La disconnexion ou Nirvana


p.

trad.

278) a pour cause la mditation, laquelle, dans


vi.

le

chemin d'aban-

don (prahnamrga,
nexion d'avec
les

60
;

c-d),

produit immdiatement la disconla moralit

passions

mais

y contribue, puisque
la moralit.

le

calme (amatha)

et la vision

(vipasyan) supposent

mcl idam bhvanety ucyate cittavsant I ] tad ht samhitam kusalam atyartham cittam vsayati gunais tanmaykarant samtateh puspais
/ j

tilavsanvat Par bon recueilli


I
* *

',

il

faut entendre le

dharma

mental (caitta)

nomm

recueil-

lement et les cinq skandhas qui coexistent avec ce caitta.


recueilli
',

Nous disons

parce que la pense bonne, mais non associe au caitta


:

nomm

recueillement, n'est pas

pense imprgne
ment.

la srie
*

hhvan, imprgnation, mditation sans doute cette mentale, mais non pas au mme degr que le recueille',

Nous disons

bon

parce que

le

recueillement des
le

associ dlectation

hhvanmaya.
1.

(svdan) (viii. 6) ne constitue pas BJivan quivaut vsan.

dhynas souills, punyakriyvastu

sems

la

bsgos phyir ro
silatn

= [cittavsant]

jj
j

2.

svargya

prdhnyd visamyogya hhvan


rites funraires
;

Suppler samvartate, samhhavati. Voir Samyutta, iv. 312, l'inefficacit des

Anguttara,

v.

271, la

destine de l'assassin qui donne des aumnes.

250

CHAPITRE
dit

IV,

124

c-d.

Le Sntra
que \

que quatre personnes produisent


'.

le

mrite

brahmi-

brhma punya

Quel est ce mrite ?


i5),

D'aprs les Vaibhasikas (Vibliasa, 82,

le

mrite qui a t dfini

ci-dessus pour faire connatre la

mesure de
^

l'acte qui

a pour

fruit les

marques du Bodhisattva
Les anciens matres
'

(iv.

110).
:

disent

124

c-d.

Quatre possdent
les cieux

le

mrite brahmique, parce qu'ils sont


*

heureux dans
1.

pendant un kalpa.
4.

Ekottara, 21, 5; Vibhfisa, 82,


/

- catvrah pudgal brhmam punyatn

prasavanti

tathagatasya sarrani stvpam ayant prathamah piidgalo hrhmam punyam prasavati / cturdise bhiksusamghe rmatn nirytayati / ayam dvitiyah .... j hhinnam fathagata[sya] rvaJcasamgham pratisamdadhti I ayant trllyah .... maitrlsahagatena cittenvairena asapatnena (MS. sanipannena) avybddhena vipulena ntaliadgatenprantnena subhvitenaikfn disant adhimucya spharitvopasampadya viharati .... ayam caturthah. [Voir Mabvyiitpatti, 69, ditions de Wogihara et de Sasaki, et Dasabhmaka cit dans Madhyamakfivaapratisthite prthivipradese
/

pratisthapayati

tfira,

55, 391, trad. Miison, 1907, p.


v.
/

53

quelques variantes.]

samgliam santaggam katv kim brahntam nanda puniiam pasavatlti kim pana bhante brahmam punnan ti / kappam nanda saggamhi modatiti. Suivent les six padas d'Itivuttaka, 19 sukh sangliassa smagg sangham samaggam katvna kappam saggamhi modati.
Anguttara,

76

bhinnam pana

bliante

so pasavatiti

....

2. 3.

Saipghabhadra attribue cette opinion d'autres matres.


D'aprs une glose de l'diteur japonais, les Sautrntikas ou les

Mabsam-

ghikas.
4.

Sanigbabbadra
ris

Il

y a d'autres matres qui disent


bzbi yi tbsaiis pabi bsod

....

[brhmam punyatn catuskasya] kalpam svargesu [modant


dgab bahi pbyir
phyir.
/

par nitho
porte
:

nams

yin

Le Bbasya

// ]

bskal

dgah gnas

Le

pluriel,

svargesu, est attest parla Vjkhy.

502, le don l'Arhat produit la naissance chez Brabma. Paramartha correspond, dans l'ensemble, au tibtain. Il traduit 124 c-d Quatre actions sont nommes mrite brahmique, parce que, pour un kalpa, elles produisent le bonheur du ciel . Il numre les quatre actions. Iliuan-tsang bouleverse le texte de Vasubandhu. Aprs avoir numr les quatre actions dont parle le Sotra, il poursuit Quelle est la mesure de ce mrite ? La karika (124 c-d) dit Produire pour un kalpa naissance dans le ciel, etc., c'est la mesure d'un mrite brahmique . Le Bbasya dit Les anciens matres disent Le mrite qui fait qu'on demeure au ciel un kalpa Dans une autre cole, il y a cette gtha L'homme de foi, de vue droite, qui cultive les dix excellentes pratiques (caritaj, qui engendre le mrite brahmi: :

Dans Suttanipata,

Hiiian-tsang,

xviii, fol.

17 b-18

a.

251
le ciel

Le mrite de
un kalpa,
est d'un

telle

mesure qu'on
80

est

heureux dans

pendant

c'est le

mrite brahmique, car la vie des Brahmapurohitas


d)
'.

kalpa

(iii.

Et dans un autre Canon, on


il

lit

Il

en-

gendre

le

mrite brahmique,

est

heureux dans

les cieux

pendant

un kalpa.

Nous avons
que
;

tudi le don matriel


les cieux

(misadna).

[18 b]
Les Vaibhsikas

il

demeure heureux dans


le

pendant un kalpa

disent que la mesure de ce mrite est celle indique pour l'acte qui mrit en marques.

La krik porte
:

mot

'

etc.

'

pour indiquer

la varit des opinions.

L Vykhy Ce mrite est nomm hrhma, brahmique, mrite des Brahms (braJimanm) par le mot Brahm, il
:

parce que c'est

le

faut entendre, dans

Brahmapurohita, puisque les Brahmapurohitas vivent un kalpa ; un autre Canon, on lit ces deux pdas brhmam ptmyant prasavati kalpam svargesi moclate. Ce mrite est donc appel brahmique parce que, [pour la dure], il est semblable (sadharnia) celui des Purohitas. Dans Majjhima, ii. 207, la nielt est le brahmnam sahavyatya maggo. Comment faut-il entendre la rtribution, d'une dure d'un kalpa, du mrite brahmique ? C'est ce qu'explique Samghabhadra (xxiii. 5, 20 a). L'homme dtach du Kma (vtarga, virakta) qui pratique les quatre Incommensurables renat parmi les dieux de la sphre suprieure et prend un bonheur qui dure une vie d'un kalpa. L'homme non dtach du Kma qui tablit un Stiipa qui construit un rma ; qui rtablit la concorde dans le Sarngha qui, plusieurs
cette expression,

puisque, dans

reprises, cultive le prparatif de la bienveillance et des autres

Incommensurables

il

nous disons
aussi,

le prparatif,

car pour pratiquer les Incommensurables eux-mmes,

faut entrer dans le clhydna, ce qui suppose dtachement

homme

comme

s'il

pratiquait

les

Incommensurables

du Kma , proprement

cet
dits

(ntaula), produit un bonheur cleste (svrgika) d'un kalpa

(kalpapramna j.

Mais n'a-t-on pas dit ci-dessus qiie, dans le Kamadhtu, il n'y a pas de rtribution d'un acte bon qui dure un kalpa ? Il n'y a pas un acte bon, ne durant

qu'un instant, qui puisse,

comme

c'est le cas

pour certain acte mauvais, produire

ainsi. Mais quand beaucoup de volitions portant sur un mme objet (construction d'un Stpa, etc.), elles donnent en succession un fruit cleste qui dure un kalpa : on meurt dans le ciel pour y reprendre aussitt naissance. Il n'y a donc pas contradiction parler d'un bonheur durant un kalpa. La Vykhy rsume cette doctrine sans nommer Samghabhadra et termine brhat piinyani brhmam ity apare.

une

vie d'un

kalpa

c'est

pourquoi nous nous sommes exprims

se produisent

2.

Anguttara,

sadnam
dna.

i. 91 Itivuttaka, 98 et 100 dvemni bhikkhave dnni mica dhammadnam ca. Dharmasamgraha, 105, ajoute le ntaitrlSpence Hardy, Eastern Monachism, 196. Diglia, iii. 191, misnup; :

padna.

252

CHAPITRE
a-b.

IV,

125.

125
souill,

Le don de Dharma,
etc.
'

c'est

renseignement

correct,

non

du Sotra,

Le don de Dharma,
non
souille, le

c'est

enseigner

tels qu'ils sont,

avec une pense

Stra

et les autres

quent, ceux qui exposent le

membres de l'Ecriture. Par consDharma soit faussement, soit avec une

pense souille, par dsir de gain (Idhha), de respects (satkra), de


rputation (klrti) ^
ils

dtruisent le grand mrite qui leur chait.

Nous avons

expliqu les trois espces de bon d'aprs la distinction

des trois punyakriyvastus.

En

outre

125
tion.
'

c-d.

Le bon

est triple, de mrite, de

Nirvana

et

de pntra-

Le bon de mrite ou

favorable au mrite
*

'

(punyahhgiya)
bon

est le

bon qui comporte une rtribution agrable.

Le bon de dlivrance (moksabhglya)


1.

"

est le

qui, ds qu'il

chos sbyin non nions can min pas

mdo

sogs yan dag ji bzhin ston


/
.

madnam] strdiu^n [samyag]aklistadesan


aklistacittasamutthpitd desana. (Vykhy)
2.

aklistadesan
37.

= [dhar=

Comparer nirmisadharmadesaka,
bsod nanis mya nan hdas pa dan
/

Malifivyuipatti, 30,

3.

ns hbyed cha mthun dge rnam gsum =:

puHya[nirvna]nirvcdhabhyyam [kusalam tridh] Il 4. Dans Mabvastu, i. 34, punyabhgya sattva un tre susceptible d'acqurir du mrite de mme phalabhgiya un tre susceptible d'acqurir les

fruits.
Ici

(Comparer Nettippakarana, 48)

punyahhgiya kuala punyabhgya hitam. Ou bien punyam bhajata iti punyabhk punyahhg cva punyabhglyam / svrthe kapra/

tyayah.
5.

bien

On peut entendre moksabhga comme s'opposant samsrabhga ou moksabhga = fnoksaprpti ; donc ntoksabhgya moksaprptyanu;

kla.

Sur

le

ntoksabhgya, Kosa,

iii.

44
le

c-d, vi. 24, vii.

30
;

Divya, 50,

7,

3()0,

(la

dvotion,

mme
14.

petite,

a pour

fruit

Nirvana), 303, 28

moksabija, Karunpun-

darlka, 78,

Viljha^,

7,

15

quelle poque sont plantes les racines

rpo<{ue o apparaissent des

Bouddhas

il

faut,

en

effet,

ntoksabhgya ? que le Dharma du

Rouddha existe pour qu'on puisse planter ces racines. D'aprs d'autres matres, mme quand le Dharma du Bouddha manque, si on rencontre un Pratyeka, on
peut les planter.

Quel corps

faut-il

avoir pour planter ces racines ?

Un

corps

Hiiian-tsang,
nat, devient

xviii, fol.

18 b-19

a.

253
les

un dharma de Parinirvna \ Quiconque, entendant


les dfauts

sermons sur

du Sanisra, sur

le

non-moi, sur

les qualits

du Nirvana, [19
qu'il

a] hrisse ses poils et verse des

larmes
;

-,

on reconnat
lorsque,

possde la racine de bien moksabhglya

de

mme,

la pluie, on voit pousser une plante, on sait qu'il y a une graine

dans

le

khalahila.
'

Le bon de
gatas,
etc.
;

pntration

'

(nirvedhabhgiya)
(vi.

est quadruple,

usma-

il

sera expliqu plus loin

17)

Quelle est la nature de ce qu'on appelle dans

le

monde

criture

d'homme ou de femme.
racines ?

En quelle
Il

occasion ou par quelle cause plante-t-on ces


:

En
'

raison du don, en raison de la moralit, en raison de l'audition

mais
'

la

cause n'est pas ncessitante.

Pourquoi ?
qui,

En

raison de la varit des

intentions

(saya).

y a des

hommes

en donnant une bouche ou un

cure-dents, plantent ces racines, par exemple Candra, etc. Ces

hommes, aprs

avoir donn, disent

Je souhaite (pranidhi) qu'en raison de cela j'obtienne la

dlivrance . Il y a des hommes qui, quoique donnant sans rserve (o tchj un grand Samgha (comparer Takakusu, I-tsing, p. 40), ne plantent pas ces raciceux-ci, aprs avoir donn, nes, comme O-pao-ng (Acanda, Araudra ?), etc. souhaitent richesse^ etc., dans une vie venir, non pas la dlivrance. De mme certains hommes aprs avoir pris l'Upavsa pour un jour et nuit, aprs avoir d'autres qui prennent le rcit une stance de quatre vers, plantent ces racines Prtimoksa pour toute la vie, qui rcitent le Tripitaka, ne les plantent pas. Tout dpend de la vivacit de l'inclination pour le Nirvana et du dgot l'endroit de
; ;

l'existence.

gan skyes na yons su mya nan hda bahi chos su hgyur ba ste / gan la la fies .... thos nas spu zin zhes byed pa dan / mchi hkhrug ces byed pa Hiuan-tsang Le bon moksabhdgya est le bon qui certainement de la ni produit comme fruit le Nirvana. La personne en qui il est n est dite avoir en soi un dharma de Nirvana. 2. La mme ide dans le Grand Vhicule, par exemple Madhyamakvatra, vi. 4-5: prtliagjanatve 'pi nisamya nyatm .... tanfiruhotphullatann ca jyate / yat tasya sambuddhadhiyo 'sti bljam. 3. Le khalahila {gyn\ gyi gseb) est le trou creus pour y dposer la graine. Le Jchala est l'aire battre le grain Anarakosa, 3. 3. 42. Paramrtha ti k'n
1.

khor bahi

tch'e
4.

= terre-trou-fissure.
DTgha,
iii.

251 (cha iiihhedhahhgiyasann), 277 (nibbedhabhgiyo sa-

viii. 17). Dans le mme sens nibbedhika frquent dans Visuddhimagga, 88 nibbedhabhgini panfi, 15 nibbedhabhdNettippakarana, passim. Dans le Divya sont distingus les giyam sllam. quatre nirvedhabhgyas (Comparer 50. 8 et 166. 15)

mdhi, comp. Kosa,


l'Aiiguttara
;

254
(lipi),

CHAPITRE

IV,

126-127.

gravure (mudr), calcul oral (gananj, posie (kvya), calcul


?
acte industrieux, du corps, de la voix ou de la pense,
lui

(samkhydj

126. Un
avec ce qui

donne

origine, tels sont l'criture, la gravure, le calcul


'

oral, la posie, le calcul


*

industrieux

'

(yogapravartita), c'est--dire du une certaine

technique (upyavisesapi'a vartitaj


*

acte triple

',

c'est--dire acte corporel, acte vocal, acte mental.

L'criture et la gravure sont

un acte corporel, industrieux, avec ce

qui donne origine cet acte, savoir le faisceau de la pense et des

mentaux.

Le

calcul oral et la posie sont

un acte vocal.

Par consquent,

criture, gravure, calcul oral, posie, sont de leur

nature cinq skandhas.

Le calcul

est acte

mental [19 b]

il

s'agit de la
^

numration (sam-

kalana) mentale (manas) des dharmas.

Maintenant nous expliquerons quelques synonymes

127
1.

a-b.

Les

dharmas
bcug pahi
/

souills sont

svadya, nivrta, hna.


ni
/

"'

rigs pas rab tu

brgya dai bgran bcas pahi


lipir

/ rnam gsiim kun sloii bcas pa nag grans te go rims bzhin. \trividham] sasnmitUhnatn [karma] ijogapravartitam j

las

yig hbru

san

mudr [sajgananam kvyam samkhy [yathkramam]


'

jj.

Dans le Sstra on entend par criture non pas l'criture au sens mondain ( aksaracihnam pustakdau), mais l'acte par lequel l'criture est crite. De mme, par ntudr, on n'entend pas un sceau portant un signe, lettre ou autre signe (aksarnaksaracihnaj, mais l'acte par lequel le sceau est creus (khanyate). (V^yakhyfl). La Vibhasa (126. 16) donne un exemple de calcul.
',

2.

Mahavyutpatti, 217
le

2-4

lipi

nan,

handrechnen

de Schiefner)
(3, 18,

mou

et

soan).

Divya

mudr (= lag-rtsis, chebii-soan = hastagasamkhy (chou-mou) ganan (chou2G, 12, etc.) lipi samkhy ganan mudr ud:

dhra nysa niksepa,


satftkhy

puis les huil parlkss.

Malivastu,

ii.

423

lekh lipi

La

liste

ganan mudr dhran du Brahmajla mudd ganan samkhna kveyya


;

...

est explique
in

par Buddhagliosa, Rhys Davids (Dialogues


18-19),
3.

i.

22), 0.

Franke (Dgha

Auswahl,

Sur kveyya, voir aussi Mrs Rhys Davids, Theragfitha,


klist [dhartnh]

1253.

svady nicft hinh

Hiiian-tsang,

xviii, fol.

19 a-b.

255
est associ

Synonymes de
(klesa)
sions
les
;

souill (klista)
;

svadya, ce qui

Vavadya, au mauvais
:

nivrtay ce qui est couvert par les passions

les

passions elles-mmes sont couvertes par d'autres pasignoble^ parce que bas (nihkrstaj ou abandonn par

Mna^

ryas.

127

b-c.

Les

dharmas bons
le

et

immaculs sont pranta.


iibJia, c'est--dire

pranlta, excellent, est

synonyme de

kusala,

bon, et d'amala, immacul, c'est--dire ansrava.

Les

dharmas

qui ne sont ni ignobles, ni excellents, sont donc


^

mdians (madhya).

127

c-d.

Les

dharmas bons

et

conditionns sont sevya.

"^

sevya, cultiver (sevitavya, paryupsitavya, introduire dans


la srie mentale,

samtndhyropana),
''

est

synonyme de bon

condi-

tionn (kiisala samskrta).


Il

s'en suit

que

les autres

dharmas, d'une

part les inconditionns,

d'autre part les conditionns qui sont souills ou non-souills-non-

dfmis (anivrtvykrta), ne sont pas cultiver.

En
;

effet, l'incondi-

tionn n'est pas susceptible d'tre produit, cultiv

(anahhyasanya
l'inconditionn

= paunahpimyena kartum aakya ou anntpddya)


n'a pas de fruit
:

or, c'est

en vue du

fruit

qu'on cultive.
^
:

Tous

les autres
d.

dharmas

sont infrieurs

127
Il

La

dlivrance est sans suprieur.

n'y a rien qui l'emporte sur le Nirvana.

Le Nirvana, tant

ter-

nel, tant bon, l'emporte sur tout.

tibkmalh j pranlth Comparer Vibhafiga, hlna majjhima panlta, p. 17 et passiin. 3. samskrtasibhh sevyh 4. Un autre quivalent est bhvayitavya kusalasamskrtadharm hhvayitavy iti nyyaJi.
1.

2.

5.

Prakarana, 33 b 4

Quels sont

les

dharmas sa-uttara
.

? Les

dharmas

conditionns, l'espace,

Vapratisamkhynirodha
//

Mme

terminologie dans

l'Abliidlianima, Vibhaiiga, p. 19 et passim.


6.

moksas

tv

anuttarah

LOirVAIN

(Belgique).

- IMPRIMERIE

J.-B.

ISTAS.

y.^ic3 DI7T. FEB 1

19S8

BL 1^16 V374
A352ii

Vasubandhu L' abhidharmakosa

1923 V.3

PLEASE

DO NOT REMOVE
FROM
THIS

CARDS OR

SLIPS

POCKET

UNIVERSITY

OF TORONTO

LIBRARY

Centres d'intérêt liés