Vous êtes sur la page 1sur 316

T

SOCIT BELGE D'TUDES ORIENTALES

L'ABHIDHARMAKOA
DE VASUBANDHU
,-'

1
TRADUIT ET ANNOT
PAR

Louis de la

VALLE POUSSIN

SEPTIME ET HUITIME CHAPITRES NEUVIME CHAPITRE OU RFUTATION DE LA DOCTRINE DU PUDGALA

PARIS,

PAUL GEUTHNER
J.-B.

LOUVAIN,

ISTAS, Imprimeur

I925

BU
|if/6

A 3 52-4 /<M3 V. 5

"3CT

La

traduction de cette dernire partie du

Kosa

est tablie d'aprs

les versions

de Paraniartha

et

de Hiuan-tsang, sans parler du comfait

mentaire de Yasomitra, auquel on a


et des

large place dans les notes,


le

nombreuses indications de Saeki Kiokuga. Pour

neuvime

chapitre, le travail de Stcherbatski (traduction et notes) et

une version

manuscrite du texte de Paramrtha due au Pre Louis van He

m'ont t

fort utiles.

S'il plat

Dieu,

mon ami

J.-B. Istas

achvera en 1926 l'impres-

sion du troisime chapitre et peut-tre celle des index.

La Fondation

Universitaire continue bien mriter de Yasubandhu.

CHAPITRE
Les Jnnas ou

VII

Savoirs

'

Nous avons

parl de ksntis,

patiences

(vi.

25

d) et

de jnnas,
(vi.

savoirs

(vi.

26

b),

de la samyagdrsti,

vue correcte

50

c)

et

du samyagjnna,
si les

savoir correct

(vi.

76

pose

ksntis ne sont pas des jnnas,

si le

La question se samyagjnna n'est


c).

pas la samyagdrsti.
1
a.

Les ksntis pures ne sont pas jnna.

1.

Ce chapitre

se divise en

deux

parties.

La premire
la

traite

1.

de la distinction
;

de la patience (ksnti), du savoir (jnna), de


caractres des dix savoirs (2-9)
;

vue (drs)

(kSrikfi 1)

2.
;

des

3.

des aspects des dix savoirs (10-13 b)


(13 c-27)
;

4.

de

diverses questions,

prasnanirdea

la seconde,

des qualits (guna)

qui consistent en savoir


japonais).

(jnnamaya)
le

(28-55)

(D'aprs la glose de l'diteur

Parmi

les

sources de Vasubandhu,

Prakaranapada,

xiii. 10, fol.

14

dfini;

tion des dix

jnnas ; darsana

qui n'est pas

jnna;

objet des

jnnas
est

(14 b 11)

inclusion rciproque (15 a 3); pourquoi? (15 a 8); quel

jnna

ansrava, ssravapratyaya, samskrta, etc. Sources plies, iii, 226-227, Patisambhidamagga, Vibhanga, 308-344, notamment 328. 2. dri med bzod rnams ses ma yin / zad dan mi skyehi blo lta min / de las gzhan hphags blo gnis ka / gzhan ses drug ni lta ba han yin nmalh ksntayo jnnam ksaynutpdadhr na drk / tadanyobhayathry dhr any jnnam drsa ca sat // Sur jnnadarana, viii. 27 c. La prajn (c'est--dire le caitta dcrit ii. 24 qui accompagne toute pense) est pure (ansrava) ou impure (ssrava). i. Pure, la prajn est savoir (jnna) ou patience (ksnti). a. Par savoir on entend une connaissance de certitude, exempte de doute ( niscita ; jnnam nicitarpena utpadyate). Le savoir peut tre pure contemplation (pratyaveksanamtra ; ci-dessous
Dgha,
/

ssrava, Samyutta, ii, 57,

p.

3
Il

n. 2)

tels

sont

le

ksayajnna

et Y anutpdajnna (vi.

67

a-b).

peut tre accompagn de samtrana, de

parimrganaya ;

en d'autres
1

CHAPITRE

VII,

1.

Les huit espces de ksnti pure (ansrava) qui font partie du chemin de vue (bhisamayntika) (vi. 25 d-26 c) ne sont pas,

de leur nature,

savoir

jnna
le

'

car,

au moment de
fait

la ksnti,

Yanusaya de doute
n'est pas dj
il

(vicikits) que

chaque ksnti

abandonner
(nicUa) :

abandonn. Or

jnna

est de certitude

se produit

quand
vue
2
.

le

doute est abandonn.

Ces huit espces de


elles sont

ksnti sont

(darana), parce que, de leur nature,

d'examen

En

opposition avec les ksntis pures qui sont


[1 b]

darana

et

ne sont

pas jnna,
termes,
il

peut tre un

upanidhynaprvaka manasikra
vue
.

(i.

41 c-d)

dans ce
;

cas

il

est

darana,
;

prcd de rflexion

Ce savoir comporte le dsir de disons donc qu'il est de considration

s'instruire

il

est

ou d'examen.

Toutefois les quivalents occidentaux sont insuffisants, car il ne s'agit pas d'une connaissance discursive , mais d'une connaissance qui peut ne durer qu'un moment, qui se produit dans des tats de recueillement exempts de vitarka et de

vicra.
b.
le

La patience n'est pas exempte de doute, puisqu'elle a pour fin de produire savoir par l'expulsion du doute. Elle ne nat pas comme certitude (nicaya),

comme acquiescement (ksamanarpena). Peut-tre rendrions-nous nuance en disant que l'ascte, dans le stade de patience, pense: Les dharmas sont sans doute transitoires .... , et, dans le stade de savoir Les dharmas sont
mais
la
:

Les patiences pures sont donc aiksl samyagdrsti (i. 41 a). Elles se produisent en effet au cours du chemin de vue et par consquent sont
transitoires
....

propres au Saiksa. Et elles sont darana. ii. Impure, la prajn est associe soit aux cinq connaissances sensibles (connaissance de l'il, etc.), soit la connaissance mentale (manovijnana).

Dans Dans

le le

premier cas,

elle est

savoir (jnna)

elle n'est

jamais
2 b)
;

vue
41

second cas,

elle est savoir (le

samvrtijna,

vii.

elle est
i.

vue

a. lorsqu'elle est lie

aux mauvaises opinions (satkyadrsti,

etc.,

a), b. lors-

qu'elle est

bonne (kusala), c'est--dire associe


il

l'opinion correcte (samyagdrsti).

Cependant

arrive qu'elle soit, indment, qualifie


(vi.

patience

le

troisime

un savoir , quoique nomm patience . 1. Prakarana (xxiii. 10, 10 b 3) cit dans la Vyakhya ad vii. 7 yat tvaj jnnam daranam api tat j syat tu daranam na jnnam astv bhisamayntikh ksntayah [duhkhe dharmajnnaksantih ....]
18
c) est

nirvedhabhglya

en

fait

2.

samtirantmakatvat
p.

= upanidhyanasvabhvatvat (Kosa
vi.
:

i.

41 c; ci-des-

sous

n.

2 et

viii. 1).

Pour
ity

les

ksntis impures (par exemple


(vii, p. 15, n. 4).

18

c),

elles sont

jnna, exactement

samvrtijna

Vyakhya amal eva ksntayo na jinatn avadhrant ssravh ksntayo jnnam ity itktam bhavati.

Hiuan-tsang, xxvi,
1
b.

fol. 1

a-1 b.

La prajn de
'

destruction

et

de

non production

n'est

pas darsana.

Le ksayajnna stituent la Bodhi

et

Yanutpdajnna

(vi.

67 a-b)

lesquels conne compor2

ne sont

pas darsana, parce

qu'ils

tent pas d'examen, parce

que l'intention d'enqute

fait dfaut.

c.

Toute autre prajfi pure


dehors des ksntis
et des

est l'une et l'autre.

En

prajn pure ou dry a est la porte examen (upanidhyna), donc


exempte de doute, donc elle est de Yabhisamaya (duhkhe jndna,

deux jfinas nomms ci-dessus, la fois darsana et jnna, car elle comelle

est
Il

darsana, car

elle est

jndna.
etc.,

s'agit des huit

jnnas

vi.

26) [et aussi de toute la

prajn du chemin pur de mditation jusqu'au ksayajnna}.


1
d.

Toute autre prajn

est

jnna.

La prajn
ssrava)

qui n'est pas pure, qui est mondaine, impure (laukikl, [prajfi associe aux cinq connaissances sensibles, caetc.,

ksurvijnna,
1
d.

prajn

associe la connaissance mentale].

Six sont aussi darsana.


fois

Six prajhs impures sont la

jnna

et

darsana, savoir

la

prajn mentale
qui est la
1.

associe aux cinq

passions

(klea) qui sont drsti

de leur nature (satkyadrsti,

etc., v. 7) et,

sixime, la bonne prajn,


i.

vue correcte mondaine

(laukikl samyagdrsti,
4 b).

41).

= darana.
2.

ksaymitpdadhir na drk (voir vii. La prajn ou connaissance

dh

= prajfi, dr = drsti

qui consiste dans le


le

savoir

de la

destruction des passions (ksayajnna), dans

savoir de la non-production

nouveau des passions ( anutpdajnna),

n'est pas drsti, darsana. asamtlrana-aparimrganaya-tvt (parimrgana ayo'bhipryah).

(krtakrtya), il Aussi longtemps que l'ascte n'a pas fait ce qu'il avait faire Vrits. Quand il des sujet au (parimrgayati) enqute il (dhyyati), rflchit (pratyaveksanamtra) a fait ce qu'il avait faire, il contemple seulement Samantapasadika, [Comparer plus. la douleur qui est connue, etc., et n'enqute
168, Milinda

338 (note

trad.

ii.

p. 225),

paccavekkhanafina].
...

yvad ayant akrtakrtyas tvad dnhkhdini satyny upari dhyyati parimrgayati cayato yathoktair anitydibhir kraih

CHAPITRE

VII,

2-4.

Combien y
Il

a-t-il

de
1

jhnas
;

?
il

y en a dix [2
:

a]

mais, en rsum (samsena),

n'y en a que

deux

a.

Le jnna
les

est

pur ou impur.
rentrent dans deux espces de

Tous
tara).

jnnas

jnna, jnna
(lokot-

impur ou mondain (laukika), jnna pur ou supramondain

De

ces deux

jnnas,

b.

Le premier s'appelle

conventionnel

smvrta.

Le jnna impur

est appel savoir

conforme

la convention,

au

monde

lokasamvrtijnna.
il
4
:

Pourquoi ? Parce

que, d'habitude

(pryena),

porte (lambate) sur des choses qui existent convencruche, vtement, mle, femelle, etc.

tionnellement
'

[Nous disons

d'habitude

',

parce qu'il porte aussi sur les caractres rels des

choses, caractres propres et

communs,
deux

vii.

10

b].

c-d.
5

Le jnna pur

est de

sortes,

dharmajnna

et

anvaya-

jnna.

1. Hiuan-tsang numre ici les dix jnnas : samvrti, dharma, anvaya, duhkha, sanaidaya, nirodha, mrga, paracitta, ksaya, anntpdajiina ; numration qui, dans l'original, est donne plus loin p. 11. Ce n'est pas l'ordre du Sfistra, ci-dessous p. Il, n. 6. 2. ses pa zag bcas zag pa med [ssravnsravam jnnam] 3. dan po kun rdzob es bya ho [dyam] smvrtam [ucyate /]

= s

Voir

vii.

3
:

a,

a, 8,

10

b,

12 a-b, 18

c,

20

c-21.
:

Vyakhya samvrtau bhavam smvrtam, et plus bas svabhvatah samvrtir jnnam samvrtau va jnnam samvrtijiinam.
Voir ci-dessous
(voir par
vii.

21.
le

Les Madhyamikas distinguent

exemple Bodhicary&vatra,
vi.

lokasamvrtijnna et le yogisamvrtijiina ix. 2). Ce dernier correspond au laukika


141-142
i.
;

jnna prsthalabdha, Kosa,


4.

vi. trad. p.
;

et

vii.

12 a-b (prsthaja), 20
v. 6.

c.

samvrtisadvastu,

Stralamk&ra,

12,

Kathavatthu,

5. zag med rnam gnis chos dan ni / rjes su dvidh dharme jiinam anvaya eva ca]

es pa

kho na yin

= [ansravam
;

Le jnna pur est


le

la

connaissance des caractres


il

nomme dharmajnna quand

porte

sur les

communs des dharmas on dharmas du Kamadhatu,

Hiuan-tsang,
Ces deux jiinas avec
le

xxvi,

fol. 1

b-2

a.

5
:

prcdent font trois

jhnas

lokasam-

vrtij flna, dharmajhna, anvayajnna. Parmi eux,

a.

Le smvrta porte sur


les

tout.

'

Tous

dharmas

conditionns (samskrta)

et

inconditionns

(asamskrta) sont

l'objet

du samvrtijhna.
la douleur, etc.,

b-c.
2

Le j hna nomm dharma a pour objet

du

Kama.

Le dharmajhna a pour
la destruction

objet le

duhkha,

l'origine

du duhkha,

du duhkha,

le

chemin de

la destruction

du duhkha du

Kamadhatu.
.

c-d.

Vanvaya

porte sur la douleur,


le

etc.,

des terres suprieures.


l'origine

h' anvayajnna a pour objet


...

duhkha,

du duhkha

du Ropadhatu
a-b.

et

de l'rpyadhatu.
tient

4 A

Ces deux j flnas, quand on


'*

compte de

la distinction

des Vrits, font quatre jiinas. savoir


:

duhkhe dharmajnna et le duhkhe 'nvayajhna), samudayajfina, nirodhaj hna, mrgajhna, parce que ces deux jhnas ont pour objet la douleur,

duhkhajnna

(qui

comprend

le

l'origine, etc.

b-c.

Ces deux jhnas, quadruples, sont


'

nomms ksayajhna

et

anutpdajhna.
vi. 26.

anvayajnna quand

il

porte sur les

dharmas

des deux sphres suprieures,

1. kun rdzob yul ni thams cad do ==s [smvrtagocarah sarvam] Les Andhakas (Kalhavatthu, v. 6) disent sammutinnam pi saccrammanam eva Le savoir mondain a seulement pour objet les vrits (d'aprs Aung:

Rhys Davids).
2.

chos ses bya bahi spyod yul ni


j

khyasya yocarah
3.

rjes ses pahi

bsnal sogs == [dharmasam/ hdod sdug Tcmaduhklidi] [anvayasya trdhvaspyod yul gon mahi sdug bsnal sogs

duhkhdi yocarah
4.

//]
/

de dag nid bden bye brag gis


/

rnam bzhi de dag ni [ksaynutpdayor jnne]


5.

bzhi ste [satyabhedata evaite catvri(?)] mi skye ba dan zad pa es ete caturvidhe /

Voir

vi.

44

d,

50

a. vii. 1, 7,

12 a-b.

CHAPITRE

VII, 4-5.

Le dharmajhna

et

Yanvayajfina, qui sont comme on vient


ils

de voir quadruples en raison de leur objet, chez l'Arhat, quand


sont pas de la nature de

ne
et

darsana

sont

nomms ksayajnna

anutpdajfina.

d-5

a.

Au moment o

ils

naissent [2 b],
2

ils

sont

duhkhnvaya-

jfina, samudaynvayajfina.

Le ksayajnna

et

Y anutpdajfina, au

moment o
et

ils

naissent

(prathamodite), sont, de leur nature, duhkhnvayajnna

et

samu-

daynvayajnna,
sphres suprieures

connaissances de la douleur
,

de l'origine des

parce qu'ils ont pour objet les skandhas du


de douleur et d'origine \

bhavgra

sous

les aspects
le

Ces deux

j nnas ont donc

mme

objet.
;

Le ksayajnna succde au Vajropamasamadhi (vi. 44 d) Yanutpdajfina succde au ksayajfina. On demande donc si le vajro-

pamasamadhi
leur naissance. oui
;

le

mme
il

objet que ces deux j nnas au

Quand

a pour objet

le

duhkha

et le

moment de samudaya,

quand

il

a pour objet

le

nirodha

et le

mrga, non.

Paramartha quand ils ne sont pas de leur nature aaiksl samyagdrsti . (vi. 50 d) que tous les Arhats possdent la vue correcte propre aux Asaiksas cette samyagdrsti est de sa nature darsana ; elle consiste en
1.
:

On

a vu

dharma
2.

et

anvayajnna.
/

de gnis dan po skyes pa ni


II

sdug bsnal rgyu

rjes ses

pa yin

te

punah

prathamodite

[duhkhahetvanvayajnnam] 3. Les deux jtnas de ksaya et d'anutpda ont ncessairement pour objet le bhavgra dont l'Arhat vient de se dlivrer. De mme que, lorsqu'un homme
;

meurt d'une blessure empoisonne, le poison, aprs avoir envahi tout le corps, se moment de la mort, dans la blessure de mme le jna de l'ascte se concentre dans l'objet abandonner, savoir les skandhas du bhavgra ; il porte sur la douleur (yena pdyate) et son origine.
concentre, au
4. duhkhasamudaykrair bhvgrikaskandhlambanatvt. VyRkhySi duhkhkrair anitydibhih / samudaykrair va hetvdibhih Paramartha: sous les quatre aspects de duhkha et les quatre aspects de samudaya . Hiuan-tsang corrige sous six aspects de duhkha et de samudaya (Glose de l'diteur japonais anitya, duhkha, hetu, samudaya, prabhava, pratyaya
:

....

deux aspects de

la douleur, quatre aspects

de

l'origine.

Voir ci-dessous

vii.

12 a-b, qui justifie la correction de Hiuan-tsang).

Hinan-tsang

xxvi,

fol.

2 a-3

a.

b.

Le

'

savoir de la pense d'autrui

(paracittajhna) procde

de quatre.

De quatre jtinas, dharma, anvaya, mrga, samvrtijhna,


procde la connaissance de la pense d'autrui
2
.

L'objet de cette

connaissance doit tre prcis

c-d. Il

ne connat pas la pense de


ni la

terre, facults, personnalit


3

(pudgala) suprieures,

passe

et la future.

Une pense

est suprieure soit


soit

au point de vue de

la

bhmi,

soit

au point de vue des indriyas,

au point de vue de

la personnalit.

Le paracittajhna d'une terre infrieure ne connat pas la pense


d'une terre suprieure.

Le paracittajnna d'un saint de facults

faibles,
c),

savoir du

Sraddhadhimukta

et

du Samayavimukta

(vi.

31

ne connat pas la
et

pense d'un saint de facults fortes, savoir du Drstiprapta

de

l'Asamayavimukta.

Le paracittaj hna d'un


d'un saint suprieur
:

saint infrieur ne connat pas la pense


l'ordre,
"

dans

Anagamin, Arhat, Pratyekabudparacitta-

dha, [3 a] Samyaksarnbuddha.

Lorsque

la

pense d'autrui est ou passe ou future,

le

1.

bzhi las pha roi senis rig pa

t==

caturbhyah paracittavit.

La connaissance de la pense d'autrui, en principe, est savoir mondain , samvrtijnna. Mais lorsque la pense d'autrui est une pense pure, c'est--dire une pense faisant partie du chemin pur (darsana ou bhvan ), la connaissance que j'ai de cette pense doit tre pure elle comporte le mrgajnna, savoir pur relatif au chemin le mrgajnna suivant qu'il est relatif au Kamadhatu ou aux sphres suprieures est ou dharmajnna ou anvayajina. Donc la science de la pense d'autrui (paracittavid) comporte quatre jnnas. ksin3. des ni sa dban gan zag hdas / zhig dan ma skyes ma rig go [ jtam na vetti sa //]
2.
;
;

Voir
4.

vii.

11 a-d et les Balas, Abhijn&s, etc.

Le texte porte raddhdhimuktasamayavimuktamdrgena drstiprapta-

samayavimuktanirgam najnti:
le
:

Par le chemin de sraddhadhimukta ..., paracittajnna ne connat pas le chemin de drstiprapta . 5. Le texte porte Le paracittajnna, par l'infrieur, ne connat pas le suprieur il ne connat pas, par le chemin d'Angamin, le chemin d'Arhat ....
:

CHAPITRE
la

VII, 6-7.

jnna ne
actuelle.

connat pas, car ce

jhna a pour

objet la

pense

La pense

d'autrui chappe-t-elle encore au

paracittajhna dans

d'autres cas ?

a-b.

Le dharmajhna
'

et

Yanvayajhna ne

se connaissent pas

l'un l'autre.

Le par acittaj hna,

lorsqu'il est de sa nature

dharmajfina,

n'est

pas capable de connatre la pense d'autrui qui est de sa nature

anvayajhna ;
jnna.

lorsqu'il est de sa nature

anvayajhna,

il

n'est pas

capable de connatre la pense d'autrui qui est de sa nature

Pourquoi Parce que ces deux jhnas ont


?

dharmaet

respective-

ment pour

objet les

dharmas
2

qui s'opposent au

Kamadhatu

aux

sphres suprieures.
Il

n'y a pas de

par acittaj nna dans


:

le

chemin-de-vue (darsanaparcourt
le

mrga),

c'est--dire
n'est

l'ascte,

pendant

qu'il

darsana-

mrga,
rapide.

pas muni du
est

par acittaj nna,

parce que la dure du

darsanamrga

trop rduite, parce que la vue des vrits est


le

Mais la

pense d'autrui qui se trouve dans

darana-

mrga

peut tre l'objet du paracittajhna.


l'on dsire connatre, par le

Lorsque

paracittajhna, la pense
pratique un exer-

d'autrui qui se trouve dans le


cice prparatoire

darsanamrga, on

(prayoga)

b-d.

Le SrEvaka connat deux moments du darsana


;

le

Pra-

tyeka, trois

le

Bouddha, sans prparation,


cultive le

tous.

Lorsque

le

Sravaka

paracittajhna dans

le
il

dsir de

voir la pense d'un ascte occup au

darsanamrga,

obtient de

1.

chos rjes blo phyogs phan thsun min == [na

dharmnvayadhpaksv

anyonyam]
kmadhtrdhvadhtupratipakslambanatvt. thos mthon bahi skad cig gfiis / rig ste bse ru lta bus gsum / sans rgyas sbyor ba med pa kun [vetti drkksanau / srvakah khadgakalpas trln sarvn buddho 'prayogatah //]
2. 3. flan

Hiuan-lsang,

xxvi,

fol.

3 a-b.

connatre les deux premiers moments,


et

dharniajnna

non pas
que

les

j hnaksnti...)

parce

la

duhkhe dharmaj hnaksnti moments suivants (duhkhe' nvay aconnaissance de la partie anvaya

(duhkha des sphres suprieures) du darsanamrga suppose un exercice prparatoire diffrent. Donc, si ce Srflvaka commence alors un nouvel exercice pour obtenir la connaissance de la partie anvaya, l'ascte qu'il examine est dj parvenu au quinzime moment quand
ce nouvel exercice prparatoire [qui dure treize

moments]
seizime

est ter-

min. Tout l'intervalle entre

le

deuxime

et

le

moment
2).

chappe donc au paraciltajnna du Srvaka (Vibhasa, 100,

Dans
trois

les

mmes

circonstances, le Pratyekabuddha [3 b] connat


les

moments, savoir
;

deux premiers

et

le

huitime,

samudaye
la

'nvayajfina

parce que l'exercice prparatoire requis, aprs

connaissance des deux premiers moments, pour la connaissance de


la

partie

anvaya,
2

est,

chez
il

le

Pratyeka, petit

(mrdu

= alpa).
et le
il

D'aprs d'autres matres,


quinzime.

connat les deux premiers

moments

Quant au Bouddha, par simple

dsir,

sans exercice prparatoire,

connat la pense d'autrui dans tous les

moments du darsanamrga.
et

Quels sont
7. Le

les caractres
c'est,

du ksayajnna

de Y anutpdaj hna ?

ksayajnna,

l'endroit des vrits, la certitude qu'elles


etc.
;

sont connues, abandonnes,

Yanutpdajnna,
'

la certitude

qu'elles ne sont plus connatre, abandonner, etc.


1.
Il

commence

l'exercice prparatoire ds qu'il voit


;

que

l'ascte

va entrer dans pense

le

darsanamrga
2.

cet exercice est

achev temps pour


99,

qu'il voie la

d'autrui occupe au

duhkha du Kamadhatu, au duhkha

partie
13,

dharmajtina.

Sur

le

paracittajnna du Pratyeka, Vibhasa,

100, 2 et ailleurs.

Quatre opinions d'aprs Samghabhadra, savoir les deux opinions mentionnes par Vasubandhu, et encore Le Pratyeka connat les moments 1, 2, 8, 14 , Le
:

moments 1, 2, 11 et 12 . La troisime opinion est correcte car s'il connat le moment 8, c'est que son exercice prparatoire la connaissance de la partie anvaya ne dure que 5 moments il pourra donc pendant les moments 9-13 se prparer la connaissance du moment 14. 3. zad pa ses pa bden rnams la / yons ses la sogs ns paho / yons ses bya ba med la sogs / mi skye ba yi blor hdod do Nettippakarana, 15: khln mejtlti idam khaye flnant nparatn itthatty ti pajnti idam anuppde inam.
Pratyeka connat
les
;

10
D'aprs
il

chapitre
le

vii, 7.

Mulasastra
:

Qu'est-ce que

le

ksayaj flna?
a

Quand

sait

en soi-mme

la douleur est parfaitement la destruction

connue par moi,


rendue prsente

l'origine est

abandonne par moi,


chemin a

par moi,

le

t cultiv par
9

moi
,

, le

savoir (jnna) qui en

rsulte (tad

updya yaj jnnam)

la vision

(darana),

la science

(vidy), l'intuition (bodhi), l'intelligence (buddhi), le discernement


(prajfi), la clart (loka), la comprhension (vipasyan)
'%

c'est ce

qu'on

nomme ksayajhna.
sait
et n'est plus

Qu'est-ce que

Quand on
par moi

anutpdajnna ?
connue
,

en soi-mme

la douleur est parfaitement


le

connatre ...

chemin

n'est plus cultiver

[4 a] le savoir .... c'est ce qu'on


la dfinition vii.

nomme anutpdaj nna.

[Voir

12 a-b].

Mais comment peut-on, par un jnna pur, avoir semblable connaissance


s

?
:

Les matres du Kasmlr expliquent


conscutifs deux j flnas de samvrti

Aux deux j flnas purs sont Le duhkha est connu par


et n'est plus

moi ....

le

duhkha

est

connu par moi

connatre

C'est en raison du caractre de ces deux

jhnas

de samvrti que
le

le

Sastra dfinit les deux jfinas purs. [C'est pour cela que
dit
:

Sastra

tad updya...]
Paramartha
:

1.

D'aprs l'Abhidharma
fol.

C'est le texte Prakarana, Nanjio

1266, Tokio, xxiii. 10,


2.

14 a 19 (trad. de Hiuan-tsang).
;

Omis par Paramartha donn par le Prakarana et par Hiuan-tsang. La Vyakhya fournit le fragment mrgo me bhvita iti tad updya yaj jnnam ..., et explique tad updya tat puraskrtya. Voir ci-dessous
3.
:

p. 27-28.

Hiuan-tsang traduit tad


de l'diteur
:

updya

= yeu ts ^=
:

en raison de cela

(glose
....

le

jnna
i

qui prend ces aspects

la

douleur est connue


le

Paramrtha
k'i.

tse

=
54

tenant compte de ce sens

Prakarana

yeu ts el

4.

On
En

a,

Nettippakarana, 54, cakkhu,


vi.

vijj,

buddhi, blmri, medh, loka.

Comparer Kosa,
5.

d.

porte sur le duhkha, sur les dharmas et leurs caracnon pas sur un moi connaissant le duhkha, moi qu'implique la formule duhkham me parijntam. Tout savoir qui envisage un moi est samvrtijnna, savoir mondain, impur. 6. Le caractre spcifique (viesa) des deux jhnas purs, qui sont nirvikalpa,
effet le

jnna pur

tres gnraux, et

Hiuan-tsang, xxvi,

fol.

3 b-4

a.

il

D'aprs d'autres matres \ l'ascte connat, par un j flna pur S qu'il


connat la douleur,
etc.

Mais nous avons

dit

que

le

ksayajhna
le

et

Y anidpdaj flna ne

sont pas darana, drsti.

Comment
terme

Sastra peut-il les dfinir

comme

vision

darana?
le

Le Sastra emploie
(bhsyksept)
3
,

vision

par habitude stylistique

reprenant la formule employe dans l dfinition

des autres savoirs

(duhkhajnna,

etc.)

Ou

bien, en raison de

leur caractre d'vidence (pratyaksavrttitvt), ces deux


qualifis
est dit
Il

jhnas sont
qu'il

"

darana. C'est en raison de ce caractre d'vidence


le

dans

Sastra

4
:

Ce qui
:

est

jhna

est

darana.

jhnas dharmajhna, anvayajhna, lokasamvrtijhna, paracittaj flna, duhkhajnna, samudayaj hna, nirodhaj flna, mrgaj flna, ksayajhna, anidpdaj hna.
y a donc dix
6

Comment
1.

rentrent-ils les

uns dans

les autres ?

Le samvrtij hna constitue un j flna, savoir


et

le

samvrtij fl'

une partie d'un autre j flna, [ savoir (ssrava) du paracittaj flna]. R


na,
est

la partie

impure

'

qui sont leur


1.

connu par induction (anumyate), en raison des deux jinas de samvrti efflux (nisyanda). Ci-dessous vii. 12 a-b.
'
'

D'aprs la glose de l'diteur japonais

psctyasramanasautrntik-

dayah.
2. D'aprs ces matres, il y a des aspects purs en dehors des seize reconnus par les Vaibhsikas (voir ci-dessous vii. 12 c).
'

'

3.
4.

Voir

ii.

trad. p. 259, iv. trad. p. 242.


:

Le Sastra est cit dans la Vyakhya yat tvaj jiinam darsanam api tat I syt tu daranam na jiinam astv bhisamayntikh ksnlayah. D'aprs la note de l'diteur japonais, Jnnapraslhna, 8, 2 et Prakaranapada, 1, 6.
(Tokio, xxiii. 10, 14 b
5.

3).
:

Paramartha ajoute
ici

En

outre,

pour indiquer que


il

les

darsanas dont
.

il

est

question

diffrent des drstis

dont

a t question plus haut


15.

6. Mme ordre dans Prakarana, xxiii. 10, fol. 14 a Hiuan-tsang (ci-dessus p. 4, n. 1) et Mahvyutpatti, 57.
7.

L'ordre diffre

manque dans Paramartha et dans l'original. L'original a le samvrtijnna constitue S. Vyakhya samvrtijnnam samvrUjnnam eva svabhvasamgrahatah j ekasya ca paracittajnnasya bhga ekadeah j
Cette question
....

tatra

Parmi ces jnnas,


:

12
2.

CHAPITRE

VII, 8.

Le dharmajhna constitue un jfina


partie relative

et

une partie de sept

jhnas, savoir la

au Kamadhatu des duhkha, samuet

daya, nirodha, mrga, paracitta, ksaya


3.

anutpdajnna.

Uanvayajhna
,

de

mme, en remplaant
la partie relative

la partie relative

au Kamadhatu
rieures.
4.

par

aux deux sphres supune partie de quatre


et

Le duhkhaj hna constitue un jfina


la partie des

et

j flnas

dharma, anvaya, ksaya


et

anutpdajnna
d'aprs le

qui a pour objet la vrit de la douleur.


5-6.

Les

samudaya

nirodhajhna
et et

s'expliquent

mme
7.

principe.

Le mrgaj flna constitue un jfina


:

une partie de cinq jfi-

nas
8.

dharma, anvaya, ksaya, anutpda

par acittaj flna.


et

Le par acittajfina constitue un jfina


:

une partie de quatre

jfianas
9.

dharma, anvaya, mrga, samvrtijfina.


et

Le ksayaj flna constitue un jfina

une partie de

six

jhnas:
l

dharma, anvaya, duhkha, samudaya, nirodha, mrgajhna. 10. L' anutpdajnna, de mme.

Comment

les

j flnas, qui sont au nombre de deux (pur

et

impur),

sont-ils distribus en dix

jhnas

?
la distinction s'tablit

8. Les

jhnas

sont au nombre de dix

en

raison de la nature, de l'opposition, de l'aspect, de l'aspect et de


l'objet,

de l'exercice prparatoire, de l'achvement de la tche, de


2

l'extension des causes.


1.

[4 b]
le

En

raison de sa nature (svabhvatas),

samvrtijhna (ou

savoir relatif la samvrti), parce qu'il n'est pas savoir absolu (apa-

ramrthajhnatvt).
1.

La

partie qui prsente l'aspect


/

Le duhkha
bcu yin no

est

connu par moi


yul dan

....

2.

ran bzhin dan ni gften po dan


/

rnam pa rnam pa spyod

sbyor dan

bya ba byas nid dan

rgyu rgya pa

las

= [svabhvt pratipaksatvd]
14 a 18
:

krkragocart / prayogt krtakrtyatvt hetuvistrato daa // 3. La Vyakhya ne donne pas la dfinition du Sstra. Prakarana, fol. lokasamvrtijnnam katamat j ssrav prajn.

Hiuan-tsang, xxvi,
2.

fol.

a-b.

13

En

raison de l'opposition, le

dharmajnna
le

et

anvayajnna

le

premier s'oppose au Kamadhatu,


!

second aux sphres sup-

rieures.
3. le

En raison de l'aspect (kratas, samudayajnna ; ces deux jnnas


(vi.

vii.

13), le
le

duhkhajnna
objet

et

ont

mme

(pahcopal'aspect.
2

dnaskandhas)
4.

trad. p.

122

et 136),

mais diffrent par

En
et
3

raison de l'aspect et de l'objet (lambana), le nirodhajn-

na

le

mrgajnna

qui diffrent tant pour l'aspect que pour

l'objet.

5. En raison de l'exercice prparatoire (prayoga), le paracittajnna connaissance de la pense d'autrui . Sans doute cejina

atteint aussi les

mentaux

(caittas) d'autrui, mais l'exercice pr;

paratoire porte sur la pense (citta)


caittas,
ratoire.
6.

aussi, bien qu'il connaisse les

on

le

nomme paracittajnna

en raison de l'exercice prpa-

Parce que

ce qui devait tre fait est fait

(krtakrtyatvt),

le

1.

Dfinition du Sfistra, cite dans Vyfikhyfi et qui correspond Prakarana,

14 b 15.

dharmajnnam katamat / kmapratisamyuktesu samskresu ycul ansravam jnnam kmapralisamyiiktnm samskrnm hetau yad ansravam jnnam kmapratisamyuktnm samskrnm nirodhe yad ansravam jnnam kmapratisamyuktnm samskrnm prahnya marge yad ansravam jnnam idam acyate dharmajnnam api khalu dharmajnne dharmajnnabhmau ca yad ansravam jnnam idam ucyate dharmajnnam. anvayajnnam katamat rprpyapratisamyxiktesu samskresu yad ansravam jnnam
/ /
j

Voir
2.

vi.

26.

anvetlty anvayajnna.
j

duhkhajnnam katamat pancopdnaskandhn anityato duhkhatah snyato 'ntmatas ca manasikurvato yad ansravam jnnam idam ucyate
duhkhajnnam.

samuday ajnnam katamat ssravahetukam hetutah samudayatah prabhavatah pratyayatas ca manasikurvato yad ansravam jnnam
I

Corrigez ssravahetuka,
3.

vi.

trad. p. 123, note

1.

15.

nirodhajnnam katamat / nirodham nirodhatah ntatah prantato nihsaranata ca manasikurvato yad ansravam jnnam mrgajnnam katamat j mrgam mrgato nyyatah pratipattito nairynikata ca manasikurvato yad ansravam jnnam idam ucyate mrgajnnam.
....

14

CHAPITRE
ce

VII,

8-11

b.

ksayajhna
o

jnna

est le

premier

jnna

natre dans une srie


nat dans

ce qui devait tre fait est fait


srie,

[Vanutpdajnna

semblable
7.
il

mais aprs].

En

raison de l'extension de ses causes,

Vanutpdajnna, car
purs, y compris

a pour causes

(=

sabhgalietu) tous

les

jnnas

le

ksayajnna (sarvnsravahetukatvt).

Nous avons
a.

dit

que

le

dharmajnna
b.

tout entier [c'est--dire

portant sur les quatre vrits,

dans

le

darsanamrga

et

dans

le

bhvanmrga]
contrecarre

s'oppose au

Kamadhtu

tout entier [c'est--dire

les cinq catgories


et

de passions, abandonner par la

vue des quatre vrits


outre [5 aj

par la mditation, du Kamadhtu].

En

a-c.

Le dharmajnna, dans

le

bhvanpatha, quand
trois sphres.
'

il

porte

sur nirodha et

mrga, s'oppose aux


et le

Le nirodhe dharmajnna
posent aux trois sphres

marge dharmajnna,
ces deux

raliss

au cours du chemin de mditation (vue renouvele des

vrits), s'op-

c'est--dire

jnnas

contre-

carrent les passions des sphres suprieures qui sont abandonnes

par mditation.

9
1.

d.

L'anvayajnna ne s'oppose pas au Kamadhtu.


la

bsgom pahi lam

hgog pa ham

lam

la

chos ses gan yin de

gyi ni gien po yin

= dharmajiinam nirodhe yan marge va


tat.
/

/ khams gsum bhvanpathe /

tridhtupratipaksas
2.

nirodhamrgau hy adhtupatitau tv adharv api na hlnau vyavasthpyete duhkhasamiidayasatye tv adharabhmike nihne na tadlambanam dharmajnnam rpcirpyadhtupratipaksa ity avagantavyam.
j /

(Vyakhya).

Le nirodha et le mrga ne font pas partie des sphres nirodha par rapport au Kamadhtu (nirodhe dharmajnna),
combattre
les

Considrer

le

c'est aussi bien

kleas des sphres suprieures.


qui

Dans
3.

expulsent les

daranamrga, ce sont les anvayadharmaksntis anuayas des sphres suprieures. hdod pahi khams kyi rjes ma yin = nnvayam kmadhtuke //
le

stade de

Hiuan-tsang, xxvi,

fol.

4 b-5

b.

15
X anvayaj nna

Dans aucune de ses branches (de douleur, ne s'oppose aux klesas du Kamadhatu.
'

etc.),

Quels sont

les aspects des dix

jnnas

?
2 ont les seize aspects.

10

a-b.

Le dharmaj nna

et

Xanvayajnna

Les seize aspects qui seront expliqus plus loin

(vii.

13

a) [5 bj

10

b-c.

De mme

et

autrement

le

samvrtijnria,
;

Le samvrtijnria prend
tres,

les seize aspects

il

en prend aussi d'au-

car

il

saisit les caractres propres, les caractres

communs,
B

etc.

10

c-d.

Quatre, en raison des aspects de leur Vrit.


et

Les duhkha, samudaya, nirodha


les

mrgajnna,

portant sur

aspects de leur Vrit, ont chacun quatre aspects.

1 1 a-b.
1.

De mme,

lorsqu'il est pur, le

paracittajnna.

bhavati
2.

kmadhtor jitatvt dharmajnnenaiva kmadhtuh prvatarajito tatah pacd anvayajnnam ntpadyate. [dharmajnnnrnam pa bcu drug kun chos ses pa dan rjes su ses
j j
/

vayajiinam sodaskrti]
3.
4.
:

[smvrtam / tathnyathpi] rdzob ni / de bzhin gzhan du han VySkhya sodakram usmagatdisu svasmnyalaksandigrahand iti svalaksanagrahant smnyalaksanagrahanc ca j diabdena bhumksva tistha gacchety evamkram ca / na hy ete svalaksankrh kim tarhy evamkr eva. Dans les nsmagatas, etc. (vi. 17 c), le sanivrtijnna prend les seize aspects des vrits. Le samvrUjtina saisit les caractres communs [par exemple l'imper/

manence], les caractres propres [par exemple

le

caractre propre du rpa]; et


! !
:

un tel Mange Va samvrlijrina n'a pas pour aspect un caractre propre, on peut seulement dire

encore prend-il l'aspect qui s'exprime par les mots

qu'il est
5.

evamkr,
ran gi
/

de

tel

aspect

[catvri svasvasatykrtni bden pahi rnam pas bzhi yin no tu] D'aprs Paramartha svasvasatykrata catustayam. 6. pha roi yid ses dri med kyan / de bzhin tlri ma dan bcas ni / ses byabi ran gi mthsan nid rnam / rdzas re re zhig spyod yul lo p= [tath paramanojnnam amalam samalam punah jneyasvalaksankram pratyekavastugocaram/ /]
raii
:

Paramartha
Le

paramanojnnam api tathmalam. cetopariyye nna ou paricce nna (= paracittajnna)


:

n'est

pas

16

CHAPITRE

VII,

11 b-d.

Le paracittajnna, dans sa
partie

partie
;

ansrava

(vii.

5 b-6,

p. 7, n. 1),

porte sur les aspects de sa vrit

il

a donc quatre aspects. Cette


constitue par le

du paracittajnna

est,

en
il

effet,

mrgajhna.

1 1 b-c. Lorsqu'il est impur,

a pour aspects les caractres propres

de son objet.

'

Lorsque

le

paracittajnna

est impur,

il

saisit les caractres pro-

pres de son objet (jneya), savoir des citta et caittas d'autrui. Ses

aspects sont conformes ces caractres propres

donc

ils

ne sont pas

compris dans

les seize.

Pur ou impur (ubhayam api


11
d. Il

tu)
2

a pour domaine un objet individuel.


il

Lorsqu'il porte sur une pense (citta),


(caitta)
il
;

ne porte pas sur un mental

lorsqu'il porte sur

un certain caitta (vedan par exemple),


connat en vrit

ne porte pas sur un autre (samjh).


S'il

en est

ainsi,

pourquoi Bhagavat
'

dit-il

Il
',

la

pense qui est sarga,

avec dsir sensuel

ga

puisque

le

paracittajnna ne connat

comme tant sarpas en mme temps


seulement sur

sammatinna
la

(Vibhanga, 330). Les Andhakas pensent


v.
7,

qu'il porte

pense, Kath&vatthu,
savoir

et soutiennent tort

qu'un Sravaka peut, par ce

nna,
1-2.

quand

les autres atteignent

un

fruit, ibid. v. 10.

Voir note 6 page prcdente.


:

3. La VyakhyS cite le Stra sargam cittam sargam cittam iti yathbhtam prajnti vigatargam cittam vigatargam cittam iti yathbhtam prajnti yath sargam vigatargam evam sadvesam vigatadvesam samoham vigatamoham samksiptam viksiptam linam pragrhtam uddhatam anuddhatam avyupantam vyupantam asamhitam samhitam abhvitam bhvitam avimuktam vimuktam iti yathbhtam prajnti.
j /

D'aprs les gloses du Bhsya,


paires

il

faut ajouter, avant

avynpanta,
:

les

deux

amahadgata, mahadgata, sa-uttara. anuttara


dans
le

en tout douze paires.


Vijnfinak&ya
vii.

Toutefois ces deux paires manquent


fol.

Stra

cit

(xxiii. 9.

4 b) et dans la rdaction du Stra cite par


liste

VyakbyS

ci-dessous

42 a-d.
celle

D'aprs Kiokuga Saeki, la

d'Ekottara

(14, 2)

comporte onze paires;


(21, 12), dix paires.
iv.

de

Madhyama

(9, 23),

dix,

en omettant uddhata-anuddhata, avyupanta-vyu;

pasnta, en ajoutant sadosa-adosa

celle
v.

de Samyukta

Sources plies, par exemple Samyutta,

265, Anguttara,

32, Vibhaiiga, 329,

Hiuan-tsang, xxvi,

fol.

5 b-6

a.

17

citta (pense) et caitta (dsir sensuel, etc.), de

mme

qu'on ne saisit

pas en

mme temps

l'toffe et la tache.

'

L'expression sarga,

avec dsir

comporte deux significations.


par samyuktasargat,
'

Une pense

est

sarga

soit

par samsrstasargat, parce qu'elle est


2
,

mle

au rga (rgasamsrsta)
unie

soit

parce qu'elle est

au rga (rgasamyukta).

La pense rgasamprayukta,
titre

associe au

-dire qui est actuellement en proie


;

rga (ii. 53 c), c'estau rga, est sarga un double


unie au rga.
'"

elle est

mle au rga,

elle est

Toute autre pense impure (ssrava)


tant qu'elle est unie

est

seulement sarga en

au rga.
pensent que
le

Certains matres
citta [6 a] dsigne

"

Stra, par l'expression sarga-

seulement la pense mle au rga, c'est--dire


les explications s'cartent
:

Visuddhimagga, 410 (dont

de celles de l'Abhidharma).

On

a seulement huit paires

moha, asamhita-samhita, avimutta-vimutta. Vyakhya yath yacl vastram iti 1. vastramalyugapadgrahant. paricchinnkram vijnnam utpadyate na tad malam grhnti et inver:

sarga-vltarga, sadosa-vltaclosa, samoha-vltasankh.itta-vikkh.itta, mahaggata-amahaggata, sauttara-anuttara,

sement.
2.

Voir

i,

trad. p. 19.

samsrstasargat associe au rga , rgasamprayukta. Tout ce paragraphe d'aprs Vibhasa, 191, 14, cite par rgasamprayogt. Kiokuga Saeki, xxvi. 8 a. samyuktasargat rgaprptyanubandhd ity eke / 3. Deux explications
C'est--dire

anuaynarglambanatvd

ity apare. Ces deux explications seront commentes et rfutes ci-dessous p. 24. 4. C'est--dire toute pense souille (klista) mais non associe au rga ; toute La pense non-dfinie; toute pense bonne (kuala) mondaine (laukika).

pense supramondaine, ou faisant partie du chemin, n'est pas ssrava.


sous
5.

Ci-des-

p. 25,
Il

1.

1.

y a trois opinions. Premiers matres: Est sarga


pense oppose au rga.

la

pense associe au rga; est vigatarga


la

la

Deuximes matres
Troisimes matres
la

Est sarga

pense

unie

au rga
est

[ce

qui peut

s'entendre de deux faons,


:

comme

ci-dessus n.
la

3J.
;

Est

sarga

pense associe au rga

vigatarga
la

pense non associe au rga.


D'aprs la Vibhasa, la deuxime opinion est bonne. Vasubandhu adopte

troisime opinion.

18
la pense associe

CHAPITRE

VII, il.

au rga, rgasamprayukta.
, c'est,

Quant

la

pense

vigatarga,
se au

sans rga

d'aprs ces matres, la pense oppo-

associe au

rga (rgapratipaksa). En effet, disent-ils, si la pense non rga tait nomme vigatarga, la pense associe
etc.) serait dite

d'autres passions (haine,

vigatarga, car

elle n'est

pas associe au rga.


Objection.
nie
elle
(ii.

Dans

cette

hypothse la pense non-soille-non-dfi;

71 b) n'est pas sarga, puisqu'elle n'est pas associe au rga

n'est pas vigatarga, puisqu'elle n'est pas oppose au rga. Par


il

consquent

faut admettre ce que disent d'autres matres (Abhidharle fait

mikas), que la pense est sarga par

de la rgasamyuktat,
soit ncessaire-

par

le

fait qu'elle

est unie

au rga, sans qu'elle

ment

mle

associe

au rga (samsrsta, samprayukta).

De mme

faut-il expliquer les

autres expressions du Satra jusque


p. 16, n. 3]

samoha

et

vigatamoha. [Voir
:

Les Vaibhasikas disent


ksipta), ainsi

La pense bonne

est concentre

(sam'.

nomme

parce qu'elle n'est pas djete de son objet

La pense

souille est distraite (viksipta), parce qu'elle est associe

distraction.

Les Occidentaux, ou matres du Gandhra, disent


associe langueur

La pense
s
;

(middha)

est

concentre (samksipta)

la pen-

se distraite (viksipta), c'est les autres penses souilles.

Les Vaibhasikas n'admettent pas cette dfinition.


ce systme, une

Ils

disent

Dans

mme

pense, savoir une pense souille associe

langueur, sera la

fois

concentre et distraite.
9)

En

outre, ce
:

systme
connat

contredit le Mulasastra (Jnanaprasthana, 15,

qui dit

Il

en vrit la pense concentre (samksipta), munie de quatre jnnas,

dharma, anvaya, lokasamvrti


[Ci-dessous
p.

et

mrgajnna

(Vibhasa, 190,

5).

20-21]

La pense

souille est affaisse (lina) [6 b] parce qu'elle est asso3

cie indolence (kausidya).


1.

Parainartha

parce que son objet est petit


lio,

2.

Dans

la

Vibhasa,

dans Hiuan-tsang,

tsi.

Samyutta,

v.

279, la pense

ajjhattam samkhitta
3.

Ibid. la

thnamiddhasahagata thlnamiddhasampayiitta. pense atilna est kosajjasahagata, kosajjasampayuUa.


est

Hiuan-tsang, xxvi,

fol.

6 a-b.

19

La pense bonne

est bien

en main

(pragrkita), parce qu'elle


'

est associe effort correct

(samyakpradkna).
(amahadgala),

La pense

souille est petite

ainsi

nomme

parce
est

qu'elle est affectionne des petites personnes.

La pense bonne

grande (makadgata), ainsi


des grandes personnes
2
.

nomme
et

parce qu'elle est affectionne

Ou

bien les deux penses, la souille et la

bonne, sont

nommes

petite

grande parce que

les

racines, la

valeur, le cortge (parivra), l'entourage (anuparivarta), la force,

sont respectivement petits et grands.

En

effet,

1.

la

pense souille est de petites racines, ayant deux


:

racines,

moka,

plus dvesa ou lobka


;

la pense

bonne

est toujours

associe aux trois racines de bien


valeur,

2. la
:

pense souille est de petite

tant obtenue sans effort

la

pense bonne est de grande


;

valeur, tant ralise au prix de grands efforts


est de petit cortge, car

3. la

pense souille

une pense

souille n'est pas

accompagne
:i

de l'acquisition d'une pense future de

mme

espce

la

pense

bonne

est de

grand cortge, tant accompagne de l'acquisition d'une


v

pense future

de

mme

espce

4. la

pense souille est de petit

entourage, n'tant entoure que de trois skandkas, vedan, samjn, samskras ; la pense bonne est de grand entourage, car il faut ajouter le rpa (dkynnsravasamvara, iv. 4 a, 26) 5. la pense
;

1.

Ibid.

la

pense atipaggahlta est tiddhaccasahagata uddhaccasampa

yutta.
2.

Dans Divya, pragrhita =

lev,

haut

(montagne, palais,

etc.).

La

grande personne
6.

par excellence est


la

le

Bouddha.

Ce paragraphe

d'aprs Vibhasa, 190,


(sevita) par

La pense souille est petite parce qu'elle est pratique


(?

svalpajana

siao-chng)

pense bonne est grande parce qu'elle


:

est pratique par

mahjana.
le

Objection

Ne voyons-nous pas qu'un nombre


nombre
d'tres pratique le bien ?

sans mesure d'tres pratique

mal, qu'un petit

Comment

peut-on dire que la pense souille est pratique par svalpajana ?


;

Nous ne disons pas

nomm
3.

petit parce que la catgorie est peu nombreuse est peu de dharraas purs. tajjtlyngatabhvanbhvt ; bhvan == pratilambha, acquisition.

petit ce qui a

D'aprs

le

principe

Ce sont
4.

les

bons
25

kusalasamskrt dharm bhvayUavyh (iv. 127 c). dharmas samsJcrta que l'on acquiert l'tat futur . Voir
:

ci-dessous

vii.

d.
:

Paramrtha

passe et future

20

CHAPITRE

VII,

li.

souille est de petite force, car les racines de bien, coupes, repren-

nent naissance

(ii.

36, trad. 184, iv.

80

c)

la

pense bonne est de


dfinitive-

grande

force, car la

duhkhe dharmajnnksnti coupe


180).

ment

dix

anusayas

(vi. trad. p.

C'est pourquoi la pense souille est

nomme

petite, et la

pense

bonne, grande.

La pense
lit

souille est sa-uttara, parce qu'elle est associe frivo;

(auddhatya)

la

pense bonne est anuttara, parce qu'elle est


'

oppose la

frivolit.

Les penses calme (vyupanta), non calme (avyupanta), s'expliquent de

mme.

[7 a]

La pense

souille est non-recueillie


;

(asamhita), parce
pense bonne est

qu'elle

est associe distraction (viksepa)

la

recueillie,

parce qu'elle s'oppose la distraction.

La pense

souille est non-cultive (abhvita), parce

que

les

deux

cultures (pratilambha,

nisevanbhvan,

vii.

27) manquent.

La

pense bonne est cultive (bhvita), pour la raison contraire.

La pense
en

souille est non-dlivre (avimukta), n'tant pas dlivre

soi, n'tant

pas dlivre en ce qui regarde la srie o


tre dlivre

elle nat.

La pense bonne peut


de vue de la srie o

(vimukta),

et

en soi et au point

elle nat.

Telle est l'explication des Vaibhasikas.


Cette explication, disent les SautrEntikas, n'est pas conforme au

Stra

et elle

ne rend pas compte de la valeur des termes (padrth-

nm
i.

arthaviesh).
n'est-elle
:

Comment

pas conforme au Stra ?

Le Sutra

dit

Quelle est la pense intrieurement concentre


qui est

(samksipta) ?

La pense
et

accompagne (sahagata

===

sam-

prayukta) de torpeur

langueur (styna-middlia), ou la pense

Sur sa-uttara, iv. 127 d, v. trad. p. 63. Elle n'est pas dlivre lorsqu'elle est bonue-impure (kualassrava) et lorsqu'elle nat dans une srie o les klesas ne sont pas coups. Sur la dlivrance de la pense, vi. 76 c.
1.

2.

Hiuan-tsang, xxvi,

fol.

6 b-7

a.

21

intrieurement accompagne de calme (samnirodha) non pas de


vision (vipayan).

Quelle est la pense extrieurement distraite


qui se disperse vers les cinq objets de plai
'

(viksipta) ?
sir,
[Il

La pense
que

ou qui est intrieurement accompagne de vision, non de calme.


rsulte de ce texte
la

pense associe la langueur, middha,

est concentre,

samksipta.]
le

Mais, rpond

Vaibhasika, nous avons

dit (p.

18

1.

23) que,

si la

pense associe la langueur est

concentre, une pense souille

(et

par consquent distraite, viksipta), lorsqu'elle est associe la langueur, sera en

mme temps
la
2

concentre et distraite.

Oui, vous avez fait cette remarque, mais elle ne porte pas.

En

effet,

on ne peut affirmer que


la

pense souille, lorsqu'elle est associe

langueur, soit distraite.


1.

D'aprs

le

pli

et

les

fragments cits dans

la

Vyfikhya

[adhytmam

samksiptam cittam katamat / yac cittam] stynamiddhasahagatam adhytmam [va] samnirodhasahagatam no tu vipasyanay samanvgatam, / [bahirdh viksiptam cittam katamat j yac cittam panca kmagunn rabhya] anuviksiptam anuvisrtam [adhytmam va vipasyansahagatam no tu samnirodhena samanvgatam].
samksipta, Paramartha
ch
:

lio,

Hiuan-tsang

isi
:

',

(= samgraha)
v.

tch' (dhar),

Hiuan-tsang

teh (samatha).

samnirodha, ParamSrtha Kiokuga


s'excluent.
/

observe que, d'aprs les Sautrantikas, vipayan et

samatha

Samyutta,

279

katamam

ca bhikkhave ajjhattam samkhittam cittam

bhikkhare cittam thinamiddhasahagatam thlnamiddhasampayuttam / idam vuccati .... / katamam ca .... bahiddh vikkhittam cittam \ yam .... cittam bahiddh panca gune rabbha anuvikkhittam anuvisatam / idam

yam

vuccati
2.

....

middhasahagatasya klistasya niksiptatvpratijiint. Hiuan-tsang traduit En effet [nous] n'admettons pas (pou
:

hi

= na prati.

jnyate) que Paramartha


: :

la

pense

souille, associe la langueur, soit distraite


l)
....

De mme

[Nous] n'tablissons pas (pou

iti krtv viksiptatvam atra na pratijnyate / kim middhaviksiptatvam nstlti na pratijnyate hosvid vidyamnam api viksiptatvam samksiptatvenvasthpitatvn na pratijnyate / ubhayathpi vycaksate / kecid vycaksate j middhasahagatt klistd yad anyat klistam tad viksiptam pratijnyate j middhasahagatam tu klistam aklistam vvisesena samksiptam eveti j apare punar vycaksate / yan middhasamyuktam tat samksiptam eva na viksiptam j yat tu visayesu visrtam tad eva viksiptam ity ato 'tra middhasamprayukte citte [viksiptatvam] na prati-

Vy&khya kim
citte

sahagate

jnyate.

22
Mais, rpond
Il

CHAPITRE
le

VII, 11.

Vaibhasika, votre thse contredit

le

Sastra
et

se peut.
'

Mais mieux vaut contredire

le Sastra,

non pas

le

Stra. [7 b]
ii.

Comment

cette explication manque-t-elle dire le sens propre

des diffrents termes ?

Parce qu'elle indique


part
:

le

caractre des diverses penses

d'une

viksipta, lna, uddhata,


;

avyupasnta, asamhita, abhvita,


etc.

avimukta
quer

d'autre part
2

samksipta, pragrhta,

sans mar-

les diffrences.

Le Vaibhasika rpond.
ses viksipta,
est la

Il

est faux

que nous n'indiquions pas

le

sens spcial des diffrents termes.


etc.,

La

qualit de souill

des penles

mme

mais nous mettons en lumire

dfauts particuliers de ces diverses penses souilles.

De mme nous
n

mettons en lumire

les qualits particulires

des diverses penses

bonnes, dont d'ailleurs la bont n'est pas diffrencie.

Rpondons que
tabli parce

le

sens des diffrents termes n'est pas correctement


la contradic-

que vous manquez carter l'objection de


que
la

tion avec le Stra \ [Le Stra, en effet, dit

pense accompagne

varam sstravirodhah Vyakhy abuddhoktam abhidharmastram abhipryah. Comparer Kosa, i. 3, iii. 32. elle con2. La souillure, klistatva, des premires penses est non diffrencie siste dans l'association, samprayoga, avec les klesas qui se trouvent avec toute
1.
:

ity

pense souille
avec les

la bont,

kusalatva, des secondes consiste dans l'association


ii.

dharmas

qui se trouvent avec toute bonne pense,

25, 26.
/

abhinnalaksanavacant.
klistatvalaksariam

Vykby

sarvni tni klistny tiktnlti


/
j

klistatvam esm viksiptdlnm avimuktntnm samksiptapragrhtdnm punah klesamahbhmikaih samprayogah kusalatvam esm cbhinnalaksanavacann nrthavisesa ukto bhavati abhinnam kim punah kusalatvam kusalamahbhniikaih samprayogah. klistasmnye 'pi (= tulya3. na vai noktah padrthnm arthavisesah
...

klistatve)

viksiptdlnm tesm dosavisesasamdarsand ukta evrthavieso

bhavati.

Nous disons en effet apy tat klistam cittam viksepayogd viksiptam j klistam kausldyayogl lnam j auddhatyayogd uddhatam .... Nous disons lnam cittam klistam kausidyasamprayogt j uddhatam cittam klistam auddhatyasamprayogt. 4. stravirodhasyparihrt. Vyakhy stre hi stynamiddhasahagatam samksiptam uktam j stynayogena yat klistam middhasamyuktam
: : :

tat

samksiptam na kusalam stynasya klesamahbhmikatvt.

Hiuan-tsang,
de

xxvi,

fol.

7 a-b.

23

styna-middha
fait partie

est

samksipta. La pense unie middha, souille


et elle

par union styna, est samksipta,

ne peut tre bonne, car

le

styna
FA
si,

des klesamahbhmikas].
le

[comme
et

Vaibhasika

le

croit],
il

le

Stra entendait, par la

pense lna \ la pense uddhata,


pense lna

ne parlerait pas part de la


il

de la pense uddhata. Or

les distingue, car

il

dit

Lorsque

la

pense est lna, ou redoute de devenir lna, ce n'est


propice pour cultiver les membres-de-Bodhi prala

pas un

moment

srabdhi,

samdhi, upeks. Lorsque

pense est uddhata ou

redoute de devenir uddhata, ce n'est pas un


cultiver les

moment

propice pour
prti. la
3

membres-de-Bodhi dharmavicaya, vrya,

Objection du Vaibhasika.

La

culture des

membres de

Bodhi
[Faut-

se trouve-t-eile donc, dans le cas qui nous occupe, partielle ?


il

croire qu' certain


;

upeks

certain

moment on cultive prasrabdhi, samdhi, moment dharmavicaya, vrya, prti ?].


'

Non
sur
',

pas.

Le
'

texte entend par

'

cultiver

',

non pas
de
'

le fait

de

'

se

rendre prsent

(sammukhbhva), mais
'

le fait

fixer l'attention

de

'

prendre pour objet

(manasikarana

= lambankarana,
le

bhogakarana).
Rplique du Vaibhasika \
1.

La
:

pense o

kausdya domine

yad eva linam lad evoddhatam, pense Nous tirons cette conclusion de leur dfinition lnani cittatn klistam kausdyasamprayogdt ; uddhatatn cittatn klistam auddhatyasamprayogt. (Ci-dessous, p. 24 n. 1, une autre rdaction.) 2. yasmin samaye lnam cittatn bhavati llnabhisanki aklas tasmin samaye prarabdhisanidhytipeksabodhyangnm bhvanyh / yasmin samaye cittam uddhatam bhavaty atiddhatybhisanki aklas tasmin samaye dharmavicayavryaprtibodhyangnm bhvanyh. Si lna et uddhata taient confondus, le Stra dirait Lorsque la pense est lna, ce n'est pas le moment pour cultiver prasrabdhi prti. Lorsque la pense est uddhata, ce n'est pas le moment pour cultiver prasrabdhi .... prti. Ou bien Lorsque la pense est lina ou uddhata, ce n'est pas le moment pour cultiver prasrabdhi .... prti. 3. kim punar atra bodhyangnm vyagr bhvan. Or la culture des sept membres de la Bodhi est simultane. 4. Pour la smrti, Bhagavad a dit smrtim khalv aham, sarvatragatm vadmi. Mais nous ne sommes pas en contradiction avec le Stra 5. Hiuan-tsang
Les Vaibh?ikas sont d'avis que
lna

= pense uddhata

24

CHAPITRE
et

VII, 11.

(adhikam)
reoit le

o Y auddhatya
de lna.

nom

est rduit (nyagbhvena vartate) La pense o Yauddhatya domine et o le

kausdya

est rduit, reoit le


le

nom

de uddhata. Ces deux penses

sont donc distinctes, et

Stra peut en parler part sans contredire


fait

mon

systme. [8 a] Mais, tenant compte du


et

que ces deux

vices,

kausdya
uddhata.
2
'

auddhatya,

coexistent, existent

simultanment dans un

seul faisceau

mental, nous disons que la pense qui est lna est

Nous ne prtendons pas


....]

rcuser

un

texte intentionnel

mais

telle

n'est pas l'intention

du Sutra [de dsigner

comme

lna une pense

o kausdya domine

Quant

la

thse expose ci-dessus

(p.

17

1.

3)

que toute pense


,

rgasamyukta demandons quel


1.

unie au

rga

est

sarga
et

est le sens de l'expression est

avec rga rgasamyukta ?

nous

Si

une pense

rgasamyukta,

par consquent sarga,

parce que la possession du rga continue dans la srie o se produit


cette

pense (rgaprptyanubandht), alors la pense du saint im-

parfait ou Saiksa,

mme quand
le

elle est

pure (ansrava), sera nom-

me sarga
la srie
2. Si

puisque

rga

n'est pas

compltement expuls de
3

du Saiksa (aiksasamtne rgasya svaesatvt).

une pense

est

rgasamyukta,

et

sarga, par
gte
'',

le seul fait

d'tre l'objet

(lambana) du

rga prenant

alors la pense

Encore que toute pense souille


domine,
le

soit
;

lna et uddhata, la pense o


celle

le

kausdya
Stra
la

Stra

la

nomme
[8 a],

lna

o Yauddhatya domine,

le

nomme uddhata. Mais


sont unes de nature.
1.

considrant leur constante association, je dis qu'elles

uddhatam klistam auddhatyasamyogt La pense souille est lna par association avec kausdya la pense souille est uddhata par association avec auddhatya. Comparer ii, trad.
lnarn klistam kausdyasarnyogd
: ;

p. 163-4.
2. Vyakhya prya iti. 3.
:

crya ha nbhipryikam yvat stre


a,

tu

nyam

abhi-

Un

Saiksa
;

actuellement, une pense pure, par exemple la pense de l'imlui la

permanence

mais reste en

possession du
voir

rga de Kfimadhatu

s'il

n'est pas

AnSg&min .... 4. anusaynarglambanatvt,

v. 17.

Hiuan-tsang,

xxvi,

fol.

7 b-8 a.

25

impure (ssrava) de l'Arhat sera sarga


tre l'objet

puisque cette pense peut

du rga d'autrui.

'

Si vous n'admettez pas que la pense de l'Arhat soit prise

comme

objet par le

rga

d'autrui,

comment

cette

pense sera-t-elle dite im-

pure?
Direz-vous qu'elle est impure, non pas parce qu'elle serait l'objet

du rga d'autrui, mais parce qu'elle


gnral

est l'objet d'une passion d'objet

(smnyaklea,

v.

12,

savoir de Yavidy ou

moha)
,

d'autrui ?

Dans

cette hypothse,

ne dites pas que cette pense est

sarga,

avec rga

dites qu'elle est

samoha,

avec

moha

puisqu'elle est l'objet

du

moha

d'autrui.

Mais, dirons-nous, aucune des explications proposes n'est valable.

En

effet la

connaissance de la pense d'autrui (paracittajhna) ne

porte pas sur les possessions


d'autrui.

qui peuvent se trouver dans la srie


la pense d'autrui

Par consquent lorsque je connais


unie

comme

sarga, cette pense d'autrui n'est pas sarga parce que rga-

samyukta,

rga

dans ce sens qu'elle serait accompagne

(sahita) de la possession de rga, dans ce sens qu'elle se trouverait

dans une srie d'o cette possession n'est pas expulse.

La connaissance de la pense d'autrui ne connat pas non plus le rga qui prendrait pour objet la pense d'autrui, le rga qui serait
l'objet de la

pense d'autrui.
n'est pas dite

Donc une pense


par
le fait d'tre

sarga par

le fait

de

rgasamyoga,

unie

rga

au double sens propos.


pense sarga ?

Objection ?

S'il
Il

en est

ainsi, quelle est la

Vasubandhu.

faut dterminer l'intention du Stra. Est


la

sarga

avec rga
1.

non pas

pense rgasamyukta

unie

rga

Les penses de l'Arhat qui font partie du chemin d'Arhat ne sont jamais

impures

car ces penses sont pures par dfinition et ne sont pas l'objet des

passions d'autrui
vrtijfina),

prenant gte

, v.

18 a-b

mais ses penses mondaines (sam-

comme son

corps, sont impures (ssrava) en ce sens

que

les

passions

d'autrui peuvent y prendre gte (i. 4 b). Voir viii. 25 c. Observons que Paramartha traduit trs nettement Si
:

par
2.

le fait qu'elle

prend

le

rga pour

objet
p.

...

une pense yun y wi king kiai

est

sarga

Les deuximes matres, ci-dessus

17 n.

5.

26
mais
o
le

CHAPITRE
la

VII,

11-12

b.

pense rgasamprayukta,

associe

rga

la

pense
,

rga

existe actuellement. Est vigatardga,

sans rga
cette

la

pense qui n'est pas associe rga, quand bien


serait

mme

pense

accompagne de

la possession

du rga.
;

Objection.

L'expression vigatarga ne peut avoir ce sens

car

un autre

Sitra dit

que

la

pense vigatarga, vigatadvcsa, vigataest

moha, ne retombe pas dans la triple existence. Or si celte pense accompagne de la possession du rga, etc., elle retombera.
Vasubandhu.
possession du
Objection.

Cet autre Stra entend par vigatarga citta


citta, la
.

le

vigatargaprpti

pense qui n'est pas accompagne de la

rga

N'avons-nous
effet (p.

pas rfut votre opinion ? [8 b] Nous


si

avons

dit

en

18

1.

1)

que,

on

nomme vigatarga

une pen-

se dissocie du

pense o

le

rga (rgena asamprayuktam), c'est--dire une rga n'est pas actuellement en exercice, on devra nomtoute pense associe une autre passion.

mer vigatarga
dit

Or on ne

pas d'une pense associe la haine qu'elle est vigatarga,


.

sans

rga

Vasubandhu.
du rga
cie
est

Il

n'y a pas faute dire que la pense dissocie


la

vigatarga. Mais on ne considre pas


et associe

pense disso-

du rga

la haine

comme

tant vigatarga, mais

bien

comme

tant

avec haine

(sadvesa) en la distinguant par


associe la haine
.
'

son caractre spcifique qui est d'tre

Le paracittajnna
il

atteint-il l'objet

de la pense d'autrui, atteintconnat ?

la

pense d'autrui en tant que

celle-ci

Non. Quand on
;

connat la pense d'autrui, on ne voit pas l'objet de cette pense

on

ne voit pas cette pense en tant qu'elle connat


qu'elle est souille (klista), etc.
etc.,
;

on

sait

seulement

on ne connat pas
en
et

l'objet, couleur,
le

en raison duquel

elle est souille. S'il le

tait

autrement,

para-

cittajnna porterait sur

rpa,

etc.,

ne serait plus paracitta:

jnna
1.

le

paracittajnna pourrait porter sur lui-mme

car la per-

na

tu tad

tarhi sadvesam

dvesdisamprayuktam cittam vigatargam iti grhyate kim samoham ity evamdi dvesdisamprayogatay viistatvt.

Hiuan-tsang, xxvi,
sonne dont
je connais la

fol.

8 a-9

a.

27
connatre

pense peut au

mme moment
:

ma
le

propre pense.

Les caractres du paracittaj flna sont dtermins

il

connat
et

caractre individuel d'une chose (dravya-svalaksana)


les

non pas

samvrtisat-smnyalaksanas
non pas

il

connat pense-mentaux (cittaet

caitta) et
futurs,
et

matire (rpa), actuels

non pas passs ou

d'autrui et

non pas de

soi,

du Rpadhatu, e^ non pas d'rpyadhtu,

du domaine du Kmadhatu ou bien encore penla catgorie laquelle


il

se et

mentaux purs (ansrava),

de
il

appartient lui-mme (sabhga) : pur,

connat pense-mentaux purs,

impur (ssrava),
cittaj flna

il

connat pense et mentaux impurs.

Le para-

est incompatible
le

avec

le

daranamrga
et

et

Ynantarya-

mrga

avec

snyatsamdhi
le

Ynimittasamdhi, comme

aussi avec le ksayaj flna et Y anutpdajhna. Les autres conditions

ne sont pas exclues

paracittaj flna est donc compatible avec


et

le

bhvanmrga (vimukti
etc. [9 a].

visesamrgas), Y apranihitasamdhi

L'expos du paracittaj flna est termin.

12

a-b.

Les autres ont quatorze aspects en excluant l'aspect


'

'

vide

'

et l'aspect

non

soi \

'

Les
L'un

autres

sont

le

ksayajhna

et

Y anutpdajhna.
(vii.

et l'autre

comportent quatorze aspects

13

a),

en excluant
ces deux
2
,

l'aspect

nya

(vide) et l'aspect

antmaka

(non

soi).

En

effet,

j flnas, bien qu'ils soient


participent cependant la

de vrit absolue

(pramrthika)
(vi. 4)
n
;

convention
et

(samvrti)

ils

sont

donc trangers aux aspects nya


sort de la contemplation
vrit absolue

antmaka. Lorsque

l'ascte

(vipayan) o sont

raliss les j flnas de

(pramrthika), par

la force de ces

jhnas

se pro-

1. lhag ma rnara pa bcu bzhi can / ston dan bdag med ma gtogs so su [sesam caturdaskram nyntmakavarjitam /] 2. paramrthanimitte paramrthena va dvyatah prmrthike. Bien

qu'ils aient
3.

pour objet

la

chose relle
1.

Voir ci-dessus

p. 10,

13.

28
duisent des

CHAPITRE

VII,

12.

jnnas

postrieurs (prsthajta)
:

'

qui sont de samvrti,

me jtih, usitam brahmacaryam, krtam karaniyam, nparam asmd bhavam prajnmi


de

vrit conventionnelle

ksln

Les deux jnnas de ksaya

et

d'anufpda participent donc


et

la

samvrli (tayoh samvrtibhajanam), non en eux-mmes


tion

par dfini-

(na mnkhyavrtty), mais par


a-t-il

leur coulement (nisyandena).

des aspects (kdra) purs (ansrava) en dehors des seize

aspects ?

12

c-d.

Il

n'y a pas d'aspects purs

(amala) en dehors des


'

seize.

D'autres, d'aprs le Sastra, affirment qu'il y en a.

Les matres du KasmTr disent

qu'il

n'y a pas d'aspects purs en


l'opi-

dehors des seize. Les matres trangers (bhya) maintiennent


nion oppose. [Opinion des

autres matres
1

de

p. 11,

1.

1]

En
1.

raison du Mulasastra
p. 10,
5.

Peut-on distinguer

les

dharmas

Voir ci-dessus

1.

2.

La naissance

est puise

pour moi

c'est--dire

l'origine est
;

abandonne

c'est voir la vrit de l'origine sous quatre aspects (vii. 13 a)

La

vie religieuse
:

est pratique

quatre aspects du chemin


;

Ce qui devait

tre fait est fait

quatre aspects de la destruction

Je ne vois pas d'existence ultrieure

deux

aspects de la vrit de la douleur, impermanence et douleur.

Parmi
i.

les

commentaires de cette formule quatre branches, Samantapasfldika,


je souhaiterais

168.

Des remarques, que


p. 60.
3.

mieux assures, dans

Nirvana

(1925),

med bcu drug gzhan rnam med / gzhan yod ces pa bstan bcos las anityato duhkhatah snyato 'ntmato hetutah samudayatah prabhavatah. pratyayatah asty tat sthanam asty etad vastu yogavihitato
dri

vijnlyt.

[La

VyakhyR explique
I

asty tat

sthanam

ity

asty tal laksanam ity ar-

vijnyd / yogavihitato vijnyd ity arthah] D'aprs l'diteur japonais du Kosa, extrait de VijfiSnakaya, 6, 17, 7, 5. Cette formule et la formule de la vue incorrecte (ci-dessous p. 29, 1. 18) sont rptes satit (avec des variantes) dans le VijnSnakaya, au sujet de multiples sortes de pense Une pense appartenant au Kmadhatu connait-elle 1. les dharmas du Kfima, 2. les dharmas du Rpa, 3. les dharmas de Prpya, 4. les dharmas non inclus aux Dhatus, 5. les dharmas du Kma et du Rpa ... ? . Cette pense est bonne, mauvaise, non dfinie, abandonner par la vue de la douleur, etc.
ity avipartato
:

thah

asty etad vastv ity ayant hetur ity arthah

Hiuan-tsang, xxvi,

fol.

9 a-b.

29

appartenant au Kamadhatu par une pense non incluse aux Dhatus

(apratisamyukta,
savoir on peut

c'est--dire

ansrava)

On peut les distinguer,


comme
y a ce caractre (sthna),

les distinguer tels qu'ils

sont (yogavihitatas),

impermanents, douleur, vides, impersonnels, cause, cause approchante


[9 b], cause prochaine, cause spcificatrice
il
;

il

y a cette cause (vastu).

On

doit

donc considrer

les

aspects spcifis par les expressions

asty tat sthnam, asty etad vastu,


s'ajoutent

comme deux
et

aspects purs qui

aux huit aspects de diihkha


les

de

samudaya.
comprendre

il

D'aprs

matres du Kasmr,

le

Sastra n'enseigne pas l'existence


Il

de deux aspects supplmentaires.

faut

y a

convenance (asty

ayam

yogah) qu'une pense pure distingue ces

dharmas comme impermanents


admissible. Car,
si le

Les matres trangers rpondent que

cette interprtation n'est pas

Sastra employait les termes asty tat sthnam...

sans viser des aspects purs, mais seulement par simple phrasologie,
il

les emploierait aussi


:

dans un passage parallle, savoir lorsqu'il


les

explique

Peut-on distinguer

dharmas

appartenant au

Kama-

dhatu par une pense susceptible d'tre abandonne par la vue des
vrits ?
hat,

Oui, on peut les distinguer, savoir, on s'attache, on

on

s'enorgueillit,

on

erre,

on distingue erronment ces

dharmas
(mithy-

comme

moi, mien (kyadrsti),

comme

ternels, anantissables (anta-

grhadrsti),

comme
dharmas.
le

non-cause,

non-action,

inexistants

La manire dont une pense


la

voit les divers

dharmas dpend

de sa nature et de

nature de ces

pense

Vijnanakya explique la manire dont une dharmas du Kamadhatu. Mais il s'explique sur les penses de Saiksa et d'Asaiksa (qui sont les deux sortes de penses Son texte est identique celui que non-incluses aux Dhatus), xxiii. 9, fol. 30 h. cite Vasuhandhu, avec cette diffrence que la formule asty tat sthvam asty etad vastu est prcde des mots asty eso hetuh (?), asty esa utpda (?). (Aussi
Je ne trouve pas

passage o

le

non incluse aux Dhatus

voit les

27 b

15,

29 b

1,

et passim)

La pense de Saiksa ou d'Asaiksa ne connat les dharmas de Kama que sous pratyayatas) ; la pense les aspects des deux premires vrits (anitya bonne de Kama connat encore les dharmas sous les aspects que Vasubandhu a spcifis (vi. 49 d) comme caractristiques du chemin mondain audrikatas, duhkhilatas, varanatas, et encore alyatas, etc. (fol. 43 b 17).
:

30
drsti),

CHAPITRE vu, 13

a.

comme suprmes, excellents, distingus, suprieurs (drstiparmara), comme purification, dlivrance, salut (slavrataparmarsa), avec anxit, dissentiment, doute (vicikits)
devrait porter les expressions asty tat sthnam...,
fiaient

\ Ce texte
signi-

si celles-ci

seulement asty

ayam yogah,
mien,

dans

le

sens qu'il est fatal qu'une

pense susceptible d'tre abandonne par la vue des vrits considre


les

dharmas comme

comme

moi....

Combien de choses (dravya) constituent


[10 a]

les seize aspects

(akra) ?

13

a.

Les aspects constituent seize choses.

Certains matres disent que les aspects, seize par

le

nom, ne sont

que sept en

fait

(dravyatas). Les quatre aspects de la vrit de la


fait

douleur sont en

distincts les

uns des autres. Les aspects des

autres vrits, sous leur quadruple nom, ne constituent qu'une chose

pour chaque vrit

hetu,

samudaya, prabhava, pratyaya


;

sont

synonymes
1.

et

ne sont qu'un aspect

de

mme

Sakra, Indra, Puram-

tmata tmlyata ucchedatah svatato


sresthato visistatah

'hetuto 'kriyto 'pavdato 'gra-

paramatah uddhito muktito nairynikatah knksto vimatito vicikitsto rajyeta dvisyn manyeta muhyed ayogavihitato
tuit

vijanlyt.

La vue des vrits carte (au moins partiellement) rga dvesa mna moha. Une pense abandonner par la vue des vrits aura rga, etc. le texte dit
;

donc rajyeta,
dre les
drsti,

etc.

Cette pense n'est pas libre de satkyadrsti, donc elle consilibre d' antagrha-

donc

dharmas comme tman et tmya ; elle n'est pas elle considre les dharmas comme destins
fol.

prir

(uccheda) ou

comme On a
2.

ternels (svata)
cette formule Vijfianak&ya

2G b

11,

29 b

6,

42 b

8, et ailleurs.

rdzas su
;

main pa bcu drug go


6, 6.

dravyatah sodakrh.

Vibhasfl,

79, 3

Nanjio 1287,

La

Les kras des Vimoksamukhas, viii. 24. spcification des kras de l'Abbidharma ne se retrouve pas dans l'Abbi(voir par
;

dhamma

exemple Patisambbidamagga, i, 107, 118, 241, Visuddhi, 494) Anguttara, i. 38 (liste de sains), iv. 422 o l'ascte considre l'Amat-dhtu comme sanla, panlta, etc., et les choses de l'tage o il On a vu vi. 49, les kras du se trouve comme dtikkha, roga, ganda, etc. chemin mondain nous aurions d observer que Vasubandhu s'inspire du Vijfiaelle n'est

pas canonique

nakaya,

fol.

59

b,

1.

18 et ailleurs.

Hiuan-tsang, xxvi,
dara sont
les

fol.

9 b-10

b.

31

noms

diffrents

d'une
les

mme

personne. Les asctes

(yoginas) contempleront, part,


douleur, et l'un quelconque
trois autres vrits.
'

quatre aspects de la vrit de la


etc.,

(ekaikam) des aspects hetu,

pour

les

Mais
l'ait,
i.

les
ils

Vaibhsikas soutiennent que

les seize aspects existent


2

en

[car

doivent tre contempls un un].

Pour

la vrit de la

douleur (duhkhasatya)

1.

anitya, impermanent, parce que naissant en dpendance des

causes (pratyaydhmatvdt
2.

= pratyayapratibaddhajanmatvt).

duhkha, douloureux, parce que pnible de sa nature (pdant(vi. 3).

makatvt)
3.

nya,

vide,

en tant qu'en contradiction avec la vue de

mien

(tmyadrstivipaksa).
4.

antmaka, impersonnel, en

tant qu'en

contradiction avec la

vue de
ii.

moi

(tmadrsti).

Pour

la vrit de l'origine

(samudayasatya)

1.

hetu, cause, parce qu'ayant le caractre de la

semence (bja-

dharmayogena).
nyya.
2.

Le hetu

est la cause lointaine.

Le mot yoga

samudaya,

origine, en tant

que produisant (prcidurbhvayo:

gena). C'est la cause prochaine (samnikrsta)

ce dont

un dharma
srie

prend immdiatement naissance (utpadycde) ou origine (samudeti).


3.

prabhava, causation successive, en tant que constituant


tige
...

(prabandhayogena, samtatiyogena) .semence, pousse,


4.

pratyaya, en tant que ralisant un


;

effet
le

en causation conjugue

(abhinispcidanayogena)
co-facteurs (pratyaya)
la cruche (Voir
iii.
ii.

par exemple,

complexe (smagrl) des

terre, bton,

roue, corde, eau, etc.

ralise

64). [10 b]

Pour

la vrit de la destruction

(nirodhasatya)

1.

nirodha, destruction, en raison de l'abolition (ksaya) des skan-

dhas [impurs].
1.

rnm ekaikam
yanti.
2.

duhkhkrm caturah prthag yoginah sammukhknryus, hetvdykity ekyamatam f dravyatah sodaseti vaibhsik varnaDe
ceci
il

rsulte que

Yabhisamaya

est

anuprva,

vi. 27.

32
2.

CHAPITRE

VII,

13

a.

nta, calme, en raison de l'extinction des trois feux, rga,


et

dvesa
3.

moha

(viii.

26

c).

pranlta, excellent, en raison de l'absence de toute peine (niru-

padravatvt) (upadrava
4.

= duhkha).
,

nihsarana,

salvifique

parce que dissoci de toute cause de

peine (sarvpakslaviyuktatvt
tvt).
iv.

=
le

sarvaduhkhakranavimukta-

Pour

la vrit

du chemin (nicrgasatya)
parcourt

1.

mrga, chemin, parce qu'on


'

(gamanrthena)

vers

le

Nirvana.
2.

dire

nyya, raisonnable ou pratique, parce que yogayukta, c'est-upapaUiyukta ou upyayukta, muni de preuves, muni de respratipad, obtention, parce
qu'il fait obtenir

sources ou moyens.
3.

correctement (sa-

myakpratipdanrthena),
vana.
4.

c'est--dire qu'on obtient par lui le Nir-

nairynika,

sortie dfinitive

(atyantam nirynya prahha-

vati), parce
Il
i.

qu'il fait

passer au del d'une manire dfinitive.


:

y a une seconde exgse


1.

anitya, parce que non dfinitif (antyantika).


2

2. 3.

duhkha, parce que semblable un fardeau.


nya, parce que vide de purusa (agent,

etc.).
!

4.
ii.

antmaka, parce que n'obissant pas


1.

la volont.

hetu, parce qu'il y a arrive de l


;

(gamanayogena)
4

la

racine hi signifie gati

hetu signifie hinoty asmt.

Sur le sens de mrga et pratipad, vi. 65 b-d, 66 a, vii. 28 c. abhinysabhfitatvad iti \ bhrabhtatvd ity arthah / duhkhena bharabhtena hi sa pudgalo bhidyate / apakramyata ity arthah. 3. akmakritvd iti j kmatah kartum llam asyeti kmakr / na kmakry akmakr j tadbhvd antm / stre 'py ayant artha uktah /
1.

2.

rpam
varteta

ced bhiksava
/

abhyeta ca rpe evam bhavatv evam

tm abhavisyan na rpam tmavybdhya samma bhd iti kmakry t-

meti (Samyutta, iii. 66, variantes). 4. niruktiparigr aht j hetur gamanayogeneti hi galau hinoty

asmd

iti

hetuh

asmd utpadyata

ity

arthah

Hiuan-tsang, xxvi,
2.

fol.

10

b.

33
:

samudaya, parce
ainsi dire

merge pour
3.

qu'il y a mersion (unmajjana) (umnajjativa) du futur.


'

le

dharma

prabhava, en tant que procession.


pratyaya, en tant que fondement,
3

4.

c'est--dire

lment essentiel

de l'action de gnration.
iii.

1.

nirodha, en raison de

la cessation ultrieur.
4

du duhkha ancien

et

de

la

non continuation en duhkha


2.

snta, parce que dlivr (vimukta) des trois samskrtalaksanas


c).

(ii.

45
3.

pranta, parce que absolument bon (paramrthaiibha)

(iv.

c).

4.

nihsarana, parce que suprmement rassurant

(iv.

b).

iv. 1.

mrga, parce qu'oppos mithymrga.


ville

2. 3.

nyya, parce qu'oppos au non-nyya.


pratipad, parce que non en contradiction avec la
6

du Nir-

vana (nirvnapurvirodhanrthena).
4.

nairynika, parce que

rejetant,

abandonnant

le triple

bhava,

l'existence des trois sphres.

Puisque

les

anciennes explications divergent,


:

il

nous

est

permis de

prsenter une troisime explication


i.

I.

anitya, parce qu'il nat et prit.

2. 3.

duhkha, parce que rpugnant


nya, parce
qu'il

la pense des

ryas

(vi. p.

124).

ne s'y trouve pas d'tman.


ce n'est pas

4.

antmaka, parce que


/

un tman.

1.

unmajjanayogeneti
v.

angatd adhvana unmajjatvety arthah (Com-

parer
2.

27, trad. p. 65).

prasaranayogeneti prabandhayogena. pratisaranrthena pratyaya iti / janikriytn prati pradhnabhta abhipryah.


3. 4. asambandhoparamd iti sambandha uparamo nirodha 5.
/

ity

prvasya duhkhasyoparamt

uttarasy-

ity arthah.

paramsvsakaratvd
vi.

iti

sarvaduhkhocchitty paramaksematvt.

Comp.
6.

60

a.

yasmd anena nirvnapiiram na virudhyate na visamvdyate


/
:

kitn

tarhi pratipadyata evety atah pratipat

pratipadyate 'nayeti krtv. Hiuan-tsang va, entre dans la ville de Nirv&na . Comparer vi. 68 pratipan nirvnapratipdant.
:

34

chapitre

vii,

13

a.

ii. 1. Les quatre aspects de la seconde vrit hetu, samudaya, prabhava et pratyaya, s'expliquent d'aprs le Satra [11 a]: Les cinq updnaskandhas (skandhas impurs, i. 8 a) sont chandamlaka, chandasamudaya, chandajtya, chandaprabhava , c'estsoif) pour racine (mla) -dire ont le chanda (= souhait trsn ou hetu, cause initiale, pour cause qui amne (samudaya), pour
:

cause spcificatrice (chandajtya

= chandapratyaya), pour cause


pratyaya en dernier
lieu, et

prochaine (prabhava)

'.

La
2

seule diffrence entre le Stra et le

Sastra, c'est que celui-ci place l'aspect

non pas

l'aspect

prabhava.

Quelle est la diffrence entre ces quatre sortes de

procession

?
:

A.
1.

On

doit distinguer quatre tats

ou formes (avasth) du chanda


3 ;

asmity abhedena ou tmabhvacchanda


4

2.

sym

ity

abhe-

dena punarbhavacchandah ; 3. ittham sym iti bhedena punarbhavacchandah 4. pratisamdhibandhacchanda ou karmbhi3 ;

1.

Ces explications d'aprs


iti

les gloses et le contexte.

VyfikhyS

chandam-

chantrsnparyya iha chandah. dasamuday iti chandasamutksam (?) ity arthah (lire samutthn ?). chandajtya iti chandapratyaya ity arthah. Paramfirtha traduit jtiya par chng, natre , et prabhava par yeou, bhava ;
lak

chandahetuk

ity arthah.

Hiuan-tsang a respectivement

Iti,
iii.

espce
16
:

et

chng,

natre

.
....

paficupdnakkhandh kimmfdaka chandamlak.. Dans un autre contexte, Anguttara, iv. 400 tanhmlaka. On a Patisambhidfimagga, ii. 111: jarmaranam kimnidnam kimsamudayam kimjtikam kimpabhavam. bhidhrmi2. Vyfikhya prabhavasabdah kevalam pact pathitavyah kaif iti vkhydhyhrah / strnusaranam ht kartavyam ity abhipryah.
Samyutta,
iii.

100,

Majjhima,

Les bhidh&rmikas, dans

la liste

des aspects de cette vrit, devraient placer


;

prabhava aprs l'aspect pratyaya car il faut se rgler sur le Stra. 3. Bhfisya et VyakhyS samastesu pancaspdnaskandhesv asmity abhedena [prakrntaraviistasyapratyutpannasya tmabhvavastuno 'nlambanatas traiyadhviktmabhvnlambanato va tmabhvaprarthan] tmabhvacchandah prathamah. [punarbhavamtraprrthan na viesarp 4. sym ity abhedeneti prrthan iti] dvityah. 5. ittham sym iti [idamprakrah sym iti] bhedena punarbhavacchanl'aspect
:

das

trtiyah.

Hiuan-tsang, xxvi,

fol.

10 b-11

a.

35
qu'on prouve

samskracchanda.
ment
le

'

C'est--dire
:

1.

l'affection
,

pour soi-mme lorsqu'on pense

je

suis

sans distinguer autre;

moi

actuel,

sans penser au moi pass ou futur


;

2. le

dsir de rexistence sans autre spcification

3. le dsir
le

d'une cer-

taine rexistence

4. le dsir

de la rincarnation,

dsir qui fait

accomplir un certain acte.

Le premier chanda

est la cause initiale

(dikrana) de
du fruit
;

la douleur
il

comme la semence nom de hetu.


*

est la cause initiale

reoit le

Le second
de la pousse,

est ce qui
tige,
;

amne
est

la rexistence

comme

la production

etc.,

un processus causal (samudaya) qui


le

amne

le fruit

il

reoit

donc

nom

de

samudaya, cause
etc.,

qui amne.

Le troisime

est la

cause qui dtermine la qualit de la douleur,

comme
vipka,
le

le

champ,
3

l'eau, la
fruit

fumure,
;

dterminent
le

le

vrya,

le

prabhva du

il

reoit

donc

nom

de pratyaya,

cause spcificatrice.

Le quatrime
est la
1.

est la cause dont surgit le fruit


;

comme

la fleur

cause du

fruit

on

le

nomme

donc prabhva.
iti

pratisamdhibandhacchanda caturtha

karmbhisamskrachando

va.

pratisamdhir eva bandhah / pratisamdher eva va bandhah pratisamdhikarmbhisamskrachanj tatra chandah prrthaneti caturthah do va caturthah ... / karmano vbhisamskrah / tatra cchandah j evam caivam ca dnam dsyrnt.

bandhah

2.

Les cinq

updnaskandhas

sont donc dits avoir pour

mla ou hetu

cette

chanda. 3. trtyacchanda ittham sym iti tajjtyaduhkhapratyaya iti / yatprakrah pnnarbhavacchandas tatprakrasya duhkhasya pratyayah sambhavati I tasya viesarpatvd visesarpam phalam utpadyata ity abhipryah / phlasyeva ksetrodakapsydikam iti / psih (?) usko gomayah / diabdena vttapdir grhyate / tato 'pi hi phalasampad iti / viryam stavryat usmavryateti / vipkah usmaparinmat madhuraparinmateti / prabhvah smarthyavisesah tadyathmlatve tuye bjaprakarasah pittam janayati malakarasas tu amayatlti. Sur vrya, vipka et prabhva d'un fruit de la terre comme aliment, ou d'une
sorte de
j /

drogue, Sarvadarsanasamgraha, 16,


4.
:

22,

Kandal, 130, Suruta,

i.

1 et 40.
:

Bhasya tala eva tatsambhavt phlasyeva puspvasnam Vykhya tata eva pratisamdhibandhacchandt pratisamdhibandhasya punarbhavalaksanasya sambhavd utpdt yath puspvasnam phalasya prabhavas tadvat.
I

...

36

CHAPITRE vu, 13

a.

Le quatrime chanda
les trois autres

est la cause

immdiate (sksd dhetuh)

sont des causes mdiates

(pramparyena hetavah).
',

B. Et encore (atha ca), d'aprs le Stra

cinq trsnvicritas

modes de

la soif

, et

il y a deux groupes de deux groupes de quatre,

qui sont respectivement les quatre

chandas

tudis ci-dessus. Les


les

deux premiers chandas sont de cinq aspects,


quatre. [11 b]
a.

deux derniers de

Lorsqu'on pense asmi,


gnral,

je suis , se produit

Vtmabhva-

chanda
tion
,

affection pour sa propre personne sans dtermina:

lequel est quintuple


:

ittham asmi, evam asmi, anyathsmi,


Je suis
;

sad asmi, asad asmi


avant]
;

tel

je suis de

mme

[qu'aupar;

je suis

diffremment

je suis

quelque chose qui est

je suis

quelque chose qui n'est pas.


b.

Lorsqu'on pense bhavisymi,


gnral,
:

je serai

se produit le

punar,

bhavacchanda
lui

soif de rexistence sans dtermination

aussi quintuple

ittham bhavisymi, evam bhavisymi, anyath


:

bhavisymi, sad bhavisymi, asad bhavisymi


serai de
c.

Je serai

tel

je

mme

....

punarbhavacchanda particularis, quadruple sym, ittham sym, evam sym, anyath sym Que je sois
Se produit
le
:

que je sois
d.

tel

que
le

je sois de

mme

que

je sois diffremment.
:

pratisamdhibandhachanda, quadruple api nu sym, apttham sym, apy evam sym, apy anyath syam Il faut absolument que je sois, que je sois tel, de mme, diffremment.
Se produit
:

Paramrtha D'aprs le Stra des trsnvicritas, il y a deux groupes de deux groupes de quatre . Tout ce qui suit jusque p. 37 1. 3 est omis. Notre texte prsente une troite parent avec Anguttara, ii. 212, sur les dix-huit tanhvicaritas, o les lectures sont incertaines, et Vibhanga, 392-400, o elles sont sres mais restent difficiles interprter (Mrs Rhys Davids a eu la grande bont de me communiquer le texte de Sammohavinodan et de Manorathapran,
1.
:

cinq,

voir note p. suivante).

On

Majjhima,

Existai-je dans le pass ? ... , Kosa, iii. 22 c, liste Visuddhimagga, 599, Madhyamakavrtti, 593. D'aprs II trad. 281, chanda est relatif au futur. ganau dvau catuskau catvra 2. trsnvicaritnm dvau pancakau

peut rapprocher la
i.

8,

i,

111,

chanda yathkramam bhavanti prathamacchandah panckrah


j

ka-

Hiuan-tsang, xxvi,
Les premiers chandas sont
douleur
iii.
;

fol.

11 a-12

a.

37
la

la

cause
reste

initiale

(dikarana) de
ci-dessus.
'

ils

sont donc

le hetu....

Le

comme

1.

nirodha, parce que coupure de

la transmigration.

2.

nta, parce que cessation


:

(uparama) de
2

toute douleur, ainsi


;

qu'il est dit

Tous

les

samskras, Bhiksus, sont douleur


.

le seul

Nirvana
3.
4.

est

absolument calme

pranta, parce que sans suprieur (anutlara).

nihsarana, parce que sans retour (avivartya

?).

iv. 1.

mrga, parce que semblable un chemin


vrai.
3

droit.

2.

nydya, parce que


pratipad, parce

[12 a]
exclusif (pratiniyat)
:

3.

que

dtermin ou
et

c'est--dire

on arrive par ce chemin

non par un autre \ comme

il

tham asmti bhiksavah saty tmadrstati satym ittham asmlti bhavati idamprakro 'smlti bhavati tadyogt trsnm utpdayatlty arthah evam asmlti yathprvam eva nnyathety arthah anyathsmti anyena prakI

rena varnabalapratibhndidarsant / sad asmti bhavati \ viparyayd asad asmlti / ayant abhedena pancadhtmabhvacchandah prathamah jj bhavisymlty asya bhavatlti ssvatariipena / na bhavisymlty ucchedarpena I ittham bhavisymti vistarena prvavad vykhynam ity ayant abhedena pancadh punarbhavacchando dvitlyah // sym ity asya bhavati ittham sym evam sym anyath sym ity asya bhavatlty ayant bhedena caturdh punarbhavacchandas trtlyah // api nu sym ity asya bhavati / aplitham sym apy evam sym apy anyath sym ity asya caturdh pratisamdhibandhacchandas caturthah. Le Vibhanga, au lieu de sad asmlti et asad asmlti a 1. as' asmlti (== nicco 'smi ...) et 2. st'asmlti ou saVasmi (= ucchissmi na bhavissmi). Le commentaire dit atthlti asa j niccass' tant adhivacanam. Mrs Rhys Davids remarque as - asa asan asanto mauvais >, Jataka iv. 435 satam va asan (accusatif singulier). On aurait je suis mauvais, je suis bon . La
j
:

Manorathaprani explique sata par sldati dans le sens de anicca : c'est l'explication que nous avons rencontre pour satkya, Kosa, v. p. 16. Serai-je ? . Le commentaire du Vibhanga entend sym 1. L'original est peut-tre pravrttyupacchedt. Sur pravrtti, ii. 6. Peuttre vattpaccheda vartmopaccheda que je pense qu'il faut lire Mahftvastu,

ii.

285,
2.

iii.

200, cit Kosa,

ii.

trad. p. 285, note.

Samyukta, 17, 16. 3. Peut-tre yathbhtavartant. 4. praliniyatatvt pratipad iti / pratiniyat pat katham punah pratiniyat j anayaiva tadgamant.

padanam

pratipat

38
est dit
:

CHAPITRE

VII,

13

a-c.

Ce chemin mne

la puret, les autres

systmes n'y mnent

pas
4.

nairynika, parce que sparant dfinitivement de

la triple

existence (bhava).

[Quatrime explication].
i.

'

En

outre, c'est

pour gurir

les

gens qui nourrissent

les

vues de

nitya, sukha,

tmya et tman que sont de anitya, duhkha, nya, antmaka.


-

tablis les aspects

(kra)

ii.

1.

L'aspect hetu s'oppose la vue


(v. 7, trad. p.

Il

n'y a pas de cause

(nsti hetuh).
2.

18)

L'aspect

soit

samudaya s'oppose svara, soit le pradhna


hetuh).

la

vue
64).

(ii.

La cause est unique La cause est un complexe


:

(samudayo
3.

L'aspect

prabhava
que
3

s'oppose la vue d'volution

(parinma:

drsti),

la thorie

le

bhva, existant d'abord, se transforme

le

bhva commence.
4.

L'aspect

pratyaya s'oppose

la

vue que

le

monde
:

est cr par

un

tre intelligent

(buddhiprvakrtadrsti)

(iv. 1)

les

choses nais4

sent de telles et telles causes, d'une multiplicit de causes.


iii.

1.

L'aspect nirodha s'sppose la vue


.
:

Il

n'y a pas de dli-

vrance
2.
3.

L'aspect nta s'oppose la vue

La

dlivrance est douleur


le

L'aspect pranlta s'oppose la vue que

bonheur des dhynas

et des

sampattis

est excellent (pranlta). (v. 7, trad. p. 18).

1.

Dans son

petit trait,

pour dmontrer que


2.

les aspects sont bien

Samghabhadra prend son compte cette au nombre de seize.


drsti

explication

nitydidrsticaritnm pudgalnm pratipaksena.

sukham tmyam tmeti ca


tmadrsticarith.
3.

Vyfikhya nityam caritam esm ta ime nityasukhatmy:

dibhvo 'yatn na tu prvam avasthitah parinamata


3
;

iti.

Voir

v. 26,

trad. p. 54, n.
4.

iii.

50

a.

nedam
/

svarabiiddhikrtatn jagat
j

bhavatti
iti

vpsrtho hi pratisabdah
et

kim tarhi tattatprattam tat tad tasmd anekapratyayajanitam jagad


/

jnpitam bhavati.
de prattyasamutpda est discut Kosa
?

Le sens de pratyaya

iii.

28,

Hiuan-tsang,
4.

xxvi,

fol.

12

a.

39
la dlivrance est

L'aspect

nihsarana s'oppose

la

vue que

sujette chute, n'est pas dfinitive.


iv.

Les aspects mrga, nyya, pratipad, nairynika, s'opposent


y a un autre chemin, que

respectivement aux vues qu'il n'y a pas de chemin, qu'un faux chemin

(mithy)

est le

chemin,

qu'il

le

chemin

est

sujet chute.

13

b.

Les

aspects

sont praj n.

'

Les aspects, kras, sont de leur nature

le

mental prajh, discer-

nement,

(ii.

24)
s'il

Mais, disons-nous,
discerne les

en est

ainsi, \&

prajn,

la

connaissance qui
la

dharmas, ne sera pas munie des kras, car


Il

prajn

ne peut tre associe (samprayukta) prajn.


de dire
ception
caitta).

est

donc correct
de
per-

avec

les

Sautrantikas

que YJcra est

le

mode

(grahana) des objets par la pense

et les

mentaux

(citta-

Est-ce seulement la

prajh

qui peroit (grah) les caractres (vise-

sa)

(i.

14

c)

des objets ?

13

b-c. Peroit, tout ce qui

a un objet.

La praj fia
lamba)
'

et tous les

autres

dharmas

qui ont un objet

(s-

peroivent.
:

rnara pa ses rab dan bcas pahi / dmigs dan bcas pas hdzin par byed 1. 13 b-d yod pa thams cad gzun bya yin. Sur kra, ii. 34 b-d, trad. p. 176, note 5.
2.

evam

lu

yuktam syd

iti

sautrntikamatam

lambanagrahanapraprajn

kra krah.
Cette explication est satisfaisante, car on conoit bien que la

la con-

naissance discernante
certaine manire
cette explication rend

(ii.

24)

prenne les

aspects

c'est--dire saisisse d'une

(comme impermanentes, etc.) les choses (lambana). En outre compte du mot kra On prend lambana le son ; on prend prakra la finale kra, et on a kra en supprimant -lambanagrahanapra3. slamb iti / lambety krantam etac chabdarpam ghanantatn va lamba iti / sahlambay sahlambena va vartante slambh slamban
:

ity arthah.

Sur

les

dharmas

qui ont un objet

Kosa,

ii.

34

b.

Kathavatthu,

ix.

3-7

Vibhanga, 428, Dhammasangani, 1185, 1508.


:

La Madhyamakavrtti,
cittacaitth.

84, cite

Pgama slamban dharmh katame sarve


/

40

CHAPITRE

VII,

13 d-15

c.

13

d.

Est objet de perception tout ce qui existe.


existe est peru [12 b] par les

Tout ce qui
objet
.

dharmas
:

qui ont

un

On a donc
kra,

trois catgories plus


;

ou moins larges

1.

l&prajfl

est

sujet, objet

2. les

autres cittas-caittas, qui sont associs


;

la prajti, sont sujet et objet

3.

tous les autres


'

dharmas, condi-

tionns ou inconditionns, sont seulement objet.

Nous avons

expliqu les aspects des dix j flnas,

il

faut expliquer

leur nature, la terre qui leur sert de point d'appui (bhmi), la per-

sonne (sraya) dans laquelle

ils

naissent.
s

14

a.

Le premier

est de trois natures, les autres sont bons.

Le premier,
est

c'est--dire le lokasamvrtij flna, parce


(vii.

que ce jhna

nomm

d'abord dans la Karika


dfini.

2 b)

3
,

est de trois sortes, bon,

mauvais, non

Les autres neuf j flnas sont seulement bons.


les terres.
*

14

b.

Le premier, dans toutes


toutes les terres, du

Dans

Kamadhatu jusqu'au bhavgra (naiva-

samjnnsamjflyatana).

14

c.

Dans

six, le

jnna dnomm dharma.


est

Le dharmajnna

obtenu dans ou par

les

quatre dhynas,

Yangamya
1.

et le

dhynntara.

Vibhfisa, 39,
;

10.

Trois systmes

1.

La prajti

est

kra, grhaka,
et

grhya
2. 3.

les cittacaittas associs

la

prajti sont

grhaka

grhya

ce qui

est concomitant (sahabhil) la prajti et ce qui est

cittaviprayukta est grhya.

et

Tout citta-caitta est kra, grhaka, grhya ; tout autre dharma est grhya. Tout dharma est kra les dharmas samprayukta sont kra, grhaka grhya ; les viprayuktas sont kra et grhya (Le sens de kra est ici tout
;

diffrent).
2. 3.
4. 5.

dan po rnam gsum gzhan rnams dge == dyam [tridhnyni kusalni]. Dans le Sstra, c'est le dharmajnna qui ouvre la liste. dan po sa rnams thams cad na [dyam sarvabhmisu]
drug na chos ces bya

= = dharmkhyam satsu.

'

Hiuan-tsang, xxvi,

fol.

12 a-13

a.

41

14

c-d.

Dans

neuf, celui qu'on appelle


est

anvaya.

'

U anvayajnna
dites, et,

obtenu dans

les six terres qui

viennent d'tre

en outre, dans trois rpyas. Six jnnas, de

14

d.

mme.

Six j finas, duhkha,

samadaya, nirodha, mrga, ksaya, anutdu dharmajina,


ils

pda, lorsqu'on
terres
;

les

considre d'ensemble, sont obtenus dans neuf


sont obtenus dans
ils

lorsqu'ils font partie


;

six terres

lorsqu'ils font partie de


terres.

Yanvayajnna,

sont obtenus

dans neuf

15

a.

Le paracittaj hna, dans


n'est

les

quatre dhynas.
les

Le paracttajnna

obtenu que dans

quatre dhynas, et

non pas

ailleurs.

15

b. Il

a pour point d'appui une personne du

Kama

et

du Rpa.

Les tres du

Kama

et

du Ropa ralisent (sammukhbhva)

le

paracttajnna.

15
1.

c.

Le dharmajina, une personne du Kama.


/

"

2.
8.

bya = [navasti tv anvaykhyam] = [tathaiva sat gzhan yid ses bsam gtan bzhi na [caturdhyne paramanojnnam] dgu na
rjes ses

de bzhin drug

//]

4. 5.

de ni hdod dan gzugs rten can chos ces bya ba hdod rten can

[kmsrayam tu dharmkhyam] On entend bien que des tres ns dans l'Arpya ne puissent actualiser le dharmajnna qui a pour objet la douleur, l'origine, etc. du Kama. Mais pourquoi les tres ns dans
le

Rpa en
:

sont-ils incapables ?

Nous avons vu qu'un

dhynas (qui sont du Rpa) (vii. 14 c). Quelques-uns disent Le dharmajnna a pour fin la dtestation (vidsan) du Kama or une personne ne dans le Rpa a abandonn le Kama par le fait mme qu'elle a transmigr dans une terre de dtachement [du Kama] (vairgyabhtlmisamcrt) ; le dharmajnna n'a donc pas natre. Autre le cas d'un homme < dtach du Kama (vtarga) [et entr en dhyna grce ce dtachement] il peut actualiser le dharmajnna parce que son existence dans le Kama n'est pas puise (kmadhtnpapatteh svasesatvt). Samghabhadra explique autrement pourquoi le dharmajnna ne peut tre actualis que par des tres du Kamadhatu tatsampattivyutthnacittnm kmadhtv
actualise ce jrina en entrant dans les
; : :

homme

42

CHAPITRE

VII,

15 d-17

c.

Le dharmajnna ne peut

tre ralis

que par une personne du

Kamadhatu, non par une personne du Ropa ou de l'rupya.

15

d.

Les autres,

les

personnes des

trois sphres.

'

Quels sont

les autres

jfinas ? Les huit jfinas qui restent quand


et le

on a cart

le

paracittajfina

dharmajnna.

Nous avons
nas,
et

expliqu les terres par lesquelles on acquiert les jnles

la sphre laquelle appartiennent

personnes qui peuvent

acqurir les jfinas. Expliquons la relation des jfinas et des quatre

smrtyupasthnas

(vi. 15).

16

a.

Le nirodhajfina
est le

est

un smrtynpasthna.

Le nirodhajfina
1

dharmasmrtyupasthna.
est trois.

b.

Le paracittaj fina

Le paracittajfina, portant sur

la

pense d'autrui, porte ncessai-

rement sur vedan, samjh, samskras.

16
En

c.

Les autres, quatre.


le

excluant

nirodhajfina

et

le

paracittajfina, les autres

eva sadbhvt / anuparivartaksraybhvd va / dharmajnnnuparivartakasya ht llasya kmvacarny eva bhtny raya dauhlyasamutthpakakleaprptivibandhakatvt prtipaksikatvt / tant ca taira na santi i dharmajnnam kmadhatvarayam eva : Parce que c'est seulement dans Je Kama que sont possibles les penses de sortie du recueillement [o on ralise
le

dharmajnna] ou
;

quent

les

encore parce que, dans les deux sphres suprieures, manlments (bhUtas) qui peuvent servir de support (raya) cette
le

espce de moralit (lla) qui accompagne ncessairement


l'immoralit n'existe que dans le
la moralit qui s'y
1.

dharmajnna.
;

Cette moralit est oppose aux klesas qui produisent l'immoralit (dauhsilya)

Kama

les

lments susceptibles de supporter


le

oppose n'existent donc que dans


j
i

Kama.

[anyat dhtutrayrayam] gzhan 2. hgog blo dran pa ner gzhag pa / gcig ste plia roi sems blo ni / gsum rao lhag ma bzhi yin no [smrtyupasthnam ekam nirodhadhh paracittadhlh / trini

khams gsum pa

rten can

sesni catvri] (Ordre des mots de Paramartha).

Hiuan-tsang,

xxvi,

fol.

13 a-b.

43

huit jnnas ont pour nature les quatre smrtyupasthnas. [Le duh-

khajnna, en
pasthna].

effet,

porte quelquefois sur

le

corps
',

....

le

mrga-

j flna, lorsqu'il a pour objet Y ansravasamvara

est

kyasmrtyu-

De combien de j flnas

les diffrents

jnnas

sont-ils l'objet ?
2

16
En

d.

Neuf jnnas sont

l'objet

du dharmajnna.

excluant Yanvayajfina.
a.

17

Neuf sont
le

l'objet de

Yanvaya

et

du mrgaj fina.
;

En excluant
en excluant
parce
qu'il
le

dharmajhna

en ce qui regarde Yanvayajfina


le

lokasamvrtij fina en ce qui regarde


fait

mrgajfina,

ne

pas partie du chemin [13


l'objet

b].

17

b.

Deux sont

du duhkha
et la partie

et

du samudayaj flna.
est im-

Le lokasamvrtij fina

du paraciUajfina qui
et

pure (ssrava), sont objet du

duhkha

du samudayaj fina.

17

c.

Dix, de quatre.

Les dix jnnas an utpdaj fina.

sont l'objet des lokasamvrti, paracitta,

ksaya

et

17

c.

Aucun

n'est l'objet d'un.

Aucun jfina
est le

n'est l'objet

du nirodhaj flna dont

le seul objet

pratisamkhynirodha.
l'objet des dix

Combien de dharmas constituent dans l'ensemble


jfinas ? Combien de

dharmas

constituent l'objet de chaque j hna?^

1.

Voir

iv.

13

c.

chos blohi spyod yul dgu y in no // lam rjes blo yi dgn yin no / sdug bsnal rgyu blo gnis yin no / bzhi yi bcu yin gcig gi min [dharmadhgocaro nava //
2.

nava mrgnvayadhiyor duhkhahetudhiyor dvayam caturnnt daa nai/

kasya] B. Ce prambule manque dans Paramartha.

44
17
d.

CHAPITRE vu, 17 d-18.

Leur

objet,

dans l'ensemble,

est dix

dharmas.

Quels sont ces dix sortes de

dharmas ?
dharmas
purs, asamskrtas,

18

a-b.

Dharmas

des trois sphres,


2

chaque catgorie tant double.

Les samskrtadharmas se divisent en huit classes

Kamadhatu, de Rpadhatu, d'rpyadhatu, plus


les

les

dharmas de dharmas purs,


:

uns

et les autres associs


(ii.

la

pense ou dissocis de la pense

(samprayukta, viprayiikta)
(avykrta).
3

22).

Les asamskrtadharmas se divisent en deux


et non-dfini

classes,

bon (kusala)

Quelles de ces dix classes de


1.

dharmas

sont l'objet des dix

jnnas

Le lokasamvrtij nna porte sur


porte sur cinq
la
:

les dix

dharmas

2. le

dhar-

maj nna

deux dharmas de Kamadhatu, associs

ou dissocis de

pense
4
;

deux

dharmas

purs (Chemin), associs ou


;

dissocis de la pense

bon asamskrta

3.

Yanvayajnna
et le

porte
fait

sur sept

deux de Rflpadhatu, deux d'rpya, deux purs, ce qui

six [14 a], et le

bon asamskrta
six
:

4-5. le

duhkhajnna
7. le

samu-

dayaj nna portent sur


porte sur les deux
trois
:

deux de chaque dhtu;

6. le

nirodha-

j flna porte seulement sur

le

bon asamskrta
purs
;

mrgaj flna

dharmas

8.

leparacittajnna porte sur

les

dharmas
;

associs la pense qui sont de

Kamadhatu, de

Rpadhatu, purs

9-10. le

ksayajfina

et

Yanutpadajfina portent

sur neuf dharmas, en exceptant Yasamskrta non-dfini.

1.

D'aprs Hiuan-tsang.
:

Paramftrtha traduit littralement l'original qui est

rendu en tibtain par


tre
il

chos bcu
et
il

dag ni sbyar bar bya


:

mis en rapport

ajoute le bhasya

: Dix dharmas doivent Pour dterminer l'objet des jnnas,

faut tablir la relation des dix

jnnas avec
/

dix sortes de

dharmas. Quels sont

dharmas ? hdus ma byas 2. khams gsum pa dan dri med chos [traidhtukmal dharm asamskrta dvidh dvidh
ces dix sortes de
3.

[rnams] gnis gnis so


/]

D'une part

le

pratisamkhynirodha ou Nirvana,
;

d'autre part l'apratisam-

khynirodha et Yka. 4. Le marge dharmajnna porte sur le Chemin moralit qui est ansravasamvara, c'est--dire rpa

fait

partie du
c).

chemin

la

(iv.

13

Hinan-tsang, xxvi,

fol.

13 b-14

a.

45
?
'

Peut-on, par un seul j flna, connatre tous les

dharmas

Non.
le

Cependant

18
reste

Un samvrtijnna, comme non-soi.


c-d.
-

en exceptant son complexe, connat

Lorsqu'un

moment
un

de samvrtijnna connat tous les

dharmas
le

comme

n'tant pas
1.

soi

c'est en exceptant, dans la totalit des

dharmas,
bhedt)
car
ils
1

soi-mme, ce

mme moment

de samvrtijnna, car

sujet de la connaissance ne peut tre son propre objet (visayivisaya;

2.
le

les

dharmas mentaux
objet que lui

(caittas) qui lui sont associs,


;

ont

mme
:

(eklambanatvt)

3.

les

dharmas

1.

Hiuan-tsang

a-t-il

dharmas ? Le na syt.

texte porte

un moment de savoir qui prenne pour objet tous les syd ekena jnnena sarvn dharmn jnyt /
:

Ceci parat tre le dbut de la discussion Vibbasa,

9, 8, cite

par Kiokuga Saeki

a-t-il

un jnna qui connaisse tous

les

dharmas
tman,
;

Non. Le jnna qui


que ce jnna
ne
qui

connat que tous les connat pas ?


lui

dharmas ne

sont pas

qu'est-ce

Il

ne se connat pas soi-mme

il

ne connat pas les

dharmas

sont associs ou coexistants.

En
;

disant qu'il ne se connat pas soi-mme, on

Mahasamgbikas en disant qu'il ne connat pas les dharmas associs, on rfute la thse des Dharmaguptas (fa-m-pou) en disant qu'il ne connat pas les dharmas coexistants, on rfute la thse des Mabssakas en
rfute la thse des
;

disant que
la

le

jnna

connat, on rfute la thse des Vatslputriyas [qui attribuent

connaissance au Pudgala (??)]. Comparer Kathavatlhu, v. 9, o les Andhakas tirent parti d'un texte: sabbasankhresu aniccato ditthesu tatn pi iinam aniccato ditfham hoti. La Vyakhya cite le Stra ihsmkam bho gautama upasthnalym samnisannnm samnipatitnm evamrpo 'ntarka hsamudhro 'bht I ramano gautamah kilaivam ha j nsti sa kascic chramano va brhmano va yahsakrt sarvam jnyt sarvam payed iti j iathyam idatn bho gautama j 2. kun rdzob gcig pus ran tbsogs las / gzhan ni bdag med nid rig hgyur. 3. svtmani vrttinirodht / na hi saivsidhr tayaiva cchidyate. BodhicarySvat&ra, ix. 18 na ccbinatti yatbatmnam asidbr tath manah.
:

la

Lieu

commun

de

la

philosophie indienne

toutefois les Sautrntikas-VijnanavaJins

diront que la lampe s'claire elle-mme.

Par une curieuse contradiction,


le

les

Yaibhasikas qui nient que


qu'elle est prsente
4.

la

pense se connaisse elle-mme, admettent que

sensation (vedan) est sentie non par une autre sensation, mais par
(iv. 49).

seul fait

atisamnikrstatvd

iti

caksuso 'njaniijanas'alkdaranavat.

46

CHAPITRE

VII,

18 c-19

b.

dissocis de la pense (viprayukta) qui l'accompagnent (sahabh),

par exemple ses laksanas

(ii.

45

c),

car

ils

sont trop proches.

Ce samvrtijfina de connaissance universelle appartient seulement au Kamadhatu (= tac ca kmadhtvavacaram


144), [14 b]
eva), tant
vi. trad.

prajfi d'audition ou de rflexion (rutamayi, cintmayi,


p.

non pas prajn de recueillement (bhvanmay)


b].

(iv. p.

123

c)

[14

Le samvrtijfina qui

est de cette troisime sorte


S'il

de prajn, a toujours pour objet une terre dtermine.

en

tait

autrement on pourrait obtenir en


l'endroit de toutes les terres.
'

mme

temps

le

dtachement

1.

D'aprs Hiuan-tsang.
) et

Paramfirtha omet

la dernire

phrase

( S'il
il

en

tait

autrement

traduit
;

Quand

il

est

prajn

est seulement quand il est non de recueillement, car cette dernire sorte de prajn a toujours pour objet une terre dtermine. Vasubandhu suit Nanjio, 1287 (10, 14): Ce jnna est prajn d'audition, de car la prajn de recueillement a un objet rflexion, non pas de recueillement

d'audition et de rflexion
d'audition,

jnna du Kamadhatu jnna du Rupadhatu, il

est

prajn

dlimit

.
:

yasmd bhvabhmim lambate kmadhtum va prathamam va dhynam yvad bhavgram va / kim kranam nantaryavimuktimrgnm adharottarabhmylambavatvd yathoktam yathkramam ntdyudrdykr uttardharagoVyakhyfi

tasya vyavacchinnabhmylambanatvd

iti

nmayam rpvacaram samvrtijnnamvyavacchinnm


I /

eva

cara

yadi ca tat sarvabhumylambanant syt sarvato iti vacant (vi. 49) yugapad vairgyam syt prayogaviesamrgayor yathsambhavam k nirvedhabhgiyaprayogamrgakalham cid eva bhmir lambanam samgrhltasya hi yasya kmadhtur lambanam na tasyetarau dht yasyetarau dht na tasya kmadhtur lambanam asubhpramnbhibhvyatandividsanaviesamrgasamgrhtusya kmadhtur evlamba/
/

natn netarau dht.


D'aprs Yasomilra, interprte fidle de Vasubandhu qui est, sur ce point, approuv par Samghabhadra, c'est seulement par une prajn de recueillement (bhvan) qu'on obtient le dtachement (vairgya). h&prajfi d'audition et de rflexion, qui est du Kamadhatu, porte en vain sur les dharmas de toutes les
la prajn de bhvan est plus puissante Vasubandhu conclut que la connaissance universelle de l'absence de soi des dharmas appartient au Kamadhatu, car, appartenant au Rupadhatu (c'est--dire tant de bhvan, tant obtenue dans les dhynas) elle produirait le dtachement de toutes les terres. Samghabhadra conteste ce raisonnement, car la prajn pratique dans les dhynas (prajn impure, puis-

terres

elle

ne

suffit

pas en dgoter

(iv.

123 c).

De

ce principe,

Hiuan-tsang, xxvi,

fol.

14

a-b.

47

De combien de jnnas sont munies d'hommes ?


Le Prthagjana possde seulement
est
le

les

diffrentes catgories

lokasamvrtijndna

lorsqu'il

dtach

[du

Kamadhatu] (virakta ou vtarga),


Quant l'rya,
au premier moment pur,
il

il

possde

aussi le paracittajnna.

19

a-b.
x

Non

dtach,

possde un

jhna.

L'rya qui ne
d'entrer dans le

s'est

pas dtach par

le

chemin mondain avant


la

Chemin, au moment o nat


c),

duhkhe dharmajnlokasamvrtijnna,

naksnti
parce que

(vi.

25

possde un seul jnna,

le

la

ksnti

(vii. 1) n'est

pas jnna.
dgot de
la terre

qu'il s'agit

de samvrtijnna) ne comporte jamais


(vi.

le

suprieure

celle dont on veut se dlivrer

49).
:

Notons ici que Hiuan-tsang traduit les deux p&das 18 c-d par trois pfidas Le samvrtijnna, en excluant son groupe > ensemble a pour objet tous les dharmas en les comprenant sous l'aspect de non-soi , et ajoute un quatrime

pada il est fait d'audition et de rflexion . Samghabhadra, dans son second trait (Nanjio, 1266), corrige les Kfirikas o Vasubandhu s'carte de la saine doctrine Vaibhasika la version de Hiuan-tsang
:
;

(xxiii. 8, fol.

69 b) donne, au quatrime pfida


.

Il

est fait d'audition, de rflexion

el

de mditation

Samghabhadra pense, en effet (xxiii. 6, fol. 56 b, premier trait) Ce jnna est seulement du Kamadhatu et du Rpadhatu, non de l'rpyadhatu,... Il est prajn d'audition, de rflexion, de recueillement (bhvan) car ces trois prajns sont capables d'avoir pour objet tous les dharmas l'exclusion d'ellesmmes et de leur groupe . Il est vrai que le SautrSntika ( Vasubandhu) dit Mais cela est faux. Dans Ce jnna n'est pas prajn de recueillement notre systme la prajn de recueillement du domaine des dhynas prend
:

pour dbjet

la terre

o on se trouve,

la

terre suprieure

elle

produit dgot
:

l'gard de la terre infrieure, joie l'gard de la terre suprieure

donc

elle

ne

produit pas dtachement l'gard de la terre suprieure. L'argument du Sautrantika est donc nul.
Il

semble que, d'aprs ce que

dit ici

Yaomitra, nous devions considrer

comme

viesamrga (vi. 65) la dtestation (vidsan) que comportent [les qualits, guna, savoir] Yaubh (vi. 9), les apramnas (viii. 29) et les abhibhvyaToutes ces qualits sont des viesa (v. 10 a, trad. p. 27) tanas (viii. 35 a). elles sont acquises par prayoga, nantarya, vimuktimrgas, et se prolongent en viesamrgas (vi. 65) voir vii. 25 d. ekajnnn1. zag med skad cig dan po la / chags can es pa gcig dan ldan

vito

rgi prathamnsravaksane

48

CHAPITRE VU, 19 c-20

c.

19

c.

Au

second moment,

il

possde trois jnnas.


il

'

Au moment du duhkhe dharmajnna,


jnna, dharmajnna, duhkhajnna.

possde lokasamvrti-

19

c-d.

Au

del,

quatre moments, s'ajoute chaque

fois

un jnna?
chaque

Au
fois

del du deuxime
;

moment, quatre moments,

s'ajoute

un jnna

au quatrime moment {duhkhe 'nvayajnna), Yan-

vayajhna ; au sixime (samudaye dharmajnna), le samudayajhna au dixime (nirodhe dharmajnna), le nirodhajnna ; au


;

quatorzime (marge dharmajnna),


5

le

mrgajnna.
l'ascte pos-

Par consquent, parvenu au marge dharmajnna,


sde sept

jnnas.

Pour l'rya

qui,

avant d'entrer dans


le

le
le

chemin pur (daranail

mrga), a obtenu

dtachement par

chemin mondain,
(vi.

faut

ajouter le paracittajnna.

L'Arhat samayavimukta
le
4

50, 56)

possde neuf jnnas, en ajoutant

vimukta possde en outre


Combien de jnnas
les diffrents stades,

ksayajhna ; l'Arhat asamayaYanutpdajnna. (vi. 50) [15 a]


5

l'ascte cultive-t-il (acquiert-il)


la

la fois

dans

daranamrga, chemin de
mditation, etc. ?
(vi.

vue des vrits,

bhvanmrga, chemin de

En ce mrga
:

qui concerne les quinze penses

28

c-d)

du darana-

1.

gnis pa la

gsum ss
ni
//]
:

dvitlye tribhih.

yan chad kavardhitaih


2.

bzhi la re re hphel dan ldan

= [rdhvam tu] catursv [ekai,

Dans les stades ou moments qui ne comportent pas d'augmendu nombre des jnnas (3 me 5 me 7 me 8 me 9 me ll rae 12 me 13 me 15 me moments de V abhisamaya), il possde les jnnas du dernier moment antrieur qui comporte augmentation. Donc, au dbut du bhvanmrga (16 me moment), il
3.

Hiuan-tsang

tation

possde ncessairement sept j flnas.


4.

Cette dernire phrase est ajoute par Hiuan-tsang.

iha dvividh bhvandhikrt pratilambhabhvan nisevapratilambhabhvan prptitah j nisevanabhvan sam/ mnlihbhvatah. Culture s'entend ici d'acquisition ou prise de possession,
5.

Vyfikhya

nabhvan ca

et d'actualisation. (Voir

vii.

27)

'

Hiuan-tsang, xxvi,

fol.

14 b-15
et les

a.

49
futurs sont

20

a-c.

Dans

le

darana,

les

ksntis

jnnas

acquis mesure

et tels qu'ils

sont produits.

Ceux qui sont produits ou


ou

actualiss

(sammukhbhta) sont acquis


l'ascte produit la

cultivs (bhvita).

Par exemple, quand


il

duhkhe dharmajnnaksnti,
espce (tajjtlya),
il

cultive la future ksnti de

prend possession de la future ksnti de

mme mme
2

espce. [Et ainsi de suite jusqu' la

marge 'nvayajnnaksnt].

Sont aussi acquis

les

quatre aspects (kras) de cette ksnti (imper-

manence,

etc.)

lorsqu'un quelconque des aspects est produit.


le

Pourquoi, dans
sition des

jnnas
3

et

darana, y a-t-il seulement culture ou acquides kras de l'espce du jnna et des kras

produits ?

Lorsqu'est produite la
c'est--dire la

duhkhe dharmajnnaksnti,
la cause

le

gotra

semence ou
)

de cette ksnti, et les gotras

de ses quatre kras sont pris (pratilabdha) \ Tandis que les gotras
des

duhkhe dharmajnna,
les
ils

etc.,

ne sont pas

pris.

Quant aux

kras, on voit que

quatre kras de chaque vrit sont de

mme
:

espce (sabhga), car

ont un

mme

objet

(tulylambanat)

lorsqu'un d'eux est actualis, produit (sammukhbhta), les gotras


des autres sont pris.

mthon babi lam la bzod pa dan / ses pa ji ltar skyes pa rnams / ma bons pa yathotpannni bhvyante ksntijnnni darane / [angatni] yathotpannni bhvyante yni yny utpannni tant tni bhvyante (bhvyante bhvanm gacchanti). bhvyante signifie sont acquis , puisqu'il s'agit de ksntis et jnnas futurs. 2. La ksnti ou le jfina produits sont sabhgahetu (ii. 52 a) cause dont
1.

hthob

.l'effet lui est


3.

semblable

de

la

ksnti

et

du jfina futurs de mme espce.

kasmt sabhgajnnabhvan sabhgkrabhvan ca daranamrga eva bhavati na bhvanmrge.


La question ne porte pas sur
le

les

ksntis parce

qu'il n'y

a pas de ksn'is dans

bhvanmrga. Vyakhya bhvanmrge tupunah sarvesm jfinnm sabhgavisabhgnm tadkrnm ca sammiikhbhvt sarvesm hetavo labdh bhavantlti tadvisist jnnkr bhvanm gacchan y angath
:

4.

Ci-dessous

p. 64.

50

CHAPITRE

VII,

20 c-21

b.

20

c-d.

Dans

le

chemin de vue on acquiert aussi

le

samvrtijnna

au moment de

trois

anvayajnnas.

'

trois

samvrtijnna futur au moment des anvayajnnas de la douleur, de l'origine et de la destruction (moments 4, 8 et 12 du darsanamrga, vi. 26 b) non pas au moment des dharmajhnas, parce que, aux dharmaj flnas, chaque vrit
L'ascte prend possession du
:

n'a pas t comprise dans son ensemble, mais seulement relative-

ment au Kamadhatu.

21

a.

Ce samvrtijnna

est

nomm

fin

d'abhisamaya

On

le

nomme abhisamayntika jhna,

parce qu'il est cultiv


vrit.

(=

acquis) la fin de la comprhension de

chaque

Pourquoi l'ascte n'en prend-il pas possession au moment du

marge 'nvayajnna (seizime moment moment du bhvanmrga) ? [15 b]


a.

de Yabhisamaya, premier

Parce que

le

Chemin (mrga)
3

n'a pas t compris (abhisamita)


les

auparavant, par un chemin mondain, sous

aspects de

mrga,

nyya,
b.

etc.

(ci-dessus p. 32).
le

Parce que
de nid la
//

Chemin
gsum

n'est pas susceptible d'tre

compris dans

1.

rjes

la ni

kun rdzob kyaii

= [tatraiva]

smvrtam cn-

vayatraye
[

Le daranamrga est tout pur (ansrava) et l'ascte qui le pratique ne un samvrtijnna. Mais il prend possession aux moments 4, 8 et 12 du samvrtijnna relatif chaque vrit sortant du chemin de vue, il possde, et pourra actualiser, une connaissance mondaine (smvrta,
produit pas en cours de route
:

laukika) des vrits, laquelle est dite prsthalabdha, voir vii. 2 b]. 2. de phyir union rtogs mthah zhes bya [tato 'bhisamayantkhyam] [On a vu ci-dessus (vii. 7, p. 10 n. 4) que les patiences se produisant au

cours de l'abhisamaya, sont

nommes abhisamayntika]
:

abhisamayntikam xxii. 2, 44 a 14) kualamlam (traduit mnonpar rtogs pahi lam mthah las hbyun ba et mnon par rtogs pahi hjug pa las hbyun ba = abhisamayamrga-ana-udbhava,
Mahavyutpatti, 54, 20 (Vibhasa, Tokio,

abhisamaya-avatra-udbhava),

suivi de 54, 21

lamlam
(vii.

= racines de biens (ou qualits) obtenues


;

ksayajnnalbhkam kuaau moment du ksayajnna

26

c)

et 245, 486.

3.

Au

contraire, tout

et destruction

par

le

homme, au cours du samsara, a compris douleur, origine chemin mondain (Vyakhya).

Hiuan-tsang, xxvi,
son entiret (krtsna). La douleur,
tre respectivement connue,

fol.

15 a-b.

51

l'origine, la destruction

peuvent

abandonne, ralise (skstkrta), dans


tre pratiqu

leur entiret

mais

le

Chemin ne peut
dans son
le

(bhvita

sammukhikrta,
la
il

actualis)

entiret.

Sans doute, d'une


dire que,

personne qui se trouve dans


fin

daranamrga, on ne peut
l'origine,

de la comprhension des vrits d'origine et de destruction,

ait

pour

elle

complet abandon de
' :

complte ralisation
et des-

de la destruction

cependant un temps viendra o abandon

truction seront complets.

Mais

il

n'en va pas de

mme du Chemin,

tant donne la diversit des familles (gotra) de Sravaka, Pratyeka-

buddha, Bouddha.

Quelques-uns disent
2
.

Parce que

le

samvrtijnna accompagne

le

daranamrga Or le seizime moment de la comprhension (marge 'nvayajnna) fait partie du bhvandmrga 3 Donc on Disons n'acquiert pas Y abhisamayntika au seizime moment.
.

que que

cet
le

argument ne porte pas, car on ne

doit pas tenir


le

comme prouv
4

samvrtijnna n'accompagne pas


b. Il est

bhvanmrga.

21

non destin
il

natre.

aucun moment

n'y a pour lui possibilit de natre.

Ce jnna ne

nat ni

quand

l'ascte est en contemplation, ni

quand

l'ascte est sorti de

contemplation

(=

vue des

vrits).

D'une part ce
p.

jnna
sire.
1.
6

est incompatible

avec la contemplation (voir ci-dessus

46)

d'autre part la pense, en dehors de la contemplation, est trop gros-

En

effet l'origine doit

encore tre abandonne par la vue de la destruction et

du chemin,

et

encore par

parfaitement connue (parijnta) par la vue de la douleur.


dj abandonne l'origine

chemin de bhvan, tandis que toute douleur est Mais se trouve qui peut tre abandonne par la vue de l'origine.
le

(Traduction du Paramartha).
2.
3.

darsanamrgaparivratvt.
Les Vaibhsikas pensent que
(vi.

le

seizime

moment

appartient au

bhvan'pi

mrga
4.

28

c)

d'autres coles le rattachent

au daranamrga.

sdhyatvd ajnpakam.
(Vyakhya).

vayam

hi

bhvanmrgaparivro

tad

iti

brmah

5.
6.

tad anutpattidharmakam / Ce paragraphe manque dans Hiuan-tsang. La Vyakhy fournit une explide ni mi skyehi chos eau yin

52
S'il

CHAPITRE en est
ainsi,

VII,

21 b-d.

samvrtijnna, que
maintenant

comment peut-on dire qu'on prend possession du le samvrtijnna est cultiv (bhvita) ?
' '
:

Le Sarvastivdin rpond
il

Auparavant

il

n'tait

pas acquis (labdha),

est acquis.

Comment

peut-il tre acquis, puisqu'il


:

ne se produit pas ?

Le
Vous
'.

Sarvastivdin rpond

Il

est dit

acquis parce qu'il est acquis, [et

non pas parce

qu'il devrait se produire].


,

Acquis parce qu'acquis

cette
le

manire de dire

est inoue.
'

n'expliquez donc pas

comment

samvrtijnna

est

cultiv

Ce

point doit tre entendu,

comme

l'entendent les anciens matres, [c'est-

-dire les Sautrntikas].

D'aprs ces matres, on

cultive

ou acquiert

le

samvrtijnna
est

par la force de l'ryamrga


sorti

(= darsanamrga).
est

Aprs qu'on

de la contemplation de l'ryamrga,

ralis,
les

actualis
et

(sammukhbhva), un samvrtijnna portant sur


beaucoup plus distingu (visistatara) que
tion de l'ryamrga.

vrits,

celui qui prcdait l'obten-

jnna

par

le

Quand on dit que l'ascte acquiert ce samvrtidaranamrga, on entend parler de l'acquisition d'une
'

personnalit (sraya) capable de la ralisation de ce samvrtijnna.

Comme
que
le

l'acquisition de minerai d'or est dite acquisition d'or. [16 a]

Les Vaibhasikas n'acceptent pas cette manire de

voir. Ils tiennent

samvrtijnna
c.

dit

abhisamayntika

est
3

anutpattidharmaka.

21

De

la terre

ou d'une
le

terre infrieure.

Lorsqu'on ralise

darsanamrga

d'une certaine terre (bhmi),


cette

on acquiert,

futur, le

samvrtijnna de

terre

ou d'une

terre

cation diffrente.

bhavisyati

darsanamrgalabhyam tat tasyakatham bhvanmrge sammukMbhvo daranamrge cotpattyanavako 'systi iti tad anupattidharj

makam
1.
ii.

varnayanti [Vaibhsikh]. tatsammukhbhvasamartlisrayalbha.


iti

Sur sraya,

iii.

41,

i.

p. 37,

p. 284, iv. p. 62, 94, 152, v. p. 8.


2.

gotre

M labdhe labdham gautrikam.


/

Vykhya gotram
:

tadutpdane

samarlho hetuh
3.

tatra

bhavam gautrikam samvrtijnnam


i.

(Vyakhya).
p. 37, vii. p. 49.

Sur gotra au sens o nous l'avons ici (sabhgahefu), voir ran dan hog sa [svdhobhmi] Vibhasa, 40, 2.

Hiuan-tsang, xxvi,
infrieure. C'est--dire
:

fol.

15 b-16

a.

53

si

on

ralise le

sur X angamya, on acquiert, futur,


terre

darsanamrga en s'appuyant le daranamrga d'une seule


le

(angamya), on

acquiert, futur,
;

samvrtijnna de deux
:

(angamya et Kamadhatu) et ainsi de suite jusque si on ralise le darsanamrga en s'appuyant sur le quatrime dhyna, on acquiert, futur, le darsanamrga de six terres (angamya,
terres

dhynntara, quatre dhynas), on acquiert, de sept terres (les mmes, plus Kamadhatu).

futur, le

samvrtijnna

21c. Dans
daya,

le

nirodha,

le

dernier.

'

Si on cultive le

samvrtijnna

la fin

du duhkha

et

du samuet

c'est--dire

aux moments de duhkhe 'nvayajnna

de

samiidaye 'nvayajnna
quatre smrtynpasthnas.

(vi.
il

le

samvrtijnna

est de sa nature les

14)

Si on le cultive la fin du

nirodha
est

c'est--dire
le

au moment du

nirodhe 'nvayajnna

seulement

dernier smrtyupasth-

na, savoir dharmasmrtyupasthna.

21

d. Il

a les aspects de sa vrit.


le

Lorsqu'on cultive
d'une
certaine
les

samvrtijnna

la fin de la
le

comprhension

vrit

(tatsatybhisamaynte),

samvrtijnna

prend

aspects de cette vrit (tatsatykram eva) et a pour

objet cette vrit

(lambanam asya tad


l'effort.
3

eva)

21

d. Il

procde de

tant acquis par la force du darsanamrga,


'

il

est

exclusivement
;

obtenu par
inn
'

effort,

exercice

'

(prayogalbhika, pryogika)

non pas

(upapattilabhya), non pas n du dtachement (vairgya).

Les jnnas sont ainsi


l'lment capital
;

nomms

parce que

le

jnna,

savoir,

est
ils

si

on tient compte de leur escorte (parivra),

1.

2. 3.

nirodhe 'ntyam hgog pahi mthah svasatykrti ran bden rnam can hbad las byun [yatnajam //]

= =

54

CHAPITRE

VII,

22-23
le

c.

comportent quatre skandhas dans

dans
iv.

le
c).

Rpadhatu

(en ajoutant le
fol.

Kamadhatu, cinq skandhas dhynasamvaralaksanarpa,

13
I

[Hiuan-tsang, xxvi,

16 a 8]

Combien de jnnas

cultive-t-on

dans
?

les

diffrents

stades du

chemin de mditation (bhdvandmdrga)

22
II

a.

Dans

le seizime, six,

par
',

le

non-dtach.

faut suppler
le

'

sont cultivs

bhvyante, d'aprs

vii.

20

a.

Dans

seizime

moment (marge 'nvayajnna), pour


du Kamadhatu,
il

l'ascte qui

n'est pas dtach

y a

culture (prise de posses3


;

sion et actualisation) de deux jnnas, prsents


(prise de possession) de six

il

y a

culture

jnnas, futurs
vrits.

savoir

dharmaj flna,

anvayajnna, jnnas des quatre

22
En
o
il

b.

Par

le

dtach, sept.

ce qui regarde l'ascte dj dtach du


atteint le

Kamadhatu, au moment

marge 'nvayajnna,

il

faut ajouter la culture du

paracittajnna, septime.

22
Au

c-d.

Au
6

dessus, dans le

bhvanmrga

associ rga, cul-

ture de sept.

del du seizime

moment,

c'est--dire

dans

le reste

du bhva-

1. De la karika 22 la karika 26 c (fol. 16 a 8-19 b 10), Hiuan-tsang s'carte de l'original (que Paramartha traduit fidlement) et pour la karika et pour le bhasya. Notre traduction est donc (de p. 54 1. 4 p. 61 1. 4) faite sur Paramartha.

Le texte de Paramartha, Tokio, xxiii. 2, fol. 21 a 1-21 b 4. 2. chags bcas bcu drug pa la drug [sodae sat sargena] 3. dve jnne pratyutpanne [bhvyante], c'est--dire anvayajnna et margajnna, parce que le marge 'nvayajnna est, de nature, ces deux jnnas. 4. Non pas le samvrtijnna, parce qu'il a t acquis auparavant (labdhaprvatvt) voir vii. 27. Non pas paracittajnna, parce que l'ascte n'est pas

vtarga.
5.
6.

hdod

las

dehi gon

chags dan bral bas bdun vitargena sapta tu j ma chags bcas kyi / bsgom pahi lam la bdun thob bo
//

= sarga*

bhvanmrge tadrdhvam saptabhvan

Paramrtha,

fol.

21 a

1-8.

55
',

nmrga, aussi longtemps qu'on n'a pas obtenu le dtachement dans les prayogamrgas, nantaryamrgas, vimuktimrgas, viseculture de sept jnnas, savoir dharmajnna, samrgas, anvayajnna, jnnas des quatre vrits, lokasamvrtij nna. 2 est cultiv prsent le lokasamSi on pratique le laukikamrga

vrtijnna. Si on pratique
des quatre
futurs.

le

lokottaramrga,
autres six

est cultiv prsent

un

dharmajnnas. Les

jnnas

sont cultivs

23

a-c.

Dans

les

nantaryamrgas de

la victoire sur sept terres,

de l'acquisition des Abhijns et de la qualit d'Inbranlable, de la


mditation mle.
3

Suppler, d'aprs ce qui prcde,

culture de sept

jnnas

On

cultive sept

jnnas,

les

mmes que

ci-dessus, dans les

chemins

d'nantarya (chemins d'expulsion des passions, des obstacles) que


comportent
1.
:

la victoire sur sept terres, c'est--dire le


et

dtachement des quatre

dhynas

de trois rpyas
;

ces terres sont vaincues lorsqu'on

s'en dtache

2. l'acquisition 3. l'entre

de cinq Abhijns, en exceptant la sixime


(vi.

(vii.

42)

dans Yakopyat

57,

60

c. p.

254)

4. la

mditation mle (krnabhvan)

(vi.

42) du Saiksa.

Si l'ascte pratique ces

chemins par voie mondaine (laukikamrsamvrtij nna ;


s'il

ga) \

il

cultive, prsent, le
il

suit la voie

supramon-

daine (lokottara),

cultive prsent

un des quatre anvayajnnas,


et

un des deux dharmajnnas (nirodha

mrga).

1.

Donc dans

les quatre espces les huit

de chemins des huit stades du


la

bh&vanmrga
et aussi

o l'on abandonne

premires catgories de klesas de Kama,

longtemps qu'on n'a pas abandonn


2.

neuvime.

Sur ces quatre espces de chemins,


C'est--dire

v. 61, vi.

65 b (46

d,

61

d), vii.

18

c,

25

d.

ntdyudrdykro bhvanmrgah, voir vi. 49. 3. sa bdun las rgyal mnon ses dan / mi gyo thob dan spel bsgom paho (?) / bar chad med pahi lam dag dan saptabhmijaybhijnkopyptykrna-

bhvite
4.

nantaryapathesu.
vi.

Voir

61 b.

56

chapitre

vii,

23 c-25

b.

Dans
dha),
il

l'acquisition de la qualit d'Inbranlable (akopyatprative-

ne cultive pas
'.

au Bhavgra

samvrtijnna ; car celui-ci ne s'oppose pas Le ksayajnna est ici le septime jnna. 2
le

23

c-d.

Aussi dans

les huit

vimuktimrgas

d'au-dessus.

Au

dessus du dtachement des sept terres, dans les huit premiers

chemins de dlivrance

du Bhavgra,

l'ascte cultive, futurs, sept

jnnas, savoir dharmajhna, anvayajnna, jnnas des quatre


vrits,

paracittajnna

; il

ne cultive pas

le

samvrtijnna, parce

que ce jnna ne s'oppose pas au bhavgra.


Il

cultive, prsent,

un des quatre anvayajhnas ou un des deux


et
le

dharmajnnas (nirodha
24
a-b.

mrga).

Le Saiksa, dans

vimuktimrga du perfectionnement des


s

facults, cultive six

ou sept jnnas.

Le Saiksa (par opposition l'Asaiksa qui entre dans


d'Inbranlable), dans le

la

qualit

vimuktimrga

(troisime stade) du perfec(vi.


:

tionnement des facults (indriyasamcra)

60

c),

cultive six

jnnas

lorsqu'il n'est

pas

dtach
il

(vitarga

lorsqu'il n'est
le

pas

Angmin). Lorsqu'il

est dtach,

cultive sept

jnnas,

paracit-

tajnna tant

le

septime.

1. saptabhmivairgye lokottare vibhvyamne samvrtijnnam bhvyate/ samvrtijiinam api tasya klesaprakrasya pratipakso bhavati na kevalam lokottaram iti samvrtijnnam api taira bhvyate tajjtiyam / akopyaprativedhe tu na tath pratipaksabhtam samvrtijnnam asty ato 'Ira na bhvyate /

jnnam
iti/

ksayajnnam saptamam iti nantaryamrgasthitatvt ksayannutpdajnnam na hy nantaryamrge sthito 'kopyadharm bhavati / akopyadharma[na]s cnutpdajnnam bhvyata
2.

tatra

tatra bhvyate

gon mahi grol bahi lam brgyad la han a= [rdhvamuktimrgesu cstasu //] paracittajiinam katham bhvyate / nantaryamrge pratisiddham paracittajiinam na vimuktimrge j ata ekaprakre prahne yvad astaprakre prahne purvaparacittajnnavisistam paracittajiinam bhvyate yat sa evamvidha ryapudgalah tato mrgd vyutthitah sammukhikuryt / samtnavisesd dhi paracittajnnavisesa isyate j (vii. 5 c) 5. slob pa spyod pahi grol ba la / ses pa drug dari bdun hthob bam
3.

4.

Paramrtha,
D'autres matres disent que

fol.

21 a 8-16.

57
est cultiv par le

le

samvrtijnna
'

non dtach comme par

le

dtach.

Dans

le

chemin prparatoire (prayogamrga, premier

stade), tous

deux cultivent ce jnna.

24
dans

c.

Dans Ynantaryamrga,
il

il

cultive six

jnnas.
8
,

Dtach ou non dtach,

cultive six

jnnas

comme
le

ci-dessus,

Ynantaryamrga (deuxime
facults ressemble

stade)

du perfectionnement des
perfection-

facults. Il ne cultive pas le

samvrtijnna, parce que


au darsanamrga
*
;

nement des
le

il

ne cultive pas

paracittaj nna parce que ce


:

jhna

est exclu de tout

nantarya-

mrga

en

effet ce

jnna ne

contrecarre pas les kleas.

24

d.

De mme dans
les

la victoire sur le

Bhavgra.

:i

Dans

nantaryamrgas du dtachement du Bhavgra,

le

Saiksa cultive six jnnas.

25

a.

Au moment du ksayajnna,
44

neuf jnnas.

Le neuvime vimuktimrga du dtachement du Bhavgra

est

nomm ksayajnna
vii.

(vi.

d).

[Il

a t question des huit premiers

23

c-d].

L'ascte cultive alors neuf jnnas, en exceptant Yanut-

pdajhna.

25

b.

L'Inbranlable cultive les dix jnnas.

1. Tout le monde est d'accord que le samvrtijnna n'est pas cultiv dans les nantaryamrgas du perfectionnement des facults (vii. 24 c). vimuktimrye kimartham vivdah daranamrgasdryt tatra tad abhisamayntikavad bhvyata ity eke na cbhisamayo 'sti daranamrgasdrsyam vety apara ity evam vivdah. 2. bar chad med pahi lam la drug [sad nantaryamrgesu] 3. dharma, anvaya, les quatre vrits. 4. kim atra darsanamrgena sdryam phalaprptih / yath darsanamrgena srotapattiphalam va sakrdgmyangmiphalam va prpyate evam anenpy nantaryamrgena aiksasya aiksendriyottpanym
/ I

tiksnendriyasamgrhtni samskrtni srotapattiphaldni prpyante 5. de bzhin srid rtsehi rnam rgyal la han 6. zad pahi ses pa la dguho 7. mi gyo bas ni bcu htob bo

...

58

chapitre vu, 25 b-d.

Le

saint qui est d'origine

un Inbranlable

(vi.

57

c)

cultive dix

jnnas au moment o il produit le ksayajnna, il obtient Yanutpdajnna (vi. 50 a).

car,

ce moment,

25

c.

Dix jnnas aussi


'

la

dernire vimukti du passage la

qualit d'Inbranlable.

L'ascte qui obtient la qualit d'Inbranlable par le perfectionne-

ment des

facults, cultive aussi dix

jnnas au

dernier chemin (neu(vi.

vime vimuktimrga) de ce perfectionnement

60

c).

25

d.

Dans

les cas

non mentionns, culture de huit jnnas.


non mentionns ?

Quels sont
1.

les cas

Le neuvime vimuktimrga du dtachement du Kamadhatu


;

(exclu de la dfinition 22 c-d)


2. les

vimuktimrgas du dtachement de
3

sept terres,

de cinq

Abhijns, de la mditation mle du aiksa

(exclus des dfinitions

23

a-c)

3. les

huit

premiers vimuktimrgas du

perfectionnement des

facults aboutissant la qualit d'Inbranlable (exclus de la dfinition

25

c)

4. les

chemins prparatoires

et les

chemins de progrs (prayoga,

viesamrga) du vltarga (ou Anagamin).

Dans tous
tant le

ces chemins, culture de huit


et

jnnas

futurs, en excep-

ksayajnna
est-il

Yanutpdajnna.

Ainsi en

du Saiksa.

Quant
et

l'Asaiksa, dans les

prayogamrgas, vimuktimrgas
et

visesamrgas des cinq Abhijns

de la mditation mle,
dix

culture de neuf

jnnas

(en exceptant

Yanutpdajnna) ou de

1. der hpho groJ bahi tha ma la han La Vyakhya cite le Bhsya tath yo 'kopyatm samcarali tasypy antye vimuktimrye dasnm bhvan. % bad pahi lhag la brgyad hthob proktasese 'stabhvan // 3. saptabhmivairgya-abhijn-vyavaMrnabhvitesu
:

Paramrtha,

fol.

21 a 16-21 b

1.

59

jnnas, suivant que l'Asaiksa est samayavimukta ou asamayavimukta. Dans les nantaryamrgas des mmes (cinq Abhijnas et
mditation mle), culture de huit ou de neuf j flnas, en exceptant

dans

les

deux cas

le

paracittajnna.

Toutefois, dans le

vimuktimrga

des deux Abhijnas qui sont nontant lui-mme non-

dfinies (il divin, oreille divine),


dfini

ce mrga
futur.
'

il

n'y a pas culture de

jhna
les

Quant au Prthagjana,

dans
et

neuvimes vimuktmrgas du

dtachement du Kmadhtu

de trois

dhynas
trois

2
;

dans

les
;

prayoles

gamrgas ; dans
ralisations
:

les

vimuktimrgas de
spirituels

Abhijnas

dans

apramnas, vimoksas, 3 etc. tous ces chemins tant pratiqus dans les dhynas (et non pas dans les smantakas) il cultive, futur, le samvrtijnna et aussi
des
biens

(guna),

'*

le

paracittajnna

except dans les nirvedhabhgiyas parce que

ceux-ci constituent l'escorte (parivra) du

chemin de vue.
5

Dans
il

les autres cas,

obtenant un chemin non obtenu auparavant,

cultive seulement, futur, le

samvrtijnna.

1. dvayos tv abhijnvimuktimrgayor iti j divyasrotradivyacaksurabhijnvimuktimrgayor avykrte srotracaksurabhijne iti vncant (vii. 42) tadvimuktimrgv avykrtau / na cvyakrtasya dharmasyngatabhva-

nsti (Vykhy).

Voir ci-dessus

p.

19 n.

3.

Entendons que, en ralisant ces Abhijnas, on ne prend pas possession des mmes Abhijnas futures.
2. prthagjanasya tu kmatridhynavairgya iti / caturthadhyn&grahanatn yasmc caturthadhynavairgye yo 'ntyavimuktimrgas tatra maulknantyyatanapratilambho na crpyadhtusamgrhtatn paracittajnnam asti rpttrthanispdyafvt. 3. prayogbhijntrayavimuktimrgpramndigunbhnirhresv iti prayogam&rg cbhijntrayavimuktimrg ca apramndigunabhinirharas (vimoksbhibhvyatandigrahanam) ceti vigrahah Les trois Abhijnas sont rddhi, prvenivsa et cetahparyya. 4. dhynabhmikesu .... dhynabhmikagrahanam smantakanirsrtham / tatra hi paracittajnnam nsti. 5. anyatreti vistarah j prthagjanasyaivnyatrprvamrgalbhe kmatridhynavairgyntyavimuktimrgn hitv yah prayognantaryavimuktimrgalbhas tasminn anyatrprvamrgalbhe samvrtijnnam evngatam bhvyate / na paracittajnnam / tathbhijntraypramndigun-

60

chapitre vu, 25 d-26

c.

quelle terre appartient

lejhna

qui est cultiv dans le chemin

mondain ou supramondain ?

En
par
le

ce qui concerne le

samvrtijnna,

cultiv futur,

il

appartient

la terre qui sert d'appui

au chemin, ou bien la

terre qu'on obtient

chemin.

'

En

ce qui concerne le

jnna pur (ansrava),


il

ce n'est pas une

rgle que, cultiv futur,

appartienne la terre qui sert de point

d'appui sa production.

26

a-b.

Le jnna qu'on

cultive futur appartient

la terre
2

dont

on se dtache, la

terre acquise,

une terre infrieure.


terre, l'ascte

Lorsque, pour se dtacher d'une

pratique les chemins

bhinirhresu ya nantaryamrgalbhas tasmims cnyatrprvamrgalbhe satnvrtijnnam eva labhyate. prayogamrgesu na paracittajnnam tadapratipaksatvt.
1. yadbhmiko mrgo ym ca bhmim prathamato labhate [tadbhmikam satnvrtijnnam angatam bkvyate] ln ascte se dtache du Kmadhtu par le chemin mondain qui a pour point d'appui (samnisrayena) (c'est--dire pratiqu dans ) Yangamya (vestibule du premier dhyna) et, par ce dtachement, obtient le premier dhyna ; au moment du neuvime vimuktimrga de ce dtachement, il cultive un samvrti-

jnna

de la terre de
:

Yangatnya ou de

la terre

du premier dhyna

et ainsi de

Ykiticanyyatana par le chemin mondain pratiqu dans le smantaka (vestibule) du naivasamjnnsatnjiiyatna, il obtient un samvrtijnna de la terre du smantaka ou de la terre du naivasamjnnsatnjnyatna. Le samvrtijnna est cultiv dans les mmes conditions lorsque l'ascte se dtache du kmadhtu par le chemin pratiqu dans Yangamya pur (ansrava). Mais si l'ascte obtient le premier dhyna pur en pratiquant le chemin pur dans le premier dhyna, le samvrtijnna qu'il obtient est de la terre du smantaka du deuxime dhyna oppos la premire ... la neuvime catgorie
suite jusque

se dtachant de

des passions (klesas) du premier


ascte obtient
le

premier

par lequel

il

obtient le

car c'est la premire fois que cet au neuvime vimuktimrga du chemin premier dhyna pur, il cultive, futur, un samvrtijnna

dhyna

dhyna

pur. Et,

du deuxime dhyna (Vykhya). 2. gan las chags bral bya phyir gan / thob pa der yan hog na han hthob yadvairgyya yallbhas tatr[py] adhas ca bhvyate / yadvairgyya j yasy bhmer vairgyya / yallbhah yasy bhmer lbhas j tatrobhayatrdha ca bhvyate 'nsravam jiinam.

Piramrtha,
(prayoga,
etc.)

fol.

21 b 1-6

Hiuan-tsang, xxvi,

fol.

19 b 10.

61

des deux classes, purs ou impurs,

il

cultive des

jndu

nas purs
fois

qui sont ou bien de la terre qu'il obtient pour la premire


;

par ces chemins


;

ou bien de

la

terre qui est le point d'appui


!

chemin

ou bien d'une terre infrieure.

26
1.

c.

Au ksayajnna,

les

impurs aussi de toute

terre.

yadbhmivairgyypi hi na kevalam yadbhmikam


I

ity

apisabdr-

thah

ym ca bhmim labhate vairgyata ity uparibhmikam (?) tadbhmikny adhobhmikni va ansravni jnnni bhvanm gacchanti.
Exemples tadyath dvityam ansravam dhynam nisritya trtiyadhynavairgyam karoti yadbhtniko mrgo dvityadhynabhmikas tadbhmikam ansravam jiinam bhvanm gacchati / yasy ca bitumer vairgyam
:

bhmes tadbhmikam trtiyadhynabhmikam navame vimuktimrge ansravam jiinam bhvanm gacchati j adhobhmikni ca prathamadhynabhmikam angamyabhmikam va ansravam jiinam bhvanm gacchati / adhobhmikam api hi tatprayogamrgdikam samkaroti trtyy

bhavati tajjtiyam

iti

bhvanm

gacchati

atha tu trtyadhynasmantakam nisritya dvitiyadhynavairgyam karoti j tatra nantaryanirgesii vimuktimrgesn ca tasya smantakasya ssravatvt tadbhmikam ansravam jfinam na bhvanm gacchati / abhvt (viii. 22 a) / adhobhmikam tu tajjtiyam dvitiyadhynabhmikam

dhynntarabhmikam prathamadhynabhmikam angamyabhmikam


ca tajjlyam ansravam jnnam bhvanm gacchati / evam anyatrpi yojyam es dig iti. Un ascte prend point d'appui sur le deuxime dhyna pur et, de la sorte, se dtache (fait le dtachement) du troisime dhyna: le jfina pur qui est cultiv est de la terre du chemin, c'est--dire du deuxime dhyna il est encore, au neuvime vimuktimrga du dtachement, de la terre dont l'ascte se dtache, savoir du troisime dhyna ; il est encore d'une terre infrieure, savoir du premier dhyna, de Vangamya. Car il arrive que le chemin prparatoire soit d'une terre infrieure le jiina d'une terre infrieure pourra donc tre cultiv. Mais quand l'ascte se dtache du deuxime dhyna en prenant point d'appui sur le smantaka du troisime dhyna, ni dans les chemins d'nantarya ni dans les chemins de vimukti ne pourra tre cultiv un jnna pur de la terre du smantaka : en effet il n'y a pas de jiina pur dans ce smantaka (viii. 22 a). Le jiina cultiv sera infrieur au chemin du deuxime dhyna, du dhynn; :

tara, du premier

ssrav ca ksayajnne [sarva2. zad pa ses Paramrtha n'a rien qui corresponde sa kun == sarvabhmika, bhmikh]. qui manque probablement dans l'original.

dhyna, de Vangamya. la zag bcas kyan / sa kun

62

CHAPITRE

VII,

26

c-d.

Au moment

o nat

le

ksayajnna
a],

(vi.

44

d),

connaissance de la
qualits (ou

destruction des sravas, [20

sont cultives les

biens

spirituels )
',

de toutes les terres, y compris les impures


etc.
2

(ssrava)

savoir apramnas, vimoksas,

En

effet le

Vajro-

pamasamadhi coupe
(kleaprpti)
;

ces cordes que sont les possessions des passions

toutes les

qualits se trouveront donc dans


;

une

me ou srie

libre de passions

on peut donc dire qu'elles

respirent

(ou qu'elles s'ouvrent, qu'elles gonflent), la manire d'un sac (ped)


lorsqu'on coupe les cordes qui le serrent \ L'Arhat a obtenu l'empire

souverain sur sa pense (svacittdhirjyaprpta)

tous les bons


les

dharmas
suprme.
3

viennent vers

lui

(pratyudgamana), comme
4

vassaux

viennent prsenter leurs

hommages au

prince qui accde la royaut

Hiuan-tsang
c'est--dire

qualits impures des neuf terres

Seulement au premier ksayajnna il cultive d'ensemble les . Avec la glose Au premier ksayajnna, au neuvime vimuktimrga du dtachement du bhavgra, et au
:

neuvime vimuktimrga des cinq perfectionnements de facults (20 a 4-5). 1. yn gunn arhadbhtv (?) sammukhkuryt te ssravs tasym avasthym bhvanm gacchanti. 2. Par et ctera on entend abhibhvyatana, krtsnyatana, etc. 3. ucchvasantiva pedsdharmyena / y ped rajjv nispldya baddh sa rajjubhedd ucchvasatva. ped, Divya 251, 4, 365, 8, sac renfermant les bijoux ou alamkras, phel,
:

ibid. 503, 24,

Mahfivastu,
;

ii.

465 (phel, phelik)

Bloch, Marathe, 370 classique,


;

peta, pet, petl

pli, pela.

Hiouan-tsang
lis,

et

ParamSrtha Comme, lorsque


:

les liens

sont coups, les [tres]

trangls, respirent
est que,

au moment du ksayajnna, se produit la possession de toutes promues un grand degr d'excellence uttaptatarnm tesm prptir utpadyate. 4. Comparer le premier roi Cakravartin, Kosa, iii. 96 c. N en haut ne cultive pas l'infrieur , thse 5. Hiuan-tsang ajoute un pda dveloppe dans la Vy&khya Quand on obtient la qualit d'Arhat (c'est--dire le ksayajnna) tant n dans le Kamadhatu, sont cultives (bhvanm lorsqu'on obtient la qualit gacchanti) les asubh, etc., des trois sphres d'Arhat tant n dans le Rpadhatu, dans l'rpyadhatu, les mmes qualits sont cultives appartenant deux sphres, une sphre. De mme en ce qui regarde les diverses bhmis des sphres qui obtient la qualit d'Arhat dans le Le sens
les qualits
:

'

'

naivasamjnnsamjnyatana
cette

'

cultive

'

seulement

les qualits

appartenant

bhmi.

Hiuan-tsang, xxvi,

fol.

19 b-20

a.

63

Tout

ce qui est

obtenu

'

est-il

cultiv

?
2

26

d.

Ce qui a

obtenu auparavant n'est pas cultiv.


c'est ce qui n'a

Ce qui
t

est cultiv

pas t obtenu. Ce qui, ayant

obtenu

et perdu, est

obtenu nouveau

c'est--dire est

nou-

veau

ralis,

actualis

cela n'est pas

cultiv

c'est--dire
t,

l'ascte n'en

prend pas possession pour l'avenir. Parce que cela a


acquis et rejet.
3

dans

le pass,

1.

yat kimcil labhyate.


snon rned
rai

labdhaprvam na bhvyate. vihnam punar labhyate sammukhikriyate samsrocitam na tad angatam bhvyate bhvitolsrstatvt samsre / yad evtra dhynpramndy anucitam samsre viistam ansravnugunam tatsammukhibhve tajjtlyam evngatam visis'am bhvyata ity cryo
2.

hthob bo

3. a.

Vyakhya

yad

darayati.
Il

est des qualits vulgaires, frquentes

au cours de

la transmigration,

qu'on

ralise,

qu'on abandonne. Ces qualits ne sont pas objet de


l'tat futur.

culture

c'est--dire

ne sont pas possdes

Mais

les qualits distingues, les

dhynas,

les

apramnas,
l'avenir.

etc.,

rares au cours de la transmigration, qui sont favorables

l'acquisition des qualits pures, lorsqu'on les actualise,

on en prend possession
culture

pour

Voil ce que Vasubandbu entend dire.


Cette explication dpend de la thse de Vasumitra, qu'il y a


qualits distingues,
b.

des

samsrnucitatvt, non pas des autres.


Le

Hiuan-tsang

dharma
'

nouveau, n'est pas pour cela

cultiv

auparavant acquis, perdu, bien qu'on l'acquire parce qu'on le racquiert sans effort. Le
',

dharma non
1

le rend prsent par effort, et il est donc que sa force est grande. Produit aprs avoir t acquis, futur, parce que sa force est petite, tant produit sans il n'est pas cultiv beaucoup d'effort . Cette version s'inspire de l'explication de Samghabhadra.

auparavant acquis, on se

cultiv

'

futur, parce

c.

Samghabhadra (Nanjio
cit

1265, xxiii. 6, 58 b
la
:

1266, xxiii. 8, 71 b ne correspond

Vyakhya cryasamghabhadro 'py etam evrtham vycaste / labdhaprvam na bhvyate / yat pratilabdhavihnam punar labhyate na tad bhvyate / arthd gamyate yad alabdhaprvam labhyate tad bhvyate \ yatnbhimukhkarant / apratiprasrabdho hi mrgo yatnenbhimukhlkriyata iti tadvedhabalatvd angato bhvanm gacchati I pratilabdhaprvas tv ayatnena samtnukhbhavati bhvitapratirabdhatvt krtakrtyadattaphalatvc ca vegahna iti tatsammukhbhvd angato na bhvyata iti yo 'ngato yatnena janyate sa bhvyata ity abhipryah /
pas exactement) est par
/

64 Le terme bhvan
bha) ?

chapitre vn, 27.


dsigne-t-il

seulement l'acquisition (pratilam-

Non
2.

pas; la bhvan est de quatre espces:


b],

1.

d'acquisition,

de pratique (nisevana, nisev) [20


4.

3.

d'opposition (prati-

paksa),

d'expulsion (vinirdhvana).
est d'acquisition

27. La bhvan des bons dharmas conditionns


et

de pratique

bhvan
'

d'opposition et d'expulsion, l'endroit des

dharmas

impurs.

Bhvans

d'acquisition

et

de pratique

l'endroit des samskrtas

bons, acquisition l'endroit des futurs, acquisition et pratique


l'endroit des prsents.

Ces deux bhvans reposent sur


effort

les

deux

premiers pradhnas,
effort

pour

la naissance de ce qui n'est pas n, est n.

pour

le

dveloppement de ce qui

La Vyakhya poursuit
C'est--dire
s'il

tad evam sati yad

uktam samvrtijnnam tvad


/

iti

vistarena tad ryasamtnapatitam eva grhyate


en est ainsi, ce qu'on a du samvrtijnna de l'Arya. de Vasumitra, l'objection des Vaibhasikas
:

dit

de la culture du samvrtijnna

doit s'entendre

La Vyakhya signale alors l'opinion

samsrnucitatvd iti cryavasumitrentra likhitam / atra kila vaibhsik huh / naitad evam / kutah / yasmd aabdham eva tad bhavati tyaktatvt tasmd bhvitotsrstasypi punarlbhe bhavaty eva bhvaneti / katham tad aprvam bhavati yvatlabdhaprvam iti na hy evamvidham
I

loke

prasiddham

iti

Enfin,

on peut comprendre

ce qui n'a pas t obtenu


.

(alabdhaprva)

ce qui n'a pas t obtenu dans cette vie

ram yad vihlnam asminn


bhvitotsrstatvt
1.
/

apare punar vycaksate ekam janmedam adhikrtyoktam na janmntaeva janmani punar labhyate na tad bhvyate /

janmntare

tu yal labhyate tad bhvyate.


/

rned dan bsten ces bya ba ni


/

dge ba hdus byas thob paho

ni thag srin bahi

thob pa zag dan bcas pahi yin


/

pratilambhanisevkhy
//]

gfien po

dan

ubhasamskrtabhvan
Voir Kosa,
2.
vi. 1, p.

[ssravasya pratipaksavinirdhvanabhvan
;

119, note

vii. p.

23, Atthaslin, 163.

pratilambha eva bhvan pratilambhvan angataprptir eva bh-

vanety arthah.

Bhvan

qui consiste dans la

prise de possession d'un

dharma
3.

De mme la nisevanabhvan consiste en nisevana. nisevanam punahpunah sammukhkaranam.


futur.

Hiuan-tsang, xxvi,

fol.

20

a-b.

65

Bhvans
impurs
la
;

d'opposition

'

et d'expulsion les

l'endroit des dharmas


effort

elles

reposent sur

deux derniers pradhnas,

pour

non-naissance de ce qui n'est pas n, effort pour la destruction de


3

de ce qui est n.

dharmas impurs (ssrava) sont susceptibles des quatre bhvans ; les dharmas purs sont susceptibles des deux premires les dharmas souills (klistas) et non-dfinis (avykrta)
Donc
les

bons

sont susceptibles des deux dernires.

Les Vaibhasikas de l'Occident disent


ns, quatre
trainte, et la

qu'il

y a six sortes de bhvacon-

comme

ci-dessus, plus

la

samvarabhvan, de

vibhvanbhvan, d'inspection. La premire est la bhvan de organes 4 de l'il, etc. est la bhvan du corps, ainsi qu'il est dit dans le Stra
,
;

la seconde
:

Ces six

organes bien dompts, bien gards


cheveux,
poils, etc.
6
.

y a .dans le corps Les Vaibhasikas du Kasmr pensent que ces


...

et

Il

deux bhvans se doivent ramener aux bhvans d'opposition


d'expulsion.
1.
'

et

[xxvii]
la

Par pratipaksabhvan on entend


contrecarrant

bhvan
:

qui consiste en pratipaksa

chemin pratipakso mrgo yathoktam stre bhvitakyo bhvitacitta iti bhvitakyacittapratipaksa ity arthah \ kyapratipaksah punas catnrdhynavairgyya yo mrgah / tath hy uktam bhvitakyo bhiksiir ity ucyate bhvitacitto bhvitallah j katham bhvitakyo bhavati / kyd vigatargo vigatatrsno vigatapipso vigataen

c'est--dire

en

<

prem vigataniyantihf?)/ atha va yo 'sau rpargaksaynantaryamrgah so 'nena vigatargo bhavatty gamah. Samyutta, iii. 7, 11, 190, iv. 111
Anguttara,
iii.

106

Majjhima,

i.

237.

Comment la pense est dite bhvita, ci-dessns vii. p. 20. coupure de la possession 2. vinirdhvanabhvan

des passions, klea-

prpticcheda.
3.

L'ordre des

pra(d)hnas

diffre

dans Mahfivyutpatti, 39
298

voir

vi.

c,

67.

54,

Hiuan-tsang omet celte rfrence aux pradhnas.


4.

indriyabhvan, Majjhima,
iii.

iii.

indriyasamvara, Samyutta,
...]

i.

Anguttara,
5.

360, Majjhima,
11, 14
:

i.

269, 346, etc.

Samyukta,

sad imnlndriyni [snsamvrtni subhvitni

V indriyasamvara
tion
6.
:

ou

samvarabhvan

est,

de sa nature, mmoire

et atten-

sa punar indriyasamvarah smrtisamprajnnasvabhva uktah. Madhyama, 34, 1G, Majjhima, iii. 90; Samyutta, iv. 111, SiksBsamuccaya,
Madhyamakavrtti,
57, etc.

228,
7.

La vibhvanbhvan, ou kyabhvan, n'est autre chose que (vinirdhvana) des passions dont le corps est l'objet.

l'expulsion

66

chapitre vu, 28 a-b.

Nous avons
par
les savoirs

expliqu les savoirs (jnna)

il

faut

maintenant

expliquer les gunas, qualits ou biens spirituels, qui sont constitus

sont propres au

(jnnamaya) Parmi ces gunas, d'abord ceux qui Bouddha (venika) que le Bodhisattva acquiert au moment du ksayajnna (vi. 45) en devenant Arhat et, en mme
'.

-,

temps, Bouddha.

Ces qualits sont au nombre de dix-huit.

28
etc.
3

a-b.

Les

dharmas propres au Bouddha

sont dix-huit, les forces,

Les dix forces (bala),


(vaisradya),
piti

les

quatre assurances ou absences de crainte


et la

les trois
4

quanimits (smrtyupasthna)
cet

grande

(mahkarun)

ensemble constitue

les dix-huit

dharmas

1. D'aprs Hiuan-tsang. L'original porte smnyena sarvesm (rvakapratyekabuddhasamyaksambuddhnm) ksayajine gunabhvanokt (vii.
:

26

c)

astdavenik
la

qu'ils soient,

prennent possession des

connaissance de
....

Nous avons expliqu en gnral que les Arhats, quels qualits au moment o se produit la destruction des sravas . Il y a dix-huit qualits propres au
....

Bouddha

Kathavatthu,
des Andhakas).

iii.

1-2,

que
7,

les

forces

ne sont pas propres au Bouddha (thse

Patisambhidmagga,
Milinda, 285.

i.

soixante-treize iinas dont six propres au

Bouddha

2. Sur venika, la dfinition de Yavidy venik (Vykhya, ad v. 12, 14, ii. 29) que cite et traduit Burnouf, Lotus, 048 samparko venir ity ucyate j na venir avenih prthagbhva ity arthah j evam hy uktam avenir bhagavn avenir bhiksusatngha iti prthag bhagavn prthag bhiksnsamgha ity abhipryah j aveny caraty venik nnyniisayasahacrinty arthah. Anguttara, v. 74. Le Samgha ne se divise pas ... na veni kammni karonti na veni ptimokkham uddisanti (= na prthak karmni ...) Il y a cinq qualits qui appartiennent exclusivement aux femmes (venya et
:

venika), Divya,

2, 3,

98, 22, etc.

Burnouf, Introduction, 169.


iv.

Le bien que
3.

j'ai fait, c'est

ma

richesse veniya, Jfitaka,


/

358.

[buddhasyvenik dharm astdaa baldayah /] Ou plutt, d'aprs l'ordre des mots de ParamSrtha astdasa tv venika buddhadharm baldayah /
sans rgyas chos ni
hdres pa
stobs la sogs pa bco brgyad do
:

ma

4.

a. C'est la liste
:

de Divya, 182,

20,

268,

4.

b.

cit)

Yasomitra dit Telle est la doctrine des Vaibhfisikas. D'autres matres (ke admettent dix-huit venikas distincts de ceux-ci, savoir nsti tathga:

Hiuan-tsang,

xxvii, fol. 1 a.

67
parce que les autres

propres au

Bouddha

venika, ainsi

nomms

ne les acquirent pas en devenant Arhats.

Nous examinerons d'abord

la nature des

balas ou

forces

'

[1 b]

tasya skhalitam, nsti ravitam (= sahas kriy), nsti dravat (= krdbhipryat), nsti nntvasamjn f= sukhadnhkhduhkhsukhesu visayesu ryadvesamohato nntvasamjn), nsty avykrtamanas, nsty apratisamkhyyopeks, nsty attesu pratihatam jnnadarsanam, nsty angatesu pratihatam jnnadarsanam, nsti pratyntpannesu pratihatam jnnadarsanam, sarvam kyakarma jnnnuparivarti, sarvam vkkarma jnnnuparivarti, sarvam manaskarma jnnnuparivarti, nsti chandahuih, nsti vryahnih, nsti smrtihnih, nsti samdhihnih, nsti

prajnhnih, nsti vimuktijnnadaranahnih.


Cette
liste,

Contredit

iv. 12, vi.

59.

quelques variantes prs, est celle de Mahavyutpatti, 9 (extraite,

d'aprs Wogihara, du Tsa-tsi de Sthiramati) que cite

Kosa.

On

en trouve dans Madhyamakavatara

extrait de la
i.

160 (voir la

du un commentaire DharanTsvarapariprcch. Trs voisines les listes de Mahavastu, note p. 505) et des sources plies, AbhidhSnappadpika et Jiualamici

l'diteur japonais

(vi.

213, p. 322-337)

kara (Burnouf, Lotus, 649, Kern, Geschiedenis,

i.

272, Milinda, 285).


:

La particularit de la liste de Yasomitra est dans les premiers termes nsti skhalitam nsti ravitam nsti dravat ; le Mahavastu et la Mahavyutpatti ont nsti (s)khalitam nsti ravitam nsti mnsitasmrtil ; le Jinalamkara donne .... natthi dav (comment kicchbhippyena kiriy, mauvaise lecture pour khiddbhippyena), natthi rav (comment sahas kiriy). On notera krdbhipryat, l'troite parent avec les gloses de Yasomitra dravat chinois dfaut de la sahas kriy ( tibtain ca co, clameur ravita voix). Pour dravat, Mahvastu-Mahavyutpatti ont, disons-nous, musitasmrtit (qui fait, peut-tre, double emploi avec la neuvime qualit nsti smrter hnih), mais Candra Das (p. 511) a une variante musit ou mudit, qui suggre l'ide
: : :

=
:

de krd.
h' apratisamkhyyopeks est
'

une upeks, une indiffrence, qui ne rsulte pas


viii. 8).
:

de

la
c.

connaissance, due, dirions-nous, l'apathie, non la sagesse (voir

La Bodhisattvabhiimi

(iii.

4.)

admet 140 venikas

32 et 80 marques, 4 purets

omniformes

Muson, 1911, 170) (sarvkra), 10 balas, 4 vairadyas,


(voir
les 4

3 smrtyupasthnas, 3 raksanas (comp.

raksyas de Mahavyutpatti,

12),

mahkarun, asampramosadharmat, vsansamudghta, sarvkravarajnna (comparer le sarvathjnna, Kosa, vii. p. 82).


d.
1.

Les venikas du Bodhisattva, Mahavyutpatti,


51
le

29,

Madhyamakavatara,

vi.212.

Lotus, 343, 781, Spence Hardy, Manual, 380 et autres ouvrages cits dans
p.
;

Dharmasamgraha,
Liste plie

Mahavyutpatti, 7 (d'aprs Yogasstra).


;

dans

Jinalamkara de Buddharaksita
i.

la

source

sanscrite

ancienne est Mahavastu,

159 (prcieux commentaire de l'diteur,


ii.

p.

502-505)

d'autre part, Patisambhida,

174,

Vibhanga, 335.

68

CHAPITRE

VII,

28

c-29.

28
phala

c-29. Dix savoirs dans


;

le

sthnsthna ; huit dans


etc.,

le

karmadeux

neuf dans les dhynas,


les
;

dans

les

indriyas, dans les

adhimoksas, dans

dhtus ; neuf ou dix dans


le

les

pratipads
'

sont samvrtijnna

nrodha

est six

ou dix savoirs.

Le Bouddha est dasabala, Mahvagga, i. 22, 13 Dasabala est le titre d'un vagga du Samyutta voir cependant les observations de Rhys Davids, Milinda, ii. 134. Les dix balas du Bodhisattva, Mahvyutpatti, 26. Les balas sont expliqus, d'aprs la Dhransvarapariprccha, dans Madhyama; ;

kfivat&ra, trad. tibtaine, p. 369-395.

Si les balas appartiennent

aux Srvakas
iii.

si les

neuf premiers balas sont des

savoirs

purs ou rya, Kathavatthu,

1-2.

1. gnas dan gnas min ses pa bcu / las hbras la brgyad bsam g tan sogs / dban po mos dan khams la ni / dgubo lam dag la bcu ham / gnis ni kun rdzob ses pa y in / zad pa drug gam bcu y in no sthnsthne daa jnnny astau karmaphale [nava //] dhyndyaksdhimoksesu [dhtau ca] pratipatsu [va /] [daa dve samvrtijiine sad va daa va ksaye //] Liste diffrente dans la petite Vyutpatti, 5 (Minaiev, 1887).

La Vyakhya

cite le

Stra

dayusmantas tathgatabalni katamni daa / ihyusmantas tathasthnam csthgatah sthnam ca sthnato yathbhtam prajnti natah / idam prathamam tathgatabalam yena balena samanvgatas tathgato 'rhan samyaksambuddha udram rsabham sthnam pratijnti brhmam cakram pravartayati parsadi samyaksimhandam nadati jj punar aparam yusmantas tathgato 'tltngatapratyutpannni karmadharmasamdnni sthnato hetuto vastuto vipkata ca yathbhtam prajnti yad yusmantas tathgatah prvavad yvad vipkata ca yathbhtam prajnti idam dvitlyam tathgatabalam yena balena // punar aparam yusmantas tathgato dhynavimoksasamdhisampattlnm samkleavyavadnavyavasthnaviuddhim yathbhtam prajnti parapudgalnm indriyaparparatm yathyad yusmantas 3. // bhtam prajnti 4. \] .... nndhimuktikam lokam anekdhimuktikam nndhtukam lokam anekadhtukam yathbhtam prajnti 5. jj anekavidham prvanivsam 7. // 6. /I sarvatragminm pratipadam anusmarati / tadyathaikm api jtim dve tisra catasrah panca sat saptstau nava daa vimatim yvad anekn api samvartavivartakalpn anusmarati / api nma te bhavantah sattv yatrham sa evamnm evamjtya evamgotra evamhra evamsukhadiihkhapratisamvedl evamdrghyur evamcirasthitika evamyusparyantah so 'ham tasmt sthnc cyuto 'mutropapannah / tasmd api cyuta ihopapannah / iti skram yad sanidnam soddeam anekavidham prvanivsam anusmarati yusmantas .... 8. jj divyena caksus viuddhentikrntamanusyakena
/ I

....

....

....

....

...

...

...

...

....

...

...

Hiuan-tsang,
1.

xxvii, fol. 1 b.

69
dans
la

Le sthnsthnajnnabala

la force qui consiste


et

connaissance de ce qui est possible

impossible
force
,

(=

le

savoir du

possible et de l'impossible qui est une


vii.

c'est--dire absolu,
'

30

c)

est les dix

jnnas, comporte
la

les dix

jnnas.

2.

Le karmavipkajnnabala

force qui consiste

dans la

connaissance de la rtribution des actes

est huit

jnnas, en ex-

cluant la connaissance du chemin et celle de la destruction (mrga-

jiina, nirodhajnna).
3-6.

Le dhynavimoksasanidhisampattijnnabala

la force

de la connaissance des dhynas, vimoksas,


sattvn pasyati

smdhis

et

sampat-

cyavamnn apy upapadyamnn api suvarnn durvarnn hinn pranitn sugatim api gacchato durgatim api yathkarmopagn sattvn yathbhtitam prajnti ami bhavantah sattvh kyaducaritena samanvgaf vgmanoducaritena samanvgat rynm apavdak
I

mithydrstayo mithydrstikarmadharmasamdnahetos taddhetu tatpratyayam kyasya bhedt parant marand apyadurgativiniptant narakespapadyante / ami punar bhavantah sattvh kyasucaritena samansugatau svarsamyagdrslikarmadharniasampdanahetos (?) vgat
9. Il .... sravnm ksayd ansravm galoke devespapadyante / yad cetovimuktint prajnvimuktim drsta eva dharme svayam abhijnya skstkrtvopasampadya prativedayate / ksln me jtir usitant brahmacaryam

krtam karanlyam nparam asntd bhavant prajnmlti yad yusmantas


tathgatah .... 10. // 1. Ce premier jnna ba la est de sa nature dix jnnas. Car le sthnsthna lequel est huit samprayukta (associ la pense) de se divise en samskrta quatre espces Kma, Rpa, rpya et ansrava ; viprayukta (dissoci de la pense) de mme et en asamskrta, lequel est ou bon ou non-dfini. Le sthnsthnabala en tant que samvrtijnna porte sur ces dix choses en tant que dharmajnna sur cinq en tant qu' anvayajnna, sur sept Comment ces dix choses sont-elles sthnsthna ? Voyez les Stras Il y a sthna (possibilit, sambhava) qu'un mle ralise la qualit de Bouddha (bud-

asthna (impossibilit, asambhava) qu'une il y a ; y a possibilit qu'un mle soit Brahm (brahmatvam krayisyati) ; il y a possibilit de dtruire la douleur Dfinition de ce bala, Vibhanga, p. 335. 2. L'acte et son fruit sont en effet inclus dans les vrits de la douleur et de
dhatvant krayisyati)
;

femme

il

l'origine,
3.

non pas dans


a quatre

les vrits

de la destruction et du chemin.

huit vimoksas (viii. 32), trois s'amdhis (deux sampattis (asamjni et nirodha, ii. 42) et neuf anuDe mme Vibhanga, prvavihrasampattis (dhynas, rpyas, nirodha).

On

dhynas

(viii. 1),

nyat,

etc., viii. 24),

339.

70

chapitre

vii,

29-30.
la force de la
;

Us ; Yindriyaparparajhnabala
bala
tres
J

'

connaissance

du degr des facults morales des tres

le

nndhimuktijnnade la connaissance des

le

la force

de la connaissance des diverses aspirations des


3

nndhtujnnabala

la force
;

diverses dispositions acquises des tres

ces quatre forces comportent

neuf jnnas, en excluant la connaissance de la destruction (nirodha-

jhana).
7.

Le sarvatragniinipratipajjnnabala

la force de la con-

naissance des chemins qui mnent aux diverses destines, au Nirvana

est

ou bien neuf jnnas ou bien dix jnnas.


le

Si

on comprend

chemin avec son


on comprend

fruit

(saphal pratipad),
le fruit

cette force

comporte

la
;

connaissance de la destruction (qui est


si
le
i

du Chemin, mrga)
[2 a], cette force
1.

chemin sans son

fruit

comporte neuf jnnas.


aksa
Bouddha

= indriyaparopariyatta, Vibbanga, 340, Patisambhida,


la

i.

121

indriya,
les aspira-

rendu dans
sont faibles,
2.

stance par

le

sait si les facults des tres (foi, etc.)

etc.

(parpara).

adhimukti

adhimoksa = ruci
:

(Vibhanga plus dvelopp). (i. 20 c) le Bouddha connat


;

tions des tres, leurs gots.


3.

iti

le

Samghabhadra explique prvbhysavsansamudgata sayo dhtur Bouddha connat les dispositions mentales qui rsultent d'habitudes
vii.

anciennes. Sur vsan,


ga, 340.

30

c,

32 d

sur saya,

Vibhanga diffre et place la


septime bala.

iv. p. 174,

176, vi. 34,

Vibhanetc.,

connaissance de Vsaya, anusaya,

dans

le

4. pratipado narakdigminyah j narakagaminl pratipad yvad devagdmini nirodhagmini ca / tatra y narakdigminyah pratipadas ta hetuh / pratipadyante tbhir iti krtv j mrgo 'pi pratipad ucyate tena hi visamyogah pratipadyate I nirodhas tu katham sa cpi pratipat j pratipadyate tain iti krtv pratipatphalam va pratipad ity ucyate \ / ata evha / yadi saphal pratipad grhyata iti / / hetur hi sarvatragminpratipad isyate / / tath hi vycaksate sarvatragaminipratipajjnnabalam j satkyasamudaya[nirodha]gminity artha iti j tatra satkyah paicopdnaskandhh j samudaya utpda ihbhipretah / satkyanirodho visamyogah j tatra sarvatra gantum slam asy iti sarvatragmini / sarvatragmini csau pratipac ca sarvatragminlpratipat / taj jiinam tad eva ca balam iti sarvatragminpratipajjnnabalam. Le savoir relatif au nirodha n'est inclus dans le savoir du chemin (pratipad) que si on entend pratipad pralipatphala ; en effet la pratipat n'est pas la cause du nirodha alors qu'elle est la cause des destines. Le Vibhanga (p. 339) n'envisage pas la pratipad du Nirodha le Patisambhid&magga en tient compte.
I

Hiuan-tsang,
8-9.

xxvii, fol. 1 b-2 a.

71

Le prvanivsaj finabala

la force

de la connaissance

des anciennes rsidences

et le

cyutyupapdajhnabala
et
,

la
:

force de la connaissance de la
ces deux forces sont savoir

mort

de la renaissance des tres

mondain
est six

sanivrtijnna.

10. L' sravaksayaj finabala

la force de la connaissance de la
j flnas ou dix jnnas.
soi, la

destruction des

vices

On

peut

considrer Y sravaksayaj fina en


tion des vices qui

connaissance de la destruc-

comporte dharmajhna, anvayajfina, nirodha;

j flna, ksayaj fina, anutpdaj fina et sanivrtijnna entendre par sravaksayaj hna
srie

on peut

lejnna
:

qui se produit dans une


les dix

d'o les

vices
srie.

ont t expulss

jnnas

existent

dans semblable

Quant aux

terres qui servent de point d'appui

aux forces

30

a-c.

La

force des anciennes rsidences et la force de la mort-

renaissance dans les

dhynas

les autres

dans toutes

les terres.

'

Le prvanivsaj fina
les

et le

cyutyupapdaj flna ont pour

terre

dhynas ; les autres forces sont de toutes les terres, Kamadhatu, angamya, quatre dhynas, dhynntara, quatre rpyas.
Quant au corps (sraya) dans lequel
en s'appuyant sur
le

elles naissent, elles naissent

mle du Jambudvlpa (jambudvipapurmle

srayni), c'est--dire dans

Bouddha, car
*

les

Bouddhas n'apparais-

sent pas en dehors du Jambudvlpa.

Ce dcuple

savoir, chez les autres, ne reoit pas le

nom

de bala

force

c'est

seulement dans la srie du Bouddha


il

qu'il est

appel

bala, parce que, ailleurs,

est entrav (vyhatatvt).


3

30

c-d.

Pourquoi ? Parce que sa force ne connat pas d'obstacle.

1. shon gnas hchi hpho skye bahi stobs / bsam gtan dag na lbag pa ni / sa rnams kun la 2. anyatra buddhnutpdt. Sur l'expression jambusandagata, iii. 41

la

fin.

3. ci yi

phyir

hdihi stobs
//]

gan pbyir thogs

rai

mnah

[kutas tasya

balam

avyhatam yatah

72

CHAPITRE

VII,

30

c-31.

Le savoir qui connat sans obstacle tous


est

les objets

de connaissance

nomm

bala. C'est pourquoi les dix balas n'existent que chez le


le

Bouddha, parce que


son gr, tous

Bouddha, ayant expuls tous


vii.

les vices

(sra-

va) et toutes les traces (vsan, voir


les objets. Il n'en

32

d) d'ignorance, connat,

va pas de

mme

des savoirs des


le

autres, et par consquent

on ne donne pas ces savoirs

nom

de

balas.
C'est ainsi que, d'aprs la tradition, Sariputra refusa

un

homme
petit

qui sollicitait l'admission dans l'Ordre (pravrajypreksapiirwsapra-

tykhyna)
par

'

il

ne fut pas capable de voir [2


2

b] le

nombre,

ou

grand, des naissances antrieures


le

et postrieures

du pigeon chass

faucon
le

(?).

Pour

Bouddha, son savoir s'exerce sans obstacle,


p. 82).

la force de

sa pense est infinie et enveloppe tout objet (Voir

Si telle est la force de sa pense, quelle est la force de son corps ?

31. La
1.

force

nryana dans son

corps, d'aprs d'autres, dans ses

C'est l'histoire raconte dans Stralamkara d'Asvaghosa, trad. Huber, p. 283.

Kiokuga Saeki renvoie Nanjio 1322 on l'histoire est beaucoup plus dtaille, Tokyo, xiv. 9, fol. 25-28, Dsanglun de Schmidt, 107-128. Voir aussi Zapiski, vii. 281, 286 et Revue Histoire des Religions, 1903, i. 323. Le hros s'appelle Srvrddhi. [D'aprs une note de P. Pelliot] Kiokuga signale encore Vibhasa, 102, 17. La Vyakhya explique Sariputra chercha vainement voir dans la srie de cet homme une racine de bien devant produire la dlivrance (moksabhglya, iii. 44 c, iv. 124, vi. 24 c, vii. 34), et par consquent refusa d'admettre cet homme. Mais Rhagavat vit cette racine de bien et lui confra la pravrajy. A son occa:

sion Dhagavat, interrog par les Rhiksus, dit

Il

fait

une action

telle qu'il
....

obtenu
reste
.

la qualit d'Arhat.

Car

les actions

ne mrissent pas dans l'eau

et le

Et

il

dit

moksabjam aham hy asya susuksmam upalaksaye dhtupsnavivare nillnam iva kficanam //


(Cit aussi Vyfikhy&,
2.
i,

p.

traduit par Rurnouf, Lotus, p. 340.)

Paramfirtha

On

rapporte aussi que


le

pigeon chass par l'pervier


et la fin

Sariputra ne fut pas capable de savoir

commencement

de ses renais-

sances [en qualit d'oiseau


:

?] .

La Vyakhya porte upapattydiparyantjnnam ceti / disabdena cyutiparyantjnnam, c'est--dire [Il y eut aussi ignorance [de Sariputra] en ce qui
:

concerne la limite des naissances et des morts [du pigeon

....].

Hiuan-tsang,
articulations
;

xxvii, fol.

2 a-b.
srie qui

73

c'est la force

du septime terme d'une

com;

mence par

l'lphant et dont chaque terme vaut dix

fois le

prcdent

elle consiste

en tangible.
est le

'

nryana
La

nom

de la force et aussi
;

sde cette force, Narayana


force du

de

nom de celui qui mme cnra, mahnagna.


le

pos-

corps de

Bouddha

est gale celle de

Narayana.

D'aprs d'autres, chaque articulation (samdhi) possde cette force

(samdhisv anye).
Bhadanta,
le

matre Darstntika, dit que la force corporelle est

comme
tait

la force

mentale (mnasa), c'est--dire


le

infinie

car, s'il

en

autrement,
2

corps deBhagavatne

pourrait supporter un savoir

(j flna) infini.

Les Bouddhas ont des articulations de ngagranthi


kas des articulations de amkal
de anku.
3

les

Pratye-

les

Cakravartins des articulations

Quelle est la mesure du bala

prkrtahastin,
1.

gandhahastin,
yi stobs
/

Soit la srie nomm nryana ? mahnagna \ praskandin, [3 a]

sku

Ja sred

med bu
/

gzban dan tbsig na glan cben sogs

bdun eu

glags par stobs yin no

de ni reg byahi skye mebed do


/

nryanam balam kye samdhisv anye dasdhikam


hastydisaptakabalam [sprastavyyatanam ca
Yogastra,
2.
iii.

tat

//]

24, sur l'acquisition


8.

de la force d'un lpbant,


Stra,
le

etc. la force

Vibhsa, 30,

Comme dit
la

le

corps du Bodhisattva a
:

de

mesure de cette force ? Il y en a qui disent La force de 19 taureaux est gale la force d'un ho-nieu (taureau qui a de longs poils aux articulations des jambes, Couvreur).... Il y en a qui disent Cette mesure est trop petite. Dans le corps du Bodhisattva, il y a 18 grandes articulations chacune la force de Narayana ... Le Mahabhadanta dit Cette mesure est trop petite. De mme que la force de la pense est infinie, de mme la force du corps. Comment le savons-nous ? .... Quand le Bodhisattva prit la rsolution Je ne me
Narayana. Quelle est
: :
:

lverai pas avant d'avoir obtenu la


six manires,
3.

mais

les

Bodhi .... , le grand chiliocosme cheveux mme du Bodhisattva ne bougrent pas


:

s'agita de

samdhisv anye. Vyakhya satndhisv anya ity uktam j asthisamdhiviesopanysah / ngagranthir iti vistarah / ngagranthisamdhayo buddhh / ngapso ngagranthih am. kalsamdhayah pratyekabuddhh satkusamdhaya cakravartinah. 4. Sur les Mahanagnas, Divya, 372, Burnouf, Introduction, 363, Lotus, 452. Canra est un ennemi de Krsna.
Ceci est l'explication de l'opinion des autres
/ /

74

CHAPITRE
l
.

VII,

31-32

c.

varnga, cnra, nryana


fois
la force

La
:

force de chaque terme vaut dix

du terme prcdent
de suite.
il
2

dix prkrtahastin font un

ganmais

dhahastin
dix

et ainsi

D'aprs d'autres,

en va ainsi pour

les six

premiers termes

cnuras

valent un demi-nryana, et deux

demi-nryanas
de la force corpo3

valent la force

nomme nryana.
livre,

D'aprs l'auteur de ce
relle

parmi

les dfinitions

du Bouddha,

celle-l est juste qui fait cette force la plus grande.

La

force corporelle du

Bouddha

est,

de sa nature, du tangible (spra-

stavyyatana). Elle consiste en des grands lments d'une nature


spciale \

D'aprs d'autres, au
(I.

contraire, elle est

un rpa driv

des grands lments \ mais un


bles drivs, laksnatva, etc.

rpa
10
>

driv diffrent des sept tangi6

d).

Quant aux quatre


1.

assurances
(qui

(vaisradya)

7 :

Dans Mahavyutpatti, 252

dpend du Kosa), varnga prcde praskan-

din.
2.

D'aprs Paramartha, remplacer dix par cent.


porte

3. L'original

Pourquoi ? Parce que


:

yath tu bahutaram tath yujyate. Paramartha ajoute la force du Bouddha est sans mesure . La Vyakhya
:

dit

L'auteur dfend la premire opinion, pour cette raison que, autrement,


la force

le

corps du
4.

Bouddha ne pourrait supporter mahbhtaviesa eva.

d'un savoir infini

5.
6.

bhautika, updya rpa. Quatre opinions dans Vihhasa, cinq dans Samghahhadra.

7.

Le Stra (Ekottara,
ii.

19,

15),

cit

dans

la

Vyakhya,

est trs proche d'Angut-

tara

8 (vesrajja)

catvrmni ripiitra tathgatasya vairadyni yair vairadyaih

samanvgatas tathgato 'rhan samyaksambuddha udram arsabham sthnam pratijnti brhmam cakram (Kosa, vi. 54) pravartayati parsadi samyak simhandam nadati katamni catvri samyaksarnbuddhasya vata me sata ime dharm anabhisambuddh ity atra mm kacic chramano va brhmano va saha dharmena codayet smrayet tatrham nimittam api na samanupasymi evatn chatn nimittam asamanupayan ksemaprpta ca viharmi abhayaprpta ca vaisradyaprptas ca udrani Mme texte cit dans Vijnanakaya, xxiii. 9, 13 a, qui porte arsabham chramano va brhmano va devo va mro va brahm va
/ / j
:

Dans Majjhima,
Mahfivagga,
i.

i.

501, les vesrajjas sont attribus tous les Arhats


le

comp.

Dans le fragment du Samjukta, JRAS. 1907, p. 377, de maison Srona est vaisradyaprpta (pithte du Srotapanna).
6. 32.

Matre

Hiuan-tsang,

xxvii, fol.

3 a-b.

75

32

a-c.

L'assurance est quadruple, semblable la premire, la


'

dixime, la deuxime et la septime force.

Le Bouddha possde quatre assurances qui sont expliques dans


le Sitra.
1.
2

Semblable

la

premire force (sthnsthnajhnabala), la

premire

assurance,

sarvadharnibhisambodhivaisradya

elle

consiste en dix jhnas, elle s'appuie sur toutes les terres.


2.

Semblable

la

dixime force (sravaksayajhnabala), la


six

deuxime assurance, sarvsravaksayajnnavaisradya,


j flnas, de six terres.
3.

ou dix

Semblable

la

deuxime force (karmavipkajhnabala),

la
2
,

troisime

assurance,

antaryikadharmavykaranavaisradya

huit jhnas, de toutes les terres.


4.

Semblable

la

septime force (sarvatragminlpraUpajjhna-

bala), la quatrime assurance,

nairynikapratipadvykaranavailes terres.
le

radya, dix ou neuf jhnas, de toutes

Comment

des savoirs (jhnas) peuvent-ils recevoir

nom

de

vaisradya, assurance ?
sence de crainte
fait qu'il sait
etc., le

Le mot
En

vaisradya

signifie [3 b] ab-

(nirbhayat).

raison des savoirs, en raison du

avoir compris tous les

dharmas,
jhna.

dtruit tous les vices,


les

Bouddha est assembles. Donc le vaisradya

exempt de crainte (nirbhayo bhavati) dans


est

notre avis
3

le

vaisradya, tant

l'effet

du jhna,

n'est pas

jhna

de sa nature.

Le jeune lion (kisora) possde vaisradya, Bodhicarya, vii. 55. Les vairadyas du Bodhisattva, Mahavyutpatti, 28, Dasabhmi,
makavalara, 320.

viii,

Madhya-

Etymologie du mot vaisradya, Wogihara, Bodhisattvabhmi (Leipsick, 1908),


p.

4L
1.

mi hjigs pa bdun pa bzbiu.


2.

ni

rnam pa bzhi

ji

ltar stobs ni

dan po dan
...

bcu pa gnis pa

Les lectures de Mahavyutpatli,

8, diffrent
....

un peu

3.

antaryikadhar-

mnanyathtvaniscitavykarana
:

4.

sarvasampadadhigamaya nairy-

nikapratipattathtvavaisradya. 3. Paramartha diffre Comme ces absences de crainte sont ralises par le jnna, on nomme le jnna du nom de vairadya. Quelle est la raison des

76

CHAPITRE

VII,

32-33.
?

Que sont

les trois

smrtyupasthnas du Bouddha
et conscience.
'

32
Le
1.

d.

Trois sont mmoire


2

Sitra

explique au long les trois smrtyupasthnas du Bouddha:

Lorsque

les disciples,

unanimes, coutent respectueusement, accepil

tent et pratiquent son


tion,
2.

enseignement,

n'prouve ni

joie, ni satisfac-

mais

il

demeure

indiffrent, en pleine

mmoire

et conscience.
et

Lorsque

les disciples

unanimes, n'coulent pas, n'acceptent


il

ne

pratiquent pas son enseignement,


tience,
3.

n'prouve ni dplaisir ni impa-

mais

il

demeure

indiffrent, en pleine

mmoire

et conscience.

Lorsque, de ses disciples, les uns coutent, acceptent et pratiquent


les autres, n'coutent pas, n'acceptent et
il

son enseignement,

ne prati-

quent pas son enseignement,

n'prouve
et

ni joie, ni dplaisir,

mais

demeure
trois

indiffrent en pleine

mmoire

conscience [4

a].

Ces

smrtyupasthnas

sont, de leur nature,

mmoire

et conscience

(samprajanya).
quatre vaisradyas ? L'utilit personnelle et
sont utiles au Bouddha lui-mme
les
et
;

l'utilit d'autrui.

Les deux premiers

les
ils

deux derniers sont

utiles autrui.
le

Ou

bien

quatre sont utiles autrui, car


le discours.

expulsent toute souillure et chez

prcheur
tray-

dans
1.

dran dan es bzhin bdag nid gsum


II]
:

= [smrtisamprajnntmakam

ant

La Vibhasa remarque Ces trois smrtyupasthnas sont compris dans le sthnsthnajiinabala, dans les six satatavihras (voir iii. 35 d, la fin). 2. trnmni bhiksavah smrtyupasthnni yny ryah sevate / yny ryah sevamno 'rhati ganam anussayitum / katamni trni / iha bhiksavah sst srvaknm dharmam desayati anukampakah kruniko 'rthakmo hitais karunyamnah / idam vo hitya idam vo sukhdya idam vo hitasukhya / tasya te srvakh usrsante rotram avadadhati jcittatn upasthpayanti pratipadyante dharmasynudharmam prati na vyatikramya variante sastuh asane / tena tathgatasya na nand bhavati na saumanasyarn na cetasa utplvitatvam / upeksakas taira tathyato
viharati smrtah satnprajnann
Lorsque

idam prathamam smrtyupasthnam yad


'rhati

ryah sevate yad ryah sevamno


les disciples ont l'attitude

ganam anusayitum

...

tathgatasya nghto bhavati nksntir nprafyayo na cetaso 'nabhirddhih. Comparer Majjhima, iii. 221 (trs proche) et i. 375) Mahavyutpatti, 11.
contraire,
;

utplvitatvam, voir BodhicarySvatara, samuccaya, 183, 6.

p. 13, n.

manasa

utplavah, SiksS-

Hiuan-tsang,

xxvii, fol.

3 b-4

a.

77
les

Mais un Srftvaka dlivr des vices (srava), que


(slsija) soient respectueux

disciples

respectueux et

(nrsamna), ou non respectueux, ou non respectueux, n'prouve ni joie (nand == anu-

naya),

(gkta=dvesa=nandya), ni joie et dplaisir. Pourquoi considrer les trois smrtyiipasthnas comme des dharmas
ni dplaisir

Bouddha ? Parce que le Bouddha a abandonn joie et dplaisir avec leurs Ou bien parce que les disciples sont traces (savsanaprahnt) il est admirable que le Bouddha n'prouve les disciples du Bouddha
propres au
'.

ni joie, ni dplaisir,

de leur respect ou de leur disrespect sont pas les disciples des


'

au conils

traire les disciples

ne

Sravakas dont

reoivent l'enseignement

l
:

rien d'admirable ce

que ces Sravakas

n'prouvent ni joie ni dplaisir.

33. La grande
lence

piti,

mahkarun,

est

pense d'ordre mondain,

grande par ses facteurs, ses aspects, son


;

objet,

son galit, son excel3

elle diffre de la piti,

karun, huit points de vue.

La grande
mondain
(karun,

piti est,

de sa nature,
le

prajn de samvrti, savoir

d'ordre

(vii.

b).

Dans

cas contraire, elle serait, de sa nature,

absence de haine (advesasvabhv)


viii.

comme
elle

est la piti tout court

29)

comme
4

la piti tout court, elle

ne porterait pas

sur les tres des trois sphres d'existence,


trois sortes

n'envisagerait pas les

de douleur.
piti

Pourquoi la
1.

de Bhagavat est-elle

grande
;

En

raison de ses facteurs (sanibhrena)

elle est

produite (sa-

yatkleacaritah 1. k punar iyam vsan nma / rvaknm yo prvatn tasya tatkrtah kyavkcestvikrahetusmarthyaviesa citte vsanetyucyate / avykrta cittavieso vsaneti bhadantnantavarm.
2.

buddham
thugs
rje

tiddisya pravrajit

iti.
/

chen po kun rdzob blo thsogs da rnam pa spyod yul dan pahi phyir dan chas chehi phyir / tlia dad bya ba rnam pa brgyad
3.

nifiam

[mahkrp samvrtidhh sambhrkrayocart samatvd adhimtratvn nnkaranam astadh


]

II]

Voir Asahga, Strlamkara,

xvii.

43

Divya, 359

(la

krp du
p.

Srfivaka)

compa-

rer les stances Divya, 96, 125 et


4.

Huber, Strlamkara,

284.

triduhkhatkr na sidhyet.

78

CHAPITRE

VII,

33-34.

mudgama,
2.

nirvrti) en effet par une grande provision


'

(sambhra)

de mrite (punya) [4 b] et de savoir (jiina).

En

raison de ses

aspects
:

(krena), de la modalit sous

laquelle elle

prend les choses

elle

considre les choses

comme

pni-

bles en raison de la triple douleur,

duhkhaduhkhat, parinma2
,

tandis que la piti n'envisage dihkhat, samskraduhkhat (vi. 3) que la duhkhaduhkhat. 3. En raison de l'objet (lambanena), car elle a pour objet les
tres des trois sphres.
4.

En

raison de l'galit (samatvena), car elle porte galement sur

tous les tres (samavrttitvt) pour leur bonheur (sukha) et leur


flicit (hita).
5.

En

raison de son excellence, car aucune autre piti ne la sur3

passe (tato 'dhimtratarbhvt).

La grande
1.

piti diffre

de la piti

Quant

la nature.

La

piti est

advesa, absence de haine

la

grande
vatvt).
2.

piti est

amoha, absence d'ignorance (advesmohasvabh-

Quant
piti

l'aspect.

La

piti

prend
triple

forme d'une douleur

la

grande
ratvt).

prend forme de la

douleur (ekatriduhkhatk-

la 1. Les Paramitas de don, moralit et patience sont la provision de mrite Paramila de prajn est la provision de savoir. La Paramita de recueillement on de dhyna ressortit au mrite, en tant qu'elle elle ressortit au savoir en tant est la culture des quatre apramnas (viii. 29)
;

qu'elle est la culture des trente-sept

adjuvants de

la

Bodhi
:

(vi. p.

281)

La Paramita d'nergie ou vrya est aussi double emploi na hi vin vlryena dnam dlyate silam samdlyate ksntir bhvyata iti ptmyasambTirabhagyam vryam bhavati / tath nntarena vlryam prajn bhavati .... Mme doctrine dans le Grand Vhicule (o on explique que les Paramitas sont
Paramitas par
le fait

de

la Prajn),

Bodhicaryavatara,

ix. 1.

Quand et comment le Bodhisattva pratique les Paramitas, Kosa, iv. 111. yasmt tisrbhir api duhkhatk2. krena / triduhkhatkarand iti rair krayati na duhkhatayaiva karunvat. Sur karana, ii. 34 b, vi. 18 a. 3. Excellence qui rsulte notamment du samskraduhkhatkra, de la praprajnsvabhvatay tlksnataratvt. "tsvabhvat.
/

Hiuan-tsang,
3.

xxvii, fol.

4 a-5

a.

79
;

Quant

l'objet.

La

piti porte

sur les tres d'une sphre

la

grande
4.

piti porte

sur les trois sphres.

Quant

la terre.

La

piti est

du domaine des quatre dhynas

'

la

grande

piti,

du domaine du quatrime dhyna (caturdhydnaca-

tuHhadhynabhmikah'). 5. Quant la personne qui


nat

lui

sert de point d'appui.


2
;

La

piti

dans

la srie des

Sravakas,

etc.

la

grande

piti

dans

la srie

des Bouddhas.
6.

Quant
;

l'acquisition.
la

La

piti s'obtient
le

par

le

dtachement du

Kamadhatu
7.

grande

piti

par

dtachement du Bhavagra (kma-

bhavgravairgyalabhyatvt).

Quant
Quant

la protection.

La

piti

ne protge pas, la grande

piti

protge (aparitrnaparitrnatas) \
8.

la piti.

La

piti est

une

piti ingale
;

elle

ne compatit
piti est

qu'aux tres souffrant (duhkhitnm eva)


piti

la

grande

une

gale,

verse sur tous les tres galement (tidytulyakaru10].


les qualits qui

nyandt). [4 b

Nous avons expliqu


ils

appartiennent aux Bouddhas


tres.

en propre et qui les distinguent des autres semblables entre eux ?


Oui, sous certains rapports
;

Les Bouddhas sont-

non, sous d'autres. [5 a]


et le

34. Pour
4

le

sambhra,
pareils
;

le

dharmakya

service des tres, les

Bouddhas sont
taille, etc.

non pas pour

la dure de la vie, la caste, la

1. Dans cette formule, on prend, avec le premier dhyna, X'angamya dhynntara. En fait, la piti est de six bhmis.

et le

il faut entendre les Pratyekas et les Prthagjanas. Sravakas ont simplement piti (karunyante) ; ils prouvent commisration, affliction ils ne protgent pas de la terreur du samsara. Mais Bhagavat, ayant piti avec la mahkarun, protge de la grande terreur du

2.

3.

Par Par

Sravakas,

etc. ,

la

karun,

les

samsara. karunay rvakdayah karunyanta eva kevalam j anuglyanty evety arthali. 4. sans rgyas thams cad tlisogs da ni / chos sku hgro bahi don spyod pas / mfiam pa nid de sku thse dpag / rigs dan sku yi thsod kyis min smbhradharmakybhym jagata crthacaryay / samat sarvabuddhnm nyurjtipramnatah //

80

CHAPITRE

VII,

34.

Les Bouddhas sont pareils


antrieures, galement
a.
I.

en ce qu'ils ont, dans


et

les existences

accumul mrite
iv.

savoir (prvapunyajn-

Diffrences entre les Bouddhas, Kosa,

102, trad. p. 212, Bodhisattvabhumi,


;

vii,

vatthu, xxi. 5
la

Wassilieff, 286 (314) KathaTheravdin admet diffrences, vemattat, pour le corps (srra), dure de vie et l'clat (pabh) l'Andhaka admet d'autres diffrences
:

Mnson

1911, 173 (vie, nom, gotra, corps)


le

la

Milinda, 285 (diffrences entre les Bodhisattvas, famille,


vie, taille).
b.

poque, dure de

Ci-dessous

p. 81, n. 3.
vii.

Vasubandhu groupe,
1.

28-34, les lments d'une Bouddhologie. Intressants


:

ce point de vue les passages suivants du Kosa


i.

Bouddha et de celle des autres saints omniscience (aussi Kosa, ix). Le Bouddha et le Bodhisattva sont des Bhagavats. ii. 10. Abandon des yuhsamskras ; victoire sur les quatre Maras. ii. 44, vii. 41 d, 44 b. Toutes les qualits (guna) acquises par le dtachement
Diffrence de la science du
;

et actualises
ii.

son gr. Conqute de la Bodhi en trente-quatre moments. ii. 62. Connaissance de l'avenir. iii. 94. Epoque de l'apparition des Bouddhas. iv. 12. Pense avykrta, pense non-recueillie le Nflga. iv. 32. Culte du Bouddha. iv. 32. Le Dharmakya, refuge le Rpakaya. iv. 73. Accepte les dons fails au Stupas.
44, vi.

24

a.

iv. iv.

102. Rtribution

de ses actes anciens.

102. Schisme.
109.

iv. iv.

109,

Tmoin des Bodhisattvas, objet de leur pense. vii. 30, 37, 42. Mmoire du Bouddha.

iv.
vi.

121. Culte des Caityas.


59.

viii.
c.

28.

Chute de la jouissance des recueillements. Conqute de la Bodhi par le quatrime dhyna.


Bodhisattva
et

Sur
94,

le
iv.

particulirement

le

futur

Bouddha Sakyamuni,
(iv.

iii.

108-112, origine, vu, pratique des Paramits

117),

dure de

la

que le Bodhisattva est naturellement charitable, iii. 94 a), dveloppement des marques. iv. 106, meurtre du Bodhisattva. vi. 23, changement de vhicule, naissances animales du Bodhisattva. Dernire naissance, iii. 9, jarytija et pourquoi (reliques) 13 a, forme d'lphant 17 a, conscience la conception, etc. 41, Prthagjana jusqu' l'arbre 53 d, le Vajrasana 85 a, exempt de mort avant le temps. [D'aprs Karanapracarrire (parce
;

jfiapti,

Cosmologie,
;

p. 327,

explication des

marques
;

331, pluie de fleurs


il

332, 334,
il

vie utrine est de

333, miracles la naissance

335, pourquoi

a un

fils,

pourquoi

bonne famille, pourquoi il ne nat pas dans tel continent, etc. Sur la mre du Bodhisattva, meurt le septime jour, 331, 337 enceinte, est l'abri du
;

feu, etc.].

Hiuan-tsang,
;

xxvii, fol. 5 a.

81

nasmbhrasamudganiatas) en
galement
le service d'autrui

ce qu'ils ralisent le
'

mme
2

dhar-

makya (dharmakyaparinispattitas)
Mais
les

en ce qu'ils

procurent

(arthacarysampdanatas).

Bouddhas

diffrent par la diffrence de la dure de la vie,


etc.

de la caste, du gotra, de la dimension du corps,

D'aprs l'poque
ils

ils

apparaissent, leur vie est longue ou courte,


ils

sont ksatriyas

ou brahmanes,

appartiennent au Gautamagotra ou au Kasyapa-

gotra, leur corps est

grand ou

petit.

Le mot

et

ctera indique

le

Dharma des Bouddhas dure longtemps ou peu de temps, suivant que, au moment de leur apparition, les tres convertir sont droits ou
tors.
3

Tous
tion

les

hommes
4

intelligents qui rflchissent sur la triple perfec-

(sampad)

des Tathagatas produisent ncessairement leur

endroit une profonde affection, un profond respect. Cette triple perfec1.

khy)

ansravadharmasamtno dharmakyah rayaparivrttir va (Vy= Le Dharmakaya est la srie de dharmas purs (Kosa, iv, 32) ou un
/
;

renouvellement de l'organisme psycho-physique, de la personnalit (sraya). Quelques exemples du renouvellement de la personnalit, iv, 56, trad. p. 123
voir
viii.

34

d.

Sur

le

dharmakaya
:

de la mre du Bouddha, d'un Upfisaka

entr dans le chemin, Huber, Stralamkra, 217, 390.

Dgha,

iii.

84 (Ajjannasutta)
iti

dhammakyo
Souvent

pi

brahmakyo

Tathgatassa hetam Vsettha adhivacanam iti pi dhammabhto iti pi brahmabhto iti


iii.

plti (Fragments du commentaire dans Dialogues,

dharmakaya

81).
le
1,
;

le

corps des critures ==


;

deuxime ratna, Divya,

396, Przyluski, Aoka, 359, etc.

BodhicarySvatara,

i.

943

Abhisamayalamkara, vi. 2-11 JRAS., 1906, du livre iv. 2. svargpavargakranam artho lokasya tasya sampdanam arthacary (Vyakhy) 3. On ne voit pas que le mot di soit fourni par la karika sanscrite ou tibtaine. Paramfirtha Le mot et ccetera indique la dure de la loi, la destruction ou la non destruction des reliques, etc. Telles sont les diffrences dues l'poque o les Bouddhas apparaissent . Epoque des sept Bouddhas, caste, gotra, dure de la vie, arbre, etc., dans Mahapadanasuttanta, Dgha, ii, 1 et Drgha, 1, 8. La loi de Kasyapa dure huit jours celle de Sakyamuni dure mille ans (voir viii. 39). Kosa, iii. 93 a. 4. Perfection est un terme commode plus qu'exact. L'expos du Kosa est souvent clair par les thories de Grand Vhicule qu'on trouve notamment dans Bodhisattvabhmi (par exemple l re partie, chap. V, sur le prabhva, Muson,

Grand Vhicule,
;

citons seulement
;

Burnouf, Introduction, 224

Si-yu-ki, fin

1911, p. 155).

82

CHAPITRE

VII,

34.
[5 b] qui consistent

tion est la perfection des causes

(hetusampad)
;

dans l'quipement de mrite

et

de savoir

la perfection

du

fruit

(pha-

lasampad) qui consiste dans le dharmakya ;la perfection du bienfait (upakrasampad) qui consiste dans le service du monde (jagadarthacary).
i.

La hetusampad

est

quadruple

1.

exercice dans l'accumulation


'

de toutes

les qualits et

de tous les savoirs


3
;

2.

exercice prolong

2
;

3. exercice

sans interruption

4. exercice zl \

ii. La phalasampad est quadruple, car la ralisation du dharmakya comporte quatre perfections, de savoir, d'abandon, de puissance et de corps matriel (jnna, prahna, prabhva, rpakya).
3

a.

Perfection de savoir
c'est--dire
8
,

1.

savoir non enseign


les

6
;

2.

savoir univer-

sel

7
,

connaissance de tous

caractres propres; 3. savoir

omniforme
4.

c'est--dire
9
,

connaissance de toutes les manires d'tre;

savoir spontan
1.

connaissance par simple dsir de connatre.


:

sarvagunajnnasambhrbhysa
;

les qualits la

cinq Pfiramitas
cice
2.

les savoirs

= punah punah

(jnna) sont prayogah.


:

Prajaparamita.

(guna) sont de leur nature abhysa, exer-

cise, iv. p. 224).

six
ii.

dlrghaklbhysa tribhir asamkhyeyair mahkalpaih (Doctrine pr nanda pense que devenir Bouddha par une mditation de (Chavannes, Cinq cents contes, ans, c'est devenir Bouddha hien aisment
....

lOOj.
3.

nirantarbhysah / asntaratay. satkrtybhysah / tvrdaratay. 5. dharmakyaparinispatty jnndisampada catasro bhavanti. 6. anupadistajnnam svayam abhisambodhanrthena. 1. sarvatra jnnam iti niravasesasvalaksanvabodhanrthena. 8. sarvath jnnam iti sarvaprakrvabodhanrthena (Vyakhy). Toutefois, d'aprs la glose de l'diteur japonais qui suit Fa-pao, le sarvatra jnna s'entend de la connaissance des caractres communs (smnyalaksana),
4.

impermanence,

etc.

de ce point de vue tout Arhat connat toute chose (voir


:

Vyakhya, i. 15, p. 39 pas de salut pour qui ne connat pas tout dharma) ; et le sarvath jnna est la connaissance des caractres propres, laquelle est venika, propre au Bouddha (Voir la stance sur la queue du paon, Vyakhya, i. p. 6, et Kosa, ix. trad. Hiuan-tsang, xxx. fol. 10 a). Comparer xxix. fol. 17 a. La Vibhasa, 74, 7, enseigne que le Bouddha, relativement aux douze yatanas, possde et sarvatra jnna et sarvath jnna ; tandis que Sariputra possde le seul premier jnna, qu'il doit l'enseignement du matre. 9. ayatnajnnam iti icchmtrvabodhanrthena.

Hiuan-tsang,
b.

xxvii, fol.

a- 6 a.

83
les

Perfection d'abandon:
2.

1.

abandon de toutes
traces

passions (Me;

sa)

abandon

dfinitif,

ou non susceptible de chute

3.

abandon

des passions avec leur vdsans, ou


liaison

parce qu'aucune

(anubandha) ne demeure
telle sorte

4.

abandon des obstacles saniest

dhisampatti, de
vr
c.

que

le

Bouddha

un doublement

dli-

(vi.

64

a).

'

Perfection de

puissance (prabhva)

1.

perfection

dans

la

matrise de cration, de transformation, de conservation d'un objet


extrieur
2
;

2. perfection
3
;

dans la matrise d'abandon

et

de prolongatra-

tion de la vie

3.

perfection dans la matrise du

mouvement
volume
4

vers les corps rsistants, travers l'espace, trs loin, rapide, et dans
la matrise de la rduction de corps tendus
4. perfection

un

petit

[6 a]

en qualits merveilleuses, multiples

et naturelles

sarvakleaprahnam iti traidhtukadaranabhaatyantaprahnam ity aparihnitah, 3. savsanprahnam ity anubandhbhvt, 4. sarvasamdhisampattyvaranaprahnam ity ubhayatobhgavimukteh (Vyakhya).
1.
:

prahnasampad

1.

vanheyakleoccliitth,

2.

vsan, ci-dessus
2.

p. 77.

Ou a bhyavisayanirmnaparinmdhisthnavaitvasampad, aprvabahyavisayotpdana nirmna ; asmdnm suvarndibhvapdana parinma ; dlrghaklvasthna = adhisthna. (Sur nirmna,

udhisthna, voir vii. 49 suiv.). 3. yusa utsarge 'dhisthne ca vaitvasampad. Voir Kosa, ii. trad. p. 120. Ekottara, 18, 16. Le Bouddha dit Sariputra Pourquoi ne demeures-tu pas un kalpa ou au del ? . Sariputra rpond C'est de Bhagavat mme que je tiens que la vie des tres est trs courte. La plus longue vie ne dpasse pas cent annes et comme la vie des tres est courte, la vie du Tathagata aussi est courte. Si le Tathagata continue vivre un kalpa, moi aussi je continuerai

vivre

un kalpa

Comment
si la vie

Sariputra peut-il parler ainsi ? Les tres ne sont

pas capables de savoir

du Tathagata
ii.

est longue

ou brve. Sariputra doit


22).

savoir qu'il y a quatre choses incomprhensibles du Tathagata. (Comparer les

quatre acinteyyas d'Anguttara,


4.

80, Sumangalavilasini,

i.

vrtkudraksipragamana-alpabahupravesa- vaitvasampad. paramnau bahnm hastydnm praveah ; alpe bahnm pravesah comparer le pouvoir de samksepa-prathana, texte de Grand Vhicule, JRAS.

1908, 45, et Dgha,


5. a.

ii.

109.

vividhanijcaryadharmasampad.
cite
le

C'est

le

sahajaprabhva de

Bodhisattvabhmi, Muson, 1911, 161.

La Vyakhya

Stra

dharmatais buddhnm bhagavatm yat

84
d.

CHAPITRE
Perfection du corps matriel
;

VII,

34-35.
perfection

(rpakyasampad)

1.

en marques (laksana)

2. perfection

en marques secondaires (anu-

vyanjna)

3. perfection

en force, c'est--dire possession du


le

bala

nryana

(vii.

31)

4.

en ce qui regarde

dedans (adhytmam),
(vajras-

perfection d'un corps dont les os sont

comme du diamant
le

rsthiarlratsampad)

en ce qui regarde
soleils.
:

dehors, mission de

rayons qui dpassent cent mille


iii.

L'upakrasampad

est quadruple
trois

1-3. dlivrer dfinitivement


;

(atyanta) de la souffrance des

mauvaises destines
;

4. dlivrer

de la souffrance de la transmigration
trois vhicules
;

ou bien

1-3. installer
l

dans

les

4. installer

dans

les

bonnes destines.

Telle est, en rsum

(smsika

= smksepika)
il

la perfection
fin.

du

Tathagata.

entrer dans le dtail,


s'ils

n'y a pas de

Seuls les

Bouddhas Bhagavats,
dire

prolongeaient leur existence pendant de


seraient capables de connatre et de
leur grandeur. C'en est assez
qualits, de savoirs, de puis-

nombreux asamkhyeyakalpas,
pour savoir que
les

(jnhim vaktum ca samarlhh)


Bouddhas, munis de

sances, de bienfaits infinis et extraordinaires (adbhuta), sont

comme

des mines de joyaux.

Cependant
qualits

= prthagjana), eux-mmes pauvres en jugeant d'aprs eux-mmes (svagunadridryena)


les sots

(bala

et

n'ont aucune aspiration spirituelle

ils

entendent vainement louer


ni

les

mrites du
ni

Bouddha

et
2

ne conoivent d'affection

pour

le

Bouddha

pour son Dharma.

[6 b]

yan

tesm gacchatm nimnasthalam ca samlbhavati yad uccam tan nlcbhavati ntcatn tacl uccbhavati andh ca drim pratilabhante badhirh rotram unmattli smrtim .... Ce sont, presque textuellement, les citrny caryni adbhutadharmh de Divya, 250-251. Comparer la citation dans Milinda, 179.
b.

Hiuan-tsang ajoute
;

ici

Ou

bien conversion de ceux qui sont


;

difficiles

convertir

solution des questions difficiles


les Trtbikas, etc.

enseignement qui conduit au salut

dompter M&ra,

1. apyatrayasamsraduhkhtyantatiirmoksasampad ynatrayasugatipratisthpanasampad va. VyfikhyS ye kecit prasdajth satpurus buddham bhagavantam astvisuh stuvanti stosyanti sarve ta etay tricidhay sampad. 2. evam ca tvad gunajnnaprabhvopakrnantdbhutamaliratnka:

Hiuan-tsang,

xxvii, fol.

6 a-b.
les qualits

85
du Boud-

Les sages, au contraire, entendant expliquer


dha, conoivent, l'endroit du

Bouddha

et

de son Dharma, une pense


des

de
os.

foi,

ou de

recours

qui pntre jusque dans la moelle


foi
',

Ces hommes, par cette seule pense de


infinie d'actions

franchissent une
2
;

masse

de rtribution non ncessaire

ils

obtiennent

d'excellentes naissances

humaines

et divines

et,

finalement, parvien-

nent au Nirvana. C'est pourquoi les Bouddhas Tathagatas, apparaissant dans ce monde, sont
le

suprme champ de mrite (anuttara


fruits certains

punyaksetra), car ce champ donne des


agrables (ista

(abandhya),

= divyavisaya), abondants (prakrsta prabhta),


Le Bouddha, en
une
effet,

rapides (u, expriments ds cette vie), et d'une excellente issue

(svanta

= nirvnaphalatvt).
cette stance
:

a lui-mme

proclam
dans
le

Si quelqu'un plante

petite racine de bien


il

champ de mrite que

sont les Bouddhas,


le

s'empare d'abord
(Ekottara, 24,
3

de bonnes destines et ensuite obtient

Nirvana

15).

Nous avons expliqu


35.

les qualits

propres au Tathagata.
lui

y a d'autres qualits (dharma) du Bouddha qui


les

sont

communes avec
jnna,
les

Saiksas

et les

Prthagjanas: Yaran, lepranidhietc.


4

pratisamvids,

les

abhijns,

Bhagavat possde d'innombrables


rs tathgath

qualits qui lui sont

communes

j atha ca punar blah svagiinadridryennumnabhtena hatdhimoksh .... buddham npriyante (= buddhe nadaram kurvanti). hatdhimoksa =s hataruci. 1. sraddhmtrakenpti niradhigamenety arthah (Sur adhigama, viii.

39

a).
2.

Les actions de rtribution ncessaire


.

(iv.

50) sont alatghanya,

infran-

chissables
3.

Quiconque, venu dans ce inonde, Paramrtha Bouddha, aprs avoir pris des naissances divines, obtient certainement le sjour immortel. Mais la Vyakhya akrn ity upakrn pjdikn. Donc Vasubandhu cite ici la stance Divya, p. 166 ye 'Ipan api jine krn karisyanti vinayake / vicitram svargam gamya lapsyante 'mrtam padam. (Sur Divya, xii, Lvi, Toung Pao, 1907, p. 107). 4. chos gzhan slob dan thun mon min (? yin) / kha cig so sohi skye bo dan / non nions med dan sinon nas ses / so so yan dag rig ranon sogs

D'aprs Hiuan-tsang.

plante un petit mrite dans

le

86
soit

CHAPITRE
avec
les autres

VII,

35-36.

ryas, soit avec les Prthagjanas aussi

aran-

samdhi, pranidhijfina, quatre pratisamvids, abhijhs, dhynas, rpyas, huit sampattis, trois samdhis, quatre apramnas, huit
vimoksas, huit abhibhvyatanas, dix krtsnyatanas,
trois
etc.

Les

premiers sont
etc.

communs au Bouddha

et

aux ryas;

les

abhijns,

dhynas,

peuvent aussi appartenir aux Prthagjanas.


le

En

ce qui concerne l'Arana, [c'est--dire


]'.

pouvoir d'empcher la

naissance de la passion d'autrui

Les Arhats savent que la souf;

france des tres est produite par leurs passions (klesa)


qu'ils

ils

savent

sont eux-mmes

le

meilleur des

champs de mrite (punya2


;

ksetra, iv. 103, 117 a);

ils

craignent qu'autrui ne produise leur


ils

endroit des passions [qui lui seraient particulirement nocives]

ranayati klesayatty arthah. 1. rana klesa. aranvihrin dans Divya et dans les sources plies (JPTS. 1891, 3). a. Voir Kosa, i. 8, o le Bhasya ran M klesa tmaparavybdhant, est expliqu ye hy ttnnam parms ca vybdhante te ran yuddhnity
: :

arthah.
Il

y a

trois

ranas, skandharana, vgrana, klearana.


i.

Aux

rfrences, Kosa,
;

trad. p. 13, ajouter


iv.

Maitr et Aranfi
fol.

Sances Ac.
;

de Belgique, avril 1921

Kosa,

56

Bodhisattvabhumi,

37 b et 83 a

Stra-

lamkara, xx. 45; Sarad Chandra Dfs, 1164. b. La Vibh&sfl numre les cinq moyens par lesquels PArhat vite de produire
la

passion d'autrui

1.

puret des attitudes (marche,


5.

etc.)

2.

savoir ce qu'il faut


il

dire et ne
si

pas dire

avant d'entrer dans


lui,

le village

pour mendier,

examine

homme
:

ou femme pourrait, cause de

produire passion.

c. La doctrine du Grand Vhicule, par exemple Nanjio 1183, diffre de celle du Kosa Le Pratyekabuddha n'arrte que les passions savastuka, le Bouddha arrte toutes les passions .... Le Bouddha se sert de nirmitas ou crations magiques .... . d. L'aran du Sravaka et celle du Bouddha sont dfinies Abhisamayalam-

kara,

vi.

srvakasyran drastrnrklesaparihrit / tatklesasrota-ucchittyai grmdisu jinran // L'aransamdhi d'un Sravaka Qu'il n'y ait pas naissance de passion de personne en me voyant (tnsmaddarsant kasya cit klesotpattih syt) .
:
!

Mais, pour les Tathagatas


des passions de tous les

elle
.

dracine, dans les villages,

etc.,

le

processus

hommes
;

2. Celui qui tue un Arhat commet un pch mortel , mme s'il ne sait pas que cet Arhat est Arhat, iv. 103 le moine qui insulte un moinillon, dont il ignore

la qualit d'Arhat, renat cinq cents fois

comme

esclave.

Hiuan-tsang,
ralisent

xxvii, fol. 6 b-7 b.

87

donc un savoir (jfina) de

telle

nature qu'autrui ne produira


etc.

pas leur endroit attachement sensuel, haine,

(rga, dvesa,

mna,
tres,

etc.).

Ce samskra

ce

savoir met un

terme, chez les


et

ce rana

querelle,
:

bataille,

cause de souillure
le

tourment

qu'est la passion (klesa)

il

reoit

donc

nom

d'Arana.

Quels sont

les caractres

du recueillement qu'on

nomme aran-

samdhi

?
est savoir d'ordre

36. L'Arana

mondain du domaine du quatrime


;

dhyna
un objet

produit par un

homme

qui est un Inbranlable. Elle porte

sur les passions (rana) du domaine du Kamadhatu, futures, ayant


rel.
'

Elle est

uniquement savoir d'ordre mondain, samvrtijnna


pour point d'appui
le

comme

il

rsulte de son objet. Elle a


est le meilleur des
66).

quatrime

dhyna, qui
agratvt,
vi.

chemins aiss (sukhapratipadm


par
les

Elle est produite


vi.

Arhats inbranlables
:

(akopyadharman,
passions

56) et non par les autres

car ceux-ci ne sont

pas capables de supprimer radicalement (parihartum) leurs propres

ils

sont en effet sujets la chute


les

plus
b].

forte raison

ne peuvent-ils arrter

passions d'autrui [7

Elle est produite

par l'homme, car

c'est

seulement un tre de destine (gati) humaine

qui peut la cultiver dans les trois dvlpas.


Elle porte sur les passions d'autrui,

du Kamadhatu, futures,

ayant

un objet
natre

rel

(savastuka)
!

Puissent les passions d'autrui ne pas


etc.

mon

sujet

Les passions savastuka sont rga, dvesa,

qui sont abandonns par la mditation

(bhvan)

(vi. 58).

Les passions d'autrui avastuka


la

(vi. 58),

qui sont abandonnes par


d'tre arrtes, car les

vue (darsana), ne sont pas susceptibles


(v.
2

klesas universels (sarvatraga)


terre,

12), portant sur l'ensemble de leur

portent aussi sur la srie d'autrui.

1. nou nions med pa kun rdzob ses / bsam gtan mthah na mi flfyohi chos skyed non nions hdod gtogs pa / ma skyes gzhir bcas spyod yul can

mis

2.

samvrtijnnam aran dhynntye 'kopyadharmanah / [nrjnutpannakmptasavasturanagocar //] Vyakhya sarvatragh sakalasvabhmylambanatvt parasamtaty:

88
Telle est l'Arana,

CHAPITRE

VII,

37.

37
tion

a-b.

Tel aussi est

le

Pranidhijnana

mais

il

a tout pour

objet.

'

Comme
, est,

l'Arana, le Pranidhijnana,

savoir rsultant de rsolu;

de sa nature, savoir d'ordre mondain


le

comme

l'Arana,

il

a pour point d'appui


d'un Inbranlable,
il

quatrime dhyna,

il

se produit dans la srie

est

mdit par un tre de destine humaine.


il

Mais, la diffrence de l'Arana,

porte sur tous les


les

dharmas.

Cependant
tant du

les

Vaibhasikas disent que

dharmas
le

de l'rpya-

dhatu ne sont pas connus d'une vue directe par

Pranidhijnana

quatrime dhyna, ce savoir ne porte pas sur une terre

suprieure. Ces

dharmas
:

sont connus par induction

(anumna).
dans une
l'rpya
;

En

effet,

on connat

1.

l'coulement (nisyarida) d'rpya, c'est-est la suite,

dire le

calme extrme (mandamandat) qui

existence subsquente, d'une existence antrieure


2. la

dans

conduite (carita) d'rpya, c'est--dire la pratique (vihra) des

rpyasampattis qui produiront une existence dans l'rpya,


et
le

on peut induire de

la

cause

l'effet et

de

l'effet

la cause.

Comme

laboureur connat la semence par


;

le fruit et le fruit

par la semen-

ce

de

mme

voyant une personne calme (sntamrti sattva), on


:

conclut (anuminoti)
elle

Elle est rene en


.

tombant de l'rpyadhatu,

natra dans l'rpya

lamban bhavantlti parihartum aakyh sarvatragh / Paramrtha donne sarvatragnm sakalasvabhmim lantbyotpdt parihartum asaky avastukh. L'Arhat fait qu'au trui n'ait pas haine son endroit, sans pour cela draciner la haine dans autrui il ne peut faire qu'autrui n'ait pas satkya:

drsti, ide d'une

personne

son endroit

car autrui,

s'il

a satkyadrsfi, a

satkydrsti l'gard de toutes les personnes . 1. sinon nas ses pa han de bzhin no / de yi dmigs pa thams cad do

= [tathpi

pranidhijnnam sakal]latnbanam
Abhisamayalamkara, vii. 8 sthitam / sarvaprasnpanud Sur le Pranidhijnana, ii. 62 a,
:

tu tat

anbhogam ansangam avyghtam sad bauddham pranidhijnnam isyate //


p.

303,

vi.

22

c, p.

172, ix. (Hiuan-tsang xxix. 9 a)

Mahvyutpatti, 48,
2. 3. J'interprte,

52.

nranvat kleamtrlambanam kim tarhi rpdylambanam api. d'aprs la Vyakhya, le Bhasya qui dit simplement rpys tu na skst pranidhijnnena jnyante / nisyandacaritavisest tu / karsakanidaranam ctreti vaibhsikh.
:

Hiuan-tsang,

xxvii, fol. 7 b-8 a.

89

Telle est l'opinion des Vaibhsikas. D'autres croient que le Prani-

dhijnana porte sur l'rpya, car


des Bouddhas.
'

il

n'est rien qui ne soit la porte

Celui qui veut produire le Pranidhijnana


rsolution

(pranidhiprvakam

commence par former une pranibhogaprvakam

dhya, bhujya) tendant


entre dans le quatrime
l'exercice prparatoire

la connaissance d'un certain objet


(viii,

il

dhyna prntakotika
sorti

41 a)

tel est
il

(prayoga). Aussitt

du recueillement,
2

produit [8 a] une connaissance exacte en conformit avec sa rsolution et dont le

domaine varie suivant


les

la force

du recueillement.

37

c-d.

De mme
'

Pratisamvids de dharnia, artha, nirukti,

pratibhdna.
1.

asty avisaya ity abhipryah. Le Pranidhijnana connait-il le futur ? Quelques-uns disent comparer-connaitre) le qu'en raison du pass et du prsent il induit (pi-tch futur de mme que l'homme des champs, de la semence, induit avec certitude
ht

na

buddhnm
4.

Vibhs, 179,

qu'il

y aura

tel fruit.

Quelques-uns disent que,

s'il

en est

ainsi, le

Pranidhijnana

connaissance par raisonnement, non pas pratyaksa, connaissance directe. Il faut dire que le Pranidhijnana ne connat pas le fruit par la cause actuelle, ni la cause par le fruit actuel: il est donc pratyaksa, non pas anumna.
est

anumna,

(Comparer Kosa,
Anguttara,
iv.

ii.

62, p. 303).

402,

comment Bhagavat

sait

que Devadatta est destin


ii.

l'enfer

sur Pomniscienee de Bhagavat, Patisambhidmagga,

194-195.

Explications d'ryadeva, Catuhsatik, 257 (Memoirs As. Soc. Bengal, 1914,


p.

492)

....

angatrthlambanam yoginm pranidhijnnam


:

yathrtham

tttvikay kalpanay drsyate 'ngato bhvah. Kathavatthu, v. 8 (sur la connaissance du futur Andhakas).

yvnts tatsamdhivisaya iti : c'est--dire que, Srvaka, l'ascte connat ce qui est du domaine du Srvaka (vii. 55 et ailleurs). 3. de bzhin chos don ns thsig dan / spobs pa so sor yan dag rig
2.

Les quatre Pratisamvids sont, semble-t-il,


prcheur.

les

connaissances qui font l'excellent

Burnouf, Lotus, 838-842 (pratisamvid


;
;

= connaissance

distincte)

Spence Hardy, Manual, 499 note prcieuse dans l'Appendice de la traduction du Kathavatthu, p. 377-382. Patisambhid s'entend dans le sens trs gnral de connaissance exacte, par exemple Patisambhidmagga. Les quatre patisambhids, Patisambhidmagga, i. 119, Vibhanga, 293, 331, Niddesa, 234 (intressant), Visuddhimagga, 440-443 les quatre pratisamvids, Dasahhvimaka, neuvime terre (dfinitions trs diffrentes) Bodhisattvabhmi,
Childers, 366
:

90
Il

CHAPITRE

VII,

38.

y a quatre Pratisamvids, dharmapratisamvid, arthapratisam-

vid,

niruhtipratisamvid pratibhnapratisamvid.
le

Elles

sont

comme

recueillement d'Arana

en ceci qu'elles appartiennent seu-

lement des Inbranlables qui sont des

hommes (akopyadharma-

manusyraya). Mais
la terre

elles

en diffrent quant leur objet, quant

o on
Les

les obtient,

quant leur nature.

38

a-b.

trois

premires sont un

savoir non-empch
le

(avi-

vartya, asanga) portant, dans l'ordre, sur


(artha), la voix (vc).
troisime partie
; '

nom

(nniati), la chose

Dharmasarpgraha,

51,

Mahavyutpatti,

13,

Stralamkara,

xviii.

34-37, xx. 47 (la troisime est le

don des langues des divers pays).


...

Artha et dharma sont expliqus vii. 39 c-d. tesu dharmesv arthapratisamved bhavati dharmapratisamvedi Vyakhya, i. p. 56 Dgha, iii. 241. dharmnusrin, Kosa, vi. 29 a-b. 1. a. gsum ni go rims bzhin min dan / don dan nag la thogs med ses Paramftrtha tisro nmrthavksu yathkramam asangam ( avivartyam) jnnam. pas Le chinois rend pratisamvid par o ngdi Tcii ou o ngdi tch empchement explication , pas empchement savoir . On peut se demander si la karika porte avivartyam ou asangam. Le Bhasya a certainement avivartya jiina, au tmoignage de la Vyakhya
...
; :

(ci-dessous p. 91 n. 2 a) et de

Vyakhya

(ad 37 c-d) a une glose

Mais thogs

mukta

asakta.

med

Paramartha (o k' hoi tchon). D'autre avivarti ity asakyam vivartayitum. asangam et, ci-dessous 38 c-d, le pratibhna est
:

part, la

qualifi

La Bodhisattvabhmi (ci-dessous) a asaktam avivartyam. Le sens de asangam, asaktam jnnam est fix par la dfinition de la Bodhi dans Bodhisattvabhmi. La Bodhi est un savoir pur (snddha), universel (sarvajnna) et immdiat (asangajnna) un savoir obtenu par simple inflexion de la pense , bhogamtrena, sans que cette inflexion doive tre rpte, na punah punar bhogam kurvatah (Bodhisattvabhmi, I, vii. Muson,
:

1911, p. 170).
b.

Bodhisattvabhmi,

fol.

100 a

(I,

xvii. 7)

yat sarvadharmndm sarvapaa

ryyesu yvadbhvikatay

yathvadbhvikatay ca
....

bhvanmayam

asaktam avivartyam jnnam iyam esm [bodhisattvnm] dharmapratiiyam esm arthasamvit yat punah sarvadharmnm sarvalaksanesu iyam pratisamvit yat punah sarvadharmnm eva sarvanirvacanesu esm niruktipratisamvit yat punah sarvadharmnm eva sarvaprakrapadaprabhedesu iyam esm pratibhnapratisamvit En raison de ces quatre, skandhakausalam, dhatvyatanakausalam,
/ / j
....

pratityasamutpda-sthnsthnakaualam.

En
a.

raison de ces quatre, les


vi. p.

dharmas

sont bien connus et bien prches.

Voir

247, note.

Hiuan-tsang,
Le savoir
(ii.

xxvii, fol.

8 a-b.

91

indfectible (avivartya) des

ndmapadavyanjanakyas

47

a) c'est la

dharmapratisamvid.

'

Le savoir
vid.

indfectible de la chose (artha), c'est Y arthapratisam-

Le savoir

indfectible de la voix (vc), c'est la

niruktipraUsamvid.

38
et

c-d.

La quatrime

est le savoir de l'expression exacte et facile,


-

de la matrise l'endroit du chemin.

[8 b]

Le savoir
asakta)
n

indfectible qui confre la capacit de s'exprimer d'une

manire exacte (yukta


et l'attention

arthasambaddha) et facile (mukta asamjamais dfaillante (samprakhyna

1.

Il

faut entendre
il

ici

le
:

dharma

fin,

qui est desan, enseignement (desanle

dharma), comme

est dit

Je vous enseignerai

dharma,

propice au dbut,
;

propice au milieu, propice la

de bon sens, de bonnes syllabes

l'unique,

complet, pur, purifi

brahmacarya, je promulguerai.
le

dans
Voir

le

texte

Qu'est-ce que

dharma ?
le

Le
:

[On a pratipattidharma chemin a huit membres . On a


le

phaladharma
iv.

= nirvana,

dans

texte

Prenez refuge dans

dharma
i.

32, vi.

73 c]

D'autre part la parole du


p. 46.

Bouddha
/

est

nman

ou vc, voir Kosa,

25, trad.

[caturthl nnion brjod la lam dban nid la 2. bzhi pa rigs pa thags thogs med yuktamuktbhilpamrgavasitvayoh //] yuktaniuktbhilpitym a. On peut restituer le Bhasya avec scurit samdhivasisatnprakhyne cvivartyatn jnnam. Vyfikhya yiiktam arthasambaddham / yuktafnuktbhilpitym iti muktam asaktam j yuktamuktam abhilapati yuktanmktbhilpl tadbhvas tasym yuktamuktbhilpitym II samdhau vas samdhivas / sawdhivasinah samprakhynam asammosah samdhivasisamprakhynam / taira cvivartyatn jtnam pratibhnapratisatnvid iti. b. L'expression yuttamuttapatibhna dans Anguttara, ii. 135; explique dans Puggalapanfiatti l'homme yuttapatibhna, interrog, rpond bien, mais non pas vite l'homme muttapatibhna rpond vite, mais non pas bien l'homme yuttamuttapatibhna rpond vite et bien. Le prcheur de Divya, 329, 493 est yuktamuktapratibhna; celui d'Avadnasataka, ii. &l,yuktamuktapratibhnin et yuktamuktavidhnajna. [Faut-il comparer asamsaktksarapada de Maha:

bharata
a

xviii. 6, 21,

Hopkins, Great Epie, 364


par
facile ,

?].
,

Je traduis
l

mukta
chj,

sans

difficult

d'aprs le Pli

Paramartha

tchdng

exempt du dfaut
p.

d'obstacle.

3.

Ci-dessous

94

1.

2.

92

chapitre vu, 39-40

b.

mosa) propre l'homme qui est matre en recueillement (samdkivasisamprakhyna), c'est la pratibhnapratisanwid.
'

39
La

a-b.
-

Son

objet est la voix et le

Chemin

elle

comporte neuf

savoirs.

voix correcte (samyagvc) et

le

Chemin sont

l'objet

de cette
le

Pratisamvid qui, de sa nature, est donc neuf savoirs en excluant

nirodhajnna.

39

b. Elle est

de toutes les terres.

Elle nat chez

un ascte prenant point d'appui sur toutes

les terres,

du Kamadhatu au Bhavagra, puisqu'elle a pour objet


soit le

soit la voix,

Chemin.
c.

39

L'arthapratisamvid

est dix

ou

six.

'

Par artha, chose, on peut comprendre


quel cas la Pratisamvid d'artha
est,

tous les

dharmas

au;

de sa nature, les dix savoirs


,

mais

si

par artha on comprend

Nirvana
et

six savoirs
'

dharma,

anvaya, nirodha, ksaya, anuipda

samvrtijhna.

39

d.

Elle nat partout.

C'est--dire en prenant pour point d'appui n'importe quelle terre.

1.
ii.

Sur
12,

le

sens de pratibhna, Mabavastu,

i.

511, Avadanasataka,

i.

48,

10,

50,

81.
/

[tadlambanam vgmrgau ses pa clguho 2. de yi dmigs pa nag dan lam jnnni nava] Quand elle a pour objet la voix (vglamban) elle est, de nature, duhkha, samudaya, dharma, anvaya, ksaya, anutpda, satnvrtijnna. Quand elle a pour objet le chemin, mrga, dharma, anvaya, ksaya, anutpda, paracitta, samvrtijiina.
3. 4.

sa thams cad

= [sarvabhh]
rig
/

bcu ham drug sarvadharms ced artho dasa jnnnl'i na ht so danm jnnnm yathsambhavam n&lambanibhavaU

don yan dag

5.

'sti
j

dharmo yo nirvnam ced

arthah sad jnnni. 6. de ni kun na

Hiuan-tsang,

xxvii, fol.

8 b-9

a.

93

37

d.

Les autres sont savoir mondain.

'

elles

Deux Pratisamvids (dharma et nirukti) sont samvrtijnna, car 2 ont pour objet les nmakyas, etc., et la voix.
le

40. La Pratisarnvid de dharma dans


nas.
s

Kfimadhatu

et les

dhy-

Elle est

donc de cinq
les

terres.

Au

dessus

manque
4

le

nmakya

[et

par consquent

padkya

et

vyanjanakya].
voix,

40

b.

La Pratisarnvid de
8

la

dans

le

Kama

et le

premier

dhyna.

La niruktipratisamvid a pour terre le Kamadhatu dhyna, parce que le vitarka manque au-dessus. 6
D'aprs
1. le

et le

premier

le

Prajflptipadasstra, les Pratisamvids sont dans l'ordre

savoir indfectible du nom, de la pbrase, de la syllabe


7
;

(nman,
le

pada, vyanjana)
nom,
etc.
;

2.

le savoir de la chose (artha) exprime par

3. le

savoir de l'expression (adhivacana) [9 a] des carac-

1.

gzhan kun rdzob

nmakydivglambanatvt. na hi duhkhdijnnam ansravam duhkhaikadeam samudayaikadeam ca svalaksankrenlambate kim tarhi pancopdnaskandhn smnyalaksankrair citas te samvrtijnc2.

nasvabhve.
3. 4.

chos rig hdod dan bsam gtan na

rdhvam nmakybhvd iti rpyadhtau dharmapratisatfivin yatra ca nmakyas tatraiva padavyanjanaky iti tulyavrtt nmakybhvavacanena vyanjanakybhvasiddhih
nstti
I /
I

elle est du Kfimadhatu et deuxime opinion elle est du Kfimadhfitu et des quatre dhynas ; troisime opinion elle est du Kfimadhatu, de Yangamya, du dhynntara et des quatre dhynas. P'ou-kouang observe que la premire opinion suppose le nman li la voix, que les deux autres opinions supposent le nman

Vibhfisa, 190,

9.

Trois opinions. Premire opinion


;
: :

du premier dhyna

li

5.
6.
7.

au corps. Fa-pao n'est pas d'accord. nag ni hdod dan dan po na

vitarkya vicrya vcam bhsaie (ii. 33, p. 174). nmdylambanatvam punar sm pratisamvidm sampannasypi vyutthilasypi tatprsthalabdhair avivartyair jnnair nmdylambanatvam bhsanam punas tatprsthenaiva.
Le Stra
dit
: :

Vyfikhyfi

94
tres de la chose, le

CHAPITRE

VII,

40 b-41

c.

nombre

(singulier, duel, pluriel), le genre (fmi'

nin, masculin, neutre), le temps, etc.

4. le

savoir de Yasaktat
soit

[=

qui produit Yasaktat] soit de


2
.

Yadhivacana,

du padavyjustifi.
s

anjana

De
:

la sorte l'ordre des

Pratisamvids se trouve

D'aprs d'autres matres, la nirukti est l'explication tymologique,

par exemple rpyate tasmd rpam, vijntiti vijnnam, cinotti


cittam.

Le pratibhna

est la rplique (?).

D'aprs l'enseignement de l'Ecole, l'exercice prparatoire (prva-

prayoga) des quatre Pratisamvids


des sons (sabdavidy), de la

est,

dans

l'ordre, l'tude

du calcul

(ganita), de la parole du Bouddha (buddhavacana), de la science

science des causes

(hetuvidy) \

Car l'homme qui ne

s'est

pas exerc dans ces quatre disciplines n'est


les

pas capable de produire

quatre Pratisamvids.

Mais, en

fait

G
,

la seule tude de la parole

du Bouddha

suffit

achever l'exercice

prparatoire.

40
Si

c.

On

ne

les obtient

qu'ensemble.

un

homme

obtient une Pratisamvid,


il

il

obtient les autres

s'il

ne

les obtient

pas toutes,

n'en obtient aucune.


dcrites,

Les

six qualits

(guna) ci-dessus

Arana,

etc. [9 b]

1.

[ekadvibahi\strpurusdyadhivacane.

Le mot adi inclut kla, kraka,

etc.

adhivacanam punah paryyah tad adhikrtyav vacanam adhivacanam,


/

2.

tasysaktatym.
va.

Vy&khya

tasydhivacanasya iasya padavyanja-

nasya
3.

pratipattih.

ata evstn kramasiddhir iti yatah padavyanjannnsrena artha/ tasyaikadvibahustrpurtisdyadhivacanam j tasysaktat ity atah kramasiddhih. 4. uttarottarapratibh pratibhanam iti vdanyyena. D'aprs Paramfirtha Pratibhna, c'est dire des paroles victorieuses de dmonstration et
.

rfutation
5.
6.

d'aprs Hiuan-tsang
76,
1-2.

Un

tlux de paroles sans digue

MahSvyutpatti,

ParamSrtha
tude
...

Mais, d'aprs d'autres matres,

...

Hiuan-tsang

En

ralit,

la seule
7.

ma

thsan bar ni de thob

med

Hiuan-tsang,

xxvii, fol. 9 a-b.

95

40

d.

Ces six sont prntakotika.

'

Parce qu'elles sont obtenues par la force du


(vii.

dhyna prntakotika

41

a-c), elles

reoivent ce nom.
est sextuple.
2

41
ma)

a.

Le prntakotika

Le quatrime dhyna
;

nomm prntakotika

est six choses


2.

(dhar-

il

consiste

1.

en Arana (kimcid arantmakam),

en Prani-

dhijnna, 3-5. en trois Pratisamvids ( l'exclusion de la niruktiprati-

pratisamvid),

6.

en prntakotika tout court.

La niruktipratimmvid, encore

qu'elle soit

obtenue par la force


le

du recueillement prntakotika, ne nat pas en ayant

quatrime

dhyna comme point et le premier dhyna ;


le

d'appui, car elle a pour terre le

Kamadhtu

par consquent

elle n'est

pas comprise dans

prntakotika.

Quel

est le

dharma

qu'on

nomme

recueillement prntakotika ?

41
son

a-c.

Le dernier dhyna, en
4

srie avec toutes les terres et port

maximum.

Le prntakotika appartient
a.

la

terre

du quatrime dhyna.

Le quatrime dhyna

est

en srie avec toutes les terres


le

sarvbhmyanulomita, lorsqu'on
1.

pratique de la manire suivante:


donne

sad

ete

prnlakotikh.

drug po de dag rab mthah las

(ce qui

prntakotitah).

2. kim
3.

de ni rnam drug
cit

= [tat sodh]
:

tadvyaUriktum kevalam prntakotikam iti Il y a un prntakotika, distinct des prcdents, nomm tout court prntakotika . D'aprs la glose de Kiokuga Saeki, il s'agit du prntakotika sur lequel le Saint s'appuie
pour rejeter
4.

la vie

....

(Voir Kosa,
/

ii.

10 a, trad. p. 121

vi. 59, trad.


/

268, note).
(?)

Lsam gtan mthah

de ni sa kun gyis mthun hya

hphel bahi kun tu


/

phyin pa yin

= [dhynam

antyam

tat\

sarvabhmyanulomitam

vrddhi-

ksthgatam. anulomita
5.

= aniiklita.
5 et

Mahavyutpatti, 67,

Dhannasarra.
quatrime
quatre
les

Pour

les SarvstivSdins, le seul


9, 9)

d'aprs Sthiramati (Tsa-isi,

dhyna peut dhynas et les

tre prntakotika

quatre rpyas.

Vibhasa, 78,

13.

96

CHAPITRE

VII,

41-42.

d'une bonne pense de Kamadhtu, on entre dans

le

premier

dhyna

du premier dhyna, dans

le
;

second, et ainsi de suite jusqu'au naivaensuite,

samjnnsamjnyatana
dhyna. [10
b.

on redescend jusqu' une pense

de Kamadhtu; enfin, de cette pense, on remonte jusqu'au quatrime


a]
le

On
on

pratique
le

quatrime

dhyna ;

aprs l'avoir pratiqu infle

rieur,

pratique

moyen

aprs l'avoir pratiqu moyen, on

pratique suprieur. Chacune de ces trois catgories se divise en trois.

Le quatrime dhyna comporte donc neuf catgories. Le quatrime

dhyna

de la plus

haute catgorie s'appelle vrddhiksthgata,

port au

maximum . Le dhyna qui possde


'

ces deux qualits s'appelle prntakotika,

parce que sa

pointe
'

'

(koti) a t

achemine (pragat) jusqu'

l'ex-

trmit (antam).
koti signifie
dit
: '

espce

'

(prakra) ou
c'est--dire
dit
:

'

sommet, apex
*

',

comme on

ctiiskotika

prasna,
;

une quadruple question


bhtakoti.

(=

ca-

tuhprakraprasna)

comme on

pragat antam prnta kotir asyeti prntakotikam. Prnta signifie non-dpass ce recueillement prnta parce qu'un autre ne le dpasse pas .
1.

Hiuan-tsang ajoute

est dit

Hiuan-tsang traduit prntakoti


(loin-terme).

= pin-tsi (limite-terme),
tsi,

Paramartha, yun

tsi

Comparer Yogasiitra,
2.

ii.

27,

prntabhmi.
tchen che
tsi,

Malivyutpatti, 94,

3,

bhiltakoli, clie

yan dag par mthah


,

(ce qui parat signifier la vraie limite ).

Burnouf, Lotus, 309, observe que

puisque, dans

bhtakoti n'est pas l'quivalent de bhavgra, nyat, le Lanka, bhtakoti

tage suprieur de l'existence

vide.

tous les dharmas , semble trs bonne. La glose de Kiokuga Saeki, bhta Le Madhyamakvatfira (trad. tibtaine p. 344) dit nettement que nirodhasambhtakotisampatti. (Elle appartient au Bodhisattva de la terre patti Dramgama). L'ascte parvenu dans le bhavgra peut pntrer dans la nirodha-

sampatti
l'existence

(ii.

44

d, p. 210),

[qui est

la

vraie pointe

la pointe

absolue de

].

L'emploi de bhtakoti dans les crits du


signalons cependant Bodbicaryavatfira,
tavibhaga,
i.

MabSyana ne nous
38,
:

intresse pas

ici

Siksasamuccaya, 257, Madbvan15; Commentaire de Namasamgti, vi. 6 aviparysrthena bhtaix. 2,

kotih

Madbyamakavatara,

340.

Hiuan-tsang,

xxvii, fol. 9 b-10 b.


l

97

41

d.

l'exception du

Bouddha, obtenues par


les

effort.

l'exception du

Bouddha,
que par

autres ryas n'obtiennent ces six

qualits,

Arana,

etc.,

effort

(prayoga), et non pas par


les

le

dta-

chement (vairgya), puisque tous ne

possdent pas
le

2
.

Le seul

Bouddha
na, par
le

les obtient

par

le

dtachement, car

Bouddha

obtient toutes

ses qualits d'un seul coup, ds le dbut,

au moment du ksayajnd-

dtachement \ Plus
;

tard,
le

son gr, sans effort

car

il les actualise (sammukhbhva) Bouddha Bhagavat est le souverain

(vaavartin) de tous

les

dharmas

qu'il possde.

Nous avons

expliqu les trois catgories, Arana, Pran'dhijnana,

Pratisamvids, qui sont

communes aux ryas. Parmi


4
,

les qualits qui

appartiennent aussi aux Prthagjanas


[10
b].

il

faut expliquer les Abhijnas

42

a-d. Ralisation

du savoir de pouvoir magique,

d'oreille,

de la

pense, des anciennes existences, de la mort et de la renaissance, de


la destruction des

sravas

c'est la sextuple Abhijfla.

1.

sans rgyas las gzhan sbyor la skyes


vi. trad.

= [buddhd aparesm prayogajh]


se dtachant

2.

268.

3.

Au moment
ii.

il

devient

Bouddha en devenant Arhat, en

du

bhavgra,
4.

p. 205.

Si les Trthikas possdent les cinq Abhijnas, oui, d'aprs Haimavatas, Sar;

vastivadins, Vatslputryas
et

non, d'aprs Mahsasakas, Dharmaguptas (Vasumitra

Bhavya).
Prna, qui n'est que prajnvimukta
(et

vi.

64

a),

n'est pas

mme

d'exercer

le

pouvoir magique frddhi)

non pas ubhayatobhgavimukta, commun aux


zad s>s

Trthikas
5.

mais

il

obtient vite les six Abhijnas (Divya, 44).


/

rdzu hphrul rna pa yid dan ni


yi
/

snon thse hchi hpho skye ba dan

mnon du bya ba
En
8,
iii.

mfion es rnam drug

= \rddhirotramanahprvavsacynt
Majjhima,
i.

yupapatksaye / jnnaskstkriybhijn] sadvidh.


lisant

upapad

= upapda
iii.

(?).

La bibliographie des Abhijnas


110; Anguttara,

est infinie.

34,
;

ii.

238, Dgha,

i.

245; Visuddhimagga, 202, 373, 406

et surtout l'Introduction, p. 61 et suiv.

Mahavyutpatti,

14,

Compendium, 209 Dharmasamgraha,

20

Daabhmi, iii. (trad. Madhyamak&vatara, p. 57, Muson 1907); Stralamkara, vii. 1, 9; Siksasamuccaya, 243, Bodhicarya, ix. 41. Abhijna, comparer ohinna, Hoernle, Uvasaga, trad. p. 48.
;

98
Il
:

CHAPITRE

VII,

42.

y a six Abhijnas 1. Abhijfia de pouvoir magique, rddhivisayajnnaskstkriybhijn, l'Abhijna qui consiste dans la ralisation
(skstkra

= sammukhibhva) du savoir portant sur


gamana
et

l'objet

de la
'

rddhi

(c'est--dire

nirmna, dplacement
;

et cration).

Sens, sens primitif, Burnouf,


Milinda,
ii.

Lotus, 820
;

Kern, Lotus, 131


9, 62.

Rhys Davids,
abhi-jn se
dit

231, Dialogues,

i.

62, 157
vi.
(

Windisch, Geburt,
la

de l'intelligence des vrits,


1.

54

c,

66, ix. (Hiuan-tsang, xxix. 14 b), etc.

Sur

la

rddhi,

iv.

117 d

ornement de
et

pense

), vi.

69 (rddhipda),
sortes de

vii.
;

47 (rddhiprtihrya), 48
viii.

(gamana
/

nirmna), 53 diverses

rddhi

35 b (ry rddhi).

a.

On a rddhih samdhih
:

rddhivisayo

nirmnam gamanam ca
;

rddhi-

visaye jnnam tasya skstkriy

sammukhlbhvah (Vyakhya).

[Pour la dfinition rddhi samdhi, vi. 69, p. 285, vii. 48 a Patisambbidfimagga, ii. 205-206]. Mah&vyutpatti rddhividhijnna ; Pli iddhividh, iddhippabheda. [prabheda peut s'entendre comme dans prajnprabheda, viii. 27 c]. Les sources plies font parfois rentrer la iddhi dans la catgorie des savoirs
: :

le

yamakaptihlre nna
et

est le savoir ayant

pour objet
ii.

le

miracle de l'eau et
;

du feu; iddhividhe nna (Patisambhidmagga,

125,

i.

111)

pancbhitnt69
prsente

nana
b.

atthasampattinna (Mahaniddesa,
Siltra

106).
la

Le

de

la

Rddhyabhijn
i.

est cit

dans
i.

Vyakhya,

vi.
iii.

il

avec la rdaction plie (Dgba,


taires
le

77,
ii.

Majjhima,

34, Anguttara,

280;

commen:

dans Patisambbidamagga,

207, Visuddhimagga, 373-406), et aussi avec

texte de Mahavyutpatti, 15 (d'aprs Mabaparinirvna), quelques variantes


/

anekavidham rddhivisayam pratyanubhavati eko bhtv bahudh bhavati bahudh bhtv eko bhavati / virbhavati tirobhvam apy anubhavati I tirah kudyam tirah prkram [tirah parvatam] asajjamnah kye(?) gacchati tadyathke / prthivym unmajjananimajjanam karoti tadyathodake udake 'bhidyamnena srotas gacchati tadyath prthivym imau va punah kse paryankena kramati tadyath akunih paksl sryacandramasv evam maharddhikv evam muhnubhvau pnin mrsti paritnrsti yvad brahmalokam kyena vae vartayata (Voir
I j
/

ityam ucyata rddhih. ... sa evam samhite citte nejjappatte iddhividhya cittam abhinharati abhininnmeti j so anekavihitam iddhividham paccanubhoti / eko pi hutv .... A anekavidham rddhivisayam correspond anekavihitam, l'opration du iddhividham. On a vu que Yasomitra explique rddhivisaya
p. 114, n. 4)

Rdaction plie:

pouvoir magique, l'objet de la connaissance qui ralise


l'expression rddhivisaye jnnam

le

miracle

et

emploie
i.

comme on

a dans Patisambhidmagga,

111

iddhividhe rinam. Rhys Davids-Stede signalent Vinaya, iii. 67 (Par. ii. 47) Il n'y a pas pch dans cette opration magique (iddhivisaye) de ceux qui
:

possdent la iddhi

et

Nettippakarana, 23

Impossible de rsister

la mort,

Hiuan-tsang,
2.
3.

xxvii, fol.

10

b.

99
'

Oue divine, divyarotrajnnaskstkriybhijn.

Connaissance de
2

la

pense d'autrui,

cetahparyyajnnas-

kstkriydbhijn.
4.
3

Souvenir des anciennes existences, prvanivsnusmrtijn4

naskstkrbhijn.

sinon par l'opration magique (anriatra iddhivisay). [La version


psychic power

extent of

n'est pas admissible].


;

Pratyanubhavati-paccanubhoti, Lotus, 836 (sur Divya, 204) on a rddhynu supernatural ii. 129 (= rddhi) ; nubhva power (Childers). c. D'aprs Patisambhidamagga (ii. 207) les miracles du Stra de la Rddhyabhijfta (ci-dessus 6) sont d'une des dix iddhis, Vadhitthna iddhi [De mme Compendium]. Voir Kosa, vii. 52 a sur diverses manifestations de rddhi, vii. 48

bhva dans Avadnasataka

et suiv.

Ne pas confondre avec la rddhi le prabhva (ci-dessus p. 83). Toutefois on rddhiprabhva comme rddhisampad, rddhivait, rddhyaivarya. 1. iha bhiksur divyena srotrena viuddhena atikrntamnusyakena ubhayn abdn rnoti mnusyn amnusyn ye va dure ye vntike ityam
a

ucyate divyasrotrajilnaskstkrbhijn. Le Stra poursuit par la description du divyacaksus et de la prvanivsnusmrti. 2. Cinquime abhijn dans le Stra. iha bhiksuh parasattvnm parapudgalnm vitarkitam vicaritam manas mnasam yathbhtam prajnti j sargam cittam sargam iti yathbhtam prajnti / vigatargam .... sadvesam .... vigatadvesam .... samoham .... vigatamoham .... viksiptam .... samksiptam .... lnam .... pra-

grhltam .... uddhatam


....

vyupantam anuddhatatn avyupantam avimuktam samhitam asamhitam abhvitam bhvitam vimuktam cittam vimuktam iti yathbhtam prajnti iyam ucyate cetah....
....

....

....

....

....

....

paryyajnnaskstkriybhijn. Ci-dessus p. 16 et suiv. Explication de l'expression cetahparyya cetahparyyo vieso raktam dvistam mdham iti va kramo va paryyah kad cid raktam kad cid dvistam mdham va. Un autre nom de cette AbhijM est paracittajnna, voir ci-dessus p. 15.
: j

3.

Les Abhijiis 4-6 sont


;

les trois sciences acquises

par

le

Bodhisattva

la

Bodbi sur les trois sciences, vii. 45 c. 4. Vyakhy iha bhiksur anekavidham prvanivsam samanusmarati iti bahub stravad grantho ySvad iyam ucyate prvanivsnusmrtijnnaskstkrbhijn. Plus bas (ad vii. 43 d) ... ami nma te sattv yatrham abhvam evamnm evamgotra evamjtir evamsukhaduhkhapratisanived evamcirasthinuit de la
:

100
5. 6.

CHAPITRE

VII,

42-43.
'

Vue
2

divine,

cyutyupapdajnnaskstkrbhijn.
des

Destruction

vices

sravaksayajnnaskstkr-

bhijn.

Bien que la sixime Abhijna n'appartienne qu'aux ryas, nanmoins,

comme

les cinq

premires sont aussi possdes par

les

Prthag-

janas, en raison de ce caractre du plus grand

nombre des

Abhijfias,
et

on considre
Prthagjanas.
3

ici

les

Abhijnas

comme communes aux ryas

aux

42
tika

d. Elles

sont

prajh de vimukti.
so

'ham tasmc cyuto 'mutropapannah j tasmd iti skram soddeam [sanidnam] anekavidham prve nivsam anusmarattyam (Variantes

evamyuhparyantah

api cyuto 'mutropapannah / tasmc cyuta ihopapanna


dans
la rdaction plie).

...

Commentaire dans Samantap&sadika, i. 158. Ne pas confondre cette Abhijna avec la jtismarat qui est un des pouvoirs naturels des Bouddhas ou Bodhisattvas, vii. 55, iv. 109, p. 225, n. 2 et 3 (limites de la connaissance du pass).
1.

C'est la troisime Abhijfifi dans le Stra. Elle porte

deux noms Hiuan-tsang


:

la

nomme
Koa,

divyacaksus, Paramartha, cyutyupapdajiina.


27

Mahavyutpatti,

cyutyupapatti, Str&lamkara, cyutopapda.


c, Suttanipfita, 1112, 1136, Samyutta, iii. 213. iha bhiksur divyena caksus viuddhena atikrntamnusyakena sattvn payati iti bahuh stravad grantho yvad iyam ucyate divyacaksurjnnaskstkriybhijn.

viii.

Vyfikhya

2.

iha bhiksur idam duhkham ryasatyam


/

iti

yathbhtam prajnti
/

ayam duhkhasamudayah ayam duhkhanirodhah iyam duhkhanirodhagmini pratipad ryasatyam iti yathbhtam prajnti / tasyaivam jnata evam payatah kmsravc cittam vimucyate j bhavsravd avidysravc cittam vimucyate / vimuktasya vimukto 'smti jnnadaranam bhavati / ksn mejtir yvan nparam asmd bhavam prajnmti iyam ucyate
/

sravaksayajnnaskstkrbhijii. Voir Patisambhidamagga, i. 115, l'explication de Y savakkhaya en fonction des trois indriyas purs (Koa, ii. 4) et des fruits (srotapanna, etc.) [Curieuse description du bhavsava].
3. 4.

Voir

p. 107,

1.

18.

rnam

grol blo

= muktimrgadhh
;

(cit

dans Vyakhya ad

viii.

27

c).

le

Paramartha traduit vimuktijnna


grhta.

Hiuan-tsang, vimuktimrgaprajnsamreproduite presque


littralement dans

D'aprs Vibhasa, 141,

12,

BhBsya.

Hiuan-tsang,

xxvii, fol.

10 b-11

a.

101
les

Elles sont de leur nature prajit de


fruits

vimuktimrga, comme

de la vie religieuse.
a.

'

43

Quatre sont samvrtijnna.

Quatre, Abhijna de pouvoir magique, il divin, oreille divine,

souvenir des anciennes existences, sont savoir mondain

(vii. 2).

[11 a]
3

43

b.

Dans

la connaissance de la pense d'autrui, cinq

jnnas.

C'est--dire, la

cinquime Abhijna a pour nature dharmajnna,


4

anvayajiina, mrgajnna, samvrtijnna, paracittajnna.

43
force.

c.
s

L' Abhijna de la destruction des

vices est semblable la

Tout comme Ysravaksayajnnabala,


six

cette

Abhijna comporte

ou dix jnnas. De mme,


et porte

elle

appartient toutes les terres (bh-

mi)

sur tout objet.


les

43

d.

Cinq dans

quatre dhynas.

fi

Les cinq premires Abhijnas s'appuient sur


c'est--dire sont

les

quatre dhynas,

obtenues par un ascte en dhyna.


de la vie religieuse

1.

Vy&khya De mme que


: '

les fruits

(vi.

51),

en tant que

dharmas
2.

conditionns

',

sont de leur nature vimuktimrga.

Voir ci-dessous

p. 103, n. 1, 107, n. 2.

samvrtijnanam] Samghabhadra D'aprs les Occidentaux, six jnnas par exemple les dharma, anvaya, duhkha, samudaya et mrgajnna, connaissent les choses smvrta
bzhi ni kun rdzob ses pa ste == [catasrah
:

du pass. 3. sems
4.

la ses

pa lna yin no
ici la

= cetasi jnnapancakam

On

considre

connaissance-de-la-pense-d'autrui pure

qui est quatre

des cinq

jnnas numrs, l'exclusion du samvrtijnna et impure qui est samvrtijnna et paracittajnna. [ksaybhijn] balam yadvat, vii. 28 c. 5. zad pahi mnon ses stobs bzhin du panca dhynacatustaye. 6. lha ni bsam gtan bzhi dag na D'aprs Compendium, 61, le cinquime dhyna est le adhitthnapdaka-

jhna,

c'est--dire le

dhyna

qui sert de point d'appui au processus de volitions

qui crent la manifestation de l'Abhijfla.


considre que les quatre

Mais Patisambhidamagga,

ii.

205

dhynas

sont les quatre

bhmis de

la

rddhi.

102

CHAPITRE

VII,

43

d.

Pourquoi ne s'appuient-elles pas sur


matriels
a.

les recueillements dits

im-

(rpyas) ?
premires ont pour objet
les produire
le

Les

trois

rpa

(voir p. 106,

1.

1).

Donc on ne peut
rpyas.
b.

en prenant pour point d'appui sur

les

Le cetahparyyaj nna, connaissance de

la

pense d'autrui, est

ralis,

prpar (nispdya), par la porte (tirtha

matire

(rpa

= dvra)
rpa,
telle

de la

visible), c'est--dire
:

par un chemin qui a pour

objet

(lambana)
'

la couleur-figure

Avec

tel

pen-

se

Or

les

recueillements immatriels n'ont pas le

rpa pour

objet.
c.

Quant

la

mmoire des existences


le
2
;

antrieures, l'ascte la pr-

pare (abhinispatti) en remontant

cours des tats successifs (anu-

prvvasthntarasmarant)
n'ont pas pour objet des

or les recueillements

immatriels
et

dharmas
gotra,
etc.,

de

Kamadhtu

quand

la
le
3

mmoire des existences antrieures


Sutra
d.

est ralise, elle porte,

comme

le dit,

sur

le lieu, le

sur des

dharmas

matriels.

En
:

effet l'ascte qui

veut connatre la pense d'autrui considre

d'abord, dans sa propre srie, le caractre (nimitta) du corps et de la

pense

Tel est

mon
il

corps, telle est

ma

pense

Gomme

il

a con-

sidr son propre corps et sa propre pense, de


la srie d'un autre,

mme, envisageant

se rend compte du caractre du corps et de la


ainsi connat-il la pense d'autrui et l'Abhijna
ralise, l'ascte

pense d'un autre

prend naissance. Lorsque l'Abhijna est


plus le corps, le

ne considre
4

rpa

il

connat directement la pense.

rpa idrsam cittam bhavati. Mme doctrine Patisambhidfimagga, saumanasyendriya 2. Vibhasa, 100, 12. On demande si l'exercice prparatoire (prayoga) a lieu par le souvenir des moments (ksana) ou des tats (avasth) successifs. Evidemment par le souvenir des tats, non des moments. Si l'ascte procdait en rmontant de moment en moment, la mort viendrait avant qu'il ait remont la P'oumoiti de sa vie. Comment arriverait-il complter le prayoga ?
1.

drse
:

i.

113

Tel rpa a son origine dans

....

kouang

Il

y a

trois explications

la

seconde est
)

la meilleure,

parce que

le

terme

complter

(dans

complter

le

prayoga
:

ne doit pas tre compris d'une 99


n. 4).
.

manire
3. 4.

troite (fi p ki, Couvreur, 1904, p. 244).


le

D'aprs

Stra cit ci-dessus


;

..

skram soddeam
:

...

(p.

D'aprs Paramartha

Hiuan-tsang

il

ne considre plus svacittarpa

Hiuan-tsang,
e.

xxvii, fol. 11 a-b.

103

L'ascte qui veut se souvenir de ses anciennes existences, comsaisir le caractre


la

mence par

(nimittam udgrhya
;

= cittaprakram
il

paricchidya) de

pense qui vient de prir

de cette pense,
sont

remonte en considrant (manasikurvan)


diatement succds dans
la

les tats qui se

imm-

prsente existence jusqu' la pense de

la conception (pratisamdhicitta).

Quand

il

se souvient d'un

moment
d'autrui,

de pense [11 b] de l'existence intermdiaire (antarbhava),Y Ahh\ji&


est ralise
'.

Pour se souvenir des existences antrieures


(prayoga)
est le

l'exercice prliminaire

mme.
la pratique de cette

L'ascte qui est un

commenant dans

Abhijna
;

ne connat les existences que dans leur ordre chronologique


l'habitude est acquise,
ces (vilanghypi
il

quand

se souvient en sautant une ou deux existen-

smaranam).
en est
ainsi,

On

se souvient seulement de ce qui a t expriment (anubhh)


2
.

autrefois

S'il

comment y

a-t-il

souvenir des Suddha-

vsas ?

En

effet,

ces dieux ne reviennent pas


ici
;

ici,

donc l'ascte ne

les

a pas expriments

et

il

ne les a pas expriments dans leur


ciel.

ciel,

car les Prthagjanas ne naissent pas dans ce

Il

s'en souvient

parce qu'il les a expriments par


vient a entendu
:

l'oue.

La personne

qui s'en sou-

Les dieux

nomms Suddhavasas
ici,

sont tels

L'exprience, en

effet, est

double, par la vue et par l'oue.

Les tres
cette

qui,

tombant de l'rQpyadhatu, naissent


srie d'autrui

produisent

Abhijna au moyen de la

(parasamtatyadhisth-

nena).

En
1.

effet le

prvanivsnusmrtijnna appartient au domaine du

D'aprs ParamSrtha.

Hiuan-tsang

....

et jusqu' ce

qu'il se

souvienne
:

d'un

moment

antrieur

Vantarbhava. [Glose de
].

l'diteur japonais

c'est--

dire de la dernire

pense de l'existence antrieure


l'Abhijn est

Alors

le prayoga, l'exercice

. Le prayoga est vimuktimrga. 2. Bhasya anubhtaprvasyaiva smaranam / suddhvsnm katham smaranam / ravanennubhtatvt. Vyakhya na hi uddhvsnm ihgamanam asty angmitvt / tena naism ihnubhtih / npi taira / prthagjannm tatrnupapatteh / ravanennubhtatvd iti / rutam ht tena bhavati suddhvs nma dev evambht iti / dvividho hy anubhavo darsannubhavah srutnubhava ca.

prparatoire,

de la prvanivsa[anusmrti] est achev


;

nantaryamrga
:

104

CHAPITRE
et

VII,

44.

dhyna,

on ne peut, par ce jhna, connatre la pense du domaine

de l'rupyadhatu.

Les autres tres au moyen de leur propre


f.

srie.

'

La

prparation (prayoga) des trois premires Abhijnas, rddhi-

visaya, divyarotra, divyacaksus, consiste dans l'observation de la


lgret,

du son, de

la lumire

(laghutva, sabda, lokamanasika-

rana)

'\

Quand

le

prparatif est achev, l'ascte obtient dans chaque

cas la matrise (vasit).

Par consquent ces cinq Abhijnas ne prennent pas point d'appui


sur les recueillements d'rpya.
3

44

a.

Elles ont pour

domaine

leur terre ou

une

terre infrieure.

Par l'Abhijna de pouvoir magique d'une certaine


obtenue dans un certain
de

terre, c'est--dire

gamana

et

de

dhyna nirmna (vii.

(vii.

43

d),

on possde

les

pouvoirs

48) relatifs cette terre ou une

terre infrieure,

non pas relatifs une terre suprieure. De mme, par l'Abhijna d'oreille divine, on entend les sons de
laquelle appartient l'Abhijna, ou des sons d'une

la

terre

terre inf-

rieure,

non pas

les

sons d'une terre suprieure.


la

Par l'Abhijna de cetahparyya, on ne connat pas


d'autrui

pense

quand

elle est

d'une terre suprieure celle de l'Abhijna.

1. Vyakhya :parasanttatyadhisthnenotpdanam itij dhynasamgrhtam prvanivasnusmrtijnnam j tena crpyvacaram cittam na grhntiti j katham ca punah parasamtatyadhisthnenotpdanam j samanantaraniruddhn manovijnnt parakyn nimittam udgrhyeti vistarah (voir p. 103 1. 2) / anyesm iti ya rpyebhyo na pracyuts tesm svasamtatyadhisthnenaivotpdanam prvanivsnusmrtijnnasya sukaratvt. 2. La discipline par laquelle l'ascte obtient l'il divin fou jnnadarsana)

est dfinie Patisambhidamagga, i. 114. Il faut obtenir, de jour et de nuit, Vlokasafin (Dgha, iii. 223). Comment l'ascte produit le tremblement de terre, Dgha, ii. 108. - Lgret , i. 10 d, 12 c.
3.

Hiuan-tsang ajoute

En

outre,
:

dans

les

ArOpyas,

la

vipayan
mme,
les

est dfi-

ciente, le

samatha

est
et

en excs
.

or les cinq Abhijfias doivent s'appuyer sur soient quilibrs.

une

terre

o vipayan

amatha

Par

le fait

anga-

ntya, etc, sont aussi carts


4.

ran dan hog sabi yul can yin

= svdhobhvisaybhijn

(cit

Vyakhya

ad

vii. 36).

Hiuan-tsang,
Par
l'Abhijfta de la

xxvii, fol. 11

b-12

a.

105

mmoire des anciennes

existences,

on n'obtient

pas de se souvenir d'existences d'une terre suprieure celle de


l'Abhijfia.

Par consquent,
ni

la

pense de rrpyadhatu ne peut tre atteinte

par l'Abhijfia de la connaissance de la pense d'autrui, ni par

l'Abhijna de la mmoire des existences anciennes, parce que cette

pense est d'une terre suprieure


[12 a 6]
elles

celle des Abhijflas [11

b 9]

'

Comment

sont acquises (lbhyante) les Abhijflas ?

Si
2

n'ont pas t acquises dans une vie antrieure, elles ne sont

acquises que par exercice, effort (prayoga).

44
elles

b.

Dj pratiques,

elles

sont acquises par

le

dtachement.

Lorsqu'elles ont t pratiques (ucita) dans une vie antrieure,

sont acquises par

le

dtachement
le

(vairgya). [L'ascte en

prend possession, prpti, par

seul fait qu'il se dtache


elles

du

Kamadhatu
tion

et entre

en dhyna]. Toutefois, intenses,

ne sont

acquises que par effort. Quant leur

actualisation
elle

leur produceffort
:

(sammukhibhva
le

= utpdana),

suppose toujours

excepter
soient,
vii.

cas du Bouddha, qui acquiert les Abhijflas, quelles qu'elles


et les actualise

par simple dtachement,


d).

son gr

(ii.

44

a,

41

44 c La
vedan,
et les

troisime est trois

smrtyupasthnas

3
.

L'Abhijfla de la pense d'autrui comprend trois smrtyupasthnas,


citta,

dharma

(vi. 14),

parce qu'elle a pour objet la pense

mentaux.

1.

D'aprs Paramartha.

Hiuan-tsang est plus bref, et place

ici

une note sur

l'extension du pouvoir d'Abhijna des diffrents saints, note cpie

Vasubandhu place

plus loin, p. 124.


2. 3.

thob bya hdris pa chags bral las

= [ucit vairyyalbhikh]
;

gsum pa dran pa
:

ner gzhag

gsum

ce qui donne

trtly

smrtyupasthna-

trayant.

Paramartha pasthnas.

l'Abhijna de la pense d'autrui est incluse dans trois smrtyu-

106

chapitre vu, 44 d-45


d.
'

b.

44

Pouvoir magique,

oreille et il

sont

le

premier smrtyupa-

sthna.

Les Abhijnas de pouvoir magique,

d'oreille

divine,
le

d'il

divin,

comportent

le

premier smrtyupasthna, c'est--dire


elles

kyasmrtyii-

pasthna, car

ont pour objet

le

rpa, couleur-figure. L'Abhijfa

de pouvoir magique a pour domaine quatre yatanas externes,


l'exclusion du son
le
2
.

L'oreille divine et l'il divin ont

pour domaine

son
S'il

et le

rpa.
ainsi,

en est
le

comment
3

l'Abhijna d'il divin peut-elle connatre


:

ainsi

que

Sotra l'explique

Ces tres munis de mauvaises actions

corporelles, de

mauvaises actions vocales, ngateurs (apavdaka)

des ryas, produisant des vues fausses, s'attachant des vues et

des actes faux, cause de

cela,

la fin de la vie,

tombent dans de

mauvaises destines

...

?
le fait

L'Abhijna d'il divin ne connat pas

qu'un tre est muni

(samanvgata) d'un
vue fausse,
etc.

acte mental, le fait qu'un tre a conu


il

une

Mais

y a un autre savoir qui escorte l'Abhijna

d'il divin \ qui nat dans la srie de l'rya, et qui connat l'acte

mental,

etc.

Comme
il

ce savoir est produit par la force de l'Abhijna


reoit,

d'il divin [12 b],

avec l'Abhijna,

le

nom

de

connaissance

de la mort et de la renaissance

(cyutyupapdajfina).
il

Comme
soi

leur nature n'est pas dtermine dans la karika,

va de
et

que

les

deux Abhijnas du souvenir des anciennes existences


(srava) ont pour nature
les
s

de

la destruction des vices

quatre smrtyu-

pasthnas.
1.

dan po rdzu hphrul


uccheditvc chabdo

ma

pa mig.

Param&rtha

rddhi, oreille et il [sont]

le

premier [smrtyupasthna].
2.

3.

na nirmyate. Voir vii. 49. ami bta bhavantah sattvh kyaduscaritena samanvgath

Comparer Majjhima, i. 22, Samyutta, ii. 214. 4. Il y a un autre savoir, abhijnparivrajiina. 5. La Karika, dans la version de Hiuan-tsang, porte < Les autres [abhijnas] sont quatre [smrtyupasthnas] , et le Bhasya Les autres abhijnas sont comprises dans les quatre smrtyupasthnas, parce qu'elles ont pour objet les cinq
: :

skandhas

Hiuan-tsang,

xxvii, fol. 12 a-b.

107
les autres

45

a-b.

Les Abhijnas
'

d'oreille et d'il sont non-dfinies

sont bonnes.

Les Abhijnas

d'oreille et d'il divin

appartiennent la catgorie
elles

du non-dfini, car on maintient que, de leur nature,

sont

prajh

associe connaissance auditive et connaissance visuelle (srotra-

caksurvijiinasamprayukta).
S'il

en est

ainsi,

quatre
tive
Il

dhynas
le

comment peut-on dire qu'elles sont de la terre des En effet, point de connaissance visuelle et audi-

dans

second

dhyna

et au-dessus,

(i.

46)

n'y a pas contradiction, car on s'exprime ainsi en considrant

l'organe. L'organe, oreille et il, qui est le point d'appui de l'Abhijna,


est produit par la force des quatre
il

dhynas

et appartient

leur terre

s'appuie donc sur quatre terres. L'Abhijna, s'appuyant sur l'organe,

est

donc

dite

s'appuyer sur les quatre dhynas.

Ou

bien on s'exprime

ainsi parce qu'on considre

sus

p.

104,1.4) de

Ynantaryamrga (ou prparatif, ci-desl'Abhijna; en effet Ynantaryamrga de l'Abhijna


quatre dhynas.
-

d'oreille et d'il divins s'appuie sur quatre terres,

Seules les autres Abhijnas sont bonnes.


quoi
le

S'il

en est ainsi, pour-

Prakaranapadasastra

dit-il

Qu'est l'Abhijna ?

Elle

est

bonne prajn ?

Cette dfinition (nirdesa) est bhulika ou prelle

dhnika,cest-k-dire
tiel.

vise le grand

nombre des cas ou


;

l'essen-

Les Abhijnas sont, en majorit, bonnes

les

Abhijnas bonnes

sont les plus importantes.

D'aprs

le

Stra,

il

y a

trois sciences

d'Asaiksa

(asaiksi vi-

dy)

'.

quelles Abhijnas correspondent ces sciences ?

1. mig dan rna pahi mnon ses ni / lun du ma bstan lhag rnams dge =s vykrte srotracaksurabhijne [sesith ubhh /] Voir vii. 25 d, p. 59. 2. Toute acquisition comporte deux chemins, chemin qui carte l'obstacle, chemin de dlivrance. On a vu que les Abhijnas sont prajn du chemin de

dlivrance

(vii. 42 d). D'aprs l'opinion expose ici l'ascte s'appuie sur un quelconque des dhynas pour tout ce qui est ncessaire l'obtention de l'Abhijna

d'oeil 3.

divin

mais l'obtention

mme

est

du premier dhyna.
i.

Ce sont

les trois sciences

de Majjhima,
viii.

22,

246 (conquises dans


v. 211,

les trois

veilles

de la nuit de Bodhi) [voir

27

c],

Anguttara,

Dlgha,

iii.

220, 275.

108

CHAPITRE
c-d.

VII,

45

c-46.

45
Les

Trois Abhijns sont science, parce qu'elles font cesser

la non-science relative
trois sciences,

au pass,

etc.

[13 a]

'

amiksi prve nivsajnnaskstkriyvidy,


asaiksi

asaiksi eyutyiipapdajnnaskstkriyvidy,

sravales cin-

ksayajnnaskstkriyvidy,
quime, deuxime
et

sont,

dans l'ordre du Stra,

sixime Abhijns.

Pourquoi ces

trois

Abhijns reoivent-elles
le

le

nom

de

science

vidy ?

Parce que
fait

souvenir des anciennes existences (cinquime

Abhijna)

cesser l'erreur relative au pass

(prvntasammoha),

parce que la connaissance de la mort et de la naissance (deuxime

Abhijna)

fait

cesser l'erreur relative au futur

(aparntasammoha)
fait
2

parce que la connaissance de la destruction des vices


l'erreur relative

cesser

au prsent (madhyasammoha).

Parmi
ksi)?

ces trois Abhijns laquelle est rellement d'Asaiksa (aai-

1. gsum ni rig pa snon mthah sogs / ma rig pa ni bzlog phyir ro [tisro vidy avidyy] prvntdau nivartant //. Comp. iii. 25, 31. Dans certaines sources, on a une liste de huit vijjs parmi lesquelles six abhinnas, Childers, 571, Visuddhimagga, 202. La VySkhyS cite le Stra tripito bhavati trividya iti. Comparer tevijja,

tevijjaka.
2.

tisrah

Le texte j>ore:prvenivsacyutyupapdsravaksayajnnaskstkriys / et hi prvparntamadhyasammoham vyvartayanti yathla

kramam.
Bhagavadvisesa et d'autres expliquent
formule 'dans l'ordre ', yathkramam,

comme
relative relative

il

suit

On
; ;

dtruit par le souvenir des anciennes existences l'erreur

au pass par la connaissance de la mort et de la renaissance, l'erreur au prsent par la connaissance de la destruction des sravas, l'erreur relative au futur (car on dit nparam asmd bhavam prajnmi). En effet, l'ordre des temps est pass, prsent, futur . Mais Samghabhadra explique Le souvenir des anciennes existences met un terme l'erreur relative au pass la connaissance de la mort et renaissance met un terme l'erreur relative au futur la connaissance de la destruction des sravas met un terme l'erreur relative au prsent c'est pourquoi ces trois abhijns sont vidys. Par la premire, on voit la souffrance de soi et d'autrui par la seconde, la souffrance d'autrui on prouve le samvega, le dgot ainsi dgot, on produit la troisime, on voit le bonheur du Nirvana. C'est pourquoi ces trois abhijns sont vidy. Yasomitra dmontre que la pense de Vasubandhu est correctement interprte par Samghabhadra.
:

Hiuan-tsang,

xxvii, fol.

12 b-13

a.

109

46

a.

La

dernire est d'Asaiksa.


la

'

La connaissance de
l'Arhat.

destruction des

vices

n'appartient

qu'

46

a-b.

Les deux autres sont nommes d'Asaiksa lorsqu'elles


2

naissent dans la srie de l'Asaiksa.

Les deux autres Abhijns sont


dans la srie de l'Asaiksa
aaiksa.
S'il
(ii.
:

dites

d'Asaiksa lorsqu'elles naissent

de leur nature, elles sont ni-aiksa-ni-

38 a) un Saiksa, des sciences du

en est ainsi, pourquoi ne pas admettre que ces deux Abhijns


lorsqu'elles se produisent chez
,

sont,

Saiksa

saiks vidy ?

46
alors

Nous admettons qu'elles existent chez le Saiksa, mais elles ne sont pas nommes sciences parce que la srie du
c-d.

'

Saiksa est associe la non-science.

En effet le Bouddha ne dit pas que ces deux sciences soient des dharmas de Saiksa. Pourquoi ? Lorsqu'une srie est associe la non-science (avidy), donner le nom de science (vidy) Abhijna

l'

qui se produit dans cette srie n'est pas correct, car l'Abhijna se

trouve alors obscurcie par la non-science.

1.

mi slob tha ma
gnis ni debi
/

2.

samtnaje yad
sa srie
3.
.

[aaiksy anty] rgyud las skyes phyir de zhes bya [tadkhye tu dve tatParamBrtha Deux ont le mme nom tant nes dans /].

Le tibtain porte slob la hdod de ma rig dan / bcas rgyud phyir na ma rig bad. Paramartha Dans le Saiksa, elles ne sont pas nommes vidy parce que la srie est accompagne d' avidy . Hiuan-tsang n'a qu'un pada Le Saiksa, il y a obscurit, pas vidy . Dans Samyutta, ii. 58, l'ascte en possession du dhamma-nna et de Yanvayaflna purifis, est nomm ditthisampanna et qu'on lui attribue sekha nna, sekh vijj. 4. D'aprs Paramfirtba. D'aprs Hiuan-tsang Dans le Saiksa, il y a erreurobscurit. Donc, quoique les deux premires Abhijftas existent cbez lui, on ne les nomme pas vidy. Quoique, pour un certain temps, elles domptent et dtruisent l'obscurit, ensuite elles sont obscures donc elles ne sont pas vidy .
: :

110

CHAPITRE
dit qu'il

VII,

47.
1
.

Le Sutra

y a

trois

Pratiharyas

A quelles

Abhijnas corres-

pondent-ils ?

47

a-b.

La

premire, la troisime et la sixime sont les Pratiha-

ryas \ [13 b]

Les Abhijnas de pouvoir magique, de la connaissance de la pense


d'autrui, de la connaissance de la destruction des vices, sont,
l'ordre, les trois

dans

Pratiharyas

ravir

(har), c'est--dire convertir,

par des miracles, rddhiprtihrya; par la lecture de la pense, dea-

nprtihrya

(dire

Telle est ta pense

)
:

par l'enseignement,

anussaniprthrya (enseigner exactement yathbhtopadea).

Le mot pra Le mot


Ces
elles,

signifie

dikarman.
bhram.

ati signifie

trois

Abhijnas sont nommes prtihrya parce que, grce

l'uvre de conversion (harana) est commence


et faite

(idam anena

karma prrbdham)
Par
elles,

d'une manire intense (prtiabdayor

adikarmabhrrthat vt).
on
'

ravit

'

(haranti)

l'esprit

des

hommes
et trs

convertir

(vineyamanas), tout d'abord (ditas, dau)


{ati bhrain).
elles

puissamment

Ou

bien, elles reoivent le

nom

de prtihrya, car par

on s'empare d'abord, on s'empare puissamment des hommes

qui hassent la

Bonne Loi (pratihata), des


on
fait

indiffrents

(madhya-

stha) \ Par
1.

elles,

que

les

hommes de
Geiger, Pli

pense hostile, de pense

On a ptihriya, ptihrika, ptihera,


;

ptihira, Senart, Kacchayana,

536

Childers, 361

Kern, Manual 60
;

Grammar

51.

Ptihira

= miracle sans plus

Milinda, 309,

yamakaptihra, Patisambhidamagga, ii. 125. miracles produits sur la tombe des Nirvns par leur ancien
;

adhitthna (voir Koa, vii. 51), par Vadltitthna des dieux ou des fidles. Paramartha et Hiuan-tsang traduisent tdo (clef 41) dans Mahavyutpatti,
ha, changer-convertir, chn-pien, rddhi-vhsuiger.
2.

pin-

dan po gsiim pa drug pa


i.

ni

cho hphrul.
i.

Dgha,
Bhiksus),
ryastra.

193, 212,

iii.

220, Anguttara,
iii.

170 (appartiennent de nombreux


xii,

v.

327; Mahavastu,
les

116; Burnouf, Lotus, 310, Divya,

Pratiha-

Les Pratiharyas sont


sattvabhmi,
3.
i.

moyens (upya) de sduction (varjana), Bodhi-

6.

Cette phrase

manque dans Paramartha.

La Vyakhya garantit

l'exprs-

Hiuan-tsang, xxvi,
incrdule, de pense

fol.

13 a-b.

111

non

zle, produisent la
'

pense de refuge, la

pense de

foi,

la pense de la pratique.
est le meilleur.
2

47

b.

L'anusan
les trois

Parmi

PrELtih8.ryas,Yanusanprtihrya est
qu'il n'existe

le meilleur.

47

c-d.

Parce

pas sans l'Abhijna, parce


3
.

qu'il confre

des fruits de salut et de bonheur

Le rddhiprtihrya
duits

et

Ydeanprtihrya peuvent

tre pro-

au moyen de

8
:

sciences magiques

(vidy)

4
.

Il

y a une vidy

nomme Gandhar
sion

l'homme qui

la possde

peut voler travers


7,

pratihatamadhyastha.
Hiuan-tsang
le
:

Mahvyutpatti,

146,

pratihatacitta

Sarad

Candra, so sor hkhrul.


1.

Ces

trois

dans
2.

Buddhadharma, que

l'on croie,

AbhijMs, dans l'ordre, font que l'on prenne refuge que l'on pratique (au sens d'adhigama) .

bstan pa mchog. Le rddhiprtihrya est infrieur parce qu'on peut produire la rddhi par des formules Vasubandhu consigne ici une vieille opinion, Dgha, i. 213 (ci-dessous n. 5). [Mais le Bouddha pratique le iddhiptihariya, Dgha, iii. 9, et partout]. Il faut mentionner Culla, v. 8, 2 (histoire de Pindola) est coupable de dukkata celui qui montre aux matres de maisons l'uttarimanussadhamma iddhipti:
:

hariya [ou plutt qui fait montre de ses pouvoirs magiques ] [Remarques de Rhys Davids sur l'poque de l'emploi du terme dukkata, Dialogues, iii. 8] comparez Divya, 275, et Przyluski, Aoka, 80. Dgha, iii. 112, dit que la iddhi sainte, exempte d'sava et d'upadhi , c'est
: ;

l'quanimit (upekkh), que la iddhi des miracles (eko pi hutv,

etc.) est

iddhi

non-sainte (na ariy), avec

Anguttara oppose
n'obtient que la

la

sava et upadhi . Voir viii. 35 b. dhamma-iddhi et Vmisa-iddhi (i. 93)


vii. 1,

puthujjanik iddhi (Culla


iii.

et

Devadatta commentaire de Dhamma;

pada
san.

17).

Les anussanavidhs de Dgha,

107, n'ont rien de

commun

avec Yanu-

3. mi hphral phyir dan phan pa dan / yid o hbras la sbyor byed phyir =s avyabhicritva[hitamanojnaphalayojant //] 4. Paramartha traduit vidysthna ; Hiuan-tsang a l'expression que Eitel traduit magie incantation au mot Atharva.

Les quatre desatiavidhs, Dgha,


5.

iii.

103.

Voir Divya,
:

p.

636 au bas.

Dgha, i. 213 atthi kho bho gandhar nma vijj / tya so bhikkhu anekavihitam iddhividham paccanubhoti / eko pi hutv .... / imam kho aham iddhiptihriye dlnavam sampassamno iddhiptihriyena .... jigucchmi ....

112
l'espace. Il

CHAPITRE

VII,

47 c-48

c.

y a aussi une vidy [14 a]


lit

nomme

Iksanika

'

l'homme

qui la possde

la pense d'autrui.

L'anussanprtihrya ne peut

tre ralis par de tels

moyens, par consquent, n'tant jamais spar

(avyabhicrin) de l'Abhijna de la destruction des vices (srava-

ksaya)

2
,

il

est suprieur

aux deux autres.

En

outre, les

deux premiers Pratiharyas sont seulement capables

de captiver la pense d'autrui pour un peu de temps, et ne produisent

pas de fruits importants. Le troisime Prtiharya, au contraire,

fait

qu'autrui produise des fruits bons, produise des fruits agrables (hita
et

sukha)

car au

moyen de

ce Prtiharya, le prcheur enseigne, en

vrit, les

moyens de

salut et de bonheur.

Que

faut-il

entendre par rddhi ?


est recueillement.
3

48

a.

La rddhi

[Dialogues,
invisible].

i.

278

dans Jataka,

iv.

498, cette vijj est

un charme pour

se rendre

Gfindharl-Gndhar est une vidydevl (Hemacandra).


C'est par le
p.

Gandhramantra que
iv.

le

hros de Ralston-Schiefner, Tibetan Taies,

288 (Kandjour
1.

171) obtient des fruits de la


;

montagne Gandhamadana.

Hiuan-tsang, ksani
ix.

Paramartha, ksanik.
ii.

Ci-dessous

vii.

56

b.

Bodhicarya,
atthi

25

Samyutta,

260, itthi

maniko (manik) nma


...

disati cetasikam pi disati

ikkhanik. vijj / tya ... parasattnam ... cittam pi katamam ca kevaddha ... jigucchmi / /

anussanlptihriyam .... [Dialogues, i. 278, Buddhaghosa identifie le jevvel churm avec la cint&man vijj ; Rhys Davids renvoie Jataka, iii. 504, Sumangalavilasin, 265, 267, 271.] kleaksayanntaryakatvt (Vyakhya). 2. avyabhicritvt Hiuan-tsang L' anussanprtihrya ne peut tre ralis que par Ysravaksaybhijil, donc il est avyabhicrin . D'aprs l'diteur, il faut entendre

<

donc
3.

il

porte ncessairement des fruits de salut et bonheur

rdzu hphrul tin hdzin


p.

= [rddhih samdhih]
les trois dernires

Voir ci-dessus

98

n. 1.

Les dix sortes de iddhi, dont


niddhi, vikubbaniddhi,

nous intressent

ici

(adhitthVisuddhi,

manomay iddhi),

sont dfinies dans l'Introduction du


ii.

Compendium

202, 373, 766).

Mrs Rhys Davids, Psychology,


i.

p.

60 (Patisambhidamagga,

205, Atthasalin, 91,


199.
4.

Limites au pouvoir de iddhi, Kathavatthu, xxi.

Bodhisattvabhmi,

5 (Muson, 1911,

p. 156-164).

Hiuan-tsang,

xxvii, fol.

13 b-14b.

113

mot rddhi dsigne le recueillement, samdhi. Le recueillement est ainsi nomm, car c'est grce
D'aprs la doctrine de la Vibhasa,
le

lui

que l'uvre est

ralise, russit (rdhyati,

sampadyate).

Cette

uvre

est ce qu'on

nomme

l'objet

(visaya) de la rddhi.

En

quoi consiste-t-elle ? [14 b]

48

a-b.

De

l,

dplacement

et cration.

'

Le dplacement, gamana,
transport
2

est

de trois sortes

dplacement de

dplacement d'adhimoksa, dplacement rapide

comme

la pense.

48

b-c.
3

Le dplacement rapide comme

la

pense est propre au

Matre.

Ce dplacement va

trs vite,

comme

la

pense

d'o son

nom

de

manojava. Seul

le

Bouddha

le possde, non pas les autres tres. Le

corps arrive trs loin dans le temps


aller.

mme
dit

qu'on prend penser y


le

C'est pourquoi le

Bouddha a

que

domaine du Bouddha

est

incomprhensible \

Le

Matre possde aussi les deux autres

dplacements.
de
la(s)

1.

ni

sprul

nirmitam.
2.

Hiuan-tsang

dan hgro ba. ParamSrtha atra kagamanam Le visaya est double, gamana et nirmita .
:

Samyutta,
tibtaine

v. 282, est

intressant.
.

dplacement de transport

L'original sanscrit m'est inconnu. La version


driv de la racine i ou

phyin byed semble indiquer un


chn, transporter
le

gam. Hiuan-

tsang

yun

corps
corps).

Paramartha

n-tsing-chn (akars,

Svab, avarj

prendre en main

dplacement d'adhimoksa dplacement rapide comme


:

provenant d'adhimoksa, dhimoksika.


pense
,
:

la

sans doute

manojavagamana.

Para-

martha sn-tsi, citta-java, Hiuan-tsang i-ch, manas-aksepa (avedha). On a, dans Divya, 52-53, le rcit du voyage de Bouddha et de Maudgalyayana l'univers Marcika. Ils vont par la rddhi de Maudgalyayana, en prenant pour tremplin le Sumeru sept jours de voyage ils reviennent instantanment par la rddhi du Bouddha Quel est le nom de cette rddhi ? La manojava . Ibid. p. 636
: ; :

au bas, une manojava vidy. Rhys Davids-Stede signalent manojava comme pithte des chevaux, Vimanavatthu. 3. ston pa la / yid mgyogs hgro ba
Voir ci-dessus
4. p. 83.
ii.

Comparer Anguttara,

80, Divya, 53.

114

CHAPITRE
c-d.
'

VII,

48 c-50

b.

48

Les autres possdent

le

gamana

de transport et d'adhi-

moksa.

Les Sravakas

et les
2

Pratyekas lvent leur corps

et se

meuvent,
3
.

comme
le

l'oiseau

successivement lve son corps et se meut


fait,

Pour

dplacement d'adhimoksa, lorsqu'on

par

le

pouvoir de la

volont (adhimoksa), que ce qui est loin devienne voisin (drasy-

sanndhimoksena)

i
:

par cet adhimoksa

l'objet

va

vite.

49
c'est

a-c.
;

La

cration du

domaine du Kama,
;

c'est

quatre yatanas

externes

elle est

de deux sortes
5

la cration

du domaine du Rpa,

deux yatanas.

La

cration (nirmita) est de deux espces, du

domaine du Kamaconsiste dans la

dbatu, du domaine du Rupadhatu.

La premire

cration de couleur-figure, odeur, saveur, tangibles (rpa,

gandha,
le

rasa, sprastavya) externes (bhya caturyatana)

6
,

en excluant

son (sabda). La seconde consiste dans


et tangible
le

la cration
et la

de couleur-figure

seulement, parce que l'odeur


7

saveur manquent dans

Rpadhatu.

La

cration de

Kamadhatu

est double, suivant qu'elle se rapporte


:

au corps

mme

de l'ascte ou autrui (svaparaarrasambaddha)


tigre,

par exemple l'ascte se transforme en

ou bien

il

cre,

en dehors

1.

gzhan dag

la

phyin byed mos pa

las

byun yan.

2. 3. 4.

pakkh sakuno.
Patisambhida

Lisons

ici les

explications de Visuddhi, p. 396.

Les Prthagjanas possdent ce premier


cit

gamana

(Hiuan-tsang).
...

Visuddhi, 401

...

brahmalokam gantukmo
:

dure pi

santike adhitthti santike hot ti santike hoti. Dsirant aller au Brahmaloka, il fait adhitthna que ce soit proche bien qu'loign Que ce soit proche et cela devient proche. [C'est l'explication du Stra kyena vasam vatteti,
!

ci-dessus
5.

p.

98

n. 1 b],

hdod par gtogs pahi sprul pa ni / phyi yi skye mched bzhi rnam gfiis / gzugs gtogs gfiis kmptanirmitam bliyam caturyatanam [dvidh / rpptam

dve]

Quatre yatanas, non pas


6.

le

son

voir ci-dessus p. 118 et ci-dessous,

vii.

51

b.

bhya, externe, c'est--dire anuptta, ne constituant pas un organisme sensoriel au service de la pense, Koa, i. 34 c. 7. Comme on a vu i. 30 b-d.

Hiuan-tsang,
de
lui,

xxvii, fol.

14 b-15

b.

115 du Rpadhatu.
trouve

un

tigre \

Il

en va de

mme

pour

les crations

La personne qui
dans
le

se trouve dans le

Kamadhatu

et celle qui se

Rpadhatu tant chacune capable de quatre

crations, la

cration est octuple.

Mais lorsqu'une personne rsidant dans


cration du

le
a],

Rpadhatu produit une


ne se trouve-t-elle pas
et

domaine du Kamadhatu [15

possder

(samanvgama, prpti) odeur

saveur ?

le

Non,

il

n'y a pas possession, pas plus qu'un

homme
'

ne possde

vtement

ou

la parure, bien qu'ils soient lis


'

(sambaddha) au

corps, parce
i.

que
b),

ces choses, n'tant pas

d'tres vivants

(asattvasamkhyta,

10

ne sont pas

lies

l'organisme sensoriel (indriydhisthna).

Cependant certains docteurs disent qu'une personne du Rpadhatu


ne peut crer que deux yatanas, couleur-figure
ils
'

et tangible

car

craignent que,
'

si

cette

personne cre odeur,

etc., elle

ne se trouve

possder

odeur, etc.

Est-ce par l'Abhijna de cration elle-mme que l'ascte cre les


objets crs (nirmita) ?
le fruit

Non pas. Comment cela ? C'est par


(ii.

de l'Abhijna (abhijnphala)

71

b, p.

320).

Quel est ce

dharma que

vous

nommez
les

fruit

de l'Abhijna ?

49
Le

c-d. C'est

par

penses de cration (nirmnacitta) que l'on


2

cre. Elles sont


fruit

au nombre de quatorze.

de l'Abhijna de pouvoir magique, c'est

les

penses de

cration, capables de produire les objets crs. Ces penses sont

au

nombre de quatorze.

50
cinq,

a-b. Elles sont fruit des

dhynas

au nombre de deux jusque

dans

l'ordre.

Ces penses sont quatorze, [15 b] tant diffrencies par


Comparer
sprul

le

dhyna

1.

les

dfinitions

des trois iddhis magiques dans Compendium,

Introduction, p. 61 et Visuddhi, 405.


2.

sems dag
//]

gis

de dag kyan ni bcu bzhi ho

[mnacittais tni puna

caturdaa
3.

bsam gtan hbras

gnis nas lnahi bar

rim bzhin.

116

CHAPITRE

VII,

50-51

a.

(dhyna fondamental, mladhyna) qui leur sert de point d'appui. Deux penses, fruits du premier dhyna la premire du domaine du Kamadhatu (samgrhta), la seconde du domaine du premier dhyna \ Trois penses, fruits du second dhyna deux des deux terres infrieures (Kamadhatu et premier dhyna) et une de la mme terre que le dhyna dont elle est le fruit, donc du deuxime dhyna. De mme quatre penses, cinq penses, fruits du troisime et du quatrime dhyna. La pense de cration, fruit d'un certain dhyna, est de la terre de ce dhyna ou d'une terre infrieure.
: :

50

b. Elles

ne naissent pas d'un

dhyna

infrieur.

La pense de dhyna d'une


rieure, parce

terre infrieure ne produit pas


fruit

une

pense de cration (c'est--dire un

de

dhyna) d'une

terre sup-

que sa force est trop

petite.

La
rieur,

cration

c'est--dire
est le fruit

l'tre

magique

'.

d'un domaine inf-

mais qui

du deuxime dhyna, l'emporte, au point

de vue de

l'alle et

venue

suprieur, qui est le fruit du premier

(gamana ?), sur la dhyna

cration, d'un

domaine
les

De mme pour

dhynas

suivants.
les obtient

50

c.

On

comme

le

dhyna.

1. C'est--dire, pense du domaine du Kamadhatu et par rpa du Kamadhatu, pense du domaine du premier dhyna cre un rpa du premier dhyna. vii. 51 a-b.

laquelle on cre
et

un

par laquelle on

gon ma Paramartha
2.

las
:

kyes min
le fruit

Elles ne naissent pas d'une terre suprieure

Pas suprieur

>,

Bhasya
krikfi,

La pense de

cration d'une terre


.
:

suprieure n'est pas

d'une pense d'un

dhyna
le
.

infrieur

Hiuan-tsang

ne traduit pas ce pada dans sa

mais dans

Bhasya

[La pense de

cration] ne s'appuie pas sur une terre infrieure

3. L'tre magique constitu dans le Kamadhatu par une pense de cration du deuxime dhyna, bien qu'il soit du domaine du Kamadhatu, peut se rendre dans le ciel du deuxime dhyna. L'tre magique constitu dans le ciel du premier dhyna par une pense de cration du premier dhyna n'a pas accs au ciel du deuxime dhyna. 4. de rned bsam gtan bzhin dhynaval lbhah. On obtient les dhynas par dtachement (vairgya). En se dtachant du Kamadhatu on obtient le premier dhyna. Du mme coup, on prend possession

des penses de cration dont ce

dhyna

peut tre

le

point d'appui.

Hiuan-tsang,

xxvii, fol.

15 b-16

a.

117

On

obtient la pense de cration, fruit du


le

mladhyna, comme

on obtient
le fruit est

dhyna,

c'est--dire

par

le

dtachement (vairgya). Car

obtenu en

mme

temps que son point d'appui.


et

50
il

c-d.

Le nirmnacitta procde du dhyna pur


'

de soi-mme

produit les deux.

Du dhyna
(vyutthna).

est produit

son

fruit,

le

nirmnacitta, pense de

cration. Cette pense n'aboutit pas la sortie de contemplation

Du dhyna

pur (uddhaka,

viii. 6)

nat

un premier nirmnacitta.
nirmnacitta
les

Ensuite les successifs nirmnacittas naissent d'une pense de leur


espce, c'est--dire

du premier, du deuxime

....

nirmnacittas antrieurs dans

cette srie produisent

donc un nir-

mnacitta. Le dernier nirmnacitta est suivi par dhyna pur. Donc


le

nirmnacitta vient de deux penses (dhyna pur

et

nirmna-

citta) et produit ces

mmes

deux.

supposer que la personne qui se

trouve dans

le

nirmnacitta,

fruit

du recueillement, non-dfini de sa

nature, ne rentre pas dans le recueillement (dhyna), elle ne sortirait et

pas de contemplation. [16 a] De

mme

qu'on entre par la porte

qu'on sort par la porte.

51a. Une
t.

cration a lieu par une pense de sa terre.


las

de ni
a-t-il

dag dan ran


Non.

de las

gris.

sortie

de contemplation (vyutthna)

l'issue
et

du nirmnacitta, oui
;

ou non ?

50

c-d. Il

procde du

dhyna

pur

de soi-mme

il

est suivi

par les deux.

de cration

Au uddhaka dhyna succde l'Abhijn de cration. A l'Abhijn succde le nirmnacitta, fruit de l'Abhijn. A ce nirmnacitta
A
celle-ci

succdent d'innombrables nirmnacittas, qui ne naissent pas d'un autre citta.


Enfin au dernier nirmnacitta succde l'Abhijn de cration.
le

succde

uddhaka dhyna ou bien le nirmnacitta. Comment cela? Si l'homme nirmnaqui se trouve dans le samdhiphala (samdhiphalasthitasya cittasthitasya) ne rentrait pas dans le mladhyna, il n'y aurait pas sortie

(vyutthna) du samdhiphala. La Vyakhya fournit un passage du Bhasya Le nirmnacitta vient du suddhakadhyna , savoir le premier nirmnacitta qui naisse lorsque l'ascte ralise le nirmnacitta ; et aussi du nirmnacitta , savoir le deuxime nirmnacitta, etc., lorsque le nirmnacitta continue. 2. ran gi sa pas sprul par byed sa svbhmikena nirmnam.
:

118
Toutes
les

chapitre vu, 51-52

a.

choses cres (nirmita) sont cres par une pense de

leur terre. Car une pense de cration d'une certaine terre ne produit

pas une cration appartenant une autre

terre.

51b. Mais
infrieure.
'

le

discours a lieu aussi par une pense d'une terre

Le discours profr par un


Le discours profr par un
mier dhyna a
lieu

tre

magique (nirmita) dpend

aussi,

dans certain cas, d'une pense d'une terre infrieure.


tre

magique du Kamadhtu ou du

pre-

en vertu d'une pense de la terre de cet tre cr.


terre suprieure,

Mais
etc.,

l'tre

magique d'une

du deuxime dhyna,

parle en vertu d'une pense du premier

dhyna

car dans les


et

terres suprieures n'existe pas

une pense munie de vitarka


d).

de

vicra

(ii.

33, p. 174) et capable de produire vijhpti (iv. 7


le crateur,

51c. Avec
Lorsque
le

sauf

le

cas du Matre.

nirmtar,

la

personne qui produit des tres magiques

(nirmita), produit un nombre d'tres magiques, tous parlent lorsque


leur crateur parle, parce que la vgvijiipti (iv. 3
est
d),

ou acte vocal,
parle,

commune
le

tous. C'est pourquoi la stance dit

Quand un
quand un

savoir

crateur, tous les tres crs parlent


.
3

reste

silencieux, tous restent silencieux

Cette rgle ne vise pas

le

Bouddha, car

il

possde une parfaite

matrise en recueillement

son

gr, les tres

magiques parlent
adharena ca

les

1.

smar hjug pa
ii.

ni

hog mas kyan

bhsanam

tv

(cit

Vyakhyfi,
2.

71

b).

ston min sprul pa po dan bcas


Cette stance est commente Vyakhya,
:

3.

i.

p.

27 (Petrograd, 1918).

Voir

khalu srvako nirmitam abhinirmimte yadi srvako bhsate nirmito 'pi bhsate / srvake tilsnbhte nirmito 'pi tsnbhavati / ekasya bhsamnasya narve bhsanti nirmith / ekasya tsnbhtasya sarve tsnbhavanU te/1 bhagavan nirmitam pranam prcchati bhagavan vykaroti (Lire plutt bhagavantam nirmith prasnam
:

Divya, 166, de prs apparent au Kosa

yam

prcchati

bhagavan vykaroti

nirmito vykaroti). Sur les nirmitas, KranaprajnSpti,

nirmitam bhagavan pranam prcchati Comparer Dlgha, ii. 212. Madhyamaka, xvii. 31-32.
/

xi,

Madhyamakavrtti,

p. 45.

Hiuan-tsang,
uns aprs
les autres
ils
;

xxvii, fol. 16 a-b.

119
le

ils

interrogent et le

Bouddha rpond

Bouddha

interroge et

rpondent.

Mais, dira-t-on, lorsque nat la pense qui produit la voix, la pense de cration (nirmnacitta) n'existe plus
:

donc ce moment

l'tre

magique

n'existe pas

comment donc
parle, parce

l'tre
le

magique

parlera-t-il ?

51.

L'tre

magique

que

crateur
'

met en mouvement
'

la parole

par une autre pense, aprs avoir

protg

l'tre

magique.

'

Par

la force

d'une pense antrieure l'entre en contemplation et


le

la cration,
Puisse-t-il

crateur
!

'

protge

'

(adhitisthati) l'tre magique


il

durer

Au moyen
magique

d'une autre pense,

le fait parler.

Donc, bien que

l'tre

parle, les

deux penses,

celle qui cre

et celle qui fait parler,

ne sont pas simultanes,

et toutefois l'action
b]

vocale a lieu avec

l'tre

magique pour support. [16


la mort.
2

52
1.

a.

h'adhisthna continue aprs

byin gyis brlabs nas gzhan hjug phyir


si

= adhisthaynyavartant
;

//

yan byin brlab yod a. Nous avons rencontr plusieurs fois adhisthna, adhitisthati, dans le sens de faire durer (dhisthnik rddhi, iii. 9; ci-dessous p. 120 n. 1 ii. p. 120, adhisthnavasit ; vii. p. 83 yuhsamskrn adhitisthati (sthpayati)
2.

ba

la

adhisthnaprabhva. b. Nombreux emplois dans un sens peu ou non technique, par exemple Bodhicaryavatara, ii. 45 Le pcheur est adhisthita ( tmastkrta) par les mes:

sagers de

Yama

Mahavastu,

iii.

376

Siksasamuccaya, 314

Ils

sont possds
.

(adhisthita) par Mara

les tres

qui n'entendent pas parler du Bodhisattva

Siksasamuccaya 356
par la diligence

Toutes les bonnes actions sont prsides (adhisthita)


285
:

ibid.

Le Bodhisattva

fait

que ses dispositions (aya)


;
:

sont bien gardes, purifies, prises en main (svadhisthita) Samyutta, v. 278 sucjgahita svadhitthita ; Samyutta, iii. 10, 135 (adhitthnabhinivesa des

passions dans la pense).

soi-mme, au moyen de Vadhimoksa,

Exercer une certaine action sur une chose, une personne, volont , applique cette chose, etc. Ce sens gnral est spcialis, dans le Kosa, dans le sens de faire durer [dans la nomenclature du Patisambhidamagga, ii. 207, il vise les miracles de multiplication, etc. ii. 207 voir encore Atthasalin, trad. p. 121 et Compendium].
c.

adhitisthati se

Mais

rpdhisthnabala (Siksasamuccaya, 330, 11) que les fleurs vont se placer autour de la tte de Dpamkara (Divya, 251, 1) c'est par Yadhisthna (= nubhava) que les Bouddhas convertissent, Bodhicaryavatara, i. 5.
c'est

par

le

d.

Burnouf a traduit

bndiction

d'aprs byin kyi rlabs.

C'est,

dit-il,

120

chapitre vu, 52-53


n'est pas seulement
'

b.

Ce
dure

pour

la
'

dure de sa propre vie que

le

cra-

teur est capable de


;

protger

une chose de

telle

manire qu'elle

sa

'

protection

'

peut faire aussi que la chose dure jusqu'aprs

sa mort.
C'est ainsi
rsolution),

que, par sa protection (adhisthdna ou


le

adhimoksa,
i'av-

Kasyapa

Grand a
'

fait

que ses os dureront jusqu'

nement du Bhagavat Maitreya.

52

a.

Non

pas, l'endroit de ce qui n'est pas dur.

C'est seulement la chose dure qui est susceptible d'tre

'

protge \
' '

pour une longue dure. C'est pourquoi Kasyapa


pas sa chair.

le

Grand ne protge

52

b.

D'autres matres disent

non.
'

Le corps protg par


c'est

la force de la

rsolution
les os
*

'

(adhimoksa)

n'est

pas capable de durer au del de la mort. Si

de Kasyapa durent,

par la protection (adhisthdna) des dieux.

par la bndiction du Thera que voyage un personnage du


la

bndiction des Bouddhas que les Bodhisattvas forment le

Thupavamsa c'est par vu de devenir des


;

Bouddhas. (Voir les deux adhisthnas, dont le second est une conscration (abhiseka), de Lankavatara, Nanjio, p. 100). On sait que la huitime bhmi est
varit d'quivalents chinois) cette bhmi est ainsi nomme parce qu'elle ne peut tre branle (parvikopanatvt). e. On aimerait comparer Gta, iv. 6 prakrtim svm adhisthya sambhavmy tmamyay, et Lotus, xv. 3 tmnam adhisthahmi sarvms ca sattv&n nirvnabhmim cupadarsaytni na cpi nirvmy ahu tasmi
:

Vadhisthnabhmi (grande

....

....

kle.
1.

Divya, 61.

maitreyah.
J.

...

ksyapasya bhiksor avikopitam asthisam....

ghtam daksinena pnin grhltv


Kasyapa, Przyluski,
As. 1914,
ii.

Sur toutes

les
;

lgendes relatives
Fa-hien, chap. xxxiii.
la matrice, et

524, et Aoka, 169, 331


le
.

On

examine, Kosa,

iii.

d,

pourquoi

Bodhisattva nat de

non

pas par une naissance


est

apparitionnelle

C'est afin de pouvoir laisser des reliques,

car le corps des tres apparitionnels disparat leur mort.

Cette explication

p.

donne par les docteurs qui nient Ydhisthnikl rddhi de Bhagavat. 2. mi brtan la med 3. gzhan dag min 4. Rves provoqus par l'adhisthna des dieux, Vinltadeva ad Ny&yabindu, 47 (trad. tib. dans Bibl. Indica).

Hiuan-tsang,

xxvii, fol. 16 b.

121

52

c-d.

Au

dbut, l'ascte cre une seule cration par de nombreu;

ses penses de cration

le contraire,

quand

la pratique est purifie.

'

Les dbutants, ou dikrmikas, au moyen de nombreuses penses


de cration, produisent un seul tre magique
;

plus tard, lorsque la

pratique (abhysa) est complte, l'ascte produit son gr, au

moyen

d'une seule pense de cration, beaucoup ou peu de crations.

53

a-b. Produite par

bhvan, non

dfinie

inne, triple.

La pense de
(avykrta)
dfini
(ii.

cration, lorsqu'elle est acquise par

bhvan
est

(c'est-

-dire lorsqu'elle est fruit de


:

dhyna, d'Abhijna),
effet

non

dfinie

le fruit
b).

d'Abhijna est en

une des espces de non


elle

71

Mais, lorsqu'elle est inne (upapattija),


:

est
etc.,

bonne, mauvaise, non-dfinie

par exemple

les dieux, les

nagas,

crent en vue de secourir ou de nuire.

Sont susceptibles

d'tre crs,

parmi
3

les dix

yatanas matriels
'

'

(rpin), neuf yatanas l'exclusion du son, savoir


l'oreille,

l'il, le visible,

l'organe de l'odorat, etc.


si

Mais, dira-t-on,

neuf yatanas sont susceptibles d'tre crs,


:

il

peut donc y avoir cration d'organes (indriya)

il

peut donc y avoir


4

apparition (prdurbhva) d'un tre (sattva) nouveau, car les organes

sont du

rpa

(couleur-figure) qui est

appartenant aux tres vivants


cr.

'.

L'organe n'est pas susceptible d'tre


sans inexactitude que
la

On

peut cependant dire

cration est de neuf


s'agisse

yatanas

(navya-

tanka), car la cration

qu'il
te
/

de la transformation du

1.

dan por du mas gcig yin


i.

byan bar gyur nas bzlog pa

ho.

Commentaire

Anguttara,

209.

2. bsgom las skyes pa lun ma bstan / skye ba las skyes rnam gsum mo = avykrtam bhvanajatn trividham tpapattijam j 3. Ne sont pas susceptibles d'tre crs le manayatana et le dharmyatana,

parce que

du

magique (nirmita) est dpourvu de pense, ainsi qu'il rsulte nirmith acintiko vaktavyah / ... nirmtus cittavasena vartate (Vyakhya). Ce Sstra est le Karanaprajfaptisastra, analys dans Cosmologie
l'tre

Sfistra

bouddhique,
4.

p.

340-341.
i.

sattvasamkJiyta, sattvkhya,

10 b.

Il

a t dit ci-dessus,

p. 114,

que

la cration consistait

en yatanas externes.

122

chapitre

vir,

53 c-54.

corps du crateur ou de la cration d'un corps distinct

consiste en
et n'existe

quatre yatanas, rpa, gandha, rasa, sprastavya,

pas

indpendamment (avinirbhta, avinirbhgena avasthita) des cinq


organes [17
[18 b 9]
'

a].

La rddhi

est,

avons-nous
2
.

dit,

de deux espces

produite

par bhvan (ou dhyna), inne


espces
:

Elle est encore de trois autres

53

c-d.

La rddhi

est aussi produite


3

par formules, plantes, actes

en tout de cinq espces.


Elle est

donc bhvanja, upapattilbhika, vidykrta ou

man-

trkrta, osadhikrta \
la

karmaja
etc., la

Exemples de

la

cinquime espce,

rddhi de Mandhatar,
(iii.

rddhi des

tres de l'existence inter-

mdiaire

14

d).

[19 a 2]
'

[17 a 1] L'il divin et l'oreille divine sont-ils appels

divins

'

au ou

sens propre, parce qu'ils sont de la nature des organes des dieux
bien par figure, parce qu'ils sont

comme
dans
fi

s'ils

taient divins (divye

iva)

.?

7
:

Ils

sont

'

comme

divins

'

les cas des Bodhisattvas, des


ils

Cakravartins, des Grhapatiratnas

Quand

sont divins au sens

propre
1.

Hiuan-tsang met

la

karika 54 avant

la k&rikft

53

c-d.

2.

upapattilbhika.

La rddhi que

certains tres possdent parce qu'ils

appartiennent une certaine catgorie d'tres.

Exemples de rddhi inne, Mahavagga, i. 15, 2, vi. 15, 8, Culla vii. 1, 4 2, 1. peut croire que les quatre iddhis (beaut, longue vie, absence de maladie et bonne digestion, popularit) du roi du Mah&sudassanasutta ont quelque chose de surnaturel mais quand Aj&tasattu se promet de dtruire les Vajjyas, si grande que soit leur iddhi, si grand que soit leur nubhva (Mali5parinibb5na), le sens de ces expressions reste douteux. Son ministre Vassakara est sans doute un bon
;

On

magicien.

sman dag dan / las las skyes dan rnam pa Ina rddhi produite par magie , par la force des formules ou des herbes. 5. Par exemple, la rddhi que certains hommes possdent de naissance, tel Mfindhatar, non parce qu'ils sont hommes, mais en raison de certains actes diffre donc de la rddhi inne (voir ci-dessous, 126, n. 3).
3.

rdzu hphrul gsan snags

4.

6.
7.

Ces personnes possdent l'il et l'oreille ns de l'acte '. Hiuan-tsang Que dsignent les expressions il divin,
' :

oreille

divine ?

Hiitan-tsang, xxvii,

fol.

16 b-17

b.

123

54
En

a-b. L'il divin

et l'oreille
'

divine sont du

rpa pur

du

domaine des dhynas.

raison d'un exercice prparatoire (prayoga) consistant dans la

mditation (bhvan) de la lumire et du son (loka, sabda)


l'ascte

prenant point d'appui sur

les

de l'ascte
(ii.

il

et oreille qui

sont de

dans l'il et l'oreille dhynas Kmadhtu se trouve attir

10

a, p.

121) un

rpa pur

(rpaprasda), une matire drive

des grands lments (bhautika), de la terre du


pris

pour point d'appui, subtile


;

et excellente.

dhyna qui a Ce rpa constitue


(rpa) de

il

et oreille
l'oreille

il

voit et entend

il

constitue ce qu'on appelle l'il divin,


la terre

divine. Naissant en raison d'une matire

des dhynas, les organes sont divins au sens propre du mot.

54

c-d. Ils

sont toujours

actifs,

non

dficients (avikala)

ils

por-

tent sur le lointain, le subtil, etc.

L'il divin et l'oreille divine de cette catgorie, obtenus par bh-

van

\ [17 bj ne sont jamais tatsabhga


la

(i.

42), tant toujours


Ils

accom-

pagns de
dficients
;

connaissance visuelle ou auditive.


ils
;

ne sont jamais

car

vont par paires, car

ils

sont en bon tat (knavi-

bhrntbhvt

vibhrnta

= kekara, atteint de strabisme), comme


le

sont les organes des tres ns dans

Rpadhatu.

Ils

saisissent ce
il

qui est offusqu (antarita), subtil, lointain, etc. Sur ce point,

y a

une stance

L'il de chair
;

(mmsacaksus) ne

voit pas le

rpa

lointain, offusqu, subtil

il

ne voit pas dans toutes

les directions

S'il s'agit S'il s'agit

de prajn, connaissance, l'expression


d'organes matriels (rplndriya)

il

oreille , est

impropre.

AbhijMs?
1.

La

kfirika dit: L'il divin et


/

comment des organes sont-ils des l'oreille divine sont du rpa pur... .
c
;

lha yi mig dan rna ba yin

bsam gtan
est le
i.

Le

rpa pur

gzugs dan ba,


,
iii.

sa pahi gzugs dan ba rpaprasda, Kosa, i. 9

les

organes

sont bhautika,

matire drive
7-8.

trad. p. 65.

Comparer Kathavatthu,
2.

med / thag rin phra sogs spyod yul can [sabhgvikale nityam drasksmdigocare If] 3. Par opposition l'il divin qui est inn chez les dieux.
rtag tu sten bcas

ma

thsan

L'il divin des dieux est souill de onze

apakslas,

iii.

14 a

voir

vii.

55

d.

124
(sarvatas ca
[11 b 9]
2

chapitre vu, 55-56

b.

na

pasyati). L'il divin,


les

le

contraire

'.

[17 b 5]

Lorsqu'on voit

rpas au moyen de

l'il divin, les

objets de la vision sont-ils proches ou loigns ?

Les objets sont


Les Mah-

proches ou loigns d'aprs la personne

et d'aprs l'il.

sravakas, les Pratyekabuddhas et les Bouddhas Bhagavats, dsirant


voir, s'ils

ne font pas

effort,

voient respectivement un Sahasra, un


73). S'ils font effort,
et le

Dvisahasra, un Trisahasra

(iii.

55

a-b. L'Arhat, le

Rhinocros
infinis.

Matre voient un Dvisahasra,

un Trisahasra, des univers

Le Mahasravaka, dsirant voir par


voit voit

l'il divin, faisant

grand

effort,

un dvisahasra madhyama lokadhtu \ Le Pratyekabuddha un trisahasra mahshasra lokadhtu. Le Bouddha Bhagavat

voit

Yasamkhya lokadhtu

il

voit suivant

son

dsir.

Pour-

quoi ?

Comme

son savoir

Qnna)
les

porte sur les

dharmas, de

mme

son il divin porte sur

rpas. [12 a 6]

Est-ce la rddhi seule qui peut tre inne ? D'autres pouvoirs surnaturels peuvent-ils tre inns ?

55
1.

c.

Les autres aussi sont inns.

D'aprs Hiuan-tsang

L'il divin voit sans

omission

Il

voit

dans

toutes les directions, devant, derrire (prsthatas), de cot (prvatas), de jour,

de nuit, dans la lumire, dans l'obscurit (voir


2.

i.

p. 52).

43.

Dans la version de Hiuan-tsang, la kfirika 55 Et le Bhasya est modifi En ce qui concerne


:

a-b est place aprs la karika


l'activit

des cinq Abhijfias,


a],

large ou troite, dans les univers (lokadhtu) qui sont leur domaine [12
les

tous

ryas ne sont pas

pareils.

Les SrSvakas,

les

Pratyekas
les

et les

Bouddhas,

lorsqu'ils

ne font pas acte extrme d'attention, produisent

l'activit

de leur matrise

en dplacement

(gamana)

et

en cration (nirmna),

premiers dans un

Mahasahasra,

les

deuximes dans un Dvisahasra,


.

les troisimes

hasra. Lorsqu'ils font acte extrme d'attention, dans

dans un Trisaun DvisShasra, dans un

Trisahasra, dans des univers infinis


3.

/ ston gnis gsum dan grans med mthon as Cit dans un commendvitrishasriksamkhyadrg arhatkhadgadaisikah / taire de la Namasamgti (ad vi. 18, asangadrk). 4. Sur les chiliocosmes , iii. 73. [aupapattikam apy anyat] 5. gzhan yan skye bas thob Les dieux du Kama et les Anagamins dans le Rpadhatu possdent, par le fait

dgra bcom bse ru ston rnams kyis

Hiuan-tsang,

xxvii, fol. 17 b-18 a.

125

Quatre pouvoirs, oue divine, il divin, souvenir des anciennes


existences, connaissance de la pense d'autrui, sont aussi inns.
les

Mais

pouvoirs inns ne portent pas


c-d.
'

le

nom

d'Abhijna.

55
diaire.

L'il divin, quand

il

est inn,

ne voit pas

l'tre

interm-

Il

n'est pas capable de voir la couleur et la figure des tres interle

mdiaires qui ne sont vus que par l'il divin d'Abhijna. Pour
reste, l'il divin

inn est pareil l'il divin d'Abhijna.


2

56

a.

Cette connaissance de la pense d'autrui est de trois sortes.

Cette

connaissance, c'est--dire la connaissance de la pense


elle est inne.

d'autrui

quand

De

trois sortes

bonne, mauvaise,

non-dfinie.

56

b.

Aussi quand

elle est

produite par rflexion, par formules.

La connaissance
dfinie,

de la pense d'autrui est bonne, mauvaise, non


est produite

quand

elle

par rflexion, tarka, par formules,

mantra. Un homme, par


d'interprter les signes
:

l'tude de

Yksankastra Vest capable

sa connaissance de la pense d'autrui est

produite par rflexion

de

mme on

peut connatre la pense d'autrui

par

les formules.

Au contraire, produite par bhvan ou dhyna,


seulement bonne.
et le
3

cette connaissance est

Le paracittajnna

prvanivsnusmrtijnna

connais-

de leur naissance, ces quatre pouvoirs.

Ces pouvoirs manquent


/

dans l'Arflpya-

rpbhvd drstir (?) [= rddhir] gamanam nirmnam ca nsti npi divyam rotrani caksu csti paracittajnnam api nsti svaparadh&tu
:

satntnapariccliedbhvt (Dtail intressant) / prvanivsnusmrtir api nsti I kmarpvacarasattvavat tdrasytmabhvasysamudgamt j


atlia
1.

des ni

va sarv apy abhift na santi. / srid pa bar ma mi mthon no.


iii.

Ceci est expliqu


2. seras es
3.

14 a

ci-dessus p. 123 n.

3.

de ni rnam
rig

gsum dan
ix.

rtog

dan

snags byas pa han


258,
etc.).

4.
5.

Le

trait

des ksanikas (Manu,

Ci-dessus p.

112, n. 1.

Atthasalinl, 91.

126

CHAPITRE

VII,

56

c-d.

sance de la pense d'autrui, souvenir des anciennes existences


sont inns chez les tres infernaux. Par ces deux

jnnas
'

56

c.

Les tres infernaux tout d'abord connaissent.


et aussi

Ds leur naissance
par la souffrance,
ils

longtemps

qu'ils

ne sont pas crass

connaissent la pense d'autrui et se souviennent


iv.

de leurs anciennes existences (Voir

80

d).

Les tres qui se trouvent dans les autres destines o le paracitta-

jhna

et le

prvanivsnusmrtijnna sont

inns,

connaissent

toujours parce que la souffrance ne les accable pas.

56

d.

Chez

les

hommes, non

inn.

Chez

les

hommes,

les cinq pouvoirs,

rddhi,

etc., dcrits

ci-dessus,

ne sont pas inns.


S'il

en est ainsi,

comment

certains

hommes,

les

Bodhisattvas,

possdent-ils naturellement le souvenir des existences antrieures ?

Le souvenir des existences


tismarat) n'est pas chez eux
d'une naissance humaine
saja).
3
;

qu'ils

possdent par nature (prakrtij,

inn

c'est--dire

obtenu par

le fait

il

rsulte de certains actes

(karmavieest

Comment
:

cela ?

Le prvanivsnusmrtijnna

de
ci-

trois espces

fruit

de mditation (bhvan) (l'Abhijna dcrite

dessus), inn (dieux), ralis par l'acte (Bodhisattvas).

dmyal ba pas ni dan po ses nrnm notpattilbhikam. mi la skye bas tbob pa med Les cinq pouvoirs (rddhydika) sont, pour les hommes, ou vairgyalbhika abhijnphala) ou tarkavidyausadhakarmakrta, non pas upapattilbhika. nma yad upapattikla eva sarvesm nisargato 3. upaputtilbhikam labhyate / na tu yat kasya cid evopapattikld rdhvam / yath pakslnm
1.

2.

kagamanam.

CHAPITRE

VIII

Les Recueillements

Nous avons
jns,
etc.

tudi (krto nirdesah) les qualits ou biens spirituels

(guna) qui consistent eu savoir (jnna)

pranidhijnna, abhiH
faut mainteetc.
*

dans leur relation avec


les

les dix savoirs.

nant tudier

qualits d'une nature diffrente,

samdhis,

Nous

parlerons d'abord de leurs points d'appui (sraya)

c'est--

dire des tats

mentaux grce auxquels

elles se produisent.

Ces points

d'appui sont les recueillements ou concentrations (sampatti) 2 Parmi


ceux-ci,
1.
est

nous tudierons d'abord

les

dhynas.
;

Les dhynas sont au nombre de quatre


:

chacun de ces quatre

double

les

d/M/was-naissances ont t dfinis. Les dhynas;

concentrations sont application de bonnes penses sur un seul objet

avec leurs concomitants, cinq skandhas.

Comme

ils

sont,

la

diffrence

des rpyas,

recueillements

immatriels

, le

point d'appui de toutes les qualits, soit


soit

communes

(sdhrana),

soit spciales,
les

pures (ansrava), soit impures,

nous tudions d'abord

dhynas.

1.

[nirdes'ah].
2.

Vyakhya anyasvabhvnm tu [gunnm] samdhydnam kartavyo On prfrerait apramnas, etc. (viii. 29-37). Hiuan-tsang a ting. Je lis sampatti et non pas samdhi d'aprs viii.
:

23,

o on trouvera quelques notes sur sanipatti-samdhi.

3.

bsam gtan dag


rtse gcig

ni

rnam
/

dge ba

pa

rjes

gfis bzhi / der skye ba dag rab tu bsad / snoms hjug hbran bcas na phiui po lna as dvidh dhynni catvri

[tafrokt

upapattayah

sampattih subhaikgryam snng skandhapan-

cakam
La
dhi.

II]

lia ri lia

a bien sampattih
le

ubhaikgryam ; mais
viii et

le

Stra parle de

sam-

Sur

sommaire traditionnel du Chapitre


23, note.

sur sampatti-samdhi,

ci-dessous

viii.

128
Il

CHAPITRE y a quatre dhynas,


ces quatre
le

VIII, 1.

premier, le deuxime,

le

troisime et le

quatrime.

Chacun de
nadhyiia)

dhynas

est de
:

deux

sortes,

ou bien sam-

patti, recueillement
;

ou concentration

c'est le
:

dhyna-cause (krac'est
le

ou bien upapatti, existence


'

dhyna-eiet
[1 b]
:

(kryadhyna).
on a vu que
octuple

Les dhynas-existences (upapattidhyna)


le

ont t dfinis dans

troisime chapitre de ce livre (lokanirdea)


et

les trois
2).

premiers sont triples

que

le

quatrime est

(iii.

Le sampattidhyna, en gnral (abhedena),


application de bonnes penses sur un seul objet

est dfini

comme

aikgryam),
tration
le
(ii.

'

car les
Si

p. 155).

(ubhnm cittnm dhynas ont pour nature le samdhi, concenon considre le samdhi avec sa suite (snuga),
les cinq

sampatti-dhyna comporte

skandhas.

'*

Que
1.

faut-il

entendre par

'

application sur

un

seul objet

'

ou samproduit

Paramartha traduit
.

dhyna
a-b,

produit par la naissance,

dhyna

par la concentration
2.

Kosa,
19

le ciel

iii. 2 c, vi. 38 a-b, 43 du premier dhyna, etc.

ii.

41

d.

Il

y a

trois (ou

deux) tages dans


, viii. 12,

Sur

les existences

de

dhyna

14 a,

16

c,

c.
:

3.

Pli

kusalacittekaggat (Visuddhimagga, 84

voir index)

Majjhima,

i.

301, Samyutta, v. 21,

Dhammasangani, 11 (cittassekaggat) (La traductrice signale Yogavacara's Manual, p. xxvi) Mrs Rhys Davids, Psychology, 1914, 104 adhicitta, vi. p. 225; membre samdhi (rfrences aux textes canoniques). du chemin, membre de la Bodbi, vi. 54 d, 70 rddhipda, vi. 69 c-d, membre du
;

Saiksa

et

de PAsaiksa,

vi. 75.

Bodhisattvabhmi,

fol.

82

b, cit viii.

27

c-28.
i.

samdhi un texte trs scolastique dans Majjhima. 301. Dans le samdhiskandha rentrent trois membres du chemin, samyagvyyma, samyaksmrti, samyaksamdhi ; il s'ensuit qu'on distingue: 1. le samdhi (= cittassa ekaggat) ; 2. les nimit'as du samdhi qui sont les smrtyupasthnas ; 3. les pariskras du samdhi qui sont les samyakpradhnas 4. la culture (bhvan) du samdhi qui est la culture du samdhi, des praSur
le
;

dhnas, des smrtyupasthnas


paripri],
4.

culture

s'entend dans

le

sens de parisuddhi,
recueillement

Quiconque entre en dhyna,


la

c'est--dire

quiconque possde
les

le

nomm dhyna,
skandhas),

possde ncessairement, outre


discipline de

mentaux
rpa.

et la

pense (quatre

dhyna

(iv.

2) qui est

Hiuan-isang,
dhi (aikgrya) ? Le
fait
'

xxviii, fol. 1 a-b.

129

que

les

penses ont un seul objet (eklam-

banat cittnm). Le Sautrantika


par
le

objecte.

S'il

en est

ainsi,

ce que l'on dsigne

mot samdhi

c'est les
Il

penses

mmes

qui ont

un seul

objet

(cittny evaiklambanni).

n'y a pas lieu d'admettre une chose

part, un certain

dharma
rplique.

mental

Le Vaibhasika
certain

nomm samdhi. Ce qu'on nomme samdhi,


2

c'est

un

dharma

par lequel les penses se trouvent concentres, applile

ques un seul objet. Les penses concentres ne sont pas


dhi.
3

sam-

Ici

se prsentent plusieurs difficults

1.

Les penses tant momen-

tanes (ksanika), chacune d'elles porte sur un seul objet. Quel est

donc

le rle

du samdhi ?

2.

Le samdhi, direz-vous,

fait

que

la

deuxime pense
jet

n'est pas distraite

ou dtourne (aviksepa)
le

de l'ob-

de la premire pense. Mais alors

samdhi

n'exerce aucune

action en ce qui concerne la premire pense que vous considrez

cependant

comme

associe au

samdhi

3.

Pourquoi imaginer un
les

samdhi en
assignez au

soi ?

Pourquoi ne pas admettre que


a ?"

penses se

trouvent appliques un seul objet en raison des causes que vous

samdhi

4. Enfin,

vous avez

dfini le
ii.

samdhi

comme un dharma
les

universel

(mahbhmika,

24)

donc toutes

penses doivent possder ce caractre d'tre concentres (kgra).

1. klambanat cittnm ; c'est la dfinition de l'Abhidharma mais il faut comprendre cittacaittnm : Le fait que les penses et mentaux .... . 2. Dfini Kosa, ii. 24 d trad. p. 155. 3. na cittny eva samdhih / yena tu tny ekgrni variante samhitni sa dharmah samdhih. De mme le Vaisesika soutient qu'une toffe est blanche uklagunayogt, par conjonction avec la qualit de blanc. 4. samprayukte samdhivaiyarthyam, c'est--dire yat prathamam cittam
; ;
:

samdhisamprayuktam tasmin samprayukte samdhivaiyarthyam taira kritram samdhir na karoti dvitlye karotlti krtv. 5. Je pense que le Bhasya porte yata eva samdhis tata eva cittnm eklambanatvam kim nesyate. Vyakhya kim ca yata eva krant samdhir ekgratlaksano 'bhipretas tata eva kranc cittnm eklambanatvam kim nesyate kim samdhij
: :

nrthntarabhtenety abhipryah.
9

130

CHAPITRE

VIII, 1.

Le Vaibhasika rpond cette dernire de la faiblesse du samdhi.


'

objection

Non, en raison

Le Sautrantika
Car
est dit,

dit

que
le

les

penses qui portent sur un


:

mme

objet

(ekgrni) constituent
il

samdhi

le

dans

le

Stra, que les quatre

samdhi n'existe pas part. dhynas sont Yadhicit


;

tam
les

iks, la

haute discipline intellectuelle

[2 a]

il

est dit

que

quatre

dhynas

sont le cittaparisuddhipradhna,
2

l'lment

capital de la purification de la pense.

Quel
l'ascte

est

le

sens du
recueilli

mot dhyna

'

En
,

raison du

dhyna,
'\

est

(samhita)

et

capable d'upanidhyna

Upanidhyai
le

signifie connatre

exactement

comme

il

est dit
5
.

dans

Stra

Celui qui est recueilli connat en vrit


le

La

racine

dhyai

est

employe dans

sens d'upanidhyna.

Dans

l'cole des Sarvastivadins,

Yupanidhyna

est donc, de sa

1.

Toute pense comporte samdhi. Mais

la

pense associe (samprayukta)

un
2.

samdhi

faible n'est pas concentre (ekgra).


le

D'aprs la Vyakhya, les deux dfinitions dans

mme
vi.

Stra

adhicittam

iks

katam
les trois

Sur
est

catvri dhynni. ikss, Anguttara, i. 235


j

ii.

194. Kosa,

43

c, p.

225.

De mme que l'adhillam iks

est lla, de

mme que Yadhiprajnam

iks

prajn, de mme Y adhicittam iks est simplement citta. Or les dhynas sont Yadhicittam iks, donc ils sont citta ; les dhynas, d'ailleurs, sont samdhi, donc le samdhi est citta. De mme la llaparisuddhi est ila, la drstipariuddhi est drsti, la vimukli-

pariuddhi
3.
4.

est vimukti. (Voir Kosa, Le Sarv&stivfidin rpond.

vi.

76

c,

p. 297).

Mahavyutpatti, 245, 1052, 1055, upanidhytavya, nidhyyati

Kosa,

i.

41

Vyakhya explique samtlranam .... visayopanidhynaprvakam nicaykarsanam. 5. samhitacitto yathbhtam prajnti [yathbhtam payati]. Cette formule figure notamment dans le Stra des cinq vimuktyyatanas cit Vyakhya
c,

la

ad.

i.

27 (Mahavyutpatti, 81, Dlgha,

iii.

241, Anguttara,

iii.

21)

Samyutta,

iii.

13

samhito bhikkhave bhikkhu yathbhtam pajnti; ii. 31 -.samdhpanisam

yathbhtam nnadassanam,
v. 3,

etc.

Et

ailleurs,

Nettippakarana, 66, Anguttara,

Visuddhimagga, 371,

etc.

D'aprs tous ces textes,

le

samdhi

est ncessaire la connaissance exacte


;

ncessaire au salut. Sur ce point, voir Compendium, 55, 75 Kosa,


p. 9, viii.

vi.

Avant -propos

22

d.

Hiuan-tsang,
nature,
est,

xxviii, fol. 1 b-2 a.

131

prajn

[tandis que, dans d'autres coles,


'

Yupanidhyna

de sa nature, cint, rflexion.]

Si les
faut-il

dhynas

sont, de leur nature,

recueillement, sampatti,

donc entendre que tous

les recueillements, bons,

mauvais ou

non-dfinis, sont

dhyna ?

Non pas.

C'est seulement le recueille-

ment muni de

certaines excellences (prakarsayukta) qui reoit le

nom de dhyna. De mme, dans le monde, c'est le soleil qu'on nomme luminaire (bhskara), non pas la mouche lumineuse (khadyotaka).

Le dhyna

est

en

effet excellent

c'est

un recueillement muni des


va au moyen de calme au joug (yuganadsont quilibrs)
2
,

membres

(angasamyukta,
o
le

viii.

10), qui

(amatha)
dhavhin,
qui est

et d'intellection

(vipayan)
calme

attels

c'est--dire

et l'intellection

nomm

dans

le

Stra du
les gloses

nom

de

batitude de ce

monde

1.

D'aprs Hiuan-tsang et

de Kiokuga Saeki.

D'aprs ParamSrtha
le
il

D'autres matres disent que ting (ss

samdhi)

est

di-h-na. Quel est


est

sens

de

dhyna? Par

le

[ting] on obtient de connatre, de voir,

donc

nomm

dhyna. Pourquoi ? Parce que la pense qui obtient le ting [la pense samhiia] connat et voit en vrit. Le mot dhyna signifie donc se (cint, cetan)-\- liang
(mesurer). Le se est prajii. Tel est le Siddhanta
2.
.

amathavipasyanbhym yuganaddhbhym vahatiti yuganaddhavh tadbhvt


j
....

ivvbhym
tel le

ratho
attel
l'intelil

Tel un char avance

tir

par deux cavales atteles au joug,

dhyna

de

amatha

et
;

de vipayan.
le

Dans les rpyas,


PAnagamya
(viii.

le
;

calme est grand,

lection petite
quilibre.

contraire dans

22)

dans

les

dhynas,

y a

amatha

= samdhi = recueillement, vipayan


la Pli
; ;

prajii.

Les diteurs de

nandha
le

Text Society (contre quelques manuscrits) lisent yuga(Patisambhida, ii. 92 et suiv. Visuddhimagga, 149) Quelqu'un cultive
:

vipassana prcd par samatha ... quelqu'un cultive le samatha prcd par vipassana quelqu'un cultive samatha et vipassana attels (samathavi...

passanam yuganandham bhveti) . Les dharmas attels ensemble et qu'on nomme samdhi et prajn ne se dpassent pas l'un l'autre (samdhipannsamkht yuganandhadhamm annamannam anativattamn ....).
....

Bodhicarya,
55, 75.

viii.

4,

Siksasamuccaya, 119, Stralamkara,


le

xiv. 9.

Compendium,

Dans

le

Tantrisme

distinction

du samsara
p. 46-48).

yuganaddhaka ou yuganaddhakrama, c'est la non et du nirvana, du grhaka et du grhya, etc.

(Pancakrama,

132

CHAPITRE
viii.

VIII,

1-2

C.

(drstadharmasukhavihra,
(sukhapratipad,
aisment
'.

27) et du

nom

de

route facile

vi. 66),

la route par laquelle

on connat mieux
qui
est

et

C'est donc le

recueillement

excellent

nomm

dhyna.
Mais, dira-t-on,
bres,
si le

dhyna

est le recueillement

muni des mem

comment

le

recueillement souill (klista), c'est--dire

savouviii.

reux

ou associ dlectation

(svdanasamprayukta,
?
2

5),

peut-il recevoir le

nom

de

dhyna

Parce

qu'il est

mauvais upanidhyna.

Mais, dira-t-on, ceci entrane des conclusions manifestement fausses.

[En

effet

on pratique mauvais upanidhyna avec une pense


:

en proie au dsir sensuel (kmarga)

et

cet

tat

ne peut tre

dhyna].

Non

3
.

Nous rservons

le

nom

de

dhyna
;

l'tat souill qui res-

semble (pratirpa) au vrai dhyna

comme, dans

le

monde, on
mais une

nomme ptibija,

graine pourrie, non pas un caillou,

etc.,

chose qui ressemble la graine, bien qu'incapable de germer. De

mme

on parle d'un Bhiksu prjika

(iv.
4

39

c-d).

Et

il

est parl

[dans l'Ecriture] de

dhynas mauvais.

En raison nas ? 2
a-b.

de quels caractres distingue-t-on les quatre [2 b] dhy-

Le premier

est

muni de vicra-priti-sukha, membres que


5

les suivants
1.

abandonnent successivement.

2.

sutarm tena dhyyanti sukhatvt. mithyopanidhynd iti mithysamtrand

ity arthah.

3.

na

tatpratirpa eva

....

kliste

dhynam

iti

samjnsamnivesah
:

pti-

bljavat.
4. uktni ckualni dhynni. La VyakhyS cite le Sotra sa kmargaparyavasthitahktnaryaparyavasthnam antar krtv dhyyati pra-

dhyyatti vistarah. Sur le dhyna souill, l'histoire du moine qui se croit Srotaapanna au premier dhyna, Arhat au quatrime, mais qui en fait reste soumis au dsir, Przyluski, Aoka, 390. Trois mauvais contemplatifs , dhyyin, Kosa, v. 21 b-d, trad. p. 43 et note
;

Majjhima,
5.

iii.

14.
/

dpyod dan dgah dan bde dan ldan

yan lag sna sna span ba yin

= vicra-

Hiuan-tsang,

xxviii, fol.

a-b.

133

Le premier dhyna
sukha,

est la

concentration (aikgrya) munie de


et
:

vicra-priti-sukha [c'est--dire associe vicra muni de priti


et associe

prti
,

et

sukha].
le

C'est
il

dire implicitement

munie de vitarka
la

car

vitarka accompagne ncessairement


le

comme

fume accompagne
prti
le

feu

n'arrive pas que le vicra


'

soit associ

et

sukha sans tre aussi associ vitarka.

Le deuxime,
vicra,

troisime et le quatrime

dhyna

sont caractriss
;

par l'abandon successif de chacun de ces trois membres


le

en cartant

deuxime dhyna qui

est

muni de

prti et

sukha

en
;

cartant ensuite prti, le troisime

en cartant ensuite sukha,


les trois

le

dhyna qui est muni de sukha quatrime dhyna auquel manquent

membres.

C'est ainsi que la concentration (aikgrya) se divise en quatre


catgories, en quatre

dhynas.

Nous avons

dcrit les

dhynas ; que

sont les
2

rpyas

2
a.

c.

De mme Yrpya, quatre skandhas.

Les rpyas

c'est--dire les recueillements et les existences

prtisukhavat prvaprvngavarjitam sukha, est expliqu ci-dessous.

//

Le sens de vitarka, vicra, prti,

Dans Niddesa,
1. Il

p. 373,

un

essai intressant de classement des


l'auteur,

dhynas.

y a difficult. vicrapritisukhavat,

Comment
dit-il

en disant que

le

premier

dhyna

est

implicitement que ce

dhyna

est aussi avec vitar-

ka ? En effet, le dhynntara est avec vicra i et sans vitarka . La Vyakhya explique yath dhynntare vicro na prtisukhavn ity avitarko naivam ayant vicrah visesito hy ayant vicrah prtisukhasahapathitah
:

vicraprtisukhavad iti prtisukhavat vicrena prtisukhena ca santprayuktant prathamant dhynam ity arthah. Vasubandhu ne dit pas vitarkaprltisukhavat, parce qu'il va dire que les autres dhynas perdent, dans l'ordre, les membres indiqus. Si on dfinissait le deuxime dhyna comme sans vitarka, le dhynntara se confondrait avec le deuxime

dhyna.

med phun po bzhi [tathrpy catuhskandhh] rpyas, Majjhima, i. 2, 164, 410, ii. 261 (o les deux premiers sont ignors), Visuddhimagga, 111, 326-340; Comm. du Dgha, Dialogues, iii. p. 273 Y ksnaiicyatana est un dhyna qui a pour lieu (objet) l'infinit de l'espace; rfrences aux notes des Rhys Davids, ibid. p. 216.
2.

de bzhin gzugs
les

Sur

134

CHAPITRE

VIII,

2 c-3
le

c.

du domaine de l'rQpyadhatu

pour

nombre

et la nature,

sont

comme
Il

les

dhynas.
et

y a quatre rpyas
et

chaque rpya
.

est double,

de nais-

sance

de concentration

Les

naissances
le

(esm rpy(iii.

nm
elles

upapattayah) ont
sont concentration,
.

t dfinies

dans

troisime chapitre

3).

Quant aux concentrations d'rpya, de

leur nature et en gnral,

application de penses bonnes

un

seul

objet

est

En raison de cette double similitude, la Karika dit que Yrpya comme le dhyna. [3 a] b. Le dhyna est accompagn des cinq skandhas ; Yrpya est
tout

accompagn de quatre skandhas, car


atisravasamvara,
ii.

rpa (dhynasamvara,

iv.

4) y

manque (anuparivartakarpbhvt,

51

a-c).

d. Il

nat de la sparation d'avec la terre infrieure.

'

Tous

les

rpyas sont concentration

mais

il

y a cependant quatre

rpyas, parce que

la concentration qui constitue

chaque rpya

procde de la sparation (viveka) d'avec la terre infrieure.

Ce qu'on nomme ksnantyyalana,


procde de la sparation d'avec
suite jusqu'au

c'est le

recueillement qui

le quatrime dhyna ; et ainsi de naivasamjhnsamjhyatana (ou bhavgra) qui

procde de la sparation d'avec Y kimcanyyatana.

viveka Que faut-il entendre par sparation (nantarya et vimuktimrga) par lequel l'ascte
'

',

Le chemin

est dlivr de la

terre infrieure, parce

que ce chemin

lui

tourne

le

dos (vairgyaga-

mant tadvaimukhyagamant).
[adhobhmivivekajh] 1. hog mahi sa las dben las skyes Paramartha traduit Sparation-terre-infrieure nait . Hiuan-tsang Sparation infrieure terre natre, d'o division en quatre . P'ou-kouang explique
: : :

Il

est
:

quadruple parce
Il
:

qu'il nat

de la sparation d'avec terre infrieure


signifiant
.

Fa-pao

est quadruple en raison de sparation d'avec naissance

dans terre

infrieure

sparation d'avec naissance

sparation d'avec dhar-

mas

souills

ou bien

se sparer et natre

On

nait [en haut] parce qu'on se

spare [de ce qui est en bas],

Hiuan-tsang,

xxviii, fol.

2 b-3

a.

135
trois

a-b. Ils sont dits


'

vibhtarpasamjfia, ainsi que

sdman-

takas.

Les drpyas fondamentaux (maula), avec


res

les stades prparatoi-

(smantaka) des
:

trois

drpyas fondamentaux

suprieurs, sont

dfinis

qui a vaincu la notion de

rpa
qu'il

Le premier smantaka, stage prparatoire de Ykdsdnantyyatana, ne reoit pas ce nom, parce


a pour objet
le

quatrime

dhyna

la notion de rpa ne s'y trouve pas compltement dpasse.

Les drpyas sont ainsi

nomms

parce qu'il ne s'y trouve pas de

rpa

c.

Dans l'rupya, pas de rpa.

vibh1. fier bsdogs gsum dan bcas par ni / gzugs kyi hdu ses bsig ces bya tarpasamjndkhyh [smantakais tribhih saha ?] 2. gzugs med pa na gzugs med do Kosa, iii. 3, explique comment l'rpyadhatu, qui ne pomporte pas de places, d'tages, est cependant quadruple au point de vue du mode d'existence des dieux L'Abhisaqui y naissent rpyadhtur asthna upapatty caturvidhah.
:

mayalamkrloka (ad Astasahasrika

153, 18), aprs avoir cit cette


:

dfinition*

ajoute une ligne (emprunte quel Sastra ?)

dhynd rdhvam sasamsthno


car

au dessus du monde des il s'y trouve un peu de Ripa . La cosmologie bouddhique connat des cieux superposs d'rpya, o il y a des chteaux (kong) ; voir par exemple Hastings, art. Cosmology. Kathavatthu, viii. 8, xvi. 9. Les Andhakas soutiennent que de la matire subtile existe dans l'rupya (en raison du texte vijnnapratyayatn ntna-

rpesadbhvo 'tha va

(Sic Ms.)
il

Ou

bien, plac
figure,

dhynas (= Rpadbatu),

comporte

rpam, voir ci-dessous p. 138). Voir Vasumitra et Bhavya. Les Mahasamghikas, Mahlsasakas, auxquels la Vibhasa ajoute
vadins, admettent l'existence du rpa.

les

Vibhajya-

le

Commentaire du Samayabheda Existent dans Rpa et l'rupya les six sortes de connaissance (sad vijnnakyh). Mais, s'il y a rpa dans l'rupya, pourquoi est-il nomm rpyadhatu ? Parce qu'il s'y trouve rpa subtil, non pas grossier. Vibhasa, 83, 16. Quelques-uns disent que le rpa existe dans l'rQpya, Les Mahasamghikas pensent que, dans l'rOpya, comme les Vibhajyavadins il y a un rpa fruit de l'acte. Le Sariputrabhidharma dit que, dans l'rupya, il y a rpa, savoir rpa faisant partie du dharmyatana (Kosa, iv. trad. p. 16). Dans le Grand Vhicule on dit que, dans l'rupya, il y a rpa fruit du samdhi. MahadharmaNotes de l'diteur japonais
:

....

136
Ceci doit tre dmontr

CHAPITRE

VIII,

C.

(sdhyam tvad

tat), disent

d'autres

Ecoles (nikyntariyh)

car nous soutenons qu'il y a du

rpa
?

dans

les

rpyas.
les

Mais alors comment

rpyas

sont-ils

nomms rpyas

On

les

pyh), de

nomme ainsi parce que le rpa y est rduit (sadrp rmme qu'on nomme pingala, rougetre , ce qui est un
(i.

peu rouge (tsatpingala)


Soit
i.
;

17, p. 32).

mais quelle sorte de rpa attribuez-vous l'rflpyadhatu ?

rpa n'est ni le corps, ni la voix, mais rpa que constituent les disciplines corporelle et le rpa faisant partie du dharvocale (kyavksamvaramtra myatana, iv. trad. p. 16), comment ces disciplines peuvent-elles exister en l'absence de corps et de voix ? Et comment un rpa driv
Si vous dites que ce
le

seulement

des grands lments (bhatika), savoir la discipline, pourrait-il


exister en l'absence

du rpa primaire, en l'absence des grands


[3 b].

l-

ments (mahdbhlas) ?

Si

vous rpondez que la discipline

corporelle et vocale existe sans le concours d'un

rpa primaire du
pure (ansrava)

domaine de l'rpya, de

mme

que

la discipline

existe sans grands lments de

mme

nature, c'est--dire purs, la

rponse ne vaut pas, car la discipline pure a pour point d'appui


les

grands lments, impurs, de la terre o l'rya est n

(iv. 6).

Cette dmonstration de l'absence du

rpa vaut non seulement


qui est rpa],

pour

les

naissances d'rpya, mais encore pour les recueillements


',

d'rQpya
ii.

[o

manque

la discipline,

samvara,

Si vous attribuez aux tres d'rpyadhtu les organes matriels


le

(rpndriya), comment pouvez-vous dire que

rpa de l'rpya

8, 16 Quant aux dieux du Naivasamjnanasamdeux vhicules ne peuvent savoir comment ils sont ... Ce qu'il y a de vie (yus : cheu ming) chez les dieux Asamjnins seuls les Bouddhas le savent; de mme pour les tres du Naivasamjnanasamjnayatana. 1. Le Bhsya porte sampattv api tatpratisedha uktah. Vyakhya D'aprs d'autres, il faut comprendre En vertu du texte sarvaso rpasamjnnm samatikramt, il est tabli qu'il n'y a pas non plus rpa dans l'arapyasampatti . L'diteur japonais comprend Parce que l'on nie qu'il y ait [ansrava samvara] dans cette sampatti .

bherlstra,

i.

13,

Mahnirv&na,

jfiyatana, les saints des

Hiuan-tsang,
est subtil ?
petites

xxviii, fol.

3 a-b.

137

Parce

que, rpondez-vous, leurs dimensions sont trs


;

(parimdnlpatvt)

les

tres y sont

donc de rpa rduit


.

(sadrpa), les tres y sont donc

sans rpa

Mais, raisonii.

ner ainsi, les minuscules et invisibles animaux aquatiques [dont parle


le

Vinaya] seront aussi


Direz-vous que
le

sans rpa

rpa de l'rpya
transparent.
'

est

transparent (accha,
.

p.

130) ?

Mais
de

les tres intermdiaires et les tres

du Rflpadhatu

possdent aussi un
Direz-vous que
seul le

rpa

le

rpa

de l'rpya est plus transparent et mrite

nom

non-rpa ?
l'tage le

Mais

alors vous devez rserver le

nom d'rpya
l'tage auquel

plus lev de l'rpya, car les corps seront


le

d'autant plus transparents qu'est plus distingu


ils

recueillement de
2

appartiennent (sampattivad upapattiviest).


des existences de

En

outre, le

rpa

Rpa

(ou de

dhyna) ne peut

tre peru par l'il d'une terre infrieure, tant trop transparent.

En

quoi diffre-t-il du

rpa que vous

attribuez l'rpya ?

Si enfin vous soutenez que le

nom

des deux premires sphres


3
.

(dhtu) correspond son objet (anvarthasamjn)


est pas de
tuite.
iii.

mais

qu'il n'en

mme

du

nom

de l'rpya, c'est l une affirmation gra-

On
:

soutient que le
il

rpa

existe

dans l'rpya

quatre argu;

ments
2.
il

1.

est dit

que la vie

et la
(les

chaleur sont connexes (samsrsla)'*

est dit

que

le

nman

quatre

skandhas immatriels)

et le

api parvatesv acchatvd 1. antarbhavarpvacar M vajramayesu Voir iii. 14 a. transasajjamn gacchanti j tesm rpyaprasangt. parent rend mal le sens du mot accha. [Il s'agit d'un rpa qui peut passer

travers les autres rpas, une matire la faon de l'ther].


2. Car les existences de recueillement (upapatti), comme ments (sampatti), sont de plus en plus bonnes.

les recueille-

3.

On

kmagunaprabhvitah kmadhtuh
ii.

rpaprabhvito rpadh-

tuh.
4.

Voir

14,

iii.

3.

yac cyusman kosthila yur yac cosmakam samsrstv imau dharmau


i.

na
ii.

Sur samsrsta, vii. p. 17, et iii. 32 a-b. Mahakotthita converse avec Sariputta sur ce sujet, Majjhima,
visamsrstau.
45, p. 215).

296 (voir Kosa,

138

CHAPITRE
s'appuient l'un sur l'autre

VIII,

C.

rpa
3.
il

comme deux
le

bottes de roseaux

'
;

est dit
le

que

le

nmarpa

a pour cause

vijfina

4.

il

est dit

que

vijnna ne

vient pas, ne part pas

indpendamment du rpa,
3

de la sensation, de la notion, des samskras.

Ces textes [4 a] ne sont pas


prter

dcisifs, car

il

y a lieu de

les inter-

(sampradhryatvt)

1.

Le Stra

dit

que la vie (yus)


vise-t-il toute sorte
'

est

associe la chaleur, laquelle est


vie ou seulement la vie du
dit
il

rpa

mais

de

domaine du Kamadhtu ?
l'un sur l'autre
et le
8
: :

2.

Le Stra
vise-t3.

que

le

nman
:

et le

rpa s'appuient

mais

toutes les sphres ou seulement le


dit

Kama

Rpadhatu ?

Le

Satra
1.

vijnnapratyayam nmarpam

mais ce texte en-

nadakalpdvayavan nmarpayor anyonyanisritavacant.


ici et

Mais

les

deux versions chinoises,

plus bas, lisent

nmarpa-vijnnayor,

lecture

confirme par les sources plies.

'nyonyanisrite / anyonyam nisritya tistheytm j taira kacid ekm apanayed dvitiy nipatet / dvitlym apanayed ek nipatet / evam yusman sriputra ntna ca rpam cnyonyanisritam anyonyam nisritya tisthati .... Mme comparaison dans Samyutta, ii. 114 mais nmarpa et vijnna, non pas rpa et nman. 2. vijnnapratyayam nmarpam iti vacant. Argument des Vibhajyate
;

Cependant la Vyakhya cite le Siitra kalpyv ksa ucchrite sytm /

tadyaihyusman sriputra dve nada-

v&dins d'aprs Vibhasa, 83,


:

16.

(Ci-dessus p. 135 n.

2).

Vyakhya pratltyasamutpdastra uktam rpyaprasiddhi(?)ksane vijnnapratyayam nmarpam iti vacant. 3. rpopagam bhiksavo vijiinam tisthati rplambanam rpapratistham / yah kas cid bhiksava evam vadet / aham anyatra rpd vedanyh samjtiyh samskrebhyo vijiinasya gatitn va [gatim va] cyutim vopapattim
va vadmti tasya tad vgvastv eva syt. Rdaction trs voisine, Samyutta, 53 (trad. de Warren, p. 162). 4. Vyakhya. La stance yur usm 'tha vijiinam ... Lorsque la vie, la chaleur et le vijnna quittent le corps, il gt, dsert, insensible, comme un morceau de bois (ii. 45 a), prouve que le Stra vise seulement le Kamadhtu, car 1. il n'y a pas de corps dans PArpya 2. dans le Rpa, le corps existe, mais
iii.

le

corps ne continue pas aprs la mort

rpadhtau

tu

yady api kyo

'sti

tatra
5.

kyanidhanam

[d'aprs

iii.

9].

Il

faut observer que, en ce qui concerne les tres de naissance spontane


la formule est
:

vijnnapratyayam sadyatanam, car ce qu'on skandhas qui n'ont pas encore pris l'tat de sadyatana (anispannasadyatanvastha) ; or le sadyatana existe ds l'origine des tres upapdukas, Kosa, ii. 14, p. 132.
(upapdukas),
appelle

nmarpa

c'est les cinq

Hiuan-tsang,
seigne-t-il

xxviii, fol.

3 b-4

a.

139

que tout vijnna

que ce soit un vijnna caus par des


Kama

samskras de Kama ou de Rpadhatu, ou un vijnna caus par des samskras d'rdpyadhatu [, c'est--dire un vijflna caus par
des actes rtribus par une existence de
...

est

cause de

nmarpa
cause
le

? Bien plutt
4.

il

enseigne que tout


nie

nmarpa

a pour

vijnna*.

Le Stra

que

le

vijnna vienne (gati) ou

parte (gati) indpendamment des quatre

rsidences ou lieux du

vijflna

(vijnnasthiti,

iii.

7),

c'est--dire
:

indpendamment des
le

rpa, vedan,
compris
:

samjn

et

samskras

mais

Stra

doit-il tre

indpendamment de toutes

ces sthitis ensemble ?

On
tat),

dira que, le Stra s'exprimant d'une manire gnrale (avise-

savacant), nous n'avons pas l'interprter (na

nous n'avons pas

le

droit de penser qu'il

sampradhryam envisage le Kamalettre,

dhatu, etc.
Cette rponse ne vaut pas
;

car prendre
1. la

le

Stra la

on

aboutit des consquences absurdes:

vie

accompagnera nces2
;

sairement la chaleur, fut-ce la chaleur externe


s'appuiera sur
le

2. le

rpa externe

nman
dit,

3.

le

vijnna
aliments
quatre

4.

il

y aura aliment en bouches dans

rpa externe aura pour cause le le Rpa et l'rpyaqu'il

dhatu, car le Stra


(iii.

d'une manire gnrale,


qu'il dit

y a quatre

40), de

mme

d'une manire gnrale qu'il y a


d'o vous concluez que la
rsi-

rsidences du

vijnna

dence rpa

existe

dans l'rpyadhatu.

Non
rgle
3
:

pas, direz-vous, car le Stra, tout en s'exprimant d'une

ma-

nire gnrale sur les quatre aliments, formule des exceptions la


il

parle d'un tre

qui dpasse les dieux qui se nourrissent

1.
ii.

C'est ce qui rsulte


:

du Stra dont nous avons

la

rdaction plie dans Dlgha

vijnnam ced nanda mtuh kuksim navakrmed api nu tan nmarpam kalalatvya sammrchet j no bhadanta / vijnnam ced nandvakrmya ksipram evpakrmed api nu tan nmarpam itthatvaya prajfiayeta \ no bhadanta j vijnnam ced nanda daharasya kumrasya kumriky va ucchidyeta vinasyen na bhaved api nu tan nmarpam vrddhim vipulatm padyeta / no bhadanta. 2. bhyasypi hy usmana yus vinbhvo na prpnoti.
63
3.

asty asyotsargasypavdah.

140
de l'aliment-en-bouches
joie
.
2

CHAPITRE

'

VIII,

C.

il

parle d'tres

qui se nourrissent de

Fort bien, mais

le

Stra ne

dit-il

pas aussi,
:

et

catgoriquement,

rpa manque dans l'rpya ? Il dit 1. Par les rpyas on sort des rpas * 2. Ces tats de dlivrance tranquilles, au-del des rpas, les rpyas 3. Il y a des existences sans
que
le
;

...

rpa, en passant absolument au-del des notions de rpa


or, si le

"

rpa

existait

dans

les existences

ou dans

les recueillements

d'Arpya,

les tres qui s'y

trouvent auraient notion de leur rpa. Le


et recueille-

Stra ne dirait pas que l'ascte obtient ces existences

ments en passant au-del des notions de rpa.


Notre adversaire rpliquera que
le

Stra, dans ces divers passages,

entend parler, non du rpa en gnral, mais du rpa grossier d'une


terre infrieure.

Nous

rpliquerons que, dans cette hypothse,


le

1.

on devra comon
les

prendre dans

mme

sens

le texte relatif

l'aliment-en-bouches,
et

lequel existera donc, subtil, dans le

Rpa

Frpyadhatu
et

2.

devra dire que l'ascte

sort,

par

les

dhynas, des rpas,


:

que

dhynas appartiennent l'rpyadhatu


del des

car les

rpas

grossiers d'une terre infrieure, le


les

dhynas sont auKamadhtu 3. on


;

devra dire que, par


n),
etc.
:

rpyas,

l'ascte sort de la sensation (vedala sensation des terres


, etc.

car les
;

rpyas sont au-del de


les

infrieures

et

on devra

nommer

sans sensation

Le
r-

Stra ne s'exprime pas

ainsi.

Tenons donc pour acquis que

les

pyas sont au-del de


Objection.

rpa quel qu'il soit. Comment les rpyas peuvent-ils


tout
44
d,

tre la sortie

1.

L'Udfiyistra (Kosa,

ii.

trad. 209) dit

bhedc ca kyasytikramya

devn kavadlkrhrabkaksn
upapadyate.
Anguttara,
2.
iii.

anyatamasmin divye manomayakya


i.

192,

comp. Dgha,

34, 186.

prtyhravacant.

iii.

98.

3.

rpnm niksaranam rpyh.


ye te ntavimoks atikramya rpny rpyh Madhyama, 24, 12. rpajtim tu krtsnm atikrntah.
...

4.
5.
6.

viii.

32.

Hiuan-tsang,

xxviii, fol.

4 a-5
effet,
:

a.

141

(nihsarana) des rpas ? Bhagavat, en

nie que l'existence

(bhava) puisse
sortir

tre la sortie de l'existence


le

Je dis qu'on ne peut

du bhava par

bhava

'.

Bhagavat
mme
sortir

s'exprime ainsi avec

raison, car, d'une part,

on ne peut
cette

sortir d'une certaine existence (ou

mode

d'existence,

bhava) par

existence,

et,

d'autre part,

par quelque existence que ce


existences

soit,

on ne peut

ni sortir

de toutes les

(asarvanihsarana),
dans
;

ni

dfinitivement

d'aucune

existence (anatyantanihsarana).

Enfin Bhagavat

dit que,

les

dhynas,

il

samjn, samskras, vijnna

que, dans les rpyas,

y a rpa, vedan, il y a veda-

n
fait

....

vijnna. Si vraiment
dirait-il

il

y avait

rpa dans

les

rpyas, pour-

quoi Bhagavat ne

pas [5 a]

qu'il s'y

trouve rpa,

comme

il

pour

les

dhynas

Donc,

comme nous
n'y a pas de

l'avons dit

c. Il

rpa dans

les

rpyas.
il

Des deux arguments ci-dessus exposs,

rsulte qu'il n'y a pas de

rpa dans l'rQpyadhatu. Les docteurs qui soutiennent l'existence du rpa dans l'rQpyadhatu soutiennent une thse fausse et en contradiction avec la raison.
S'il

en est ainsi, lorsqu'un tre obtient une existence d'rpya-

dhatu, sa srie de

rpa

se trouve coupe pour de

nombreuses priodans une sphre

des cosmiques

(iii.

81). Lorsqu'enfin cet tre renat

infrieure, d'o vient

son rpa ?

1.
iii.

naham bhavena bhavasya nihsaranam vadmi.

Comparer Udfina,

10.

bhava

dfini

i.

c.

Voir Pavant-propos des chapitres


dain, qui est
et

v-vi, p. ix.

Par

le

premier

un certain bhava, on ne peut


Il

s'lever au-dessus

du premier

dhyna mondhyna ;

ainsi de suite.

n'y a pas de

bhava par
le

lequel on puisse s'chapper du

naivasamjnnsamjnyatana
outre,

qui est

Bhavfigra, le

sommet du bhava. En
on ne peut trouver

dans quelque stade suprieur d'existence que ce


le

soit,

la sortie dfinitive d'un stade infrieur, car la

chute est toujours possible.


fait

Donc

on ne sort du bhava que par


pas bhava.
2.

Chemin qui ne

pas partie des Dhalus, qui n'est


n'y a absolument pas

VibhasS, 83,

16.

Objection des Vibhajyavadins

S'il

142

chapitre vin, 3 d-4.


d.

Le rpa

nat de la pense.

Autrefois a t produite une cause

une certaine action,


cette cause
2
;

etc.

devant mrir en rpa

la trace

(vsan) de

demeure
le

dans

la

pense

son

efficacit arrive

maintenant maturit

rpa

qui nat maintenant nat donc de la pense.

le KSina et le Rpa, et qui meurent dans l'Arpya et renaissent en bas, leur rpa a t coup depuis 20000, 40000, 60000, 80000 kalpas : comment le rpa est-il produit nouveau ? Si, comme vous le supposez, le rpa coup, abandonn (prahna), est produit nouveau, qui nous empchera de dire que les samskras, quoique coups et abandonns l'obtention du NirvSna,

de rpa dans l'Arpya, les tres qui meurent dans


ils

renaissent dans l'Arpya, lorsque, plus tard,

rapparatront plus tard ? Pour viter ce dfaut,


existe dans l'Arpya
1.
.

il

faut admettre

que

le

rpa

ni seras las skye bar hgyur. ParamSrtha Parce qu'elle est parfume (vsita) par une cause ancienne devant mrir en rpa, la pense a l'efficace de produire maintenant le rpa . Il semble bien que l'expression vsan (Kosa, iv. 27 d, p. 64, vii. 28 c, p. 70, 30 c, 32 d) soit trangre au Sarvfistivfida. Quoiqu'il en soit, Samghabhadra ne

gzugs

2.

l'emploie pas.

Samghabhadra, Petit trait (xxiii. 8, 80 b 3) Quel sens a cette expression Le sens que tout rpa y manque. Quand on meurt [de l'Arpya] et qu'on nat en bas, le rpa nat du citta. Nous constatons que, dans ce monde, des dharmas matriels et immatriels (rpin, arpin) se produisent en effet en dpendance rciproque du changement de la pense nat diversit du rpa ; quand les organes matriels sont modifis, le vijnna est aussitt diffrent. Donc, lorsqu'un tre mourant de l'Arpya nat en bas, la srie de pense (cittasamtati)
:

rpya ?

se trouve favorable la production de rpa,

et,

par sa force,
il

le

rpa d'une

existence infrieure est


dire

amen

la naissance. D'ailleurs

n'est pas permis de

que le rpa nat seulement de la pense. C'est aussi en raison de la sriede-pense-accompagne-de-mpa d'une ancienne existence le rpa, dtruit depuis longtemps, est sa propre semence. Nous soutenons en effet que le sabhgahetu est la fois pass et prsent (ii. 52 a, p. 256). Pour les Arhats dj nirvns, ils ont coup sans reste la srie des skandhas ; il ne reste aucune cause qui puisse produire la naissance de nouveaux skandhas : ce n'est pas l un cas auquel puisse s'appliquer l'exemple de l'tre qui meurt de l'Arpya [et retrouve un rpa
:

nouveau]. (Voir l'argument des Vibhajyavdins,

p.

141 n.

2).

Grand

trait (xxiii. 6,

69 b

5)

Les

gamas

cits,

par notre adversaire n'tablis-

sent pas que le

rpa

existe dans l'Arpya.

plus de valeur, car, bien qu'il n'y ait pas de

venant mourir

et renatre

en bas,

Son argument de raison n'a pas non rpa dans l'Arpya, un tre d'rpya son rpa vient de la pense. Nous constatons

que dans ce monde

Hiuan-tsang,

xxviii, fol.

a.

143

Mais comment

la

pense, dans l'rpyadhatu, peut-elle exister


le

sans s'appuyer sur

rpa

Pourquoi
mme

n'existerait-elle pas sans


qu'il

rpa ?

Parce que cela n'arrive jamais ici-bas

ait

pense

sans corps.

Mais, en vertu du

raisonnement, vous devrez

nier que les tres du


D'ailleurs nous

Rpadhtu
'

se passent de l'aliment-en-bouches.

avons expliqu

comment

la pense,

dans l'rpya-

dhatu, a pour support le

nikya

et le jvita.

Nous avons rendu compte du nom gnral donn aux drpyas.


Reoivent-ils leurs diffrents noms,
fait qu'ils

ksnantyyatana,
etc.

etc.,

du

auraient pour objet l'espace (ksa),

Non

pas.

Les

trois premiers,
le

a-c.

Vksnantya,

vijnnnantya, Ykimcanya sont nom2

ms d'aprs
Les
trois

l'exercice prparatoire.

rpyas

infrieurs reoivent leur

nom du

fait

que, dans
3

l'exercice prparatoire (prayoga),

on considre l'espace,

etc.

En raison de sa samjn-ni-asamjn.
c-d.
4

faiblesse, le recueillement qu'on

nomme

ni-

1.

iii.

3 c-d

nikyam jvitam ctra

nirit cittasamtatih
/

voir

ii.

41, 45.
/

2.

rnam

phyir

mthah yas mkhah mthah yas ci yan med ces bya de ltar [vijnnnantyam knantyam akimcanhvayam] j
ses
:

sbyor

tath

prayogt.
3.

Vykhya prayogakla kdlny lambanni. Hiuan-tsang:


:

L'ascte,

dans l'exercice prparatoire, pense Infini l'espace vijnna Il n'y a rien . Sur les rpyas, comment on les obtient, Majjbima, i. magga, 326 et suiv.
Vibhasa, 84,
objet,

Infini

le

[sextuple]

164, Sutta 121, Visuddhi-

3. Ce n'est pas en raison de sa nature ou en raison de son mais en raison du prayoga que Y knantya reoit son nom. Le dbutant (clikrmika) considre le caractre de vide du dessus du mur, de l'arbre, de la maison quand il a pris ce caractre, par adhimukti, il contemple le caractre
;

de V ksa
etc.

infini

Dans les rpyas, l'ascte considre Yanitya,


;

le

pratyaya,
la

Vasumitra explique comment, dans Ykimcanya (stade prparatoire),


de sujet et d'objet est carte
voir ci-dessus 124, n. 5.
/

notion

4. dman phyir hdu ses med hdu nasamjnnpyasamjnakam //

ses

med pa han ma

yin no

s mndyt tu

144

CHAPITRE
reoit

VIII,

5-6.

Le quatrime rpya
notion,

son

ide

y est trs
il

faible.

nom du fait que la samjn, La samjn n'y est pas claire


:

ou vive (patu), mais

n'est pas

compltement sans samjn.

cet rpya en considrant La La samjn est ulcre La samjn est samjn flche [5 b]. L'absence de samjn (samjnika ; comparer ii. 41 b) est hbtement (sammoha) ! Cela est tranquille, cela est excellent, mais ce n'est pas en raison le naivasamjiinsamjnyatana ! de cet exercice prparatoire que le quatrime rpya reoit son nom. Et pourquoi le quatrime rpya est-il conu, par l'ascte qui se trouve dans les recueillements prparatoires, comme m-sam-

Sans doute,
2

on se prpare
!

est maladie

'

jn-ni-asamjn ?

Il

faut certainement rpondre que c'est

en

raison de l'exigut des


l'explication de son

samjns (mrdutvt samjnnm).

C'est l

nom.

5.

Il

y a donc huit choses qui sont

recueillement fondamental
:

les sept

premires sont de trois espces

de dlectation, pures (ud;

dha, suddhaka), exemptes d'srava (ansrava)

la

huitime est de

deux espces.
6.

Le recueillement de

dlectation est associ la soif

le recueil-

lement pur est du

bon

d'ordre

mondain

il

est l'objet de la dlec-

une question s'il y a samjn dans le quatrime rpya, la sphre de et non-non-sam/t . Anguttara, iv. 426 Kathavatthu, xiii. 12 Vasumitra et Bhavya. Le recueillement de l'arrt de la samjn et de la vedan ne peut tre obtenu que par un ascte entr dans cet rpya (ii. 44 d, p. 210 et iii. 6 c). On peut, de ce fait, conclure que la samjn y existe. (Sur la pense subtile-subtile, viii. 33 b).
C'est

non-samjn

1.

yady api tatrpy evam prayujyate


Comparer Majjbima,
s'agit des
i.

....

2.

435,

ii.

230

Anguttara,

iv.

422, Visuddhimagga, 335.

samjns des recueillements infrieurs. En effet on entre dans le quatrime rpya en se dgotant, par une mditation pratique dans le smantaka, du troisime rpya. 3. C'est--dire cause d'hbtement (sammohakrana). tair 4. kasmt tu tais tad evam grhyate, c'est--dire, d'aprs la VyakhyS iti tatsampattibhis tad iti naivasamjnnsamjiyatanam evam grhyata iti naiva samjn nsamjneti grhyata ity arthah /
Il
:

Hiuan-tsang,
tation

xxviii, fol.

5 a-b.
est

145
supramondain.
'

du premier

le

recueillement
et les

ansrava

Les quatre dhynas

quatre rpyas sont les huit recueille-

ments fondamentaux,

les huit

maulasampattidravyas.
notion

Les sept premiers de ces huit peuvent tre de


huitime, en raison de la faiblesse de la

trois sortes

le

(samjnmn-

dyt)

[et

par consquent de la vipayan, intellection, aussi], n'est


3

jamais ansrava.
1.

/ rnam pa brgyad bdun rnara pa gsum / dan dag pa dan / zag med brgyad pa rnam pa gnis ro myan mthsuns ldan sred bcas so / bjig rten pa yi dge ba ni / dag pa de ni des myan bya / zag med hjig rten hdas pa ho [evam maulasampattidravyam astavidham tridh j

de ltar sfioms hjug dnos gzhihi rdzas

ro myaii ldan

[astamam dvidh //] [svdanasamprayuktam satrsnam laukikam ubham uddham tadsvdyam idam lokottaram ansravam //] Nous devons ici renoncer traduire ansrava par pur , traduction
/

sapta] svdanavacchuddhnsravny

justifie

ailleurs par le
Vibhfisfi,

synonyme amala, nirmala. 163, 11. La sampatti ansrava

est pure

au sens propre du mot


:

pourquoi ne pas la

nommer uddhaka

....

Quelques-uns disent

Le

nom

est

tabli en raison de la diffrence

(kuala)

et

dharmas

du sens. La sampatti qui est la fois bonne &\ec-sravas (ssrava, laukika), est la premire contradiction des souills on la nomme uddha parce que le sens de puret y est domi:

est dominant dans le noble Chemin. kuala ssrava ; ansrava, c'est--dire Chemin. Mais le recueillement kuala ssrava est samala, sakasya, savisa, sakantaka, ssrava, sadosa comment peut-on le nommer uddhaka ? On le nomme ainsi,

nant. Le sens de

ansrava

uddhaka,

c'est--dire

bien qu'il ne soit pas absolument pur, parce qu'il


n'est pas

l'est

partiellement, parce qu'il


;

ml de klea

parce qu'il contrecarre les kleas


est pur

parce qu'il
;

amne

le

au sens vrai du mot parce qu'il est favorable parce qu'il est l'escorte de Y ansrava. 2. Hiuan-tsang Les maulasampattis, dhynas et rpyas, expliques ci-dessus sont au nombre de huit ... Paramartha Les maulasampattis, considrer les dharmas rels (ou dravyas), sont seulement huit dravyas, quatre rpasampattis et quatre rpyasampattis.
recueillement
; :

ansrava lequel (anukla) au Chemin

Vyakhya
ity
et le

abhipryah.

sampattidravyni maulnti khs tesm nopanyasyanta Les Sakhas ou branches sont les smantakas (viii. 22 a) dhynntara, ou les asamjnisampatti et nirodhasampatti [Note du
:

traducteur].
3.

C'est--dire,
.

le

Chemin

Vibhasa, 162,

on ne peut pas, entr dans ce huitime recueillement, mditer 11. On ne peut pas pratiquer le Chemin dans le
10

146

CHAPITRE
espce,

VIII, 5-8.

La premire
est

svdanasampatti,

est

le

recueillement

associ la soif (trsn).

La

soif,

comme
a].

elle s'attache et

savoure,

nomme svdana,
donc
.
'

dlectation [6

Le recueillement associ

la soif est

recueillement savoureux

ou

recueillement de

dlectation

Le recueillement pur (uddhaka)


association avec les

est

concentration (samdhi)
elle

bonne, mondaine. La concentration est bonne quand

nat en
(iv.

dharmas

blancs, non-dsir (alobha), etc.

a).

Le recueillement pur

est l'objet

savour par

le

recueillement de

dlectation. Aussitt le recueillement pur disparat, aussitt nat le

recueillement de dlectation qui

le

savoure. L'ascte est alors sorti


;

(vyutthita) du recueillement pur qu'il savoure

mais

il

est recueilli
il

(sampanna) du
savoure.

fait

du recueillement de dlectation par lequel

Le recueillement ansrava
ou objet de la soif
;

est

supramondain.

Il

ne peut tre cause

il

n'est

donc pas savour.

Seuls parmi les recueillements, et la diffrence des rpyas, les

dhynas

sont munis des

membres

(anga), [parce que


p.

le

calme

et l'intellection,

samatha
2

et

vipayan, y sont gaux,

157, n. 4].

Combien de membres
Kamadhatu,
1.

dans chaque

dhyna

ni

non plus dans


7
:

le

bhavgra.
...

Voir Avant-propos de Chapitres


le

v-vi.

Mahavyutpatti, 85,
ii.

svdanasamprayuktadhyna.
entre et demeure dans

Anguttara,
elle le

126

Une personne
elle

premier

dhyna;
dans
le

savoure, l'aime, y trouve dlectation sensible (tatn assdeti tant nikmeti

tena ca vittim pajjati). Si

meurt sans en tre tombe,


les autres

elle renat

monde des Brahmakayikas


sance dans
le ciel

De mme pour

dhynas, avec

renais-

qui convient.
les

Ce texte
xiii. 7.

est

invoqu par

Andhakas contre

le

Theravadin dans Katbavatthu,

2.

On

trouvera dans F. Heiler, Buddhistische Versenkung, 1922, une biblio-

graphie europenne trs complte.

Les

sources plies les plus notables sont

Vibhanga, 257, Visuddhi, 139. Parmi les travaux europens, Burnouf, Lotus, 800, Senart, MahSvastu, i. 552 (oubli par Heiler). Il est trop vident que les dfinitions canoniques, malgr les efforts des bhidharmikas-bhidhammikas, restent
obscures.

Hiuan-tscmg,
7-8. Cinq membres dans
et
le

xxviii, fol.

5 b-6

b.

147

samdhi ; dans
le

le

deuxime, quatre,

dans

troisime, cinq,
;
'

sukha samprasda et priti, etc. upeks, smrti, samprajnna, sukha et


premier, vitarka, vicra, priti,
;

samdhi
samdhi.

dans

le

dernier, quatre, smrti, upeks,

aduhkhsukha,

Le premier dhyna

possde
sukha
1.

lorsqu'il est

pur (uddhaka) ou ansrava


2

cinq membres, savoir vitarka, vicra, priti, [6 b]

et

cittaikgrat (== samdhi).

dan po la lna rtog dpyod dan / dgah dan bde dan tin hdzin rnams / gftis pa yan lag bzhi / rab dad dan ni dgah la sogs / gsum pa la lna btan sfioms dan / dran dan ses bzhin bde dan gnas / mthah na bzhi dran btan snoms dan / bde min sdug min tin hdzin gnas [dye panca tarka]craprlti$ukhasamdhayah / [prtydayah prasda ca dvitlye 'ngacatustayam //] trtye panca tpeks [smrtir jnnam sukham sthitih / catvry antye smrtyupekssukhduhkhasamdhayah //] a. La Vyfikhyfi donne vicraprti
la ni
*>
:

b.

par

A la premire et la quatrime ligne, le tibtain traduit concentration > Un hdzin, par gnas la troisime. ParamSrtha traduit partout tchou, et
;

Hiuan-tsang ting.

Je pense ne pas me tromper en restituant sthiti tchou =


la

gnas

cette restitution est garantie par Stralamkara, xvi. 25, trad. p. 188.
le

Dans
le

Bhasya de

premire ligne, Hiuan-tsang dit


par
le

La karika dsigne

le

tng-tch'

(= samdhi)

mot ting

(fixit)

les

mots
:

diffrent, le

sens est

mme.
le

C'est pourquoi le Stra (Samyukta, 28, 20) dit

Le ting

(sthiti) de la
le

pense,

tng ting (samsthiti) de la pense, c'est ce qu'on


l'appelle aussi

nomme

samyak-

samdhi ; on
Dans
le

ubhaikgrya

.
:

Bhasya de la troisime ligne, Param5rtha dit Par tchou (sthiti), il ubhaikgrya, parce que tchou est un autre nom de sa-m-dhi. Le Stra dit Qu'est-ce que le sa-m-dhi ? C'est le tchou (fixit) de la pense dans objet correct (samyagvisaya), correcte condition (avasth) .
faut entendre
:

Premier Dhy&na

vitarka, vicra, priti

de l'ordre du ntanas,

satisfaction

, ii.

f saumanasya, sensation agrable a), sukha (= prarabdhi, fait partie

ii. 25, p. 157), samdhi. Deuxime DhySna adhytmasamprasda (= raddhendriya), priti (= saumanasya), sukha (= prarabdhi), samdhi. Troisime Dhyfina upeks ( samskropeks, ii. 25, p. 159), smrti, samprajanya, sukha (sensation agrable, vedan, ii. 7 c), samdhi. Quatrime Dhyfina upeks (sensation ni-agrable-ni-dsagrable), upekspariuddhi ( samskropeks), smrtiparisuddhi, samdhi.
: :

du samskraskandha,

2.

Paramfirtha ajoute
.

ici

Ces cinq dans recueillement capables

attirer contre-

carrant prarabdhi

148

chapitre vin, 7-9


le

a.

L'enseignement de l'Ecole est que


est

samdhi, concentration,

dhyna et un membre du dhyna, tandis que les autres membres sont membres du dhyna mais non pas dhyna mais, notre avis, il en va du dhyna cinq membres comme de l'arme quatre membres, laquelle n'existe pas part de ses mem la
fois le
;

bres.

Le deuxime dhyna possde quatre membres


c'est--dire priti,

priti, etc.

sukha

et

cittaikgrat

plus

adhytmasamupeks,

prasda. Le troisime dhyna possde cinq membres


nimit
,
:

1.

quala

non pas

la

vedanopeks, sensation d'indiffrence, mais

samskropeks,
soit

\& priti

exempte de
2
;

flexion vers quelque objet


:

que ce

(anbhogalaksana)
le

2.

smrti, c'est--dire

ne pas perdre de

vue

nimitta

(le motif, la
;

raison) de cette quanimit (upeksni-

mittsampramosa) 3 3. samprajnna, conscience relative cette smrti ; 4. sukha ; 5. samdhi. Le quatrime dhyna possde quatre membres upekspariud:

caturangasenvat. Comparer Samantapasadika, i. 146 De mme qu'on arme les membres de l'arme et rien d'autre (yath senangesu eva sensammuti), de mme on entend par Dhyna les cinq membres et rien d'autre ... Le Vibhanga dit Dhyna, c'est vitarka, vicra, prtisukha, cittasya ekgrat ; ... donc la cittaikgrat aussi est un membre . De mme l'Ecole enseigne que le dharmapravicaya est en mme temps la Bodhi et un membre de la Bodhi, que la samyagdrsti est en mme temps le Chemin et un membre du Chemin, que l'abstention de nourriture est en mme temps PUpavasa et un membre de PUpavasa (iv. 29, p. 68). caksus 2. La formule de cette upeks est donne dans Vyakhya, iii. 35 d rpni drstv naiva suman bhavati [ nnunyate] na durman bhavati \= na pratihanyate] upeksako bhavati [= nbhujati / katham nbhujati kiwi pratisamkhyya hosvid apratisamkhyya iti visesayann ha] smrtimn samprajnan [= smrtisamprayuktay prajnay pratisamksamnah].
1.
:

entend par

Comme
vihra.
C'est le

pour

la

connaissance visuelle et ses objets, de


32, p. 76 n.

mme

pour

les cinq

autres connaissances. Cette sextuple indiffrence est le sextuple stata, satata-

Voir

vii.

1.
;

Visuddhimagga, 659. majjhatta de la pense du Vibhanga Samantapasadika, i. 150, commentaire de upekkhako vihsim. 3. C'est pour cela qu'il est dit que le Bouddha n'a jamais apratisamkhyya Comment il faut expulser la mauvaise upeks par la bonne, iii. 35 d. upeks.

Hiuan-tsang,

xxviii, fol.

6 b-7

a.

149
d'indif-

dhi \ smrtiparisuddhi, aduhkhsukh vedan ou sensation


frence,

samdhi.
fait

Cela

donc, considrer les noms, dix-huit

membres

mais

combien ces dix-huit membres, quand on n'entre pas dans


tions, font-ils de

les distinc-

choses ?

a.

considrer les choses, onze


le

membres
s

2
:

Onze, savoir cinq dans


1.

la
6.

dhyna auxquels s'ajoutent 2-5. Yupeks, Yadhytmasamprasda du deuxime dhyna smrti, le samprajrina et le sukha du troisime dhyna Y aduhkhsukh vedan du quatrime dhyna. Cela fait onze
premier
;
:

choses diffrentes.
Il y a donc des membres du premier dhyna qui ne sont pas membres du deuxime dhyna. Quatre alternatives 1. membres du premier qui ne sont pas membres du deuxime, savoir vitarka et vicra ; 2. membre du deuxime qui n'est pas membre du premier, savoir Yadhytmasamprasda ; 3. membres communs aux deux premiers dhynas, savoir prti, sukha, cittaikgrat ; 4. membres
:

adhobhmikpakslavigamt. dravyato dasa caikam ca Vibhas, 80, 4. A considrer les noms, les membres des dhynas sont au nombre de dix-huit. Combien sont-ils considrer les choses ? Seulement onze. Dans le premier dhyna, cinq noms et cinq choses. Dans le second dhyna, les membres sont au nombre de quatre, mais trois sont comme dans le premier on ajoute l'adhytmasamprasda. Dans le troisime dhyna, cinq membres mais le cinquime a dj t mentionn; on ajoute quatre nouveaux. Dans le quatrime dhyna, quatre membres les trois derniers ont t mentionns on ajoute le
1.

2.

rdzas su bcu gcig

premier

....

deux premiers dhynas, il y a prarabdhisukha, c'est--dire sukha prasrabdhi ; dans le troisime, il y a vedansukha, sukha consistant en sensation. Le sukha des deux premiers dhynas fait partie du satnskraskandha ; le sukha du troisime fait partie du vedanskandha L'unit d'objet de la pense (cittaikgrya) est le dhyna parce que le dhyna a pour nature samdhi (c'est--dire cittaikgrya). Le samdhi et les autres [dharmas] numrs sont membres du dhyna.

Dans

les

consistant en

Voir Kosa,
3.
4.

vi. trad. p.

154.

panca prathamadhynikni.
dvitye

'dhytmasamprasdo vardhate.

150

CHAPITRE

VIII,

b.

qui n'appartiennent aucun des deux premiers dhynas, savoir

tous les autres membres.

La correspondance des membres d'aprs les mmes principes.


Pourquoi dites-vous que
le

des autres

dhynas

s'tablit

une nouvelle chose, un nouveau


les

sukha du troisime dhyna constitue membre ? N'y a-t-il pas sukha dans

deux premiers dhynas ?


le

Parce que

sukha du
;

troisime

dhyna

est

sukh vedan,

sensation agrable

tandis que,
il

b.

Dans
'

les

deux premiers dhynas, par sukha

faut entendre

prarabdhi.

Dans
sukha,
ii.

le

premier

et le

deuxime dhyna, ce qui

reoit le

nom

de

c'est la
:

prarabdhi (= karmanyat,
s'y trouve
le troisime,

aptitude,

bon

tat ,

trad. 157)

il

prasrabdhisukha, sukha consistant en


il

prarabdhi. Dans

y a sukh vedan.
il

En

effet,

dans

les

deux premiers dhynas,

sukhendriya (sukhendriyyogt
Parce que
1. le

= asambhavt). Pourquoi ?
dhynas ne peut
tre

ne peut y avoir de

sukha

attribu ces

sukha

prarabdhih sukham dyayoh. 1. daii po na / sin tu sbyahs pa Me ba yin Dans Vibhanga, le sukha du premier dhyna est cetasika sukha, cetosatnphassaja sukha ; ce sukha est accompagn de piti et est donc nomm ptisukha la piti est pmojja .... attamanat cittassa. Sur prarabdhi, ii. 17 c, 25, p. 157, iv. 48 (samskraskandha).
Vibhasa
cite p. 149 n. 2.
:

Samghabbadra, xxiii. 6, 72 a 10 Dans notre systme il n'est pas dit que la prarabdhi soit sukhendriya (-sensation agrable), il est dit que la prarabdhi est cause de sukha, qu'elle est le membre nomm sukha des deux premiers dhynas .... Dans l'Ecriture, ce n'est pas seulement la sukh vedan (sensation agrable) qui reoit le nom de sukha ; d'autres dharmas reoivent ce nom. Ainsi est-il dit qu'il y a trois sukhas, prahnasukha, virgasukha (?), nirodhasukha ; ailleurs il est dit que le sukha est quintuple, pravrajysukha, vivekasukha, samathasukha, bodhisukha (voir vi. 50 b, p. 259), nirvnasukha. Le terme sukha dsigne donc, dans les Stras, toute sorte de dharmas .... 2. Vyakhyfi ad iii. 32 c. Le sukha du troisime dhyna repose sur le seul Il n'y a pas, dans le manas, non sur les autres organes (mana evsritam). Kamadhatu, de sukha qui soit du domaine du manas (manobhmika sukha).

Hiuan-tsang,
corporel
',

xxviii, fol. 7 a-b.

151

vu que

les

cinq connaissances sensibles


2
;

manquent un

homme

entr en contemplation

2. le

sukha

attribu ces

ne peut tre sukha mental (caitasika) parce que ces


sdent prti. Or la priti [7 b] est
est inadmissible

dhynas dhynas pos,

saumanasya

satisfaction

et

il

que prti

et

sukha, sukha de sensation bien entendu,


qu'ils se succdent, car le
le

coexistent

on ne peut non plus supposer


cinq membres, et

premier

dhyna possde
les trois

deuxime, quatre.

Thses des Darstntikas.


i.

Dans

premiers dhynas,

il

n'y a pas

sukhendriya men-

tal

(caitasika

= sensation de
de ces

satisfaction),
plaisir),

mais seulement sukhenle

driya corporel (sensation de

lequel constitue

membre

nomm sukha
de
l'tat

dhynas
3

[et entre

en activit au cours

mme

de recueillement].

Objection.
le

Dans
:

cette

hypothse vous devez expliquer comment


le

Stra peut dire

Qu'est-ce que

sukhendriya (sensation agra-

ble en gnral) ?
et

Le sukha (sensation agrable) corporel (kyika)


c'est
.

mental (caitasika) produit en raison d'un contact agrable,

ce qu'on

nomme sukhendriya
:

1.

C'est--dire

sensation agrable ayant pour point d'appui les cinq organes


....

constitus par des atomes, sensation associe aux cinq connaissances (visuelle
tactile) ,
2.
ii.

25, p. 157-8.
le ciel

Les tres ns dans


;

visuelle, etc.

mais non pas

les

hommes

du premier dhyna possdent la connaissance qui sont entrs dans le recueillement du

premier dhyna.

samhitvasthnlarlasamudcrt / drstntiknm tesm hi na dvibhmikam eva sukhendriyam kmaprathamadhynabhmikant kim tarhi caturbhmikam (= Le sukhendriya n'appartient pas seulement deux terres , au Kamadhfitu et au premier dhyna, mais encore au deuxime et au troisime dhyna). ata eva ca vibhsym bhadantena sautrntikenoktam bhidhrmiknm paramateneva (?) caksurvijnndikam adhastd rdhvam krsyata iti tad evam asyestam bhavati caksurvijnndikam dvitydidhynabhmikam api bhavatty api.
3.
:

kilaisa

Vyakhya paksah

Les Abhidharmikas pensent que la connaissance visuelle est seulement de deux

terres,

Kfimadhatu
la

et

premier

dhyna

(i.

46,

viii.

13 a)

mais

ils

admettent que
visuelle

les tres des

dhynas
Dans
la

suprieurs voient au

moyen d'une connaissance

d'en bas

connaissance visuelle est tire d'en bas en haut


Vibhasa,
le

comme

avec une

machine

(?).

Bhadanta Sautrantika pense

qu'il est bien plus

simple d'admettre que la connaissance visuelle est du domaine du deuxime

dhyna

152

CHAPITRE

VIII,

b.

Cette lecture n'est pas authentique \ rpond

le

Darstantika
lit

le
:

mot
le

mental

a t ajout. Dans toutes

les sectes

on

seulement

sukka

corporel.

En outre, poursuit-il, dhyna nomm sukha,


dhyna,
l'ascte
2

en ce qui regarde
le

le

membre du

troisime

Sutra

dit

en propres termes que, dans ce

prouve sukha par son corps


.

na sampravedayate) Soutiendra-t-on que le manahkyena manahsamudyena, et qu'on

(sukham mot kyena


doit
le

...

kye-

signifie
:

traduire

l'ascte

prouve sukha par ce complexe qu'est


le

manas

Pourquoi
ide ?
ii.

Satra emploie-t-il

le

mot kyena pour exprimer

cette

L'explication du Vaibhasika, que le

membre sukha

des deux

premiers
ble
;

dhynas

est la

prasrabdhi

(= karmanyat), est intenadhyna


i

car la prasrabdhi du quatrime

est certainement plus


et le

grande que la prasrabdhi des deux premiers,


pas au quatrime

Satra n'attribue

dhyna un membre sukha.

adhyropita esa ptha iti. sa prter virgd upeksako viharati smrtimn samprajnamnah sukham ca kyena sampravedayate yat tad ry caksate upeksakah smrtimn sukhavihr [nisprttikam] trtyam dhynam upasampadya viharati. Comment sentirait-on par le corps (kyena) une sensation mentale
1.

2.

(caitasika) ?
3.

Le Vibhanga
il

(p.

259) entend

ici

par

Vaibhasika), et
et

explique

kya

= les

trois

sukha le cetasika sukha (comme le skandhas de sann, samkhra

viniina.

kyena skstkaroti, vi. 43 c, 58 b, viii. 9, 35 b. SBE. 45, p. 23. 4. caturthe dhyne prarabdhibhyastve 'pi sukhvacanc ca. Vyakhya caturthe dhyne prasrabdhisukham bhyo bhavati bahutaram bhavati dhynntarebhya caturthasya prarabdhataratvt / tadbhyastve 'pi sukhasyvacanam j caturthe dhyne sukham nocyate j tasya sukhasyvacand vedan sukham eva trtiye dhyne na caturthe sukh vedanstti
:

tatra nocyata ity abhipryah.

Dans
est plus

le

quatrime

dhyna

le

sukha

qui consiste en prasrabdhi,

bien tre

grand que dans


:

les tages infrieurs, et

cependant on n'attribue pas

le

sukha cet tage d'o il rsulte que, dans les tages infrieurs, il faut entendre, par le membre sukha, la sensation sukh, le sukha de sensation [et non pas le prarabdhisukha], et que, dans le quatrime dhyna, il n'y a pas de sensation
sukh.

Hiuan-tsang,
Si le

xxviii, fol. 7

b-8

a.

153

Vaibhasika rplique
est

La prarabdhi des deux premiers


la

dhynas

nomme sukha

parce qu'elle est favorable la sensa-

tion agrable

(sukh vedan), tandis que


n'a pas ce caractre

',

prarabdhi du

quatri:

me dhyna
est favorable
bue-t-il

le

Darstantika rpond
celle des
le

La

prarabdhi du troisime dhyna, comme


la sensation agrable
;

deux premiers,
n'attri-

pourquoi

Vaibhasika

pas au troisime

dhyna

le

prarabdhisukha, sukha conle

sistant en

prarabdhi, mais, au contraire, un vedansukha,

sukha

consistant en sensation mentale agrable ?


:

Si le Vaibhasika rplique

Dans

le

troisime

dhyna,
(ii.

la

pra-

rabdhi, dont
est rduite

le

caractre est

karmanyat, aptitude

trad. 157),

(upahata) par Yupeks, quanimit, dont


,

le

caractre est
:

akarmanyat
prarabdhi

le

Darstantika nie la vrit de cette assertion

la

est accrue par

Yupeks,

comme

il

rsulte

du

fait

que la

prarabdhi du troisime dhyna


des deux premiers.
Enfin, le Stra dit
2
:

est plus

grande que la prarabdhi

Lorsque

le

Sravaka [8
de cinq

a],

ayant ralis la

joie ne de la sparation, reste en recueillement, alors cinq

dharmas

sont pour

acheve, savoir prti, prarabdhi, sukha,

dharmas se trouve prajn et samdhi . Dans ce Stra, la prarabdhi est nomme part du sukha ; elle doit tre distincte du sukha pour que la liste de cinq dharmas soit comlui

abandonns,

et la culture

1.

sukhavedannuklatvt prasrabdhih sukham


D'aprs la Vyakhya. Le Bhftsya donne seulement
voit par la version de Paramartha).
:

iti cet.

2.

les

premiers mots du Stra

(comme on

a. Hiuan-tsang En outre, parce que le Stra (Samyuktaka, 17, 24) dit yasmin samaye ryasrvakah pravivekajm pritim kayena skstkrtvopasampadya viharati pancsya dharmas tasmin samaye prahiyante panca dharm bhavanpariprim gacchanti [iti vistarah yavad bhvany dharmah katame tadyath prmodyam (?)pritih prasrabdhih sukham samdhi ca].
:

Comparer la liste Samyutta, iv. 79, Anguttara, v. 1, etc. (prmodydayah). b. Paramartha En outre, parce que le Stra distingue la prarabdhi et le sukha. Comme dit le Stra yasmin samaye ryarvakah prarabdhijm pritim kyena skstkrtv upasampadya viharati. Dans le Stra la prarabdhi est nomme part du sukha. Nous savons donc qu'ils diffrent . [La lecture prarabdhij est peut-tre une mprise.]
: :

154
plte.

CHAPITRE

VIII,

b.

Donc, dans
'

les

deux premiers dhynas,

le

sukha

n'est pas

prasrabdhi.
iii.

Objection du Vaibhasika.

Pour que
corporelle,

le

sukha des deux


corporelle

premiers
agrable,

dhynas
il

soit

sensation

sensation

faut que, chez

l'homme en recueillement (sampanna),


Ce
n'est pas pos-

se produise connaissance du tact (kyavij hna).


sible.

Rponse du Darstantika.
est pntr

Dans

l'tat

de recueillement,

le

corps

(spharana) par un vent (vyu) n

d'excellente concen-

tration mentale (samdhivisesaja), lequel vent [est


est
[et

un tangible

qui]

senti

agrablement (sukhavedauiya

sukhavedannukla)

qui est

nomm

prasrabdhi]. Donc se produit connaissance du

tact [avec sensation agrable associe

cette connaissance].

Critique du Vaibhasika.
il

Quand
:

cette connaissance se produit,

y a

distraction de la pense vers

un objet extrieur

(bahirvi-

ksepa, bhyavisayaviksepa)
tration

donc

l'ascte

tombera de

la

concen-

(samdhibhramsa).

Rponse du Darstantika.
relle

Non, car

la sensation agrable corpo-

qui nat de la concentration

[comme on
2

vient de voir], tant

interne, est favorable la concentration.

Critique du Vaibhasika.

Mais l'ascte tombera de la concentration

au moment o se produit la connaissance-du-tact ?

Rponse du Darstantika.

Non,

et

pour la

mme
!

raison

cette

connaissance est favorable la concentration. Aussitt aprs l'apparition de cette connaissance, la concentration reprend.

Donc, dans les trois premiers dhynas, le membre sukha est 1. Vyakhya uniquement sukha corporel . 2. Bh&sya na / samdhijasya antahkyasambhtasya kyasukhasya
:

samdhyanuklatvt. Vyakhya samdhijasya abahirbhtasya kyavijnnasamprayuktasya veditasukhasya samdhyanuklatvt. Une connaissance de tact du 3. punar upatisthate samdhih. Vyakhya domaine du Kma ne peut saisir un tangible du domaine du Rpa d'o il rsulte que la connaissance de tact qui saisit la prasrabdhi est du domaine du Rpa,
:
: :

et

que

la

sensation agrable (sukha) associe cette connaissance peut tre


.

membre du dhyna

Hiuan-tsang,

xxviii, fol.

a-b.

155

Le Vaibhasika.

Comment

l'organe-du-corps ou du tact (kdyen-

driya)> qui est du domaine du Kamadhatu, peut-il donner naissance

la connaissance de ce tangible du domaine du Rpadhatu qu'est,


d'aprs vous, la prasrabdhi, [une sorte de vent]
(i.

47
il

c) ?

Le Darstantika.

Cette critique ne

porte pas

car

y a production
'

d'une connaissance du tact en raison de la prasrabdhi.

Le Vaibhasika.
tangible.
2

y a

difficult

faire

de la prasrabdhi un

Supposons
:

l'ascte en possession

du dhyna supramondain

ou andsrava

le

tangible (prasrabdhi) et la connaissance du tact


s'y rfre seront

(kdyavijnna) qui

andsrava, car

les

membres du
les autres

dhyna andsrava
sdsrava. [Or
le

[8 bj ne peuvent tre les uns


dit
Il

andsrava,

Sutra

que

Tout il

...

tout tangible est sdsrava].

Le Darstantika.
corporelle

n'y a pas contradiction.


est dfinie

(kdyasya karmanyatd)
cite le

En effet la prasrabdhi comme membre de

Bhasya prasrabdhijnnasyotpatteh (?). naisa dosah j prarabdhipratyayasya vijnnasya utpatteh ; d'aprs Paramartha naiso Wthah svayam prarabdhivijnnasya
1.
:

La Vyakhya

D'aprs Hiuan-tsang

utpatteh.

La Vyakhya donne une explication trs satisfaisante L'organe du tact de l'homme en recueillement [hien qu'il soit du domaine du Kama], passe dans un tat tel [tm avasthm gtant yad ...] qu'il peut tre le point d'appui d'une connais:

sance de tact d'une terre suprieure.

Samghabhadra,

xxiii. 6,

72 b

12.

Le Vaibhasika

En

outre,

il

est inadmissible

un organe du tact (kyendriya) du Kamadhatu, naisse une connaissance d'un tangible du Rpadhatu. Donc on ne peut pas dire que, le corps tant du Kamadhatu, la connaissance du tact (kyavijnna) saisisse un tangible constitu par la prasrabdhi et n du dhyna. Si on nous
que, avec pour point d'appui (raya)
il

rpond que, ce tangible tant produit intrieurement (en s'appuyant sur l'intrieur), est capable de produire semblable connaissance [d'un tangible du ROpadhatu]
encore que celle-ci s'appuie sur un corps du Kamadhatu, cette rponse n'est que
parole vaine, sans raison ou texte pour la soutenir. Quelle raison ou quel texte en
effet

tablissent que, s'appuyant sur

un corps du Kamadhatu, on saississe un

rpa
dit
:

qui est prasrabdhi, non pas un autre tangible? Cette thse contredit les
;

autorits

seule la doctrine de l'Abhidhainna est irrprochable.

Ici le
...

Sthavira

Comment
Pour
le

savez-vous que la prarabdhi reoit


la

le

nom

de sukha ?

2. le

Vaibhasika,

prasrabdhi (=

le

membre du dhyna dsign sous


du
tact qui

nom

de sukha) est un santskra, qui peut tre ansrava. Pour son adversaire,
est la sensation associe la connaissance

le dit

membre du dhyna

connat la prarabdhi, un certain tangible.

156
la

CHAPITRE
.
'

VIII,

b.

Bodhi

Si le Vaibhasika rplique
la

Elle est ainsi dfinie, bien

que n'tant pas membre de

Bodhi, parce qu'elle est favorable au

nomm prasrabdhi et qui est la prasrabdhi mentale , je dirai que, pour la mme raison, on peut considrer la prasrabdhi corporelle comme ansrava. Si le Vaibhasika rplique
membre
de la Bodhi
:

La prarabdhi
intentionnel

corporelle ne peut tre


2

ansrava, car

le

Stra
est

dclare que tout tangible est ssrava

je dirai

que ce Stra

et vise les tangibles

l'exception de la prasrabdhi,

les

connaissances du tact l'exception de la connaissance du tact

qui connat la prasrabdhi.

Le Vaibhasika.
soient pas ?

Comment admettre que


soient

certains

dhyna ansrava
Le Darstantika.

ansrava, que certains

membres du membres ne le

Le membre ansrava n'est pas simultan (ayaugapadya) au membre non-ansrava ; on sait bien que le sukha (corporel) n'existe pas en mme temps (asamavadhna) que
la priti (mentale).

Le Vaibhasika.
cinq membres,
le

Alors

le

premier

dhyna

ne sera pas muni de

second ne sera pas muni de quatre membres.


Si l'Ecriture attribue

Le Darstantika.

priti aux deux premiers

dhynas,

c'est

parce que ces


et

membres de sukha et de dhynas sont


;

susceptibles, successivement, de

sukha
et

de priti
et

de

mme

l'Ecri-

ture attribue au premier

dhyna

vitarka

vicra, lesquels ne

peuvent exister que successivement.

Le Vaibhasika.
membres,

Nous affirmons que vitarka


Cet
exemple
est

et

vicra coexistent:

l'exemple que vous allguez pour dmontrer la non-coexistence des


n'est pas prouv.

Le Darstantika.

prouv
3

car le vitarka, tat

grossier de la pense, et le vicra, tat subtil de la pense, sont


contradictoires et ne peuvent coexister.
1.
ii.

Et vous ne dites pas quel

kyikaprasrabdhisambodhyangavacant.
Hiuan-tsang ajoute

Cette question a t discute

25, trad. p. 158.


2.
:

Il

est dit
:

dans
60

le

Stra que quinze dhtus sont seule-

ment ssrava
3.
ii.

Kosa

i.

31 c-d
i.

trad. p. 58,
;

dans
iv.

la note, lire
;

Vibhasa, 183,
1,

9.

33, p. 173-76, voir

33, trad. p.

11 d

viii. p.

157, n.

27 c-28.

Hiuan-tsang,

xxviii, fol.

8 b-9
'

a.

157

mal

il

y a ce

qu'ils

ne coexistent pas.

Rendons-nous
a]
le

compte
du

de la thorie des

membres
c'est

on dtermine [9

la spcificit

deuxime dhyna
trois,

et des
:

suivants en retranchant (apakarsa) deux,

quatre

membres

pour cette raison que

premier

dhyna

est dit tre de cinq

membres, parce qu'on veut

dfinir les autres

dhynas en

retranchant, successivement et dans l'ordre, les quatre

samjn et les autres dharmas du premier dhyna ne sont pas considrs comme membres, car ils ne sont pas retranchs dans les dhynas suivants. Si vous n'acceptez pas cette explication, pourquoi le premier dhyna n'a-t-il
premiers de ces membres. C'est pourquoi la

que cinq membres ?


sont seuls appels

Mais,

dit le

Vaibhsika, les cinq


qu'ils

membres

membres parce
le

sont utiles

au

dhyna

(upakratvt).

Non, rplique
2

Darstantika, car la smrti et la

prajn sont

plus utiles que le vitarka et le vicra.


soutient le systme qui vient d'tre expos, mais
J

Certaine cole
les

Anciens Matres (prvcryas) ne s'expliquent pas d'accord.


le

Par consquent

point doit tre examin.


:

1. La Vyakhy signale deux leons vitarkavicrayor ayaugapadyam dosavacanc ca et dosvacant (= asamavadhnena ca na kacid dosa ucyata

ity arthah).
2.

Paramartha
fi

suit la

deuxime leon.
;

Les Sautrntikas, d'aprs Kiokuga Saeki

ci-dessus, les Dfirstfintikas.

3.

Hiuan-tsang
14)
:

kong ch ch

na

martha (28 a
tch"
4.

Les anciens matres ne disent pas


sont

leur autorit, savoir quels


:

dharmas na anu akyate jntum).


tat.

saha prajriapayanti. Paraainsi. On ne peut pas, d'aprs membres du Chemin (? pou soei k'o

tasmd vicryam
de

Vyakhya

yogcrabhmidaranena vicryam
:

tat. Suit l'expos

la doctrine
\

de Samghabhadra

tatra kautilhalam ptayety

cryasamghabhadrah ayant ctrrthasamksepo drastavyah. Les dhynas comportent un grand nombre de dharmas pourquoi certains dharmas sont-ils considrs comme membres (anga) ? Sont considrs comme c membres les dharmas qui sont pratipaksnga, anuamsnga, tadubhaynga membre d'opposition, d'excellence, d'opposition et d'excellence [Dans les
:

recueillements d'rpya on ne distingue pas de membres, parce que toute leur

saveur est

le

calme, amathaikarasat]. Premier

s'opposent aux mauvaises penses (vitarka) du

vihims, concupiscence, nuisance, hostilit), 2. vitarka et vicra ont expuls leurs antagonistes (vipaksa),
de la sparation d'avec ces antagonistes,
3.

dhyna, 1. vitarka et vicra Kamadhatu (kma, vypda, prlti et sukha obtenus lorsque
et par le fait

mme

samdhi ou

cittaikgrat,

eon-

158
Quel
est le

CHAPITRE

VIII,

c-d.

dharma nomm adhytmasamprasda ?


du vitarka
et
:

'

Lorsque

l'agitation

du vicra a
c'est ce

pris fin, la srie

coule calme, claire (prasntavhit)

qu'on appelle adhy-

tmasamprasda.
srie,

Telle une

rivire agite par les vagues, telle la


et

en raison de l'agitation du vitarka

du vicra,

n'est pas

calme, claire. [Telle est l'explication des Sautr&ntikas].


Mais, admettre cette explication, Y adhytmasamprasda n'est

pas une chose en

soi. Il

n'y aura donc pas onze choses dans les


:

dhynas. Donc

il

faut dire

c.

C'est la foi qui est le


est

prasda.
soi,

Le prasda
admet que

une chose en

la

raddh,

foi.

L'ascte, en

obtenant la terre du deuxime dhyna, produit une


il

foi

profonde

les terres
foi est

de recueillement elles-mmes peuvent tre


ce que l'on
le

abandonnes. Cette

La

foi,

ayant pour caractre

prasda

nomme adhytmasamprasda. (vi. 75), est nomme pra:

sda. Ayant abandonn

l'extrieur, elle coule gale

donc,

adhy:

tmam sama.

Prasda adhytmasamprasda. 3
D'aprs d'autres matres
et

qui est

interne

et

gal [9 b]

donc

les Sautrantikas les vitarka, vicra,


sont pas des choses pat
des

samdhi

adhytmasamprasda ne

(dravyntara).

Si ce ne sont pas des choses part, comment dire


dharmas mentaux
?

qu'ils sont des caitasikas,

Des

tats

centration

par la force de laquelle les quatre autres membres existent. Deuxime


l' :

dhyna
membres
posent

d'excellence. Troisime

adhytmasamprasda s'oppose vitarka-vicra prlti, sukha dhyna upeks, smrti et samprajanya s'opprlti; sukha, membre d'excellence. Quatrime dhyna upekspariici
:
:

uddhi
1.

et

smrtiparisuddhi s'opposent sukha ; aduhkhsukhavedan, membre

d'excellence.

Vibhanga, 263.
i.

Yogastra,

47.

2.

rab tu dad pa dad pa yin


80, 17)

raddh prusdah.
compare
les
;

ii.

25, p. 156.

Vasumitra (VibhusS,
blent l'eau
;

vitarka-vicra aux vagues qui trou-

quand

ils

sont expulss, la pense est

samprasanna, comme
(raddh)
reoit le

l'eau

devient claire quand les vagues s'apaisent

donc

la foi

nom

de

adhytmasamprasda.
3.

Paramartha omet ces explications.

Hiuan-tsang,
spciaux de la pense reoivent
naissent dans la pense.
cette thorie.
2
'

xxviii, fol.

9 a-b.

159

le

nom

de caitasika, parce qu'ils

Le systme d'Abhidharma

Vous avez
dit

n'admet pas

Objection du Sautrantika.

que

la prlti, joie, est

saumanasya,

satisfaction,

sensation

agrable mentale.

Gomment

tablissez-vous cette dfinition ?


Si \a priti n'est pas

saumanasya,

quel est donc votre avis le

dharma

qui reoit

le

nom

de priti ?
3

Nous suivons une

autre cole.

D'aprs cette cole,

il

existe

un

dharma distinct du saumanasya, un caitasika (ou mental ) nomm priti. Le sukha des trois dhynas est saumanasya donc
;

la priti, qui est distingue


Il

du sukha,
le

est distincte
les

du saumanasya.
soit

n'est

pas admissible que


4

sukha, dans

dhynas,

sauma-

nasya.

c-d.

La priti

est

saumanasya ;

c'est

prouv par deux textes.

1. avasthviseso 'pi hi nma cetasa caitasiko bhavati cetasi bhavatvt. La Vyfikhy" donne aussitt des exemples paryesakamanojalpvasth vitarkah pratyaveksakamanojalpvasth vicrah (voir Kosa, ii. p. 175) / vksamutthpikvasth vitarkah / tadanyvasth vicra iti bhagavadviesah j aviksiptvasth samdhih j prantavhitvasth cittasydhytmasam:

prasda

iti

Sur l'existence des caitasikus distincts du citta (et des bhautikas distincts des mahbhfitas), ii. p. 150-152. 2. Hiuan-tsang Quoique ceci soit raisonnable, ce n'est pas mon systme >. 3. D'aprs P'ou-kouang et Fa-pao, les Sthaviras.
:

Hiuan-tsang.

Comment une autre cole


Elle dit qu'il y a

soutient-elle

que

la

prlti n'est pas


;

saumanasya ?
le

une

prlti,

caitasika dharma, part

comme

sukha des trois dhynas est tout entier saumanasya, la prlti et le saumanasya sont distincts. 4. na vai sukham dhynesu saumanasyam yujyata iti tulyasukhavedansvbhvye 'pi sati kasmt saumanasyam sukham iti nocyatej asti kranamj iyam hi prltir anupasnt / tay hi tat samhitam api cittam ksipyata

unnamyata iva smodam sahsam viplutam iva vyavasthpyate tad yadopasntam bhavati tad bhmyantaraprptau tajjtlyaiva vedan sukham ity ucyate.
iva
/

5.

lun rnams guis phyir dgah yid bde


ii.

Voir

7 c-8 a, p. 114-115, sur la prlti.

160

CHAPITRE
dit

VIII,

9 C-ll
'

d.

Le Bouddha
le
le

dans

le VipartasCitra

Dans

le

troisime

dhyna,
;

saumanasyendriya n antrieurement
quatrime dhyna,
le

est dtruit

sans reste

dans
.

sukhendriya
2

est dtruit sans reste

Le

Bouddha, dans un autre Stra,


du daurmanasyendriya
prouvent que, dans
le

dit

En

raison de l'abandon du
la disparition antrieure

sukhendriya, du duhkhendriya, en raison de


et

du saumanasyendriya. Ces deux textes

troisime

syendriya. Donc

la.

prti est

dhyna, il n'y a pas de saumanasaumanasya. [10 a]


possde-t-il
les

Le dhyna
chaque

souill (klista)

membres que nous

venons d'tudier ?

Non. Quels sont les membres qui manquent


souill ?

dhyna
Dans

10

a-c.

le souill

manquent prti
et

et

sukha, prasda, sam3

prajanya

et smrti,

upeks

smrtipariuddhi.

Le premier dhyna,

lorsqu'il est souill,


,

ne possde pas prti

et

sukha

ns de la sparation

parce qu'il n'est pas spar des


15).

passions du

Kama

(klesviviktatvt) (Vibhasa, 160,

Le deuxime ne possde pas adhytmasamprasda, parce


est troubl par les passions (klesvilatvt)
;

qu'il

les passions font qu'il

n'est pas clair (klesair

aprasannatvt).
et

Le troisime ne possde pas smrti


mis en confusion par un sukha
tatvt).

samprajanya, parce

qu'il est

souill

(klistasukhasambhrami-

1.

Param&rtha
Samyutta,

transcrit
v.

pi poo
le

li

too king.

le

Kosa,

v.

a.

Madhyama,

42,

18,

213, Majjhima,
:

iii.

26, AtthasalinT, 175.

Hiuan-tsang traduit

Comme
le

Bouddha, dans

Stra de l'explication des

ViparySsas, expose la disparition graduelle des cinq indriyas de sensation,

daurmanasya,
dans
2.

etc.

[Dans

premier dhyna, destruction du


le

le

second du duhkha], dans


...

troisime du

daurmanasya, saumanasya, dans le quatrime

du sukha

Dfinition

Donc la prti est saumanasya . du quatrime dhyna sa sukhasya ca prahnd duhkhasya


:

ca prahnt
3.

prvam eva saumanasyadaurmanasyayor astamgamd aduhkham asukham upkssmrtipariuddham caturtham dhynam


....

non mons can la dgah bde dan dran pa dag pa med.

rab dad ses bzhin dran pa dan

btan sfioms

Hiuan-tsang,

xxviii, fol.

9 b-10

b.

161

Le quatrime ne possde pas upekspariuddhi, smrtiparisuddhi,


parce qu'il est
sali

par les passions (klesamalinatvt).


et

10

d.

D'aprs quelques-uns, la prarabdhi


d'autres

Yupeks.

'

D'aprs

manquent
2.

1.

la

prarabdhi dans
les

les

deux

premiers dhynas,

Yupeks dans

deux derniers, parce que


se trouvent seulement
ii.

prarabdhi
dans
la

et

upeks sont des dharmas qui

pense bonne (kualamahbhmika,


trois

25).

Le Stra enseigne que


en raison des

dhynas
-.

sont

remus

(sa-injita),

dfauts
il

(apakslas)

[10 b]

11

a-b.

Gomme
3

est libr des huit

apakslas,

le

quatrime est

non-remu.

Quels sont
1 1 c-d.

les huit

apakslas

?
'*,

savoir vitarka et vicra, les deux souffles


le

les

quatre

dont sukha est

premier.

Les huit apakslas sont vitarka, vicra, sukha, duhkha, sauma-

nasya, daurmanasya, vsa, pravsa. Aucun de ces huit ne se


trouve dans
le

quatrime dhyna,
est vrai

c'est

pourquoi, seul,
dit

il

est dclar

non remu

. Il

que

le

Stra

que

le

quatrime

dhyna

est

non-remu
et

parce qu'il n'est pas agit par vitarka et vicra,


6

par priti
1.

par sukha.

[Mais l'intention n'est pas d'attribuer vasa,

kha cig sin tu sbyans btan snoms. Le problme du sefijita et de Yninjya a t examin iv. 46, trad. p. 106-108, (vi. 24 a-b) les apakslas, iii. 101, Madhyama, 5, 1, Majjhima, i. 454, ii. 261 apaksla). (nanjasappyasutta), Anguttara, v. 135 (kantaka 3. skyon brgyad las ni grol bahi pbyir / bzhi pa gyo ba med pahi yin astpakslamuktatvt [caturtham syd aninjitam (?)] 4. vsv iti / vsapravsau dvitvapradaranrtham ctra dvivacananirdeah. 5. rtog dan spyod dan dbugs dag dan / bde ba la sogs bzhi yin no = vitarko vicrah vsau catvra ca sukhdayah //]
2.
;

6. vitarkavicraprtistikhair akampanlyatvd iti yath prvakni trlni dhynni vitarkdibhih kampyante prathamam dhynam vitarkavicrbhym kampyate dvityam prty trtyam sukhena naivam ebhis caturtham kampyate. Comparer iii. 101
j / j
j

11

162
etc.

CHAPITRE VIH, 12-13.

au quatrime dhyna

le

Satra veut seulement marquer la

diffrence avec les autres

dhynas].

D'aprs d'autres,
qu'il est

le

quatrime
qui,

dhyna

est

non-remu

parce

comme une lampe


'

dans un endroit

clos, n'est

pas agite

par

le vent.

Les naissances de dhyna (dhynopapaltayah), ou existences


dans
le

monde du Rpa,
les

possdent-elles les

mmes sensations

(veda-

ns) que

recueillements de
les

dhyna

?
il

12. Dans
et

naissances de dhyna,
et

upeks,

upeks

sumanaskat,

y a

saumanasya, sukha sukha et upeks,

upeks. [11 a]
a.
1.

Dans

la

premire naissance de dhyna,


trois

il

y a
(il,

trois

sensations
corps)

sukha-vedan associe

vijnnas

oreille,

saumanasya-vedan, du domaine du manovijhna ; 3. upeksvedan, associe quatre vijnnas (il, oreille, corps, manas).
2.
b.

Dans

la

deuxime naissance de dhyna,


et

il

y a deux sensations,

savoir

saumanasya
Il

upeks, l'une

et l'autre

du domaine du

manas.
c.

ne s'y trouve pas de sukha, parce que

les cinq

vijnnas

corporels sont absents.

Dans Dans

la troisime naissance de
4

dhyna,

il

y a deux sensations,

savoir sukha
d.

et

upeks, l'une

et l'autre

du domaine du manas.
il

la

quatrime naissance de dhyna,


d'upeks.

y a une seule sensa-

tion, sensation

1. yath nivte pradpo na kampyate vyun tadvad ity uktam stre ity apara hur nstpakslamuktatvt. btan 2. skye bahi bsam gtau dag na ni / yid bde bde dan blan sfioms dan saumanasnoms yid bde bde ba dan / btan sfioms btan snoms thsor ba dan syasukhopeks upeks sumanaskat / sukhopekse upeks ca vido dhyno/

papattisu // Voir Koa,


3.
il

i.

30 b (ci-dessus

p. 151) et

ii.

31 sur les dhtus et les caittas qui

existent dans le Rpadhatu.

Hiuan-tsang
s'y trouve

et

parce que la satisfaction mentale y est grossire

[Donc
.

ne
4.

pas de sukha du domaine du manas].


:

Saeki Kiokuga ajoute

parce que la satisfaction mentale y est subtile

Hiuan-tsang,
Telle est, sous
le

xxviii, fol.

10 b-11

b.

163

rapport des sensations, la diffrence entre les


et les recueillements

naissances de
Si,

dhyna

de dhyna.
oreille,

partir du deuxime dhyna, trois vijnnas (il,

corps) font dfaut ainsi que vitarka et vicra,

comment

les tres

ns

dans
et

les trois

cieux suprieurs de

dhyna

pourront-ils voir, entendre

toucher?

Gomment
iv.

pourront-ils

produire l'action d'information


(i.

(vijnaptikarman,

7 d) corporelle ou vocale ?

46

et suiv.).

Nous ne
privs des

disons pas que les tres qui naissent dans ces cieux soient

vijnnas

visuel, etc. Ils

possdent ces vijnnas, mais

non pas du domaine du deuxime, du troisime ou du quatrime

dhyna
1

a-c.

Dans

le

deuxime dhyna

et

au del,

les

vijnnas du
'

corps, de l'il, de l'oreille, et le

vijnna qui promeut

l'action d'infor-

mation, appartiennent au domaine du premier dhyna.

Les vijnnas visuel,

etc.

et

le

vijnna qui promeut


le

l'action

d'information n'existent pas dans

deuxime dhyna

et

au del.

Mais

les tres

de ces

dhynas

se rendent prsent

vanti) ces vijnnas, de

mme
'

qu'ils se rendent prsent


et,

(sammukhkurun nirmnaces vijnnas,

citta d'une terre infrieure


ils

[11 b],

par

le

moyen de

voient, entendent, touchent, produisent acte d'information.

13
1.

d.

Ces vijnnas sont non-souills-non-dfinis.

gfs

pa sogs na lus mig dan


/

ma

bahi rnam ses rnam rig slon

gan yin de

ni

dan por gtogs

de lun

ma

bstan non mons min sr kyksirotravijnnam

vijnaptyutthpakam ca yat j dvitydau tad dyplam. Voir iv. 8 a. dyplam, ity dyadhynasamgrhltam. 2. Hiuan-tsang Les tres ns dans les trois bltmis (~ dhynas) suprieures produisent trois vijnanakayas (connaissance de l'il, etc.) et pense d'information (vijnapticitta) du domaine du premier dhyna . 3. nirmnacittavad iti yathdharabhmikam nirmnacittam tadbhU:

mikam nirmnam nirmtukm nirmtrah sammukhlkurvanti

tadvat.

Voir

vii.

50.
:

Hiuan-tsang Les tres ns en haut produisent des exemple nirmnacitta .


4.

dharmas

d'en bas, par

aklistvykrtavn ca tat

jj

164

chapitre vin, 14 a-b.


les tres

Les quatre vijnnas que se rendent ainsi prsents

du

deuxime dhyna

et d'au-dessus,
ils

appartiennent au domaine du pre-

mier dhyna. Donc

ne sont pas souills, parce que ces tres sont


;

dtachs (virakta) l'gard des terres infrieures


bons, parce que
le

ils

ne sont pas
'.

bon d'une

terre infrieure est

moins bon (nihna)

Gomment a lieu l'acquisition (lbha) des recueillements (sampattis) de Rpa et d'rQpya suivant qu'ils sont purs (uddhaka),
ansrava ou
souills ? (viii. 5).

14

a-b. Celui qui

ne

les
2

possde pas

les acquiert, purs,

par dta-

chement ou par naissance.

Celui qui ne possde pas ces recueillements (atadvn,

tadasaman-

vgatah), les obtient en se dtachant de la terre infrieure (adho-

bhmivairgyt)

ou en prenant naissance dans une terre infrieure


4
;

(adhobhmyupapattitas)
Quel
pas

excepter

le

quatrime

recueillement

d'rQpya qu'on acquiert seulement en se dtachant du troisime.


est le sens

de cette expression

Celui qui ne les possde

1. na kualam hnatvd itij tad dhi prathamadhynabhmikam kualam dvityadhynabhmikn nihnam nikrstam ato na sammukhkurvanti / prayojanena hi te prathamadhynabhmikam sammukhkurvanti na bahuiti kualacittam mnenaj savipkam ca tat kualam / na ca tadvipkena

sammukhkarane yatnam na kurvanti.


(prayojanena) que ces tres produisent un vijnna du premier non pas par estime (bahumna) ; en outre, ce vijnna, s'il tait bon, comporterait une rtribution dont ils n'ont que faire donc ils ne font pas effort pour se rendre prsent un vijnna bon. atadvn 2. de dan mi Idan bdod chags bral / skye ba las ni dag pa thob labhate suddham] vairgyenopapattitah j vabdo luptanirdeah. Le sens est vairgyenopapattito va. 3. adhobhmivairgyd va asamanvgatas tena uddhakam pratilabhate dhynam rpyam va / kmavairgyt prathamam uddhakam pratilabhate triprakram anyatra nirvedhabhgyt (viii. 17) / evam yvad kimC'est par utilit
et

dhyna,

canyyatanavairgyd bhavgram pratilabhate. uparistd adharym bhmv upapadya4. adhobhmyupapattito va mnas tal labhate / anyatra bhavgrd iti tasydhobhmivairgyata eva
/ /

lbhah.

Hiuan-tsang,
Entendons
:

xxviii, fol. 11

b-12

a.

165
.

Celui qui ne les a pas acquis ou qui les a perdus

En

effet

un

homme

qui possde ces recueillements purs de la classe


17) peut, par exercice, les obtenir purs d'une
'

hnabhgiya,
la classe

etc. (viii.

classe suprieure

(nirvedhabhgiya)

celui qui les


les obtenir

possde purs de
purs de la classe

sthitbhgya peut, par chute,

hnabhgiya.
Aussi [12 a]
est-il

dit

dans

la

Vibhasa

2
:

Peut-on acqurir un

dhyna pur

par dtachement ? Peut-on abandonner un

dhyna pur

par dtachement ? Peut-on acqurir un

dhyna pur

par chute ? Peut-

on abandonner un dhyna pur par chute ? Peut-on acqurir un

dhyna pur par


naissance?

naissance ? Peut-on abandonner un


dit
:

dhyna pur par

'

Il

Oui.

Comment ?
.

Il dit

Le premier dhyna

de la classe hnabhgiya

En
;

effet

1.

on obtient ce dhyna par


perd par dtachement du
;

dtachement du Kamadhstu

2.

on
le

le

brahmaloka
tient

en passant dans

deuxime dhyna)
'
;

3.

on
le

l'ob-

en tombant du dtachement du brahmaloka


"
;

4.

on

perd

en tombant du dtachement du Kamadhatu

5.

on

l'obtient en renais-

1.

prayogato nirvedhabhgiyam
/

iti

tasya vairgyopapattikrtah sa lbho


iti

na bhavati parihnito hnabhgyam labhate.


2.

'pi

hnabhgyam
;

sthitibhgiyt

parihyamno
:

la

Le Bh&sya porte ata evocyate Vibhasa .


:

de

mme

Hiuan-tsang

Paramartha

Dans

La Vyakhya cite la Vibhasa syc chuddhakam vairgyena labheta, vairgyena vijahytj syc chuddhakam parihany labheta, parihny vijahyat / syc chuddhakam upapatty labheta, upapatty vijahyat / ha / syt / katham ity ha / hnabhgyam prathamam dhynam. 3. brahmalokah prathamam dhynam tribhmikam visesena brahmaloka

upapadyamna

iti

vacant.

brahmalokavairgyena tyajyata iti yasmt prathamadhynavairgyena hnabhgyam dhynam klesnugunyt tadbhmikaklesavat tyajati / ato brahmalokavairgyena tyajyata iti / evam tvat prathamaprasnasya
visarjanam.
4. brahmalokavairgyaparihny labhate / yadi brahmalokavairgyt parihlyate parihny parihyate punas tad dhnabhgyam pratilabhate tadbhmikaklesavat.

5.

kmadhtuvairgyaparihny tyajyate

yad kmadhtuvairgyt

parihyate tad

suddhakam

tyajyate.

166
sant d'au-dessus dans
le

CHAPITRE

VIII,

14
'

c-d.

brahmaloka

6.

on

le

perd en renaissant

dans

le

Kamadhatu

\ [De

mme

pour

les

recueillements des autres

terres,

Hiuan-tsang].
c. Il

14

les acquiert,

de la qualit ansrava, par dtachement.

Entendons

celui qui

ne

les

possde pas.
le

L'rya qui se dtache


ansrava de
la terre

d'une terre infrieure acquiert

recueillement

suprieure. Cette rgle vise seulement l'ascte qui est compltement

dpourvu du recueillement en question.


Celui qui possde dj un recueillement acquiert ce

mme

recueille

lement de la qualit ansrava dans d'autres conditions. Par

ksayajnna
asaiksa
vi.
;

(vi.

44

d),

il

acquiert recueillement ansrava, catgorie

par
il

le

perfectionnement des facults (indriyasamcra,

60) \

acquiert recueillement ansrava, catgorie aiksa ou


le cas.

asaiksa suivant
est encore acquis

[Le recueillement ansrava, dj possd,

par exercice ou par chute,

comme

expliqu ci-des-

sus, Hiuan-tsang].

Mais ne peut-on pas

dire

que

l'ascte,

par l'entre dans

le

samyakle

tvaniyma
ansrava
?

(vi.
'

26

a),
8
.

acquiert pour la premire fois le recueillement

Non

Car Ynupurvika

(ii.

16

c)

peut entrer dans

t.

uparistd

brahmaloka
labhate.

brahmaloka upapadyamno labhata iti dvitiydibhyo upapadyamno hnabhgyam tadbhmikakleavad eva


/ /

2. tasmt kmadhtv upapadyamno vijahtiti lasmd brahmalokt kmadhtv upapadyamno vijahti. 3. zag raed hdod chags bral pa yis == [ansravam virgena] 4.

indriyasamcrato

'pi

aiksaiksam
/

iti

sraddhvimukto drstiprpakopyaprativedhe asaiksatn


d'Arhat (ou ksayajnna),
:

tym (?) saiksam labhate samayavitnukto


labhate.
5. Vibhasfi, 162,

'py

H.

Lorsqu'on obtient

la qualit

on a dj obtenu
l'entre

le

premier dhyna, classe

ansrava

savoir au

moment de
dhyna]

dans

le

samyaktvaniyma

de

la qualit

d'Arhat] ?
l'entre

Le
dans

pourquoi dire qu'on l'obtient [ l'obtention


et

texte devrait dire [qu'on obtient le susdit


le

au moment de
fruit d'Arhat.
6.

samyaktvaniyma,
/

non pas l'obtention du

nirayena

nvayam nuprvikenlbhd iti yady nuprviko 'nyamyasamniymam avakrmati na labhate.

Hiuan-tsang,

xxviii, fol.

12 a-b.
(viii.

167

samyaktvaniyma en s'appuyant
sampatti). [Or
le

sur

Yangamya

22

c)

il

n'acquiert pas ncessairement le recueillement fondamental

(maula-

Sastra n'examine que les cas qui comportent

ncessairement l'acquisition du recueillement, Hiuan-tsang].

14
ment

d. Il les acquiert, souills,

par chute

et

par naissance.

'

Celui qui

tombe du dtachement d'une

terre acquiert le recueilleterre sup-

souill de cette terre. Celui qui,

mourant dans une


le

rieure, nat

dans une terre infrieure, acquiert


terre.

recueillement souill

de cette seconde

[12 b]

Combien de

sortes de recueillements naissent aprs

combien de

sortes de recueillement ?
1.

la suite

du premier dhyna ansrava peuvent natre six

recueillements: 1-2. recueillement pur et


3-6.

ansrava de

la
et

mme

terre

2
;

recueillement pur et
8

ansrava de deuxime

de troisime

dhyna.
2.

la suite
:

de Y kimcanyyatana ansrava naissent sept

recueillements
3-6.

1-2. recueillement

recueillement pur et

d'ksnantyyatana \

pur et ansrava de la mme terre ansrava de vijnnnantyyatana et 7. recueillement pur de naivasamjnn;

satnj hyatana parce que cet

yatana ne comporte pas de

recueille-

ment ansrava.
1.

2.

non nions can nams skye ba yis svabhmike suddhaknsrave

= [klistam hnyupapattitah
iti

//]

vyutthnakale pravhe
le

ca.
Il

Un
le

ascte contemple les Vrits tant entr dans

premier dhyna.

possde

dhyna ansrava. S'il continue sa contemplation (pravhe) le moment de dhyna ansrava est suivi par un moment de dhyna ansrava s'il sort (vyutthnakale) de cette contemplation, le dhyna ansrava est suivi par dhyna pur ou suddhaka. 3. dvityatrtyadhynabhmike ceti mirakmisraknulomasampattau
premier

vyutkrntakasampattau ca. Quand l'ascte pratique le recueillement ml (vi. 42, vii. 23a) o les moments ansrava et purs (suddhaka) se succdent, recueillement en ordre ascendant,
ou
le

recueillement avec passage au-dessus de certaines terres

(viii.

18

c), le

premier
4.

dhyna

est suivi

du deuxime ou du troisime.
iti

sapta svabhmike suddhaknsrave

prvavat

vijiinknan-

168
3.

chapitre vm, 14 d-16

a.

la suite
:

du deuxime dhyna ansrava naissent huit


recueillement pur et

recueil;

lements

1-2.

3-8. recueillement

pur
'

et

ansrava de la mme terre ansrava du troisime, du quatrime et du

premier dhyna.
4.

la suite
:

du vij hnnantyyatana ansrava naissent neuf


1-2.

recueillements

deux de

la

mme

terre

3-6. quatre, dont


2
;

deux

de Y ksnantyyatana et deux du quatrime

dont deux de Y kimcanyyatana et un du

dhyna 7-9. trois, naivasamjhnsam-

jfiyatana.
5.

D'aprs les

mmes
3

principes on verra que dix recueillements

naissent la suite des recueillements de


spcifis ci-dessus.

dhyna

et

d'rpya non

[13 a]
:

La

rgle est formule brivement


a-c.

15
le

la suite de Y ansrava, jusqu' la troisime terre vers

haut ou

le bas, nat le

bon (subha).
le

Le mot

bon

dsigne

recueillement pur (suddhaka) et Y ans(iv. 8).

rava, car l'un

et l'autre

sont kusala

A
pur

la suite d'un
la

ansrava, on a:
terre
2.

1.

ou bien deux sortes de recueil-

lement de
et

mme

que

cet

ansrava, savoir recueillement


ou d'une
terre infrieure jusqu' la
trtyt).

ansrava,

ou bien deux sortes de recueillement, pur ou

ansrava, d'une

terre suprieure

troisime dans les deux directions

(rdhvdhobhmike yvai

tyyatanabhmike ca tathaiva pratilomasampattau bhavgrabhmikam suddhakam evnsravbhvt j mndyd ansravatn nstty uktam (cidessus p. 145) / anulomasampattau tu vyutthanakle tad bhavati.
j

1. trtyacaturthaprathantadhynabhmike mapratilomavyutkrntakasampattiklesu.

ceti

amirakamisraknulo-

2. knantyyatanacaturthadhynabkmikdni catvrti trisv eva klesu I trny ansravbhvt .... 3. evatn anyadhynrpynantaram dasa dravyni yojynti. Aprs le troisime Dhyfina: 1-2, deux de celte bhmi (suddhaka et ansrava), 3-6, quatre, deux du quatrime dhyna, deux de V ksnantya ; 7-10, quatre, deux du premier, deux du second dhyna. Et ainsi de suite pour le quatrime dhyna et pour V ksnantya. 4. zag pa med pahi mjug thogs su / lhag hog gsum pahi bar dge ba / skye ho.

Hiuan-tsang,

xxviii, fol.

12 b-13

a.

169

En

effet,

en raison de la distance trop grande, l'ascte n'est pas capa-

ble de franchir

deux

terres.

A
que

la suite de Y anvayajnna (vii.


;

c),

on peut entrer dans

la con-

templation d'rpya
celui-ci
'

non pas
et

la suite

du dharmajnna, parce

a pour support

pour objet

l'infrieur

(adharlaniba-

natvt).

Nous avons vu rava sampatli.

quels recueillements naissent la suite de l'ans-

15

c-d.

De mme
2

la suite

du pur (uddha), en ajoutant

le souill

(klisla) de sa terre.

la suite de tout recueillement

pur peut natre

le le

recueillement
recueillement

souill

de la
'

mme

terre.

Le

reste

comme pour

ansrava.

la suite

du recueillement ansrava ne peut natre un

recueillement souill.

16

a.

Du

souill, le

pur

et le souill

de sa terre.

A
de la

la suite

du recueillement
terre.

souill, le recueillement

pur ou souill

mme

1. anvayajnnnantaram ceti vistarah idam vyutpdyate rdhvdkarabhmylambanatvd dhynnm asti prasanga iti krtv. tasydharraylambanatvd iti yasmt tad dharmajnnam adharsrayamkmadhtvrayam adharlambanamkmaduhkhdylambanam na dharmajnnnantaram rpyam sampadyante.
/ / /
....

2. dag pa las de bzhin / ran klistam cpi svabhmikam //

gi sa

pahi non nions kyah

= tath

suddht

3. esam yathaivnsravd iti/ svabhmike ca suddhnsrave utpadyete/ rdhvdhobhmike ca yvat trtiyd iti / Hiuan-tsang ajoute Donc la suite du naivasamjnsamjnyatana [pur]
:

peuvent natre six sortes de recueillement le pur et le souill de ce mme yatana, l'ansrava et le pur des deuxime et troisime rtlpyas. A la suite du premier dhyna [pur], sept sortes les trois du premier dhyna ; l'ansrava et
: :

le

pur du deuxime

et

du troisime.
;

la suite

de Vkiiicanya, huit
;

la suite

du deuxime dhyna, neuf


4.

la suite du vijnnnantya, dix


.
/

la suite

des

autres recueillements purs, onze

non nions can

las ran

dag dan

non mons

= klistt

svam suddhakam

klistam.

170

CHAPITRE
b.

VIII,

16 b-d.
'

16

Et

le

pur d'une terre infrieure.


les

Harass par

passions (klesa) de la terre o

il

passions propres au recueillement souill d'une terre


l'ascte produit estime

suprieure
terre

se trouve

l'endroit du recueillement pur d'une

infrieure.

Donc, la suite du recueillement souill d'une terre sup-

rieure (deuxime

dhyna), peut

natre le recueillement pur d'une

terre infrieure (premier


Il

dhyna).

y a une
le

difficult. Si l'ascte tait


le

mme

de connatre distincil

tement

recueillement souill et

recueillement pur,

pourrait

passer du recueillement suprieur souill au recueillement infrieur


pur. Mais, tant souill,
distincte
;

il

n'est pas capable de cette connaissance

comment donc

peut-il,

la suite du recueillement

souill,

produire un recueillement pur ?

Par

la force

d'une rsolution
:

(pranidhna)

antrieure.

Il

a pris

cette
!

rsolution

Puiss-je

obtenir le recueillement infrieur pur

Qu'ai-je faire du recueillese dveloppe en raison de la


le

ment suprieur
rsolution
;

souill

? La

srie

et,

par consquent, plus tard,

recueillement infrieur

pur nat la suite du recueillement suprieur souill.


qu'un

De mme
ne nat

homme

forme la rsolution de dormir jusqu' un certain au moment


fix.
2

moment,

s'endort, et se rveille

Le recueillement ansrava, de quelque


jamais la suite du recueillement souill
rciproque [13 b] entre ces deux sortes.

terre
'.

que ce

soit,

[Il

n'y a pas gnration


le

Tandis que

recueillement

pur est en gnration rciproque avec Y ansrava

et le souill].

Nous avons
il

dit

que

le

recueillement souill qui succde recueil-

lement pur ou souill est toujours de la terre du recueillement auquel


succde. Cette rgle doit s'entendre de ce qui se passe au cours du

hog mahi dag gcig kyan as [ekam cdharauddhakam /) pranidhyeti vistarah / yadi kacid evam buddhim utpdyrdhartre candrodaye candrstamaye va maya praboddhavyam iti svapet sa prvbhiprynuvartant samtateh tasminn eva kle prabudhyate. 3. sarvaih notpadyata iti / npi svabhtnikam npy adkarabhmikam utpadyata ity arthah.
1.

2.

Hiuan-tsang,
recueillement
' ;

xxviii, fol.

13 a-b.

171

mais
la suite du pur,
le souill

16

c-d.

la mort,

de toute espce.

la mort,

succdant au recueillement pur obtenu par naissance

3
,

peut natre une pense souille de toute terre.

16

d.

la suite

du

souill,

pas

le

suprieur.

la

mort ne peut succder aux Rpas

et

rQpyas

souills qu'une

pense souille de la

mme
le

terre

ou d'une

terre infrieure.

Nous avons vu que


recueillement

recueillement
;

andsrava peut succder au


il

pur

(suddhaka)

mais

ne peut pas succder

toutes les espces de recueillement pur.

1. sampattiklam praty etad uktatn iti suddhakt klistc ca samananlaram svabhumikam eva klistam utpadyate nnyabhmikam iti katham tath suddht klistam cpi svabhimikam (viii. 15 c-d) klistt svatn suddha/
/

kam
2.

klistam (16

a) ity

evam.
tats de

hchi po dag las non

L'auteur a parl jusqu'ici des

contemplation, et

mons kun. sampattidhynas, recueillements, de leur succession mais le kusalasamhita, la


;

pense

bonne de recueillement
les

qui existe dans les upapattidhynas, c'est--dire dans


etc.), et

naissances de

Rpa (= de dhyna ; brahmaloka,


le

qui est acquise par

dhyna pur (suddhaka dhyna). Lorsque meurt un tre du Rpadhatu, ce dhyna pur prend fin ne peut-il tre suivi que par un dhyna souill de la mme terre ? Non A la mort, la suite du pur, le souill de n'importe quelle terre . En effet, la mort (maranabhava) n'est jamais recueillie (samhita) (iii. 43) l'tre du Rflpa, au moment o il meurt, ne possde jamais le dhyna de recueillement pur. La
naissance (upapattilbhika), reoit aussi

nom

de

pense

la rincarnation

(pratisamdhicitta) qui succde

la

pense

la

mort

(maranabhava)

sera donc souille, non recueillie.

3. cyutikle tu maranabhava upapattilbhikc chuddhakd iti vistarah / upapattidhynesu yad upapatlilbhikam kusalasamhitam lad apisuddhakam dhynam ity ucyate / ata idam ucyate cyutikle tv iti vistarena j kim kranam / asamhitatvn maranabhavasya / na ht tadnm suddhakam sampattidhynam astlty atah sarvabhmikatn klistam utpadyala iti svabhmikd adharordhvabhmikam pratisamdhicittam klistam asamhitam utpadyata ity arthah. 4. non mons can las gon ma min.

172

CHAPITRE
a-b.

VIII,

17-19

b.

17
etc.
1

Le recueillement pur

est de quatre sortes,

hnabhgya,

Le suddhaka

est de quatre espces,

hnabhgya, de

chute, sthi-

tbhgiya, de stagnation, viesabhgya, de progrs, nirvedhabhgya, de pntration. Toutefois


le

suddhaka du naivasamjnnen exceptant la


2

samjnyatana

n'est

que de

trois espces [14 a],

catgorie viesabhgya, parce qu'il n'y a pas de terre suprieure.

Quelles sont ces quatre espces ?

17

b-d.

Dans

l'ordre, idoine

(anukla)

la naissance des kleas,


'

sa propre Lorsque

terre,

une

terre suprieure,

Yansrava.

le

suddhaka
suddhaka suddhaka suddhaka
(vi.

est de telle nature qu'il tend

aboutir

la

naissance des klesas, on l'appelle hnabhgya.

Lorsque

le

tend aboutir sa propre terre, on l'appelle

sthitibhgya.

Lorsque

le

tend aboutir une terre suprieure, on

l'appelle viesabhgya.

Lorsque

le

tend aboutir Yansrava, on l'appelle


a).

nirvedhabhgya
de

20

C'est donc de cette dernire catgorie

suddhaka que

nat

Yansrava.

Quelle est la gnration rciproque de ces quatre catgories ?

18

a-b.

la suite

du hnabhgya,
le

etc.,

deux,

trois, trois,

un.

la suite

du hnabhgya,

hnabhgya

et le

sthitibhgya \

[hnabhglydi suddham 1. dag pa nams pahi cha mthun sogs / rnam bzhi caturdh] 2. anyatra visesabhglyd iti j ita rdhvabhmyabhavt. Paramartha
en exceptant le nirvedhabhgya . Ces quatre catgories sont les dharmas duppativijjha de Dlgha, iii. 277. Voir les sources cites iv. 125, trad. p. 253, vi. 20 a, p. 169. 3. de ni go rims bzhin / non inons skye dan ran sa dan / gon dan zag med rjes

traduit

mthun paho 4. nams cha mthun sogs mjug thogs su


5.

/ gnis dan gsum dan gsum dan gcig hnabhgyam pravhakle sthitibhglyam visesagamanakle. Au hnabhgya succde hnabhgya lorsqu'il n'y a

hnasthitibhgye

iti

Hiuan-tsang,

xxviii, fol.

13 b-14
le

b.

173

A A
A

la suite
la suite la suite

du sthitibhgya,

trois,

en exceptant

nirvedhabhgya.
le

du viesabhgya,

trois,
le

en exceptant
seul

hnabhgiya

'.

du nirvedhabhgya,
(viii.

nirvedhabhgya.
recueil-

Nous avons vu
recueillement

15

a-c) que,

immdiatement aprs un
terre,

lement suddhaka ou ansrava d'une certaine

peut natre un

haut ou vers
terre et

le

suddhaka ou ansrava de la troisime terre vers le bas . Quand cela se produit, l'ascte franchit une
le

change
la

caractre du recueillement
le

il

pratique ce qu'on

nomme
tion
.

vyutkrntakasampatti,

recueillement avec transi-

Gomment
b.

ce recueillement est-il ralis?


et

18 c-19
terre, aller

Ayant parcouru de deux manires

dans

les

deux

sens les huit terres, en succession immdiate, en franchissant une

la troisime terre d'espce diffrente, c'est la


2

vyutkrn-

takasampatti.

[14 b]
:

Dans

les

deux sens

aller ,
;

c'est

prendre les recueillements en


,

ordre ascendant

(anuloma)

revenir

c'est

prendre les recueille-

ments en ordre descendant.

De deux manires,
rava.
[Il

recueillement

ansrava

et recueillement ss-

s'agit

du recueillement suddhaka, non pas du klista]


:

Les huit terres

quatre dhynas, quatre rpyas.


:

En En

succession immdiate
franchissant une terre
prparatoire
1.

de proche en proche. en sautant une terre.


quatre
disciplines

L'exercice

(prayoga) comporte

successives

pratique des huit recueillements ssrava en ordre


;

ascendant

et

descendant

2.

cette pratique tant assure, pratique


recueillement pur s'affermit et qu'il

pas progrs, succde sthitibhgya lorsque

le

va y avoir progrs (visesagamana).


1. anyatra hnabhgyd iti / visesabhgyd dhyumnasya sthitibhgyparityge tasyaivotpattiyogt. 2. sa brgyad rnam guis hbrel pa dan / gcig brgal son zhin ons nas ni / ris mi mthun pa gsum par bgro / thod brgal gyi ni snoms bjug yin .... vyutkrntakasampattir visubhgatrtyag // Mahavyutpatti, 68, 5 voir Kosa, ii. 44 d, trad. p. 210. Visuddhimagga, 374 (Atthasalin, 187) jhnmilomato jhnapatilomato jhnukkantito.

174
des sept recueillements
3. cette

CHAPITRE

VIII,

18 c-20

b.

ansrava en ordre ascendant

et

descendant

pratique tant assure, pour conqurir la matrise en recueil-

lement, passer du premier de

dhyna ssrava dans

le

troisime

dhyna

mme

qualit

de celui-ci dans Y knantyyatana, de celui-ci


;

dans Ykimcanya
tant

et

redescendre de mme, tous ces recueillements


pratique tant assure, pratiquer de

ssrava
les

4. cette

mme,

dans

deux sens,

les recueillements

ansrava.

dhyna ssrava dhyna ansrava, de celui-ci dans Y knantyyatana ssrava, de celui-ci dans Ykimcanyyatana ansrava,
Lorsque l'ascte est capable de passer du premier
le

dans

troisime

et

de revenir de la
le

mme

manire, alors se trouvent raliss

l'alle

dans

troisime recueillement de qualit diffrente et le retour de ce


;

recueillement
Il

la

vyutkrntakasampatti

est

acheve

'

est impossible de franchir

deux terres

et d'entrer

dans

la qua-

trime, parce que la quatrime terre est trop loigne.

La vyutkrntakasampatti
des trois dvlpas
(vi.
;

n'est pratique

que par

par des Arhats de la catgorie

hommes asamayavimukta
les

57),

parce qu'ils ont dtruit les passions (klesa), parce qu'ils


la

possdent
(vi.

matrise

en

recueillement.

[15

a].

Les Drstipraptas
et

31

c) sont

de facults aigus (tksnendriya)


;

possdent la
fait dfaut.

matrise en recueillement

mais

la

premire condition leur

Les Arhats de
sions,

la catgorie

samayavimukta
fait dfaut.

ont dtruit les

pas-

mais

la

deuxime condition

Les uns

et les autres

sont donc incapables de pratiquer la vyutkrntakasampatti.

Combien de dhynas
liss

et

d'rpyas peuvent

tre pratiqus, actua-

(sammukhbhva), par

les tres des diffrentes terres ?

1.

D'aprs Paramrtha.

Hiuan-tsang

diffre

....

(3)

pratiquer les ssravas

et

ansravas en

ordre ml et continu (c'est--dire


;

de premier
les
le

dhyna ssrava,
ssrava en ordre
....)
;

entrer dans deuxime

discontinu

dhyna ansrava) (4) pratiquer (c'est--dire du premier dhyna entrer dans


:

troisime

(5)

de

mme

en ce qui concerne les ansravas

et discontinu. La Vibh&sS, 165, 11, diffre: 1. bonne pense du Kmadhatu, 2. recueillement ssrava, aller et retour, jusque bhavgra, 3. recueillement ansrava, aller et retour, 4. ssrava en sautant, 5. ansrava en sautant, 6. ssrava et ansrava en sautant.

en ordre ml

(6)

pratiquer les ssravas et

ansravas

Hiuan-tsang,

xxviii, fol.

14 b-15

a.

175
point d'appui
'

19
Un

c-d.

Les dhynas

et

les

rpyas ont pour

(raya) des tres de leur terre ou d'une


tre

terre infrieure.

du bhavgra

= naivasamjnnsamjnyatana) peut
bhavgra. Le peuvent aussi
raliser les
recueil-

raliser le recueillement de

tres des terres infrieures jusqu'au

Kamadhatu. De

mme les

lements des autres terres peuvent tre raliss par

les tres qui se

trouvent dans la terre de ces recueillements ou dans des terres infrieures.


le

Mais un

tre

n dans une terre suprieure ne peut pas raliser


:

recueillement d'une terre infrieure

19

d.

Le recueillement

infrieur n'a pas d'utilit.


terre infrieure

Le recueillement d'une
petite utilit

ne prsente pas

la

plus

pour un tre n dans une terre suprieure, parce que ce


est,

recueillement

en comparaison, mdiocre.

Telle est la rgle gnrale, qui souffre une exception

20
Un
dire
tives

a-b.

Mais, dans

le

bhavgra,

c'est

en entrant dans
4

le recueille-

ment rya 'kimcanya qu'on


tre n

dtruit les vices.

dans

le

bhavgra
effet le

ralise le recueillement
les

rya,

c'est--

ansrava, d'kimcanyyatana pour dtruire


au bhavgra. En
le

passions relatre

chemin pur (ansrava) ne peut


;

pratiqu dans

bhavgra (svasybhvt)'

d'autre part,

Ykim-

canya

est tout

proche (abhysa

= samnikrstatva).
ni
/

1. bsam gtan gzugs med ran dan ray dhynrpyh]

hog sahi rten can

[sv/Xdhobhmy-

2.

hog dgos med.


Hiuan-tsang
3.
:

3.

l^car

il

n'y a pas d'utilit ce qu'un tre d'une terre suprieure


;

produise recueillement infrieur

2.

car sa propre terre l'emporte sur ce recueille;

ment ment

car la force de ce recueillement est faible


car ce recueillement est objet de dgot.
/

4.

car

il

a rejet ce recueille-

5.

4. srid rtse hphags pa ci yan med mnon sum byas nas zag pa zad = rykimcanyastmmikhyd bhavgre tv sravaksayah. Les deux traducteurs chinois ont lu ry kimcanyasmmukhyt 5. Voir ii. 45 a-b (trad. p. 221) ci-dessus p. 145, 168. Vyakhya vi. 73 a-b yvad eva samjnsampattis tvad jnprativedha iti vacant (Anguttara,
:

...

iv.

426).

176

CHAPITRE

VIII,

20

c-21.

Quel

est l'objet des recueillements de

dhyna

et

'rpya

? [15 b]

20

c.
'

Associ la

soif,

le

recueillement a pour objet son propre

bhava.

Recueillement associ la soif


(viii.

recueillement de dlectation
,

6).

Il

a pour objet

son bhava
:

c'est--dire le

bhava de
[Ceci est

sa terre

par bhava on entend

ce qui est
viii.

ssrava
6
:

une autre manire d'exposer


de dlectation a pour objet

la doctrine de
le

le

recueillement
(bon, mais

recueillement

suddhaka

ssrava), non pas Yansrava].

Il

n'a pas pour objet une terre

infrieure, car l'ascte qui pratique le recueillement de dlectation

d'une certaine terre est dtach de la terre infrieure

2
.

Il

n'a pas pour

objet une terre suprieure, car les terres sont dtermines, dlimites

par la soif
qu'il est

3
.

Il
4
.

n'a pas pour objet

Yansrava, ce qui impliquerait

bon

20

d.

Le recueillement bon a pour

objet tout ce qui existe.

Le recueillement bon (subha),


1.

c'est--dire

suddhaka ou ansrava,

sred bcas ran gi srid la dmigs

[satrsnam svabhavlambam] (Voir

ci-dessus p. 146).
2. On a vu que le dhyna de dlectation (uddhaka), non pas Yansrava. Entendons

a pour objet

le

Il

ne porte pas sur

dhyna pur le dhyna


:

pur d'une terre infrieure


3.

La Vyakhya, dont le texte est malheureusement peu sr, explique trsnparicchinnatvd bhmnm iti / y yasym bhmau tasytn eva bhmv anuayanm ?) tay sa bhmih paricchinn bhavati j anyath hi tasyottaratvam (?) na sidhyed ekabhmisthnntaravat ata evauttardharye 'pi sthnntarnm traynm traynm astnm caikabhmit sidhyati
( /

trsnvyatihrayogt. C'est la trsn qui dtermine

la

bhmi.

C'est ainsi

que

les trois

lieux

des cieux des trois premiers

dhynas

et les huit

slhnas ou sthnas du ciel du

quatrime

parce que la
elle
4.

dhyna ne font qu'une bhmi, bien que ces lieux soient superposs, mme trsn prend gte-et-croissance dans toute la bhmi laquelle
(v. 17).

appartient

Voir

iii.

c,

dfinition des Dhtus.


iti

nnsravam kualatvaprasangd
:

cchandah
Kosa,
5.

Le dsir de Yansrava
36.

n'est pas soif,

tatprrthan hi kualadharmamais dsir du bien .

v. 16, p.

bsam gtan dge

yul yod dgu yin

= dhynam sadvisayam ubham

//

Hiuan-tsang,
prend pour objet tous
les
'.

xxviii, fol.

15 a-16

a.

177
ce

dharmas,

c'est--dire

qui

existe,

samskrta

et

asamskrta

Toutefois

21

a-b.

Les rpyas bons des terres principales n'ont pas pour


infrieur.
2

objet le

ssrava

Les recueillements bons pratiqus dans

les terres principales d'rfl-

pya

par opposition aux recueillements de

dhyna

et

aux
22)

recueil-

lements pratiqus dans les smantakas d'rpya

(viii.

n'ont

dharmas impurs (ssrava) (ssravdharavastu), mais bien les dharmas


pas pour objet
les

des terres infrieures

de leur terre ou d'une

terre suprieure.

En
pour

ce qui concerne les

dharmas
ils

purs (ansrava)

ils

prennent

objet, ils portent sur l'ensemble de


;

sarvnvayajnnapaksa
(dont l'objet, savoir le

anvayajnna (vii. 3 c), le ne portent pas sur le dharmajnna


est trop loign)
;

Kamadbatu,

ils

ne portent
terre
s'ils

pas non plus sur


infrieure

la destruction (laquelle est

ansrava) d'une
que

(adhobhminirodha), ce qui ne

serait possible

portaient sur cette terre.

Les recueillements pratiqus dans

pour objet
dont

la terre infrieure, car ils

smantakas d'rpya ont comportent un nantaryamrga


les
3

le seul objet est la terre infrieure.

Parmi
klista,

les trois

espces de recueillement

ansrava, suddhaka,
dhynas
et

supramondain, pur, souill

des

des rpyas,

laquelle dtruit les passions (kleas) ? [16 a]

21
1.

c-d.

Les kleas sont abandonns par

le fait

de X ansrava.

D'aprs Paramrtha.

Hiuan-tsang
l'objet

Il

a pour objet tout samskrta de sa

terre,

des terres infrieures et suprieures, et Vasamskrta. Toutefois les

asam-

skrtas non-dfinis ne sont pas


2.

du recueillement ansrava . gzugs med dnos gzhi dge rnams kyi / spyod yul zag bcas hog
/

ma min

na maulh kualrpyh ssravdharagocarh

3. Pour se dtacher du quatrime dhyna, l'ascte entre dans le smantaka du premier rpya et considre le quatrime dhyna comme grossier, etc. (vi. 49) c'est l' nantaryamrga du dtachement du quatrime dhyna. Voir iii. 35 a, sur le smantaka d'knantya et sur les rpyas.
:

4.

zag pa

med pas non mons rnams

spon no.
12

178

CHAPITRE

VIII,

21 c-22

c.

Tout recueillement ansrava


non pas
le

est capable de

couper

les

kleas

uddhaka,

ni,

plus forte raison,


les

le klista.

Le uddhaka ne coupe pas


terre

kleas d'une terre infrieure, car

l'ascte ne peut obtenir le recueillement

suddhaka d'une
'

certaine

que parce

qu'il est

dtach (virakta) l'endroit de la terre


la terre infrieure
;

infrieure,
les

dgag des kleas de


il

il

ne coupe pas
2

kleas de sa terre, car


les

ne contrecarre pas ces kleas

; il

ne

coupe pas

kleas d'une terre suprieure, parce qu'ils sont plus


3

raffins qu'il n'est lui-mme.

21

d.

Et aussi au moyen du smantaka,


et

mme

pur.*

Les smantakas des dhynas


coupent
les kleas,
a-t-il

des rpyas, fussent-ils

purs
6

5
,

parce qu'ils s'opposent la terre infrieure.


de

Combien y

smantakas

22

a.

Aux

recueillements principaux, huit


principal

smantakas.

Chaque recueillement
principal

(maula) a un smantaka, un
le

recueillement liminaire, par lequel on entre dans

recueillement

(yena tatpraveah).
trois sortes, souills, purs,

Les smantakas sont-ils de

ansrava,

comme

sont les recueillements principaux ? Possdent-ils les

mmes

sensations (vedan, savoir priti pour les deux premiers dhynas,

sukha pour
1.

le troisime,

upeks pour

le

quatrime) que ceux-ci ?

2.

vltargatvn ndhah. tadapratipaksatvt.


viii. p.

Vyakhya
iti

na

hi

bhavena bhavanihsaranam

astti (voir ci-dessus


3.

141).

viislataratvn
fier

nordhvam

nordhvabhmikh Me adharabhmi-

kena uddhakena prahyante.


4.

snogs dag pas kyan.

hiddhakenplty apiabdd ansravenpti sambhavatas tv etad uktam. kmvacar hi kleh prathamadhy6. adhobhmikapratipaksatvt. nasamantakena prahyante prathamadhynabhmik dvitlyadhynasmantakena evam yvad kimcanyyatanabhmik naivasamjnn5.

samjnyatanasmantakena.
7.

de dag

la ni fier

snogs brgyad

= [tesu smantaka astau]

Hiuan-tsang,

xxviii, fol.

16 a-b.

179

22

b.

Purs

sensation d'indiffrence.

'

Les smantakas sont exclusivement uddha, purs, associs la


sensation d'indiffrence, parce qu'ils

vont

par effort (yatnavhya

= abhisamskravhya)
n'a pas disparu
s
,

-,

parce que l'horreur de la terre infrieure


le

parce qu'ils sont

chemin par lequel on se dtache

de la terre infrieure \
rence
;

Donc

ils

ont seulement sensation d'indiff-

ils

ne sont pas associs dlectation.


est aussi

22

c.

Le premier

rya.

Le premier smantaka
espces, pur

est

nomm angamya

6
.

Il

est de
b]

deux

(uddhaka)

et

rya, c'est--dire ansrava. [16

La pense de smantaka par


est souille (klista)
;

laquelle on entre dans une existence

mais

la

pense de
'

smantaka par

laquelle

on

entre en recueillement, ne peut tre souille, car nous avons rfut


cette thse (ci-dessus, p. 178,
1.

15).

1.

dag pa bde min sdug bsnal min.

Voir

iii.

35

d, vii.

26

a, viii.

22

c.

anabhisamskravhl mrgah prtisukkbhym samprayujyate j tni ca smantakni yatnavhyni sbhisamskravhyni. 3. adhobhmyudvegnapagamt. Par consquent la priti et le sukha y manquent prltisukhayor ayoga iti. 4. vairgyapathc ca nsvdanasamprayuktni. Etant chemin de
2.
:

dtachement,
5.
6.

ils

ne peuvent tre associs dlectation, donc

ils

sont purs.

dan po hphags pa han. Explication du terme angamya,


vrai dire les

vi.

44

d, p. 228,

note

ci-dessous

p.

181

n. 2.

A
et

smantakas ou recueillements rpyas peuvent tre nomms angamya,

liminaires de tous les

dhynas

parce qu'ils ne peuvent entrer

dans le recueillement principal et parce qu'ils coupent les kleas. Mais Samghabhadra dit que le nom ' angamya est rserv au smantaka du premier dhyna pour montrer que ce smantaka diffre des autres. L'ascte le produit avant d'tre entr dans un tat quelconque de recueillement et, quand il s'y trouve,
il

n'prouve pas de dlectation (svdana). Les autres


;

smantakas

sont produits

par la force d'un recueillement antrieur

l'ascte qui s'y trouve peut prouver

dlectation [Ceci ne parat pas conciliahle avec les dfinitions de YasubandhuJ.

La Vibhasa dit On le nomme angamya, parce qu'il est produit sans qu'on soit arriv (an-gamya) la terre principale (maulabhmi), car les qualits de
:

la terre principale
7.

en sont absentes
le

En

disant que

smantaka

est le

terre infrieure.

D'aprs Paramartha.

chemin par lequel on se dtache d'une La Vyakhya explique la premire

'

180

CHAPITRE
c.

VIII,

22

c-d.

22

D'autres disent qu'il est

triple.

D'autres docteurs disent que


associ dlectation.
-

le

smantaka angamya

est aussi

Le dhynntara
Il

diffre-t-il,

ou ne

diffre-t-il pas,

du smantaka ? du dtachement

en

diffre.

En

effet le
;

smantaka

est la porte

d'une terre infrieure

ce qui n'est pas le cas pour le

dhynntara.

En

outre
d.

22

Le dhynntara

est sans vitarka.

Le premier dhyna principal (maula)


rieurs (les

et le

premier

smantaka

sont associs vitarka et vicra. Dans les sept recueillements sup-

vicra. Seul

manias avec leurs smantakas), il n'y a ni vitarka, ni le dhynntara est muni de vicra, sans tre muni de
:

astsv api dhynrpyesu ycisya yat smantakam tasya tena smantakacittena klistensamhitena samdhibandha ity esasiddhnta ity ata idam ncyate yady api smantakacitteneti vistarah. La premire
phrase du Bhasya

pense d'une existence de dhyna, Yupapattibhava

(iii.

38),

appartient au
la terre

smantaka
dhyna. 1. kha

de ce

dhyna

elle est souille

de tous

les

kleas de

de ce

cig

gsum.
1.

Vibh&sS, 140,
joie

Quelques-uns disent que les terres de smantaka comportent


Stra dit qu'en s'appuyant sur la joie on abandonne
:

(prti), car le

la

tristesse

(daurmanasya). D'aprs d'autres sources La joie du smantaka du premier dhyna comporte mouvement et n'est pas comme celle du dhyna principal .... Les deux smantakas suivants comportent sukha . Vibhasa,
164, 5
:

Les Darstfintikas disent que

les

smantakas

sont seulement bons

on

explique qu'ils sont bons, souills, non dfinis.


2.

Hiuan-tsang ajoute

principal s'attache aussi


l'aptitude

Parce que celui qui ne produit pas La VyHkhyfi dit au smantaka .

le
:

recueillement

En

raison de

(patutva) de

Vangamya

il

peut tre ansrava,

il

peut de

mme

Samghabhadra explique: maulapratispardhitvd svdanasampattisadbhvt. 3. rtog med bsam gtan khyad par can a atarkam dhynam antaram //
tre associ dlectation. Telle est l'intention.

Sources plies, Points of Controversy,

p.

329 (Psychological Ethics,


;

p. 43, 52,

Theragatha, 916, avec un autre paucangika samdhi)

Koa,

viii.

a-b, p. 133,

23

c.

Sur

le

dhynntara

et la thorie

des Sammityas

et

Andhakas, Kathavatthu,

xviii. 7.

Hiuan-tsang,
vitarka
:

xxviii, fol.

16

b.

181

par consquent

il

l'emporte sur

le

premier

dhyna
il

et est
'

infrieur

au deuxime. C'est pourquoi on


consquence que, dans

le

nomme dhynntara.

D'o

cette

les terres suprieures,

n'y a

pas de dhynntara, car


la premire,

tes autres terres

ne prsentent pas,
2

comme

un haut

et

un bas (visesbhvt).

1.

D'aprs Hiuan-tsang.

Param&rtha
il

Ce dhyna

est dissoci de vitarka.

On
il

le

nomme dhynntara,
le

parce qu'il est diffrent de deux dhynas.


n'est pas plac
etc.,

Comme
.

l'emporte sur
n'est pas plac

premier dhyna,
le

dans

le

premier dhyna.

Il

non plus dans

deuxime,

vu l'absence de visesa
c'est--dire

On

peut douter que les traducteurs chinois aient bien compris.


dit
:

La Vyakhya

Le Bh&sya a

dhynavisesatvt,

Le premier

dhyna principal, par le dpart du vitarka, devient plus distingu et reoit le nom de dhynntara = tad eva maulam prathamam dhynam vitarkapagamd visistam dhynntaram ucyata ity arthah. 2. visesbhvt = yath prathame dhyne viseso bhavati kvacid vitarkavicrau kvacid vicra eveti na tath dvitlydisv iti / ato [dvitiydisu] dhynesu na vyavaslhpyate dhynntaram.
Samghabhadra reproduit
le

texte de

Vasubandhu
et le

(version de Hiuan-tsang) et

ajoute des explications utiles sur

Vangamya
est

dhynntara. Nous dcoule

pons ces explications en paragraphes.


a. C'est dire

que

le

dhynntara, qui
le fait qu'il
etc.),

compris dans
le

premier dhyna,

diffre

de

celui-ci

par

a en moins
?

vitarka. Dans les terres sup-

rieures (deuxime

dhyna,

quels sont les

donnerait naissance un

dhynntara

Donc

il

dharmas dont la suppression y a un dhynntara dans le

premier dhyna, non pas dans les terres suprieures.


b.

Le Stra ne

dit-il

pas que sept recueilllements (sampatti)


premiers

savoir

les

quatre

dhynas

et les trois

rupyas
27
c]

sont les points d'appui [de la


tablissez-vous qu'il y a

Prajna pure, des

qualits

, viii.

20

a,

Comment

en outre un
c.

angamya, un dhynntara ?
:

Nous savons qu'il y a un angamya par l'Ecriture et par le raisonnement. Le Stra dit Celui qui n'est pas capable d'entrer dans le premier dhyna, etc., et d'y demeurer, il obtient ici-bas la destruction des sravas au moyen de la Prajna rya ou pure (ansrava) . S'il n'y a pas d'angamya, quel peut tre
le

point d'appui de cette Prajna ?

En

outre, le Stra de la

bonne moralit (sulastra


vi.

?) dit

Il

y a un

dlivr-par-la-Prajna (prajnvimukta,
principal

64) qui

n'a pas obtenu le


dit) .

homme dhyna
en pre-

(mauladhyna

le

dhyna proprement

Or

n'est-ce pas

nant point d'appui sur le dhyna que l'ascte obtient la dlivrance-par-la-Prajfta ? [Donc il y a un dhyna qui n'est pas maula, savoir le dhyna liminaire,

Vangamya. Sur
d.

le

caractre mixte de
le

Vangamya,
y a
trois

iii.

35

d].

Quant au dhynntara,

Stra

dit qu'il

samdhis, sa-vitarka,

182

chapitre vin, 23

a-d.

A
t-il?

combien de catgories appartient-il ? Quelle sensation comporte-

23
Il

a.

De

trois sortes

sensation d'indiffrence.

'

peut tre associ dlectation, pur (suddhaka), ansrava.


les recueillements liminaires

la

Comme
driya

(smantaka),
il

il

comporte
2

sensation ni-dsagrable-ni-agrable, car


(iv.

est associ

Yupeksenet
le

48).

Il

va par

effort

(bhisamskravhin)

ne peut

donc tre associ satisfaction (saumanasya). Donc on

considre

comme

route

difficile

(duhkh pratipad,

vi. 66).

Quel est

le fruit

du dhynntara ?
fruit

23

b. Il

a pour

Mahabrahma.

Quiconque pratique au plus haut degr ce recueillement renat en


qualit de

Mahabrahma.
expliqu les sampattis
'.

Nous avons
sa-vicra,

Quels sont

les

samdhis

etc. (viii.

23

c). Il dit

que

le

premier

dhyna
serait

est

muni de vitarka

et

vicra

que, dans le deuxime et les suivants, vitarka et vicra ont cess. S'il

n'y avait pas de

dhynntara,

quel

samdhi

avec vicra et sans


il

vitarka
y
ait

? Parce que les citta-caittas cessent graduellement,

convient qu'il

un dhyna avec vicra et sans vitarka. En outre, en dehors du dhynntara, quelle cause la naissance de Mahabrahma souverain du monde (Kosa, viii. 23 h) ? e. Le Bouddha ne parle pas d'angamya et de dhynntara : c'est que l'un et l'autre sont compris dans le premier dhyna. En nommant le premier dhyna,
il

les
f.

nomme.

Le premier
le

vestibule

smantaka,

reoit le

nom d'angamya

parce qu'on

veut

distinguer des autres. Le

dhyna

ne nat pas avant qu'on soit entr dans

ce premier
1.

2.
vi.

smantaka. (Voir ci-dessus vi. 44 d, p. 228). rnam gsum de bde mi sdug min. Ailleurs abhisamskravhya ; voir iv. 78 c, p. 168 (vahati
a,

gacchati),

66
4.

71 d.

3.

de ni thsans chen hbras bu can.

Voir

ii.

41

d.

Manque dans Paramfirtha. Hiuan-tsang, samp atti samdhi tng tch' (tenir, dhar).

= tng-lch (clef 133),


samdhi
et

Vibhfisa, 172,

9.

Les opinions diffrent sur

la diffrence entre

sampatti.

Samdhi

s'entend d'un recueillement

momentan (ksanika) ;

Hiuan-tsang,
Le Stra
vitarka
et
'

xxviii, fol.

16 b-17

a.

183
1.

dit qu'il
;

y a

trois sortes de

samdhis

samdhi avec

vicra

vicra 2. samdhi sans vitarka et avec seulement sans vitarka et sans vicra. samdhi ; Le dhynrdara est le samdhi sans vitarka et avec vicra.
3.

Relativement au dhynntara,

23

c-d.

Jusque

l,

samdhi avec vitarka


2

et

vicra

au-del,

samdhi

sans l'un

et l'autre.

Tout samdhi qui


appel

se

trouve en dessous du
. Il

dhynntara
*

est
et

avec vitarka et vicra

s'agit

du premier

dhyna

de tout autre

samdhi s'appuyant
,

sur

le

premier dhyna.

Au-dessus du dhynntara, tout samdhi


sans vicra
depuis
le

est sans vitarka,

smantaka du deuxime

dhyna jusqu'au

quatrime rpya.
sampatti d'un recueillement prolong (prbandhika).
portent toujours la pense (citta)
;

Les samdhis comLes satnpattis

ils

sont sacittaka
i.

cette pense peut tre ou

samhita,
(ii.

recueillie,
p.

ou vyagra (ou viksipta,


et

33

c-d) disperse.

44

d,

213)

sont accompagnes de pense ou exemptes de pense (par


:

samjnveditanirodhasampatti). Donc on a associ pense vyagra [On comprend mal comment la pense non samhita peut tre en samdhi, voir ci-dessus p. 128 n. 3 mais il est certain que la pense de Kfimadhatu peut tre en samdhi, viii. 25 a, etc.] 2. exclusivement sampatti, les tats exempts de amatha, pense 3. samdhi et sampatti, tout tat de pense recueillie.
exemple asamjnisampatti
1.

exclusivement samdhi,

le [similij-recueillement

un tat accompagn de pense, de pense

recueillie.
1.

Un sommaire
2.

traditionnel
3.

du

viii e

chapitre veut qu'il traite

des rpyas,

des sampattis (tout ce qui est


ii.

ou sans pense (voir


le

44

d, p.

213)

4.

des dhynas, samhita, avec des samdhis, c'est--dire au sens propre


recueilli
,

groupe nyatsamdhi
1.

(viii.

24).
;

Drgha, 9, 2, Samyukta, 18, 25 Dlgha, iii. 219, 274, Samyutta, iv. 363, Anguttara, iv. 300, Kathavatthu, ix. 8 et trad. p. 239, note ailleurs ne sont distingus que le savitarka-savicra et Vavitarka-avicra, Samyutta, v. 111 etc. [Rle de V avitakka-avicra dans la lecture de la pense d'autrui, Dgha, iii. 104]. Voir Compendium, Introduction, 58,

Madhyama,
iii.

17, 22,

Majjhima,

162,
;

Visuddhimagga,
Vibhasa, 145,

169.
6.

Les D&rstfintikas pensent


tin

qu'il

y a vitarka-vicra jusque

dans
2.

le

Bhavagra.
rtog dpyod bcas pa yi
p.
:

man chad

hdzin yan chad gnis ka med.

Sur

vitarka-vicra,
3.

133

n.

1.

Hiuan-tsang

Il s'agit

du premier dhyna

et

de son

smantaka .

184

CHAPITRE
'

VIII,

24.

Le Satra

enseigne

qu'il

y a

trois recueillements

nomms nyamditations

tdsamddhi, nimitlasamdhi,

apranihitasamddhi,

de la vacuit, du Sans-caractres, de non prise en considration.


[17 b]

24
1.

a.

Vdnimitta a
8, 12

les

aspects du Tranquille.

Dlrgha,

Ekottara, 16,

15,

41, 16

Dlgha.

iii,

219

suniato samdhi,

animitto samdhi, appanihito samdhi; Dhammasangani, 344, 505; Vibhanga, Prface, p. xviii Atthasalin, 221 et suiv. Stralamkara, xviii. 77-79. Anguttara, iii. 397, animitta cetosamdhi. Ci-dessous p. 187 n. 2. a. Vibhasft, 104, 6. Les samdhis sont innombrables pourquoi dire qu'ils sont trois? En se plaant au point de vue du contrecarrant (pratipaksa), au point de vue de l'intention (saya), au point de vue de l'objet (lambana) : 1. le
; ;

snyatsamdhi

contrecarre la

croyance au moi

(satkyadrsti)
et

comme

il

considre les choses sous les


;

aspects

de non-moi

de vide,

il

s'oppose aux

aspects de moi et de mien 2. l'apranihitasamdhi est le samdhi o il y a non intention (saya), non volont (pranidhna) l'endroit de tout dharma des trois Dhatus (ou bhava, tribhava, triple existence , i. 8 c). Il n'y a pas complte absence de pranidhna l'endroit du Chemin mais, quoique le Chemin repose sur le bhava, l'intention relative au Chemin n'a pas de rapport avec le bhava; 3. Vnimittasamdhi a un objet libre des nimittas, savoir de rpa, de sabda, etc. Pour d'autres, les trois samdhis, dans l'ordre, contrecarrent
;

la

satkyadrsti,
b.

le

ilavrata

et la vicikits.
:

La Bodhisattvabhmi, fol. 106 a, range les samdhis dans l'ordre suivant snyat, apranihita, animitta, et en donne une dfinition trs diffrente de celle de Vasubandhu. tatra katamo bodhisattvasya snyatsamdhih / iha bodhisattvasya sarvbhilptmakena svabhvena virahitam nirabhilpyasvabhvam vastu payatah y cittasya sthitih ayam asyocyate snyatsamdhih / apranihitasamdhih katamah j iha bodhisattvasya tad eva nirabhilpyasvabhvam vastu mithyvikalpasamutthpitena kleena parigrhitatvd anekadosa-

dustam samanupasyato y yatym tatrpranidhnaprvak

cittasthitir

nimittasamdhih, katamah \ iha bodhisattvasya tad eva nirabhilpyasvabhvam vastu sarvavikalpaprapancanimittny apaniya yathbhtam ntato manasi kurvato y cittasthitir ayam asyocyate nimittasamdhih / Le deuxime samdhi se rfre au conditionn (samskrta) pour lequel on ne
ity

ayam asypranihitasamdhir

ucyate

forme pas de

pranidhna
le

le

troisime l'inconditionn (Nirvana), objet de


le

pranidhna
on ne forme

premier l'inexistant (asat),

moi, le mien, l'endroit duquel

ni

pranidhna
zhi bahi

ni

apranidhna, mais qu'on regarde seulement

comme
2.

vide.

mthsan med

rnam pa dan.

Il

faut entendre

\J animitta a les

Hiuan-tsang,

xxviii, fol. 17 a-b.

185

Le recueillement associ (samprayukta) aux aspects (kra) de


la vrit de la destruction

(nirodhasatya)

c'est--dire

est
le

le recueille-

ment dans
Pourquoi

lequel l'ascte considre le

nirodha

nomm

ani'

mitta, nimittasamdhi. Ce recueillement a donc quatre aspects.


reoit-il ce

nom

Parce que
nomm
a. les

Nirvana ou nirodha,

tant libre de dix nimittas, est

animitta. Le recueillement

qui a le Nirvana pour objet est donc Yanimitta \ Les dix nimittas,

marques ou
et femelle

caractres, sont

cinq yatanas, sources externes


etc.
;

de la connaissance sensible, couleur-figure (rpa), son,


;

b.

mle

c. les

trois

samskrtalaksanas

fii.

45), naissance,

dure-

changement, mort.

24
est

b-c.

Le snyat a

les aspects

de vide

et

de non-soi.
et

Le recueillement associ aux deux aspects de snya

d'antman

nomm

snyat, snyatsamdhi.

Il

a donc deux aspects, les

deux derniers aspects de

la vrit de la douleur.
est associ

24

c-d.

L'apranihita

aux autres aspects des

vrits.

On nomme
dration
,

apranihita,

recueillement de non-prise en consi-

le

recueillement qui prend les autres aspects, soit donc

dix aspects.

D'une

part, les aspects

anitya

et

duhkha (deux premiers

aspects
l'ori-

de la vrit de la douleur) et les quatre aspects de la vrit de

[Risquons-nous traduire nimittah samkrah\, et non pas U animitta a l'aspect tranquille , nimittah sntkrah. Le Tranquille nirodha Nirvana, a quatre aspects nirodha, pranlta, snta, nihsarana, vii. 13 a. Ce samdhi a les quatre aspects du nirodha ; le nirodha 1. Hiuan-tsang peut tre nomm ama [ou snta] . 2. Sur animitta, substantif et adjectif, Wogihara, Bodhisattvabhumi, p. 19-20. Sur nimitta, Kosa, ii. 14 c. 3. ston nid bdag med ston nid du / hjug paho [snyatntmanyalah / pravartate] II faudrait tudier la vacuit du Petit Vhicule. 4. sinon pa med pa ni / de las gzhan bden rnam pa dan, ce qui donne aprani-

aspects du Tranquille
:

=
:

hitas tadanyasatykravn.

186
gine, qui

CHAPITRE

VIII,

25.

provoquent

terreur

(udvega)

'

d'autre part, les quatre

aspects du chemin,
et doit

mrga, car

le

chemin
2

est

semblable un radeau

ncessairement tre abandonn.

Le recueillement qui prend ces dix aspects

est tourn vers

le

passage au-del des choses qui sont anitya, duhkha, samudaya,

mrga

'

on

le

nomme

donc apranihita, exempt de pranidhna,


.

exempt de

volont vers

Au

contraire, le Nirvana, sous ses quatre aspects

objet de Yanideux derniers

mittasamdhi

ne

doit pas tre

abandonn

et les

aspects de la vrit de la douleur,

vide

et

non-moi

objets

du snyatsamdhi

ne provoquent pas

la terreur, car ces

deux

aspects appartiennent au Nirvana

comme aux samskrtas.


espces [18 a]
:

Ces

trois

samdhis sont de deux


4

25
1.

a.

Purs ou immaculs.

2.

anityaduhkhataddhetubhya udvegt. mrgasya kolopamatayvayatyjyatvt.


i.

Voir
desito

7 c-d
i.

(p. 12, n. 5).


:

135 ... evam eva kho bhikkhave kullpamo maya dhatnmo nittharanatthya no gahanatthya / kullpamam vo bhikkhave jnantehi dhamtn pi vo pahtabb pg eva adhamm. Vajracchedika, p. 23 ... na khalu punah subhte bodhisattvena mahsattvena dharma udgrahtavyo ndharmah j tasmd iyam tathgatena samdhya vg bhsit / kolopamam dharmaparyyam jnadbhir dharma eva prahtavyah prg evdharm iti. Bodhicaryavatara, ix. 33 adhigata upeye pascal kolopamatvd upyasypi

Majjhima,

prahnam.
thse

Comparer la bhisl (vrsl, radeau) de Suttanip&ta, 22 I hve passed over ... is no (further) use for a raft . Dans Samyutta, iv. 174-175, le magga est un radeau, mais il n'est pas dit qu'on
:

doive l'abandonner.

La Vajracchedikatlka (Tandjour, Mdo,


formule
: :

xvi. 237 b) cite le


....

Ratnakaranda, o

la

prg evdharmh, est complte kolopamam dharmaparyyam par les mots ye dharmh prahtavy na te dharma npy adharmh. Il faudrait examiner le sens de dharma et adharma dans les diverses sources.
3.
4.

dag dan

tadatikrambhimukhatvt. dri ba med de dag s= [suddhak amals

caite].

Voir

viii. 5.

Hiuan-tsang,
Ils

xxviii, fol. 17

b-18

a.

187

sont purs, suddhaka, ou immaculs, amala, c'est--dire an-

srava, suivant qu'ils sont mondains ou supramondains. Mondains,


ils

existent dans les onze terres

supramondains dans

les terres

existe le

Chemin.

'

25

b.

Immaculs,

ils

sont les trois


ils

vimoksamukhas.

Lorsqu'ils sont

ansrava,
,

reoivent le

nom

de

vimoksamukha,

porte de la dlivrance

parce qu'ils sont effectivement la

porte

dvra, du Nirvana ou moksa.

snyatvimoksamukha, nimittavimoksamukha, apranihitavimoksamukha.


a
:

On

25

c-d. Il
etc.
3

y a encore

trois autres

samdhis nomms snyatu-

nyat,

1. Exclure le Kamadhatu, du deuxime clhyna.

le

bhavgra, les smantakas

partir

du smantaka

dri med rnam thar sgo gsum mo. Patisambhidamagga, ii. 35: taijo me bhikkhave vimokkh sufinato vimokkho animitto vimokkho appanihito vimokkho ; ibid. ii. 67. Dhammasangani, 344,
2.

Atthasftlinl, 223,
90, 119, 126
;

Visuddhimagga, 658 (Compendium, 211, 216); Nettippakarana,

Milinda, 413.

Mahavyutpatti, 73, les trois Vimoksamukhas, snyat, ammittam, apranU hitam Madhyaniakavrtti, 246 trini vimoksamukhni snyatnimittpranihitkhyni vimuktaye vineyebhyo bhagavat nirdistni Madhyamak;
: ;

vatara, 319; Deva, Catuhsatikfi, p. 497; Bodhisattvabhimi,

I,

17, 14

(avec la

nirodhasampatti,
3.

les trois

ston nid stoii nid ces la

vimoksas constituent Vryavihra du Bouddha). sogs / gzhan yan tin ne hdzin gsum mo =: [silnyat//]

snyatetydy anyat samddhitrayam punah


D'aprs Ekottara, 26,
5.

La Vibhasa et Hiuan-tsang dans Kosa nomment ces samdhis des tch'ngsamdhis, des samdhis rpts , accumuls , puisqu'ils sont snya-

nya

....

La pense qui inspire

la thorie

de ces
brle

samdhis

est clairement explique par

Samghabhadra
corps, de

De mme qu'on
le

le

bois du bcher qui a d'abord brl le

(snyatsamdhi ) a brl les fmyatsamdhi pour obtenir dgotabandon l'endroit du premier vide (=: du premier snyatsamdhi) . La Vibhasa traite de ces samdhis, 105, 5 1. A quel moment les obtient-on ? D'aprs une opinion, dans le darsanamrga, quand on obtient l'abhisamayntika (vii. 21 a) d'aprs une autre opinion, dans le bhvanmrga, quand
lorsque

mme

recueillement du vide
le

kleas, l'ascte produit

nouveau

l'Arya dtach (virakta) obtient

le

nirmnacitta

(vii.

49c); d'aprs une troisime

188

CHAPITRE

VIII,

26.

Nomms snyatsnyatsamdhi,
objet

apranihitpranihitasam-

dhi, nimittnimittasamdhi, parce qu'ils ont respectivement pour

de la manire qu'on va expliquer

les

samdhis de

su-

nyat, apranihita, d'nimitta.

26

a-b.

Les deux premiers portent sur Yasaiksa sous


et

les aspects

de vide (nya)
Ils

d'impermanent (anitya).
le

'

ont pour objet

pectivement pour objet


raliss par

samdhi d'Asaiksa le sunyatsamdhi


viii.

c'est--dire

ils

ont res-

et

Yapranihitasamdhi

un Arhat

(voir

27

a).

Le snyatsnyatsamdhi considre
lequel considre les

le

sunyatsamdhi

antman)
vue de
vide.
3

dharmas comme vides et non-moi (nya, comme vide, non pas comme non-moi parce que la
-,

vue de non-moi ne provoque pas

la

mme

horreur (udvega) que la

opinion (opinion orthodoxe), au moment du ksayajiina (vi. 44 d), parce que ce moment, l'ascte cultive tous les bons dharmas impurs (ssrava) des trois sphres (vii. 26 c). 2. Les obtient-on sans effort? 3. Aprs quels jnnas? 4. Au moyen de quelles terres (viii. 27 b) ? 5. Avec quel raya (viii. 27 a) ? 6. Quels
;

kras
1.

prennent-ils ?
/

gnis ni ston dan mi rtag par

mi slob pahi

la

dmigs pa yin

= [dvayam
j

lambate 'aiksam] nyata cpy anityatah. 2. snykrena asaiksani nyatsamdhim lambate. 3. La Vyakhya, citant sans doute un S&stra ou la Vibhasa ha kim atra kranam yac chnyatsnyatsamadhih snyatakra eva na punar andtmkro 'pi nyatvad itij atrocyate / snyatakrapravrtlafmyatprstho:

tpadyatvt
notpattir

ha kim artham punah nyatkrapravrttanyatprsthcatrocyate na punar antmkrapravrttasnyatprstheneti


/ j
I

tadutpattyanuklyt

sa eva

snyatkrah snyatsamdhis tasya

snyatsnyatsamdher utpattv atmklyenvatisthate nntmkrah / na hy evam antmadarsanam udvejayati yath snyatdaranam / drstesu hy antmato bhavesv abhiratir asti samsre nyatdaranbhvt / tadyathdhvagasysambdhadhvadarsand api prtih j ekdkinas tu tacchnyatvd apritir iti j tadvat. Le snyatsnyatsamdhi succde au sunyatsamdhi qui a l'aspect nya, non pas celui qui a l'aspect antman. Snyat dgote plus que antmat on continue trouver plaisir dans les choses qu'on a reconnues antman, comme le voyageur voit avec plaisir un chemin peu frquent (asambdha; MS asambandha), mais, solitaire, a horreur du chemin parce que
:
:

celui-ci est vide.

Hiuan-tsang,

xxviii, fol.

18

a.

189

L'apranihitpranihitammdhi a pour
dhi de l'Asaiksa
aspects
:

objet Y apranihitasam-

lequel

samdhi

considre les choses sous dix


c)

anitya, duhkha,

etc. (viii.

24

en

le

considrant

comme

Il ne le considre pas comme duhkha, ni non plus comme hetu-samudaya-pratyaya-prabhava, car Yapranihitasam-

impermanent.

dhi, tant pur (ansrava), n'est pas douleur, n'est pas cause (hetu);

bien que Y apranihitasamdhi soit chemin (mrga), Y apranihit-

pranihita ne

le

considre pas non plus


le

comme mrga-nyya-pra-

tipad-nairynika, parce que

but poursuivi par l'ascte est de se


'

dgoter de Y apranihitasamdhi.

26

c-d.

Vnimittnimitta a pour objet Y asamkhyksaya


tda.
2

et le

considre

comme

C'est--dire Y nimittnimittasamdhi a pour objet

Yapratisam-

khynirodha
sapience

destruction qui n'est de Ynimittasamdhi \

pas acquise en raison de la


considre ce nirodha sous

et

dsanlyatvt Vyakhya so 'aiksasamdhir dsayitavya iti. mthsan ma med pa mthsan med ni / zhi bar ma brtags zad pa la Voir viii. 35 b-d. mittnimittas tu ntato] 'samkhyay ksayam. 3. Il y a deux nirodhas de Y nimittasamdhi a. anityatnirodha [ou svalaksananirodha ou svarasanirodha]
1.
:

2.

=
(i.

[<%ni-

20

a,

trad. p. 35,
h.

ii.

45

c)

la destruction

qui est la
i.

loi

de tout conditionn (samskrta).

apratisamkhynirodha
ici
il

(voir

c,

c-d,

ii.

55

d, p. 279).
il

Le mot nirodha

ne peut tre
naissent en
n'taient

lgitimement traduit par destruction, mais


s'agit
:

n'est pas impossible

de dire de quoi
lui,

lorsque l'Arhat sort de

Ynimittasamdhi, des penses

pures ou impures, qui ne sont plus de ce

samdhi ;

si

ces penses

pas nes, de nouveaux moments

d' nimittasamdhi

seraient ns.

Au moment o naissent ces autres penses, l'Arhat prend possession de Y apratinimittasamdhi qui, faute de samkhynirodha des nouveaux moments
dt

causes, ne natront pas.

Vyakhya katham tasya [nimittasamdher] apratisamkhynirodhah / aaiksd nimittt samdher vyutthitasya tadanantaram ye ssravh ksan atikrmanty anye vnsrav(s) yadi te notpannh syur aaiks nimittaksan utpannh syuh tesm ssravnm anyesm ansravnm votpattikle tesm asaiksnm nimittaksannm apratisamkhynirodho labhyate pratyayavaikalyt / tam apratisamkhynirodham lambate ntkrena. V nimittnimittasamdhi prend donc comme objet Y apratisamkhyniro:

190

chapitre vin, 26 c-27

b.

l'aspect de tranquille
quille
Il
.

nto 'yam

iti

Ce nirodha

est tran-

[18 b]

n'a pas pour objet le

pratisamkhynirodha

il

destruction

acquise en raison de la sapience

de Y nimittasamdhi, car ce

samdhi

est

pur (ansrava),
l

et

n'y a pas

pratisamkhynirodha
le

de ce qui est pur.

Et des quatre aspects sous lesquels on peut considrer

prati-

samkhynirodha, savoir
ta), excellent

destruction (nirodha), tranquille (n(vii.

(pranita), issue (nihsarana)

13

a),

l'aspect
le

tran-

quille est le seul qui

convienne
,

ici.

En
3

effet,

caractre de

nirodha,

destruction

appartient Yapratisamkhynirodha,
;

mais

il

appartient aussi Yanityatnirodha


n'est pas excellent (pranita), car

Yapratisamkhyniest non-dfini
il

rodha
krta)
1

il

(avy-

*; il

n'est pas issue

(nihsarana), car
3

n'est pas discon-

nexion

d'avec les passions (visamyoga).


car ce

dha de V nimittasamdhi,
tyarthikabhtatvt)
ce

nirodha

est

l'ennemi de ce

et l'ascte dsire se

dgoter

samdhi (tatpra(vidsanam ubhilasan) de


est le

samdhi.
1.

Comme

on a vu

i.

c.

Le pratisamkhynirodha

nirodha dont on

prend possession par une sorte de prajn

La VyakhyS explique tatsamyogavisamyogya yatante


:

nomm pratisamkhy. yad dhi pratikulam rynm apratiklatvt


/ /

visamyoga ca pratisamkhynirodhah.

i. 40 a (p. 79). Le [caractre ou aspect] nta indique seulement la cesYapratisamkhynirodha a donc le caractre sation (tch-si arrter-respirer) nta ; la pratique prolonge du Chemin (ryamrga) (qui culmine dans les fmyat, apranihita, nimittasamdhi) comporte fatigue, on produit donc

Les

dharmas
:

purs sont aheya,


:

% Samghabhadra

plaisir
3.

sukhalaksana)

l'endroit de sa cessation

Si l'ascte

considrait

Yapratisamkhynirodha de
il

Y nimittasamdhi

sous l'aspect de nirodha, destruction,


quille
,

ne

le

considrerait pas

comme

tran-

nta
il

il

le

considrerait sous un aspect qui le rend hassable, et par

consquent
4.

Comme

ne prendrait pas en dgot Y nimittasamdhi. on a vu iv. 9 d.

5. avisamyogc cpratisamkhynirodhasya na nihsurankrena tant lambate / samkleavi[sam]yogo hi samkleanihsaranam isyate tasmn npratisamkhynirodhena samsranihsaranam bhavati / tath hi saty apy apratisamkhynirodhe kesm cit kualkualnm dharmnm taih samfprajyukta eva tatprptyavicchedt. L'apratisamkhynirodha d'un certain klea n'est pas le visamyoga (ii. 55 d)

Hiuan-tsang,
Ces
trois
a.

xxviii, fol.

18

a-b.

191

samdhis sont exclusivement

'

27

Avec-sravas

Parce
dant

qu'ils hassent le

comme

vide, etc.].

Chemin [: ils lui tournent le dos en le regarOr tels ne sont pas les dharmas immaculs,

ansrava.
Par qui
sont-ils

pratiqus?
2

27
Ils

a.

Appartiennent aux hommes, l'Inbranlable.

ne sont pratiqus que par des hommes, de


;

trois

dvpas, non

pas par les dieux


(vi.

seulement par des Arhats de la classe akopya

56

a).

27

b.

l'exception de sept

smantakas.

Ces samdhis ont pour point d'appui onze


dhatu,
et

terres,

savoir Kama

angamya,

les

huit recueillements

principaux

(dhynas

drpyas, l'exclusion des recueillements

liminaires ) et le

dhydnntara.
Le Satra
dit qu'il
Il

y a quatre pratiques du recueillement (samdhi-

bhvan)

y a une pratique du recueillement qui pratique,

d'avec ce klesa. Supposons qu'un ascte prenne possession de Y apratisamkhynirodha de dharmas bons ou mauvais il reste li ces dharmas parce que la possession (prpti), que seule peut couper la possession du pratisamkhynirodha, n'est pas coupe. [Un bon exemple, Kosa, vi. 23 le possesseur de la ksnti obtient Y apratisamkhynirodha de klesas dont le pratisamkhynirodha ne peut tre atteint que par le darsanamrga].
: :

1.

zag bcas

= [ssravh].
iti
j

ryamrgadvesitvd mukhyt.
2.

katham

dvisati

nydibhir akrais tadvai-

mi nan mi gyo

la

= [nrsv akopyasya].
:

akopyadharman, en raison de ses facults aigus, a la force (smarthya) de les produire. Non pas les autres Arhats. La VyakhyS explique tebhyo drsladharmaukhavihratvd sangspadabhtebhyo 'aiksebhyah nyatdisamdhibhyo vaimukhyrtham aparasamdhn sampadyante.
Seul l'Arbat
3. fier

snogs bdun ni

ma

gtogs pa

= [saptasmantavarjith]

192
cultive, fortifie,

CHAPITRE

VIII,

27 c-28.

a pour rsultat
'

la possession des batitudes de ce

monde

, et le

reste.

27
tat la

c-28. Le premier dhyna, bon, est la pratique du recueillersultat la batitude


;

ment qui a pour


vue
;

l'Abhijna de l'il a pour rsul-

la

pratique du bon n de l'exercice a pour rsultat la


;

comprhension

le

recueillement Vajropama du quatrime


2

dhyna

a pour rsultat la destruction des vices.


1.

Sur samdhibhvan, ci-dessus,


cite le

p.

128

n.

Visiuldhi, 371.

La Vyakhya

Stra: asti

samdhibhvan
...

sevit bhvit bahulkrt

drsladharmasukhavihrya samvartate j asti divyacaksurabhijnjiinadaranya samvartate / asti .... prajiiprabhedya samvartate / asti sravaksayya samvartate. Sur la valeur de sevita, bhvita, bahulkrt, la Vyakhya dit sevit nisebahulkrt vipaksadrvit bhvanay j bhvit vipaksaprahnatay karanatay. Quand il s'agit des chemins de l'acte, iv. 85 a. Dgha, iii. 222, Anguttara, ii. 44 atth' vuso samdhibhvan bhvit nanadassanapatibahulikat ditthadhammasukhavihrya samvattati lbhya satisampajannya savnam khayya samvattati. Daus BodhisaUvabhDmi (I, 13, fol. 82 b), la thorie des trois sumdhibhvans
....
:

....

....

....

est modifie

katamo bodhisattvnm dhynasvabhvah bodhisattvapitakaravanacintprvakam yal laukikam lokottaram bodhisattvnm k'nalam taducittaikgryam cittasthitih amathapaksy va vipayanpaksy va bhayapaksy va ayant bodhisattvnm dhynasvabhvo veditavyah tatra katamad bodhisattvnm sarvadhynam tad dvividham laukikam lokottaram ca I tat punar yathyogam trividham veditavyam drstadharmasukhavihrya dhynam bodhisatlvusamdhigunanirhrya dhynam sattvrthakriyyai dhynam tatra yad bodhisattvnm sarvavikalppagatam kyikacaitasikaprarabdhijanakam paramaprantam manyanpagatam ansvditam sarvanimittpagatam dhynam idam esm drstadharmasukhavihrya veditavyam pratisamvidm aranpranidhijnndlnm gunnm rvaksdhrannm abhinirhrya samvartate idam bodhisattvasya dhynam samdhigunbhinirhrya veditavyam
tatra
j ....
j /

dge bahi bsam gtan dan po ni / hde hgyur tin dzin bsgom pa yin / mig gi sbyor ba las byun blo dbyer hgyur / rdo rje lta ses mthon hgyur hdod buhi bsam gtan mthahi / gan yin de zag zad hgyur sgom. prajiiprabhedya Le quatrime pda, dans la version de Paramartha samskrajh dans la version de Hiuan-tsang prajiiprabhedya pryogika2.

mnon

ubhabhvan.
La thorie de Harivarman, Nanjio,
de PAbhidharma.
1274, chap. 158, est trs diffrente de celle

Hiuan-tsang,
1.

xxviii, fol.

18 b-19

a.

193

Par

premier

dhyna bon

, il

faut entendre premier

dhyna
Il

pur (uddhaka) ou ansrava. Par ce dhyna, l'ascte obtient la

batitude de ce

des trois autres

monde (drstadharmasukhavihra) dhynas comme du premier.


le
le

en va

Ce recueillement n'a pas ncessairement pour


d'au-del
plus haut
:

rsultat la batitude
;

car l'ascte qui


;

possde peut en tomber

il

peut renatre
il

il

peut obtenir

Nirvana

dans ces

trois cas

ne jouit

pas de la batitude dans une vie venir.


2.

sition

La deuxime pratique du du jhna-darsana


2
.

recueillement a pour rsultat l'acqui-

1.

Sur

les

drstadharmasukhaviharas, Kosa,
que vihra

ii.

4,

vi.

42

c,

58

b,

65 b

(p.

278,

n. 3).

On

se rappelle
ii.

samdhiviesa
-

(ii.

p.

203, n. 5).

dpend de ['jritvndriya et suppose donc la qualit d'Arhat; elle consiste dans le fait d'prouver la satisfaction et le bien-tre de la dlivrance des passions (kleavimuktiprtisukhapratiD'aprs
4, p. 110,

la batitude d'ici-bas

samvedana)
du Nirvana

en d'autres termes, cette batitude est la jouissance (upabhoga)


6, p. 112).

(ii.

Du sukhavihra nous devons distinguer le sntavihra qui est la nirodhasampatti (ii. 43 b), laquelle est semblable au Nirvana (les nta vimoksa, viii. p. 140, Majjh. i. 472). Nous tenons de Samghabhadra (ci-dessus p. 150, n. 1) que le mot sukha ne signifie pas ncessairement sensation agrable mais le sukhavihra, tant pratisamvedana, est sensation . D'aprs la Vibhasa, les sukhavihras s'entendent seulement des quatre dhynas fondamentaux, purs (uddhaka) ou ansrava, non pas des terres liminaires (smantakas) ou des rpyas. Dans Buddhaghosa, les Arhats (comparer Majjhima, iii. 4) pratiquent les huit sampattis (quatre dhynas, quatre rpyas) pour passer agrablement la

journe avec la pense concentre

(ekaggacitt

sukham dioasam

vihariss-

ma), et la neuvime sampatti (samjnveditanirodha) pour passer agrablement sept jours dlivrs de la pense, ayant atteint dans ce monde le nirodha, le Nirvana ... sattham acittak hutv dittheva dhamme nirodham nibb:

nam patu sukham


2.

viharissma (Samantapasadika, i. 156). La Vyakhya explique la valeur de ces deux mots. Le jnna est un discernement (prajfi) associ la connaissance mentale (manovijnnasamprayukt) et qui comporte des vikalpas (ou jugements ) comme celui-ci Les tres, munis de mauvaises actions corporelles .... . Le darana, au contraire, est un discernement associ la connaissance visuelle, et comme tel exempt de vikalpa
:

(avikalpik prajn, voir i. 33 a-b, trad. p. Quelques rfrences sur jnnadarana

61).
:

13

194
*Jr
^

CHAPITRE

VIII,

27 C-28.

twf

eJL.

C'est la divyacaksurabhijii.
3^

'

JnUTnx

La

troisime pratique du recueillement a pour rsultat

le

prajn-

vj,
t

jLa-tt4

i.

Vue-connaissance d'ordre mondain.

x^.rJj^v^Aj><^.
/v^.,

a-

1_,

prsent, l'avenir (Trois derniers


n. 4)
;

Le Bouddha possde asanga apratihata jnnadarsana sur le pass, le venikas de MahSvyutpatti, 9, Kosa, vii. p. 66
ce

iinadassana

est atraka, Dgha,


les

iii.

134.

Le iinadassana a pour terrain


b. L'ascte obtient le

anciennes existences, Nettippakarana, 28.


(en ayant,

iinadassana par lokasaiinmanasikra


divsahii)
;

de jour et de nuit,

l'ide qu'il fait jour,

de

la sorte

sappabhsam

cittam bhveti, Dgha, iii. 223. c. Le Bodhisattva obtient le iinadassana aprs


les

la

samdhisampad, avant

jhnas, Majjhiina, i. 203. d. Le Bodhisattva, avant la Bodhi, purifie son iinadassana : il samjnti l'obhsa, mais ne voit pas les rpas ; ensuite il voit les rpas, sans toutefois avoir commerce avec les dieux, Anguttara, iv. 302. e. Le Niggantha affirme que allant, restant en place, endormi, veill, toujours
sans interruption
f.

le

nnadassana

m'est prsent

Anguttara,

i.

220,

iv.

428.

Le jnnadarana de Sakra porte en bas, Avadanaataka, i. 189. g. bodhisattvasya sarvavidysthnesv avyhatam pariuddham paryavadtam jiinadarsanam (Bodhisattvabhmi, I, xv, Muson 1906, 22 a) plus tard, en vertu de la vipayanpariuddhi, ce jnnadarana acquiert prthuvrddhivaipulyat. ii. Connaissance, savoir, satnbodha. a. Kosa, vi. 75 b, iina dassana ; Majjhima, i. 173 iinam nesam dassa;

nam udapdi akupp no


:

vimutti
100).

Mahavyutpatti, 81,
le

'sntti
4, 5, b.
c.

jiinadaranam bhavati; c'est


vi. p.

vimuktasya vimukto vimuktipnadars'anaskandha (ibid.


9
:

Kosa,
Kosa,

295,

vii. p.

vi.

54,

darsana
51
:

caksus, jina,

vidy, buddhi.

Mahavyutpatti, 245,
Anguttara,
ii.

d.

200

samyak pratytmam jnnadaranam pravartate. abhabb te nnadassanya anuttarya abhisam-

bodhya.
L'abhijii de l'il divin a pour rsultat le jnnaLa pratique du recueillement de i'abhijii de l'il divin a pour rsultat ]e jnnadarana ? La Vyakhya explique ha I divyacaksurabhijii jnnadaranya samvartata ity uktam na ca divyacaksurabliijnsamdhibhvan / atrocyatej ayant phale hetpacrah / yasya hetoh samdhibhvany divyacaksurabhijii phulam tatra phale hetpacrah / jiinadaranya samdhibhvaneti / yesm punar ayant paksah sadvidh muktimrgadhr (vii. 42) iti dhynasamgrhlt eva mnas vimuktimrgh sad abhijii iti tesm acodyam evaitat tesm vimuktimrgnm samhitatvt j prvaka eva tu pakso 'bhidharmakoacintaknm

1.

Pourquoi
,

le texte dit-il

darana

et

non pas

ity

avagantavyam

divyacaksuhrotravijiinayor abhijiitvenbhstatvt.

Hiuan-tsang,

xxviii, fol.

19 a-xxix,

fol. 1 a.

195

prabheda

',

[c'est--dire attirer des


].

formes excellentes de connaisdes qualits sup-

sance spculative

C'est la

samdhibhvan

rieures qui naissent de l'exercice, c'est--dire qualits des trois sphres


et qualits

pures (ansrava)

2
.

Le samdhi qui produit ces qualits


de ces qualits.
se produit
3

est

nomm samdhibhvan
Dans
le

4.

quatrime

dhyna

un recueillement qu'on

nomme

pratique du Vajropama. Ce recueillement dtruit tous les

vices (srava).

D'aprs l'Ecole, Bhagavat, en exposant cette quadruple pratique

du recueillement, expose sa propre pratique.


Parce que lui-mme
raliser le
s'est
(vi.

plac dans le
b) qui,

Comment cela? quatrime dhyna pour


on a vu, peut tre ralis

Vajropama

44

comme
;

dans d'autres tats de recueillement.

[xxix]
;

Nous avons
(guna) que

expliqu

le

recueillement

expliquons les qualits


le

l'ascte ralise en

s'appuyant sur

recueillement.

1. prajnprabhedyeti prajiviseskarsya ( Vyakhya) [ vaisesikagunbhinirhrya, Kosa, vi, p. 278, n. 3J. [Comparer l'expression iddhippabheda,

vii.

trad. 98],

2. Les dharmas ou gunas, qualits , des trois sphres sont aubh, npnasmrti, aran (vii. 36), pranidhijnna (vii. 37), pratisamvid, abhijn, vimoksa (viii. 32), abhibhvyatana, etc. Les qualits pures sont vimoksamukha (viii. 25), vyutkrntakasampatti (viii. 18 c), sravaksaybhijn, etc. 3. Vyfikhya traidhtuk ansrava iti traidhtuk asubh .... / atra tu
:

samdhisamprayogt pryogiknm gunnm samdhibhvanety


rah.
:

tipac-

4. Bhasya tmopanyik (= tmano desik) kilais bhagavato dharmadean. Vyakhya bodhisattvo hi karmntapratyaveksanya niskrnto jambumle prathamam dhynam utpditavn (voir Koa, iii. 41) / bodhimle ca devaputramram bhanklv prathame yme divyam caksur utpditavn tena divyena caksus sattvn cyutyupapattisamkatasthn abhivlksya tatparitrnya madhyame yme dhynavimoksasampatth sammukhkrtavn / te 'sya pryogikagunh prajiprabhedya jyante \ tatas trtlye
:

yme caturtham dhynam niritya niymam (vi. 26 a) avakramya yvad vajropamena samdhin sarvayojanaprahnam krtavn (Comparer Majjhima,
5.
i.

22).

Sur

la
14.

conqute de la Bodhi par

le

Bodhisattva,

vii. p.

80.

Vibhasa, 81,

Pourquoi expliquer
les et les

les

immesurables
s'attirent

immdiatement
les

aprs les
surables
;

dhynas

Parce que

dhynas

attirent

ou produisent

imme;

parce que les

dhynas

immesurables

rciproquement

parce que les immesurables sont les meilleures qualits parmi [celles que produisent] les

dhynas

196

chapitre vin, 29-30


a.

a.

29

Quatre Apramanas ou Immesurables.

[1 b]

Bienveillance, maitr, piti, karun, joie, mudit, indiffrence,

upeks.

On
fruit

les

nomme Apramanas
),

parce qu'ils s'appliquent un

nombre
rable
(

d'tres

immesurable, tirent leur suite un mrite immesuproduisent des fruits [de rtribution]

d'coulement
2

immesurables.

29

b.

Parce qu'ils s'opposent


qui,

l'hostilit, etc.

Quatre Apramanas

dans

l'ordre, s'opposent

l'hostilit,

vy-

pda,
que

la nuisance,
et

vihims,

la dissatisfaction, arati,
et

l'attache-

ment sensuel
fait

l'hostilit,

kmarga

vypda. La bienveillance
abandonnent
l'hostilit, et

les

hommes adonns
*

l'hostilit

ainsi de suite.

1.

thsad

med pa
iii.

ni bzhi yin

69

Dgha,

223, catasso

no == [apramnni catvri]. Mahavyutpatti, appamannyo. Drgha, 8, 14, Ekottara, 21, 14,

Madhyaraa, 21, 10. Ce sont les quatre brahmavihras. Visuddhimagga, 295, Atthasalin, 192, Itivuttaka, 15, BodhisattvabhOmi, Muson, 1911, p. 177, Yogastras, i. 33; pratiqus par un Rajarsipravrajita, Divya, 122. Considrs par plusieurs sectes comme membres de la Bodhi (Bbavya), Koia, figurent dans l'expos du Chemin, Anguttara, i. 38, entre les dhynas vi. p. 281
;

et les

smrtyupasthnas. Sur maitr et aran, Kosa,

vii.

36

formule de la maitr,

iv.

124

diffrence

entre

karun

et

mahkarun,
bons
et

vii.

37.

Samghabhadra observe
Pourquoi
etc.
;

sont-ils

ici que les Immesurables ne font pas de bien autrui. non pas non-dfinis? Parce qu'ils contrecarrent l'hostilit,

parce qu'ils assurent la pense la matrise d'elle-mme.


les miracles
;

Sur
v. 6,
1

que

ralise

un maitrsampanna, Divya,

186,

2,

Cullavagga,

Dgha,

ii.

238, etc.

2.

Paramfirtha omet la seconde raison.

(ii.

P'ou-kouang
56)

fruit

de rtribution et

fruit

d'coulement

Parce que produisant non mesurables. Trois raisons


:

dans Fa-pao.
3.

gnod sems
:

la

sogs gnen pohi phyir

= [vypddivipaksatah]

Vyakhya advesasvabhvatvn maitr vypadapratipaksah j duhkhpanayankratvc ca karun duhkhopasamJirkry vihimsyh pratipakso bhavati / mudit crateh pratipaksah saumanasyarpatvt / upeks ca mdhyasthyt kmargavypdayoh pratipaksa iti (apaksaptitve npy anunto npi pratihata iti). v. 47, p. 90, n. 2. 4. vypdabahulnm tatprahnya maitr.

Hiuan-tsang, xxix,

fol. 1 a-b.

197

On
vi.

a vu que la

mditation de l'horrible

(aubhabhvan,
;

c)

s'oppose l'attachement sensuel

(kmarga)

nous appre-

nons

ici

que l'indiffrence (upeks)

s'y

oppose aussi. Quelle est la

diffrence de l'opposition de la mditation de l'horrible et de l'indiff-

rence ?

D'aprs la Vibhasa (83,

3),

il

y a lieu de distinguer, dans

l'attachement sensuel, l'attachement aux visibles (varna) du

Kama-

dhatu
gible).

et

l'attachement sexuel (qui est attachement un certain tanla mditation de l'horrible s'oppose

Or

au premier de ces deux


1

attachements, tandis que l'indiffrence s'oppose au second

Disons

plutt que la mditation de l'horrible s'oppose l'attachement sexuel,

car cette mditation expulse tout dsir relatif couleur, figure, aspect,
contact,

dmarche

tandis que l'indiffrence s'oppose l'attachement


fils

qui a pour objet les pre, mre,

et parents.

Que

sont, de leur nature, les


a.
;

Apramanas

?
et aussi la piti

29 c-30
tion, la joie

Non-haine, la bienveillance
2

satisfac-

non-dsir, l'indiffrence.

La

bienveillance,

comme

aussi la piti, est de sa nature la racine


;

de bien

nomme
ii.

non-haine, advesa

la joie, c'est
la

la

satisfaction

(saumanasya,
Mais

8 a) qu'on prouve de

satisfaction

d'autrui

l'indiffrence est la racine de bien


si l'indiffrence est

nomme

non-dsir, alobha.
peut-elle contrecarrer
:

non-dsir,

comment

l'hostilit
tilit

(vypda)

? Les Vaibhasikas rpondent


le dsir

parce que l'hos-

est

provoque par

(lobha). Disons plutt que l'indiff3

rence est la fois non-dsir et non-haine.

Quels sont

les aspects des

Apramanas
Vasubh
et

?
Y upeks contrecarrent, dans

1.

Samghabhadra

dit le contraire

l'ordre, le dsir sexuel et les autres dsirs.

Sur l'attachement aux visibles , ci-dessous viii. 32 a. zhe sdan med byams snin rje yan [maitry advesah karund ca] yid bde ba ni dgah ba yin [mudit sumanaskat //] btan snoms ma chags =x [upekslobhah] 3. Nous ne voulons pas dire qu'un dharma unique, Vupeks, possderait deux
2.

natures

nous voulons dire que

le

mot upeks dsigne

la fois le non-dsir et la

non-haine.

198

CHAPITRE
c.

VIII,

30-31

b.

30 a-30
tres
!

Leurs aspects sont

Heureux

Malheureux

Rjouis

<

Les tres heureux (sukhita) sont


cte produit leur endroit
les tres
!

l'objet

de la bienveillance. L'as:

une pense de l'aspect suivant


dans la

Heureux

[2 a] et, par l, entre

mditation de bienveil-

lance

maitrbhvan.
l'objet de la piti.
!

Les tres malheureux (duhkhita) sont


endroit l'ascte pense
:

leur

Malheureux
,

les tres

et,

par

l,

entre

dans la

mditation de piti

karunbhvan.
l'objet
*

Les tres rjouis (mudita) sont


l'ascte

de la
l,

joie.

leur endroit

pense

Rjouis les tres

et,

par

entre dans la

mdi-

tation de joie

muditdbhvan.

Les

tres, considrs

comme
:

tres tout court et sans faire de dis-

tinction, sont l'objet de l'indiffrence.

A
!

leur endroit l'ascte produit

une pense de

l'aspect suivant

tres

tres

et,

par

l,

au moyen
s
,

de ce qu'on peut

nommer

impartialit
,

(mdhyasthya)

il

entre

dans la

mditation d'indiffrence

upeksdbhdvan.

Cependant, considrer
pas
le

comme heureux les tres qui ne possdent bonheur (atadvatm sukham astiti), cette vue volontaire
6

(adhimoksa)
(viparta).

non conforme aux


Non
;
;

faits

est errone, de

mprise
:

elle n'est
!

pas errone
:

1.

lorsque l'ascte pense


!

Heureux

les tres
2.

, le

sens est

Qu'ils soient heureux

(santv

ity

abhipryt)

il

n'y a pas mprise dans son intention (saya3. l'ascte sait

sya avipartatvt), car


1.

bien qu'il conoit une

vue

rnam pa

ni

kye

ma

bder gyur sdug bsnal dan


/

dgar gyur sems can rnams

2.

= [krah sukhita vata duhkhith mudith sattvd Qu'ils soient sukhita vata sattvh. Le sens est
:

heureux !

La

maitrbhvan analyse comme punyakriyvastu,


iv.

iv.

112 c; son efficacit,

121 b
3.

ci-dessus

p.

196

n. 1.

duhkhita vata sattvh.


!

L'intention est

Puissent-ils tre dlivrs de

la souffrance
4.

>

Comparer Yanumodan du Grand Vhicule (Bodhicaryavatara, troisime


L'absence de sympathie (anunaya) et d'antipathie (pratighta).
la

chapitre).
5.

Sur
6.

samskropeks,
ii.

iii.

35

d.
vi. 9, viii.

Voir

72, trad. p. 325,

Vadhimuktimanasikra ;

32, 34, 35.

Hiuan-tsang, xxix,
volontaire

fol. 1

b-2 b.

199

se mprendrait, quel

(adhimuktisamj flnt). Et quand bien mme l'ascte mal cela? Direz-vous que les Apramanas sont
qu'ils

mauvais (akusala) parce


sont pas

prennent

les tres

comme

ils

ne

'

Mais

ils

sont les racines de bien


la haine, etc.

mme (kusalamla)

puisqu'ils s'opposent

Les Apramanas ont pour objet


prcisment

les tres vivants (sattva)

plus

30
En

d. Ils

ont pour domaine les tres vivants du

Kama.

effet ils

s'opposent la haine qui vise ces tres.


le

Cependant, d'aprs

Stra

3
,

l'ascte produit la

pense de bien-

veillance l'endroit d'une rgion cardinale, l'endroit de deux rgions

cardinales

....

Expliquons que
a en vue

le

Stra parle du rceptacle (bhtrouvent dans


le rceptacle

jana), mais

qu'il

les tres qui se

(bhjanagata).

Sur quelles

terres

prend point d'appui l'ascte quand

il

produit les

Apramanas

?
joie

31

a-b.

La

dans deux dhynas


*

les autres

dans six terres

ou, d'aprs quelques-uns, dans cinq.

On

cultive la joie

(mudit) dans

les

deux premiers dhynas seuleet la satisfaction

ment, car la joie est satisfaction (saumanasya)

manque dans

les autres

dhynas.

[2 b]
:

Les autres Apramanas dans six terres


tara, les quatre

Y angamya,

le

dhynn-

dhynas. Toutefois, d'aprs d'autres matres, dans

cinq terres seulement en exceptant Y angamya. D'aprs d'autres


1. akusalatvam iti vipartagrahanatah j na kusalamlatvt j naitad evam kasmt kusalamlatvt / katham punar kusalamlatvam ity ha
/

vypddipratipaksatvt. 2. spyod yul hdod pahi sems can mains


3.
4.

= kmasattvs tu gocarah

//

Dlgha,

i.

250,

iii.

223, etc.

dgah ba bsam gtan gnis na yod [dhynayor mudit] gzhan ni drug na [anyni satke] kha cig lna [ke cit tu pancasu /]

200

chapitre vin, 31

a-c.

matres encore, dans dix terres en ajoutant aux six


les

le

Kamadhatu
chiffre

et

trois

smantakas

des

suivant qu'on attribue les

dhynas suprieurs. Le Apramanas l'tat de non

varie

recueillement

(Kamadhatu) comme
toires

l'tat

de recueillement, aux stades prpara-

(smantaka) comme aux dhynas principaux.


dit

Nous avons
sions (klesa) au

que

les

Apramanas contrecarrent (pratipaksa) Apramanas ?


les

la

haine, etc. Est-ce dire que l'on puisse abandonner (prah) les pas-

moyen

des

31c. Pas d'abandon par

Apramanas.

'

Car les Apramanas ont pour terre, ou lieu de leur production, les dhynas fondamentaux (mauladhynabhmikatvt) car ils comportent un jugement (manasikra) arbitraire ou volontaire
;

(adhimukti
kra)
;

ii.

72),

non pas un jugement exact (tattvamanasi-

car

ils

ont pour objet les tres vivants (sattva), non pas les

caractres gnraux des choses


trad. 325).

(dharmasmnyalaksanas,

ii.

72,

Cependant

les

Apramanas, envisags dans


(drikarana)
que

leur stade prparatoire


etc.
;

(prayoga), branlent (viskambh) la haine,


cartent, rendent distante

les

Apramanas
abandon

la haine dj
les

ne

c'est

pourquoi on a

dit ci-dessus
etc.

Apramanas
etc.,

contre-

carrent

(pratipaksa) la haine,

Plus clairement \ Les bienveillance,


1.

piti,

cultives dans le

de yis mi spoh sa [na taih


:

prahnam]
:

Comprenons maulasuddhakadhynabhmikatvt Ont pour terre les dhynas fondamentaux de la catgorie suddhaka ou pure (viii. 5). Les recueillements liminaires (smantaka), purs, procurent l'abandon mondain des passions, non pas les recueillements fondamentaux (viii. 21 c). 3. vypddayah kleopakle drkriyante j aias tatpratipaksatvam uktam j kmadhtubhmikny angatnyabhmikni ca maitrydini trlni maulpramnasadrni vidyanfe j prayoglambankrasvabhvasdrsyt / ... tair apramnais tribhih klesn viskambhya prahnamrgair
2.

nantaryamrgaih prajahti. Vibhasa, 82, 2. Les apramanas

Non. font-ils abandonner les passions ? L'abandon (prahna) des passions est de deux espces, abandon temporaire, abandon dfinitif. Considrant le premier abandon, le Stra dit que les apram*

Hiuan-tsang, xxix,

fol.

2 b-3

a.

201
(iv. p.

Kamadhatu

et

Yangamya (viii. 22 c)

stade prliminaire
piti, etc.,

251)

sont semblables aux bienveillance,


damentaux

de l'ordre du recueilles

lement (bhvanmaya) qui seront cultives dans

dhynas

fon-

stade de

l'Apramana proprement
piti,
etc.,

dit.

Aprs

avoir,

au

moyen de
haine,
etc.,

ces bienveillance,
l'ascte produit,

prliminaires,

branl la

dans

le

recueillement

angamya, un
Les passions

chemin d'abandon (prahnamrga)


lance, piti, etc.

le

indpendant des bienveilles passions.

par lequel
le

il

abandonne

une

fois

abandonnes, l'ascte obtient

dtachement (vairgya) du

Kamadhatu, entre dans


druple

Apramana

de la

dhyna fondamental, obtient donc le quaterre du dhyna fondamental [3 a]. Les


'pi), est

passions se trouvent par l cartes, distantes, et l'ascte, rencontrtil

des causes puissantes de passion (balavatpratyayalbhe

dsormais invincible (andhrsya).

Comment
Il

le

dbutant (dikrmika)

cultive-t-il la bienveillance ?
;

se souvient du bonheur qu'il a lui-mme prouv

il

entend

parler de la flicit prouve par autrui, par les Bouddhas, les Bodhisattvas, les Sravakas, les Pratyekabuddhas.
les tres
Il

forme

le

vu que

tous

obtiennent cette

flicit.

Quand

la passion est trop violente, l'ascte n'est


:

pas capable de
les

convoyer ainsi sa pense en galit


trois catgories, amis, indiffrents,

il

doit

donc diviser

tres en

ennemis. La premire

catgorie
;

se divise aussi en trois

grands amis, amis moyens, petits amis

de

mme
nas

la troisime

tandis que la catgorie des indiffrents ne comle

font

abandonner
2.

considrant

second,

le

Sam&dhiskandha

dit qu'ils

ne font

pas abandonner.
Vibb&sfi, 172,

Pourquoi

les

apramnas
:

ne font-ils pas abandonner les


;

passions?
les

Pour les raisons suivantes


:

1.

cause de la diversit de leurs aspects

seize aspects coupent les passions


2.

les quatre aspects des

apramnas

diffrent

apramnas
les

sont
;

coupe

passions

3.

les

adhimuktimanasikra ; seul le tattvamanasikra apramnas sont anugrahamanasikra (tsng ,


:

ajouter-augmenter), acte d'attention de bienfaisance


les actes d'attention qui n'ont
le

seuls coupent les passions

pas ce caractre

4. les

apramnas
:

ont pour objet

prsent

seul coupe les passions le


5. le

ou Yasamskrta;
sont obtenus au

chemin qui a pour objet seul nantaryamrga coupe les passions

les trois les

poques

apramnas

moment du vimuktimrga.

202

chapitre vin, 31 c-32


soit,

a.

porte pas de subdivisions

dans l'ensemble, sept groupes. Cette

division tant acquise, l'ascte forme d'abord le


l'gard des grands amis
petits amis. L'ascte
'

vu

de bonheur
et des

ensuite l'gard des amis

moyens

en arrive ne plus distinguer


le

les trois catgories et des

d'amis

il

forme alors

mme vu

l'gard des indiffrents


il

ennemis. Par la force de l'entranement,

produit, l'gard des plus

grands ennemis,
amis.

le

mme vu

de bonheur qu' l'gard des plus chers

Lorsque

cette mditation

ou culture du vu de bonheur, septuple


progressivement [3
b] le

et gal, est assure, l'ascte largit

domaine
dans

de ce vu, embrassant la

ville, le

pays, une direction cardinale, tout

l'univers. Lorsque, sans exception, tous les trs sont englobs

la pense infinie de bienveillance, la mditation de bienveillance est

acheve.

Ceux qui ont


et

plaisir

dans

les qualits d'autrui

cultivent aisment
plaisir

rapidement la bienveillance, non pas ceux qui ont

dcou-

vrir les dfauts d'autrui.

Car

les

hommes mmes
eux-mmes
3
:

qui ont coup les

racines du bien

(iv.

79) ne sont pas sans qualits, et on peut trouver


les

des dfauts chez les Pratyekabuddhas

consquences

des anciennes bonnes actions des premiers, et des mauvaises actions

des seconds, sont visibles dans leur corps,


Il

etc.

faut entendre de

mme

la mditation

ou culture de

la piti et
:

de

On voit les tres tomber dans l'ocan des souffrances on forme le vu (adhimucyate) Puissent-ils tre dlivrs de la soufla joie.
:

france

Puissent-ils tre dans la joie


piti et

De

la sorte

on s'exerce

(prayujyate) la

la

joie.

Celui qui cultive l'indiffrence prendra pour point de dpart la

1.

paramamitre

2. 3. 4.

sukar maiirl spharatiti. gunagrahin, dosagrahin.

prvapunypunyaphalasamdarsant. apy eva duhkhd vimucyerann ity adhimucyamnah karunyam prayujyate j apy evbhipramoderann ity adhimucyamno muditym
prayujyate.

Hiuan-tsang ajoute
le

On

a l'ide qu'ils sont dlivrs de la peine et obtiennent

bonheur

Hiuan-tsang, xxix,
catgorie

fol.

3 a-4

a.

203

des

indiffrents,
:

car l'aspect (kra) de


!

l'indiffrence,

comme on
Dans

a vu, est

Etres, Etres

'

quelle destine cultive-t-on les

Apramanas
2

31
Les

c-d.

On

les produit

parmi

les

hommes.

hommes

seuls peuvent cultiver les

Apramanas

et

non pas

les

tres des autres destines.

Lorsqu'un
t-il

homme

possde (samanvgaia) un
les autres ?

Apramana possdepossde pas tous

ncessairement tous

Il

ne

les

ncessairement.

31

d.

Ncessairement muni de

trois.

L'homme
possder la

qui produit le troisime


joie,

puisque la

dhyna ou le quatrime, ne peut satisfaction manque dans ces dhynas.


trois.

Lorsqu'on possde un Apramana, on en possde toujours

Quels sont

les

Vimoksas ?

[4 a]
huit.
4

32
1.

a.

Les Vimoksas sont au nombre de

Hiuan-tsang ajoute

Des

indiffrents

on passe aux autres catgories


la

jusqu'au

moment o on
.
/

a,

pour

les plus

grands amis,

mme

pense que pour

les indiffrents
2. 3. 4.

mi dag
ns

gi

nah du skyed

do.

gsum rnam par

ldan.

thar brgyad

= [vimoks astau]
:

Rfrences de Saeki Kiokuga

Madhyama,

24,

14,

42,

14,

Dlrgha,

10, 18, 9, 12,


, 1,

Prakaranapada,
Nanjio 1274,
Dgha,
ii.

8, 12,

Vibhfisa, 65, 17; Nanjio 1287,


,
;

Samyuktahrdaya
i.

10;

Satyasiddhi

15, 10;

Amrtasastra, Nanjio 1278,


;

9.

70 (Lotus, 824
ii.

Dialogues

O. Franke, 212), Atthasalin, 190, Pati(sept).


;

sambhidamagga,

38,

Dhammasangani, 248

Mahavyutpatti, 70 (d'aprs Samgtiparyaya, Nanjio, 1276) Chavannes, Religieux minents, p. 164, compare la Mahavyutpatti et le Dictionnaire numrique.

Vimoksas,

le svabhva (nature) des Vsraya (les personnes qui les produisent), l'kra (aspect), Vlatnbana (objet), le smrtyupasthna (en quelle * application de la mmoire ils consistent), le lbha (mode d'acquisition), etc.

Vasubandhu
la

suit Vibhasa, 84,


(l'tage

8,

o sont expliqus

bhmi

o on

les produit),

204
D'aprs
le

chapitre vin, 32
Sutra
'

a-b.

1.

rpi rpni payati

2
;

c'est le

premier

1.

Texte de

la

Vyakhya

a.

rp rpni pasyati.

b.
c.

adhytmam arpasamjn bahirdh rpni pasyati. subham vimoksam kyena skstkrtvopasampadya viharati.
sarvaso rpasamjfinm samatikramt pratighasamjnnm astam-

d.

gamn nntvasamjnnm amanasikrd anantam ksam anantam


kam ity knantyyatanam upasampadya viharati tad yath dev knantyyatanopagh. e. punar aparam sarvasa knantyyatanam samatikramy anantam vijnnam anantam vijnnam iti vijnnnantyyatanam upasampadya viharati tadyath dev vijnnnantyyatanopagh. f. punar aparam sarvao vijnnnantyyatanam samatikramya nsti kim cid ity kincanyyatanam upasampadya viharati tadyath dev kincanyyatanopagh. g. punar aparam sarvasa kiiicanyyatanam samatikramya naivasamjtinsamjnyatanam upasampadya viharati tadyath dev naivasamjnnsamjnyatanopagh. h. punar aparam sarvaso naivasamjnnsamjnyatanam samatikramya samjnveditanirodham kyena skstkrtvopasampadya viharaty ayam astamo vimoksa iti.
2.
Il

est difficile d'interprter cette formule.


la

a.

Les sources plies lisent rp rpni passati ;

Vyakhya commente rp
:

rpnti svtmani rpni vibhvya bahir api rpni pasyati. Paramartha, Hiuan-tsang, une des versions de Mahavyutpatti, 70, et encore Harivarman (Nanjio, 1274), lisent adhytmam rpasamjni bahirdh rpni

payati
b.

(ce qui est la

formule des Abhibhvayatanas,

viii. 35).
ii.

L'exgse de l'Abhidhamma est dveloppe Patisainbhid,

38 et ailleurs

l'ascte considre le
le

rpa

(bleu, nla, etc.) interne et externe (premier Viinokkha),

rpa externe seulement (deuxime Vimokkha). Il parait probable que le Kosa l'entend de mme. c. Quel est le sens de l'expression rpni vibhvya (Vyakhya cite ci-dessus D'aprs Atthasalini, 163 Dans les expressions rpam saniiam vibha) ? vehi, le mot vibhvan signifie antaradhpana, faire disparatre . Ci-dessus, qui a fait disparatre la notion du rpa. Kosa, viii. 3 a, vibhtarpasamjiia expulser, briser . Premier Vimoksa Harivarman traduit vibhvan adhytmam rpasamjni bahirdh rpni payati [= Il prend notion du rpa interne (du corps) comme horrible (asubha), et continue voir le rpa externe]: L'ascte, par ce Vimoksa, brise-fend (p'ouo-li) le rpa. Comment savons-nous cela? Parce que, dans le deuxime Vimoksa, il est dit adhytmam arpasamjn bahirdh rpni payati. L'ascte est qualifi adhytmam arpasamjn, parce qu'il a bris le rpa interne. Par l nous savons que l'ascte, dans le premier Vimoksa, progressivement (tsin) limine (hoai) le rpa du corps de telle sorte

= =

Hiuan-tsang, xxix,

fol.

a-b.

205
il

Vimoksa

2.

n'ayant pas la notion des visibles intrieurs,

voit les

visibles extrieurs, c'est le

deuxime Vimoksa

3. se
il

rendant prsent

(ci-dessous p.

210
;

n. 3)
le

recueillement

c'est

Vimoksa agrable, troisime Vimoksa .


le

demeure dans ce

Les

Vimoksas 4-7
etc.)
;

sont les quatre recueillements d'rpya (ksnantyyatana,


le

huitime Vimoksa est la samjmiveditanirodhasampaUi.

32

a-b.
'

Les deux premiers sont mditation de l'horrible

dans deux

dhynas.

Les deux premiers Vimoksas sont, de leur nature, aubhabhvan


(vi. 9),

car

ils

ont pour aspect (kra) l'ide de cadavre bleuissant,


le

etc.

(vinlakdisamjn) [L'ascte considre

visible interne

ou

externe, son corps ou les corps extrieurs, sous les aspects de vint-

laka,

etc.]

Par

consquent

les rgles les

(naya) qui concernent

les

deux premiers Vimoksas sont


Ils

sont cultivs dans les deux premiers


ils

mmes que pour l'Asubha. [4 b] dhynas seulement


ils

quand

sont pratiqus dans

le

premier dhyna,

contrecarrent
il

que, dans le deuxime Vimoksa, le


le

rpa

interne tant limin,


le

n'y a plus

que

rpa externe

[qu'il voie].

Dans
il

le

troisime Vimoksa,

rpa externe

aussi

tant limin, l'ascte ne voit plus le

rpa
dans

interne et externe. C'est ce qu'on


le
il

nomme rpasnya, comme


notion de rpa,
il

est dit

Parayana
ne voit pas
:

Eliminant-fendant

la

abandonne-dtruit

le dsir;

tman

intrieurement,

extrieurement

kyappahyino
cti
1.

(Le chinois

Comparer SuttanipSta, 1113 vibhtarpasannissa sabbalit kma) ajjhattam ca bahiddh ca n'atthi kim

passato.

mi sdug bsam gtan gnis na yod. Karika Les Vimoksas sont de huit espces. Les trois premiers sont non-dsir (alobhaj ; deux dans deux recueillements un dans un recueillement .... Bhasya ... Les deux premiers sont, de leur nature, non-dsir parce qu'ils contrecarrent le dsir. Le Stra (Madhyama, 24, 5) dfinit le Vimoksa en disant que l'ascte voit (pasyati) : [il ne veut pas dire que le Vimoksa soit vision il s'exprime ainsi] parce que la vision accrot le Vimoksa. Hiuan-tsang met dans le texte de Vasubandhu la dfinition de Vibhasa, 84, 8 [o il est not que le huitime Vimoksa est cittaviprayuktasamskraskandha]. 2. L'opposition dont il s'agit est drbhvapratipaksa opposition qui a pour effet de rendre loign (v. 61, p. 104), car, du fait mme que l'ascte entre dans le premier dhyna, l'attachement la couleur du Kamadhatu est dj abandonn (prahna : au moyen d'un prahnapratipaksa ralis dans Yangamya, viii.
/

dan po guis

Hiuan-tsang

diffre.

p. 201,

1.

6).

206

chapitre vin, 32 c-33

b.

l'attachement la couleur (varnarga) du

Kamadhatu

pratiqus

dans

le

deuxime dhyna,

ils

contrecarrent l'attachement la coun'y a pas, dans le deuxime

leur du premier

dhyna.

[Il

dhyna,
le

d'attachement la couleur qui devrait tre contrecarr dans


troisime

dhyna,

viii. p.

151, 163]
le

32

c.

Le troisime dans

dernier

dhyna

; il

est non-dsir.
le

'

Le troisime Vimoksa ne peut

tre pratiqu

que dans

quatrime

dhyna. De sa
sidre

nature,
;

il

est la racine de bien alobha,


il

non pas mdiqu'il

tation de l'horrible

en

effet,

prend pour objet une chose


:

con-

comme
trois

agrable, bonne

il

a l'aspect ubha.
qui leur sont associs, sont
:

Ces

Vimoksas, avec

les

dharmas

de leur nature les cinq skandhas. Quant aux Vimoksas d'rpya

32

d.

rpyas bons

et

de l'ordre du recueillement.
les

Les Vimoksas 3-7 sont


dire

quatre rpyas bons (ubha), c'est-(viii. 5),

purs

(uddhaka) ou ansrava

et

de recueillement
la fin

(samhita)
[viii.

non pas Yrpya qui se produit

de la vie

16

c,

171 notes].
rtri

D'aprs d'autres matres, les pense-et-mentaux produits par


bution

chez les tres

ns dans l'mpyadhatu

sont aussi

non

recueillis .

On donne

aussi le

nom

de Vimoksa aux chemins-de-dlivrance

(vimukUmrga)

des stades liminaires des recueillements d'ArOpya


viii.

(rpyasmantakasampatli,
don (nantaryamrga) des
pour objet la

22);

non pas aux chemins d'aban:

dits stades liminaires

car ceux-ci ont

terre infrieure qu'ils font

abandonner
le

et les

Vimoksas

reoivent leur

nom du

fait qu'ils
4
.

tournent

dos la terre infrieure

(adharabhmivaimukhyt)
1.

gsum pa mthah na de ma chags. gzugs med mfiam gzhag dge rnanis so == hibhrpyh [samahith] // On ne meurt pas dans l'tat de 3. maranabhavvastJiym. iii. 43 samdhi. 4. Vibhfis, 84,9. Pourquoi nomms Vimoksas? Quel est le sens de vimoksa?
Q

2.

Hiuan-tsang, xxix,

fol.

4 b-5

a.

207

33

a.

La nirodhasampatti.

'

La samjiwditanirodhasampatti,
de la notion et de la sensation, est
le

recueillement de la cessation

huitime Vimoksa.

Nous en
le

avons parl
la notion
le

2
.

On
le

la

nomme vimoksa
et

parce qu'elle tourne


;

dos

(samjn)

la sensation
3

ou bien parce
4

qu'elle tourne

dos tout

conditionn.

D'aprs d'autres matres,

les huit

Vimoksas

sont

nomms vimo5

ksas parce

qu'ils dlivrent [5 a] des obstacles

au recueillement.

La nirodhasampatti

est ralise

(sammukhbhva)
6

33

b.

la suite d'une

pense subtile-subtile.

rejettent la pense de dsir


;

Le sens de vimoksa est rejet (k'i-pi, rejeter-dos) .... Les deux premiers du rpa (rpulobhaciUa) ; le troisime rejette Yattbhsamjn les quatre Vimoksas d'Arpya rejettent, chacun, la pense de la
terre
;

immdiatement infrieure le Vimoksa de nirodhasampatti rejette toute pense ayant un objet (slambanacitta). Par consquent le sens de vimoksa est rejet . Le Bhadanta dit que les Vimoksas sont ainsi nomms parce qu'ils

sont obtenus par la force de

Vadhimoksa

d'aprs Parsva, parce qu'ils sont

le lieu

o on rejette. 1. hgog pain soms par hjug paho. 2. Voir ii. 44 d, vi. 64 a, viii. 1%.
tara, iv. 426, 448.
3.

Paramrtba: nirodhasampatti vimoksa.


i.

Majjbima,
(

100, 301, 333, 400, 45G,

Angut-

tourne

sarvasamskrtad va vaimukhyt. Hiuan-tsang corrige le dos tout ce qui a un objet slamba) , c'est--dire
Hiuan-tsang
.
:

parce qu'elle

la

pense et aux
parce
qu'il

mentaux.
4.

Le huitime Vimoksa est


la

nomm Vimoksa

dlivre
Il

est vident
et,

que

possession du huitime Vimoksa, [qui confre


est Arhat, le

le

nom

de

Kayasaksin
parfaite
(vi.

quand on
la version

nom d'Ubhayatobhagavimukta],
la

assure la

matrise
;

en recueillement, dlivre compltement du

vimoksvarana
possession

64 a)

mais

de Paramrtha est sans doute correcte, car


la

des deux premiers Vimoksas, qui supposent


cette
p.

pratique du premier

mme
n. 2),

pratique plus aise en

loignant

le

dhyna, rend rga dj abandonn (ci-dessus


(voir note suivante).

205

en donnant la pense la

karmanyat

Le

Vimoksa supprime l'obstacle aux Vimoksas du domaine du Rpadhatu (rpi vimoksvarana, p. 211, n. 2). 5. sampattyvaranavimoksant. L'obstacle est l'inaptitude de la pense ( akarmanyat ) qui fait qu'un homme dtach du triple Dhtu n'est pas mme capable d'entrer dans le premier dhyna. [sksmasksmd anantaram\ 6. phra bahi phra bahi mjug thogs su
troisime

VibhasS, 152,

4.

Les Darstntikas

et les

Vibhajyavdins soutiennent que,

208

chapitre vin, 33 c-34.


de Bhavagra (naivasamjnnsamjiiyatana), o se

La pense
est subtile

trouve l'ascte qui est

mme

de raliser la nirodhasampatti,

en comparaison de toute pense associe

notion

(samjn)
dire

'.

On nomme

subtile-subtile,

sksmasksma,

la

pense

plus subtile encore


:

qui entre dans la nirodhasampatti


....

[c'est--

laquelle succde

33
patti,

c-d. Sortie

dans une pense

pure

de la terre de la dite
2

sam-

ou dans une pense rya infrieure.

La nirodhasampatti prend fin quand apparat, soit une pense suddhaka (viii. 5) de la terre de Bhavagra, quatrime rQpya
terre

laquelle appartient la nirodhasampatti


c'est--dire

ou

soit

une pense

rya,

ansrava, de
par une pense

la

terre

du troisime rOpya.

Donc, entre dans la nirodhasampatti par une pense


(ssrava),
sortie
3

impure

impure

non-impure

(ansrava).

Quel

est l'objet des

Vimoksas ?
objet le visible du

34. Les premiers ont pour


qui sont

Kama
etc.
*

quant ceux

immatriels

tout ce qui appartient

Yanvayajnna,

la douleur

de leur terre

et
la

d'une terre suprieure,

dans

la

nirodhasampatti,
le

pense subtile n'est pas dtruite. D'aprs eux,


;

il

n'y a pas d'tre (sattva) sans matire (rpa)

il

n'y a pas

non plus de

recueille-

ment sans pense. Si


trouve en recueillement.

recueillement tait exempt de pense, l'organe vital

(jivitendriya) serait coup

on Pour
;

dirait

que

[l'ascte] est

rfuter cette opinion,

mort et non pas qu'il se on indique que la nirodha44


d, p.

sampatti
1.

est

absolument sans pense. [Voir Kosa,


viii.
/

ii.

211, n. 3J.

Dfinition du Bhavagra,
raii gi

c.

2.

dag dan hog

ma

yi

hphags pahi seras kyis de


//]

las ldan

[svauddha-

kdharryena
3.

cittena vyutthitis tatah

le Grand Vhicule, la * pense d'entre > de ce recueillement est ansrava, la pense de sortie est des deux sortes, ansrava ou ssrava .... Chez le Bouddha, les huit Vimoksas sont ansrava ; chez les autres, le huitime est toujours ansrava, les sept premiers sont des deux sortes suivant qu'ils ont pour nature le savoir mondain ou supramondain ( lankikalokottara-

D'aprs

toujours

jnna). {kmptadryavisayh prathamh] 4. dan po hdod chags snan yul can ParamSrtha kmadhtudryavisay dys trayah. gan dag gzugs can min de dag / spyod yul gon dan ran gi sahi / sdug bsnal

Hiuan-tsang, xxix,
Les
trois

fol.

5
le

a.

209

premiers Vimoksas ont pour objet

rpa du Kamadhatu,

rpa rpa

dplaisant

(amanojna) en

ce qui concerne les deux premiers,

plaisant en ce qui concerne le troisime.


et

Les Vimoksas d'rpya ont pour objet la douleur de leur terre


d'une terre suprieure
totalit
',

la

cause et la destruction de cette douleur, la


2

de Yanvayajnna, Yapratisamkhynirodha
a-c)

et

Yksa.

On

a vu (32

que

les

deux premiers Vimoksas appartiennent


le

aux deux premiers dhynas, que

troisime
a-t-il

Vimoksa appartient au
le

quatrime dhyna. Pourquoi n'y


troisime

pas de Vimoksa dans

dhyna
les
le

Parce que,

connaissances corporelles (kyikavijnna) manil

quant dans

deuxime dhyna,

n'existe pas d'attachement la

couleur (varnarga) du domaine de ce

dhyna

[,

lequel devrait tre


4
;

contrecarr, pratipaksitavya, dans le troisime


le

dhyna]

parce que
.
r '

troisime

dhyna

est

secou par son excellent plaisir

Mais,

s'il

n'existe pas d'attachement la couleur


l'ascte

du domaine du
le troisi-

troisime

dhyna, quel but poursuit

en produisant

me Vimoksa

[qui est la contemplation d'un

rpa
6
;

agrable] ?

L'ascte veut rjouir (ou rconforter) son esprit que la contemplation de l'horrible

(asubhabhvan) a dprim

ou bien

il

veut se

sogs dan rjes ses phyogs =r ye tv arpinah

te

'nvayajnnapaksordhvasvaest le

bhduhkhdigocarh // 1. rdhvdhahsvabhmika.
La Vyfikhya indique
excluant sept
2.

V anvayajnna
o
les

chemin

l'exclusion

de la partie du chemin relative au Kamadhatu.


les terres

Vimoksas sont pratiqus

onze terres en

smantakas.
:

Vyakhya ha
/ /

/ /

katamah punar apratisamkhynirodhas tesm lam-

banam atrocyate asaiksasynimittasya samdher apratisamkhynirodham lambante ete hy rpy vimoksa nimittnimittasamdhisvabhvh sambhavanti
3.
4.
(viii.

26

c).

L'ka

est l'objet

du Vimoksa d'knantyyatana.
iti

dvityadhynabhmikavarnargbhvd

dviUyadhynabhmika-

sya varnargasya pratipaksitavyasybhvt. 5. sukhamandenjitatvc ca / sukhasya mandait sarvasukhoparistham

sukham
6.

tenenjitatvt kampitatvt.

asubhay lnm samtatim pramodayitum.


14

210

chapitre vin, 34-35

a.

rendre compte (jijndsdrtham) de son succs ou de son insuccs


il

se

demande
le

si

les

deux premiers Vimoksas [5 b] sont russis ou deux premiers


Vimoksas,

non. Si, dans la contemplation de l'objet agrable (troisime Vimoksa),

dsir (klesa) ne surgit point, c'est que les

Vimoksas sont
lointaines,

russis
etc.,

'.

En
;

effet l'ascte cultive les


:

Abhibhvayatanas,
les

dans un double but


2.

1.

loigner, rendre plus

passions

obtenir la

matrise
effet la

en

recueillement

(samdpattivasitva). Cette matrise a pour

production (abhietc.,

nirhdra) des qualits (guna),


tion de la

telles

que l'Arana,
:

et la

produc-

Rddhi des ryas (dry rddhi)


fait

le

pouvoir surnaturel par

lequel

un saint transforme ou

durer les choses (vastuparindma,


etc.
2

adhisthdna), renonce la vie (dyurutsarga),

Pourquoi

le

Stra emploie-t-il l'expression kdyena sdksdtkrtvd


et

dans la dfinition des seuls troisime


1.

huitime Vimoksas ?
si les

En

Vibhfis&, 84,

15.

Parce

qu'il

veut s'assurer
:

kusalamlas
l'horrible
les

sont com-

plets

(mn) ou
;

non. L'ascte pense

Quoique je contemple
si

(aubha),

je ne produis pas de passion,

mais je ne sais pas


la

kusalamlas sont

complets

si,

en contemplant l'agrable,

passion ne nat pas, je saurai que les

kualamlas sont complets. 2. ryyA ca rddheh [abhinirhrya bhavati]. sa pnnar yay vastuparinmdhisthnyurutsargdlnti / tatra vastuparinmo yad vastu yathdhimucyate tathaiva tad bhavati / yath suvarnasya mrtkaranam tathdhimoksd adhisthnam sthirasya vastunah iyantam kalam avatisthatam iti / tathyusa utsargah di&abdena sumeroh paramnau pravea ity evant anyac ca stre drastavyam. (Voir vii. 42, 48).

Sur abhinirhra, Speyer, Avadfinasataka, ii. 221 index du Mahvastu et du Divya Mahavyutpatti, 21, 88, 25, 12 Lvi ad Stralamkara, iv. 12 Rhys Davids; ; ;
;

Stede.

Sur Vary rddhi des sources


3.

plies, vii. p. 111.


:

On a pour le troisime Vimoksa subham vimoksam kyena skstkrtvopasampadya viharati, et pour le huitime samjnveditanirodham kyena
:

skstkrtvopasampadya viharati. VyakhyB atra skstkrtveti pratyakskrtyety arthah viharatti tant sampattim sampadya viharatlty arthah.
:

upasampadya

vi.

43

c,

58 b

(p. 259),

63

viii. p.

Comparer
catasso

les expressions

152. - Uttarfidhyayana, v. 23, SBE, 45, p. 23. phusati cetosamdhim, nirodham (Dgha, i. 184),
etc.

appamannyo
11.

(Theragatha, 386),

Vibhasa, 152,

Dans d'autres Stras, Bhagavat emploie, dans la dfinition


kyena skstkrtv upasampadya viharati ;

des huit Vimoksas, l'expression

Hiuan-tsang, xxix,

fol.

a-b.

211

raison de leur excellence et parce qu'ils se trouvent la terre finale

de deux dhtus.

'

35

a.

Les Abhibhvayatanas sont au nombre de

huit.

notamment dans le Mahahetupratyayastra ... Quelques-uns disent Le troisime et le huitime Vimoksas se trouvent l'extrmit de deux Dhatus .... , Quelquesuns disent Ces deux Vimoksas se trouvent l'extrmit de deux bhmis .... . 1. Bhasya -.prdhnyd dhtubhmniparyantvasthitatvc ca. VyakhyS: prathatnadvitybhym vimoksbhym trtlyasya vimoksasya prdhnyt / rpivimoksvaranaskalyaprahnd rayaparivrttitas trtlyasya skstkaranam uktam / astamasypi prdhnyd rpyavimoksvaranaskalyaprahnd srayaparwrttitah skstkaranam uktam Le Stra dit que l'ascte se rend prsent (skstkarana, pratyakskarana) le troisime Vimoksa parce que ce Vimoksa l'emporte sur les deux premiers. Il comporte l'abandon de tous les obstacles qui s'opposent aux Vimoksas de dhyna (rpivimoksa) : une
: :

fois

qu'on

l'a

acquis, on possde la souplesse de pense qui permet de raliser

sans

effort les trois

premiers Vimoksas. Et cela, parce qu'il comporte une raya-

parivrtti, une certaine transformation de


logique.

Vraya ou complexe physico-psycho-

De mme

le

huitime Vimoksa l'emporte sur les Vimoksas prcdents

parce qu'il comporte l'abandon de tous les obstacles aux Vimoksas du domaine

de l'Arpya.

Le troisime Vimoksa est obtenu par un ascte qui pratique le quatrime dhyna, terre extrme du Rpadhatu le huitime, par un ascte qui pratique le bhavgra, terre extrme de l'rpyadhtu. 14 c, parivrttaa. iv. 56, p. 123, rayaparivrtti par le Chemin de vue, etc. vyanjana dont le sexe a t chang 38, rayatyga, rayavikopana le abandon, bouleversement de Vraya par la mort, l'hermaphroditisme Dharmakaya, vii. p. 81 note. Le StrSlamk&ra prfre l'expression rayapar; ;

vrtti.
h.
ii.

raya
i.

le

corps muni d'organes

, iii.

41

5,

20 a
i.

(p.

37).

Un
ii.

synonyme d'raya
(p. 284), vii.

est

encore
nine

34 d

(p. 63),

55 d

21 b, et
vi.

les organes, le manas, tmabhva, v. 2 c. Voir ailleurs. La traduction per;

parmi

sonnalit
.... .

n'est pas mauvaise, par

exemple

21 a

une personnalit fmi-

Certaines qualits ne peuvent avoir pour support (raya) que des


;

hommes

des trois dvpas

on ne

les obtient

qu'avec un raya humain.


telle

Dans une acception


2.
zil

diffrente, tel

dhyna,
,

bhmi

est

Vraya,

le

point

d'appui, de l'acquisition de tel

savoir

etc.

gyis gnon pahi skye


ii.

mched brgyad
iv. 85,

= [abhibhvyatanny astau]
Majjhima,
ii.

Dlgha,

110,

iii.

260, Samyutta,

13,

Visuddhimagga,

175,

Atthasalin, 187.

Mahavyutpatti, 71

Stralamkara, xx-xxi. 44.

Lorsque

l'ascte considre les six

yatanas

(couleur-figure, son, etc.) sans

que

212
1.

chapitre vin, 35-36

a.

adhytmam rpasamjn
/
2

'

bahirdh rpni pasyati part-

tni suvarnadurvarnni

tni khalu

rpny bhibhya jnmy


/

bhibhya paymi

evamsamjh bhavati

idam prathamam
parittni, c'est
le

abhibhvyatanam.
2.

De mme, en

substituant

apramnni

deuxime Abhibhvayatana.
3-4.
les

De mme, en substituant arpasamjni rpasamjn. Avec


fait

deux premiers, cela

quatre AbhibhvSyatanas. [6 a]
....*

5-8.

arpasamjni ca punar nlapltalohitvadtni

Cela
:

fait huit.

surgissent des ides mauvaises, ces


sont, les dix

yatanas sont domins, abhibhta


iv.

tels

abhibhyatanas, Samyutta,
1,

77.
26,

Rfrences de Saeki Kiokuga, Madhyama, 59


Samgtiparyfiya, 19,
tymologie, 141,
11,

Drgha,

9, 12,

Amrta,

ii.

9,
13,

Prakarana,

7, 13,

Samyuktahrdaya

(?), 7, 10,

VibhfisS, 88,

Satyasiddhi

(?), 15, 14.

Version du Madhyama, tch'u-tch'u (expulser-habiter), Paramrtha, tch-ju


(gouverner-entrer), Hiuan-tsang, chng-tch'u (a&7u-habiter).
la formule

U bhibhya de

tni rpny bhibhya est traduit par tch-sieu (gouverner*&AA* van) ou par tch'u (expulser, vinodana, apanayana, vibhvana).
1.

Pli

eko bahirdh.
: :

Paramrtha jnmi paymi. ... pasyati. darana, ci-dessus viii. 27 c. 3. adhytmam arpasamjni bahirdh rpni payati nllni nilavarnni nlanidaranni nlanirbhsni tadyath umakpuspama sampannam va vrnaseyam vastram nilam nllavarnam nlanidaranam nllanirbhsam I sa tni khalu rpny bhibhya jnmy bhibhya paymi evam samjnlbhavati idam pancamam abhibhvyatanam b adhytmam arpasamjni ... pltanirbhsni tadyath karnikrapuspam sampannam va .... adhytmam arpasamjni... lohitanirbhsni tadyath bandhkapuspam" sampannam va ... adhytmam arpasamjni. ..avadtanirbhsni tadyath uanastrak <* sampannam va ...
2.

VyfikhyS jnti
et

Sur jnna

ummpuppham nilam nilanibbhsam Mahfivyutpatti: umakapuspam. k seyyath va pana tam vattham brnaseyyakam tibhatobhgavimaa.
...

ttham nilam c. bandhujvakapuppham, Mah&vyutpatti bandhujvakapuspam.


...
:

d.

osadhitrak.

Hiuang-tsan,

xxix, fol. 5 b-6 a.

213
;

35 b-d. Deux sont comme le premier Vimoksa les deux suivants comme le deuxime les autres comme le Vimoksa dit subha.
;

Les deux premiers Abhibhvyatanas sont semblables au premier

Vimoksa 2

le

troisime et le quatrime, au deuxime

Vimoksa

les

quatre derniers, au troisime Vimoksa. Quelle est donc la diffrence entre

Vimoksa

et

Abhibhvayatana ?
;

Par

les

premiers,

dlivrance

sans plus (vimocsamtra)

par

les seconds,

domination sur
la

l'objet l'objet

(lambanbhibhavana). Cette

domination comporte

vue de

comme on

le dsire

(yathestam

adhimoksah)
patti).
n

et

l'absence de klesa provoqu par l'objet (klesnut-

36

a.

Dix Krtsnayatanas.

1. gnis ni rnam thar dan po gnis sdug pahi rnam par thar pa bzhin

(lire bzhin)

dvayam dyavimoksavat
/ /

gnis ni gnis ka bzhin no gzhan


/

dve dvityavad

anyni punah subhavimoksavat // 2. yath rpi rpni pasyatti prathatno vimoksah tmagatam rpam pasyan bahirgatam rpam pasyati evam dye abhibhvyatane / tayor hy ekam tmagatam rpam pasyan bahirgatam pasyati / tath hy tat pathyate adhytmam rpasamjn bahirdh rpni pasyati parittnti vistarah / dvitiyam api tathaiva ayant tu viseso bahirdh rpni pasyaty adhimtrni kim ca yath prathatno vimoksah prathamadhynabhmikah kmvacaravarnargapratipaksah kmvacararpyatanlambana ca tatheme prathame abhibhvyatane veditavye. 3. tair vimoksamtram iti nlambanbhibhavanam / katham cbhibhvyatanair lambanbhibhavanam ity ata ha yathestam adhimoksd iti / yathestam tair nilaptdyadhimokst ksanena nlam ksanena ptam ity di amanojnasya va vinlakder manojndhimokst klesnutpdc ceti subhato 'pi ca smklesikam vastv krayatah klesnutpatter iti tair abhibhvyatanair lambanbhibhavanam bhavati. (Sur krayati, vi. p. 164,
j / / j / j I
/

vii. p. 78).

4. zad par bcu ho brgyad pa gnis ni gzugs med dag alobho 'stau dhyne 'ntye

ma
/ ....

chags / bsam gtan mthah na spyod yul ni / hdod spyod yul ran gi phun po bzhi [dasa krtsnny

gocarah
v.

kmo

dve

suddham rpyam
Majjhima,
i.

svaca14, les

tuhskandhagocare //] La liste classique Anguttara,


Dgha,
iii.

46,

60 (Comm.

i.

27, 10),

423,

ii.

268 (Sumangala,

i.

115, Franke, p. 210); Visuddhi, 110,

remplace
;

deux derniers par loka, paricchinnksakasina (voir Childers) les deux derniers omis parfois dans Patisambhida. [Sur lokamanasikra, etc., vii.
p. 104, 123].

214
Ils

CHAPITRE
sont

VIII,

36-37.

nomms krtsna
de dix
; :

parce qu'ils embrassent leur objet dans


'

sa totalit et exclusivement.

Au nombre

vue en

totalit

de terre, eau, feu, vent, bleu,


l'espace et du

jaune, rouge, blanc

plus les

nantyyatanas de

vijnna (premier

et

deuxime rpya).

36

b-c.

Huit sont non-dsir, appartiennent au dernier dhyna, ont


le

pour objet

Kama.
la racine de bien

Les huit premiers sont, de leur nature,


[6 b]
:

alobha
ils

avec

les

dharmas

concomitants, cinq
le

skandhas

sont

raliss par

un ascte entr dans

quatrime

dhyna

ils

portent
les avis

sur

le

rpyatana
le

(=

le visible)

du Kamadhtu. Toutefois

divergent: quelques-uns pensent que le quatrime,

vyukrtsnyatana
;

a pour objet

tangible qu'on

nomme

lment-vent (vyudhtu)

Visuddhimagga, 425 (voir Index et Warren, 293), Atthasalin, 185, Compendium, Spence Hardy, Eastern Monachism, 252 Kern, Geschiedenis, i. 393 ( les cercles universaux ou cosmiques ) Yogavacara-Manual, p. xxix Rhys Davidspassim
Stede.
; ; ;
;

Mahfivyutpatti, 72, SamgtiparySya, 11 e section, Slralamk&ra,

vii. 9,

xx. 44.

La Vibhasa contient un trait complet d'o sont extraites les remarques sommaires du Kosa. 1. nirantarakrtsnaspharand iti nirantaram krtsnnm prthivydnm spharand vypant krstnyatannty ueyante. Param&rtha traduit krtsna tantt pin (= total, clef 60), tantt o-pin ( ananta) 36 a. Il y a dix krtsnyatanas (pin ju). Ils sont nomms krtsna
:

(o-pin) parce qu'ils embrassent totalement une espce sans intervalles-fissures.

Quels

dharmas
:

rouge, blanc

ceci

sont krtsna (o-pin) ? Terre, eau, feu, vent, bleu, jaune, embrasse ce qui est rpa (Littralement rpalaksanni)
:

y a des matres qui disent que a pour objet le tangible.


Il

le

vyukrtsnyatana
:

(fong o pin ju)

La Vibhasa, 85, 10, traduit krtsna par pin (clef 162) Ils sont nomms krtsnyatanas pour deux raisons parce qu'ils ne prsentent pas d'intervalle (kin), parce qu'ils sont tendus (kong ta) d'une part, l'acte d'attention imaginative (adhimuktimanaskra) porte exclusivement sur le bleu, etc., sans tre
:

ml d'un autre caractre


bleu, etc., a pour objet
est large-tendu
2.

d'autre part, l'acte d'attention, portant sur tout le


infini.

un caractre

Bhadanta
prthiv

dit

Parce que leur objet


.

(k'on-kong), parce

qu'il n'y
iti
/

a pas intervalle-fissure (kin k'i)

kmvacaram rpyatanam
/

lokasatnjnay

pas

teja

ca vyus tu

varnasamsthnam ucyate dhtur eva tathpi ca iti vacand

Hiuan-tsang,

xxix, fol. 6 a-7 a.

215
le

quelques-uns pensent que les quatre premiers ont pour objet


gible, les

tan-

quatre derniers

le visible.

'

36

c-d.

Deux sont rpya pur

ils

ont pour objet les quatre skan-

dhas de

leur terre.

Les deux derniers sont recueillement pur (uddhaka) d'rpya


leur objet est les quatre

skandhas de

la terre (premier et

deuxime

rpya) laquelle

ils

appartiennent.

Les huit Abhibhvayatanas ont pour


huit

entre

(prvesika) les
les huit

Vimoksas
:

les dix

Krtsnayatanas ont pour entre


en
effet,

Abhi-

bhvayatanas

les suivants,

sont suprieurs aux prcdents

(uttarottaraviistatvt).

Toutes ces qualits (gunas) peuvent avoir pour appui (sraya)


srie

la

mentale d'un Prthagjana ou d'un rya, l'exception du niroqui ne peut se produire que chez l'rya.
le
2

dhavimoksa
Examinant

mode

d'acquisition de ces qualits et les personnes


:

qui peuvent les produire

37

a-b.

Le nirodha a

t expliqu
'

les autres

sont obtenus par

le

dtachement ou par

l'exercice.

Voir ce que nous avons

dit

de la nirodhasampatti

(ii.

43)

les

autres qualits sont obtenues par vairgya ou par


qu'elles ont t,

prayoga suivant

ou n'ont pas

t,

habituellement pratiques (ucit-

nucitatvt). [7 a]

37

c-d.
;

Les qualits d'rpya sont obtenues par

les tres

des trois

Dhatus

les autres,

seulement par

les

hommes.

(i.

13, trad. p. 23)

tanam necchanti
1.

Cette

vyau sprastavyyatanam ity eka iti / ye vyum rpyata ahuh j vyau sprastavyam alambanam iti. dernire phrase manque dans Hiuan-tsang.

2. 3. 4.

ekntenryasmtnikatvt. hgog pa bad zin lhag ma ni / hdod chags bral dan sbyor bas thob. gzugs med ces bya khams gsum gyi / rten can lhag ma mi las skye.

216
Les Vimoksas
et les

CHAPITRE

VIII,

37

c-38.

Krtsnayatanas du domaine de l'rpyadhatu

sont pratiqus par des tres ns dans les trois sphres. Seuls les

hommes peuvent

pratiquer les autres recueillements

trois

Vimo-

ksas, huit Abhibhvayatanas, huit

Krtsnayatanas parce

que ces

recueillements naissent par l'efficace de l'enseignement (upadesa-

smarthyotpdt).
S'il

en est ainsi, comment les tres ns dans les terres (bhmi)


et

du Rpadhatu

de l'Arpyadhatu peuvent-ils raliser des recueilleet

ments de dhyna

d'rpya suprieurs
la cause, de l'acte, de la
c'est

la terre

ils

sont

ns ? En raison de

dharmat.
et

38
l'acte

a-b.

Dans deux sphres,

par la force de la cause


'

de

qu'on produit les recueillements d'rpya.


le

Dans

Rpadhatu

et

dans

les terres infrieures

d'rpyadhatu,
d'r-

les recueillements

d'rpya, ou

les recueillements suprieurs


2
:

pya, naissent par


qus \

la force de la cause

quand
et

ils

ont

t,

au cours

d'une existence antrieure,


Ils

prochainement

intensivement prati-

naissent aussi par la force de l'acte, c'est--dire en raison

de la rtribution imminente d'un acte ancien, de la catgorie

rtri-

buer plus tard


celle

comportant une terre de rtribution suprieure


terres infrieures d'rpyadhatu)

(Rpadhatu ou

dans laquelle

on

est n.

Car quelqu'un qui

n'est pas dtach d'une terre infrieure


4

ne peut renatre dans une terre suprieure.


1.

med pa / rgyu dan las kyi stobs kyis te. examin Visuddhimagga, 415. 2. hetubalt. La cause, hetu, est le recueillement d'rpya agissant comme sabhgahetu, c'est--dire amenant un nouveau recueillement d'rpya. Quelqu'un produit un recueillement d'rpya, 3. sannbhksnbhyst. tombe de ce recueillement, meurt, renat dans un ciel du Rpadhatu (en vertu de quelque acte ancien) il y produira un nouveau recueillement d'rpya parce que le prcdent recueillement d'rpya est proche (sanna). Quelqu'un est frquemkhams
gnis dag tu gzugs
est

Ce problme

ment entr dans un recueillement d'rpya; il en a l'habitude intense (abhkmbhysa) ; il meurt, renat dans le Rpadhatu il y produira nouveau recueillement d'rpya. De mme, n dans Yksnantyyatana, on pourra y produire un recueillement suprieur d'rpya, de vijnnnantya, etc. 4. aparaparyyavedanyasya rdhvabhmikasya karmanah pratyupa:

sthitavipkatvt.

Hiuan-tsang, xxix,

fol.

7 a.
et aussi
!

217
en raison

38

c-d.

Dans

le

Rpa,

c'est

par ces deux forces,

de la nature des choses, qu'on produit les dhynas.

Les tres ns dans un tage infrieur du Rupadhatu produisent


des

dhynas

suprieurs l'tage o

ils

sont ns en raison des deux

forces dcrites ci-dessus. Et aussi, l'poque de la fin du

monde

-,

Quelqu'un a accompli un acte qui doit tre rtribu dans l'rpyadhatu, non pas immdiatement la mort, mais dans une naissance ultrieure (iv. 50). En
raison d'autres actes,

rtribuer tout de suite,

il

renat d'abord

dans

le

Rupa-

dhatu. L'imminence de la rtribution de l'acte rtribuer dans l'rpyadhatu fait

que cette personne produise

le

recueillement d'rpya. Ceci est ncessaire la

rtribution de cet acte, car n'tant pas dtache de la terre o elle est ne

(adhastd avtarga), savoir du Rupadhatu, cette personne ne pourrait renatre dans l'Arpyadhatu si elle ne se dtachait pas, par le recueillement d'rpya,
de la dite
1.

terre.
/

gzugs kyi khams su bsam gtan mains

de dag dan chos nid kyis kyan =.


et les cieux

[dhynni tu rpadhtau tbhym] dharmataypi ca // 2. Lorsque l'univers prit par le feu, disparaissent le Kamadhtu
du premier dhyna
disparaissent aussi
terres
;

lorsqu'il prit

par

l'eau, les

cieux du deuxime

dhyna
les

lorsqu'il prit

par

le vent, la disparition

comprend aussi

du troisime dhyna (Kosa, iii. 100 c-d). D'o cette consquence que, la fin du monde, tous les tres doivent renatre dans les sphres l'abri de la destruction, et par consquent produire des recueillements comportant renaissance dans les cieux du deuxime, du troisime ou du quatrime dhyna. Hiuan-tsang Par la force de la dharmat, lorsque le monde rceptacle va prir. Telle est la loi ou la nature (dharmat) des tres des terres infrieures [7 b] qu'ils produisent des dhynas suprieurs, parce que, dans ces circonstances (avasth), les bons dharmas prennent plein dveloppement par la force de la dharmat. Les tres ns dans les deux dhtus suprieurs (c'est--dire dans lt-s cieux du quatrime dhyna et dans l'rpya), c'est par la force de la cause et db l'acte qu'ils produisent rpyasampatti ; non par la force de la dharmat, car les dieux de PAnabhraka, etc. (quatrime dhyna) ne sont pas atteints par
:

les trois catastrophes.

Vibhasa, 153,
duisent les

6.

Pourquoi
:

les

tres ns dans le

Rupadhatu
:

produisent-ils

d'abord les dhynas, les rpyas, non pas la nirodhasampatti ?

Ils pro-

dhynas en
2.

raison de trois causes (pratyaya)


ils ils

1.

par la force de la

cause (hetubala)

dans une existence antrieure,


:

ont produit, dtruit, les ont


fait

dhynas ;
rieure dans

par la force de l'acte (karmabala)


terre de

et

accumul des
la force

actes de rtribution ncessaire et devant tre rtribus dans une existence post-

une

dhyna ;

cet acte donnera son fruit


:

3.

par

de

la nature des

choses

(dharmat) l'poque o
en haut

le
...

monde

prit, les tres

des

terres infrieures renaissent ncessairement

Les deux premires raisons

valent pour la production des rpyas.

218
par la force de la
des bons

CHAPITRE

VIII,

38

c-39.

dharmat

'

[7 b].

cette poque, tous les tres des

terres infrieures produisent les

dhynas

suprieurs, car l'efficace


2

dharmas prend

plein dveloppement.
la

Combien de temps durera


tre clairement

Bonne Loi de Bhagavat

priode
3

durant laquelle ces diverses spcifications des

dharmas

pourront

connues

et

vues ?

La Bonne Loi du Matre adhigama. s


a-b.

39

est double, elle est

gama

et

Udgania,
1.
:

c'est l'enseignement,

Stra,
/

Vinaya

et

Abhidharma
j

6
.

eva
tv

Vyfikhya keyam dharmat nma kecit tvat santrntik huh esm dharmnm udbhtavrttnmprvadhynavsandhipatyt tadutpatupadesatn antarena dhynotpattv nugunyam dharmat prakrtih
/

svabhva ity arthah // vaibhsik api kecid huh paurvajgarikt sabhgahetoh nisyandaphalam dhynotpdanam tadupadesam aniarennyato
dharmateti. Sur dharmat, voir
2.
ii.

46, p. 237, iv. 17 a, 20,

58

(p.

128), 67, vi.

34
:

a.

kusalnm dharmnm udbhtavrttiivt. Vyakhy kusalnm karmapathnm ity arthah vrttis tesm dharmnm yat kritram udbht utkrst vrttir esm ity udbhtavrttayah tadbhvah tasmt etad uktam bhavati tesm kusalnm prakarsentmalbht tadutpattynugunyena tmalbht tadupadesam antarena anyatah prvadhynavsanym satym dhynotpattir iti.
/ / j / j

Sur vsan, voir vii. p. 70, 72, 77. Les bons dharmas sont ici adhipatipratyaya. ssravnsravnm dharm3. ima drs dharmnm prakrh .... nm dhtubhmylambankrdiprakr yathyogam. Tant que dure

la

Bonne Loi, il est possible de connatre tous les dharmas, purs et impurs, quel dhtu et quelle terre ils appartiennent, quel est leur aspect, etc. 4. D'aprs Paramrtha. Hiuan-tsang Tous ces dharmas spcifis diversement ont pour but l'largissement et la dure de la Bonne Loi. Qu'est-ce que la Bonne Loi ? Combien de temps restera-t-elle ? 5. ston pabi dam chos rnam gnis te / lun dan rtogs pahi bdag nid do
:

[saddharmo dvividhah sstur


:

gamdhigamtmakah

/]

Le Saddhamma est triple pariyattisaddhamma : toute la parole du Bouddha dans les trois Pitakas patipattisaddhamma : les 13 dhutagunas, les 14 khandhakavattas, les 82 mahvattas, slla, samdhi et vipassan ; adhigamasaddhamma : les quatre ariyamaggas, les quatre fruits et le Nirvana (Samanta;

pSsadika,
6.

i. 225). Voir ci-dessous p. 221 note. Les douze angas sont numrs dans Abhisamayalamkraloka

stram geyam vykaranam gthodnvadnakam / itivrttikam nidnam vaipulyam ca sajtakam j upadeo 'dbhut dharm dvdangam idam vacah //

Hiuan-tsang,

xxix,

fol.

7 a-7 b.

219
temps que
vi.

Vadhigama, [c'est la dharmas adjuvants de


gieuse
(vi.

saintet
la

]'

c'est,

en

mme

les

Bodhi (bodhipksika dharma,

67 b)
reli-

pratiqus par les ryas des trois vhicules, les fruits de la vie

51) obtenus par les trois vhicules. Telle est la

Bonne

Loi, double de sa nature.

39
quent.
1.
Il

c-d.
2

La supportent ceux

qui la prchent et ceux qui la prati-

semble que

saintet

ne soit pas un trop mauvais quivalent d'adhi-

gama, puisque Vadhigama est dfini comme tant les dharmas adjuvants de la Bodhi plus les fruits du brahmacarya [C'est par les bodhipksikas que le brahmacariya est addhaniya ciratthitika, Dgha, iii. 27]. D'ailleurs adhigama
signifie pntration, intelligence
.

adhigama
trois

est

synonyme de satybhisamaya
:

(vi.

27) dans la dfinition des

prajns ou discernements % On appelle bla celui qui manque la prajn inne (upapattilbhik) laquelle procde de la trace d'un exercice ancien (prvbhysavsannirjt) ; asrutavn, celui qui manque la prajn qui nat de l'enseignement (gamaj) ; prthagjana, celui qui manque la prajn qui nat de Vadhigama, qui nat de la comprhension des vrits (yasydhigamaj satybhisamayaj nsti ...) (iii. 28 a). La Bodhisattvabhmi, dans la dfinition des recours (pratisarana), dfinit le jnna, qui est recours par opposition au vijnna, qui n'est pas recours

comme adhigamajnna
2.

fait

de recueillement,

bhvanmaya

(Voir

iv. trad. 162,

note et ci-dessous Chapitre

ix. trad.

Hiuan-tsang, xxix. 15
/

a, note).

de hdzin hyed pa smra byed dan

sgrub par byed pa kho na yin

= dhtras

tasya vaktrah pratipattra eva ca // a. Hiuan-tsang traduit Aussi longtemps qu'il y a porteurs, prcheurs, acqureurs, aussi longtemps dure la Loi . Les deux traducteurs chinois distinguent trois catgories les deux premires (ceux qui portent et ceux qui prchent) par rapport Vgama ; la troisime (ceux qui acquirent) par rapport Vadhigama. h'gama dure aussi longtemps qu'existent les deux premires catgories Vadhigama, aussi longtemps qu'existe la troisime. Donc la Loi dure en raison de ces trois classes d'hommes. ParamSrtha ajoute Pourquoi ? Parce qu'il y a deux causes de dure de la
: :

Bonne Loi correctement


:

dire,

correctement recevoir.
:

Il

y a d'autres matres qui


futur,
les

disent que la Loi dure mille ans

cela se rapporte

Vadhigama, non Vgama


le

qui dure plus longtemps.

Pourquoi ?

Dans
:

temps

hommes
Les
et

capables de porter la Loi sont de deux sortes


l'audition,

ceux qui croient en raison de


(? tchng-kii).

ceux qui croient en raison de l'intelligence correcte

dieux protgent ces

hommes pour que Vgama


il

et

Vadhigama ne
et

disparaissent

pas

vite.

Par consquent
.

faut, et

pour

la lettre

pour

le sens,

mditer

pratiquer

220

CHAPITRE
la

VIII,

39

c-d.

Ceux qui prchent


Loi qui est

Bonne

Loi, Sutra, etc., supportent la

Bonne
Loi,

dgama. Ceux qui pratiquent ou


etc.,

ralisent la

Bonne

dharmas
bles
Il

adjuvants de la Bodhi,

supportent la Bonne Loi qui


le

est adhigama. Aussi longtemps qu'existent dans

monde sembla-

hommes,

aussi longtemps dure la

Bonne

Loi.

est dit [dans

Samyukta, 25,

20],

d'une manire gnrale, que la

Bonne Loi dure


longtemps.
2

mille ans aprs le Nirvana.

On

explique que ce

chiffre se rapporte

Y adhigama

',

mais que

Ygama

dure plus

b.

Samghabhadra

rectifie

Vasubandhu sur

plusieurs points et ajoute des dtails

intressants.

Le saddharma de Bhagavat est double, gama et adhigama. V gama, c'est Vadhigatna, c'est le chemin pur (ansravamrga) des trois vhicules [Pour Vasubandhu, c'est les bodhipksikas qui ne sont pas tous ncessairement purs]. Aussi longtemps que dure dans le monde Y adhigamaSatra, Vinaya, Abhidbarma.

saddharma,
Dans
le

Y gama-saddharma, accru et soutenu par


'

lui,

dure aussi. Actuel-

lement, dans l'Orient,

Nord,

Yadhigama-dharma dprit Ygama beaucoup disparat. comme Yadhigama-dharma y fleurit, le bon gama de Bhagavat
;

s'tend et s'augmente. Par consquent, c'est le pays

du savoir suprme des


le

Tathgatas

(...

dharma
sur les
le

fleurit

jiinagocara). Les ryas y demeurent dans cette contre non pas en Orient,
; ;

sens correct de l'Abhi-

etc.,

la tradition et la

pratique sont impossibles porteurs


;

(??).

V gamadharma,

essentiellement,

s'appuie

(dhtar, ceux qui ont appris)

et les prcheurs

pour durer dans

monde Y adhigama dure en s'appuyant seulement

sur

ceux qui pratiquent

(pratipattar). Mais ceux-ci ne sont pas les supports de Y adhigama seulement

Y gamadharma s'appuie aussi sur les pratipattar

aussi longtemps que des

hommes pratiquent sans erreur (aviparlta) le Dharma, aussi longtemps dure Y adhigama aussi longtemps dure Yadhigama, aussi longtemps dure Ygama.
;

[Pour la disparition de la Loi en Orient, comparer les Songes de Krkin, rdaction

du Vinaya des Mahlsasakas, Nanjio 1122, Chavannes, Cinq cents contes, ii. 348. Le onzime songe (pice d'eau dont le centre est trouble et les bords limpides) signifie que la Bonne Loi commencera disparatre dans le pays du milieu, tandis qu'elle sera prospre dans les royaumes de la frontire.] 1. La Vykhy approuve cette explication esa euapakso yukta iti pasymah. pas men2. a. Conditions de la dure de la Loi (respect l'gard du Bouddha
:

tion d'annes), Anguttara,

iv.

84.

Pourquoi
i.

la Loi

de certains

angatabhaya, iii. 105, 108. etc. Bouddhas dure longtemps, Suttavibhanga,


ii.

Parajika,

Samantapsdik, i. 184, Kosa, vii. p. 81. L'Arhat prolonge sa vie pour prolonger la Loi, Kosa, est protge par les hommes et les dieux, Samyukta, 25,
3, 3,

trad. p. 121.

1.

La Loi Lvi et Chavannes,

Hiuan-tsang, xxix,

fol.

7 b-8 a.

221

Le prsent

trait,

l'Abhidharmakosa, s'appuie sur l'Abhidharma


et inclut le

[=

les traits

canoniques]

sens de l'Abhidharma (voir


;

chap.

Les seize Arhats protecteurs de la Loi, J. As. 1916, ii. 9 J. Przyluski, Aoka, vii. Dveloppement des ides escbatologiques relatives la Loi, et aussi
b.

207, 336, 399, 452.

Cullavagga.

x. 1,

Si les

femmes n'avaient pas


;

t admises, ce

brahma-

cariya aurait dur longtemps, aurait dur mille ans mais comme elles ont t admises, ce brahmacariya ne durera pas longtemps le Saddhamma durera cinq cents ans . [Pas mention d'annes dans Bhiksunkarmavcana (Bulletin School Oriental Studies, 1920, 125), ni dans Rockhill, Life, p. 60]. Mme doctrine dans P'i-ni-mou-king (Nanjio, 1138), o l'explication est donne par Kasyapa (Przyluski, Aoka, 173) voir aussi Madhyama, 28, 17 (cit par Kiokuga Saeki).
;

Vinaya des MahsSsakas (32, 3, cit par l'diteur japonais du Kosa) Si les Bhiksuns observent les huit gurudharmas, la Loi durera mille ans . Mais, dans le Vinaya des Sarvstivfidins ( jugement d'nanda ), la dure de la Loi esl limite mille ans parce que les femmes ont t admises. Mme doctrine dans d'autres textes relatifs au premier concile (Przyluski, ibid.).
:

Asokavadna,

et

beaucoup d'autres
le

textes, mille
;

ans

MahamysQtra, Nanjio,
qu'il

382, quinze cents ans (Przyluski, 161-173)


I-tsing (Takakusu, 106) cite

Nanjio, 123.
:

Vinaya
),

Aussi longtemps

y aura un
il

karmcrya

(? the

holder of rules

ma

Loi ne sera pas dtruite.

Quand
,

n'y
:

aura personne qui

tienne et supporte

les

karman, ma

Loi finira

et encore

Aussi longtemps que mes prceptes existent, je vis . Sum. Vil. i. 11. c. Cinq disparitions successives adhigama, patipatti, pariyatti,
:

linga,

dhtu, ManorathapQran,
481).

i.

87,

AnSgatavamsa (Minayev, JPTS. 1886

et

Warren,

adhigama, patipatti, linga, Milinda, 133. Bouddba .... et combien d'Arhats avons-nous qui puissent conserver la Bonne Loi ? Il est dit dans un Trait Le grand Lion a ferm
Trois disparitions,

Disparition de l'ombre du

les

yeux et les tmoins ont disparu l'un aprs l'autre ... , I-tsing, Takakusu, p. 106 [Comparer ci-dessous p. 224]. La Vajracchediktka, Mdo, xvi. fol. 234 a, expliquant Vajraccbedika, p. 22
:

pacime kle pascime samaye pacimym pancaatym saddharmavipralopakle vartamne Il est bien connu (prasiddha) que l'enseignement de Bhagavat dure cinq fois cinq cents ans c'est pourquoi le texte spcifie pendant la dernire priode de cinq cents ans, car c'est alors que les cinq kasyas (iii. 4 c,
:
; :

93

a)

prennent dveloppement

Nanjio (dans Max Millier, SBE. 49, p. 116) signale Mabasamnipatastra (Nanjio, 61), 51 me section Dans les premiers cinq cents ans, les Bhiksus et autres seront
:

(Entendez obtiendront le salybhisamaya ?j ; dans la seconde priode de cinq cents ans, ils seront forts en mditation (samdhi,

forts

en dlibration

dhyna); dans

la troisime,

en Ecriture (ruta) ; dans

la

quatrime, fondation de

CHAPITRE
i.

VIII,

40.

c).

[Or

il

y a plusieurs manires d'expliquer l'Abhidharma


'

:]

dans

ce trait, d'aprs quelle interprtation est-il expliqu ?

40. L'Abhidharma qui


kas du Kasmlr,
c'est

est tabli par l'interprtation des Vaibhasij'ai

dans l'ensemble ce que


ici,

expliqu.

Que

des

exgses inexactes soient [reproduites]


ble],

c'est notre faute [invita-

car les Munis seuls sont autorit dans l'interprtation de la


Loi.
-

Bonne

monastres
invisible.

dans

la

cinquime, querelles

et

reproches.

La blanche Loi deviendra

A l'poque o le Saddharma de KSsyapa va prir, un d. Samyukta, 3:2, 3 pratirpaka Dharma nat quand celui-ci est n, le Saddharma a pri . Saddharmapundarka, 67, 7 Le Saddharma de Padmaprabha durera trente-deux antarakalpas ; quand il sera dtruit, le saddharmapratirpaka durera autant de kalpas 377 Quand le Saddharma de Jitasvararaja fut dtruit, l'poque o le saddharmapratirpaka tait disparaissant, comme cette religion (ssana)
: ;

tait

envahie par des Bhiksus qui s'attribuaient des dons spirituels qu'ils n'avaient
.

pas
1.

...

D'aprs Hiuan-tsang.

Paranmrtha: J'ai expos dans ce trait l'Abhidharma


comme

de Bouddha Bhagavat. L'ai-je expos d'aprs l'cole des Sautrntikas ou


il

VibhasS ? D'aprs la Vyfikhya L'Abhidharma que j'ai enseign ici, savoir l'Abhidharmakosa, est-ce l'Abhidharma des Traits canoniques, l'Abbidliarma du Jfianaest expos

dans

la

prasthana,
2.

etc.

bdag
thub

gis

mnon
/

palii

chos hdi

pliai

cher ni

kha che bye brag smra bahi


/

thsul grub bsad

fies

pa zin gan de hdir bdag

gi(s) fies

dam

chos thsul la thsad

ma

mams

yin

kmravaibhsikanltisiddhah

pryo niayyam kathito 'bhidharmah j yad durgrhtam tad ihsmadgah saddharmantau munayah pratnnam
|Paramrtha
:

//
/

saddharma durgrhta (pris de guingois, p'in-tch) maddosah netum dharmasannltim munayah pramnam. Hiuan-tsang traduit dur:

grhta

blmable-pmmwa.] Vykhy yo 'yam iti vistarah / yo 'yam ihbhidharmakoalaksano 'bhidharma uktah kim esa eva strbhidharmo jnnaprasthndilaksano deito 'ta idam ucyate / kmravaibhsikantisiddha iti vistarah kamre bhavh ksmlrh / vibhsay divyanti vaibhsik iti vykhytam tat j santi kmr na vaibhsik ye vinayacintdayah sautrntik bhadantdayahj santi vaibhsik na kmr ye bahirdeak ity ubhayaviesanam I tesm nty yah siddho 'bhidharmah sa pryeneha maya desitah j arthd
:

Hiuan-tsang, xxix,
Cet Abhidharma, en gnral, a t
l'interprtation des Vaibhasikas
dit

fol.

a.

223
est] tabli

par moi [qui

dans

du Kasmr. Ce

qui, l,

a t mal pris
les

par moi, c'est

ma

faute

pour l'interprtation de la Bonne Loi,

Bouddhas

seuls et les

fils

du Bouddha sont

l'autorit.

'

uktam bhavati

/ anyantisiddho 'pi deita iti // yad durgrhltam ksmravaibhsikanayennyanayena va tad ihavacane 'smadgo 'smadapardhah II kim kranam ity aha j saddharmanltau munayah pramnam iti / saddharmasygamdhigamalaksanasya ntaxi varnane munayo buddh bhagavanto buddhaputr cryaradvatiputrdayah pramnam sarvkrasarvadharmvabodha pt ity arthah. 1. bdag gis chos mnon pa hdi phal cher kha che bye brag tu smra ba rnaras

kyi tshul du grub par bsad pa yin no

hdi la bdag gis

fies

par zin pa gan yin pa

de ni bdag gi

fies

pa yin

te

dam

pahi chos kyi tshul

la ni

sans rgyas marins kho

na dan
a.

sans rgyas kyi sras rnams tshad


:

ma

yin no.

Hiuan-tsang

La discussion de PAbhidharma des Vaibhasikas du Kasmr


[Il

les

cinq cents Arhats, d'aprs Saeki Kiokuga] est correctement tablie


ici

y a
j'ai,

peut-tre

mprise sur

le

sens de siddha]. C'est en m'appuyant sur eux que


fautif, c'est

en gnral, expos PAbhidharma. Ce qui est


juger
le

ma

faute. L'autorit

pour

Dharma, c'est seulement les Bouddbas et les Mahsravakas . ... C'est en m'appuyant sur eux que j'ai, en b. Samghabhadra (xxiii. 8, 84 h) gnral, expos l' Abhidharma. Ici le Sautrntika [ Vasubandhu] expose sa pense fondamentale, disant M'appuyant sur la Mahavibhasa, discussion des principes d'Abhidharma des Saugatas de ce pays, faisant effort pour comprendre correctement, afin que la Bonne Loi dure longtemps pour le salut des tres, j'ai compos ce trait. La grande masse de ce livre expose le systme [de la Vibhs] une petite partie suit d'autres chemins, par exemple sur le rpa-gure (satnsthnarpa, iv. trad. p. 8-9), sur le pass et le futur (v. 27), etc. Mais la nature des
: : ;

dharmas

est trs profonde,

mon

intelligence est faible

je ne suis pas capable de

diligemment chercher (k'n-k'ieu) le prcheur vridique (yathbhtavdin ) (?). Par consquent, dans l'interprtation (nlti) expose dans ce long trait, si une
petite partie est

mal taye (durgrhta


;

=
:

pin-liang

censurer-autorit

d'autorit contestable

le

sens est peut-tre

Si

j'ai,

parfois,

reproduit des
est vaste

doctrines inexactes
et

...

), c'est

ma

faute. L'interprtation des

dharmas

profonde

...

Les Bouddhas, ayant accumul l'quipement de savoir (jnnasam-

bhra) connaissent tout objet de connaissance. Les Pratyekabuddhas ne peuvent


juger du caractre des
qu'ils ralisent

dharmas

plus forte raison les Srvakas, car

le

Dharma

dpend de l'enseignement. Donc, pour juger des dharmas, il n'y a que les vrais grands Munis. Par l, nous savons que l'Abhidharma est vraiment la parole du Bouddha. Il faut l'accepter avec foi, pratiquer-mditer correctement, diligemment chercher la dlivrance . c. Paramartha. Les Vaibhasikas du Kasmr possdent les deux tcheng . Cet Abhidharma l'Abhidharmakosa a t expos par moi, en gnral,

224

CHAPITRE vin, 40.


Matre, il du monde, s'est ferm
;

Le
vu la

les tmoins,

en gnral, ont
qui n'ont pas
retient.

pri [8 b]

la loi est

mise en confusion par des


sophistes, indpendants,

hommes

vrit,

mauvais

que rien ne

Car, Celui qui sait par lui-mme est parti dans le


et aussi
les

Calme suprme,
:

soutiens de la

loi

de Celui qui sait par lui-mme

le

monde
tuels,

n'a plus de gardien. Les vices, qui dtruisent les biens spiri-

ont maintenant pleine libert.


la loi

Voyant que
'

du Muni

est

son dernier

souffle,

que

c'est l'heure

de la force des vices, ceux qui dsirent la dlivrance doivent tre


diligents.

conformment leur doctrine.


faute.
les

S'il y a ici quelque chose qui soit mal pris, c'est ma dfaut de tcheng capable de juger correctement de la Bonne Loi, seuls

qu'ils voient

Bouddhas Bhagavats sont la suprme mesure (pramna). Pourquoi ? Parca immdiatement tous les dharmas. Les Aryasravakas du Bouddha, en dehors de l'Ecriture (agama) et du Chemin (mrga), pour correctement juger de la Bonne Loi ne sont pas mme mesure mdiocre.
a.

Quel est ce double tcheng

(=

sksin, pratibh,

etc.) ?
viii.
1.

Peut-tre des gens

qui possdent V Agama et

Vadhigama (comme

expliqus
p.

39
5).

a),

en d'autres

termes
1.

Vgama

et le

nirga (comme ci-dessous

224, note

nimilite stari lokacaksusi

ksayam

gte sksijane ca bhyas

adrstatattvair niravagrahaih svayatn


[kutrkikaih]

sanam kulatn krtam

//

gte hi ntim paratnm svayambhuvi

[svayambhuvah sanadhrakesu ca j jagaty anthe gunaghtakair (?)\ malair nirankuaih svairam ihdya caryate //

evam kanthagataprnam [viditv munisanam] malnni balaklam ca na pramdyam mumuksubhih.


/

//

La premire stance est cite par I-tsing, Takakusu, p. 106. ston pa hjig rten mig ni zum gyur cin / dban gyur skye bo pbal cher zad pa na / de nid ma mthon ran dgar gyur pa yi / nan rtogs rnams kyis bstan pa hdi dkrugs
so

ran byun ran byun

mgon med pa na

(?) bstan pa gces hdzin rnams / mchog tu zhir gsegs hgro hdoms med yon tan hjoms par byed pa yi / dri mas dgah dgur

den san hdi na spyod de ltar thub pa dag gi bstan pa rnams / stobs dan ldan pahi dus su
kyis

ni
rig

lkog mar srog phyin hdra dan dri

ma

nas

ni

thar pa hdod pa dag gis bag yod

VykhyS nimilite stari lokacaksusti


:

parinirvrte bhagavati lokasya

Hiuan-tsang, xxix,

fol.

a-b.

225

caksurbhte tnrgmrgasamdarsake / anenndhabhtatm lokasya darayati // ksayant gte sksijane ca bhfiyaseti / sksd drastari sks j

mrgmrgajno bhagavn iti ye 'dhigatatattv bhagavatah sksijanah sahyabhtah / tasmin parinirvne kslne / avidyndhdrstatattvair niravagrahair nirankusaih svayamdrstikatay kutarkpannair bhavadbhir bhagavatah sanam granthata crthatas ckulam krtam // gte ht ntim paramm svayambhuvltydi prvaslokoktasyrthasya heturpo 'yam dvityah loka upanyasyate / buddhabuddhapiitresu hi parinirvrtesv anthajagati sanntardhnahetubhir drstydibhir malair dosair nirankuaih svayam yatheccham iha loke 'dya samprati caryate / bhvasdhanam tat j/ tata caivam kanthagataprnam ivety arthah j tad viditv / balaklam ca malnm dosnm na pramdyam mumnksubhir iti bhvas-

dhanam

iti.

15

CHAPITRE IX
Trait de la rfutation de la doctrine du Pudgala
Notes prliminaires
D'aprs la version tibtaine
la rfutation

i.

Neuvime chapitre (Koasthna)

intitul

du Pudgala (gan zag dgag pa bstan pa zhes bya ba mdzod kyi gnas dgu pa, Mdo, 64, Cordier, p. 394)7 Cependant le colophon du huitime chapitre du Bhasya dit que l'Abhidharmakosa se termine avec ce chapitre chos union pahi mdzod kyi bsad pa las sfioms par hjug pa bstan pa zhes bya ba mdzog kyi gnas brgyad paho / chos mnon pai

Expos de

mdzod hdi rdzogs so


D'aprs
D'aprs
le

=
/

[Abhidharmakoabhsye Sampattinirdeo
:

nma

astamam koasthnam sampto 'yam Abhidharmakoah].


colophon de la Vyakhya

Dtermination du Pudgala, annexe du

huitime chapitre
le

(astamakoasthnasantbaddha eva pudgalavinicayah).

Bhasya:
(iv.

Trait de la rfutation du Pudgala

pudgalapratise,

dhaprakarana

73, p. 154),

ou

Rfutation de la doctrine de l'me

tma-

vdapratisedha (v. 27, p. 63). Pour certains commentateurs, la dernire des stances chapitre se rfre au Kosa tout entier pour d'autres
;

finales

du

neuvime

qui paraissent plus

sagaces

la seule Rfutation du
comme
Suivent
les stances p. 224,

Pudgala.
des Vaibhasikas, se termine avec
la

On
viii.

peut considrer

vident que PAbhidharmakoa, expos des doctrines

d'Abhidharma d'aprs
40.

les principes

karika

qui sont la conclusion de l'ouvrage.

Le soi-disant

neuvime chapitre

ne comporte pas de karikas

Vasubandhu

y expose des doctrines dont plusieurs sont communes aux Vaibhasikas et aux Sautrantikas, mais, dans l'ensemble, il se place au point de vue des SautrSntikas.

Samghabhadra ne s'occupe pas du


Les stances
place la
fin

neuvime chapitre

p. 224, sont,

disons-nous, la conclusion du Kosa. Paramrtha les


viii
;

de son chapitre

Hiuan-tsang, au contraire, en

fait le

prambule

du chapitre du Pudgala
ii.

ix.

Pour

cette raison

videmment que

le

Trait de la rfutation
1).

s'accroche, si on peut dire, ces stances (voir p. 230, n.


rfute la doctrine des Pudgalavadins, partisans
:

du Pudgala , et les dsigne comme Vatsputryas. La Vyakhya explique vtslputrly ryasmmatyh (p. 232, n. 2). Les sources (Vasumitra, Bhavya, Vintadeva) ne sont pas d'accord dans l'numration des sectes ou coles qui admettent le Pudgala. On trouvera quelques indications dans Nirvana, 1925, p. 34, et dans la version du trait de Vasumitra que nous esprons publier dans la Collection de Matriaux pour l'tude du Bouddhisme de M. J. Przyluski.

Vasubandhu

228
La question
est trs net
:

RFUTATION DU PUDGALA OU CHAPITRE


fut

IX.

pose

si les

Pudgalavdins sont des Bouddhistes. Yasomitra

On ne : prtend pas qu'ils ne puissent pas obtenir la dlivrance, puisqu'ils sont des Boud-

na

hi

Vtslputrynm muktir nesyate bauddhatvt


Opinion oppose

p. 273 (Hiuan-tsang, xxx, fol. 6 b Pudgalavadin est rang avec le Tlrthika. Lcan-skya hu-thug-tu exprime une opinion trs rpandue en disant que les cinq coles du Mahasmmitya, admettant que le moi est une personne , ne peuvent tre considres comme bouddhistes (Wassilief, p. 270).
.

dhistes

(voir p. 232, n. 2).

in fine) et stances finales

le

Sfintideva (Bodhicaryavatara,
l'intrieur

ix.

60)

* Les partisans du Pudgala, infidles de

(antacaratrthika), admettent une me (tman) nomme Pudgala, et disent que cette me n'est ni identique aux skandhas, ni diffrente des skan-

dhas : autrement on

verrait qu'ils entrent

dans

le

systme des infidles

Ils

se disent bouddhistes,

saugatammanya.
vi.

CandrakTrti (Madhyamakavatara,

86)

Les infidles {tlrthika) parlent de


supposs n'ont aucune

pudgala,
activit, le

etc.

voyant que

le

pudgala
;

et autres principes

Bouddha

dclare que la seule pense est active.

Dire

les infidles ,

une manire de parler gnrale car il y a des bouddhistes ( des sectateurs de ce Dharma ) qui admettent le pudgala. D'un certain point de vue (rnam pa gcig tu na ekaprakrena), ils ne sont pas des bouddhistes, car, comme les infidles, ils ne comprennent pas exactement le sens de l'Enseignement. Par consquent, cette dsignation [d'infidles] s'tend tous. Il est dit dans la Ratnavall Le monde, avec les Samkhyas, Vaisesikas, Nirgranthas, croit au pudgala, aux skandhas, d'autres principes. Demandons-lui s'il enseigne le moyen de passer au del de l'tre et du non-tre [ou bien s'il passe au dessus de l'affirmation et de la ngation de l'existence] .... Par consquent il faut considrer comme des hommes du dehors (bhya) ceux qui croient aux skandhas, etc. [On voit que les partisans des skandhas (skandhavdin), c'est--dire les Bouddhistes
c'est

orthodoxes du Petit Vhicule, sont,


la

comme

les partisans

du j)udgala, exclus de

Bonne
iii.

Loi.]

gan sag

Etymologie classique de pudgala, reprsente dans la version tibtaine et dans la chinoise (Mahavyutpatti, 207, 7) tsng kin : pryati galati
:

ca (Sarvadarana, Sarad Candra Das, S. Lvi, trad. du Stralamkara, p. 259 dont le dmrite augmente, dont le mrite diminue, et inversement ). Buddhaghosa, Visuddhimagga, 310 pun ti vuccati nirayo tasmin galantti puggal. L'Abhisamayalamkarloka, expliquant Astashasrika, 19, 2, propose l'tymologie punah punar gatisu llyate, qui se reflte dans la traduction de Hiuantsang chou ts'i ts'i, qui, plusieurs reprises, prend les gatis. Astashasrika sattvadrsty jvadrsty pudgaladrsty bhavadrsty vibhavadrsty ucchedadrstyh svatadrstyh svakyadrsty etsm evamdynnt drstlnm prahnya dharmam deayisyatlti tenrthena bodhisattvo
: : : :

mahsattva ity ucyate. loka tatrhamkrdhnrthena tm hito 'hamkra etasminn iti krtv j sldantmakatvt sattvah jvitendriyavasena nikyasabhge pari:

NOTES PRLIMINAIRES.

229
/

sampte vartata itijvah / punah punar gatisu llyata iti pudgalah virbhavatiti bhavah j tirobhavatiti vibhavah j nstdnlm abht prvam ity ucchedah [prasajyate] asti yac [ca] svabhvena na tan nstti asvatah / tmatmtykrena paiicaskandhadarsanam / evamdynm drstnm ....

On remarquera que
Kosa,
v. 7, p.

l'tymologie de sattva est celle que nous avons rencontre

16 (lecture de S. Lvi)

Buddhaghosa
p.

Sur d'autres synonymes de Pudgala, ci-dessous

la fin).

tire satta de sakta, etc. 245 (Hiuan-tsang, xxix, 14 b

iv. Parmi les documents qu'il faudra comparer au prsent Trait de la rfutation du Pudgala, il convient de signaler 1. Kathvatthu, i. 1 (traduction de S. Z. Aung et Mrs Rhys Davids, Points of controversy) 2. Vijnanakaya, Nanjio 1281, chap. ii. (traduit ou analys dans Etudes Asiatiques, 1925, i. p. 358-376) 3. Sammitlyasfistra, Nanjio 1272 (dont une analyse sera publie dans la Collection de Matriaux pour l'tude du Bouddhisme de J. Przyluski). Vasubandhu a tir parti de ces deux
: ;

les notes de Stralamkara d'Asanga (dit et traduit par S. xviii. 92-103, dpend dans une certaine mesure du Trait de Signalons par exemple la discussion des rapports du feu et
:

derniers traits

quelques indications ce sujet dans

notre traduction.
Lvi, 1907-1911),

D'autre part,

le

l'emploi des
gala.

mmes

textes scripturaires, la

Vasubandhu. du combustible, dmonstration de l'inactivit du Pudix.

La dpendance de Sntideva (Bodhicaryavatara, par exemple commentateur l'gard de Vasubandhu est non moins vidente.
sur

73) et de son

Les observations de Vasubandhu sur l'inaptitude d'un tman transmigrer, le combustible et le feu, se retrouvent dans Madhyamakastras, x. 14, xvi. 2. Toute la rfutation du Pudgala dans Candrakrti, Madhyamakavatara, est on
par Vasubandhu, par exemple
vi.

dirait inspire

146

Quelques-uns soutiennent

Pudgala dont on ne peut dire qu'il soit identique aux skandhas ou diffrent des skandhas, permanent ou impermanent il est connu par les six vijnnas il est l'objet de l'ide de moi . Vasubandhu rencontre dans son petit Trait, non seulement les partisans du Pudgala, bouddhistes quoique hrtiques, mais encore des htrodoxes, les Grammairiens, les Samkhyas, les Vaisesikas. Il cite Varsaganya (v. 27, trad. p. 63). Il a, sur les positions de ces htrodoxes, des prcisions qu'on pourra comparer la tradition rdige par Paramartha et K'ouei-tchi (Takakusu, T'oung-pao, 1904,
l'existence relle d'un
;

JRAS.
v.

1905).

Pudgalavadin, non signal ici, est indiqu dans la Vyakhya 85 de l'd. de Petrograd). Le Stra dit caksus rpni drstv na nimittagrahl ... Ayant vu les visibles par l'il, il ne conoit pas d'affection ... >. Puisque l'il voit, c'est donc que le Pudgala voit par l'il =s yasmc caksuh pasyati tasmt pudgalas caksus pasyati. Ci-dessous p. 244, n. 3.
de
i.

Un argument du
42
(p.

deux hypothses sont admises que Vasubandhu attribue la mort , cyuti, la pense (citta) ou au Pudgala. Buddhaghosa, Manorathapran, i. 95, dans des termes qu'approuverait Vasubandhu, explique pourquoi Bhagavat parle du Pudgala, bien que le Pudgala
iii.

Dans Vyakhya de

43

a, les

n'existe pas.

230

RFUTATION DU PUDGALA OU CHAPITRE

IX.

Est-ce donc qu'il n'y a pas de dlivrance en dehors de cette doctrine

en dehors du Bouddhisme en s'appuyant n'y a pas de dlivrance en dehors de d'autres doctrines ?


(dharma)
'

sur

Il

cette

doctrine, car les autres doctrines sont

corrompues par une fausse


le

conception du

moi

Le moi

tel

que

conoivent les autres docla srie des lments


ls
;

trines n'est pas

une expression mtaphorique de

(skandhasamtna), mais un moi substantiel indpendant des


la rvolution de la triple existence,

ments. Par la force de la croyance ce moi naissent les passions

ou cercle des

trois sphres, se

poursuit

la dlivrance est impossible.

kim khalv ato 'nyaira mokso nstti na pramdyam mumuksubhir vacand ayant eva moksopyo nsty ato 'nyo moksopyas tad atra moktukmaih pramdo na kartavya ity arthd uktam cryena codakah prcchati kim khalv ata iti vistarah.
1.
/

iti

Vasubandhu

vient,

de dire

(p.

224)

Ceux qui dsirent


.

la dlivrance
Il
:

doivent

s'appliquer sans dfaillance cette doctrine

C'est dire:

n'y a pas de dli-

vrance en dehors de cette doctrine


n'y a pas de dlivrance
2.
....

L'objectant reprend

Est-ce donc qu'il

vitathtmadrstinivistatvd
...

iti

vitathym tmadrstau nivisth ku-

tirthyh

On a le raisonnement nsti kapilolkdinm moksah / vitathtmadrstinivistatvd adrstatattvapurnsavat j atmagrhaprabhav ca kleh. 3. A ce sujet, la stance du Stotrakara (= Matrceta, Takakusu, I-tsing, p. 156)
:

shamkre manasi na amam yti janmaprabandho nhamkra calati hrdayd ttnadrstau ca satym anyah st jagati ca yato nsti nairtmyavdi nnyas tasmd upasamavidhes tvanmatd asti mrgah II Aussi longtemps que l'esprit (manas = citta) est accompagn de
/

l'ide

de

je , la srie

des naissances ne peut s'arrter; l'ide de

je ne s'carte pas

du

cur aussi longtemps qu'y existe la vue qu'il y a une me (tman). Or il n'y a pas dans le monde de matre qui enseigne l'inexistence de l'me (nairtmyavdin), except toi. Donc, il n'y a pas, en dehors de ta doctrine, un autre chemin de
la dlivrance .

Comparez

les stances

attribues l'carya, Bodhicaryvatarapanjika, 492

yah pasyaty fmnam tasyham iti ssvatah snehah / sneht sukhesu trsyati trsn dosms tiraskurute .... De mme Candraklrti, Madhyamakavatara, vi. 120 (cit Madhyamakavrtti, Voyant par la prajn que toute passion et tout mal (klesa, dosa) p. 340)
:

viennent de l'ide de moi (satkyadrsti)

se rendant
.

compte que

l'objet

de cette

ide est l'me (tman), l'ascte (yogin) nie l'me

Hiuan-tsang, xxix,

fol.

8 b-9

a.

231
qu'une dsigna-

Comment savons-nous que


[9

ce

nom

de

moi

n'est

tion de la srie des lments, et 'qu'il n'existe pas de

moi

en soi

a]?

Parce
moi
est
il

qu'aucune preuve n'tablit l'existence d'un moi


ni

indpendant des lments,


tion \ Si le
entits
1
,

preuve d'vidence, ni preuve d'induc-

une

entit relle,

part,

comme

sont les autres

faut qu'il soit atteint par la connaissance d'vidence

comme
sont

sont atteints les objets des cinq connaissances sensibles et de la con-

naissance mentale

'*,

ou par

la

connaissance d'induction

comme

atteints les cinq organes matriels qui sont matire subtile.

En
dans

effet,

ces cinq organes sont connus par induction.

On constate
:

le

monde

que, malgr la prsence des causes gnrales, le fruit


si

ne se produit pas
t.

les

causes spciales font dfaut


2, 4
:

pour que la
asamskrtas
:

Kiokuga

cite
;

le

commentaire de Vijnaptimatra,

a.

les

n'existent pas

b. ce qui existe

fasti-dharma
;

= bhva)
comme

est de trois sortes

choses connues par vidence, matire (couleur), pense; choses


et
les

comme

les

cruches

vtements (hin-cheu-yng-fa)
;

choses

les

organes (yeu-ts-

yng-fa)

c.

trois

conceptions du moi
ni diffrent.

identique aux skandhas, diffrent des

skandhas, ni identique 2. L'gama, preuve

d'autorit,

n'est pas

mentionn parce

qu'il

rentre dans

Yanumna,
3.

induction.
;

Entit

= bhva

Hiuan-tsang traduit yeou-fa qui rappelle

atthidhamma

de Buddhaghosa.
4. pratyaksam upalabdhir iti pratyaksam ity upalabdhiviesanam / pratyaksam tad upalabdhih pratyaksata upalabdhir ity arthah athav pratyaksam pramnam upalabdhir upalabhyate 'nay ity upalabdhih
j /

Sur Yupalabdhi,

i.

trad. p. 30,

ii.

trad. p. 177,

Stralamkara,

p. 155.
:

L'objet de la connaissance mentale est dfini par Yasomitra

[upalabdhir]

dharmdyatanasya vedandilaksanasya yogivisayasya ca = perception du dharmyalana (c'est--dire vedan, etc.) et des choses que peroivent les
Yogins.
|

En

effet la

connaissance mentale des Yogins connat la pense et les

mentaux d'autrui, vii. 11]. Mais comment la perception (upalabdhi) par le manas peut-elle tre pratyaksam, immdiatement ? En effet le manas qui vient de passer est connu par le manas qui suit immdiatement (i. 17) manasas ca kim pratyaksam upalabdhih I samanantaraniruddham hi mano 'nantarotpannena manovijnnena vijnyate. Il y a l une difficult. D'autres matres (SautrSntikas) pensent que
:

la

pense se connat elle-mme


:

le

sujet et l'objet de la connaissance sont, l'un

raktam va dvistam va sukhasamprayuktavn va duhkhasamprayuktam va [iv. 49] ity evamdi svasamvedyatay [pratyaksam] ity apare tad etad dvividham pratyaksam grhyagatam grahakagatam va.
et l'autre, vidents
/

232
pousse naisse,

RFUTATION DU PUDGALA OU CHAPITRE


il

IX.

faut

non seulement

l'eau, la terre, l'effort


les

humain,
prsence

mais encore

la

semence. De mme,
etc.

causes gnrales

de l'objet extrieur, attention,

fussent-elles

ralises, les aveules

gles et les sourds ne voient ni n'entendent, tandis

que

non-aveugles

et les non-sourds voient et entendent. Chez les premiers manquent,

chez les seconds existent les causes spciales de la connaissance


visuelle
faits

ou auditive

ce sont les organes, organes matriels qui sont

d'une matire invisible et impalpable, et qu'on ne connat que


'

par induction.

En

ce qui concerne

un moi indpendant des lments,

ni vidence,

ni induction.

Nous savons donc qu'un moi


il

rel n'existe pas.

Le Vatslputrya,
examiner

est vrai,

admet un Pudgala qui


que
les

n'est ni identique
2
.

aux lments (skandha),


si

ni autre

lments

Nous devons
comme

S'il

ce Pudgala existe

comme
ou
3

entit

(dravyatas) ou

dsignation (prajnaptitas), d'une existence nominale.


part ou en soi,

existe

comme

la couleur

le

son, le Pudgala existe

comme
le lait,

entit. S'il n'est


il

qu'une collection ou un complexe,


dsignation [9
b].

comme

existe
1.

comme

yam caksurvijnndikranam
2.

maharsipranidhijnnaparicchinnatvd asty eva caksurdikam indriiti / sarvesm avivdc ca. Voir i. 9 c (Vy&khyfi, p. 25), 44 a. Sur pranidhijnna, vii. 37.
Vtsputriy ryasmmatiyh
/

anena vitathtmadrstinivistatvala-

ksano hetur anaikntika iti darayati / na hi vtsputrynm mokso nesyate bauddhatvt atha va prkpaksavirodhah / spakslo 'yam pakso nsty tm ity anena darsayati. De deux choses l'une. Les Vatsputrlyas croient une certaine sorte de moi
I

rel

or

ils

sont bouddhistes, et on ne nie pas qu'ils puissent obtenir la dlivrance


tort

donc l'auteur a eu
dlivrance.

de dire qu'une conception fausse du moi

fait

obstacle la

Ou bien la thse qui nie le moi est fausse. Sur Yavaktavyat du Pudgala, voir par exemple Madhyamakavrtti, 283. 3. rpdivad bhvntaram ced dravyatah. / ksrdivat samudyas cet prajnaptitah / La couleur, le son, etc. sont des choses distinctes fbhinnalaksana) ; le lait, la maison, l'arme sont des complexes de couleur-saveur-odeur-tangible, de paillebois, d'lphants-chevaux-chars, non pas des choses part, bhvntara le lait
:

n'est pas autre

que

la couleur, etc.
xviii.

Comparer Stralamkara,
vyato

92 prajnaptyastitay vcyah pudgalo dra:

na

tu.

Hiuan-tsang, xxix,

fol.

9 a-b.
la

233

Le VatsTputrlya.
hypothse ?
Si
le

Quel mal admettre

premire ou la seconde

Pudgala

est

une

entit,

il

sera diffrent des lments, parce

que sa nature est


des autres
;

part,
il

comme

les

lments sont diffrents

les

uns

ou bien

sera produit par des causes [et donc ne sera


le dites, et

pas ternel

comme

vous

vous aurez
:

nommer

ses causes],

ou bien

il

sera inconditionn (asamskrla)


;

et c'est l

une doctrine
donc vain de

non-bouddhique (trthikadrstiprasangah)

inconditionn, le Pudgala
'.

sera d'ailleurs sans emploi (nihprayojanatva)


croire
le

Il

est

que

le

Pudgala

est

une

entit.

Mais

si

vous confessez que

Pudgala n'existe qu'au

titre

de dsignation, vous abandonnez votre

doctrine et vous vous rangez notre avis.

Le Vaslputrlya.
soit

Je dis que
dis

le

Pudgala

est

je ne dis pas qu'il

une

entit

je ne

pas

qu'il
:

existe seulement en tant

que

dsignation des lments (skandhas)

pour moi

la dsignation

Pud-

gala

a lieu par rapport aux lments


2

(skandhn updya)

actuels,

internes, assums.

Rponse d'aveugle (andhavacana)

par rapport ? Si vous expliquez

dhn lambya (lambya


1.

= = grhltv, apeksya), vous arrivez dire


:

! Que signifie cette expression skandhn updya skan:

Yasomitra

cite la

stance de Dharmaklrti

varstapbhym kim vyomnas carmany

asti tayoh

phalam
//
;

carmopamas
Sarvadarsana,
varttika Si le
:

cet so

'nityah khatulyas ced asatphalah


ii.

p.

10 (1858); Nyayavarttika,

1,

5,

Tatparya, 164

dans Slokaest

khatulyas ced asatsamah ; Naiskarmyasiddhi, ii. 60, etc. Pudgala est inconditionn (asamskrta), ternel, non modifiable,
il

il

semblable l'espace,

est

comme

n'existant pas. Existe seulement ce qui est

capable d'action

thse Sautrantika

pour

(arthakriy), ce qui est momentan (yat sat tat ksanikam) : les Vaibhasikas, les asamskrtas (espace et deux nirogi zin pahi

dhas,
2.

i.

c) existent.

da

ltar gyi

nan

phun po rnams rgyur byas nas gan zag

tu

hdogs

so

= [pratyutpanndhyttnikopattaskandhn] updya [pudgalah prajnaPour


le

pyate].

VatsTputrlya

comme pour Vasubandhu

les

skandhas du pass
et

et

du

futur n'existent pas.

Kosa,

Le sens des expressions dhytmika (ou abhyantara) i. 34 d, 39 a-b.

uptta

est expliqu

234

RFUTATION DU PUDGALA OU CHAPITRE

IX.

La dsignation
:

Pudgala

a lien en prenant
est

les

lments

comme
les l-

objet

c'est reconnatre

que Pudgala

un mot dsignant

ments

de

mme

que la dsignation
lait,

lait

a lieu en prenant pour

objet les constitutifs du

couleur, etc. Si vous expliquez

skandhn
que ce sont

updya
lments
les

=
,

skandhn prattya
conclusion.

(== prpya)

en raison des

mme

Vous admettez, eu

effet,

lments qui sont la cause (pratyaya) de la dsignation


.

Pud-

gala

Le VatsputrTya.
et ses relations
le

Ce

n'est pas ainsi

que

je conois le
le

Pudgala
conoit
le
:

avec

les lments,

mais bien

comme

monde
[10 a]
;

feu et ses relations avec le combustible.

Le monde conoit
'

feu

par rapport au combustible


le

(indhanam updya)
le

il

ne

conoit pas

feu

indpendamment du combustible

il

croit

que

le feu n'est ni

identique au combustible ni autre que

combustible.

Si le feu tait autre que le combustible, le combustible ne serait pas

chaud
le

si le

feu tait identique au combustible, le

combur
Pudgala

serait

comburant. De

mme
;

nous ne concevons pas

le

comme
que

indpendant des lments


tique
les

nous tenons que

le

Pudgala
:

n'est ni iden-

aux lments
il

ni

autre que les lments


ternel

s'il

tait autre

lments,
;

serait

(ssvata)

et

donc
il

inconditionn

(asamskrta)

s'il

tait identique

aux lments,

serait susceptible

d'anantissement (uccheda).
Dfinissez le feu et le combustible, pour que j'entende
signifie l'expression
:

mieux ce que
.

le

feu par rapport au combustible


dirai-je ?
:

Le Vatsputrya.
bustible
;

Que vous

Le combur,

c'est le

com-

le

comburant,

c'est le feu

si

vous voulez une rponse, voil

la rponse.

Mais

c'est

prcisment ce que je veux savoir avec prcision

quelle

est la chose qu'on

nomme

le

combur, quelle est

la

chose qu'on

nomme

le

comburant ?
/

1. yathendhanam updygnih prajnapyata iti dravyasan pudgalah nnyo nnanya iti svam updnam updya prajnapyamnatvt yo hi bhvo nnyo nnanya iti svam updnam updya prajnapyamnah sa dravyasams tad yathgnir iti vtsputriybhipryah
/ /

Hiuan-tsang, xxix,
Le VatsTputrlya.

fol.

9 b-10

b.

235

brler,

Dans

le

monde,

la chose
'

non flam-

bante, le bois, s'appelle combustible,

combur

la

chose qui exerce

l'action de brler, brillante, trs chaude, flambante, s'appelle

combu-

rant, feu.

Par

ceci, le feu, la srie

qui constitue cela, le combustible,

est

mise en ignition (idhyale

dlpyate), est rduite en cendres


le

(ddhyate

=
'
;

bhasmikriyate)

par

feu,

il

se fait

que chaque

moment

d'existence de la srie du combustible diffre du prcdent.


et le

Le feu
tible

combustible sont, l'un


le feu

et l'autre, constitus

par huit

substances

cependant
le lait

nat en raison (pratitya)

du combuslait

comme

ferment
le

et le vinaigre naissent

en raison du
dire

et

du

vin. C'est

pourquoi

existe par rapport


S'il

monde est d'accord pour (updya) au combustible . [10


le

que

le

feu

b]

en est ainsi,

feu est autre que le combustible, car leurs

poques sont

diffrentes

(bhinnakla)

d'abord

le

combustible,

ensuite le feu. Si votre Pudgala existe par rapport aux lments

comme

le feu

par rapport au combustible, vous devez admettre que,


il

naissant en raison des lments,


est en outre transitoire

est autre

que

les lments, et qu'il

(anityas ca prpnoti).

Le VatsTputrlya.

Dans

la chose

enflamme,

bois, etc. \

une des

substances, savoir cette sorte de tangible qui est la chaleur (us-

man),
Mais

c'est le feu

les autres

substances sont

le

combustible.

Donc

vos remarques sur l'antriorit du combustible ne portent pas.


le

feu et le combustible,

naissant

en

mme

temps, sont

autres

(anyatva), car leurs caractres sont distincts (laksanapar rapport


attribue

bhedt) \ Le sens que vous attribuez l'expression


1.

apradlptatu ksthadikam

indhanam

....

La Vyakhya

ce

paragraphe l'auteur, non au Vatsputrya.


et dahyate sont quivalents. asfadravyaka (ii. 22) les quatre mahbhtas, substances lmentaires, et les quatre updyarpas, du rpa (visible) au tangible. 4. tatraiva ksthdau pradpta iti tadubhayalaksane samudye. La
2.

Pour certains commentateurs idhyate


:

3.

chose en ignition (pradpta) est un complexe


et

elle est

la fois

comburant

(feu)

combur (indhana) : en

effet cette
;

chose est constitue par quatre substances


celle

lmentaires (ci-dessous
c'est l le feu.
5.

p. 235, n. 2)

de ces substances qui est

chaleur

La

terre et l'eau sont diffrents, car leurs


et

laksanas

diffrent

de

mme

en

ira-t-il

du comburant

du combur.

236

RFUTATION DU PUDGALA OU CHAPITRE


Puisque feu
et

IX.

n'est pas encore expliqu \

combustible naissent en

mme
tible ?

temps,

comment
le

dire

que

le

feu existe par rapport au combusl'objet

Le

feu, qui est

une des substances de

en ignition, n'a

pas pour cause


objet,

combustible, qui est les autres substances du dit

puisque toutes ces substances naissent en

mme

temps chacune

de sa cause.
ait

On

ne peut pas dire non plus que l'appellation


le
2

feu

pour cause (ou objet)

combustible, puisque cette appellation


.

s'applique au tangible

chaleur

Le VatsTputiya.
tible s'entend

L'expression
le

le

feu par rapport au

combus'

dans ce sens que


le feu

feu co-existe avec le combustible

(sahabhva) ou que
C'est dire

le

combustible pour support (sraya).

que

le
:

Pudgala co-existe aux lments ou


doue admettre
qu'il diffre

qu'il s'appuie

sur les lments

c'est

des lments. Et la

logique veut aussi que, de

combustible manque, de
lments.

mme que le feu n'existe pas quand le mme le Pudgala n'existe pas dfaut des
ces conclusions
;

Vous n'admettez pas

donc votre explica-

tion est sans valeur [11 a].

Le VatslputrTya rappelle
n'est pas diffrent

qu'il

a montr
car,

(p.

234

1.

15)

que

le feu

du combustible,

dans

cette hypothse, le

com-

bustible ne serait pas chaud.

Nous

lui

demanderons quelle

est la nature

du

chaud

S'il

dfinit le

chaud

comme
a

tant le tangible

chaleur

[c'est--dire le

feu], ainsi qu'il

fait ci-dessus,

alors le combustible ne sera pas


l'objet

chaud [puisque
ble chaleur

le

combustible est
S'il

en ignition, moins

le tangi-

].

entend par
le

chaud

ce qui est associ la

chaleur,

[s'il

admet que

combustible est

nomm chaud
ity

en raison

1.

updyrthas

tu

vaktavya

iti

ananyatvd

abhipryah.

Il

faut

donner de l'expression
le 2.

updya une

explication qui justifie la thse que le feu et

combustible ne sont pas diffrents.

(indhanam) tasya (agneh) kranam j npi tatprajtapteh. = trois mahbhtas ; le feu, usmalaksana le quatrime mahbhta. Ils naissent en mme temps comme les deux cornes. 3. Il faut comprendre indhanam updya = indhanam ritya le feu prend point d'appui sur le combustible. Ou bien le sens est celui de sahabhva,

na

hi tat

Le combustible

co-existence,

sahotpda, co-naissance.

Hiuan-tsang, xxix,
de son association la chaleur],
[de la
le seul

fol.

10 b-11

b.

237

c'est

donc que des choses diffrentes

chaleur

sont

nommes

chaud

par

feu est dsign

tangible
le

chaleur

tout ce qui est associ ce tangible est


ainsi, c'est confesser

dsign par

combustible

nom de chaud . Penser est nomm chaud quoique


Le VatsTputrya
le

que

le

diffrent

du feu ou tangible
le

chaleur

'.

n'est pas fond

dire que

feu n'est

pas diffrent du combustible puisque

combustible est chaud.

Le VatsTputrya.
on
le

Le bois en

ignition,

on

le

nomme

combustible,

nomme

aussi feu.
le

Expliquez donc

sens que vous attribuez l'expression

le

feu

par rapport (updya) au combustible

Le Pudgala (donn

actif

du

rapport

de

Yupdna)
)
:

sera identique aux lments (donns


tablir la

passifs

du

dit

rapport

aucun raisonnement ne pourra

non-identit.

La

thse du VatsTputrya, que le Pudgala existe par

rapport aux lments

comme

le

feu par rapport au combustible, ne

peut en aucune hypothse tre rationnellement tablie.

Le VatsTputrya soutient que


lments.

le

Pudgala

est ineffable

(avaktavya)
les

en ce qui concerne sa relation, identit ou non-identit, avec

Gomment

peut-il distinguer cinq catgories de choses


2
:

susceptibles d'tre connues

1-3. les

choses conditionnes (samskrta)


;

ou, en d'autres termes, les choses passes, prsentes, futures

4. les

choses non causes (asamskrta) et


[11 b] Le Pudgala, en
effet,

5.

l'ineffable [ou

Pudgala]

doit tre aussi ineffable ce point de


ni qu'il est
3

vue

s'il

est ineffable,

on ne peut dire

une cinquime

catgorie, ni qu'il n'est pas

une cinquime catgorie.

Examinons quoi
se rapporte

se rapporte cette expression


le

Pudgala

Si elle

aux lments,

Pudgala existe seulement en tant que

dsignation (prajnaptisat), puisque l'expression Pudgala se rapporte


Paramartha
ce qui est chaud de sa nature

1.

S'il dit

[,

le feu,] est

nomm
,

chaud. L'objet en question (combustible), quoique diffrent du feu chaud de sa


nature, devient chaud par son association avec ce qui est chaud de sa nature

nous concluons
2.

qu'il n'y

a pas dfaut dire que feu et combustible diffrent.


Ci-dessous
p. 243, n. 1.

pancavidham jneyani

Voir

Sammityanikaya-

sastra.
3.

Stcherbatski, p. 832, diffre.

238

RFUTATION DU PUDGALA OU CHAPITRE


et

IX.

aux lments
Pudgala

non pas un Pudgala. Si


le

elle se
dit

rapporte un
la dsignation
:

Pudgala, pourquoi

VatsTputrTya nous

a-t-il

que
Il

est

par rapport aux lments


.

aurait d dire

par rapport au Pudgala


soit tabli
soit

Mais, en

fait,

il

ne soutient pas que

le

Pudgala

par rapport au Pudgala.

Reste que l'expression


'

Pudgala

une simple dsignation des lments.

Le VatsTputrTya.
dhesu),
le

Quand
est peru

les

lments sont donns (satsu skan:

Pudgala

(upalabhyate)
est

voil pourquoi j'ai dit

que

la dsignation

Pudgala

par rapport aux lments.

Mais, dirons-nous, la couleur est perue quand sont donnes diverses causes, l'il, la lumire, etc.
tion couleur est

faut-il

en conclure que la dsigna

par rapport ces diverses causes


six connaissances
tact, et

Autre point. Par laquelle des


de
l'il,

connaissances

de l'oue, de l'odorat, du got, du

connaissance men-

tale

le

Pudgala

est-il

peru (upalabhyate) ?
les six

Le VatsTputrTya.
en seconde ligne

Par
le

connaissances. Lorsque la connais-

sance visuelle connat la couleur

et la figure (== le corps), elle discerne


et

Pudgala
la

3
,

nous pouvons donc dire que

le

Pudgala

est

connu par

connaissance visuelle. Mais la relation du

Pudgala avec

la couleur-figure, identit
les

ou diffrence,
:

est indicible.

De mme pour

autres connaissances

lorsque la connaissance
et les

mentale connat

les

dharmas
a],

(la

pense
;

mentaux

), elle

discerne en seconde ligne le Pudgala

celui-ci est

donc connu par


les

la

connaissance mentale [12


taux est indicible.

mais sa relation avec

pense-men-

traduirait peut-tre mieux est constat . rpasypi prajnaptir vaktavy, caksuradisu satsu tasyopalambht tni caksurdlny updya rpam prajnapyata iti. 3. [caksurvijneyni rpni pratitya pudgalam] prativibhvayatty upalaksayati tadupdnatvt j no tu vaktavyo rpni va no vety atallaksanatvd avaktavyatvc ca. Le chinois fn pie koan protge la version discerner . En raison des couleurs, etc., que l'il peroit [comme son objet
1.
:

On

2.

propre], la connaissance visuelle

connat indirectement
le

connat en seconde

ligne

le

Pudgala, parce que les couleurs sont


le

support

(updna) du Pudgala.
.

Et on ne peut pas dire que

Pudgala

soit les couleurs

....

Hiuan-tsang, xxix,
Il

fol.

11 b-12

a.

239

rsulte de cette explication

mme

que

le

Pudgala, tout

comme

le lait, existe

seulement en tant que dsignation. Lorsque la connaislait,

sance visuelle connat la couleur du


ligne, le lait
:

elle discerne,

en seconde

le lait est

donc connu par

la connaissance visuelle et

on ne peut dire que

le lait soit la
'.

diffrent de la couleur

mme chose que la couleur ou soit De mme pour l'odorat, le got et le tact la
:

connaissance du tact connat


le lait

le

tangible

d'o connaissance du

lait

est donc connu par la connaissance du tact sans qu'on puisse


le lait

dire

que

soit identique

au tangible, diffrent du tangible.


2
:

En

effet le lait n'est

pas quadruple
;

donc

il

n'est pas couleur, odeur,

saveur, tangible

et,

d'autre part, on ne peut pas penser que le lait

ne

soit

pas

fait

de ces quatre.

La conclusion s'impose

on dsigne

mtaphoriquement par
que
etc.

Pudgala

un complexe d'lments, de

mme

la dsignation lait s'entend d'une runion de couleur, d'odeur,

Simples nominaux sans

ralit.

Quel sens attachez-vous cependant la formule


connaissance visuelle connat la couleur-ligure,
4

Lorsque
discerne

la

elle

en

seconde ligne

le

Pudgala

Voulez-vous dire que la couleur-

figure est la cause de la perception


la perception

(upalbdhi) du Pudgala ? ou que

de la couleur-figure

et

du Pudgala a

lieu

en une

fois ?

1.

caksurvijneyni ced rpni pratitya ksiram prativibhvayati caksur-

vijneyni ksiram
2.

vaktavyam no tu vaktavyam rpni va no mbht kslrodakayo catustvaprasangah.

va.

3. yath rpdlny eva samastni samuditni ksiram iti udakam iti va prajnapyante tath skandh eva samasth pudgala iti prajnapyanta iti siddham. 4. Le BhSsya porte caksurvijneyni rpni pratitya pudgalam prativibhvayatlti ko 'sya vkyasyrthah / kim tvad rpni pudgalopalabdheh kranam hosvid rpny upalabhamnah pudgalam upalabliata iti yadi tvad rpni pudgalopalabdheh kranam bhavanti na ca tebhyo 'nyo vaktavyah evam tarhi rpam apy lokacaksurmanasikrebhyo 'nyan na vaktavyam tesm tadupalabdhikranatvt / atha rpny upalabhamnah pudgalam upalabhate kim tayaivopalabdhyopalabhate hosvid anyay / yadi tayaiva rpd abhinnasvabhvah pudgalah prpnoti rpa eva va
:

idam rpam ayam pudgalah katham idam paricchidyate athedam na paricchidyate katham idam pratijnyate rpam apy asti
tatprajnaptih
/ /

pudgalo

'py astity

upalabdhivaena hi tasystitvam pratijnyate.

240

RFUTATION DU PUDGALA OU CHAPITRE

IX.

Si le VatsTputrTya rpond que la couleur-figure est la cause de la

perception du Pudgala

et que,

cependant, on ne peut dire que

le

Pudgala

soit diffrent

de la couleur-figure

[12 b] les conditions et


Pudgala en
si

causes de la perception de la couleur, il, lumire, acte d'attention,

ne seront pas non plus diffrentes de

la couleur.

Si le VatsTputrTya rpond qu'on peroit le

mme
le

temps

que

la couleur-figure

',

nous demanderons

on peroit

Pudgala

par l'opration par laquelle on peroit la couleur-figure ou par une


opration distincte.

Dans
est

la

premire hypothse,

le

Pudgala

n'est

que couleur-figure

et

la dsignation
Il

Pudgala

porte uniquement sur la couleur-figure.


:

donc impossible de distinguer


.

Ceci est couleur-figure

cela

est

Pudgala

Faute de cette

distinction,

comment

tablir qu'il y a

couleur

et qu'il

y a Pudgala ? L'existence (astitva) du Pudgala ne

peut tre tablie que par cette distinction.

Dans
diffre

la

seconde hypothse, l'poque des deux perceptions tant

diffrente, le

Pudgala diffrera de

la couleur-figure

comme

le

jaune

du bleu,

comme

l'antrieur diffre

du postrieur.

Mme

raisonnement pour

les autres lments.

Le VatsTputrTya.
gala soit la

De

mme

qu'on ne peut pas dire que

le

Pud-

mme

chose que la couleur-figure, ni non plus

qu'il soit

diffrent de la couleur-figure, de

mme
dire

la perception

du Pudgala

n'est

ni la perception de la couleur-figure, ni autre

que cette perception.

Ce point de vue vous obligera


(voir

que

la perception

du Pudgala,

tant ineffable, ne fait pas partie de la catgorie du


ci-dessus p. 237
1.

conditionn

20)

or vous n'admettez pas cette thse,

puisque, pour vous, toute perception est


Si le

conditionne

Pudgala

est

une

entit qu'on

ne peut dfinir

comme
(les

tant

matire (l'lment rpa), ni

comme

tant non-matire
etc.)

quatre

lments immatriels, vedandskandha,


Dans
:

[13

a],

pourquoi Bhagadu

1.

cette hypothse la couleur-figure n'est pas cause de la perception


il

Pudgala

pakse na

y a perception du Pudgala par rapport la couleur-figure (dvitiye tu kranatvam kim tarhi rpny updya pudgalopalabdhih).

Hiuan-tsang, xxix,
vat
a-t-il dit

fol.

12 a-13

b.

241

que

La matire

et les autres

lments ne sont pas un

moi

'

Le Pudgala,

dites-vous, est atteint par la connaissance visuelle.

Cette connaissance nat-elle en ayant


la couleur-figure,

pour condition (pratyaya)

ou

le

Pudgala, ou les deux ?

Dans
effet,

la

premire

hypothse, on ne peut pas soutenir que cette connaissance peroive

(upalabh)

le

Pudgala, car

le

Pudgala

n'est pas l'objet

(lambana)

de cette connaissance, pas plus que

le son.

En

toute connais-

sance qui nat ayant pour condition (pratyaya) une certaine chose a
cette chose
ii.

pour

condition en qualit d'objet

(lambanapratyaya,

62

c)

le

Pudgala, n'tant pas la condition de la connaissance


l'objet.

visuelle,

ne peut en tre

Donc
les

la connaissance visuelle ne
elles

peroit pas le Pudgala.

Pour

deux autres hypothses,

contredisent

le

Stra, lequel dit que la connaissance visuelle nat en


2
,

raison de deux choses

savoir de

l'il et

de la couleur-figure. Le

Stra
(hetu)

dit

Bhiksus, la connaissance visuelle nat ayant pour cause

l'oeil et

pour condition (pratyaya


3

= lambanapratyaya)
est

la

couleur-figure.
et

Toute connaissance visuelle


.

en raison de

l'oeil

de la couleur-figure
Si le

Pudgala

est cause de la connaissance visuelle,


le

il

sera imper-

manent (anitya), car

Stra

dit

Toutes

les causes, toutes les


.

conditions qui produisent la connaissance sont impermanentes

Le Vatsputrya.
l'objet, la

Admettons donc que

le

Pudgala

n'est pas

condition en qualit d'objet (lambana), de la connais-

sance (vijnna). [13 b]


Fort bien
;

mais alors

il

n'est pas discernable (vijneya), objet


il

du

vijnna
1.

s'il

n'est pas discernable,

n'est pas connaissable (jneya),

2.

rpam antm vijnnam antm. dvayam prattya non pas en raison


....
... ;

de

Comparer Samyutta,
trois.
:

iv.

166.

3. Samyukta, 9, 6. La VyakhyS cite les premiers mots caksur bhikso hetur [caksurvijnnotpdya / rpam bhikso pratyayah ....]. Vyakhya hetur sannah pratyayah / viprakrstas tu pratyaya eva // janako hetuh pratyayas tv lambanamtram ity apare / paryyv etv ity
:

apare.

Voir

ii.

61

c, vii.

13

a, p. 32, 34.

16

242
objet du

RFUTATION DU PUDGALA OU CHAPITRE

IX.

jnna;

s'il

n'est pas connaissable,

comment

tablir qu'il

existe? Si on ne peut tablir qu'il existe, votre systme croule. [Voir


p.

244, n. 2, 248].

Vous avez
ces
*.

dit

que

le

Pudgala

est discern par les six connaissanil

Mais,

s'il

est discern par la connaissance visuelle,


;

sera,

comme
figure.

la couleur-figure, diffrent du son


il

s'il

est discern par la

connaissance auditive,

sera,

comme

le son, diffrent

de la couleur-

Et ainsi de

suite.

D'ailleurs votre thse est en contradiction avec le Stra.


dit
:

Le Stra
tact) ont

Brahmane,

les cinq

organes (vue, oue, odorat, got,

des domaines (gocara), des objets (visaya) distincts. Chacun d'eux


sent (anubhavati) son propre domaine, son propre objet
2
,

et

ne sent

pas

le

domaine,

l'objet des autres.

Et l'organe mental sent


et ceux-ci

le

domaine,

l'objet des cinq

premiers organes,

ont l'organe mental pour


le

refuge

3
.

Ou

bien confesserez-vous, d'accord avec

Stra, que

1.

Saeki Kiokuga a une note

(fol.

14 a) sur la thorie Darstantika des six

vijnnas.

Donc aucun d'eux ne sent le Pudgala. Madhyama, 58, 12 svakam gocaravisayam pratyanubhavanti / nnyad anyasya gocaravisayam pratyanubhavati / mana caism pratisaranam. Samyutta, v. 218 paiicimni brhmana indriyni nnvisayni nngocarni niinamannassa gocaravisayam paccannbhontij katamni panca .../ imesam kho pancannam indriynam nnvisaynam nngocarnam na annamannassa gocaravisayam paccanubhontnam mano patisaranam mano ca nesam gocaravisayam paccanubhoti. Sur la formule mana caism pratisaranam, la Vyakhya dit anusangenedam uktam I nedam udharanam j tathpi tu mana caism indriynam pratisaranam iti tadapeksnlndriyni vijnnotpattau kranam bhavantty
2.
3.
: : :

arthah.
Vibhasa, 97, 5. Les DarstSntikas disent L'objet des six vijnnakyas, caksurvijnna, etc., est distinct . Ils disent Le manovijnna a un objet distinct il ne porte pas sur l'objet des cinq vijnnas, caksurvijnna, etc. Us disent Les six vijnnas portent seulement sur les objets extrieurs ils ne portent pas sur les organes internes (dhytmika, voir p. 231), ni non plus sur le vijnna . Pour rfuter cette opinion, on explique que les cinq premiers vijnnas ont un objet distinct, portent seulement sur les objets extrieurs, ne portent pas sur les organes et le vijnna ; mais que le manovijnna a un objet commun
:

avec les cinq vijnnas et aussi un objet diffrent, qu'il porte sur les organes

Hiuan-tsang, xxix,
le

fol.

13 b-14

a.

243

Pudgala
il

n'est pas l'objet (visaya) [des cinq organes] ?

Dans

ce

cas,

n'est

pas discern [par

les cinq
'

organes]

vous vous mettez en

contradiction avec votre systme.

Le VatsTputrlya.

[Vous
un
.

affirmez, d'aprs le Stra, que


le

chacun

des cinq organes a un objet propre, et vous concluez que


n'est pas objet de la connaissance visuelle
....]

Pudgala
le

Mais, d'aprs

Sutra,

l'organe mental lui aussi a


tion avec votre systme]

objet propre [et ceci est en contradiceffet,

En

le

atpranakopamastra
3

dit

Ces six organes ont chacun un objet propre, un domaine propre


;

[14 a]

chacun recherche son

objet,

son domaine
six organes
;

Ce Sotra n'entend pas parler des


de voir, d'entendre,
la connaissance

car les cinq organes

matriels et les cinq connaissances qui en dpendent n'ont pas dsir


etc.

Par organe

de

l'il, etc.,

ce Stra entend
l'il, etc.
4

mentale qui est induite

et

domine par

internes et aussi sur


dix-huit

le

vijnna.

dhtus

treize sont l'objet

du son, etc., qui sont aussi l'objet 1. Les mots entre parenthses d'aprs Hiuan-tsang.

Il a t expliqu, Koa, i. 48 a, que parmi les du seul manovijina l'exclusion du visible, du caksur vijnna, etc.

Bhsya
kriyate]
I

et

VySkhya

na

ced visayah [yadi

vijneyah [tatas sus p. 237 n. 2).


Paramfirtha
:

na va pudgalo visaya iti [yadi stram pramnna kasya cid vijiinasya visayah] na tarhi ca pancavidham jneyam iti svasiddhnto bdhyate] (Ci-des:

Ou

bien

le

Pudgala

n'est pas objet. S'il n'est pas objet,

il

n'est

pas discern par


2.

les six connaissances.

En
;

dpit du Stra, vous affirmez que l'objet de la connaissance mentale est

gnral

de mme, en dpit du Stra, nous affirmons que

le

Pudgala est

discer-

nable par la connaissance visuelle.


3. Samyukta, 43, 10, Ekottara, 32, 4, Samyutta, iv. 198. sad imnndriyni kukkurapaksisrglainmrasarpamarkath sat prnanngocarni kh kena cid baddh madhye granthim krtvotsrsth / te svakam svakam gocaravisayam ktksante / grtnkamanodakavalmikavanknksand evam sad imnndriyni 4. Le dsir (knksana) de voir, d'entendre, etc., est certainement tranger
....

....

aux organes de la vue, de aussi aux connaissances


kalpakatvt).
Il

l'oue, etc.,

qui sont matriels (rpasvabhvatvt), et

visuelle, auditive, etc., qui sont inimaginatives (nirvi-

s'agit,

sous

le

nom

d'organe de

l'il

(caksurindriya), de
,

la

connaissance mentale induite par l'action


organe, taddhipatydhyhrta.

souveraine

spcificatrice,

de cet

244
Par
le fait, la

RFUTATION DU PUDGALA OU CHAPITRE


connaissance mentale qui est isole

IX.

c'est--dire qui

n'est pas induite et

domine par un des cinq organes matriels, mais

seulement par l'organe mental


et

n'a pas dsir

l'endroit

du domaine

de l'objet des cinq organes, mais seulement l'endroit du dinarle

myatana. Donc demment cit.


Bhagavat a
dit

Satpranakopama ne contredit pas

le

Sotra prc-

Bhiksus, je vous dclare tous les

dharmas

qui

doivent tre pntrs (abhijneya) et compris (parijheya) (nanta-

rya

et

vimuktimrga), savoir
le

l'il,

la couleur-figure (rpa), la

connaissance visuelle,

contact visuel, la sensation qui est produite


l'il,

ayant pour cause

le

contact de

sensation pnible, plaisante, ni


:

pnible ni plaisante
est produite

Et ainsi de suite jusque


le

la

sensation qui
:

ayant pour cause

contact de l'organe mental

voil ce
les

qui doit tre pntr et compris.

Ce

texte

nous apprend que

dharmas
d'tre

pntrer et comprendre sont seulement ceux numrs.


figure pas dans la liste
:

Le Pudgala ne

donc
la

il

n'est pas susceptible

discern (vijneya).

En

effet

connaissance spculative
le

(prajn) par laquelle on pntre

et

comprend, a

mme domaine
bj.
2

(visaya) que la connaissance vulgaire (vijnna) [14

Le docteur qui soutient que


que
l'il voit

l'il voit le

Pudgala
le

doit apprendre

seulement ce
:

qu'il

y a de rel dans

Pudgala [ savoir

la couleur figure
qu'il voit

de

mme
3

pour

les cinq autres organes].

En

disant

un moi dans ce qui

n'est pas

un moi,

il

tombe dans l'abme

de la mauvaise opinion.

sabbam bhikkhave abhinnparinneyyam / kim ca 1. Samyutta, iv. 29 bhikkhave abhinnparinneyyam / rpam bhikkhave abhinnparinneyyam /
:

cakkhuvinnnam
2.

prajnvijnnayoh samnavisayatvt.
D'aprs Hiuan-tsang.

Comparer Vasumitra, Sectes,


:

sur jneya, vijneya, abhijneya.

Paramartha Le docteur qui croit au moi dit Je au moyen de) l'il comme il voit qu'il y a un moi dans (y) ce qui n'est pas un moi, il tombe ... . Le Bhasya contient le mot antman que la VySkhyS glose caksus caksurDonc il faut comprendre le y de ParamSrtha dans le vijnnenety arthah. sens de l'instrumental Comme il voit, par ce qui n'est pas un moi c'est--dire
3.
:

vois le Pudgala par (yeu

par

l'il,

par la connaissance visuelle

....

Hiuan-tsang, xxix,
Aussi
les
le

fol.

14 a-b.

245

Bouddha a-t-il expliqu que l'expression Pudgala dsigne S'appuyant sur lments. Dans le Stra de l'homme il dit
',
:

l'il,

ayant pour objet


;

et condition la couleur-figure, nat la

connais;

sance visuelle

en raison de la rencontre des

trois nat le contact

en
2

mme
les

temps naissent

la sensation, la notion, l'acte d'attention, etc.

Les quatre derniers termes, vijnna, vedan, samjfi, cetan, sont


lments (skandhas) immatriels (arpin)
;

l'il

et la couleurdit

figure sont l'lment rpa. Voil tout ce dont

on parle quand on

homme

Pour exprimer diverses nuances, on se

sert de divers

vocables, tels que saUva, tre, nara,

homme, manuja, n de Manu,


la

mnava, jeune homme, posa,


jantu, qui nat
3
,

qui se nourrit, jva, principe vital,

pudgala, personne. On en parle


, et

premire per:

sonne

Mon

il voit la couleur-figure
est de tel
tels

d'aprs l'usage courant

Ce vnrable

nom
tel

(Devadatta), de telle famille, de


tel
il

tel

gotra (Kasyapa), de
telle

aliments, de

bonheur

et

de

telle peine,

de

dure de vie
:

il

dure

temps

termine sa vie de
is

telle

mani-

Stcherbatski

This idea of yours that there

an existing

self

who through
is

the opening of his eyes contempltes other selves, this idea

it is

which

called

Wrong Personnalism . De la formule caksus rpni


Pudgala
1.

drstv, on peut tirer la conclusion que

le

voit par l'il,


:

Cullaniddesa,

Vyakhy ad i. 42, p. 85 (d. de Petrograd). On a dans 234 cakkhun puriso lokati rpagatni. Ci-dessous 254, n. 3.

D'aprs Paramartha et Hiuan-tsang.

Stcherbatski
texte bien

In the Ajita-sermon
:

2.

Version de Paramartha.

C'est

le

rpni cotpadyate caksurvijrinam / Voir iii. 32 a-b (Hiuan-tsang, x. 7 b). sahajt vedan samjii cetan .... ju Hiuan-tsang nara s na ramate, mnava 3. Paramartha transcrit leitv-kumra, jantu qui nat . t'ng Un commentaire YogacSra cit par Saeki Kiokuga sattva, parce que tous les ryas voient en vrit qu'existent seulement les dharmas, pas autre chose ou bien parce qu'il y a affection l (sattva de sakta, comme dans Buddhaghosa ?) manoja (i-chng), parce que constitu par le manas .... pudgala, parce qu'allant

caksuh prattya traynm samniptah sparsah /


connu

plusieurs reprises prendre

les destines

sans pouvoir s'en dgoter jva, parce


;

que vivant actuellement par l'union avec Yyus (Kosa, ii. 45) jantu (cheng), parce que tous les dharmas qui existent sont munis de naissance. D'autres listes contiennent treize noms. Parmi ceux-ci yaksa, Suttanipfita, 875. Sur sattva, Ledi Sadaw, JPTS. 1914, 1&3, Mrs Rhys Davids, Buddhist Psycho;

logy, 1914, 83.


p. 228-9.

On

a vu que sattva signifie

qui prit

, v.

p. 16 et ci-dessus

246
re
'.

RFUTATION DU PUDGALA OU CHAPITRE

IX.

Bhiksus, sachez que ce sont l seulement des manires de

dire,

[15 a] des paroles, des expressions conformes l'usage du


Car, dans
le

monde.

Pudgala

il

n'y a que des choses impermanentes, condi.

tionnes, nes des causes et conditions, cres par l'acte

Bhagavat dclare que

les

Stras de sens explicite sont

le recours,

sont l'autorit. Le Sotra que nous venons de citer est de sens explicite
;

on ne peut en fournir une explication divevgente.

1.

Voir ci-dessous,

p.

256, n.

1.

, points d'appui , est cit Vyakhya ad ii. catvrlmni bhiksavah pratisaranni j katamni catvri / dharmah pratisaranam na pudgalah j arthah pratisaranam na vyanjanam / nltrtham stram pratisaranam na neyrtham / jnnam pratisaranam na vijnnam. Mah&vyutpatti, 74, o l'ordre diffre arthapratisaranena bhavitavyam na vyanjanapratisaranena, dharma..., jiina..., nltrthastrapratisaranena... (Extrait du Hin-yng, Nanjio, 1177, Tokio, xviii. 7, 10 a). Dharmasamgraha, 53 Sutralamkara, xviii. 31-33; J. As. 1902, ii. 269, Madhya-

2.

Le Sotra des quatre

autorits

46, trad. p. 226:

makavrtti, 268, 598.

Pratisarana, pratisarana (Divya, 427,


fiance) est traduit

22,

176, 26,

l'diteur traduit

con-

rtonpa
I,

(confiance) et rten-pa (point d'appui), * (point d'appui),

liang
i.

(autorit).
xvii.

Bodhisattvabhmi,

kathatn bodhisattvas catursu pratisaranesu prayujyate. iha bodhisattvah arthrth parato dharmam rnoti na vyaiijanbhisamskrrthi j arthrth dharmam rnvan na vyanjanrthl prakrtaypi vca dharmam desyamnam arthapratisarano bodhisattvah satkrtya
srnoti.

punar bodhisattvah klpadesam mahpadesam ca (Dgha, ii. 124, etc.) yathbhutam prajnti prajnan yuktipratisarano bhavati na sthavirenbhijiinena va pudgalena tathgatena va samghena va ime dharm bhsit iti pudgalapratisarano bhavati sa evam yuktipratisarano na pudgalapratisaranas tattvrthn na vicalati aparapratyaya ca bhavati dharmesu. [aparapratyaya gzhan las ses ma yin, Madhyamakavrtti, xxiv. 8]. punar bodhisattvas tathgate nivistasraddho nivistaprasda aikntiko vacasy abhiprasannas tathgatantrthastrampratisarati na neyrtham / nltrtham sfram pratisarann asamhryo bhavaty asmd dharmavinayt tatra hi neyrthasya strasya nnmukhaprakrtrthavibhgo 'niscitah santdehakaro bhavati sacet punar bodhisattvo ntrthe "pi stre 'naikntikah syd evam asau samhryah syd asmd dharmavinayt. punar bodhisattvah adhigamajnne sdars (?) bhavati na ca ruta/ /
/

Hiuan-tsang, xxix,
D'ailleurs
existe,
il

fol.

14 b- 15

a.

247
Si je dis que tout
i.

1.

Bhagavat

dit

un Brahmane

s'agit des

douze sources de la connaissance (yatana,

cintdharmrthavijnnamtrake / sa yad bhvanmayena jnnena jntavyam na tac chakyam srutacintvijnnamtrakena vijntum iti viditv

paramagambhirn api tathgatabhdsitn dharmn srutv na pratiksipati

prmnyam prakitam bhsitasydrthasya yukteh sstur bhvanmayasya cdhigamajnnasya. exprime dans Mahvagga, i. 23, 4, ii. arthah pratisaranam .... Notion Majjhima, ii. 240; dveloppe dans Lanka: arthapratisaranena bhavitavyam... et encore arthnusrin bhavitavyam na desanbhilpbhinivistena. La

npavadati / evam .... caturnm

syllabe

est

comme

le

doigt qui touche l'objet qu'on doit voir

il

faut retirer
fol. 34).

le

doigt pour voir l'objet (Lanka cit dans Subhasitasamgraha, d. Bendall,

Sur

les relations

de Vattha et des vyanjanas, Dgha,

iii.

127-129, Nettippaka-

rana, 21.
iii.

dharmah pratisaranam na pudgalah.

Variante

yuktipratisarano

bhavati na pudgalapratisaranah. Le refuge est la vrit en soi, non l'autorit de qui que ce soit, mme du Bouddha. C'est la doctrine de Majjhima, i. 265. Celui qui dit Ces dharmas sont enseigns par un Sthavira, une personne possdant les abhijns, le Tath&gata, le Samgha,
il

est

pudgalapratisarana

Ne
iv.

pas perdre de vue la doctrine des mahpades&s, ci-dessous p. 252, Le Stra nitdriha est le Stra vibhaktdrtha, de sens explicite
;

n. 2.
le

Stra

neyrtha
iv. 39, p.
Il

est de sens indtermin, de sens dterminer

(Vyakhya ad
soit

iii.

28).

96, solliciter un Stra de sens explicite.


le

Vasumitra, Sectes.
ici

semble que

seul texte canonique intressant


;

Anguttara,

i.

60

attribuer au Tathagata ce qu'il n'a pas dit

ne pas reconnatre
le

comme

dit

par

lui

ce qu'il a dit

considrer

comme neyyattha

Suttanta ntattha et inversement.


iii.

[La thorie du Stra exact dans la lettre mais mal compris, Dgha, peut mener la distinction des Stras ntattha et neyyattha].

127-128,

et neyyattha dans Nettippakarana [dont le sens est conforme la yatharutavasena natabbattham, dont le sens doit tre dtermin par la et dans Dlpavamsa (d. Oldenberg, rflexion, niddhretvd gahetabbattham] p. 36) cit dans l'Introduction au Commentaire de Kathavatthu (JPTS. 1889, p. 3). Confondre le pariyyabhsita et le nippariyyabhasita (comparer Visuddhi-

Nitattha

lettre,

magga, 473, 499 ce qui ne doit pas tre pris au pied de la lettre, et ce qui doit tre pris au pied de la lettre), le nitattha et le neyyattha attribuer ce qui est dit avec une certaine intention (samdhaya bhanita) un autre sens [que le
:

vrai sens]

ainsi, respectant la lettre

dtruire le sens

confectionner de simili-

Stras

....

.
:

Nous pserons le sens du Stra que lu allgues .... . Samghabhadra, iii. 25 (Tokio xxiii. 4, 33 b 16). D'aprs le Sthavira, toute Yry desand promulgue par le Bouddha lui-mme (tathgatabhsita ss

AtthasalinT, 91

248 20
a).
il
'

RFUTATION DU PUDGALA OU CHAPITRE

IX.

Donc

si le

Pudgala
;

n'est pas

compris dans

les

douze yaqu'il est

tanas,

n'existe pas

s'il

est inclus,

on ne doit pas dire

ineffable.
2.

Les VatsTputrlyas

lisent

un Stra qui

dit

Tout

ce qu'il y a

d'oeil,

tout ce qu'il y a de couleur-figure

le

Tathagata, Bhile

ksus,

embrassant

cet

ensemble [ savoir que

les

douze yatanas],

nomme
soi
.

tout
il

, tablit

tout existe, autant de


:

Or
est

n'y a pas l de Pudgala


entit relle ?

dharmas en comment peut-on dire que le

Pudgala

une

ahaccavacana de Nettippakarana, 21), c'est nitrthastra; les autres Stras sont antrtha. Samghabhadra observe d'abord que cette dfinition ne se trouve pas dans l'Ecriture ensuite, qu'elle est mauvaise en raison car il y a des Stras non
;
:

promulgus par
exemples.
Il

le

Bouddha qui sont nltrtha


:

et inversement.

Suivent des
(ou

est dit
:

Il

est impossible de dire, sinon par

abhimna
le

pr-

somption

J'entrerai dans

Ynimitta sans m'appuyer sur

vide

[Cette

parole n'est pas de

le Stra est nltrtha] dans Wassiliev, 329, dans Madhyamakavatara, vi. 94, ne distribuent pas d'accord les Stras dans les deux catgories. v. On a vu que, d'aprs le Bodhisattvabhmi, Y adhigamajiina est la connaissance de recueillement (bhvanmaya), tandis que le vijiina est la connais-

Bouddha lui-mme, cependant


voit

Les Ecoles,

comme on

sance obtenue par l'audition et


D'aprs les Vibhajyavfidins,
est associ

la rflexion
\e

(rutacint)
;

bon en soi le vijnna est bon quand 8 b, p. 33, n. 3] ce qui peut s'entendre que le jnna est le savoir supramondain , et que le vijnna, savoir mondain, est bon lorsqu'il est conscutif au savoir supramondain. D'aprs iv. 75, opinion des anciens matres , Yadhigata (ce qu'on connat dans le recueillement) fait partie du vijnta : mais il s'agit d'une connaissance
est
il

jnna

jnna

[Kosa,

iv.

mondaine, d'un recueillement mondain.

[Jnna, dans le Stra des quatre Pratisaranas, dsigne par excellence Yansravajnna, le savoir des ryas tout comme la Prajna est, parmi toutes les la prajii pure]. prajiis qui peuvent tre avykrta, klista, kusala,
;

Ci-dessus

p. 244, n.

1, 2.

Quelques notes Madhyamakavrtti, xxv. 16, p. 65, 74. Le jnna est distingu du vijnna dans la Glt, iii. 41, vi. 8, vii. 2, ix. 1, xviii. 42. Tout, c'est--dire les douze yatanas, l'il, etc. 1. Samyukta, 13, 16 porte Kosa, v. trad. p. 64, Mahaniddesa, 133, Samyutta, iv. 15 sabbam vuccati dvdasyatanni. Sur sarva, sabba, Kosa, v. 27 c, Warren, p. 158, Mrs Bhys Davids, Points of controversy, 85, Stcherbatski, Central conception, 5 Nirvana (1925), p. 139. celui qui plusieurs 2. Hiuan-tsang traduit ici Pudgala ss chou tsiu tsiu
:

reprises prend les naissances

voir ci-dessus p. 245, n. 3.

Hiuan-tsang, xxix,
3.

fol.

15 a-b.

249

Le Bimbisarastra

dit

Le

sot ignorant Prthagjana, s'attachant

aux dsignations, s'imagine


ni

qu'il

y a un moi

or

il

n'y a l ni moi,
futurs, prsents

mien

mais seulement des dharmas douloureux,


'

et passs.
4.

La

sainte (arhat) religieuse Sila

dit

Mara [15

bj

Tu

tom-

bes dans de mauvaises opinions (kudrstigata) en maintenant tort


qu'il

y a un tre dans la masse des conditionns (samskras) qui


:

sont vides

les

savants comprennent que cet tre n'existe pas. De


le

mme
ments.
5.

qu'on donne
le

nom
:

de char la masse des parties,


il

le

monde
l-

emploie

mot
le

tre

faut savoir que c'est la

masse des

Dans

Ksudrgama

\ le

Boudd