Vous êtes sur la page 1sur 226

O PUBLIC

MBRAL

LO PBLICO
EN EL UMBRAL
Los espacios y los tiempos,
los territorios y los medios

Editores
Mariano Fernndez
Matas David Lpez
Director
Carlos Giordano
Coordinadores Editoriales

Paula Porta, Bianca Racioppe


y Lucas Daz Ledesma

LO PBLICO EN EL UMBRAL
LOS ESPACIOS Y LOS TIEMPOS,
LOS TERRITORIOS Y LOS MEDIOS

LO PBLICO EN EL UMBRAL
LOS ESPACIOS Y LOS TIEMPOS,
LOS TERRITORIOS Y LOS MEDIOS
Editores
Mariano Fernndez y Matas David Lpez

Director

Carlos Giordano
Coordinadores editoriales

Paula Porta, Bianca Racioppe y Lucas Daz Ledesma

Lo pblico en el umbral : los espacios y los tiempos, los territorios y los medios /
Mariano Fernndez ... [et.al.] ; dirigido por Carlos J. Giordano ; edicin
literaria a cargo de Mariano Fernndez Alt y Matas David Lpez. - 1a ed. -
La Plata : Universidad Nacional de La Plata, 2013.
E-Book.
ISBN 978-950-34-1045-5
1. Ciencias de la Comunicacin. I. Fernndez, Mariano II. Giordano, Carlos J. ,
dir. III. Fernndez Alt, Mariano, ed. lit. IV. Lpez, Matas David , ed. lit.
CDD 302.2

Diseo de tapa e interior: Jorgelina Arrien


Los artculos includos en esta compilacin fueron sometidos a referato.
Convocatoria inicial a cargo de Paula Porta y Vernica Vidarte Asorey

Derechos Reservados
Facultad de Periodismo y Comunicacin Social
Universidad Nacional de La Plata
Primera edicin, noviembre 2013
ISBN 978-950-34-1045-5
Hecho el depsito que establece la Ley 11.723
6HSHUPLWHHOXVRFRQQHVDFDGpPLFRV\SHGDJyJLFRVFLWDQGRODIXHQWH
y a los autores.
Su infraccin est penada por las Leyes 11.723 y 25.446.

NDICE
PRLOGO
Por Mariano Fernndez y Matas David Lpez ....................

PRESENTACIN
Discutir el Espacio de Lo Pblico
Por Nora Rabotnikof .............................................................. 13
CAPTULO I
Lo pblico como lugar practicado.
Regulaciones sociales, temporalidades colectivas
y apropiacin diferencial de la ciudad
Por Ramiro Segura ................................................................. 18
CAPTULO II
La problemtica de la masa en la mediatizacin actual,
Por Sandra Valdettaro ........................................................... 47
CAPTULO III
3RVWQHROLEHUDOLVPRFRUSRUDWLYLVPR\FRQLFWRVSROtWLFRV
notas acerca del espacio pblico en Argentina y Ecuador
Por Soledad Stoessel ............................................................... 67
CAPTULO IV
El acceso a lo pblico. Agendas, espacios-tiempos
mediticos y transformaciones de los dispositivos
Por Gastn Cingolani ............................................................. 90

CAPTULO V
Tiempo, distancia e intermediacin
en el espacio pblico mediatizado
Por Mariano Fernndez ........................................................ 115
CAPTULO VI
Primeras aproximaciones a la esfera pblica virtual
Por Mariano Vzquez ............................................................ 138
CAPTULO VII
Pblico, privado, ntimo: las tramas de la vida social
Por Vanina Papalini .............................................................. 164
CAPTULO VIII
Lugares de vida. Nueva escena de espacios culturales
emergentes de exhibicin en la ciudad de La Plata
Por Matas David Lpez ........................................................ 189

SOBRE LOS AUTORES ............................................................... 219

PRLOGO
Por Mariano Fernndez y Matas David Lpez

Hemos concebido este trabajo bajo el impulso de la convoca-


toria que, en 2012, abri el Instituto de Investigaciones en Comu-
nicacin de la Facultad de Periodismo y Comunicacin Social de
la UNLP. Desde el principio, nos propusimos dos objetivos que
tal vez hayan resultado complementarios.
3RUXQODGRTXLVLPRVSURPRYHUXQDUHH[LyQTXHDVXPLHUD
como objeto de anlisis la temporalidad, objeto que no por difcil
de aprehender es menos constitutivo de aquello que, tradicional-
mente, concebimos como espacio pblico. Al mismo tiempo,
nos interesaba tomar como punto de partida la inestabilidad del
estatuto de lo pblico, tensionado, como est, por la yuxtaposicin
entre las experiencias mediatizadas y no mediatizadas de la vida
colectiva y por el debilitamiento de las perspectivas tradicionales,
particularmente aquellas orientadas por pretensiones normati-
vas. Nos interesaba revisar sus manifestaciones presentes sin ne-
cesidad de ponderarlas por sus distancias con un ideal estilizado.
'HDOOtWDPELpQHOpQIDVLVVREUHODPHGLDWL]DFLyQSHURHYL-
tando ciertos lugares comunes, casi consuetudinarios, de la cr-

tica a los efectos de las tecnologas mediticas sobre el espacio


pblico. Si la mediatizacin le ha hurtado al concepto de espa-
FLRS~EOLFRXQUHIHUHQWHSUHFLVRWDPELpQKDFRODERUDGRFRQOD
anulacin de los lmites (fsicos, normativos, deseables, impl-
FLWRV GHORTXHSXHGHLQJUHVDUDORS~EOLFRSURGXFLUVHHQpOR
de cualquiera de las condiciones que adquieran las propiedades
que, segn propone Rabotnikof, pueden sintetizar la semntica
de lo pblico desde sus orgenes: lo visible, lo abierto y lo comn.
$VXYH]HOHVSDFLRS~EOLFRFRPRLPDJLQDULRHVWiJHQpWLFD-
mente ligado a la organizacin poltica de la comunidad y, quizs
por eso, se nos impone con la potencia de una tradicin de pen-
samiento que le ha dado densidad normativa: lo pblico es un
gran depsito de ideales y expectativas. No conviene renunciar
VLQPiVDHVHKRUL]RQWHTXHWDPELpQIXQFLRQDFRPRXQDSRWHQWH
arma de crtica. Sin embargo, no parece posible, en la actuali-
dad, sostener la equivalencia entre pblico y poltico.
Como se ve, no podemos decir que nos moviera una hiptesis
clara; era ms bien una intuicin (sobre las formas de ese des-
plazamiento de lo pblico entre el mundo no meditico y el de la
mediatizacin; y entre los imaginarios espaciales y la temporali-
dad de la experiencia social). Intuicin estimulada, a su vez, por
una incomodidad que nos negamos a ahuyentar con prejuicios
tericos o simplemente, con prejuicios a secas: nos incomodaba,
SUHFLVDPHQWHODGLFXOWDGSDUDQRPEUDUHVRTXHQRVLQWLWXEHRV
LGHQWLFDPRVFRPRXPEUDO
Podemos confesarlo sin rubor: todava nos debemos una de-
QLFLyQSUHFLVDVREUHHOXPEUDO(QQXHVWUDLQWXLFLyQLQLFLDOHO
umbral remita a un imaginario espacio-temporal: un interme-
GLRGHHQWUDGDVDOLGDHQHOFXDOWDPELpQVHSXHGHSHUPDQHFHU
DXQTXHQRLQGHQLGDPHQWH\HQHOTXHTXHGDQORVUDVWURVGHO
pasaje entre un polo y el otro. Es decir: el umbral como respues-
ta a la pregunta sobre el estatus, la entidad, la localizacin, la

duracin, la emergencia o la dilucin de lo pblico. El umbral


entendemos- es el presente, pero no como mera actualidad sino
como historicidad hecha de rupturas, trozos, continuidades,
SDVDMHV3UHJXQWDVUHH[LRQHV\UHVSXHVWDVVLHPSUHLQTXLHWDV
por el presente. Probablemente, en la lectura acumulada del
conjunto de artculos aqu reunidos termine por ofrecer un prin-
FLSLR GH GHQLFLyQ 2 QR &RPR VH VDEH D YHFHV QR HV SRVLEOH
corresponder con respuestas apuradas a las preguntas urgentes.
En cualquier caso, esta fue la sospecha que nos moviliz:
que los espacios y los tiempos, en los territorios y en los me-
GLRVJXDUGDQOyJLFDVHVSHFtFDVSHURHVWiQVRPHWLGRVWDPELpQ
a pasajes internos (entre territorios, entre medios) y externos
(entre territorios y medios). En esos umbrales se puede apreciar
el devenir de vidas individuales y colectivas; all se suceden ex-
periencias comunes y se construyen subjetividades o se pugna
SRUFRQVWUXLUODVDOOtWDPELpQVHSURGXFHQFRQLFWRVDSRGHUD-
mientos y expropiaciones, imposiciones y resistencias. La inten-
cin de este libro es indagar en esos umbrales para aprehender
estas dimensiones yuxtapuestas, imbricadas, en tensin, de lo
pblico en el espacio y en el tiempo.
El otro objetivo se vinculaba con los autores a los que hara-
mos extensiva la invitacin a participar de la propuesta. Nos
pareci una opcin justa y estimulante integrar investigadores
con trayectoria e investigadores en formacin, pero lo hicimos
siguiendo un criterio preciso: que el espectro de invitados abar-
cara perspectivas, y por lo tanto preguntas, categoras, proble-
mticas e incluso lenguajes diversos. Es que como objeto de la
UHH[LyQLQWHOHFWXDOHOHVSDFLRS~EOLFRQRVUHVXOWDXQIHQyPHQR
desbordante. Desborda las perspectivas, los conceptos y tam-
ELpQORVUHIHUHQWHV
Expuestos los objetivos, debemos decir que nos gustara que
este libro se insertara en un campo de discusin abierto y plural,

TXHORJUDUDHVWLPXODUHQHOHVSDFLRDFDGpPLFRDOJXQRVGHEDWHV
\UHOHYDUSUREOHPDV\OtQHDVGHLQGDJDFLyQHQFXUVR<SRUTXp
QRTXHDSRUWDUDPDWHULDOHV\UHH[LRQHVSDUDHQSHUVSHFWLYD
abrir nuevos espacios sobre los temas y problemticas que aqu
nos convocan.
El modo en que est organizado el trabajo no guarda una
OyJLFDVXFHVLYDRGHDQLGDGWHPiWLFD/DOHFWXUDSRUORWDQWR
puede hacerse de manera aleatoria, segn las preferencias del
posible lector. An as, una breve, mnima, presentacin de los
artculos que componen este volumen es tal vez necesaria.
El primer artculo, escrito por Ramiro Segura, se titula Lo
pblico como lugar practicado. Regulaciones sociales, tempora-
lidades colectivas y apropiacin diferencial de la ciudad. Partien-
do de un postulado general (lo pblico es la puesta en prctica,
contingente, de un lugar) y de una posicin terico-poltica (la
necesidad de no idealizar el espacio pblico, y al mismo tiempo,
de conservarlo como una herramienta de crtica del presente)
Segura indaga en las experiencias urbanas, desplazamientos,
interacciones de los habitantes residentes en un barrio de la pe-
riferia (el autor habla de espacios segregados) de la ciudad de
La Plata.
La problemtica de la masa en la mediatizacin actual, es-
crito por Sandra Valdettaro, es el segundo artculo del libro. La
autora interroga algunos fenmenos contemporneos de rebe-
liones polticas (por caso, la denominada Primavera rabe), en
los que la intervencin sobre el espacio pblico est precedida
o articulada con intercambios en las redes sociales, recurriendo
a la descuidada nocin de masa. Volviendo sobre un clsico
OLEURGH(OtDV&DQHWWL9DOGHWWDURSURSRQHXQDGHQLFLyQVHJ~Q
la cual la masa es un dispositivo de contacto que se caracte-
riza por inversin del temor a ser tocado. Y an ms: la masa

opera como una red poltica en la que se anudan los cuerpos


reales y la digitalizacin, uno de cuyos efectos es la produccin
de un nuevo espacio-pblico poltico.
(Q 3RVWQHROLEHUDOLVPR FRUSRUDWLYLVPR \ FRQLFWRV SROtWL-
cos: notas acerca del espacio pblico en Argentina y Ecuador,
6ROHGDG 6WRHVVHO SURSRQH XQD UHH[LyQ VREUH HO HIHFWR TXH OD
intervencin de actores corporativos produce sobre el espacio
S~EOLFRTXHIXQFLRQDVLPXOWiQHDPHQWHFRPRVXSHUFLHGHLQV-
cripcin de demandas y como recurso de legitimacin. El trabajo
VH EDVD HQ XQ HVWXGLR FRPSDUDWLYR GH GRV FRQLFWRV UHFLHQWHV
en Argentina y Ecuador. En el primer caso, la autora estudia las
lgicas corporativas de la Mesa de Enlace durante el llamado
FRQLFWRGHO FDPSR HQ HO DxR HQ HO VHJXQGR HO PRWtQ
policial, acompaado por sectores de las Fuerzas Armadas, que
en septiembre de 2010 se opuso al gobierno de Rafael Correa a
UDt]GHODDSUREDFLyQGHOD/H\2UJiQLFDGH6HUYLFLR3~EOLFR
En el cuarto captulo, titulado El acceso a lo pblico. Agen-
das, espacios-tiempos mediticos y transformaciones de los dis-
positivos, Gastn Cingolani, entiende a la mediatizacin como
un modo de administrar y disponer espacios y tiempos que so-
SRUWDQODDUTXLWHFWXUDGHORTXHVHUiQDOPHQWHODVXVWDQFLDGH
lo pblico. La mediatizacin estar entonces en la constitucin
misma de lo pblico. A partir de retomar de una forma renovada
OD QRFLyQ GH DJHQGD HO DXWRU DUPDUi TXH HV HO QRPEUH GH
estrategias de disposicin de temas en los medios y un tejido de
reenvos, para desde ah analizar la transformacin en el sistema
GHPHGLRVSHULRGtVWLFRV\VHLQWHUURJDUiVREUHHOQDOSRUODV
nuevas trayectorias mediticas dadas por la red.
Bajo el ttulo Tiempo, distancia e intermediacin en el espacio
pblico mediatizado, Mariano Fernndez continua indagando
sobre la mediatizacin entendida como proceso histrico, tanto
en un despliegue diacrnico como sincrnico, y atiende al vncu-

10

lo que tiene con la conformacin de la esfera pblica moderna.


(ODXWRUVHLQWHUURJDVREUHTXpHVHOHVSDFLRS~EOLFRPHGLDWL]D-
do? en las formas contemporneas de sociabilidad, constituidas
por caractersticas diferentes a las que marcaron las formas bur-
guesas, que fueron explicadas por los anlisis clsicos sobre el
espacio pblico. Lo que le interesa sealar es que lo que resulta
mediatizado no es una sustancia sino una relacin de inter-
cambio discursivo, por lo que no es tan solo un lugar fsico. As,
la mediatizacin afecta las condiciones productivas del sentido
DOOtGRQGHpVWDVLPSOLFDQXQDUXSWXUDGHHVFDODHVSDFLRWHPSRUDO
por la presencia de dispositivos tecnolgicos de comunicacin.
El sexto captulo del libro se titula Primeras aproximaciones
a la esfera pblica virtual. All Mariano Vzquez busca delinear
las caractersticas del modelo analtico de la esfera pblica vir-
tual, construido desde una revisin crtica de la teora de la es-
fera pblica y de la perspectiva que entiende a las nuevas tecno-
logas como artefacto cultural y que a la vez pone el foco en la
interactividad virtual. El autor concluye que la esfera pblica
YLUWXDOVHHULJHFRPRXQHVSDFLRVRFLDOGHGLVHQVRVGHFRQLFWRV
y desacuerdos donde distintos actores se posicionarn de acuer-
GRDVXVLQWHUHVHV\VXVHVWUDWHJLDVGRQGHODVUHODFLRQHVDVLPp-
tricas pueden convertirse en un elemento distintivo.
El anteltimo captulo, escrito por Vanina Papalini, tiene por
WtWXOR3~EOLFRSULYDGRtQWLPRODVWUDPDVGHODYLGDVRFLDO(QpO
ODDXWRUDVHLQWHUURJDVREUHODFRQJXUDFLyQKLVWyULFDTXHRSRQH
y complementa en las sociedades modernas a la esfera privada de
la dimensin privada. Segn Papalini esta divisin entre las es-
feras no es natural ni tan ntida como se presupone. Su anlisis
busca argumentar que los procesos culturales contemporneos
colaboran en borronear esta distincin; proponiendo que las
emociones se hacen visibles y audibles, constituyendo una justi-
FDFLyQ\XQDPRWLYDFLyQYiOLGDVHQHOVHQRGHODYLGDHQFRP~Q

11

El libro se cierra con el trabajo titulado Lugares de vida. Nue-


va escena de espacios culturales emergentes de exhibicin en la
ciudad de La Plata, escrito por Matas David Lpez. El punto
de partida del artculo es la emergencia de espacios culturales
de exhibicin (galeras de arte, centros culturales, colectivos de
UHH[LyQVREUHODFXUDGXUtD\RUJDQL]DFLyQGHPXHVWUDV DSUR-
psito de los cuales el autor se pregunta si constituyen un nue-
vo escenario cultural. Ese interrogante de partida est anudado
con otros que Lpez va desplegando a partir de entrevistas a los
impulsores y gestores de estos espacios: se trata de una nue-
va elite cultural? Son nuevos lugares de vida en los que se
producen y dinamizan las batallas de ideas y se disputan posi-
ciones en el campo cultural? Cmo se relacionan estos espacios
con los actores polticos con capacidad de direccionar polticas
culturales? Preguntas clsicas para un fenmeno novedoso, que
reinstala en el espacio pblico de la ciudad las apuestas y visio-
nes ligadas a la autogestin, la independencia y lo emergente en
la produccin cultural.
Nos resta, por ltimo, agradecer a todos los autores por su in-
PHGLDWRLQWHUpV\SUHGLVSRVLFLyQHQSDUWLFLSDUGHHVWHYROXPHQ
y por sus valiosos aportes para que esta apuesta intenciona-
GDUHH[LYD\P~OWLSOHVHOOHYDUDDGHODQWH4XHUHPRVWDPELpQ
agradecer a Nora Rabotnikof por la prestancia generosa con que
respondi a nuestra invitacin a realizar el comentario de aper-
WXUD\SRUODVSUHFLVDVUHH[LRQHVTXHOXHJRQRVHQYLy\TXHVRQ
la puerta de entrada a los textos que siguen; para nosotros es un
RUJXOORTXHVHDHOODTXLHQGpHOSXQWDSLpLQLFLDODHVWHOLEUR)L-
nalmente, queremos agradecer a las autoridades del IICom por
la aceptacin de publicar esta propuesta y por la ardua tarea em-
prendida para que este e-book se concrete.

12

PRESENTACIN
Discutir el Espacio de Lo Pblico
Por Nora Rabotnikof

Las concepciones normativas clsicas del espacio pblico con-


densaban experiencias (los espacios de sociabilidad urbanos, clu-
EHV\DVRFLDFLRQHVFDIpV\VDORQHVFLQHV\WHDWURVODLPDJHQHVWL-
lizada de la discusin parlamentaria, las interacciones callejeras)
histricamente preadas con expectativas de futuro ms o menos
distantes en el tiempo. La apuesta por la articulacin poltica era
fuerte: enlazar los circuitos polticos decisionales con redes de co-
municacin difusa, desde los espacios de interaccin familiares o
vecinales hasta el sistema poltico y jurdico, para reducir razona-
blemente la contingencia de lo jurdico y polticamente posible o,
en un sentido ms fuerte, para asentar las decisiones vinculantes
en una voluntad colectiva racionalmente alcanzada. Esa volun-
WDGSRGtDYROYHUVHPiVXLGD\PRYHUVHDWUDYpVGHFLUFXLWRVGH
comunicacin difusos, aunque mapeables. En las versiones ms
cercanas a nuestros das, ese espacio pblico no apareca como el
lugar de un sujeto soberano constituido, sino justamente como
escenario de una pluralidad de voces, que, en un acceso reconoci-
damente desigual, pugnaban por aparecer y ser reconocidas.

13

Es posible que, aunque desde la sociologa se cuestionara


la imagen de la sociedad como sujeto colectivo capaz de actuar
como un sujeto individual y se proclamara el advenimiento de
la sociedad sin centro, y aunque desde la teora poltica se cues-
tionara el estado y la soberana, todava subsistiera, aun en su
versiones ms actualizadas, una cierta idea de Estado, de socie-
dad y de centro. Probablemente a su dimensin espacial, que
OOHJyDDPSOLDUVHDORJOREDOOHFRVWyLQFRUSRUDUDUFKLSLpODJRV
barriadas, marginalizacin, coexistencia de rdenes y lgicas
GLIHUHQWHVTXHDOSULQFLSLRVRORSXGLHURQVHUWLSLFDGDVFRPR
GHVRUGHQRFDRV\GHVSXpVJORULFDGDVFRPRQXWULHQWHVGHQXH-
vas vocaciones utpicas.
Estas imgenes clsicas y modernas operaban sobre un espa-
cio reticular y con un tiempo propio. El viejo tiempo escandido
entre pasado, presente y futuro. No es tanto que el tiempo fuera
lo impensado del espacio o de la esfera pblica. Por el contra-
ULR HVD LPDJHQ GHVFDQVDED VREUH XQD WHPSRUDOLGDG UpJLPHQ
GH KLVWRULFLGDG GLUtDQ DOJXQRV KLVWRULDGRUHV  HVSHFtFDPHQWH
PRGHUQRV/DHVIHUDS~EOLFDPRGHUQDVHDUPDEDSRGtDSURFH-
VDUODVQDUUDWLYDVGHOSDVDGR\DVHDTXHUHULHUDQDWUDGLFLRQHV
asentadas o a experiencias comunes y apropiarlas de manera co-
lectiva, o en todo caso, transformarse en escenario de la lucha
SRU ODV PHPRULDV < WDPELpQ HUD HO HVSDFLR SDUD SURJUDPDU HO
futuro, ya sea como piedra de toque de su factibilidad y deseabi-
lidad o como laboratorio de experimentacin de su capacidad
de interpelacin. Todo ello desde un presente que, asediado por
el acontecimiento y la presin de lo inmediato, de todos mo-
dos guardaba lazos de hospitalidad con el pasado y asuma, a
su modo, la contingencia del futuro. Estas visiones normativas
UHJLVWUDEDQ WDPELpQ XQD SOXUDOLGDG GH WLHPSRV TXH FRH[LVWtDQ
en la simultaneidad: los tiempos del sistema poltico (elecciones,
calendarios parlamentarios), el tiempo ms largo de la discusin

14

racional (tradicionalmente enarbolada como privilegio intelec-


WXDORDFDGpPLFRTXHSRGtDSUHVFLQGLUGHODGHFLVLyQ HOWLHPSR
en general ms largo, del cambio cultural.
Este libro parte de las transformaciones en las condiciones
de posibilidad de esa esfera pblica, y en general de la construc-
cin de lo pblico, a partir de las transformaciones inducidas
por las nuevas tecnologas de comunicacin e informacin. La
FXHVWLyQIRUPDSDUWHGHXQJUDQGHEDWHWDPELpQJOREDO6LDOJX-
nos creen ver en ellas la expresin de una radical reorganizacin
del General Intellect\XQDFRQUPDFLyQGHOSDVRGHOSXHEORD
la multitud, otros, sin caer (o cayendo) en un nuevo determinis-
mo tecnolgico auguran la realizacin de la sociedad del conoci-
PLHQWRGHODGHPRFUDFLDYLUWXDOUHDOPHQWHH[LVWHQWH2WURVPiV
prudentemente registran la reorganizacin temporal de la agen-
GDSROtWLFDSHURWDPELpQGHODVRFLDELOLGDGGLIXVD(QFXDOTXLHU
caso, la temporalidad se transforma: de la tensin entre impera-
tivos decisionales y procedimientos deliberativos, o entre rutina
y acontecimiento, o entre normalidad y excepcin, o entre el dis-
currir (tentativamente ms pausado y ms pleno de sentido) del
mundo de la vida y los tiempos de los sistemas, pasamos a otras
cadencias temporales. La simultaneidad de comunicaciones, el
acontecimiento que ya es historia en el momento de su presen-
tacin meditica, la llamada aceleracin temporal (que termin,
en algunas versiones, borrando la nocin de futuro) articulada
con las nuevas formas de interaccin y conectividad inter indivi-
GXDOHV\ODFUHDFLyQGHQXHYDVIRUPDVGHLGHQWLFDFLyQFROHFWL-
YDVSDUHFHQGHVDDUODWHPSRUDOLGDGVXSXHVWDSRUODHVIHUDS~-
EOLFDPRGHUQD6HSXHGHGHVFRQDUGHODQXHYDHVSRQWDQHLGDG
motorizada por las redes, exaltar la ausencia de direccionalidad
SROtWLFDGHVFRQDUGHHVDDXVHQFLDRFUHHUTXHKHPRVOOHJDGRD
la plena socializacin de los medios de produccin de la infor-
macin. Podemos investigar las nuevas formas de constitucin

15

de la subjetividad o recelar de la consagracin del aislamiento


individualista. En todo caso la pregunta por el enlace entre esos
mltiples territorios y temporalidades, por su articulacin o ms
mdicamente, coordinacin, parece pasar a segundo plano fren-
te al desafo de mapear el presente o los varios presentes.
Sin embargo, parece subsistir alguna imagen o referencia a
la esfera pblica, aunque cambie la valencia del individuo, de
los grupos, de las corporaciones, del gobierno. Ya sea para in-
vocar una esfera pblica no gubernamental o no pblica (Virno,
por ejemplo), para alertar contra los peligros de una publicidad
VLQHVIHUDS~EOLFDRSDUDGHQXQFLDUFDVLHQWpUPLQRVFOiVLFRVOD
clausura o eclipse imputado a la omnipotencia meditica.
Cuestin global, si las hay, esto adquiere sin embargo una to-
QDOLGDG\XQDUHOHYDQFLDHVSHFtFDSDUD$UJHQWLQDFX\RVHVWX-
dios de caso recoge el libro. Para cualquier extranjero, an ver-
sado en cuestiones de la aceleracin temporal, percibir los tiem-
pos locales constituye un desafo. No solo porque dos fuentes de
informacin distintas proporcionen dos mapas diferentes. Dara
ODLPSUHVLyQGHTXHORVWHUULWRULRVPDSHDGRVVRQWDPELpQRWURV
Por otra parte, la agenda parece construida sobre lo extraordi-
nario, no como domesticacin de la contingencia, sino como
exaltacin de la misma. Todo acontecimiento es un parteaguas,
WRGR PRPHQWR HV GHQLWRULR $ SULPHUD YLVWD HQWUDPRV HQ HO
reino del presentismo, entendido este como la colonizacin del
pasado por el presente, y la dilucin del futuro en la contingen-
cia y el riesgo. Los tiempos del sistema poltico, los del avance
tecnolgico, los del mundo global, los del barrio y los de la sub-
jetividad parecen dispararse. Todo pasa a ser pasado demasiado
vertiginosamente y el futuro parece resistirse a ser encuadrado
en las formas clsicas (la utopa, la esperanza, el proyecto). Y sin
embargo a poco de estar, el extranjero, sin demasiada investi-
JDFLyQHWQRJUiFDGHVFXEUHTXHHOYtQFXORFRQHOSDVDGRQRVH

16

ha roto y que por el contrario la esfera pblica, ahora pensada en


GLIHUHQWHVUHJLVWURVHVFHQLFDLQWHUSUHWDFLRQHV\YHUVLRQHVGLV-
WLQWDVVREUHHOSDVDGRLQPHGLDWR\WDPELpQVREUHHOPiVOHMDQR
Y que la referencia al futuro o los futuros sigue apareciendo bajo
la forma de la reivindicacin del proyecto, o del modelo, o de la
impugnacin a partir de la duda acerca de su sustentabilidad
HQHOWLHPSR&ULVLVGHOWLHPSRHQWpUPLQRVDSRFDOtSWLFRVSHUR
WDPELpQHQFXHQWUR\GHVHQFXHQWURHQWUHGLVWLQWDVWHPSRUDOLGD-
des y distintos territorios.
Mientras tanto, a nivel conceptual, lo pblico del espacio p-
EOLFRH[LJHSUHFLVLRQHV\UHGHQLFLRQHV/DUHIHUHQFLDQRUPDWLYD
a la representacin de lo comn y lo general, lo visible y mani-
HVWR\DORDELHUWRHLQFOX\HQWHVLJXHWHQLHQGRXWLOLGDGDXQTXH
ODSHOHDSRUODVSDODEUDVVHHVFHQLTXHHQFDGDGLVSRVLFLyQVREUH
el espacio urbano, en cada decisin polticamente vinculante, en
cada medida distributiva, en cada construccin periodstica, y
en cada movilizacin callejera. Un vasto territorio abierto a la
H[SORUDFLyQ D OD LQYHVWLJDFLyQ HPStULFD \ OD UHH[LyQ WHyULFD
Estamos en el umbral. Es cuestin de atreverse a cruzarlo.

17

CAPTULO I

Lo pblico como lugar practicado.


Regulaciones sociales, temporalidades
colectivas y apropiacin diferencial
de la ciudad
Por Ramiro Segura

Introduccin
En este artculo interrogo a la ciudad como espacio pblico.
Me pregunto particularmente por las formas de acceso, regula-
cin y exclusin del espacio pblico urbano. A partirde un traba-
MRHWQRJUiFRSUHRFXSDGRSRUODVIRUPDVGHLPDJLQDFLyQ\XVR
de la ciudad de La Plata por parte de sectores urbanos segrega-
dos1, busco delinear las lgicas predominantes en el espacio p-
blico urbano analizando las prcticas, las temporalidades y las
regulaciones que se traducen en una apropiacin diferencial de
la ciudad.

1 Entre 2007 y 2009 realic el trabajo de campo etnogrfico en un sector de la periferia conocido actualmente con Centro Comunal Altos de San Lorenzo, emplazado
al sudeste del casco fundacional de La Plata, cuya poblacin se estima en 40000
habitantes. En este artculo me detengo principalmente en la experiencia urbana de
los residentes de un asentamiento de la zona conocido como Puente de Fierro.

18

Esta perspectiva de abordaje de lo pblico supone, al menos,


dos desplazamientos respecto de las nociones habituales. Por un
ODGRDQWHVTXHSHQVDUORFRPRXQOXJDUMRGHOLPLWDGR\HVWD-
ble, se concibe al espacio pblico como puesta en prctica de un
lugar (De Certeau, 2000), lo que supone accin, temporalidad
y, muchas veces, irrupcin e interrupcin. Lo pblico, entonces,
como contingente, como interseccin entre la forma urbana y la
prctica social. Por el otro, si bien se suele caracterizar al espacio
S~EOLFR 5DERWQLNRI DVRFLDGRDOLQWHUpVFROHFWLYR RSXHVWR
a lo individual), a lo visible (opuesto a lo oculto) y a lo accesible
(opuesto a lo cerrado), considero que es en la propia prctica del
HVSDFLRGRQGHVHGHQHQORVOtPLWHVGHORS~EOLFR ORFROHFWLYR
ORYLVLEOH\ORDFFHVLEOH GHQLFLyQFDPELDQWH\FRQLFWLYDQR
exenta tampoco de exclusiones.
(QHVWDGLUHFFLyQEXVFDUpPRVWUDUTXHHQODFLXGDGH[LVWHXQ
conjunto de regulaciones y reglamentaciones, explcitas e impl-
citas, que prescriben y proscriben acciones y usos, delineando
un acceso desigual al espacio urbano. Se trata de una estructura
de interaccin (Barth, 1977) que, si bien se encuentra sujeta a
FXHVWLRQDPLHQWRVQHJRFLDFLRQHV\PRGLFDFLRQHVWiFLWDPHQWH
supone que hay un lugar y un tiempo para cada cosa (y para
FDGDFODVHJUXSRJpQHURHGDGHWF /DWDUHDFRQVLVWHHQFDUDF-
terizar estas regulaciones y sus consecuentes temporalidades y
espacialidades, as como marcar los cronotopos de interrupcin/
LUUXSFLyQTXHODFXHVWLRQDQ\HYHQWXDOPHQWHODPRGLFDQ

El espacio pblico urbano: lugar practicado


Interrogar a la ciudad en su cualidad de espacio pblico su-
SXVR XQ QHFHVDULR HMHUFLFLR GH UHH[LyQ D SDUWLU GHO FXDO LGHQ-
WLFDPRV XQ FRQMXQWR GH SUHFDXFLRQHV DQDOtWLFDV (Q HIHFWR

19

espacio pblico es una de esas categoras puente que engloba


dimensiones de la sociedad, la poltica y la ciudad, conectando
esferas fuertemente diferenciadas (Gorelik, 2008: 34) y que,
dependiendo de la tradicin terica, postula articulaciones cam-
biantes entre tales dimensiones.
(Q HO FDVR HVSHFtFR GH ORV HVWXGLRV XUEDQRV GHEHPRV WH-
QHU SUHVHQWH TXH XQD YH] HQXQFLDGD HQ OD GpFDGD GH  OD
crisis de la ciudad, las posiciones han oscilado entre, por un
lado, aquellas teoras que encuentran anclaje en la idea de la di-
solucin de la ciudad y, por otro lado, aquellas que pregonan
su recuperacin, depositando gran parte de las esperanzas en
-y orientando sus intervenciones hacia- el espacio pblico de la
ciudad (Gorelik, 2002), entendido como lugar donde la ciudada-
na se activa, se construye y se ejerce; espacio de encuentro entre
diferentes; condicin de posibilidad del dilogo, del disenso, del
FRQLFWR\GHVXHYHQWXDOUHVROXFLyQ'HHVWDPDQHUDGHVGHORV
aos 80 hasta nuestros das, en el campo de los estudios urba-
QRV \HVSHFtFDPHQWHGHOXUEDQLVPRTXHVHSLHQVDDVtPLVPR
como progresista) asistimos a cierto romance del espacio pbli-
co, como lo denomin Adrin Gorelik (2008). El problema de
este romance reside no slo en que espacio pblico es una ca-
tegora con la cual se dicen muchas cosas distintas y contrastan-
tes, sino que adems funciona en este contexto como fetiche, es
decir, lugar idealizado donde depositamos todas las virtudes de
la ciudad para no tener que afrontar el difcil compromiso de po-
nerlas en prctica en la realidad de nuestras ciudades (Gorelik,
2008: 44). Teniendo presente este sealamiento crtico del rol
de la nocin de espacio pblico en los estudios y las interven-
ciones- urbanos se desprenden dos precauciones complementa-
rias para realizar el anlisis.
Por un lado, debemos HYLWDUUHLFDUHOHVSDFLRS~EOLFR. Hace
XQ WLHPSR 1pVWRU *DUFtD &DQFOLQL VH SUHJXQWDED QR VLQ FLHUWD

20

LURQtDVHDFXHUGDQGHTXHKXERpSRFDVHQTXHORS~EOLFRHUD
un espacio? (1996: 5). Y enumeraba: la plaza y el gora en la
*UHFLD FOiVLFD VDORQHV FOXEHV \ FDIpV D SDUWLU GHO ,OXPLQLVPR
El lugar comn de las investigaciones fue, entonces, asociar la
desorganizacin de estas dos maneras clsicas de lo pblico
con el advenimiento de las democracias masivas, pasando as
del espacio pblico a la esfera pblica. Separar analticamente
espacio pblico urbano de esfera pblica poltica es una opera-
cin necesaria en tanto gran parte de las cuestiones pblicas se
vehiculizan cada vez ms por medio de soportes tecnolgicos y
mediticos distintos al espacio pblico urbano y a la comuni-
cacin cara a cara que predomina en este ltimo; a la vez, ta-
les procesos comunicacionales masivos impactan en el espacio
urbano, coexistiendo con la ciudad material una ciudad comu-
nicacional (Garca Canclini, 1998) clave para entender las re-
presentaciones y los usos del espacio pblico urbano. Simult-
neamente, el intento de pensar las relaciones recprocas entre
DPERVVHHQIUHQWDFRQHOGHVDItRGHYpUVHODVFRQORTXH$GULiQ
Gorelik reconoci como la radical ambigedad del espacio p-
blico: por un lado remite a esferas de la accin humana (habla
de la poltica), por otro nombra lugares materiales (habla de la
forma). As, mientras en su primera acepcin aparece como la
dimensin que media entre la sociedad y el Estado, en la que se
hacen pblicas mltiples expresiones polticas de la ciudadana
HQGLVWLQWDVIRUPDVGHDVRFLDFLyQ\FRQLFWRFRQHO(VWDGRGHVGH
la segunda ha sido revalorizado en su cualidad material: el espa-
cio pblico de la ciudad, en el que la ciudadana se activa. Lucha
que no tiene lo estatal como amenaza sino lo privado (1998: 19-
20). Es precisamente esta ambigedad constitutiva la que se ha
transformado en un obstculo para pensar la produccin mutua
entre el espacio pblico urbano y la esfera pblica poltica, de-
sarrollndose estudios bifurcados: los que analizan la poltica,

21

donde la ciudad aparece como escenario, como teln de fondo,


por un lado; los que analizan la forma (tipologa, evolucin, as-
SHFWRVItVLFRVHWF VLQSHQVDUHQVXVLJQLFDFLyQ\YtQFXORFRQ
la esfera pblica, por otro. Siguiendo nuevamente a Gorelik, en
el intento de superar esta dicotoma podemos pensar al espacio
pblico como elproducto de la colisin, fugaz e inestable, entre
forma y poltica. De este modo, ms que de tratarse de una re-
lacin estable entre forma y poltica, la emergencia del espacio
pblico puede ser pensada como una coyuntura, en su doble
acepcin: como ocasin puntual en la historia y como contacto
entre esferas diferentes. Un espacio es pblico, entonces, cuan-
do es atravesado por una experiencia social al mismo tiempo
que organiza esa experiencia y le da formas (1998: 20). En los
WpUPLQRVGH0LFKHOGH&HUWHDXHQWHQGHPRVDOHVSDFLRS~EOLFR
como lugar practicado. As, mientras lugar (o forma) remite al
orden segn el cual los elementos se distribuyen en relaciones
GHFRH[LVWHQFLDHVGHFLUDXQDFRQJXUDFLyQLQVWDQWiQHDGH
posiciones, hay espacio en cuanto se toman en consideracin
los vectores de direccin, las cantidades de velocidad y la varia-
ble tiempo (2000: 129). La prctica social no se localiza sino
que espacializa, es decir, produce espacio.
Por el otro lado, debemos evitar idealizar el espacio pblico.
(VKDELWXDOHQFRQWUDUDUPDFLRQHVGRQGHGHVGH XQDSRVLFLyQ
normativa, se sostiene que ese espacio colectivo por excelencia
no debera rechazar ni extraarse ante lo extrao, dado que re-
sulta de un proceso masivo de extraamiento recproco y, por lo
mismo, es el mbito donde es posible estar juntos sin jerarquas
ni estructuras concluidas (Delgado, 2007: 49-50). Y prosigue el
citado autor:

22

el espacio pblico es programticamente un espacio no


VyOR DVH[XDGR VLQR WDPELpQ DFODVLVWD DpWQLFR \ DJHQH-
UDFLRQDOHQHOVHQWLGRGHTXHODVGLIHUHQFLDVGHJpQHUR
clase, etnia o edad deberan ser irrelevantes a la hora de
ejercer lo que Hannah Arendt haba llamado derecho a
la presencia, es decir derecho de todos y todas a acceder
y disfrutar de lo que es de todos y de todas, derecho que
se adquiere por el mero hecho de estar ah (2007: 260).

Sin renunciar a tales ideas como horizonte poltico, en la


investigacin es conveniente no perder de vista que lo pbli-
FRHVSURGXFWRGHGHVLJXDOGDGHVH[FOXVLRQHV\FRQLFWRV. Ha
sido Nancy Fraser quien, a partir de la nocin de esfera pblica
de Habermas como foro de las sociedades modernas donde
VHOOHYDDFDERODSDUWLFLSDFLyQSROtWLFDDWUDYpVGHOKDEOD  
espacio institucionalizado de interaccin discursiva distinto
del Estado y de la economa (1997: 97), seal que el modo
en que Habermas formul el concepto no es totalmente satis-
factorio, ya que no se cumplen cuatro de sus supuestos cen-
trales: el supuesto de igualdad, cuando en realidad la esfera
pblica se constituy histricamente por medio de exclusiones
y desigualdades; el supuesto de un pblico nico, cuando es
habitual (y fructfera) la emergencia de contra-pblicos; el
supuesto de que el espacio pblico debe restringirse a la delibe-
racin sobre el bien comn,cuando muchas veces sucede que la
rotulacin de ciertos intereses como privados limita el rango
de problemas; y el supuesto de la total escisin entre Estado
y sociedad civil, cuando en realidad existen pblicos fuertes
\S~EOLFRVGpELOHVHQEDVHDODVSRVLELOLGDGHVGHFDGDXQRGH
SDUWLFLSDUQRVyORHQODIRUPDFLyQGHRSLQLyQVLQRWDPELpQHQ
la toma de decisiones.

23

Antes que depositar todas (o muchas de) las esperanzas en el


espacio pblico, romance que en el caso de la ciudad parecera
VLJQLFDUTXHFRQVWUXLUHVSDFLRVS~EOLFRVHVXQPRGRGHDYDQ]DU
en la resolucin de los problemas sociales y urbanos2, conven-
dra pensar siguiendo la tradicin de Simmel y Benjamin- que
el espacio pblico funciona, ms que como un modelo aplica-
ble, como una herramienta de crtica del presente (Gorelik,
2008: 39). De esta manera, si el espacio pblico urbano se de-
QHHQWpUPLQRVQRUPDWLYRVSRUORVLGHDOHVGHKHWHURJHQHLGDG
accesibilidad e igualdad (Caldeira, 2000) o por las cualidades
de lo comn, lo accesible y lo visible (Rabotnikof, 1997) propios
de un mbito moderno y democrtico, la investigacin consiste
en describir las prcticas sociales urbanas (el lugar practicado)
SDUD LGHQWLFDU \ FRPSUHQGHU ODV UHJXODFLRQHV ORV FRQLFWRV
ODV LUUXSFLRQHV \ ODV H[FOXVLRQHV &RQLFWLYLGDG FRQVWLWXWLYD
(Huffschmid, 2012) del espacio pblico urbano, ya que pese a
las tentativas normalizadoras, no hay nada estabilizado o garan-
WL]DGRSDUDVLHPSUHVLQRQHJRFLDFLyQFRQLFWRLQFOXVRQDWXUD-
OL]DFLyQ\XQDPXOWLSOLFLGDGGHPRGRVGHSUDFWLFDU\VLJQLFDU
la ciudad.

2 En las intervenciones urbanas que exclaman ms espacio pblico convergen


ambos problemas: lo pblico se reifica (es una cosa, por ejemplo, una plaza) y se lo
idealiza como solucin (se asume que resuelve problemas). Con esto no estoy proponiendo abandonar necesariamente este tipo de intervenciones as como tampoco
olvido las tendencias privatizantes presentes en muchas de nuestras ciudades; solo
me limito a sealar la ingenuidad (o la coartada) de ciertas intervenciones.

24

Trnsitos y relaciones categoriales en el espacio


pblico
El espacio pblico urbano ha sido caracterizado como el espa-
cio que posibilita el encuentro entre extraos, constituyendo la
diferencia, la complejidad y la extraeza aspectos constitutivos
de la experiencia urbana (Sennett, 1997: 29). Si la ciudad tiene
habitantes, el espacio urbano tiene usuarios, personas que estn
de paso (transentes, manifestantes, vendedores y paseantes,
entre otros), sin derechos de propiedad ni de exclusividad sobre
ese marco que usan y que se ven obligados a compartir en todo
momento (Delgado, 1999: 33). De esta manera, las relaciones
que los actores sociales establecen en el espacio pblico de la
ciudad, denominadas relaciones de trnsito (Hannerz, 1986),
generalmente se caracterizan por ser relaciones de interaccin
social mnima entre actores que son recprocamente extraos,
desconocidos y/o annimos, es decir, nos encontramos ante
relaciones sociales que combinan la proximidad espacial y la
distancia social (Simmel, 1986). A diferencia de otros dominios
urbanos como la relaciones de vecindad, las familiares o las la-
borales, el espacio pblico urbano tiende a constituirse en es-
cenario de un tipo inslito de estructuracin social, organizada
en torno al anonimato y la desatencin mutua o bien a partir
de relaciones efmeras basadas en la apariencia, la percepcin
LQPHGLDWD\UHODFLRQHVDOWDPHQWHFRGLFDGDV\HQJUDQPHGLGD
fundadas en el simulacro y el disimulo (Delgado, 1999: 12).
$QRQLPDWR DOWHULGDG \ PRYLOLGDG PRYLPLHQWR \ WDPELpQ
movilizacin) surgen como las caractersticas distintivas de la
experiencia social del espacio pblico urbano. Y por esto, la vida
social en los espacios pblicos con sus relaciones de trnsito y su
cruce de movilidades y de tiempos se caracteriza no tanto por
estar ordenada, como por estar permanentemente ordenndo-

25

se (Delgado, 2007: 90), orden que es el resultado transitorio


e inestable producto de la relacin entre la forma urbana, los
practicantes de la forma (formantes) y las reglas implcitas y ex-
plcitas que orientan y son producto de las prcticas del espacio
(formalidades). Estructuras que, antes que estructuradas, estn
continuamente estructurndose, en el sentido de estar elabo-
UDQGR \ UHHODERUDQGR FRQVWDQWHPHQWH VXV GHQLFLRQHV \ VXV
propiedades (Delgado, 1999: 25).
Ahora bien cmo se procesa social y cotidianamente en el es-
pacio urbano ese juego de heterogeneidades, de anonimatos, de
alteridades? Hace tiempo Clyde Mitchell (1999) seal que en la
ciudad es posible distinguir, adems de las relaciones estructu-
rales (relaciones como las laborales- que tienen pautas perma-
nentes de interaccin basadas en roles) y las relaciones persona-
OHV UHGGHOD]RVDIHFWLYRVTXHORVLQGLYLGXRVFRQJXUDQHQWRUQR
suyo), lo que denomin relaciones categoriales, es decir, rela-
ciones que se desarrollan en situaciones en las que los contactos
VRQVXSHUFLDOHV\UXWLQDULRV\TXHVRQUHVXOWDGRGHODWHQGHQ-
cia a categorizar a la gente en funcin de algunas caractersticas
visibles y a ordenar su comportamiento de acuerdo con dicha
categorizacin (generalmente estereotipada).Se trata, pues, de
XQPpWRGRSDUDVLPSOLFDURFRGLFDUHOFRPSRUWDPLHQWRHQVL-
tuaciones que de otro modo seran no estructuradas y, de esta
manera, habitualmente (re) producir estereotipos y prejuicios.
En efecto, la experiencia cotidiana del espacio urbano ha sido
descrita como una sociedad de miradas, gora visual (Sennett,
1997: 381) donde prevalece la mirada sobre el discurso (Simmel,
2001) y donde, en consecuencia, ante todo cuenta lo observable
a primera vista, lo intuido o lo insinuado mucho ms que lo sa-
bido (Delgado, 2007). En la experiencia de vivir la ciudad somos
PiTXLQDVGHKDFHULQIHUHQFLDVGRQGHFRPRSXVRGHPDQLHVWR
%RXUGLHX  ORVJHVWRVPiVLQVLJQLFDQWHVODYHVWLPHQWD\

26

los rasgos corporales pueden brindar pistas sobre la identidad de


quien los realiza y el lugar que ocupa en el espacio social.
En esta direccin, en una investigacin sobre miedos e inse-
guridad urbana en la ciudad de La Plata (Segura, 2005, 2009a)
LGHQWLFDPRVXQFRQMXQWRGHHVSDFLRV SDUWLFXODUPHQWHODSHUL-
feria urbana pobre), de tiempos (paradigmticamente, la noche) y
de rostros (especialmente, jvenes varones de sectores populares,
SHURWDPELpQPDQLIHVWDFLRQHVSROtWLFDVYHQGHGRUHVDPEXODQWHV
LQGLJHQWHV\SROLFtDV GHOPLHGR4XHGyFODURSXHVTXHODVUHOD-
ciones en el espacio urbano remiten constantemente al problema
de la accesibilidad y la diversidad en la ciudad, ya que la gente
reacciona no slo al hecho de estar cerca, sino a estar cerca de
tipos particulares de personas (Hannerz, 1986: 117), a catego-
UtDVVRFLDOHVHVSHFtFDV SDUDXVDUORVWpUPLQRVGH0LWFKHOO $
ORVQHVGHHVWHDUWtFXORPHJXVWDUtDVHxDODUWUHVFXHVWLRQHVUHOH-
vantes que sern retomadas ms adelante. En primer lugar,antes
que constante y permanente, el miedo es claramente situacional y
contextual y, por ende, temporal y discontinuo. Se teme en ciertos
momentos y lugares, en el encuentro ante ciertas personas. En
segundo lugar, en la mayora de los relatos lo heterotpico (Re-
guillo, 2003) y las topofobias (Lindn, 2005) remiten a campos
de sentido que se entrecruzan: afuera, villa, noche, droga, jvenes,
pobreza. En tercer lugar, salvo excepciones, no se trata de una al-
ternativa dicotmica entre estar y no estar en el espacio pblico
de la ciudad; antes bien, se trata de modos de estar, de transitar
\GHYLYLUODFLXGDG(QGHQLWLYDHOPLHGR\ODLQVHJXULGDGIXQ-
cionan como un poderoso regulador de los usos de la ciudad y,
por ende, de la densidad del espacio pblico urbano. De hecho,
como seal Gabriel Kessler, el miedo y la inseguridad se vinculan
a cambios en la experiencia urbana que adopta la forma de un re-
lato sobre trayectorias y usos del espacio (2009:194), en el que se
observa una paulatina diferenciacin entre lugares controlados y

27

no controlados, y la consolidacin de estrategias de restriccin de


movimientos, evitacin de lugares y proteccin en circunstancias
HVSHFtFDV 6HJXUDD 

Movilidades, regularidades y regulaciones


en el acceso al espacio pblico
A partir de lo dicho hasta aqu podemos sostener que el espa-
cio pblico urbano en tanto lugar practicado es el resultado de la
cambiante articulacin entre movilidades, alteridades y estructu-
raciones en los usos de la ciudad. Analizar, pues, el espacio pblico
urbano supone analizar la movilidad cotidiana, las interacciones
HQFXHQWURVHYLWDFLRQHVFRQLFWRV\RH[FOXVLRQHV TXHODVPLV-
mas provocan y los ordenamientos espacio-temporales (ms o me-
nos estables) que tales movimientos e interacciones (re) producen.
Tradicionalmente los estudios urbanos han enfatizado la po-
sicin y el estatismo, ignorando o trivializando la importancia
de los movimientos cotidianos de las personas vinculados con el
trabajo, la vida familiar, el ocio, la cultura, la religin y/o la pol-
tica (Sheller y Urry, 2006). La pregunta por los desplazamientos
no busca, sin embargo, contraponer teoras sedentaristas de la
vida social con metforas nomdicas o lquidas, sino analizar
cmo se articulan y combinan las posiciones, las distancias y los
desplazamientos en la vida urbana (Segura, 2010b), para cono-
cer las formas de vida urbanas, es decir, el proceso consistente
en integrar crecientemente la movilidad espacial en la vida coti-
GLDQDKDVWDXQSXQWRHQTXHpVWDTXHGDYHUWHEUDGDSRUDTXpOOD
(Delgado, 1999: 23). Entre la inmovilidad forzada y las diver-
sas formas de movilidad obligada (Urry, 2002) se despliegan
en la ciudad diversas formas de movilidad cotidiana, accesos al
espacio pblico y relaciones con otros en la ciudad.

28

Sintetizando nuestra propuesta, en lo que queda del artculo


analizaremos las formas de acceso y de regulacin del espacio
pblico a partir de la experiencia urbana de los residentes de un
barrio estigmatizado de la ciudad de La Plata. Se trata de una
alternativa intermedia entre los clsicos anlisis que desde los
lineamientos de la Escuela de Chicago abordan espacios resi-
denciales populares como si fueran relativamente autnomos y
los trabajos que a partir de los aportes de Erving Goffman se
centran en las relaciones e interacciones en el espacio pblico
sin conocer el background de los actores sociales involucrados.
Por medio del anlisis de los desplazamientos y las interaccio-
nes de los residentes de la periferia en el espacio pblico busco
precisar, entonces, dos cuestiones. Por un lado, si bien el espacio
pblico urbano no est estructurado de manera estable tampoco
HV WRWDOPHQWH FDyWLFR R DOHDWRULR VLHQGR SRVLEOH LGHQWLFDU OyJL-
cas y patrones, regularidades y regulaciones, con sus necesarias
OLPLWDFLRQHV\UHFRQRFLHQGRTXHVRQSRWHQFLDOPHQWHPRGLFDEOHV
Por el otro lado, las movilidades y los trnsitos tienen modalidades
HVSHFtFDV0HUHHURFRQHVWRDTXHQRDOFDQ]DFRQFRQWUDSRQHU
TXLHWXG\PRYLPLHQWRVLQRLGHQWLFDUORVFXiQGRORVFyPRORV
TXLpQHV\ORVSDUDTXpGHWDOHVGHVSOD]DPLHQWRVHLQWHUDFFLRQHV
Parafraseando a Michel de Certeau (2000) -y suponiendo un mis-
mo trayecto- circular y pasear podran distinguirse, entre otras co-
sas, en que el paseante otorga un mximo de tiempo a un mnimo
de espacio y la circulacin busca exactamente lo opuesto.

Lgicas de circulacin por la ciudad


4XHORVUHVLGHQWHVHQODSHULIHULDFRPSDUWDQXQDSRVLFLyQHV-
pacial y social desventajosa y que sea imperioso para ellos des-
plazarse por la ciudad, no debe conducir a la conclusin de que
VXVPRYLPLHQWRVVHDQLGpQWLFRV1RDOFDQ]DFRQVHxDODUTXHORV

29

residentes de la periferia se desplazan cubriendo grandes distan-


cias fsicas y sociales y cuestionando un conjunto de lmites eco-
QyPLFRV IDOWD GH GLQHUR  JHRJUiFRV GLVWDQFLD \ XELFDFLyQ 
urbanos (ausencia de infraestructura y servicios) y simblicos
(estigmas). En necesario reconstruir sus lgicas de circulacin
(Kessler, 2004) por la ciudad.
Para esto en la investigacin retomamos los cinco dominios
XUEDQRV GRPpVWLFRDSURYLVLRQDPLHQWRUHFUHDFLyQYHFLQGDG\
WUiQVLWR LGHQWLFDGRVSRU+DQQHU]  \DQDOL]DPRVODWHUUL-
torialidad de las prcticas de los residentes de la periferia aso-
FLDGDVD FDGD XQR GH HVRV GRPLQLRV (Q WpUPLQRV JHQHUDOHV OR
SULPHURTXHLGHQWLFDPRVHVODFHQWUDOLGDGTXHWLHQHODSUiFWLFD
del salir, es decir, el desplazamiento hacia fuera del barrio, en
las estrategias de aprovisionamiento. El barrio no es un mbito
DXWyQRPRQLDXWRVXFLHQWHSRUORTXHVXVUHVLGHQWHVGHEHQVD-
lir para obtener un conjunto de bienes y servicios fundamentales
para la reproduccin de la vida. En otro trabajo (Segura, 2009b)
propuse la ecuacin recursos hacia afuera, vnculos hacia
adentro como una frmula que condensabaesquemtica y par-
cialmente la vida en barrios populares, vida tensada entre una
multiplicidad de fuerzas que empujan hacia el aislamiento y la
exclusin, por un lado, y la movilidad como prctica fundamen-
tal en las estrategias implementadas para sobrevivir, por el otro.
Se trataba de una frmula esquemtica y parcial por dos moti-
vos. En primer lugar, porque no todos los recursos para vivir
se obtienen fuera del barrio ni se sale nicamente en bsqueda
de recursos. En segundo lugar, porque segn la posicin social
de los actores barriales analizados, la circulacin, los desplaza-
mientos y las territorialidades varan sensiblemente. De hecho,
del trabajo de campo realizado surge que para comprender los
desplazamientos por la ciudad se debe mirar la cambiante ar-
WLFXODFLyQHQWUHODFRQGLFLyQODERUDOHOJpQHUR\ODHGDGHQWUH

30

RWUDVGLPHQVLRQHVTXHLQX\HQWDQWRHQHOFRQRFLPLHQWRGHOD
ciudad como en las territorialidades cotidianas de cada una de
las personas en la ciudad (Segura, 2012a)
Como la razn fundamental para salir del barrio se vincula
con el aprovisionamiento, la ocupacin de las personas es funda-
mental para comprender sus desplazamientos, sus vnculos con
la ciudad y las representaciones que tienen de la misma.Varones
como Carlos (albail) y Javier (cartonero) sostienen lo mismo
que Vctor (electricista) voy al centro todos los das. Como des-
cribe Daniel la gente de barrio es ms quedada, viene del tra-
bajo y se queda, de casa al trabajo y del trabajo a casa. Hay muy
poco contacto con la gente de ciudad.
$GHPiVGHODLQVHUFLyQHQHOPHUFDGRGHWUDEDMRHOJpQHUR
nos ayuda a comprender las lgicas de circulacin por la ciudad.
Mientras la mayora de los varones adultos salen del barrio ha-
cia sus trabajos, caracterizados por la informalidad y la baja ca-
OLFDFLyQODVPXMHUHV LQGHSHQGLHQWHPHQWHGHVXLQVHUFLyQHQ
el mercado laboral) se encargande la reproduccin del espacio
GRPpVWLFR\GHVRVWHQHUODVDFWLYLGDGHVEDUULDOHVORFXDOLPSOL-
FDWDPELpQODPRYLOLGDGFRWLGLDQDKDFLDODHVFXHODODVDOLWDRHO
hospital, el comedor. Se delinea una lgica barrial cotidiana: los
varones salen temprano para trabajar y regresan al barrio por
la tarde; las mujeres independientemente de su vnculo con el
mercado de trabajo- se ocupan de las actividades de la casa, mu-
chas de las cuales implican grandes desplazamientos y sostienen
diversas instancias barriales como el comedor. Por supuesto,
H[LVWHQ VLJQLFDWLYDV YDULDFLRQHV HQ HO JUDGR GH PRYLOLGDG GH
las mujeres. As, mientras Azucena no sale mucho, cuida de
la casa y de sus hijos, y realiza la contraprestacin del plan en
un comedor del barrio, Ester, militante social y referente de un
comedor, relata: casi siempre estoy en el centro, porque si no
me muevo esto no funciona.

31

Ms all de las variaciones, de las que las experiencias de


Azucena en tanto ama de casa y Ester con su rol clave en la trama
social y poltica del barrio quizs sean las posiciones extremas,
ODVUHODFLRQHVGHJpQHURVHWUDGXFHQHQODOyJLFDGHFLUFXODFLyQ
cotidiana en itinerarios territoriales claramente diferenciados
entre varones y mujeres. Mientras los primeros realizan itinera-
rios lineales del tipo casa-trabajo-casa, podramos caracterizar a
los itinerarios femeninos como no lineales o mltiples, en tanto
GHEHQKDFHUFRPSDWLEOHVP~OWLSOHVUHTXHULPLHQWRV GRPpVWLFRV
ODERUDOHVHWF $VtHODOPDFpQHOFRPHGRUODHVFXHOD\ODVDOL-
WD VRQ HVSDFLRV HVSHFtFDPHQWH IHPHQLQRV SXQWRV D SDUWLU GH
los cuales las mujeres organizan cognitivamente el resto de la
morfologa urbana (Delgado, 2007: 238) y ordenan sus andares,
FRQLWLQHUDULRVGHOWLSRFDVDHVFXHODWUDEDMRDOPDFpQFDVDR
casasalitacasaescuela-casa.
De esta manera se observa que la mayor parte de los despla-
zamientos por la ciudad son instrumentales (Grimson, 2009),
VHVDOHSRUDOJRSXQWXDO\HVSHFtFR\VXSRQHQXQJUDQHVIXHU]R
HQWpUPLQRVHFRQyPLFRVWHPSRUDOHV\FRUSRUDOHV6LQHPEDUJR
HQDOJXQDVRFDVLRQHVVDOLUSXHGHVHUWDPELpQXQDRSRUWXQLGDG
Adems de las estrategias de aprovisionamiento, las prcticas
(excepcionales) ligadas al consumo y al ocio yla poltica consti-
tuyen instancias para salir del barrio. Azucena, a quien conoc
precisamente en una marcha al centro de la ciudad que realiza-
ban organizaciones polticas de la periferia, relataba:

Voy a las marchas que hace el comedor. Ah es donde me


voy un poco a despejar, porque paso mucho tiempo ac
en la casa. Vamos con algunas compaeras del comedor,
por ah la llevo a mi hermana, a mi mam, vamos porque
miramos, porque es tranquilo. Para ver, para salir al aire.

32

Por ah a marchas de Buenos Aires, si van me prendo,


ms cuando hay un micro, mejor. Porque una vez me fui
HQWUHQ\GHVSXpVDODYXHOWDKLFLHURQXQSLTXHWHHQODV
vas y no haba tren. Por eso me voy cuando hay micro.
$SDUWHSRUTXHFRQRFpVJHQWHYHVODJHQWH

Para una mujer como Azucena, las marchas son fundamen-


talmente una oportunidad para salir de la casa, despejarse, mi-
rar, conocer gente. La forma en que habla sobre dichas prcticas
condensa los sentidos asociados al salir por contraposicin con
el estar adentro: me voy un poco a despejar, salir al aire. De
esta manera, en oportunidades como la descrita, salir adquiere
un alto contenido simblico, en tanto permite escapar momen-
tneamente a una cotidianeidad anclada y circunscripta a los
lmites del barrio (y, en el caso de muchas mujeres, de la casa)
por una conjuncin de lmites econmicos (ausencia de dinero,
VLQYtQFXORVFRQHOPHUFDGRGHWUDEDMR JHRJUiFRV GLVWDQFLDV
inaccesibilidad y medios de transporte), polticas pblicas terri-
WRULDOL]DGDV TXHWLHQGHQDUHIRU]DUHODLVODPLHQWR \UROHVGHJp-
nero tradicionales.

Relaciones de trnsito, interacciones y estigmas


Como decamos ms arriba, las interacciones en el espacio
S~EOLFRH[FHGHQODUHODFLyQHQWUHDQyQLPRVSRQLpQGRVHHQMXH-
go relaciones categoriales (Mitchell, 1999). Marcas o atributos
IXQFLRQDQ FRPR LQGLFLRV GH OD HGDG HO JpQHUR OD HWQLFLGDG OD
clase y la ocupacin (entre otras) promoviendo, segn los casos,
el acercamiento, la indiferencia, el rechazo. Las relaciones de
trnsito, relaciones de interaccin mnima constitutivas de la
ciudad, constituyen un mbito de la vida urbana relevante para

33

entender la experiencia urbana de quienes residen en un barrio


SHULIpULFR &yPR H[SHULPHQWDQ VXV SURSLRV GHVSOD]DPLHQWRV
SRUODFLXGDG"4XpLPDJHQOHVGHYXHOYHQORVRWURVFRQORVFXD-
les se encuentran e interactan en el espacio pblico?
En el imaginario de la ciudad, asentamientos como Puente de
Fierro son cotidianamente estigmatizados. Los medios de comu-
nicacin refuerzan estos estereotipos al asociar de modo unvo-
co dicho espacio con los delitos, las carencias infraestructurales
y las usurpaciones de terrenos. Ester seala que los del centro
a nosotros nos dicen villeros y en la escuela a mi hija le decan
villera, porque a ella le decan dnde vivs? en la 90 Ah!,
esta es una negrita villera. La mayora de la gente dice a la 90
no vamos, es peligrosa.
En el relato de Ester se condensan las caractersticas prin-
cipales de los estigmas territoriales (Wacquant, 2007); bsica-
mente el desplazamiento que el estigma opera desde un tipo de
hbitat o vivienda a un tipo de persona -de la villa a los villeros-
lo que se traduce tanto en las prcticas espaciales de los habi-
tantes de la ciudad, que asocian esos espacios a la violencia y
la delincuencia, por lo que los evitan, como en una marcacin
que acompaa a los residentes del barrio a diversos espacios de
interaccin social, sumando una desventaja adicional a las que
ya experimentan.
Aurora relata que durante una capacitacin en un comedor
del barrio, una de las talleristas se refera a los chicos como los
del barrio, los negritos y ella le dijo

Se equivoca, porque muchas veces puede haber negritos y


muchos maleducados pero no hace falta tener plata y vi-
vir en el centro para ser educado. Muchos lo piensan as,
igual que en las charlas en el San Juan de Dios, donde una

34

doctora dijo los mocosos del barrio cuando hablbamos


de las adicciones, yo digo, no hace falta ser del barrio
para ser adicto.

Esta situacin se agrava con los habituales controles discre-


cionales que realiza la polica a los residentes del barrio, ya sea
cuando estn saliendo o retornando a sus hogares, en las inme-
diaciones del barrio, o cuando se encuentran en espacios pbli-
cos alejados de su lugar de residencia. Como relata Daniel cuan-
do la polica te pregunta de dnde sos y vos le decs de Puente de
Fierro, listo, para ellos ah estn todos los malandras. Cansado
de esta situacin, Daniel aprendi a responder a los interrogato-
rios policiales callejeros.

'DQLHO 'HVSXpV XQR YD WRPDQGR H[SHULHQFLD \ OH FDP-


ELDEDODGLUHFFLyQDYHUTXpHVORTXHSDVDED
5DPLUR<TXpOHGHFtDV"
Daniel: En vez de decirle Puente de Fierro, deca calle 88
HQWUH\HQWRQFHVTXpKDFHHOSROLFtDSLHQVDGLFH
adnde queda?. Como que se pierde.

/DDQpFGRWDHVUHYHODGRUD(OFDPELRHQORVFULWHULRVGHUH-
ferencia y localizacin, desde el nombre propio estigmatizado
3XHQWHGH)LHUUR DODUDFLRQDOL]DFLyQ\FXDQWLFDFLyQGHOHVSD-
cio propio de los criterios abstractos de la grilla fundacional de
la ciudad le permiten, al menos situacionalmente, desmarcarse.
A la vez, es una muestra ms de que la mayora de las personas
que habitan la ciudad desconocen la ubicacin del barrio, lo que
no impide que en general continen reproduciendo el estigma.

35

Ahora bien, la estigmatizacin no es solamente territorial,


recordndonos que el acceso desigual a la ciudad se articula y
FRPELQDFRQGLPHQVLRQHVpWQLFDV\UDFLDOHVHQWUHRWUDV'DQLHO
cuenta que

hay dos o tres compaeras que ya estn independizndo-


se, quieren hacer su vida, salen a buscar trabajo, salen al
centro y ah cuentan ellas que como son morochitas, las hi-
cieron al costado y agarraron a otra ms blancona, enten-
GpV"6HVHQWtDQPX\PDOHVWDVFKLFDVSRUTXHKDEtDQVLGR
despreciadas. Donde se ve un trabajo que lo puede hacer
cualquiera, eligen a gente sin experiencia y ms blancos.

<(VWHUVHxDODTXHGHVSXpVGHUHLWHUDGDVDJUHVLRQHVDVXKLMD
en la escuela decidi ir a hablar con la maestra y la directora y
les dijo a m me pueden decir boliviana, bolita, lo que ustedes
TXLHUDQSHURDPLKLMDQR/HJXVWHDTXLpQOHJXVWHPLKLMDHV
muy nacida en esta tierra y en este suelo, y tiene todos los dere-
chos como todos estos.
De esta manera, adems de los obstculos econmicos y geo-
JUiFRVORVUHVLGHQWHVHQORVDVHQWDPLHQWRVVRQREMHWRGHODHV-
tigmatizacin cotidiana en mltiples mbitos de la vida social
(trabajo, educacin, salud, polticas sociales), a la cual muchas
veces se oponen, cuestionando los argumentos sostenidos acer-
FDGHHOORV<WDPELpQHQODFLUFXODFLyQSRUORVHVSDFLRVS~EOLFRV
en los espacios transicionales entre el barrio y la ciudad.
De esta manera, el anlisis de los desplazamientos y las inte-
racciones en el espacio pblico por parte de los residentes de la
SHULIHULD SHUPLWLHURQ LGHQWLFDU XQD OyJLFD R HVWUXFWXUD PiV R
menos estable y ms o menos naturalizada- de posiciones y re-

36

ODFLRQHVHQHOHVSDFLRXUEDQR4XHUHPRVGHFLUFRQHVWRTXHHQOD
ciudad existe un conjunto de regulaciones y reglamentaciones ex-
plcitas e implcitas que prescriben y proscriben acciones y usos.
Se trata de una estructura de interaccin (Barth, 1977) que, si
bien se encuentra sujeta a cuestionamientos, negociaciones y mo-
GLFDFLRQHVWiFLWDPHQWHVXSRQHTXHKD\XQOXJDU\XQWLHPSR
SDUDFDGDFRVD \SDUDFDGDFODVHJUXSRJpQHURHGDGHWF 'H
hecho, como veremos a continuacin, es precisamente cuando
suceden acontecimientos no esperados -y distanciados de la ru-
tinaria reproduccin de los usos habituales de la ciudad- que este
conjunto naturalizado de supuestos y de relaciones se deja ver.

Irrupciones e interrupciones
Esta cotidiana reproduccin de una lgica de interaccin ms
o menos estabilizada en el espacio pblico urbano -anclada en un
FRQMXQWR GH FRQGLFLRQHV GH H[LVWHQFLD FRQJXUDFLRQHV HVSDFLD-
les, relaciones sociales y sentidos e imaginarios sobre la alteridad-
fue puesta en suspenso por la irrupcin de un acontecimiento que
funcion tanto como interrupcin de dicha lgica como condicin
de posibilidad para su inteleccin.
En la investigacin constatamos que los jvenes constituan
para los dems actores barriales un problema y tanto desde las
polticas estatales como desde las organizaciones barriales se im-
plementaban diversas actividades que los tenan como foco de ac-
cin: cursos de educacin sexual, talleres de arte, capacitaciones
laborales, entre otras. Pese a estos intentos, los jvenes del barrio
no tenan lugar: se encontraban fuera de la escuela (los ndices de
desercin eran elevados), fuera de la casa (espacio de los adultos,
generalmente de pequeas dimensiones) y fuera del mercado la-
boral formal (Sarav, 2004). As, la ocupacin de esquinas y des-

37

campados que tanto temor generaba en otros residentes, lejos de


hablarnos de una apropiacin y dominio juvenil del espacio barrial,
sealaba el repliegue hacia el nico lugar y tiempo disponibles.
Tampoco era sencillo para ellos ir al centro de la ciudad, debi-
do al estigma territorial que reduca sus posibilidades de accesi-
bilidad y circulacin por el espacio urbano. Si la lgica dominante
sostiene que los residentes de la periferia pobre van a la ciudad
casi exclusivamente por razones instrumentales, estos jvenes
desde esta misma lgica- no tienen nada que hacer ah. Sus rela-
tos (y muchas veces los de sus madres) sobre su experiencia ur-
bana coincidan con el relato de la estigmatizacin centrado en la
vivencia continua de un estigma en el barrio, del hostigamiento y
el maltrato de la polica y de los patovicas en los lugares de diver-
sin (Kessler, 2009: 121). Como sostena Aurora, madre de tres
KLMRVQRSXHGHQLUDOFHQWURSRUTXHORVWLHQHQLGHQWLFDGRVOD
polica les pregunta dnde viven, los levantan y los llevan y en
OD PLVPD GLUHFFLyQ \ UHPDUFDQGR XQD GLIHUHQFLD GH JpQHUR OD
maestra de una escuela del barrio contaba que cuando les digo
que vamos a ir al centro los chicos dicen que no, las chicas s, pero
los chicos directamente dicen que no.
Sin embargo, ms all de estos obstculos, a medida que avan-
zaba en el trabajo de campo pude observar que era frecuente que
chicas y chicos del barrio pasaran algunas tardes y noches en pla-
]DVFpQWULFDVGHODFLXGDG(QHOUHODWRGH/X]\6RItDGRVKHUPD-
nas de 15 y 16 aos, frecuentaban la plaza para pedir plata o robar
algo, para pasar el tiempo y se encontraban con chicos y chicas
GHRWURVEDUULRVSHULIpULFRVGHODFLXGDG)XHHQHOPDUFRGHHVWDV
incursiones de jvenes de la periferia pobre al centro de la ciu-
dad que fueron agredidos. En efecto, el 25 de julio de 2008, cerca
GHODPHGLDQRFKHXQJUXSRGHDGXOWRVDWDFyFRQFDGHQDVHUURV
y armas blancas a un grupo de alrededor de 20 chicas y chicos
TXHKDELWXDOPHQWHSDVDEDQVXVGtDV\~OWLPDPHQWHWDPELpQVXV

38

noches- en la plaza, bautizado tiempo antes por los medios locales


como la banda de la frazada o banda de la plaza San Martn.
He analizado con detalle este acontecimiento y el proceso po-
OtWLFRSRVWHULRUHQRWUROXJDU 6HJXUDE 6yORPHGHWHQGUp
aqu en los supuestos implcitos acerca del acceso y permanencia
en el espacio pblico urbano que la presencia fuera de lugar de
HVWRVMyYHQHVSHUPLWLyREMHWLYDU(QHVWHVHQWLGRDORQHVGHPL
argumentacin lo ms relevante es que existen pruebas ms que
VXFLHQWHVGHTXHODSUHVHQFLDGHODVFKLFDV\ORVFKLFRVGHODSHUL-
IHULDHQHOHVSDFLRFpQWULFRGHODFLXGDGJHQHUDEDPDOHVWDUGHVGH
WLHPSRDQWHVGHODDJUHVLyQDVtFRPRWDPELpQTXHODDJUHVLyQQR
IXHXQKHFKRDLVODGRDOHDWRULRRHVSRQWiQHR(QGHQLWLYDHVWRV
jvenes fueron en primer lugar vistos, es decir, recortados como
distintos y peculiares en el marco de un espacio intensamente
WUDQVLWDGRUHFLpQGHVSXpVGHHVWDRSHUDFLyQGHYLVLELOL]DFLyQ\GH
diversos intentos de expulsin es que fueron agredidos.
Como sealamos, uno de los presupuestos fuertes de la nocin
de espacio pblico es la igualdad en la accesibilidad al mismo y
HQODPRYLOLGDGDWUDYpVGHpO&XDQGRHVWRVXFHGHODDFWLWXGKD-
bitual hacia los dems en el espacio pblico se caracteriza por lo
TXH*RIIPDQ  GHQRPLQyGHVDWHQFLyQFRUWpVHVGHFLUXQD
forma de sociabilidad, una manera de organizar la co-presencia
de extraos entre s en los espacios pblicos que consiste en una
manera de tener bien presente la presencia de aquellos a quie-
nes se ignora (Delgado, 2007: 137-138). Nos encontramos ante
personas que en sus trnsitos por el espacio pblico, ya sea para
circular o permanecer en el mismo, han conquistado el derecho
al anonimato, lo que les permite transitar por la ciudad sin dar
explicaciones. Es precisamente este derecho al anonimato lo que
les fue negado a los jvenes de la plaza como consecuencia de la
progresiva visualizacin (mayoritariamente negativa) por parte
de distintos actores sociales, dejando de resultar desconocidos

39

TXHQRGHVSLHUWDQQLQJ~QLQWHUpVSDUDSDVDUDVHUGHWHFWDGRV\
localizados como individuos cuya presencia suscita situaciones de
malestar, inquietud o temor.
En efecto, lo que gener la prctica de chicas y chicos de ba-
UULRVSHULIpULFRVGHRFXSDUXQDSOD]DFHQWUDOGHODFLXGDGHVTXH
llamaron la atencin -de la polica, de la prensa, de los comer-
ciantes cercanos, de algunos vecinos- precisamente porque su
presencia y sus prcticas contradecan la hasta ese momento im-
plcita estructura de interaccin dominante y naturalizada en la
ciudad que estipula trnsitos bsicamente instrumentales para
los residentes de la periferia pobre de la ciudad hacia el centro.
Su presencia fuera de lugar supuso su visibilizacin creciente,
ODFRQVHFXHQWHSpUGLGDGHVXGHUHFKRDODQRQLPDWR\HOYHUVH
interpelados constantemente a dar explicaciones sobre s mismos
y sobre lo que hacan ese lugar.
La (in) visibilizacin consiste, sin dudas, en un proceso pa-
radjico. Como han sealado los estudios feministas del espacio
urbano (Wilson, 1992; Tonkiss, 2005), no se trata de optar entre
YLVLELOLGDGHLQYLVLELOLGDGVLQRGHSUHFLVDUFyPR FRQTXpVHQWLGRV
\HQTXpFRQWH[WRV XQGHWHUPLQDGRFROHFWLYRRDFWRUVRFLDOHV LQ
visibilizado. En nuestro caso, no hay dudas que la visibilizacin es
el resultado de un consenso implcito (estos jvenes no pueden
estar ac), actualiza un conjunto de prejuicios y criterios valora-
WLYRVDFHUFDGHSDUDTXLpQHVODFLXGDG\REVWDFXOL]DHOXVXIUXFWR
del espacio pblico. Simultneamente y de manera ciertamente
SDUDGRMDOODSpUGLGDGHOGHUHFKRDODQRQLPDWRGHHVWRVMyYHQHV
fue la punta de lanza para la consolidacin de organizaciones y
acciones como Autoconvocados por los Derechos de los Pibes de
la Calle primero y la Asamblea Permanente por los Derechos
GHOD1LxH]GHVSXpVTXHDSDUWLUGHODDJUHVLyQEXVFDURQYLVL-
bilizar otras cuestiones mediante la apropiacin del espacio p-
blico: la situacin social de los jvenes de sectores populares en

40

la ciudad, las polticas represivas que sistemticamente recaen


sobre ellos y la inaccin de un conjunto de legislaciones y dispo-
VLWLYRVTXHWLHQHQSRUQDOLGDGDVHJXUDUVXVGHUHFKRV
La agresin a los jvenes y la dinmica poltica ulterior permi-
WLHURQLGHQWLFDU XQD HVWUXFWXUD GH LQWHUDFFLyQ VXMHWD D GLVFX-
sin) que regula las prcticas espaciales en la ciudad y que supo-
QHTXHORVUHVLGHQWHVGHORVEDUULRVSHULIpULFRV~QLFDPHQWHYDQD
la ciudad (al centro de la ciudad) por motivos instrumentales:
trabajo, trmites burocrticos, ir al hospital. Es por esto que en
las lgicas de sus desplazamientos desde la periferia hacia el cen-
tro (su andar) y en el tipo de espacio apropiado y los modos de
apropiarse del mismo (su estar) los jvenes cuestionaban, quizs
sin saberlo, un conjunto de lmites sociales y simblicos acerca de
los usos de la ciudad.

Eplogo. Regulaciones del espacio pblico


La nocin de espacio pblico constituye una poderosa he-
rramienta de crtica del presente. Antes que partir de un sentido
UHLFDGRHLGHDOL]DGRGHOHVSDFLRS~EOLFRHVGHFLUDQWHVTXHVX-
poner un espacio estable donde es posible el encuentro y el di-
logo igualitario entre diferentes- el desafo consisti en conocer
las formas de practicar el lugar, con sus tiempos, sus lgicas, sus
REVWiFXORV\WDPELpQVXVH[FOXVLRQHV
Por medio del anlisis de la experiencia que de la ciudad tie-
nen los residentes de espacios segregados -una eleccin meto-
dolgica in between las tradicionales investigaciones de espacios
residenciales que anclan a los actores a dichos lugares y las in-
dagaciones de las relaciones entre desconocidos en el espacio p-
blico, donde los actores parecen no venir desde ni ir hacia ningn
OXJDU EXVTXp FRQRFHU HO JUDGR GH UHJXODULGDG \ OyJLFD %DUWK

41

2000) que tienen sus desplazamientos y usos del espacio pblico.


Desde la perspectiva escogida, no se trataba ni de presupo-
ner a priori una estructura coherente y estable, como tampoco
asumir acrticamente una celebracin un tanto ligera de la movi-
lidad, la inestabilidad y la indeterminacin en la caracterizacin
del espacio pblico urbano. Manuel Delgado (1999) contrapone
la idea de un espacio estructurado, tpico de dominios como el la-
boral o el familiar, con la imagen de un espacio estructurndose,
propio del espacio pblico urbano. Sin embargo, en sus trabajos
HOpQIDVLVVHFRORFDHQORPDOHDEOHORLQHVWDEOHORPyYLO\QRV
TXHGDPRVSUHJXQWiQGRQRVSRUTXpOODPDUDHVRHVWUXFWXUD GHO
tipo y cualidad que sea). Por mi parte y a partir de los resulta-
dos obtenidos- considero que, si bien inestables y contingentes
(y, por lo mismo, transformables), asistimos a estructuraciones
del espacio pblico urbano.
En nuestro caso, las condiciones de existencia, la temporali-
dad involucrada en la reproduccin cotidiana de la vida, las con-
JXUDFLRQHVHVSDFLDOHV\ORVVHQWLGRVHLPDJLQDULRVVREUHODDOWH-
ridad que impregnan las interacciones cotidianas delinean unas
IRUPDVPiVRPHQRVLGHQWLFDEOHVGHYLYLUODFLXGDG \HOHVSDFLR
pblico) por parte de los actores sociales analizados. Estructura
de interaccin (Barth, 1977) es el concepto que mejor articula
ODWHQVLyQHQWUHHORUGHQ\HOFDRVHQWUHORMR\HOPRYLPLHQWR
dejando abierta la posibilidad, adems, a que esas interacciones
HVWUXFWXUDGDVVHDQPRGLFDGDVHQODPLVPDWHPSRUDOLGDG\GH-
sarrollo de la interaccin en el espacio pblico. No se trata, en-
tonces, de una estructura que se impone a los actores, sino que es
XQDHVWUXFWXUD RVLTXLHUHQJXUDFLyQ TXHHOORVPLVPRV VXMH-
tos situados social y espacialmente) producen cotidianamente en
VXVUHODFLRQHVFRQLFWRV\HYLWDFLRQHVHQODFLXGDG SRU PHGLR
de la cual se regulan esferas de la vida social y se (re) producen
asimetras y desigualdades sociales.

42

Bibliografa
BARTH, Frederik, Los grupos tnicos y sus fronteras 0p[LFR
FCE, 1977.
BARTH, Frederik, A anlise da cultura nas sociedades com-
plexas, en O Guru, o iniciador e outras variaes antropo-
lgicas. Rio de Janeiro, Contracapa, 2000.
BOURDIEU, Pierre, El sentido prctico. Buenos Aires, Siglo XXI,
2007.
CALDEIRA, Teresa, Cidade de Muros. San Pablo, Editora 34, 2000.
De Certeau, Michel, La invencin de lo cotidiano I0p[LFR,7(-
62
DELGADO, Manuel, El animal pblico. Barcelona, Anagrama,
1999.
DELGADO, Manuel, Sociedades movedizas. Pasos hacia una an-
tropologa de las calles. Barcelona, Anagrama, 2007.
FRASER, Nancy, ,XVWLWLWLD,QWHUUXSWD5HH[LRQHVFUtWLFDVGHVGH
la posicin postsocialista. Bogot, Siglo del Hombre / Uni-
versidad de los Andes, 1997.
GARCA CANCLINI1pVWRU3~EOLFRSULYDGRODFLXGDGGHVGLEXMD-
da. Alteridades. Vol. 6. N 11. Pp. 5-10, 1996.
GOFFMAN, Erving, Relaciones en pblico. Microestudios de orden
pblico. Madrid, Alianza, 1974.
GORELIK, Adrin, La grilla y el parque. Espacio pblico y cultu-
ra urbana en Buenos Aires, 1887-1936. Bernal, Universidad
1DFLRQDOGH4XLOPHV
GORELIK, Adrin, Ciudad, en Altamirano, Carlos (Dir.), Trmi-
nos crticos de sociologa de la cultura. Buenos Aires, Paids,
2002.
GORELIK, Adrin, El romance del espacio pblico. Alteridades.
Vol. 18. N 36. pp. 33-45, 2008.
GRIMSON $OHMDQGUR ,QWURGXFFLyQ FODVLFDFLRQHV HVSDFLDOHV \
43

territorializacin de la poltica en Buenos Aires, en Grimson,


Alejandro, Ferraudi Curto, Cecilia y Segura, Ramiro (Comp.),
La vida poltica en los barrios populares de Buenos Aires.
Buenos Aires, Prometeo, 2009.
HANNERZ, Ulf, La exploracin de la ciudad. Hacia una antropo-
loga urbana. Buenos Aires, FCE, 1986.
HUFFSCHMID$QQH,QWURGXFFLyQ7RSRJUDItDVHQFRQLFWRHQ
Huffschmid, Anne y Durn, Valeria (Editoras), Topografas
FRQLFWLYDV PHPRULDV HVSDFLRV \ FLXGDGHV HQ GLVSXWD.
Buenos Aires, DAAD/Nueva Trilce, 2012.
KESSLER, Gabriel, Sociologa del delito amateur. Buenos Aires,
Paids, 2004.
KESSLER, Gabriel, El sentimiento de inseguridad. Sociologa del
temor al delito. Buenos Aires, Siglo XXI, 2009.
LINDN, Alicia, Figuras de la territorialidad en la periferia me-
WURSROLWDQDWRSROLDV\WRSRIRELDVHQ5HJXLOOR5RVVDQD\
Godoy, Marcial (Ed.), &LXGDGHV7UDQVORFDOHVHVSDFLRXMR
representacin0p[LFR,7(62665&
MITCHELL&O\GH2ULHQWDFLRQHVWHyULFDVGHORVHVWXGLRVXUEDQRV
en frica, en Banton, Michael (Comp.). Antropologa social
GHODVVRFLHGDGHVFRPSOHMDV Madrid, Alianza, 1999.
RABOTNIKOF, Nora, El espacio pblico y la democracia moderna.
0p[LFR,QVWLWXWR)HGHUDO(OHFWRUDO
REGUILLO, Rossana, Utopas urbanas: la disputa por la ciudad
posible. Revista Ciudades. N 60. RNIU, Puebla, 2003.
SARAV, Gonzalo, Segregacin urbana y espacio pblico: los
jvenes en contexto de pobreza estructural. Revista de la
CEPAL, n 83, pp. 33-48, 2004.
SEGURA, Ramiro, Los otros en el espacio urbano. Miedo y cons-
truccin del otro peligroso en el espacio urbano, en Vivir
en la ciudad. Espacios urbanos en disputa. Rosario, Laborde
Editor, 2005.

44

SEGURA, Ramiro, Paisajes del miedo en la ciudad. Miedo y ciu-


dadana en el espacio urbano de la ciudad de La Plata. CUA-
DERNO URBANO. Espacio, cultura, sociedad. N 8. pp. 59-
76, 2009a.
SEGURA, Ramiro, Si vas a venir a una villa, loco, entr de otra for-
ma. Distancias sociales, lmites espaciales y efectos de lugar
en un barrio segregado del gran Buenos Aires, en Grimson,
Alejandro, Ferraudi Curto, Cecilia y Segura, Ramiro (Comp.),
La vida poltica en los barrios populares de Buenos Aires.
Buenos Aires, Prometeo, 2009b.
SEGURA, Ramiro, Resea: KESSLER, Gabriel. 2009. El senti-
miento de inseguridad. Sociologa del temor al delito. Buenos
Aires: Siglo XXI Editores. Cuadernos de Antropologa So-
cial. N 32. pp. 223-227, 2010 a.
SEGURA, Ramiro, Representar. Habitar. Transitar. Una antro-
pologa de la experiencia urbana en la ciudad de La Plata.
Tesis doctoral. Programa de Doctorado en Ciencias Sociales.
Universidad Nacional de General Sarmiento-Instituto de De-
sarrollo Econmico y Social. 2010b.
SEGURA, Ramiro, Elementos para una crtica de la nocin de se-
gregacin residencial socio-econmica: desigualdades, des-
plazamientos e interacciones en el periferia de La Plata. Quid
16. Revista del rea de Estudios Urbanos. Instituto de Inves-
tigaciones Gino Germani, UBA. No. 2. pp. 106-132, 2012a.
SEGURA, Ramiro, La ciudad y el acontecimiento. Juventud, clase
social y acceso al espacio pblico en la ciudad de La Plata.
Revista Question. Universidad Nacional de La Plata. Vol. 1,
N 35. pp. 188-200, 2012b.
SENNET, Richard, Carne y Piedra. El cuerpo y la ciudad en la
civilizacin occidental. Madrid, Alianza Editorial, 1997.
SHELLER, Mimi y John Urry, The new mobilities paradigm. En-
vironment and Planning, vol. 38, pp. 207-226, 2006.

45

SIMMEL, Georg, Sociologa 2. Estudios sobre las formas de socia-


lizacin. Madrid, Alianza Editorial, 1986.
SIMMEL, Georg, El individuo y la libertad. Ensayos de crtica de
la cultura. Barcelona, Ediciones Pennsula, 2001.
TONKISS, Fran, 6SDFHWKH&LW\DQGWKH6RFLDO7KHRU\6RFLDO5H-
lations and Urban Forms. Cambridge, Polity, 2005.
URRY, John, Mobility and Proximity. Sociology, vol. 36, n 2,
pp. 255-274, 2002.
WACQUANT, Lic, Los condenados de la ciudad. Guetos, perife-
rias y Estado. Buenos Aires, Siglo XXI, 2007.
WILSON, Elizabeth, The Invisible Flneur. New Left Review. N
191, 1992.

46

CAPTULO II

La problemtica de la masa
en la mediatizacin actual

Por Sandra Valdettaro

La persistencia de la masa: el ocaso de las teoras


de la manipulacin
El tema de la conformacin de la sociedad de masas y del
hombre-masa form parte de la constitucin del ncleo duro
del campo de estudios de la Comunicacin y contina circulando
como parte central del canon, vinculado con el fenmeno de
emergencia y consolidacin de los medios masivos de comuni-
FDFLyQDSDUWLUGHQHVGHOVLJOR;,;\KDVWDPHGLDGRVGHOVLJOR
XX. Tanto es as que dicha temtica es la que ocupa un privile-
giado primer lugar en una pretendida historia de las teoras
sobre efectos de los medios: la teora de la manipulacin, o de
ODDJXMDKLSRGpUPLFD7DOFRQFHSFLyQIRFDOL]yORVHIHFWRVGLVWRU-
sivos de los medios en la sociedad, la cultura y los individuos
desde distintos supuestos (crtica conservadora, y crtica freudo-
marxista de la Escuela de Frankfurt, entre otras): la sociedad
de masas obtura toda referencia crtico-racional y genera indi-
viduos enajenados/alienados por la accin manipuladora de los

47

medios. Tanto el uso de los medios por parte de los totalitaris-


mos europeos, como la democracia de masas norteamericana y
su industria cultural, constituyeron el campo referencial de di-
FKDKLSyWHVLV\HQWpUPLQRVGHRSHUDFLyQGHGHOLPLWDFLyQGHOD
disciplina, se torn funcional a los propsitos de control de los
diversos aspectos de la comunicacin que en tal contexto recla-
maban tanto la industria como la poltica (cfr. Valdettaro 2013).
La actual vigencia de una doxa asentada en dicha teora de la
manipulacin -doxa, hay que decirlo, en muchas de sus versio-
nes francamente infame- vuelve a colocar de manera central el
WySLFRGHODVPDVDVKHFKRTXHHQpSRFDVGH,QWHUQHWUHVXOWD
slo en apariencia paradjico, ya que en realidad nos obliga a
UHH[LRQDUGHXQPRGRFRPSOHMRORVGHVDItRVTXHSUHVHQWDQORV
fenmenos de mediatizacin via lenguajes digitales cuya interfaz
con diversos movimientos sociales y polticos produce nuevas
interrogaciones.
Las masas que, ininterrumpidamente, en la actualidad, y a
nivel global, irrumpen en el espacio pblico urbano -calles, pla-
zas, cuerpos-, desplegando inadvertidas y, en principio, eva-
nescentes formas de ejercicio poltico, colocan al pensamiento
social progresista en una especie de estado de estupefaccin,
que produce un campo de reacciones atestado de audaces ope-
raciones tericas plagadas de anacronismos, en los cuales pare-
ce advertirse una nueva productividad heurstica: de la suges-
tin y el contagio de la sociopatologa de las masas del siglo
;,;DFLHUWDVKLSyWHVLVQHXURVLROyJLFDVDFWXDOHV\QRVLQGHMDU
de recurrir a la psicologa de las masas de Freud, el tema de la
multitud spinoziana por ejemplo -en oposicin al degradado
FRQFHSWRGHSXHEORGHORVFRQVLGHUDGRVFOiVLFRVGHODORVRItD
poltica- ocupa en la actualidad un lugar destacado en la agenda
de interrogantes acerca de la ancestral complejidad inherente a
la ontologa del lazo social (cfr. Valdettaro 2008 y 2013).

48

La hiptesis constructivista y el retorno


de Lazarsfeld
En tal contexto, sostener el motivo de la manipulacin
como explicacin de las masas -motivo que, insistimos, es el
que ocupa de manera preeminente el rumor meditico en la
actualidad, a pesar, es de suponer, de la conciencia de su im-
procedencia por parte de todo tipo de comunicadores ms o
menos intelectuales o incultos- descansa sobre un ocultamiento
que, aunque se quiera inadvertido, constituye en s mismo una
mera operacin ideolgica. Dicho ocultamiento en el trata-
miento del tema de las masas consiste -entre otras operaciones-
HQ XQD WHUJLYHUVDFLyQ DJUDQWH GH OD KLSyWHVLV FRQVWUXFWLYLVWD
que, a diferencia de la representacionalista (que tributa a la idea
de manipulacin), alude al carcter formal, de lenguaje, de los
medios; es decir, a su capacidad sintctica de construir sentido,
TXHYDUtDGHDFXHUGRDFDGDGLVSRVLWLYR\PDWHULDOLGDGVLJQL-
cante (cfr. Valdettaro 2013). Mediante una impdica operacin
de cambio de nivel de anlisis -de las dimensiones formales a
las contenidistas- dichos voceros ideolgicos reponen el vero-
smil de la idea ms simplista de manipulacin a partir del im-
plcito de que, si los medios construyen la realidad, entonces
la manipulan. Nos encontramos, en tal sentido, plenamente
en la dimensin de lo ideolgico, ya que -como seala J. L.
Fernndez- lo ideolgico (es)... el lmite que a la produccin
discursiva ponen los verosmiles sociales o de gnero de una
sociedad dada. Lo ideolgico no es tanto lo que se dice sino el
proceso que impide que se piense y/o digan otras cosas (Fer-
nndez 2012: 243). De tal manera, la circulacin actual de la
doxa de la manipulacin impide advertir la complejidad de los
procesos comunicativos y, en su marco, las modalidades de con-
formacin de las masas.

49

Vale dejar claro que el constructivismo implica posicionarse,


entre otros niveles de abordaje, en la dimensin de produccin
semitica de la mediatizacin, y la manipulacin no ocupa, en
dicha perspectiva, ningn lugar, quedando reservada, en todo
FDVR D FLHUWRV LQWHQWRV KHUPHQpXWLFRV GH DWULEXFLyQ GH LQWHQ-
cin situada en produccin, perspectivas que se encuentran hace
tiempo superadas a partir, principalmente, de las propuestas de
ODGHFRQVWUXFFLyQ(QGHQLWLYDSRGHPRVGHFLUTXHODWHRUtDGH
ODPDQLSXODFLyQHQORVWpUPLQRVDFiUHVHxDGRVQRHVWi QXQ-
ca estuvo, en realidad) en condiciones de responder el complejo
fenmeno de conformacin de las masas. La manipulacin, en
todo caso, ocupa su puesto legtimo slo como una hiptesis a
SRVWXODU\TXHHQWRGRFDVRKDEUiGHFRQUPDUVHHPStULFDPHQ-
te mediante investigaciones fundadas- dentro de un campo ms
amplio de efectos retricos buscados por la instancia emisora.
Si la manipulacin, entonces, no es una via posible de expli-
FDFLyQHQpSRFDVGH,QWHUQHWODTXHVtSDUHFHUHFREUDUXQLQWHUpV
en relacin con el tema de las masas es la perspectiva lazars-
feldiana, nombrada en ocasiones como un neo-lazarsfeldismo
(Lacalle 2012: 123). El clsico tema del papel principal que cum-
SOHQODVUHGHVLQWHUSHUVRQDOHVHQHOXMRGHODFRPXQLFDFLyQPD-
VLYDTXHDOGHFLUGH.DW]\GHPDQHUDVLQWpWLFDVXSRQHTXHODV
personas deciden ms hablando entre ellas que por la accin
GHORVPHGLRV 2WHURHQ9DOGHWWDUR UHFREUDLQWHUpV
en la actualidad al calor de las llamadas redes sociales. El con-
tacto interpersonal habilitado por la convergencia de la infor-
matizacin de la comunicacin, con sus efectos de liberalizacin
del mbito de la recepcin y complejizacin de la circulacin,
SURGXFHPRGLFDFLRQHVSURIXQGDVHQODVFDPSDxDVHOHFWRUDOHV
por ejemplo -el caso ms contundente es la campaa de 2008 de
%DUDFN2EDPDDODVSUHVLGHQFLDOHVGH((88 FIU/DFDOOH
en Valdettaro 2013).

50

Las nociones, propuestas recientemente, y entre otras, de red


de medios (Carln 2012: 182), de hipercomunicacin a par-
tir del circuito produccin global + interface comunicacional +
consumo individual (Fernndez 2012: 257), de realimentacin
intermeditica (Vern 2011: 81), etc., ayudan justamente a con-
siderar la complejidad de la mediatizacin actual en relacin a la
construccin de nuevas modalidades del lazo social y reactualiza-
cin de formas primitivas de socialidad, tanto en el nivel de la
interaccin meditica como en el de la conformacin de las masas.
Por ejemplo, focalizando en el primer nivel aludido -el de la
LQWHUDFFLyQFRQORVPHGLRVVHSURSRQHQQXHYDVJXUDVHVSHFWD-
toriales habilitadas por la convergencia meditica: nuevo sujeto
televidente 2.0 (Garca Fanlo, 2012: 101) o nuevo sujeto especta-
dor convergente (Carln, 2012: 190 y stes.)
En el dominio de investigacin relativo a la conformacin de
las masas actuales en contacto con las tecnologas, cabe sealar los
desafos que presenta la fenomenal mutacin de la circulacin que
implica, entre otros efectos, profundas alteraciones en las condi-
ciones de acceso (Vern, 2011: 287) que producen una altera-
cin del vnculo de los actores con el espacio-tiempo social (Vern
2011: 21), y mutaciones en las relaciones entre cuerpos concretos
\FXHUSRVWpFQLFRV 9HUyQ\VWHV 
9HUyQSRVWXODTXHORVQXHYRVFXHUSRVHOpFWULFRVTXHSXOXODQ
en la Red (Vern 2011: 309) se articulan, histricamente, no con
los cuerpos densos de los cdices, sino con una primera fami-
OLD GH GLVFXUVLYLGDGHV HItPHUDV SDQHWR OLEHOR EURFKXUH WUDFW
EURDGVLGH GHODWHPSUDQDPRGHUQLGDGFX\DJXUDSULQFLSDOHV
la de la urgencia (Vern 2011: 294)1. Cmo situar, entonces,

1 Ver, en Valdettaro 2013, las referencias que Vern (2011) realiza en relacin con
las reflexiones de Darnton a este respecto.

51

el estudio de las masas en el contexto de la mediatizacin actual?


Cul es su relacin con las llamadas redes sociales habilitadas
por los recursos de Internet?

La masa en las redes: produccin del contacto


y reaccin participativa
Digamos, en principio, que entendemos a la masa como un
dispositivo del contacto, ya que, en tanto agrupacin, lo espec-
FRTXHSURPXHYHHVVHJ~Q&DQHWWLODLQYHUVLyQGHOWHPRUDVHU
tocado (Canetti 1960: 10). Se produce, en la masa, un montaje
del lazo social guiado por una afeccin instantnea; un efecto de
inmediatez que liga a los cuerpos con el rumor de la calle promo-
viendo un escenario psquico (Canetti 1960: 60) de contagio,
un deseo de crecer y una vivencia de igualdad (Canetti 1960:
11 y 25). El temor a ser tocado se convierte, en la masa, en su
contrario (Cfr. Ritvo 2011: 53 y stes.)
Dicho esto, es preciso aclarar que la nocin de redes so-
ciales articulada a la problemtica de las masas, resulta -a los
propsitos analticos- demasiado imprecisa y, en todo caso, ne-
FHVLWDUtDVHUHVSHFLFDGDFDGDYH]6LJXLHQGRD/DWRXU  
SURSRQHPRVHOFRQFHSWRGHDVRFLDFLRQHVHQUHG\HVSHFtFD-
mente, en el caso del estudio de la conformacin de las masas en
la actualidad, de redes polticas (cfr. Valdettaro 2011 y 2012).
Este tipo de redes polticas conformadas por la conver-
gencia de cuerpos-reales y digitalizacin -cuerpos efmeros,
al decir de Vern (2011: 287 y stes.)- produce un nuevo espa-
cio pblico-poltico. Nuestra hiptesis es que la mediatizacin
actual es condicin de produccin de dicha mutacin por los
QLYHOHVLQpGLWRVGHIXVLyQ\FRQWDJLRTXHKDFHQPDVDSURPR-
viendo acontecimientos de rebelin en muchos casos nombra-

52

dos como revolucin (Valdettaro 2012). Las asociaciones-


en-red promovidas por Internet actan en cadena con la
ciudad, sus calles y sus plazas porque cuerpos, redes y calles
son conectores-de-afectos-en-vivo (Valdettaro 2012: 161). El
espacio pblico poltico de la ciudad se encuentra, as, afectado
en su propia cotidianeidad por la irrupcin de una multiplicidad
de contactos cuya evanescencia se torna, paradjicamente,
singularmente ubicua por su poder de atravesamiento a escala
LQFOXVRJOREDO/DHVSHFtFDPRGDOLGDGGHHVWHWLSRGHFRQWDF-
tos -contacto bsico (mejor sera nombrarlo como una indiciali-
dad blanda, eminentemente ftica2)- tiende a desvanecer la
frontera entre el face-to-face y los intercambios mediatizados
al hacer coincidir en un espacio situado y local, y en un tiempo
puntual, a la materialidad de los cuerpos con sus extensiones.
Via mediatizacin, esos cuerpos resultan radicalmente inscrip-
WRV HQ VX FRQWH[WR XQ FRQWH[WR TXH SUHVHQWD OD VRQRPtD KR-
rizontal de la vida urbana3: el espacio se torna territorial ms
all de toda soberana (o, en todo caso, habilitando soberanas
in-situ y ad-hoc, siempre provisionales), y el tiempo se encoge
HQXQXMRGHLQVWDQWHV
Desde el punto de vista de una epistemologa del sujeto, no
nos parece posible -en estos casos de conformacin de un sujeto-
colectivo en tanto masa- suponer un mecanismo racionalstico
de toma de decisin. La decisin de hacer masa -o de entrar,
para ser ms claros, a la masa- no constituye, en tal sentido, una

2 Tomamos la sugerencia de Fernndez J. L (2012) y lo relacionaremos con su concepto de textura.


3 Remitimos en este punto a las reflexiones de Jos Luis Fernndez sobre la vida
urbana, de claro tono certeauniano. Cito, como ejemplo, el siguiente fragmento:
en la misma baldosa compartimos la familia y el mundo (en 2012: 278).

53

accin -tal como se entiende a la accin en las sociologas cl-


sicas (cfr. De Ipola 2001)-, sino, al contrario, una reaccin. La no-
cin -central para el entendimiento de la accin desde este punto de
vista- de indeterminacin situacional de la accin (que De Ipola
retoma de Vern y otros, en 2001: 24) supone una relacin de in-
certidumbre entre la accin y su entorno, y se aparta de cualquier
funcionalismo o esquema estmulo-respuesta. Se tratara, enton-
ces, de un sujeto paradojal, conjetural, cuyo contacto bsico, pri-
mario, con las texturas de la masa produce una reaccin que se
torna en decisin de rebelin. Ms que motivos racionales, lo que
se pone en juego, entonces, es un conjunto de razones semiticas
de decisin entre las cuales, sin dudas, se incluyen las razones
-discriminacin, opresin, segregacin, explotacin, denigracin,
avasallamiento, etc.- pero, preeminentemente, ciertos rasgos de
textura (Fernndez, 2012: 285 y 288)4. Entre dichos rasgos de
WH[WXUDTXHKDFHQDODVRQRPtDVRPiWLFDGHODPDVDSRGHPRV
nombrar citando a Canetti: un ritmo, una especie de notacin
musical rtmica (Canetti, 1960: 27), una euforia del movimiento
HQFRP~Q &DQHWWL HQGHQLWLYDXQSODFHUYROXSWXR-
so por el nmero que crece de golpe (Canetti, 1960: 90).
Esta indicialidad blanda, eminentemente ftica -tal como la
caracterizamos ms arriba- supone un primer efecto de contacto

4 Cfr. los comentarios acerca de la nocin de textura radiofnica en Fernndez J. L.


(2012: 133 y stes). La nocin de textura, que proviene de lo textil, remite en pintura
a la pincelada; en escultura a las tensiones entre el grano del material y el trabajo de
las herramientas; en teora musical a la textura de diferentes voces o lneas meldicas, contrapuntstica o polifnica; etc. Se trata de un concepto visual y tctil, de la
primera impresin que produce el contacto, planificado o no, a partir de lo cual se
produce atraccin o repulsin. Aclara Fernndez que en el efecto de textura tambin interviene algn aspecto referencial o temtico: amor, muerte, deporte, poltica,
informacin, ficcin. (Parfrasis ma del texto referido).

54

material como construccin del vnculo (Fernndez, 2012: 175),


que incluye, entre otros rasgos, lo sensorial, y que hace emerger
una especie de acuerdo estilstico entre los participantes5.
Podemos completar, de este modo, una teora de la decisin en
cuanto reaccin proveniente de la sociologa, con las nociones de
textura y razones semiticas de decisin como modalidad b-
sica del contacto de la sociosemitica (en este caso nos referimos
a la obra citada de J. L. Fernndez), en tanto supuestos de una
HSLVWHPRORJtDGHOVXMHWRGHFDUiFWHUFRQMHWXUDO: un sujeto no
capta ni puede captar directamente a otro. Lo que efectivamente
FDSWDVRQORVVLJQLFDQWHVTXHUHSUHVHQWDQDORWUR<ORKDFHDQWL-
cipndose a la certeza mediante conjeturas (Ritvo 2011: 12/13)6;
no un sujeto-de-decisin, sino un VXMHWRSDUDGRMDO, y en el nivel
del anlisis de lo poltico desde el punto de vista de la metfora
fuerte que remite a la idea de revolucin (cfr. De Ipola 2001).
En tal sentido, De Ipola rescata la idea de Laclau de la importancia
de el registro de lo Real lacaniano para el anlisis de lo poltico
al concebir el campo sociosimblico como estructurado en torno a
XQDVXUDTXHUHVLVWHDODVLPEROL]DFLyQTXHQRSXHGHVHUVLPER-
lizada. Es en dicho registro -dice De Ipola- donde interviene
la decisin como operacin constitutiva (De Ipola 2001: 77). Es
por ello que la decisin, en el campo de la poltica, es radicalmente
SDUDGyMLFD'HQH/XKPDQQTXHVHGDXQDSDUDGRMDFXDQGRODV
condiciones de posibilidad de una operacin son, al mismo tiempo,
condiciones de su imposibilidad (en De Ipola 2001: 78). La deci-

5 Remitimos nuevamente a Fernndez J. L. y su nocin de sintona estilstica o


ideolgica (en 2012: 249).
6 Nos permitimos un recorte de la cita simplemente a los fines analticos del presente
texto y con la intencin de evitar derivaciones psicoanalticas que, de todos modos,
podrn ser desarrolladas en otro lugar.

55

sin, entonces, opera como irrupcin, interrupcin, corte;


no como resultado de un proceso lgico, calculado, racional, de
deliberacin, sino con una modalidad de urgencia precipitativa
y violencia disruptiva (Derrida referido en De Ipola 2001: 77),
haciendo emerger un sentido instituyente en lo poltico (De Ipo-
la 2001: 77). No es asimilable, por tanto, la decisin poltica, a
lo que puede entenderse por decisin en el mbito del lenguaje
cotidiano. Tiene que ver, al contrario, con la urgencia de decidir
en esos momentos de indecidibilidad (nuevamente referencia a
Laclau 1990 en De Ipola 2001: 78). Por lo tanto, resultara im-
procedente -desde un punto de vista epistemolgico- asimilar el
anlisis de acciones y decisiones relativo al sujeto individual con
el nivel de la conformacin de sujetos colectivos.
$ORVQHVGHHVSHFLFDUHQWRQFHVHODERUGDMHHSLVWHPROyJLFR
citamos la hiptesis que desarrolla De Ipola en relacin con el su-
jeto colectivo: El sujeto colectivo al que nos referimos es un tipo
PX\HVSHFtFRSRUORJHQHUDOHPHUJHGHXQDIRUPDSDUWLFXODUGH
intervencin que es la protesta social, forma pblica pero slo in-
FLSLHQWHPHQWHSROtWLFDTXHQRWLHQHTXHKDEpUVHODVDXQFRQODV
paradojas, desafos y potencialidades de la representacin, forma
relativamente compleja, pero inscripta en una memoria y un es-
pacio mticos y que acaba por construir un discurso propio. Esto
vale no slo para la protesta social, sino para toda empresa polti-
ca (De Ipola 2001: 84).
Ubicndonos en el punto de vista de la metfora fuerte de lo
poltico planteado por De Ipola7, el tiempo de la decisin -repeti-

7 De Ipola reconstruye dos grandes modalidades de concebir la poltica, a las cuales llama metforas de la poltica: por una parte, la poltica concebida como un
subsistema dotado de funciones predeterminadas -como por ejemplo la autorregulacin de lo social- o como una superestructura social predeterminada, y, por

56

mos, no entendida como accin, sino como reaccin precipitati-


YDHLQFLHUWDDXQDVLWXDFLyQLQGHWHUPLQDGDVXSRQHXQXMRGH
instantes que se desenvuelve en el tiempo y que remiten al acon-
tecimiento por excelencia: la revolucin. La poltica, desde este
punto de vista, se aleja de sus prerrogativas representacionalis-
tas, y adquiere un carcter ptico y micro, pero con consecuen-
cias virales. Asimismo, la mediatizacin de la masa no implica
tampoco representacin, sino directamente presentacin de
esos cuerpos mediatizados en el espacio urbano que se vinculan
directamente en tanto individuos en estado de suspensin de la
interdiccin del contacto, es decir, en estado-de-masa. Tanto la
repeticin como la difusin global de dichos acontecimientos de
masas en la actualidad van imponiendo una tendencia moral que
LPSOLFD\DXQDUHFLHQWHSHURHVSHFtFDPHPRULDPHGLiWLFD$Vt
como el face-to-face tiende a confundirse con la mediatizacin,
del mismo modo el discurso de la actualidad y el de la memo-
ria reciente tienden a fundirse en un mecanismo de permanente
reedicin del directo de las masas movilizadas en las distintas
SDQWDOODV(VHVDHVSHFtFDPDQHUDTXHORVGLVSRVLWLYRVLQGLFLD-
les tienen de situar espacios particulares en temporalidades aco-
tadas lo que se viraliza a nivel global produciendo una tendencia
de rebelin siempre a punto de ser retomada.

otra parte, como la dimensin de contingencia inherente a lo social, como su dimensin de apertura, que posibilita la intervencin eficaz de la decisin individual y
colectiva sobre el mundo social y, en particular, que permite, dadas ciertas circunstancias, el cuestionamiento del principio estructurante de una sociedad, de su pacto
social fundamental, ya sea para reafirmarlo, ya para subvertirlo e instituir un nuevo
orden (De Ipola 2001: 9).

57

La masa como comunidad de carencia


El tipo de comunidad que deviene de una masa as consti-
tuida se caracteriza no por alguna pretendida identidad, sino
de manera carencial. Los miembros se unen por aquello que no
poseen, no por lo que tienen en comn; lo comn -dicho de otro
modo- es la carencia. En esto consiste el efecto comunitario de
las masas actuales, en poner en comn aquello que no poseen, y
GLFKDDSXHVWDVHUHDOL]DGHPDQHUDIRFDOVLQXQHVSDFLRHVSHFt-
co, pero en un territorio que se funda en el propio gesto del con-
tacto directo en la calle. La comunidad de tal modo conformada
supone, entonces, un sujeto sin sustancia o sin soporte: sin otro
soporte que una relacin; nico modo, tal vez, de sustraerse a
la obra de muerte que sin dudas fue la comunidad en toda la
historia humana (Nancy en Esposito 2007: 11/18).
En el Coloquium al libro de Esposito, Nancy sita sus
preocupaciones en la actualidad abrumadora del tiempo de su
escritura: Bosnia, Kosovo, Congo, Timor, Chechenia, Pakistn,
Afganistn, Irlanda, Crcega, violencias intercomunitarias en
India, Indonesia, frica. A partir de ello, plantea que hemos
sido incapaces de desmantelar o de desalentar los recursos a las
esencias comunitarias (Nancy en Esposito 2007: 12), y que
an no hemos podido comprender o inventar una constitucin
y una articulacin del ser-en-comn, decididamente distintas
(Nancy en Esposito 2007: 12). A partir, entonces, de la responsa-
bilidad que implica en tal presente abrumador de la experiencia
trgica del siglo, referirse a la comunidad, el texto se dedica a
deconstruir las nociones comunes y plantear un programa inte-
OHFWXDOTXHVHFRQVWLWX\HHQSURJUDPDSROtWLFR4XpLPSOLFDOD
comunidad?: El cum es lo que vincula o lo que MXQWD el mu-
nus del communis el reparto de una carga, de un deber o
de una tarea, y no la comunidad de una sustancia (Nancy en

58

Esposito 2007: 15 16). Ese con, siendo efectivamente nada,


consiste meramente en el lugar mismo, en la capaci-
GDGGHTXHDOJXQDVFRVDV\DOJXQRVHVWpQah, es decir que ah
se encuentren los unos con los otros o entre ellos, siendo el
con y el entre, precisamente, no otra cosa sino el lugar mismo,
el medio o el mundo de existencia (Nancy en Esposito 2007:
17): la circulacin de la proximidad en su alejamiento
propio, y del alejamiento en su proximidad: la devolucin
o el rebote de prximo en prximo por el cual un mundo hace un
mundo (Nancy en Esposito 2007: 17/18). Es por ello que se
trata de un sujeto sin sustancia o sin soporte; como citbamos
ms arriba: sin otro soporte que una relacin la de una
circulacin de sentido (Nancy en Esposito 2007: 19)8.
En realidad, communitas designa no lo que es comn, sino lo
que no es propio, ya que siendo pblico -es decir, concernien-
do a ms de uno- comienza all donde lo propio termina (Espo-
sito 2007: 25/26). Pero, adems, al sentido del cum se adhiere
RWURTXHYXHOYHDODIyUPXODDOWDPHQWHFRQLFWLYDHOGHOmunus,
que remite a la idea de deber y, en una de sus acepciones, al
don como deber (Esposito 2007: 26). De tal manera, se abre un
campo semntico particular alrededor del munus en tanto do-
numTXHUHFXSHUDQGRODVUHH[LRQHVGH0DXVVLQGLFDXQGRQ
particular que se distingue por su carcter obligatorio (Esposito
2007: 27). Es un don que se da porque se debe dar y no se puede
no dar, dice Esposito. El munus es, entonces, la obligacin que
se ha contrado con el otro y requiere una adecuada desobliga-
cin. Es ponerse a disposicin, a merced del otro, instalando

8 Todas las negritas del original.

59

la reciprocidad del compromiso, a la manera de un juramen-


WRFRP~Q (VSRVLWR (QGHQLWLYDHQVXVHQWLGR
antiguo, communis es quien comparte una carga (un cargo, en
encargo) (Esposito 2007: 29).
Remarcamos, entonces, esta modalidad carencial en el con-
cepto de comunidad: Communitas es el conjunto de personas
a las que une no una propiedad sino un deber o una deuda
las personas no se encuentran unidas por un ms, sino por un
menos, una falta (Esposito 2007: 29/30). La comunidad, para
(VSRVLWRWDPELpQWLHQHHVHFDUiFWHUVRPiWLFRHVDWH[WXUDDOD
FXDO\DQRVUHIHULPRVXQYpUWLJRXQDVtQFRSDXQHVSDVPR
en la continuidad del sujeto (Esposito 2007: 32). El motivo ba-
WDLOOHDQRGHOH[FHGHQWHHQHUJpWLFRVDFULFLDOTXHH[SRQHDOLQGL-
viduo ms all de sus propios lmites hacia el encuentro de un
contagio metonmico es la propia comunidad; comunidad de
DTXHOORVTXHHYLGHQWHPHQWHVyORODWLHQHQSHUGLpQGROD\SHU-
GLpQGRVH HQ VX PLVPR GHXMR (VSRVLWR   
La masa, en tanto comunidad, es entonces un desgarrado po-
QHUVHHQMXHJR con los otros9. De este modo se encuentra el
ORFXV EDWDLOOHDQR TXH GHQH OD OyJLFD GH OD FRPXQLGDG HO GRQ
por excelencia, sin motivacin ni retribucin, de la comunidad
batailleana, es el de la vida. Implica el abandono de cada identi-
dad no a una identidad comn, sino a una comn ausencia de
identidad (Esposito 2007: 202).

9 Ver las referencias a Bataille en Esposito: (Bataille) busca la comunidad en un


contagio provocado por la ruptura de los lmites individuales y la infeccin recproca
de las heridas, hay una ley: los seres humanos slo estn unidos por desgarros o
heridas. Cada uno de ellos pierde por un desgarro de su integridad una parte de su
propio ser en provecho del ser comunial (cita 42 en Esposito 2007: 201 y referencias a Bataille en Ibidem: 51).

60

La modalidad preeminentemente carencial que se detecta en


la conformacin de las masas actuales puede constatarse a partir
GHODLGHQWLFDFLyQGHHVWRVFRPSRQHQWHVVHJUHJDWRULRV\VDFUL-
FLDOHVTXHVHSRQHQHQMXHJR(QORVSURFHVRVFRQRFLGRVFRPR
la Primavera rabe, por ejemplo, se produjeron numerosas in-
molaciones, como la de Mohamed Buaziz, que se inmol con el
fuego el 17 de diciembre de 2010 en Tnez, muriendo unos das
GHVSXpV'HWDOPDQHUDVHSRQHHQDFWRXQSULPLWLYLVPRGHOD
crueldad que se convierte en slogan de la revolucin, toman-
do a la palabra slogan en su genealoga de grito de combate,
que remite al grito de guerra de los muertos (Canetti 1960: 40
en Valdettaro 2012: 156), y que liga, de este modo, a las masas
actuales con las luchas ancestrales. Del mismo modo, el uso de
smbolos de masa como el fuego -que, segn Canetti, es el ms
vigoroso que existe para la masa (Canetti 1960: 15)- contribuye
a reforzar las hiptesis retrospectivas. Este ancestral mecanismo
VDFULFLDOTXHHYDGHWRGDVXVWLWXFLyQVLPEyOLFDFRPRDFWRSROt-
tico de masas rene las condiciones requeridas por la mediati-
zacin actual para su viralizacin: mxima visibilidad, mxima
destruccin, mxima ambigedad, inmediata extincin, urgen-
cia instantnea. La masa, de este modo, se abre y entra en su fase
de estallido alcanzando a todos (Canetti 1960: 17), su gramti-
ca interna muda de lo cardinal a lo ordinal10, de la agregacin a
la fusin. Y su carcter paradojal se hace evidente.

10 Dice Ritvo, tomando una intuicin de La Botie, que la red del poder es eminentemente ordinal. Un tirano no domina directamente a una masa indiferenciada: uno
se liga a seis, que a su vez se ligan a sesenta, que a su turno etc., hasta formar una
pirmide de solidaridades y complicidades, de pactos y de traiciones (Ritvo 2011:
23/24 y nota 6 en las mismas pginas),

61

0XFKR VH KD UHPDUFDGR WDPELpQ HO FDUiFWHU MRYHQ GH OD
llamada wikirrevolucin del jazmn (cfr. Castells 2011). Los
GDWRV FRQUPDUtDQ GLFKD KLSyWHVLV FDVL HO   GH ORV iUDEHV
tiene menos de 30 aos; y cuentan con una importante pene-
tracin de medios y, principalmente, de los dispositivos ligados
a Internet. Son los jvenes, justamente, quienes mayormente
desarrollan un vnculo estrecho con las nuevas tecnologas, y
fueron ellos quienes ocuparon un lugar central en el desarrollo
de estos acontecimientos. Asociada a los dispositivos, la msica
GHVHPSHxyWDPELpQXQUROLPSRUWDQWHGHVGHHOSXQWRGHYLVWD
de la irradiacin de las revueltas. Por lo tanto, es posible carac-
terizar estos fenmenos mediante una serie de rasgos estilsticos
caractersticos de la juventud, ya que la juventud -adems de
construirse como un artefacto sociolgico a partir de determi-
nados indicadores-, se distingue por una condicin que hace
DOFDUiFWHUGHODpSRFDHOFRQWDFWRPXOWLPHGLiWLFRSHUPDQHQWH
(Fernndez 2012: 253). Pero es de suponer que la vida de una
masa excede dicha identidad etaria conformndose como una
FRPXQLGDG HVWpWLFD LGHQWLWDULD )HUQiQGH]    FDSD]
de aglutinar diferentes componentes generacionales. Podramos
postular que son, justamente, esas rutinas de contactos multi-
mediticos trans-generacionales lo que hace a la conformacin
de las masas actuales.
El carcter ambiguo de una masa as constituida presenta
una modalidad radicalmente paradojal abriendo un espacio de
indeterminaciones en cuyo seno son posibles las bifurcaciones:
GHORQHJDWLYRDSRVLWLYLGDGHVGHODXWRVDFULFLRDXQDPDVDTXH
hace rebelin. La posibilidad individualizada de conmutacin
universal habilitada por las tecnologas (Vern 2011: 146) re-
IXHU]D OD OyJLFD GHO FRQWDFWR \ SURGXFH HVFHQDULRV GH LQpGLWRV
niveles de complejidad cuyos grados de incertidumbre contri-
buyen al despliegue de trayectorias impensadas. Estas masas

62

instantneas y, en principio, fugaces, habilitadas por las tecno-


logas, constituyen la modalidad central de ejercicio poltico de
los excluidos en la actualidad o, para decirlo con palabras de
Rancire, de aquellos que no tienen parte (cfr. Rancire 2007).
De este modo, se cuestiona la divisin policial de lo sensible
o, dicho de otro modo, el reparto de lo sensible11, ya que la
actividad poltica es la que desplaza a un cuerpo del lugar que le
estaba asignado o cambia el destino de un lugar; hace ver lo que
no tena razn para ser visto, hace escuchar un discurso all don-
de slo el ruido tena lugar, hace escuchar como discurso lo que
no era escuchado ms que como ruido (Rancire 2007: 45). Se
pone en juego, de tal modo, la distribucin entre lugares y partes
tornando a la poltica una estticaODSROtWLFDHVHVWpWLFDHQ
WDQWRTXHHVODPLVPDFRPSRVLFLyQHVWpWLFDODGLVWULEXFLyQGH
lugares y partes la que se pone en juego, es ese el terreno de la
disputa, la composicin y la percepcin de un comn y de unas
SDUWHV H[FOXVLYDV \ D OD YH] HV HVWpWLFD \D TXH VXSRQH OD FRQV-
titucin de un nuevo tipo de comunidad basada en el como si
que implica cuestionar la particin de lo sensible instituida, la
esthesis vigente, as como la formacin de una nueva reparti-
cin exigible que evidencia la parte de los que no tienen parte
(Di Filippo 2010: 29).

11 El reparto de lo sensible se entiende como la ley generalmente implcita que


define las formas del tener-parte definiendo primero los modos perceptivos en los
cuales se inscriben,es el recorte del mundo y de mundo, el nemen sobre el cual
se fundan los nomo de la comunidad (Rancire 2006: 70). Tambin, en El reparto
de lo sensible, Rancire define como divisin o reparto de lo sensible a ese sistema
de evidencias sensibles que al mismo tiempo hace visible la existencia de un comn
y los recortes que all definen los lugares y partes respectivas (Rancire 2009: 9).

63

La poltica, en su sentido fuerte de revolucin (De Ipo-


la), depende, entonces, en principio, de la visibilizacin de las
reacciones posibles de esos cuerpos en contacto; la masa -desde
este punto de vista- es una asociacin pasional, un dispositivo
del contacto cuyo estallido depender del tipo de articulacin de
ciertos vectores pasionales que instituyen un espacio indeter-
minado y contingente de accin; y esto es as, porque antes o
GHVSXpVGHORVJpQHURVHOLQGLYLGXRHOLJHHQWUHtexturas (Fer-
nndez 2012: 284/285). Siendo, como decamos ms arriba, la
mediatizacin actual condicin de produccin de la conforma-
cin de las masas actuales, ello no implica necesariamente un
efecto de estabilizacin o institucionalizacin de los vnculos. Al
FRQWUDULRHOHVFHQDULRTXHVHKDELOLWDHVWDPELpQHQFRQVRQDQ-
cia con la caracterizacin de sujeto, accin y decisin que
realizramos ms arriba- radicalmente SDUDGRMDO. Parafrasean-
do a Luhmann, podemos decir que la inmediatez del contacto
que faculta la digitalizacin, es, efectivamente, condicin de
posibilidad de la masa, y, simultneamente, condicin de su
imposibilidad, ya que las asociaciones-en-red via digitalizacin
WLHQGHQFRPRODPDVDDODHYDQHVFHQFLD(QGHQLWLYDVyORVH
trata de una ligera levedad que, de manera incierta, tal vez, pue-
da producir revolucin.-

64

Bibliografa
Canetti, Elias (1960), Masa y Poder, Barcelona, Muchnik Edi-
tores, 1994.
Carln, Mario,En el ojo de la convergencia. Los discursos de los
usuarios de Facebook durante la transmisin televisiva de la
votacin de la ley de matrimonio igualitario, en Carln M.
y Neto F., La poltica de los cibernautas. Nuevas formas de
participacin, Bs As: La Cruja, 2012.
&DVWHOOV 0DQXHO/D ZLNLUUHYROXFLyQ GHO MD]PtQ HQ 2SLQLyQ
Lavanguardia.es, 29/01/2011.
De pola, Emilio, Metforas de la poltica, Rosario, Homo Sapi-
ens Ediciones, 2001.
'L )LOLSSR 0DULOp -DFTXHV 5DQFLqUH DFHUFD GH YLUDMHV HVWpWL-
cos y escndalos polticos, Tesina de Grado, Licenciatura en
Ciencia Poltica, Facultad de Ciencia Poltica y Relaciones In-
ternacionales, Rosario, UNR, 2010.
Esposito, Roberto, Communitas. Origen y destino de la comuni-
dad, Buenos Aires, Amorrortu, 2007.
)HUQiQGH]-RVp/XLVLa captura de la audiencia radiofnica,
Liber Editores, Bs As, 2012.
Garca Fanlo, Luis,Twitter y la rebelin de los ciberfans de
Gran Hermano 2.0 en Carln M. y Neto F., La poltica de
los cibernautas. Nuevas formas de participacin, Bs As, La
Cruja Ediciones, 2012.
Lacalle, Charo, Elecciones catalanas y web 2.0, en Carln M.
y Neto F., La poltica de los cibernautas. Nuevas formas de
participacin, Bs As: La Cruja, 2012.
Latour, Bruno, Reensamblar lo social. Una introduccin a la
teora del actor-red, Bs As, Manantial, 2008.
Nancy, Jean Luc; Conloquium en Espsito, Communitas. Origen
65

y destino de la comunidad, Buenos Aires, Amorrortu; 2007


2WHUR('LiORJRFRQ(OLKX.DW]HQ5HYLVWD7DOyQGH$TXLOHV
Nro. 8, Chile, invierno de 2000.
Rancire, Jacques, Poltica, polica y democracia, Santiago de
&KLOH/20(GLFLRQHV
Rancire, Jacques, (O GHVDFXHUGR 3ROtWLFD \ ORVRItD, Bs As,
Nueva Visin, 2007.
Rancire, Jacques, El reparto de lo sensible. Esttica y poltica,
6DQWLDJRGH&KLOH/20(GLFLRQHV
Ritvo, Juan Bautista, 6XMHWR0DVD&RPXQLGDG/DUD]yQFRQ-
MHWXUDO\ODHFRQRPtDGHOUHVWR, Santa Fe, Mar por Medio Edi-
tores, 2011.
9DOGHWWDUR6DQGUD 0LGLDWL]DomR H 0XOWLG}HV UHH[}HV VREUH
RVYtQFXORVHQWUHVRFLRVVHPLyWLFDHORVRDSROtWLFDQDDWXDOL-
dade en Neto F. y otros (orgs.). Midiatizao e processos so-
ciais na Amrica Latina, So Paulo: Editorial Paulus, 2008.
Valdettaro, Sandra, Audiencias, de las redes sociales a las aso-
ciaciones en red, en Valdettaro Sandra coordinadora, Inter-
IDFHV\3DQWDOODVDQiOLVLVGHGLVSRVLWLYRVGHFRPXQLFDFLyQ,
Rosario, UNR Editora, 2011.
Valdettaro, Sandra, Fuego, revolucin, tecnologas: la masa te
pasa a buscar, en Carln M. y Neto F., La poltica de los ci-
bernautas. Nuevas formas de participacin, Bs A, La Cruja,
2012.
Valdettaro, Sandra, Revisin de las teoras sobre efectos en el
contexto de la mediatizacin actual: la cuestin de la masa
en Maestri M. y Biselli R. (Compiladores), Cuadernos del CIM
Nro. 1-Mediatizaciones en foco, Rosario, UNR Editora. 2013.
Vern, Eliseo, Papeles en el Tiempo, Bs As: Paids, 2011.

66

CAPTULO III

Post-neoliberalismo, corporativismo
y conflictos polticos: notas acerca
del espacio pblico en Argentina
y Ecuador

Por Soledad Stoessel

/DLQYRFDFLyQ\UHH[LyQHQWRUQRDODQRFLyQGHHVSDFLRS~EOL-
co constituye una de las preocupaciones tericas ms recurrentes
DODTXHODORVRItD\VRFLRORJtDSROtWLFDVKDQGHVWLQDGRGpFDGDV
de debates y teorizaciones. Si bien dicho concepto ha atravesado
P~OWLSOHV UHFRUULGRV SROLVpPLFRV \ HQWXHUWRV VHPiQWLFRV LPSR-
VLELOLWDQGRKDOODUXQFRQVHQVRHQWRUQRDVXVLJQLFDGRKR\HQ
da contina siendo una de las categoras claves de las ciencias
sociales para analizar y comprender los procesos polticos. Desde
diferentes perspectivas tericas se ha venido recuperando esta
categora para dar cuenta de mltiples fenmenos sociales y po-
lticos contemporneos, otorgndoles diversos sentidos. Tanto
desde paradigmas herederos del republicanismo cvico (Arendt,
2008), pasando por las teoras transicionales de la democracia,
hasta distintas perspectivas (neo)liberales, el espacio pblico o
la esfera de lo pblico- ha estado ntimamente asociado al mismo
tiempo con determinadas formas de comprender la construccin
del orden social, las disputas por la hegemona y las relaciones
entre el Estado y la sociedad (Rabotnikof, 2008).

67

$VLPLVPR YDULDV GH HVWDV UHH[LRQHV QR HVWXYLHURQ DMHQDV


DXQDFRQFHSFLyQQRUPDWLYLVWD\WDPELpQLGHDOLVWDGHOHVSD-
cio pblico al descontextualizar su anlisis de las condiciones
reales de (re)produccin o, por el contrario, anclar la nocin en
FDVRVHVSHFtFRVSDUDGHVGHDOOtRWRUJDUOHFLHUWDVDWULEXFLRQHV
sentidos y funciones a priori. El problema con los estudios con
fuertes referencias normativistas que no siempre son explici-
tadas- muchas veces reside en la adopcin de sus premisas y
conclusiones para explicar fenmenos socio-polticos que res-
ponden a otros contextos de produccin. Varias de las concep-
FLRQHVHQWRUQRDORS~EOLFRHQ$PpULFD/DWLQDIXHURQHODER-
radas a partir de la importacin de teoras y paradigmas euro-
pestas para analizar los fenmenos de nuestra regin -como las
SHUVSHFWLYDVKHUHGHUDVGHODORVRItDSROtWLFDKDEHUPDVLDQD\
muchas de sus debilidades para explicarlos ha sido producto
de la carencia de estudios empricos en clave latinoamericana
acerca de los modos en que la nocin de esfera pblica funciona
en determinadas coyunturas y procesos socio-polticos latinoa-
mericanos.
Las tesis segn las cuales el espacio pblico opera como una
arena autnoma, plural y democratizadora en donde se constru-
\HODYROXQWDGFROHFWLYD\ODRSLQLyQS~EOLFDUHDODWUDYpVGHOD
deliberacin racional entre los ciudadanos (Habermas, 1986), o
como una instancia mediadora entre la sociedad civil y el siste-
ma poltico que funciona como una caja de resonancia para que
los ciudadanos puedan tematizar pblica y polticamente de un
PRGRLQX\HQWHORVSUREOHPDVGHLQWHUpVSDUDWRGRV +D-
bermas, 1992: 444; Cohen, 1985) calaron profundamente en el
debate sociolgico y politolgico post-regmenes dictatoriales
HQ$PpULFD/DWLQD/DSUHPLVDGHIHQGLGDSRUDOJXQRVSDUDGLJ-
mas latinoamericanos en pleno auge del neoliberalismo y de las
luchas sociales en contra de este modelo durante los aos 80

68

y 90 que colocaba a la esfera pblica como la instancia crtica


\HPDQFLSDGRUD 'DJQLQR2OYHUD\3DQFKL IUHQWHDXQ
Estado dictatorial, represor y neoliberal abrev en aquellas tesis
e impregn gran parte de los estudios en torno a las transicio-
QHVGHPRFUiWLFDVHQ$PpULFD/DWLQD(OVXUJLPLHQWRGHQXHYRV
movimientos sociales en algunos pases habra contribuido a
ampliar la esfera de lo pblico para sectores histricamente re-
legados y excluidos. Movimientos como el de derechos humanos
y de trabajadores desocupados en Argentina, los movimientos
urbanos vecinales en Brasil (Avritzer, 2006) y el zapatismo en
0p[LFRUHVLJQLFDURQODQRFLyQGHORORS~EOLFRODFXDOKDEtD
estado asociada hasta ese momento al estricto campo estatal. A
partir de entonces, comenz a hablarse de lo pblico no esta-
tal (Bresser y Cunill Grau, 1998) en donde, en tanto instancia
FUtWLFDGHOSRGHUHVWDWDO\GHVFDOL]DFLyQS~EOLFDVHLQVWDXUDUtD
ODFRPXQLGDGSROtWLFD\VHGHIHQGHUtDHOLQWHUpVJHQHUDOGHODV
sociedades.
En este contexto, las diferentes acepciones que fue asumien-
do la nocin de espacio pblico implic la imposibilidad de
DWULEXLUOH XQD GHQLFLyQ LQHTXtYRFD SURYRFDQGR XQD SURIXQ-
dizacin del desfase entre el corpus terico y la realidad (Ze-
melman, 1987), una disociacin entre el pensamiento terico y
los fenmenos objeto de estudio y anlisis. Ceirse a concep-
WRVFRQVLJQLFDGRVGHOLPLWDGRV\DFXxDGRVHQRWURVFRQWH[WRV
puede acarrear el problema de leer los fenmenos a partir de
determinadas lentes conceptuales que encorsetan y amarran
al investigador, llevndolo incluso a la invencin de realidades
acordes a dichas nociones. Es por esta razn que los conceptos y
teoras deben ser revisados a la luz de las exigencias que ameri-
ta la realidad, del surgimiento de fenmenos concretos, nuevos,
inusitados e imprevistos para los cuales no existen -o si existen
deben ser repensadas- herramientas conceptuales.

69

Es a partir de estas premisas que el presente artculo1 se


SURSRQHRIUHFHUXQDEUHYHUHH[LyQDFHUFDGHOIXQFLRQDPLHQWR
del espacio pblico a la luz de los procesos socio-polticos con-
temporneos suscitados con la llegada al poder poltico de go-
biernos que imprimieron un giro a la izquierda (Arditi, 2009;
Panizza, 2005) al ciclo poltico inaugurado con el advenimiento
del siglo XXI, como los casos de Argentina y Ecuador2. Espec-
FDPHQWHVHLQWHUURJDSRUHOPRGRHQTXHHOHVSDFLRS~EOLFR
RSHUDHQGHWHUPLQDGDVFR\XQWXUDVFRQLFWLYDVDOPLVPRWLHP-
SR FRPR VXSHUFLH \ UHFXUVR SDUD TXH DFWRUHV VRFLRSROtWLFRV
corporativos puedan movilizar y defender intereses y agendas
particularistas.
Para ello, se presentarn sucintamente dos casos concretos
de contiendas polticas protagonizadas por sectores corporati-
vos en rechazo de polticas estatales. El primero desarrollado
entre el gobierno presidido por Cristina Fernndez de Kirchner
y las entidades patronales ligadas al sector agropecuario duran-
WHHQWRUQRDXQDUHVROXFLyQSUHVLGHQFLDOTXHPRGLFDED
HOUpJLPHQGHGHUHFKRVGHH[SRUWDFLyQ\HOVHJXQGRSURWDJRQL-
zado en septiembre de 2010 por la Fuerza Pblica de Ecuador
contra el gobierno de Rafael Correa a raz de la aprobacin de

1 Este artculo recoge algunas de las reflexiones esbozadas en la tesis realizada en el


marco de la Maestra en Ciencias Polticas de la Facultad Latinoamericana de Ciencias Sociales-Sede Ecuador.
2 Otros pases como Bolivia y Venezuela tambin son incluidos por gran parte de la
literatura acadmica dentro de este grupo de pases cuyos nuevos regmenes polticos
han implementado polticas progresistas, de izquierda. No obstante, por cuestiones
de espacio, en este trabajo nos detendremos en los casos de Argentina y Ecuador que
si bien difieren en aspectos tales como origen, estilo, discurso, formas de apelacin,
base social, alianzas de intereses y polticas (Kitzberger, 2010: 61), comparten
algunos elementos como la recuperacin de la autonoma del Estado para llevar adelante el proceso de cambio.

70

OD/H\2UJiQLFDGH6HUYLFLR3~EOLFRTXHUHHVWUXFWXUDEDFLHUWDV
mbitos del sector pblico.
El artculo se estructura en tres apartados. En primer lugar,
VHSUHVHQWDQXQDVLQWpWLFDFRQWH[WXDOL]DFLyQ\SULQFLSDOHVOLQHD-
mientos poltico-ideolgicos de los gobiernos post-neoliberales
de Cristina Fernndez de Kirchner en Argentina y de Rafael Co-
rrea en Ecuador y su relacin con el corporativismo. En segunda
instancia, se indagar en el modo en que funcion la nocin de
HVSDFLRS~EOLFRHQORVGRVFDVRVGHFRQLFWRSROtWLFRHQORVTXH
la esfera de lo pblico oper como arena en la cual movilizar
intereses sectoriales-particulares y legitimarlos. Por ltimo, se
SURSRQGUiQ DOJXQDV UHH[LRQHV HQ WRUQR D ODV FRQGLFLRQHV GH
produccin y reproduccin del espacio pblico latinoamericano.

Entre la recuperacin de lo pblico


y el corporativismo en los nuevos gobiernos
post-neoliberales
$ SDUWLU GHO VLJOR ;;, DOJXQRV SDtVHV GH $PpULFD /DWLQD
como Bolivia, Argentina, Ecuador y Venezuela, experimentaron
la llegada al poder de gobiernos que dieron un giro poltico
DOJXQRVPiVRWURVPHQRVHQUHODFLyQDODVGpFDGDVDQWHULRUHV
en tanto se propusieron superar la ortodoxia neoliberal crista-
OL]DGDHQHO&RQVHQVRGH:DVKLQJWRQGXUDQWHODGpFDGDGHORV
DxRVQRYHQWD7DQWRHOJRELHUQRDUJHQWLQRGH1pVWRU.LUFKQHU
en 2003 como el de Correa en 2007 en Ecuador emergieron
como consecuencia del agotamiento del paradigma neoliberal
en tanto modelo econmico y proyecto poltico. La expresin
4XHVHYD\DQWRGRVTXHUHSUHVHQWyODVFDtGDVSUHVLGHQFLDOHV
WDQWRGH'HOD5~DHQ$UJHQWLQDHQFRPRGH/XFLR*XWLp-
rrez en Ecuador en 2005 fue el resultado de la crisis que decant

71

la instalacin de la agenda neoliberal en esos pases (Ramrez,


2010) y la nula intervencin del Estado en pos de las mayoras.
Para lograr este propsito, las coaliciones polticas y movimien-
tos que encarnaron los nuevos gobiernos colocaron al Estado en
un primer plano en tanto agente poltico de regulacin econ-
mica, redistribucin de la riqueza, inclusin social y coordina-
cin de lo social (Ramrez Gallegos, 2010a; Vilas, 2010). En Ar-
gentina y Ecuador, la recuperacin de las capacidades estatales,
opacadas y minimizadas durante el neoliberalismo, constituy
uno de los elementos en el que estos gobiernos se fundaron y
legitimaron para llevar adelante las agendas de cambio poltico
\ UHVLJQLFDU ORV VHQWLGRV GH OD SROtWLFD \ HO (VWDGR (O (VWDGR
empoderado recuper un sentido de lo pblico que durante el
neoliberalismo se haba visto fuertemente aniquilado: el Estado
como un actor orientado a construir y lograr el bien comn a tra-
YpVGHXQDOyJLFDGHDFFLyQEDVDGDHQODXQLYHUVDOL]DFLyQGHORV
intereses (Rabotnikof, 2008). La primaca de la nueva acepcin
de lo pblico-estatal por sobre otras variables ha posibilitado
que estos gobiernos adquieran cierto grado relativo de autono-
ma (Thwaites Rey, 2009) respecto a los actores pro-Consenso
de Washington que durante el ciclo neoliberal haban marcado
los procesos polticos, econmicos y sociales.
El kirchnerismo3, desde sus inicios, se caracteriz por la
construccin de un discurso cargado de tintes antineoliberales,
nacionalistas y populistas (Muoz y Retamozo, 2009), dirigido a
interpelar y atraer a los sectores desfavorecidos durante el ciclo

3 Entendemos por kirchnerismo el proyecto poltico iniciado en mayo de 2003 con la


asuncin del ex Presidente Nstor Kirchner y continuado en diciembre de 2007 por
la Presidenta Cristina Fernndez de Kirchner.

72

QHROLEHUDOHULJLHQGRFRPRDQWDJRQLVWDVDORVDFWRUHVDQHVDOD
dictadura militar, las empresas privatizadas, la clase poltica de
ese perodo y las diferentes corporaciones, entre ellas, los me-
dios de comunicacin, quienes desde el discurso kirchnerista,
durante el neoliberalismo colonizaron la esfera pblica y actua-
ron como verdaderos poderes fcticos a favor de las polticas
pro-mercado (Kitzberger, 2010: 84). Este repertorio discursivo,
que demostr una gran productividad poltica, se vio acompa-
ado de un conjunto de polticas y gestos polticos implementa-
dos con el objeto de revertir los perjuicios generados en la etapa
anterior, mostrando una relativa ruptura con el ncleo duro de
OD HWDSD QHROLEHUDO $OJXQDV GH ODV SROtWLFDV PiV VLJQLFDWLYDV
fueron las polticas de derechos humanos destinadas a satisfacer
algunas de las demandas esgrimidas por el movimiento de de-
rechos humanos argentino, como la derogacin de las Leyes de
2EHGLHQFLD'HELGD\GH3XQWR)LQDOTXHRWRUJDEDQLQGXOWRVDORV
militares y policas responsables de la desaparicin y muerte de
personas durante la ltima dictadura militar; el descabezamien-
to de las cpulas militares; la renovacin de la Corte Suprema
de Justicia debido al desprestigio y deslegitimacin social en el
que haban cado sus jueces durante los gobiernos de Menem,
reemplazndolos por un cuerpo de mayor autonoma y plurali-
dad ideolgica (Mauro y Rossi, 2011); las retenciones al sector
DJUDULRFRQQHVUHGLVWULEXWLYRV\HODXPHQWRGHORVLQJUHVRVHQ
los sectores pobres.
La asuncin de Cristina Fernndez de Kirchner en diciembre
GHKDELHQGRJDQDGRODVHOHFFLRQHVFRQXQVLJQLFy
la profundizacin y continuidad del proyecto iniciado con Kir-
chner. Pese a contar con un contexto econmico relativamente
favorable, un capital poltico heredado de su esposo, recursos
institucionales de poder y una oposicin poltica pulverizada, a
los cuatro meses de iniciado la gestin y sin haber alcanzado an

73

XQ UXPER SURSLR HVWD VH YLR HQYXHOWD HQ XQ LQWHQVR FRQLFWR
FRPRFRQVHFXHQFLDGHXQDGHFLVLyQSUHVLGHQFLDOTXHPRGLFDED
el nivel de retenciones a las exportaciones de cereales.
Con respecto al gobierno ecuatoriano de Correa, al igual que
el kirchnerismo, enunci desde el inicio un discurso anti-neo-
liberal, bolivariano e izquierdista (Ramrez, 2010a: 178), cons-
truyendo como adversarios polticos a la elite econmica ecua-
toriana encarnada en los grupos empresarios la oligarqua gua-
yaquilea o pelucones desde la retrica de Correa- respaldados
por el partido de la derecha PSC-, organismos internacionales
GHFUpGLWRTXHLPSXVLHURQODDJHQGDQHROLEHUDO\ODFODVHSROtWLFD
ecuatoriana y al sistema poltico en general. Alianza Pas, el mo-
YLPLHQWRSROtWLFRIXQGDGRSDUDORVQHVHOHFWRUDOHVSUHFLVDPHQ-
te prescindi de una estructura partidaria y manifest signos de
distanciamiento con los partidos polticos tradicionales.
Adems de la decisiva convocatoria a una Asamblea Consti-
tuyente para reformar la Constitucin en el ao 2008, el proyec-
to corresta de la Revolucin Ciudadana (RC) llev adelante
contundentes polticas de gran impacto popular. Por ejemplo,
la intervencin total en la base rea en territorio ecuatoriano
controlada hasta ese momento por el gobierno de EEUU, la sus-
pensin de las negociaciones en torno al Tratado de Libre Co-
mercio (TLC); la incautacin de empresas correspondientes al
Grupo Isaas, uno de los conglomerados econmicos y medi-
ticos ms poderosos del pas que haba sido responsable de la
FULVLV QDQFLHUD HFXDWRULDQD GH  (VWDV SROtWLFDV VH YLHURQ
acompaadas por la implementacin de programas en materia
de educacin, salud, vivienda y desarrollo humano, como el au-
mento del Bono de Desarrollo Humano, la duplicacin del Bono
orientado a la vivienda, la aplicacin de subsidios a la energa
SDUDORVKRJDUHVGHPHQRUSRGHUDGTXLVLWLYR 2VSLQD \
una reforma progresiva del sistema tributario, entre otros, lo-

74

grando un mejoramiento en todos los indicadores sociales y eco-


nmicos. De esta forma, el proyecto de la RC comenz a cobrar
un tinte institucional y exhibir un gran apoyo popular alrededor
del liderazgo de Correa.
Este novedoso escenario supuso, casi como una peticin de
SULQFLSLRV OD DFWLYDFLyQ GH XQD DJXGD GLQiPLFD GH FRQLFWLYL-
dades socio-polticas proveniente de diversos frentes, cuyos ac-
tores vieron perjudicados, de alguna u otra manera, sus intere-
ses a raz de este giro en las agendas polticas progresistas. La
UHVLVWHQFLD D ODV SROtWLFDV RULHQWDGDV D PRGLFDU HO status quo
provino, especialmente, de poderosos sectores sociales y pol-
ticos corporativos renuentes a aceptar un cambio en la corre-
lacin de fuerzas polticas y en su capacidad vigorosa durante
el neoliberalismo- de intervenir en el seno del Estado. De esta
IRUPDHOFRQLFWRFRQGLFLRQyHOWLHPSRSROtWLFRGHORVQXHYRV
gobiernos y abri un momento fundamentalmente antagnico
en la poltica democrtica de la regin (Ramrez, 2010a: 134).
La relacin que los gobiernos post-neoliberales entablaron con
los actores que caben bajo la nocin de corporativismo estuvo
marcada por constantes tensiones debido a su imposibilidad de
ORJUDUFRQVHUYDUFLHUWRVEHQHFLRV\SULYLOHJLRVHQODVDUHQDVHQ
las que tradicionalmente haban actuado como en el Parlamen-
to, al interior de las agencias estatales, acuerdos privados-, por
lo que el momento antagnico encontr su modo de expresarse
IXQGDPHQWDOPHQWHDWUDYpVGHOHVSDFLRS~EOLFR
Por corporativismo entendemos una dimensin dual que
estar ntimamente ligada a los tres sentidos que Rabotnikof
 LGHQWLFDSDUDODGLFRWRPtDS~EOLFRSULYDGRORUHODWLYR
DOELHQFRP~QIUHQWHDORVLQWHUHVHVSDUWLFXODUHVORPDQLHVWR\
visible, frente a lo oculto; y lo accesible a todos, frente a lo que se
sustrae a la disposicin del colectivo. Por un lado, entendemos al
corporativismo como un sistema de representacin de intere-

75

ses y/o actitudes, un particular arreglo institucional ideal-tpico,


para vincular los intereses de la sociedad civil organizados en
asociaciones con las estructuras de decisin del Estado (Schmit-
WHU HVGHFLUDWUDYpVGHDUUHJORVLQVWLWXFLRQDOHVGH-
terminados grupos logran enquistarse en las estructuras de de-
FLVLyQGHO(VWDGRHLQXLUHQGHWHUPLQDGDViUHDVLQVWLWXFLRQDOHV
TXHORVEHQHFLDQ(QHVWHVHQWLGRODOyJLFDFRUSRUDWLYDFDUHFHUtD
de la visibilidad y accesibilidad que encarnara lo pblico dado
que establece acuerdos que no necesariamente son conocidos por
el resto de la sociedad y a los que slo pueden acceder los grupos
organizados, reconocidos institucionalmente como tales.
3RURWURODGRDTXHOODTXHUHHUHDOFRQWHQLGR\RULHQWDFLyQ
de ciertos intereses y demandas. Esta concepcin, que se retro-
WUDHDODVWHRUL]DFLRQHVGH*UDPVFLHQWRUQRDOSDUGLDOpFWLFRIDVH
HFRQyPLFD LQWHUHVHVSDUWLFXODUHV IDVHSROtWLFD LQWHUpVJHQHUDO
KHJHPRQtD  *UDPVFL EDVDVXGHQLFLyQHQODVSDUWLFX-
laridades que revisten ciertos intereses defendidos por sectores y
organizaciones, en contraposicin a una cultura de la generali-
dad (Rosanvallon, 2008). En los casos que analizaremos en las
prximas pginas veremos que fueron los sectores corporativos
los que, de alguna u otra forma, lograron desestabilizar a ambos
gobiernos y amenazar la democracia en estos pases.

La colonizacin del espacio pblico en Argentina


y Ecuador
Las contiendas polticas escogidas como trasfondo de estas
UHH[LRQHVFRQGHQVDURQFRPRSRFDVXQDPXOWLSOLFLGDGGHGL-
mensiones e involucraron una heterogeneidad de actores so-
ciales y polticos -como partidos polticos, organizaciones, mo-
vimientos sociales y medios de comunicacin, entre otros- que

76

complejizan su estudio4. No obstante, a continuacin nos deten-


dremos sucintamente en un aspecto de las mismas la relacin
entre corporativismo y espacio pblico- a partir del siguiente
interrogante: De qu modo y con qu consecuencias, frente el
ahogo de los mecanismos corporativos para tramitar los inte-
UHVHV\GHPDQGDVHOHVSDFLRS~EOLFRRSHUyFRPRVXSHUFLH\
recurso de construccin de legitimidad por parte de sectores
corporativos?
El 11 de Marzo del ao 2008 el gobierno argentino presidido
por Cristina Fernndez de Kirchner anunciaba en una conferen-
cia de prensa la Resolucin 125 la cual estipulaba un aumento
en los derechos de exportacin para la soja y reglamentaba un
esquema de retenciones mviles para los cereales por un pe-
rodo de cuatro aos, segn el cual aumentaban o disminuan
las alcuotas segn lo hicieran los precios internacionales de los
JUDQRV(VWDPHGLGDGHVGHHOGLVFXUVRRFLDOHVWDEDGLULJLGDD
IUHQDUODLQDFLyQGHORVSURGXFWRVHQHOPHUFDGRLQWHUQRHYLWDU
la sojizacin y redistribuir el ingreso hacia los sectores ms des-
favorecidos, gravando a aquellos que ms ganancias extraordi-
QDULDVUHFLEtDQDWUDYpVGHVXVDFWLYLGDGHVSURGXFWLYDV
La poltica adoptada por el gobierno nacional en un marco
carente de debate con los actores corporativos involucrados ge-
ner un fuerte rechazo de los diversos sectores que se vean per-
judicados econmicamente por la decisin poltica, los cuales
iniciaron un enfrentamiento para demandar la derogacin de la

4 Si bien todo conflicto poltico logra visibilidad pblica en el momento de su estallido, entendemos que sera necesario remitirnos a los antecedentes contextuales no
tan inmediatos de los mismos para comprenderlos, dado que no operan en el vaco
sino que muchas veces constituyen el resultado de la acumulacin de eventos pasados. No obstante, en este trabajo no sern abordados por una cuestin de espacio.

77

125. Ante la falta de respuesta por parte del gobierno nacional,


a los pocos das de anunciada la medida las entidades gremiales
UHSUHVHQWDWLYDVGHORVKHWHURJpQHRVHVWUDWRVGHOVHFWRUDJURSH-
cuario5 se aliaron en un bloque conocido como Mesa de Enla-
FH 0( (OFRQLFWRVHGHVSOHJyGXUDQWHFXDWURPHVHVHQORV
cuales la ME as como grupos de autoconvocados6 apelaron
a diversos repertorios de accin -que, en principio, no se aso-
cian a una gramtica poltica corporativa (Giddens, 1994)- como
son los piquetes, paros, lock-outs, movilizaciones y asambleas,
logrando incluir en sus reclamos originales un conjunto de de-
mandas provenientes de diversos actores.
El intenso y prolongado activismo llevado adelante en el es-
pacio pblico por estos actores desbord la demanda inicial,
logrando aglutinar reclamos provenientes de las clases medias
(mayor dilogo por parte del gobierno), los partidos polticos
(debatir la Resolucin en el Congreso) y los medios de comu-
nicacin (libertad de expresin). De esta forma, se oper un
desplazamiento desde un reclamo estrictamente sectorial a una
demanda que gan en generalidad a partir de la interaccin con-
WHQFLRVDTXHHOFDPSRVXSRVRVWHQHUHQHOWLHPSR\DWUDYpVGH
ODFXDOORJUyDJOXWLQDUDXQFRQMXQWRKHWHURJpQHRGHVHFWRUHVa
priori irreconciliables.
'H HVWD IRUPD FRQWLQXy HO FRQLFWR HQWUH ORV GRV SRORV TXH
se haban conformado el campo y el gobierno nacional- in-
WHQVLFiQGRVHODVDFFLRQHVGHSURWHVWDFRQFRQVHFXHQFLDVWDOHV

5 Ellas son Sociedad Rural Argentina (SRA), Federacin Agraria Argentina (FAA),
Confederaciones Rurales Argentinas (CRA) y la Confederacin Intercooperativa Agropecuaria Limitada (CONINAGRO).
6 Aquellos productores que no son representados por ninguna entidad gremial.

78

como el aumento exponencial de los precios de los alimentos e


incluso su desabastecimiento- alternndose con momentos de
tregua, hasta que en julio la presidenta decidi tramitar este
FRQLFWR HQYLDQGR HO SUR\HFWR GH OD  DO &RQJUHVR SDUD VX
debate y aprobacin o derogacin. La resolucin termin dero-
gndose en una votacin muy pareja de la que tuvo que desem-
SDWDUHOYLFHSUHVLGHQWHGHOSDtVWDPELpQSUHVLGHQWHGHO6HQD-
do- Julio Cobos.
&RQUHVSHFWRDOFRQLFWRHQ(FXDGRUDSULQFLSLRVGHMXOLRGH
2009, el presidente Rafael Correa envi a la Asamblea Nacional
HOSUR\HFWRGH/H\2UJiQLFDGH6HUYLFLR3~EOLFR /26(3 SDUD
su debate. ste propona un conjunto de normativas tendientes
DUDFLRQDOL]DUKRPRJHQHL]DU\GHPRFUDWL]DUHOUpJLPHQODERUDO
GHORVVHUYLGRUHV\HPSOHDGRVS~EOLFRVDWUDYpVGHODHOLPLQDFLyQ
de prerrogativas y privilegios que histricamente haban gozado
ciertos sectores dentro de la funcin pblica tales como las con-
decoraciones, medallas y canastas navideas para policas y
militares. Asimismo aumentaba los salarios totales al incluir el
pago por horas extras, lo cual democratizara el servicio pblico.
A partir de esa fecha, se convoc a diferentes sectores de la
oposicin poltica, organizaciones sociales, sindicatos y movi-
mientos sociales con los cuales se comenzaran a entablar discu-
VLRQHV\GHEDWHVHQWRUQRDOFRQWHQLGRGHOD/26(3SDUDUHGDF-
tar el informe que sera remitido al Poder Ejecutivo. Al ser una
ley bajo la cual se regan trabajadores de diferentes mbitos den-
tro del sector pblico -desde los empleados estatales del Poder
Ejecutivo, hasta trabajadores de la salud y educacin, pasando
por las FFAA y la Polica- el debate contempl la participacin
de una amplia variedad de organizaciones, en especial los sin-
dicatos representativos de los trabajadores del sector pblico.
/XHJRGHKDEHUVHGHVDUUROODGRGLHFLVpLVVHVLRQHVGHGHEDWHVH
redact el primer informe que sera remitido al Presidente de

79

la Asamblea Nacional. El Pleno de la Asamblea aprob la Ley


KDELpQGRVHGDGRXQJUDQFRQVHQVRHQWUHDVDPEOHtVWDVRFLDOLV-
tas y de la oposicin. El proyecto que se enviara nuevamente
al Ejecutivo para su aprobacin no inclua los dos artculos que
perjudicaban a la Fuerza Pblica la suspensin de la entrega
de medallas y condecoraciones- y que haban constituido el ob-
jeto de debate, negociaciones y acuerdos corporativos entre los
asamblestas, las diversas organizaciones, entidades gremiales y
la Fuerza Pblica.
Sin embargo, el presidente Correa vet el proyecto de ley, re-
chazando algunos de los artculos propuestos y aprobados por
mayora en el seno de la Asamblea. A partir de este momento,
HO FRQLFWR DGTXLULy XQD YLVLELOLGDG S~EOLFD $VLPLVPR GHVGH
diversos sectores ya se vena gestando un clima de malestar en
torno a la forma en que el Poder Ejecutivo estaba procesando el
debate de ciertas leyes al interior de la Asamblea, especialmente
D WUDYpV GH OD JXUD GHO YHWR SUHVLGHQFLDO )XH D SDUWLU GH HVWH
momento que comenz el ciclo de movilizaciones que decanta-
ran en lo que se conoci como el 30-S.
A primeras horas de la maana del 30 de septiembre, la ca-
pital ecuatoriana amaneca con la noticia de que los policas del
5HJLPLHQWR4XLWRQVHKDEtDQDFXDUWHODGR\GHFLGLGRQRRIUHFHU
sus servicios a la comunidad, declarndose en estado de huelga.
A medida que transcurran las horas, las policas de las otras pro-
vincias se sumaban a la protesta en sus respectivas ciudades para
H[LJLUDOJRELHUQRTXHUHWURFHGLHUDFRQODDSUREDFLyQGHOD/26(3
El motn policial se vio acompaado de la toma del aeropuerto de
la capital ecuatoriana por parte de un sector de las FFAA, movi-
lizaciones en diversas ciudades por parte de estudiantes y docen-
tes representados por la Unin Nacional de Educadores, tomas
de las gobernaciones y ocupacin de la Asamblea Nacional por
SDUWHGHPRYLPLHQWRVVRFLDOHVFRPROD&21$,(RUJDQL]DFLRQHV

80

sindicales, como la Unin General de Trabajadores del Ecuador y


partidos polticos, como el Partido Sociedad Patritica.
El motn policial haba constituido el catalizador para que
tanto sectores ubicados en la derecha como en la izquierda del
espectro poltico-ideolgico, se fueran incorporando a la protes-
ta de forma ms o menos oportunista, generando mecanismos
GH DUWLFXODFLyQ HQWUH GLYHUVRV VHFWRUHV 6H SXVR GH PDQLHVWR
que detrs de lo que pareca una reivindicacin de la Fuerza P-
blica, otros sectores aprovechaban el contexto de malestar que
se vena gestando a lo largo de los meses para intentar desestabi-
lizar al gobierno, e incluso destituirlo. Este escenario se convir-
ti en una verdadera crisis poltico-institucional, lo cual forz al
gobierno nacional a decretar el estado de excepcin y resolver el
FRQLFWRFRQODLQWHUYHQFLyQGHODV)XHU]DV$UPDGDV7.
Lo interesante de estas contiendas polticas es que revela-
ron que cuando el tipo de racionalidad que impera en las lgi-
cas corporativas no encuentra las condiciones necesarias para
VXHFDFLDVHDSRUTXHHO(VWDGRQRUHFRQRFHVXVLQWHUHVHVVHD
porque alianzas polticas al interior de dichos espacios los obsta-
culizan, como fue en los casos analizados- el enfrentamiento se
desplaza hacia otro terreno, el espacio pblico. Cuando los con-
tenidos particulares de las agendas son desconocidos por el sis-
tema poltico que en otros momentos u ordenamientos sociales

7 Algunos de los factores que imposibilitaron un efectivo golpe de Estado fueron, por
un lado, el importante hecho de que la CONAIE no convocara activa y pblicamente a
sus bases. Por otro lado, ante los evidentes intentos golpistas, varios actores sociales
y polticos decidieron no movilizarse. Asimismo, el nmero de muertos y heridos que
hubo en un pas que se caracteriza por bajos niveles de violencia fsica en acciones de
protesta, ofreci las condiciones para que el conflicto se canalizara tal como lo hizo.

81

haban sido absorbidos de forma institucional, entonces deben


salir de su aislamiento superar la fase econmica-corporativa,
GLUtD*UDPVFL\IXQFLRQDUFRPRXQDVXSHUFLHPiVDPSOLDGH
representacin susceptible de acoger otras demandas que con-
tribuyan a devolver la legitimidad que el sistema les amput.
(VDTXtGRQGHHOHVSDFLRS~EOLFRPXHVWUDHQpUJLFDPHQWHVXSR-
tencial para que demandas particulares ganen en generalidad
(Rosanvallon, 2008) y se articulen en un bloque poltico capaz
de bloquear decisiones polticas vinculantes.
(QHOFDVRGHOFRQLFWRDUJHQWLQRODOyJLFDFRUSRUDWLYDTXHGy
FHUFHQDGDFRQDQWHULRULGDGDOLQLFLRGHOFRQLFWRQLVLTXLHUDVH
gener el contexto para que ese tipo de vnculo entre los grupos
sectoriales y el Estado pudiera desplegarse: una decisin polti-
FDHPDQDGDGHVGHHO(MHFXWLYRDWUDYpVGHODVIDFXOWDGHVTXHOH
concede la Constitucin para decretar ese tipo de resoluciones
ya haba agotado toda posibilidad de que los sectores involu-
crados pudieran negociar sus intereses con el poder poltico. En
Ecuador, por el contrario, la lgica corporativa pudo operar en la
arena parlamentaria desde el primer instante en que se tom co-
QRFLPLHQWRGHOSUR\HFWRGHOD/26(3(O(MHFXWLYRDGLIHUHQFLD
del caso argentino, haba enviado el proyecto a la Asamblea Na-
cional para su debate y posterior aprobacin. El gobierno ecua-
toriano contaba con que gozaba de mayora parlamentaria y que,
por lo tanto, no debera haber obstculos para su aprobacin.
Sin embargo, la Asamblea logr llegar a un consenso con votos
GHORVDVDPEOHtVWDVRFLDOLVWDVSDUDTXHVHGHURJDUDQORVDUWt-
culos que perjudicaban a los policas y militares. Ante el veto
presidencial, estos sectores no encontraron otro canal de expre-
sin de disenso ms que el espacio pblico. El amotinamiento
policial activ tal violencia que gener un escenario hostil para
la estabilidad democrtica, incluso, la vida del propio presidente
(Ramos y Pez, 2010).

82

Ahora bien, la diferencia que existe entre la temporalidad de


la lgica corporativa frente a la temporalidad que se despliega en
el espacio pblico da cuenta, en efecto, de los diversos modos en
que debe operar la accin poltica dependiendo del terreno donde
se est jugando. Si en la primera el reconocimiento institucional ya
est de antemano garantizado, agilizando los acuerdos y arreglos
LQVWLWXFLRQDOHVHQWUHORVDFWRUHV\HOVLVWHPDSROtWLFRHVDWUDYpV
de la segunda que los actores contendientes deben idearse nue-
vas modalidades de accin para lograr presentar sus demandas
de forma tal que sean recepcionadas por el poder poltico como
legtimas, lo cual puede implicar esfuerzos prolongados y activos.
En ambos casos, la dinmica que adquiri el espacio pblico,
colonizado por diversos sectores para los cuales la calle no es
un espacio habitual de negociacin y disputa de intereses, fue
un hecho que los gobiernos no supieron ni pudieron anticipar.
La duracin y la naturaleza que adquiri la interaccin conten-
ciosa entre el campo y el gobierno argentino lo colocaron a un
paso de la crisis poltico-institucional ante la cual el gobierno se
vio obligado a ceder a la presin corporativa. No se percat de
que el alto grado de movilizacin social en su contra durante un
tiempo prolongado, los intentos fallidos por parte del sector de
HQWDEODUQHJRFLDFLRQHVFRQHORFLDOLVPRORVWURSLH]RVWiFWLFRV
del gobierno (haber logrado reunir a actores tan dismiles en un
frente comn) prepararon el terreno para que una vez enviada la
resolucin al Parlamento, la correlacin de fuerzas fuera positi-
va para el campo y ejerciera una presin sin igual sobre los le-
gisladores. El Ejecutivo debi respetar la decisin del Congreso
y derogar la Resolucin. Se estaba, pues, cediendo ante la lgica
corporativa que se haba querido ahogar desde el inicio.
En Ecuador, al igual que en el caso argentino, el gobierno de-
bi ceder ante la lgica corporativa propia de las Fuerzas Milita-
res. Pese a estar sospechadas de haber participado en el intento

83

de golpe de Estado, el presidente les deleg la tarea de resolver


la situacin, volviendo a ejercer el rol de fuerza dirimente en los
asuntos polticos, tal como haba ocurrido en las ltimas cadas
presidenciales en Ecuador (Garca, 2009). Incluso los meses pos-
WHULRUHVDOGHVHSWLHPEUHHOSUHVLGHQWHUPyDOJXQRVGHFUHWRV
TXHEHQHFLDEDQDOD)XHU]D3~EOLFDHQHVSHFLDODODV))$$

Reflexiones finales
$SDUWLUGHODUHFXSHUDFLyQGHGRVFDVRVGHFRQLFWRSROtWLFR
en Argentina y Ecuador, este trabajo intent ofrecer elementos
para responder a una doble necesidad: por un lado, en un nivel
terico, romper con las concepciones esencialistas sobre el es-
pacio pblico que le atribuyen un inherente potencial democra-
tizador y por otro lado, en un nivel emprico-poltico, explorar
la relacin entre espacio pblico y corporativismo a la luz de los
nuevos procesos socio-polticos que se desplegaron con el surgi-
miento de gobiernos post-Consenso de Washington.
En primer lugar, si bien proponer una nueva nocin de espa-
cio pblico que se despoje de los resabios normativistas propios
de algunas perspectivas constituye una tarea compleja y un tan-
to ambiciosa, consideramos pertinente, al menos, interrogarnos
por los modos en que el espacio pblico opera en determinadas
coyunturas. Las contiendas polticas aqu presentadas pusieron
GH PDQLHVWR TXH HO HVSDFLR S~EOLFR QR VyOR SXHGH IXQFLRQDU
FRPR XQD OHJtWLPD VXSHUFLH GH H[SUHVLyQ GHPRFUiWLFD GH LQ-
tereses, demandas y reivindicaciones y construccin de iden-
tidades por parte de sectores que no tienen voz, la parte que
QRFXHQWD 5DQFLqUH (OHVSDFLRGHORS~EOLFRWDPELpQ
SXHGHRSHUDUFRPRXQUHFXUVRHVWUDWpJLFRSDUDTXHVHFWRUHVGR-
minantes, o no necesariamente ubicados en posiciones subalter-

84

nas, que ven cercenados sus modos tradicionales de relacionar-


VHFRQHOVLVWHPDSROtWLFRHLQXLUHQpOSXHGDQKDFHUDSDUHFHU
otorgar visibilidad e incluso disfrazar de legitimidad a agendas
particularistas que, paradjicamente, no requirieron ser elabo-
radas ni legitimadas de forma pblica. En este sentido, el espacio
es pblico en la medida en que otorga visibilidad a intereses que,
QRUPDOPHQWHVHWUDPLWDQHQHVSHFtFRVHVSDFLRVLQVWLWXFLRQD-
lizados con dinmicas temporales y polticas determinadas. No
obstante, en los dos casos analizados, estos intentos fracasaron
porque, en ltima instancia, quedaron encapsulados en sus par-
ticularidades, no pudiendo privilegiar una dimensin universal
HQVXVUHFODPRV)XHURQFRQLFWRVHVWULFWDPHQWHGLVWULEXWLYRV
ya sea por la renta extraordinaria en el caso argentino-, ya sea
por el reconocimiento institucional de determinadas categoras
sociales en el caso ecuatoriano-.
No estamos sosteniendo que el espacio pblico slo funciona
como un recurso para sectores corporativos que se orientan
FRQQHVSDUWLFXODULVWDV\HVFDVDYRFDFLyQGHPRFUiWLFD3RUVX-
puesto la esfera pblica constituye una potente herramienta con
que cuentan las sociedades democrticas y debe revitalizarse, en
especial, por aquellos sujetos que no encuentran otros canales
de expresin y visibilizacin ms que su irrupcin pblica. En el
marco de estos gobiernos, el espacio pblico no abandon su ca-
pacidad de funcionar como terreno de expresin de los sectores
subalternos o excluidos pero comenz a adquirir nuevas poten-
FLDOLGDGHVXVRV\VHQWLGRVHLQFOXVRIXQJLUGHVXSHUFLHSDUDTXH
actores corporativos puedan movilizar pblicamente sus intere-
ses y lograr su legitimidad. La idealizacin del espacio pblico,
no obstante, puede oscurecer el hecho de que -an corriendo el
ULHVJR GH VLWXDUQRV HQ XQ SODQR pWLFRQRUPDWLYR QR WRGDV ODV
demandas revisten de legitimidad democrtica y muchos menos
una vocacin por la vida en democracia.

85

(QUHODFLyQDOVHJXQGRDVSHFWRHVWRVFRQLFWRVHQGHQLWL-
YDSXVLHURQGHPDQLHVWRTXHODEDQGHUDSROtWLFDGHODGHVFRU-
SRUDWLYL]DFLyQFRQODTXHHVWRVJRELHUQRVVHLGHQWLFDQWHUPLQD
DFWLYDQGRFRQLFWLYLGDGHVTXHHQ~OWLPDLQVWDQFLDGHELGRDOD
dinmica que adquiere la movilizacin social en el espacio pbli-
co, obligan a los poderes polticos a ceder ante la lgica corpora-
tiva. El crculo vicioso que se activa (poltica orientada a la des-
FRUSRUDWLYL]DFLyQ DFWLYDFLyQ GH FRQLFWR TXH VH H[SUHVD HQ HO
espacio pblico -fortalecimiento de las corporaciones) pues, ter-
mina agotando la capacidad del gobierno de absorber este locus
GHFRQLFWRSROtWLFR\IRUWDOHFLHQGRDORVDFWRUHVFRQWHQFLRVRV
anclados en intereses particulares y en muchos casos, con una
GpELOHLQFOXVRQXODYRFDFLyQGHPRFUiWLFD(VWDUHSURGXFFLyQ
de la lgica de funcionamiento del espacio pblico lejos est de
responder a los principios habermasianos deliberacin, racio-
nalidad comunicativa y entendimiento intersubjetivo-a los que
tan enfticamente apel gran parte de la sociologa poltica para
caracterizar al espacio de lo pblico.

86

Bibliografa
ARDITI%HQMDPtQ(OJLURDODL]TXLHUGDHQ$PpULFD/DWLQDXQD
poltica post-liberal? En Cincias Sociais Unisinos, 45(3),
pp. 232-246, 2009.
ARENDT, Hannah, La condicin humana. Buenos Aires, Paids,
2008.
AVRITZER, Leonardo, Democracy and Public Space in Latin Ame-
rica. New Jersey, Princeton University Press, 2002.
BRESSER-PEREIRA, Luiz Carlos y Cunill Grau, Nuria, Lo Pblico
No-Estatal en la Reforma del Estado. Buenos Aires, Paids,
1998.
DAGNINO(YHOLQD2OYHUD$OEHUWR-\3DQFKL$OGRLa disputa
por la construccin democrtica en Amrica Latina0p[L-
co, FCE CIESAS UV, 2006.
GARCA GALLEGOS, Bertha, Singularidad de las Fuerzas Armadas
\SHUOHVPLOLWDUHV'HPLOLWDUHVDHPSUHVDULRVODFULVLVDF-
tual de las FFAA En (FXDGRU FRQWHPSRUiQHR DQiOLVLV \
alternativas actuales. Montes del Castillo (ed). Espaa, Edi-
tum, 2009.
GRAMSCI, Antonio, Cuadernos de la Crcel. Volumen 5. Edicin
crtica del Instituto Gramsci a cargo de Valentino Gerratana.
$03DORV WUDG 0p[LFR(GLFLRQHV(UD%HQHPpULWD8QL-
versidad Autnoma de Puebla, 1999.
GIDDENS, Anthony, La constitucin de la sociedad. Buenos Aires,
Amorrortu, 1994.
HABERMAS, Jrgen, Historia y crtica de la opinin pblica0p-
xico, Gustavo Gili, 1986.
HABERMAS, Jrgen, )DFWLFLGDG \ YDOLGH] VREUH HO GHUHFKR \ HO
Estado democrtico de derecho en trminos de teora del
discurso. Madrid, Trotta, 1992.
87

KITZBERGER, Philip, Giro a la izquierda, populismo y activismo


JXEHUQDPHQWDOHQODHVIHUDS~EOLFDPHGLiWLFDHQ$PpULFD/D-
tina. En Sorj, Bernardo (comp.), Poder poltico y medios de
comunicacin. De la representacin poltica al reality show.
Buenos Aires, Siglo XXI, 2010.
LACLAU, Ernesto y Chantal Mouffe (1985), Hegemona y estrate-
gia socialista. Hacia una radicalizacin de la democracia.
Buenos Aires, Fondo de Cultura Econmica, 2004.
MAURO, Sebastin y Rossi, Federico, Entre la plaza y la Casa Ro-
sada: dialogo y confrontacin entre los movimientos sociales
y el gobierno nacional. En Malamud y De Luca (comps.), La
poltica en tiempos de los Kirchner. Buenos Aires, Eudeba,
2011.
MOUFFE, Chantal, El retorno de lo poltico. Comunidad, ciuda-
dana, pluralismo, democracia radical. Barcelona, Paids,
1998.
MUOZ Mara Antonia y Retamozo, Martn, Hegemona y dis-
curso en la Argentina contempornea. Efectos polticos de los
XVRVGHSXHEORHQODUHWyULFDGH1pVWRU.LUFKQHU(QRe-
YLVWD 3HUOHV /DWLQRDPHULFDQRV 0p[LFR )/$&620p[LFR
2009.
OSPINA PERALTA, Pablo, Corporativismo, estado y revolucin
ciudadana. El Ecuador de Rafael Correa, En Estado, movi-
mientos sociales y gobiernos progresistas, Instituto de Estu-
dios Ecuatorianos, 2009.
PANIZZA, Francisco, Unarmed Utopia Revisited: The Resurgence
of Left-of-Centre Politics in Latin America, Political Studies,
nmero 53, pp. 716- 734, 2005.
RABOTNIKOF, Nora, En busca de un lugar comn. El espacio p-
blico en la teora poltica contempornea0p[LFR,QVWLWXWR
de Investigaciones )LORVyFDV81$0
RABOTNIKOF, Nora, Lo pblico hoy: lugares, lgicas y expectati-

88

vas. Revista conos, Flacso Ecuador, 2008.


RAMREZ GALLEGOS, Franklin, Decisionismos transformaciona-
OHVFRQLFWRSROtWLFR\YtQFXORSOHEH\R3RGHU\FDPELRHQODV
izquierdas sudamericanas del siglo XXI. En: Amrica Lati-
na. 200 aos y nuevos horizontes. Buenos Aires, Secretara
de Cultura, Presidencia la Nacin, 2010.
RAMREZ GALLEGOS, Franklin, Postneoliberalismo indcil. Agen-
da pblica y relaciones socio-estatales en el Ecuador de la Re-
volucin Ciudadana. En Revista Temas y Debates, Nmero
8QLYHUVLGDG1DFLRQDOGH5RVDULR&/$&62SS
2010a.
RAMOS, Mario y Alexei Pez, El magnicidio perfecto. Anlisis de
la crisis del 30 de septiembre del 2010 en Ecuador En 30S
La contrarrevolucin4XLWR0LQLVWHULRGH&RRUGLQDFLyQGH
la Poltica y Gobiernos Autnomos, 2010.
RANCIRE, Jacques, El desacuerdo. Buenos Aires, Nueva visin,
1996.
SCHMITTER, Philippe, Contina el siglo del corporativismo. En
Lanzaro, Jorge, (OQGHOVLJORGHOFRUSRUDWLYLVPR. Caracas,
Nueva Sociedad, 1998.
VILAS, Carlos, Las ideas y regresos del Estado. En Utopa y
praxis latinoamericana, Nmero 49, pp. 101-108, 2010.
THWAITES REY 0DEHO 'HVSXpV GH OD JOREDOL]DFLyQ QHROLEHUDO
4Xp(VWDGRHQ$PpULFD/DWLQD"(QRevista OSAL, Nme-
ro 27, pp. 19-43, 2009.
ZEMELMAN, Hugo, Uso crtico de la teora. En torno a las funcio-
nes analticas de la totalidad0p[LFR8,QVWLWXWR3ROLWpFQLFR
Nacional, 1987.

89

CAPTULO IV

El acceso a lo pblico. Agendas,


espacios-tiempos mediticos
y transformaciones de los dispositivos

Por Gastn Cingolani

Frente a dos sobrentendidos


Tal como se propone varias veces en este mismo volumen, lo
pblico se hace de tiempo y de espacio. Aunque ciertamente la
metfora espacial ha predominado, los modos de acceso a ello
VH RUJDQL]DQ WDPELpQ VHJ~Q WHPSRUDOLGDGHV 4XL]iV VLHPSUH
haya sido as, indisociablemente espacio y tiempo participan en
la constitucin de lo pblico; pero particularmente en la era de
la mediatizacin masiva, lo pblico se ha escandido, seccionado,
distribuido y organizado segn ritmos y fronteras diversas desa-
rrolladas por la mediatizacin misma. Y, por si hace falta decir-
lo an, la mediatizacin es un modo de administrar y disponer
espacios y tiempos que soportan la arquitectura de lo que ser
QDOPHQWHODVXVWDQFLDGHORS~EOLFR
En consecuencia, tratamos aqu con un asunto que concierne
al problema de la mediatizacin, a situaciones que pueden com-
prenderse como procesos de mediatizacin. Para evitar que se
VREUHQWLHQGDDOJRTXHQRHVWiGHQLGRSDUDVLHPSUHQLPXFKR

90

menos, convendra hacer aqu algunas precisiones. Considerare-


mos meditico a cualquier proceso por el cual se producen y/o
reconocen textos o mensajes (de cualquier naturaleza material
\ VLJQLFDQWH  FRQ DOJ~Q JUDGR GH GHVIDVH WHPSRUDO \R HVSD-
cial y/o intercorporal entre sendas instancias de produccin y
de reconocimiento.1 Vale decir, que cualquier soporte autnomo
de produccin de sentido (autnomo con respecto a quienes se
LQWHUUHODFLRQDQDWUDYpVVX\R SRVLELOLWDXQSURFHVRmeditico:
DPRGRGHVLPSOHHMHPSOLFDFLyQSRGHPRVHQXPHUDUGHVGHXQ
diario ntimo hasta una fotografa, pasando por la dimensin
decorativa de un objeto funcional en tanto que comunica un
VHQWLGRGHSHUWHQHQFLDRGHLGHQWLFDFLyQHWFpWHUD
Pero por mediatizacin entenderemos estos mismos proce-
sos de signos autnomos producidos en una escala cuyas con-
diciones de reconocimiento involucran la construccin de lo co-
lectivo.2 Por colectivo no hacemos referencia nicamente a un
quantum plural; bien podra ser, para desgracia de sus gestores,
TXHXQOPHRXQSURJUDPDGHUDGLRVHDYLVWRRHVFXFKDGRSRU
un nico individuo receptor; este caso no ira contra lo que
aqu entendemos por dimensin colectiva. Son otros dos aspec-
tos, de ndole cualitativa, los que operan como implcitos nece-
sarios, tanto en produccin como en reconocimiento:
1. el texto es materialmente idntico en todas las instancias
GH VX UHFHSFLyQ WDQWR DTXHOORV TXH RSHUDQ FRPR UpSOLFDV

1 Retomamos estas nociones (desfase, produccin, reconocimiento) de la teora de la


discursividad de Vern (1993).
2 Evitamos emplear la denominacin de masivo, ya que la nocin de masa propone otros
problemas que no vamos a tratar aqu. Sin embargo, algunos autores como Luhmann
(2000) la emplean para referir a lo que aproximadamente aqu caracterizamos como
mediatizacin a secas.

91

mltiples (los impresos son el caso ms obvio, pero esto tam-


ELpQ HVWi DVXPLGR HQ OD GLVWULEXFLyQ GH WRGR WLSR GH HMHP-
SODUHV GH JUDEDFLRQHV FRQ HO VXMR grfcas OPRJUiFDV
IRQRJUiFDVIRWRJUiFDVYLGHRJUiFDVHWFpWHUD FRPRORV
de distribucin instantnea de seales por sistemas broad-
casting (como la radiofona o la televisin).
2. la interpelacin al sujeto receptor no es singularizante o
individualizante, sino que slo es invocado como formando
parte de un colectivo: implica un gesto generalizante.3
Segn esta hiptesis, esta doble operacin es la condicin de
posibilidad de que la circulacin de un texto construya el muy
difundido pero no por eso menos particular proceso de media-
tizacin, para lo cual debe interpretarse de tal modo tanto en
produccin como en reconocimiento.
El otro sobrentendido concierne a la naturaleza de lo pblico.
Puede advertirse que el ttulo expone algo a discutir: el acceso
a lo pblico. El peligro es que por ello se sobrentienda que lo
pblico es algo previo a su proceso de publicacin. Tan es as,
que es frecuente escuchar que la mediatizacin (slo) posibilita
(o restringe) su acceso. En lugar de ello, estamos con las tesis
que sostienen que en las sociedades mediatizadas lo pblico se
construye en la mediatizacin. Esto implica que lo efectivamen-
te pblico no es algo preestablecido formalmente, ni responde a
una inherencia independiente de sus condiciones empricas de
circulacin social, lo que lleva a tener que trabajar forzosamente

3 Ampliamos esta perspectiva en una investigacin en curso: De los medios a las mediatizaciones (I). Estado de la cuestin., Programa de Incentivos (MECyT), rea Transdepartamental de Crtica de Artes, Instituto Universitario Nacional del Arte, 2013-2014.

92

sobre condiciones empricas y materializadas de produccin de


sentido. El acceso no es as un lugar que abre o clausura, que
devela u oculta, sino por donde se llega, por donde se toma con-
tacto invariablemente a lo pblico. Inclusive: analizar el acceso
es analizar variantes de ese contacto, y analizar los recorridos,
ODVWUD\HFWRULDVODVELIXUFDFLRQHV\FRQH[LRQHVTXHVRQHQGH-
nitiva, la sustancia misma de lo pblico. Por tanto, acceder pro-
mueve siempre tensiones entre produccin y reconocimiento;
\VDEHPRVELHQSRULQYHVWLJDFLRQHVTXHGHVGHKDFHGpFDGDVVH
ocuparon de ello, que no hay estrategia en produccin que tenga
un nico proceso posible de reconocimiento.
Valga una ltima aclaracin, ya que los hemos involucrado
estrechamente: proceso de mediatizacin no es sinnimo de lo
pblico, sino su condicin de posibilidad; pero en las sociedades
mediatizadas, lo pblico es lo colectivo comprendido as, en sen-
tido cualitativo y mediatizado.
Es conocida la tesis de que la organizacin del espacio p-
blico en la modernidad fue desarrollndose con especial apoyo
en la mediatizacin generalizada de las sociedades.4 Para ello,
coincidiendo con Luhmann, desde el siglo XVII se gest paulati-
QDPHQWHXQVLVWHPDVRFLDOPX\SDUWLFXODU\HVSHFtFRHQFDUJD-
do de producir realidad colectiva: el sistema que llama medios
masivos. La realidad colectiva en tanto sustancia de lo pblico,
como todo otro modo de procesar realidad de manera intersub-
MHWLYDQHFHVLWDPDWHULDOL]DUVHHVSHFtFDPHQWHHVXQDPDWHULD-
OLGDG TXH SURGXFH VHQWLGR HQ EDVH D VXV FRQJXUDFLRQHV 1RV
preguntamos entonces por las formas de esa materialidad.

4 Cf., por mencionar slo algunos estudios heterodoxos: Martin (1992), Ferry (1998),
Luhmann (2000), Hjarvard (2008).

93

Est claro que un conocimiento de esta naturaleza puede


GDUVH FRQ P~OWLSOHV QLYHOHV GH JHQHUDOLGDG R HVSHFLFLGDG VH-
gn se quiera o se pueda (segn las condiciones de acceso a los
materiales) analizar ms o menos minuciosamente lo sucedido
en tiempos y espacios histricos determinados. Desde ya, en la
mayor parte de los casos, hace falta una investigacin colectiva
TXHDQDOLFHODVP~OWLSOHVVXSHUFLHVGHFRQVWUXFFLyQGHHVDUHD-
lidad meditica, ya que el nmero y variedad de materialidades
mediticos disponibles en un espacio-tiempo dado fue desde sus
RUtJHQHV LQDEDUFDEOH SRU GHQLFLyQ \ QR KD FHVDGR GH FUHFHU
globalmente hablando, desde el comienzo de la mediatizacin
de las sociedades.5
Por otra parte, quizs en los ltimos 40 o 50 aos incluso
ms, segn el caso fue literalmente imposible para un mismo
individuo, ver, procesar, apreciar, consumir toda la oferta del
sistema local en una unidad de tiempo: leer todos los peridicos,
escuchar todas las estaciones de radio, ver todos los canales de
televisin de una ciudad, regin o nacin. Lo que de otra manera
podra traducirse como la imposibilidad de tomar contacto con
toda la realidad, metfora con bastante de utopa, pero cuya vi-
gencia se resiste a la extincin Precisamente, a partir del punto
en que esa imposibilidad se hace patente, es cuando el sistema
medios masivos probablemente haya alcanzado el mximo de
autonoma. No slo se produce ms informacin y evaluacin
sobre la realidad que la que se puede consumir, sino que se for-
talecen crecientemente los mecanismos de diferenciacin entre

5 Se pueden conocer las estrategias de indagacin de los procesos de proliferacin


de impresos en las primeras centurias, en Martin (1962), Chartier (1994, 2000, 2006),
Darnton (2003, 2010) o Eisenstein (2010), por citar los trabajos ms reconocidos.

94

cada uno de los medios en competencia, como parte misma del


proceso natural de mejoramiento del sistema.
En ese punto, lo pblico comienza a ser un universo al cual
slo se accede fragmentariamente. La totalidad es intensiva, ya
TXHSURJUHVDKDFLDODKLSHUHVSHFLFDFLyQWHPiWLFD\WDPELpQH[-
pansiva, desplegndose en el eje de la actualidad, o mejor dicho,
de la actualizacin. La temporalidad tiende progresivamente al
gesto de mimesis con el tiempo real, es decir, hace uso de la ecua-
cin vagamente regular e isomorfa entre el tiempo continuo y la
temporalidad subjetiva.
Es en funcin de ello que me parece sensato repasar esquem-
WLFDPHQWHFLHUWRVDVSHFWRVGHODVDUWLFXODFLRQHVRFRQJXUDFLRQHV
de la agenda.

Por qu volver a la nocin de agenda?


Volvemos sobre la nocin de agenda. Tal vez sea obvio, pero es
fundamental comprender que esta es una nocin que remite inva-
riable y estrictamente a los procesos de mediatizacin, es decir, a
los medios que participan en procesos de produccin mediatiza-
da de lo colectivo. Y al mismo tiempo, en tren de hacer anlisis, la
constitucin de la agenda es un sndrome (conjunto de indicios sin-
tomticos) del funcionamiento de la mediatizacin de lo colectivo.
Entonces volvemos sobre ella, pero no como un recurso sim-
SOLFDGRU SDUD UHVROYHU ORV SUREOHPDV TXH VH SUHVHQWDQ 3RU HO
contrario, de hecho, en el tiempo que hace que se teoriza en base
a este concepto, las diferentes corrientes no se han puesto de
acuerdo sobre los alcances de la nocin: hay una agenda o slo
hay agendas de cada medio?, la agenda se establece (setting) o
se construye (building)?, se aplica slo a los medios o hay una
agenda de los individuos, una agenda de la gente, una agenda po-

95

OtWLFDHWFpWHUD" (Bregman, 1998). Incluso su invocacin cotidiana


se ve limitada por la nunca contrastada correspondencia con los
hechos o con los datos producidos por un anlisis, ya que se trata
siempre de la evocacin de una entidad imaginaria, al estilo de lo
que sucede con opinin pblica.
En todo caso, retomamos la nocin de agenda como un instru-
mento para problematizar el acceso a lo pblico materializado en
VXSHUFLHVGLVFXUVLYDVFRQFUHWDV$SURSyVLWRGHORVPRGRVGHRU-
ganizacin meditica de temas y de las disposiciones que otorgan
valores acerca de esos temas, la nocin de agenda puede y debe
pensarse como articulacin6 del conjunto y de conjunto de las
materialidades mediticas que organizan esas representaciones
de la realidad.7
Agenda es, entonces, el nombre de las estrategias de disposi-
cin de temas en los medios<FRPRWDOQRFRQVLVWHHQDOJRMR
RMDGR FRPRXQDIRWRJUDItD VLQRHQXQWHMLGRGHUHHQYtRVTXH
SXHGHOHHUVHDSDUWLUGHODVGLIHUHQWHVVXSHUFLHVGLVFXUVLYDV\UH-
construirse pero no asignrsele ni un centro ni un recorrido nece-
sarios por encima de otros, aunque s haya zonas de intensidad o
densidad variable.8

6 Donde articulacin no prejuzga sobre el carcter logrado o defectuoso, ms o menos


conforme a una norma o carente de coherencia de las estrategias mediticas.
7 Empleo representacin de la realidad en el sentido menos ingenuo que pueda pensarse, es decir, sosteniendo que ms all de esa representacin no hay nada sino ms
representaciones o discursos, y que realidad es el nombre del universo de circunstancias resultante de las operaciones que producimos para adaptarnos a nuestro entorno (y
no algo inmanente y/o positivo y/o universal). En tal sentido, evito decir construccin
porque remite ms al proceso que al resultado; lamento la estela positivista ingenua
que las palabras representacin y realidad siguen dejando. En adelante, evitar las
comillas slo por simplificacin.
8 Es, de algn modo, a lo que remite la nocin de diarios de referencia dominante,
en el marco del trabajo de investigacin que presentan Steimberg y Traversa (1997b).

96

Esto implica varios aspectos: por un lado, tenemos la dimen-


sin organizativa que resulta de lo que los medios producen como
discurso expositivo de representacin de la realidad. Analizar los
materiales discursivos de los medios puede revelar las estrategias
GHRUJDQL]DFLyQGHRUGHQDPLHQWR\GHFRQJXUDFLyQGLIHUHQFLDOGH
ODIRUPDTXHWLHQHODUHDOLGDGVHJ~QFDGDPHGLRORTXHHQGHQL-
tiva se traduce en esta dimensin de la agenda. Para observar la
identidad de cada medio en particular, hay que hacer una visin del
conjunto, visin compleja ya que es preciso conocer el estado del
FRQMXQWRHQXQPRPHQWRSHURWDPELpQUHFXSHUDUODSURJUHVLyQ
(QODVVXSHUFLHVREVHUYDEOHVVHHQFXHQWUDFyPRFDGDPHGLR SUH
dispone con su esquema su representacin de la realidad, y pro-
mueve recorridos posibles.
Nos apoyamos en alguna mirada atrs en la historia. Como ejem-
SOR GH WUDQVIRUPDFLyQ HQ ORV PHGLRV JUiFRV HV PX\ LQWHUHVDQWH
lo que sucede con los peridicos en el paso del siglo XIX al XX en
Argentina; slo por situar fechas y nombres propios, entre 1870 y
1913, tenemos los contrastantes nacimientos de La Nacin y de Cr-
tica (Cf. Steimberg y Traversa, 1997a; y Satta, 1998), o incluso si
nos estiramos hasta 1928 con el primer tabloide de nuestro pas, El
Mundo (Fernndez, Lpez Barros y Petris, 1996). En un recorrido
por ese periodo se observa la constitucin progresiva de la puesta en
pgina como plataforma organizativa del recurso espacial para dar

El recorrido puede mostrar que, ms all de los consumos efectivamente producidos,


medidos por cantidad (rating de audiencia, nmero de lectores o de ejemplares vendidos), hay un dilogo que da forma a posiciones y contraposiciones entre medios o entre
actores que hablan en los medios, lo que permite registrar la forma del tejido cualitativo
de la agenda. Por citar un caso sintomtico, en los ltimos aos en Argentina, los medios
llamados oficialistas han sido bastante menos poderosos en trminos de consumo que
de posicionamiento en un sistema en el que no han dejado de abrirse lugar por voluntad
propia y tambin ajena.

97

sentido jerrquico a las noticias: la cantidad de espacio, los lugares


ocupados, los recursos paratextuales (el tamao de la tipografa de
los ttulos, las imgenes), y el paso de la titulacin para encabezar las
notas a la autonoma de los ttulos constituyen las grandes operacio-
nes consagradas a este efecto jerarquizante.9 Una progresin simi-
lar, con las diferencias del caso, se da entre los semanarios, donde en
ORVSULPHURVFXDWURDxRVGHODGpFDGDGHVHSURGXFHXQFDPELR
TXHGHVGHODSHUVSHFWLYDGHDOJXQRVJpQHURVUHVXOWDGUiVWLFRFRQ
el abandono de la tapa como mero envase y su uso sistemtico como
espacio denso de reenvos (Cingolani, 2007).
La temporalidad ha sido el otro gran insumo para la organiza-
cin de la agenda. Con el avance del siglo, las salidas de los diarios
fueron ocupando cada vez ms horas del da con ediciones que iban
actualizando la informacin, en una suerte de intento de construir
un tiempo real de la noticia (Fernndez, Lpez Barros y Petris,
 UHPHGRGHOGLUHFWRSRUQDWXUDOH]DYHGDGRDODSUHQVDJUiFD
(toda escritura es en pasado /DUDGLRDWUDYpVGHORVDVKHV y los
LQIRUPDWLYRVSRFRDSRFRHPXOyHVHGHYHQLU\UHFRQJXUyGHVGHOD
produccin propia de la noticia la forma del tiempo de la actualidad.
*XWLpUUH]5HWR 3HVHDODVSRVLELOLGDGHVGHOGLUHFWRODWHOH-
YLVLyQGHODVSULPHUDVGpFDGDVHQQXHVWURSDtVQRDGRSWyHVWDVFD-
UDFWHUtVWLFDVVDOYREDMRFRQGLFLRQHVH[FHSFLRQDOHVODFRQJXUDFLyQ
SURJUDPiWLFD\HODQFKRGHJpQHURV\UHJLVWURVGLVFXUVLYRV FFLyQ
HQWUHWHQLPLHQWRV YDULHGDGHV \ VyOR DOJXQRV HVSDFLRV SUHMDGRV
para la noticia periodstica; cf. Varela, 2005) fue la matriz organi-
zadora, en un modelo anlogo al que Wolton (1992) denomina
televisin generalista para los casos europeos.

9 En la actualidad, quien se ha hecho cargo de la parodia a estos recursos centenarios


es la revista Barcelona.

98

Esto cambia con la aparicin de las seales de cable y con ella


los canales de noticias.10 Por citar otro caso, tuve la oportunidad
de analizar en profundidad entre los aos 2000 y 2001 las estra-
tegias de los dos canales de noticias de mayor audiencia a nivel
nacional en ese entonces, Crnica TV y Todo Noticias (ubicados
as en orden de rating), que por entonces remitan a modelos
opuestos. Mientras que la organizacin del segundo era mucho
ms cercana a la forma programtica de un canal televisivo tra-
dicional (las secciones y los programas tenan un nombre y un
KRUDULRSUHMDGRVSDUWHVGHODHPLVLyQGLDULDHVWDEDQJUDEDGDV
ORVFRQGXFWRUHVWHQtDQUPDSURSLDORVLQIRUPHVVHHGLWDEDQ
con duracin acotada a una regularidad cannica), Crnica se
desarrollaba como un devenir continuo, sin escansiones, sin co-
tos en la duracin de una informacin, donde la voz institucional
VHPDQWHQtDSRUHQFLPDGHODGHORVSHULRGLVWDV\FRQXQpQIDVLV
LQpGLWRHQODVRSHUDFLRQHVGHLQWHUUXSFLyQHLUUXSFLyQSDUDOD-
guracin del estatuto imprevisto, febril, y contingente de la rea-
lidad (Cingolani, 2000, 2004). Crnica TV no haca la diferencia
tanto en la tematizacin ni slo en la mostracin: la forma de
la temporalidad que adopt gener un impacto sobre la agenda
que transform la jerarquizacin de lo urgente por encima de o
como modo de, se puede discutir la disyuntiva lo importante.
Claramente, en este sentido la agenda no remite nicamente
a los temas. Los recursos organizativos son una dimensin fun-
damental que revela que la tensin entre los distintos medios no
es slo temtica, de instalacin o imposicin de asuntos, sino

10 El propio Hctor R. Garca (2012) cuenta cmo ensay Crnica TV en la poca en que
fue propietario de Canal 2 de La Plata (es decir, antes de ser un canal de cable), y cmo
ide su estrategia de emisora observando la oferta previa.

99

WDPELpQGHODSURPRFLyQGHUHFRUULGRV\UHHQYtRVGHOLQHDGRVD
partir de variaciones de volmenes y densidades espacio-tempo-
rales. El procesamiento individual de la realidad colectiva en al-
gn grado depende de la experiencia que mantiene el individuo
con cada materialidad meditica. La disposicin que cada medio
adopta, y los recorridos que sugiere, propone concretamente
una forma de la realidad. Sin llevar la hiptesis al extremo de
despreciar la tematizacin (lejos de ello), la organizacin de las
VXSHUFLHV GLVFXUVLYDV KDELOLWD \ UHVWULQJH ODV RSHUDFLRQHV TXH
realiza el receptor para su encuentro con la realidad meditica.

Agenda, operaciones y autonoma del sistema


medios
Parecer anacrnico o desfasado en sus detalles, pero la pues-
WD HQ GLVFXUVR LQFOXVR SDUD VHU PiV HVSHFtFRV OD SXHVWD HQ
pgina como condicionante de la dinmica discurso-lecturas,
es asunto recurrente en los trabajos sobre los comienzos de la
impresin de libros y el impacto concreto que tuvo en las condi-
ciones de lectura (Cf. Chartier, 1994, 2000): es de alto aporte la
DWHQFLyQSXHVWDHQODRUJDQL]DFLyQHVSDFLDOJUiFDHQUHODFLyQ
FRQODVWUDQVIRUPDFLRQHVGHODVSUiFWLFDVHVFULWXUDOHV\WDPELpQ
como condicionante de sus lecturas, no slo en su sentido inter-
SUHWDWLYRVLQRWDPELpQHQORTXHLPSDFWDHQODSUiFWLFDOHFWRUD
HQVtPLVPD OHFWXUDVLOHQFLRVDDSURSLDFLyQLQGLYLGXDOHWFpWH-
ra). 11 La obra de Chartier dedicada a los procesos de produccin,

11 Cf. la lectura oblicua que hace Eisenstein (2010:16) de la edicin grfica de The
Gutenberg Galaxy de McLuhan.

100

circulacin y lectura de libros nos da una pista para indagar los


PRGRVGHDFFHVRDORS~EOLFRQRWDQWRSRUORHVSHFtFRTXHWLHQH
el mercado del libro, sino como modo de aprehensin de la orga-
nizacin cultural implicada (que incluye lo econmico, lo semi-
tico, la historia de las prcticas y destrezas, y la de los accidentes
singulares). Pero an en esos casos, no exista en virtud de sus
condiciones de circulacin, la remisin intertextual y la organi-
]DFLyQGHODHVWUDWHJLDWHPiWLFDDWUDYpVGHVXVUHFXUVRVJUiFRV
como sucedi posteriormente con el sistema de medios periods-
ticos. Vale decir, el eje temporal que vertebra las condiciones de
circulacin del discurso constructor de lo pblico articula a tra-
YpVGHODDJHQGDODFRQJXUDFLyQGHXQVLVWHPDHQHOFXDOQLQJ~Q
temaSXHGHGHMDUGHVHUOHtGRIXHUDGHHVHWUDVIRQGRVLVWpPLFR
lo que implica la autonomizacin del sistema de medios. Esto
SXHGHREVHUYDUVHDWUDYpVGHXQWULSOHMXHJRGHRSHUDFLRQHVHQ
la construccin de la tematizacin:
a. presencia/ausencia: se trata de un eje binario (un tema
est o no est tratado en los medios), de tipo cuantitativo,
en el que sin embargo uno de sus valores (el valor ausente)
est atado a la paradoja que revela el uso del grillo en el cine
VRQRURHOVLOHQFLRHVUHSUHVHQWDGRDWUDYpVGHXQVRQLGRGH
lo contrario no es silencio, es no-sonido. Un tema tiene el
sentido de pblicamente ausente al que se lo cataloga como
silenciado u ocultado por los medios cuando supimos de
pOen los medios. As, tanto el valor positivo como el nega-
tivo son emergentes de un trasfondo que tie de absoluto un
valor que slo es relativo al intertexto: la ausencia se constru-
ye por presencia diferencial.
b. jerarquizacin: los temas son un insumo para la cons-
truccin de criterios de gradacin de importancia, criterios
WDPELpQUHODWLYRVDOLQWHUWH[WR(OLQWHUWH[WRGHODKLVWRULDGH

101

un mismo medio (este medio habitualmente brinda o no es-


pacio/tiempo a ese tema?) y el del resto del conjunto de los
medios (si el resto minimiza/enfatiza el tema es realmente
LPSRUWDQWHRORHVWiQLQDQGR" RSHUDQFRPRVRVWpQGHOD
valoracin de las jerarquas.
FWLSLFDFLyQRDJUXSDPLHQWRFRQRVLQUyWXORVDGHPiVGHOD
jerarqua, hay una valoracin que emerge del agrupamiento
HQ]RQDVSRUDQLGDGWHPiWLFD XQRGHFX\RVFDVRVHVODRU-
JDQL]DFLyQSRUVHFFLRQHV /DJULOODDWUDYpVGHODFXDOFDGD
medio organiza esos agrupamientos, establece una de las
formas que adopta lo real pblico bajo un tamiz cualitativo:
desde la gran divisoria informacin/opinin, pasando por las
secciones ms arraigadas como poltica, economa, de-
SRUWHVSROLFLDOHVHVSHFWiFXORVHWFpWHUDRODVGHUDQJR
por proximidad (locales, nacionales, internacionales),
KDVWDODVYHFLQGDGHVPXGDVGHUyWXORV TXpWHPDVHVWiQHQ
UHODFLyQFRQFXiOHVRWURV" 'HTXpVHKDEODFXDQGRVHKDEOD
del pas, de la sociedad, de lo econmico, o de los temas situa-
dos en las secciones blandas o populares? La agenda en
este punto es un sistema revelador de coloraciones diferentes
que la realidad colectiva adquiere, y a la vez de la suposicin
que hay colectivos de preferencias (suposicin en produccin
de lo que sucede en reconocimiento: representatividad asu-
mida de los medios respecto de sectores socio-culturales).
La agenda tiene sentido como producto y a la vez como factor
de los procesos de mediatizacin: resultado emergente en pro-
duccin de lo que es el sistema medios en un momento, y gestor
de efectos en reconocimiento; y cuando decimos en reconoci-
miento no excluimos de las consecuencias en la recepcin aque-
llos efectos que tiene sobre el sistema meditico mismo. All se
PDQLHVWDFODUDPHQWHODGLPHQVLyQGHODWHPSRUDOLGDGH[SUH-

102

sada en lo que Luhmann (2000: 57-58) remonta a la operacin


de memoria, que no debe entenderse como almacenamiento
de acontecimientos pasados o de sucesos [] Ms bien consiste
en una permanente discriminacin entre olvidar y recordar. Y
luego: sin memoria nada podra aparecer como nuevo (=des-
viacin), y sin experiencia de lo desviante no podra construirse
ninguna memoria. (Luhmann, 2000: 59).
+DVWDDTXtODVUHH[LRQHVSUHVHQWDGDVDSXQWDQDVXVWHQWDU
la hiptesis de que lo pblico toma la forma de la agenda, que
QRHVQLKRPRJpQHDQLKHWHURJpQHDHQWRGRFDVRHYLGHQFLDXQD
organizacin dinmica, donde algunos ejes transversales (ope-
raciones espacio-temporales de organizacin discursiva) van
JXLDQGRODVH[LRQHVHQWUHODVIRUPDVTXHKD\TXHVRVWHQHU\ODV
apuestas por la variacin.
La agenda funcionara como gestora de tensiones del siste-
PD WHQVLRQHV TXH VRQ HQ DOJ~Q JUDGR FRRSHUDWLYDV HO VRVWpQ
colectivo de un tema o su silencio) y al mismo tiempo diferen-
ciatorias (todos los medios se proponen ofrecer algo diferente,
nico, an sobre un comn denominador temtico). Estas ten-
siones contradictorias hacen de ella el punto de ignicin para las
contradicciones acerca de lo pblico, variablemente evidentes
SDUDORVDFWRUHVVRFLDOHV\WDPELpQSDUDHOSURSLRVLVWHPD(VWH
GREOHSDTXHWHGHHIHFWRVVHDSUHFLDREYLDPHQWHHQVXSHUFLHV
discursivas diferentes.
En los medios mismos, las operaciones que listamos (la cuan-
titativa presencia/ausencia, y las cualitativas MHUDUTXL]DFLyQ y
agrupamiento temtico) son las que dan el fundamento a los
ejercicios cooperativos y competitivos.
Al mismo tiempo hay que decirlo, siendo ontolgicamente
la realidad meditica a lo que accede el receptor (espectador,
OHFWRUR\HQWHHWFpWHUD VREUHHOPXQGRFROHFWLYDPHQWHFRPSDU-
WLGR OD DJHQGD HV HO RSHUDGRU GH FRQDQ]D 3DUD OOHYDUOR D XQ

103

extremo ya casi banal por todo lo que se lo ha discutido, los


receptores no tienen acceso (metafricamente hablando) a los
hechos, sino slo (literalmente hablando) a los discursos que los
UHSUHVHQWDQUHHUHQWHPDWL]DQHQHVHVHQWLGRODagenda es la
mediatizacin de lo pblico o lo pblico mediatizado.

Tensiones y fuerzas de la agenda


Pensando de este modo la nocin de agenda, pasemos a lo
que esta nos permite problematizar. Si la agenda es la disposi-
cin dinmica de temas, esa disposicin revela tres fuerzas: coo-
perativa, competitiva y UHH[LYD. A las dos primeras las hemos
mencionado y resaltado: cada medio produce sus disposiciones
conociendo o anticipando su relacin intertextual con el resto
del conjunto. La tercera sintetiza y comprende a las otras, ges-
tionando su ajuste. Los medios asumen que cada paso es una
apuesta y siempre se puede leer all el meta-nivel del posiciona-
miento buscado.
De este modo, como parte esencial de los procesos de me-
diatizacin, se asume que los temas expresan intentan expre-
VDUSURPHWHQH[SUHVDUHOLQWHUpVS~EOLFR4XLpQORDVXPH"6H
enuncia as implcita y explcitamente en los medios, y se enun-
FLDSHURWDPELpQVHSRQHHQGXGDHQORVGLVFXUVRVGHORVLQ-
dividuos receptores. Surge el meta-nivel que se puede ver desde
lo enunciativo: el acto mismo de su puesta en discurso presume
HOLQWHUpVXQLQWHUpVQRVyORGHOPHGLRPLVPRVLQRGHOUHFHS-
tor, lo que por supuesto no siempre se consuma, pero colabora
en invocarlo. Esto en s mismo es un problema, es una tensin
nunca resuelta, porque condensa al mismo tiempo el deseo o in-
WHUpVSURSLRGHacertarTXpOHLQWHUHVDUiDOS~EOLFR\HOGHVHRR
LQWHUpVSURSLRGHprovocar o generarHOLQWHUpVGHOS~EOLFR/D

104

diferencia entre ambas situaciones es indecible, est en el clcu-


lo de las intenciones y de las profecas autocumplidas.
Aqu interviene la fuerza de la cooperacin entre los medios,
por la cual la agenda es un efecto de conjunto. La puesta en dis-
curso simultnea entre mltiples fuentes mediticas es el arma-
zn de ese imaginario. Esto fue dando lugar a un claro compor-
WDPLHQWRVLVWpPLFRGRQGHHOVHQWLGRGHORSXEOLFDGRQRSXHGH
interpretarse por fuera de esa remisin al conjunto.
Luego tenemos la inversin de la carga de la prueba: el pen-
samiento segn el cual algo se tematiza en los medios porque
le interesa al pblico se apoya en dos hiptesis de sentido co-
mn, jams fundamentadas. Una de esas hiptesis confunde la
relacin entre los medios y su consumo como una relacin en-
tre oferta y demanda, cuando en verdad es en palabras de
Wolton (1992) entre oferta y reaccin a la oferta. La historia
muestra que, as como con la mediatizacin fue incrementan-
do la autonoma de los llamados medios masivos respecto de
las otras instituciones sociales, la autonoma respecto del com-
portamiento de los individuos consumidores de medios no fue
progresiva sino originaria: por su naturaleza misma, los me-
dios masivos no tienen en su proceso productivo ningn tipo de
contacto bidireccional con la instancia espectatorial (en el mejor
de los casos, se generan procesos paralelos para obtener algn
tipo de dato acerca de la reaccin de los receptores: mediciones
y sondeos de audiencia, anlisis de respuestas producidas por
ORVPLVPRVFRQVXPLGRUHVHWFpWHUD QLORVLQGLYLGXRVDFFHGHQD
la discursividad meditica sin el costo de pasar a transformarse
ipso facto en parte de ella misma.12 Por lo tanto, han sido pri-
mordialmente las presuposiciones las que estructuraron las es-
trategias:13 HQ SDUWLFXODU OD DVXQFLyQ GHO LQWHUpV S~EOLFR GH OD
agenda se basa en la presuposicin en produccinGHXQLQWHUpV
colectivo en reconocimiento.

105

La problematizacin que emerge a partir de esta nocin de


agenda habilita a pensar lo pblico mediatizado aproximada-
PHQWHHQWpUPLQRVGHORTXH*RRG\OODPDcontradicciones cog-
nitivas.14 Las condiciones de acceso a lo pblico, en tanto se basa
HQ HO SUHVXSXHVWR GHO LQWHUpV FROHFWLYR TXHGD D PHUFHG GH ORV
recorridos individuales, produciendo sus propias condiciones
de (des FRQDQ]D&XiQWDVYHFHVQRVKHPRVSUHJXQWDGRHQXQ
recorrido por los medios con resultado desparejo (temas inespe-
rados, contradicciones, desproporciones, lagunas15 DTXLpQOH
LPSRUWDHVWR"TXpLQWHUpVKDEUiHQTXHHVWRVHVHSD"SRU
TXp OR GLUiQ DKRUD \ QR DQWHV" H LQFOXVLYH SRU TXp KDEUiQ
FDPELDGRGHRSLQLyQ"/DFRQWUDGLFFLyQRGHVFRQDQ]DHPHU-
JHQWHHVWDPELpQXQHIHFWRGHagenda, es decir, resultado de un
recorrido UHH[LYR sobre tensiones cooperativas y competitivas.

12 Tema por dems interesante: la constitucin de la voz no-meditica en los medios;


remito aqu a algunas investigaciones propias y cercanas sobre este aspecto en gneros
televisivos (Cingolani, 2006) y en medios grficos y radiales de nuestro pas (Garis,
2010, 2011, 2012).
13 An en las mediciones del minuto-a-minuto contemporneas del consumo televisivo,
se mide slo eso, el consumo, no los efectos de sentido. Ms an: se mide el inters
preasumido, y no entre otros efectos mucho ms complejos el inters constatado.
14 Las contradicciones cognitivas existen en aquellas situaciones en las que la comprensin del mundo puede transcurrir por dos o ms caminos dada la naturaleza misma de la
cognicin. Estas situaciones son necesariamente inestables durante mucho tiempo. Es
decir, si un grupo elige una lnea de pensamiento, la otra constituye una alternativa potencial, a nivel social o a nivel individual. A nivel social tenemos una contradiccin potencial
(manifiesta a nivel analtico) y a nivel individual tenemos actitudes ambivalentes. (Goody,
1999: 271). La ambigedad y la contradiccin se sitan, sin embargo, cerca del epicentro de los procesos comunicativos y cognitivos y resultan fundamentales para explicar los
aspectos generativos de los fenmenos socio-culturales. (Goody, 1999: 260).
15 Como las teorizadas por Luhmann (2000) y las observadas por Vern (1987).

106

ltimo momento: el acceso meditico a los medios.


La red y la Red
Si lo pblico se construye en la mediatizacin, no debemos
olvidar por obvio que pueda parecer que se construye como
trayectorias de reenvos intertextuales. Si la mediatizacin de lo
pblico es en una de sus dimensiones una representacin de lo
realpVWDVyORHVFRQFHELEOHFRPRXQFRQMXQWR SUREDEOHPHQWH
inextricable de modo exhaustivo) de reenvos en forma de red. Si
QRKD\XQDFRQVWUXFFLyQ~QLFDGHORS~EOLFRLGpQWLFDSDUDWRGRV
es porque no se trata de un sustrato ontolgicamente ltimo, ni
de una mera imagen, ni de un plano al que se accede o no de ma-
nera uniforme (para los cultores del encubrimiento o de la simu-
lacin), sino que tanto en produccin como en reconocimiento
se construye en el acceso mismo, y ese acceso es un recorrido en
UHGDWUDYpVGHP~OWLSOHVUHHQYtRVGHGLIHUHQWHVFDUDFWHUtVWLFDV
Nos lo recuerda Darnton (2003: 38316) a propsito de sus es-
tudios sobre el Pars pre-revolucionario: la red siempre ha sido
la forma de los modos de acceso y construccin de lo pblico.
A lo pblico mediatizado, o a lo pblico a secas, ya que no es-
tamos interesados aqu en el siglo XVIII sino en las sociedades
contemporneas se accede de dos maneras: pro-meditica-
mente e inter-mediticamente.17

16 Cito la pgina en la que el autor esquematiza una red de informacin, pero el artculo
completo es sumamente valioso: Una de las primeras sociedades informadas: las novedades y los medios de comunicacin en el Pars del siglo XVIII, op. cit.: 371-429.
17 En el caso que estudia Darnton, esa red no es pro-meditica sino para-meditica, ya
que en ninguno de sus puntos hay una tendencia a hacer confluir en un espacio ms o
menos centralizado de lo pblico en los medios, como sucede en sociedades altamente
mediatizadas (Darnton, 2003: 373); se podra decir que entonces haba mediacin y no
mediatizacin.

107

El acceso que podemos llamar pro-meditico es una trayecto-


ria que se origina para alguien en el exterior de la red de reenvos
LQWHUPHGLiWLFDHVGHFLUDWUDYpVGHODGLVFXUVLYLGDGTXHVHGH-
sarrolla, en el ejemplo ms habitual, entre individuos que con-
versan personalmente. El comentario, la recomendacin, e in-
clusive la cita de lo que se produce en y por los medios, gestiona
HOLQWHUpVSRUlo pblico y da pistas para su acceso en los medios:
LGHQWLFDHOHVSDFLRPHGLiWLFRFRQVXVFRRUGHQDGDVHVSDFLDOHV
y/o temporales de encuentro, tematiza sobre sus personajes,
PDUFDVFDUDFWHUtVWLFDVHWFpWHUDHPSOHDQGRHQDOJ~QJUDGRORV
UHFXUVRVFODVLFDWRULRV\DHVWDQGDUL]DGRVHQORVPLVPRVPHGLRV
(Cingolani, 2012). Mientras que esta trayectoria pro-meditica
se considera un acceso a lo pblico en tanto QDOL]D en los me-
dios, o al menos pasa por ellos en alguna de sus etapas, el acceso
inter-meditico se gestiona desde los mismos medios, mediante
reenvos por publicidades, promociones, crticas, citas de archi-
YRHWFpWHUD$KRUDELHQHODFFHVRLQWHUPHGLiWLFRHQWRGDODHUD
previa a las redes informticas es slo, o casi slo, intertextual.
Vale decir, las plataformas de acceso y conexin entre distintos
soportes estn fsicamente separadas HQWUH XQ PHGLR JUiFR
XQRUDGLDOXQRWHOHYLVLYRHLQFOXVLYHXQRFLQHPDWRJUiFRKD\
un hiato que es insalvablemente fsico. Estos hiatos son, sin em-
bargo, tan importantes, que incluso sus despliegues llegan a es-
tar instituidos, en un altsimo grado, en zonas del recorrido do-
PpVWLFR\XUEDQRVHJ~QXVRV\FRVWXPEUHVVRFLDOHVIXHUWHPHQWH
FRQVROLGDGDV DXQTXHWDPELpQFDPELDQWHV /DOHFWXUDSULYDGD
GHOGLDULR HQHOKRJDU \WDPELpQODS~EOLFD HQHOFDIpHQHOVXE-
WHHWFpWHUD ODHVFXFKDUDGLRIyQLFDHQHODXWRPyYLOODSHOXTXH-
ra o la sala de espera, la pantalla televisiva del bar y la del living
hogareo, organizan un tejido que puede describirse al mismo
WLHPSRHQWpUPLQRVLQWHUWH[WXDOHVWHUULWRULDOHV\VRFLROyJLFRV
VLHPSUH PHGLDGRV SRU ODV FRQYHUVDFLRQHV GHQVDPHQWH VLJQL-

108

cantes al respecto. Al cine en la sala se llega por caminos fsicos


\GLVFXUVLYRVPX\GLVWLQWRVTXHDOOPHYLVWRSRUWHOHYLVLyQHQOD
SURJUDPDFLyQGHOViEDGR\ODWHUWXOLDSRVWHULRUTXHGDWDPELpQ
enmarcada por actividades de socializacin diferentes.
2WURWDQWRVXFHGHFRQHOUHFRUULGRGHQWURGHOPLVPRVRSRUWH
condicionando los reenvos: las respectivas plataformas (el kios-
co de diarios y revistas, el espectro radiofnico en el dial, la grilla
de canales en televisin) agrupan a los medios por enlaces real-
mente pobres en lo que respecta al paso de un punto a otro. As,
la costumbre del canillita que con su lgica por las convenien-
cias comerciales, distribuye en zonas centrales y secundarias las
tapas para la visibilidad del transente, la horizontal linealidad
de las frecuencias graduadas en el dial radiofnico y el no menos
disputado orden de aparicin y ubicacin en el vecindario de los
canales mediante la numeracin en la televisin por cable o por
parablica que actualmente, es motivo de discusin y gestin
poltica central balizan las rutas de los individuos espectado-
res. En esa circulacin, el zapping D WUDYpV GHO GLVSRVLWLYR GHO
control remoto ha sido la antesala de la decisin de recorridos
no-lineales. Pero esos recorridos sin embargo estaban muy lejos
de la navegacin
Probablemente, un umbral de cambio, en nuestro pas, ha
sido la presencia de espacios mediticos que producen y temati-
zan reenvos inter-mediticos, con un impresionante crecimien-
WRHQOD~OWLPDGpFDGD18

18 Hemos podido estudiarlos en Cingolani, 2010.

109

(QODFRQWHPSRUDQHLGDGDWUDYpVGHODSDUWLFXODUUHGTXHHV
internet, la trayectoria de acceso adems de intertextual es, por
decir as, intra-textual: no es necesario ir a otro lado, no es
necesario viajar de soporte en soporte por espacios fsicos que
QRGHMDURQGHVHUWDPELpQSDUWtFLSHVIXQGDPHQWDOHVHQODVWUD-
yectorias, como las calles, ferias, plazas, bares, clubes, parro-
TXLDV DWHQHRV SDUWLGDULRV RFLQDV HVWDGLRV WHDWURV lobbies,
entre muchos otros. Actualmente, las trayectorias de acceso a lo
pblico pueden desarrollarse en la misma interfaz. La mayora
de los medios aparecen en la Red, y los espacios en pantallas
de manejo ubicuo no slo son escenarios de circulacin de lo
que antes ya era inter-meditico (el reenvo entre textos de di-
IHUHQWHVPHGLRVDORVTXHVHVXPDURQQXHYRV VLQRWDPELpQGH
lo que fue pro-meditico: los comentarios inter-individuales y
la posibilidad del posting, del linking, son activados por los
propios individuos.
El impacto de estas nuevas trayectorias intra-mediticas en
la agenda no es menor. Por el momento, los espacios mediticos
pertenecientes a empresas previas a internet conservan la cos-
tumbre de evitar el reenvo explcito a sus competidores. Esto
ltimo se entiende, pero es una excepcin en la dinmica de la
Red; hasta podra decirse que la contradice. Adems de los mo-
WRUHVGHE~VTXHGDJHQpULFRV\HVSHFtFRVHVHQRUPHODFDQWLGDG
y variedad de espacios, de orgenes individuales e instituciona-
les, que trabajan sobre el reenvo explcito, la recomendacin,
replicacin, crtica y edicin de lo producido en otros medios.
(QHVSHFtFRSRUFDVRDWUDYpVGHODVSODWDIRUPDVWLSRUHG
social se desarrolla un contrato de hacer pblico desde la marca
GHODLQGLYLGXDOLGDG3HURODRUJDQL]DFLyQGHODVXSHUFLHGLVFXU-
siva impide utilizar el conjunto de operaciones que el sistema de
medios masivos: salvo la disposicin por presencia/ausencia,
donde tanto la novedad como la repeticin juegan un papel, la

110

MHUDUTXL]DFLyQ y la WLSLFDFLyQ quedan de lado. Digamos que en


principio el impacto recae sobre la transformacin de las ope-
raciones cualitativas: es lo que representa ni ms ni menos el
YDORUGHODRSLQLyQDWUDYpVGHODSDODEUDHQ Facebook y Twitter,
no tan alejado del funcionamiento que tienen los comentarios
debajo de las noticias de los medios on line. (Interesante: es-
tas opiniones son retomadas luego por los medios tradicionales,
reentrando de otro modo en el sistema medios). La centralidad
de los medios anteriores a la Red se ha estado debilitando, y las
trayectorias que constituyen lo pblico, sin dejar de ser media-
tizadas, van siendo operadas por otros actores que no son ne-
cesariamente las empresas e instituciones mediticas. No me
UHHUR D OR TXH VXFHGH en recepcin (eso ya suceda), sino en
produccin: individuos u organizaciones ajenas a las empresas
de medios producen tejidos de reenvos accesibles por otros,
conformando una agenda? cada vez menos nucleada en el sis-
tema medios, lo que se traduce como un acceso a lo pblico cada
vez menos generalizable. Cul ser la forma de lo pblico con
los nuevos modos de acceso en los prximos aos?

111

Bibliografa
BREGMAN, Dorine, La funcin de agenda: una problemtica en
transformacin, cap. 14 en J.-M. Ferry, D. Wolton et al., El nue-
vo espacio pblico. Barcelona, Gedisa, 1998.
CHARTIER, Roger, Libros, lecturas y lectores en la Edad Moderna.
Madrid, Alianza, 1994.
CHARTIER, Roger, El orden de los libros. Barcelona, Gedisa, 2000.
CHARTIER, Roger, Inscribir y borrar. Cultura escrita y literatura
(siglos XI-XVIII). Buenos Aires, Katz, 2006.
CINGOLANI, Gastn, Lo serio y lo sensacionalista en el perio-
dismo televisivo: un problema de juicio de gusto., Memorias
de las V Jornadas de Investigadores de Comunicacin, Red Na-
cional de Investigadores de Comunicacin y la U.N.Entre Ros,
Paran, 2000.
CINGOLANI, Gastn, Juicios de gusto sobre canales de noticias. Un
anlisis discursivo, Tesis de Maestra, Facultad de Cs. Polti-
FDV\55,,5RVDULR8QLYHUVLGDG1DFLRQDOGH5RVDULRLQpGLWD
2004.
CINGOLANI*DVWyQ3RUTXpHOreality no se comi a la TV? (Puestas
en escena del hombre comn: enunciacin, institucin y dis-
positivo en los shows informativos.), en Cingolani,Gastn (ed.),
Discursividad televisiva, pp. 81-106. La Plata, Edulp, 2006.
CINGOLANI, Gastn, Tapas de semanarios argentinos en el siglo
XX: historia discursiva de un dispositivo y dos medios, en Ber-
man, M.; J.L. Fernndez, D. Fraticelli y D. Koldobsky (Comps.),
'HVGHODVHPLyWLFDKLVWRULDVGHORVPHGLRV3RQHQFLDVGHO
Encuentro de investigaciones, pp. 192-205. Buenos Aires, FCS.-
UBA., AAS, 2007.
CINGOLANI, Gastn, Crtica de medios: agenda, memoria y opi-
nin colectiva, en Figuraciones, teora y crtica de arte, nro.
112

7. Buenos Aires, rea Transdepartamental de Crtica de Artes,


IUNA, 2010.
CINGOLANI, Gastn, Para una teora de las operaciones enunciati-
YDVGHORVMXLFLRVGHJXVWR, Tesis doctoral, Facultad de Filosofa
\/HWUDV8QLYHUVLGDGGH%XHQRV$LUHVLQpGLWDHQWUHJDGDDOD
espera de Defensa: diciembre de 2012.
DARNTON, Robert, El coloquio de los lectores. Ensayos sobre auto-
res, manuscritos, editores y lectores0p[LFR'))&(
DARNTON, Robert, El beso de Lamourette. Buenos Aires, FCE, 2010.
EISENSTEIN, Elizabeth, La imprenta como agente de FDPELR0p[LFR
DF., FCE, 2010.
FERNNDEZ-RVp/XLV&ODXGLD/ySH]%DUURV\-RVp/XLV3HWULVEl
Mundo condensado/r e ilustrado/r, IX Congreso Nacional de
Historia, Academia Nacional de la Historia. Rosario, 1996.
FERRY, Jean-Marc, Las transformaciones de la publicidad poltica
cap. 1 de J.-M. Ferry, D. Wolton et al., El nuevo espacio pblico.
Barcelona, Gedisa, 1998.
GARCA+pFWRU5LFDUGRLa culpa la tuve yo. Buenos Aires, Planeta, 2012.
GARIS$QD9LFWRULD&RUD]RQHVHQFRQLFWR(OFRQVXOWRULRVHQWL-
mental en Argentina (1920-1975), en La Trama de la Comu-
nicacin. Anuario del Departamento de Ciencias de la Comu-
nicacin, Vol. 14, 123-149. Rosario, Escuela de Comunicacin
Social, UNR, UNR Editora, 2010.
GARIS, Ana Victoria, El Consultorio Sentimental radiofnico, en
Andruskevicz, C. y C.G. Melo (comps.), Actas del VIII Congreso
Nacional y III Internacional de la Asociacin Argentina de Se-
PLyWLFD &DUWRJUDItD GH LQYHVWLJDFLRQHV VHPLyWLFDV. Posadas,
Asoc. Argentina de Semitica, 2011.
GARIS, Ana Victoria, El amor est en el aire: el consultorio senti-
mental radiofnico, en F@ro. Revista terica del Departamen-
to de Ciencias de la Comunicacin, nro. 15, Fac. de Cs. Sociales,
Universidad de Playa Ancha, 2012. Disponible en: http://web.
upla.cl/revistafaro.
113

GOODY, Jack, Representaciones y contradicciones. Barcelona, Pai-


ds, 1999.
GUTIRREZ RETO, Matas, Dispositivo radiofnico y vida cotidiana
en los inicios de la radiodifusin, en Fernndez, J. L. (dir.), La
construccin de lo radiofnico, pp. 155-175. Buenos Aires, La
Cruja, 2008.
HJARVARD, Stig, The Mediatization of Society. A Theory of the Me-
dia as Agents of Social and Cultural Change, Nordicom Review
29: 2, pp. 105-134, 2008.
LUHMANN, Niklas, La realidad de los medios de masas. Barcelona -
0p[LFR$QWKURSRV8QLYHUVLGDG,EHURDPHULFDQD
MARTIN, Henri-Jean, La aparicin del libro, tomo LXX de La evolu-
cin de la humanidad0p[LFR8WHKD
MARTIN, Henri-Jean, La imprenta, en R. Williams, Historia de la
comunicacin, vol.2. Barcelona, Bosch, 1992.
SATTA, Sylvia, Regueros de tinta. Buenos Aires, Sudamericana,
1998.
STEIMBERG2VFDU\7UDYHUVD2VFDU3DUDXQDSHTXHxDKLVWRULDGHO
OHQJXDMHJUiFRDUJHQWLQRHQEstilo de poca y comunicacin
meditica, pp. 33-74. Buenos Aires, Atuel, 1997a.
STEIMBERG2VFDU\7UDYHUVD2VFDU3RUGRQGHHORMROOHJDDOGLDULR
el estilo de primera pgina, en Estilo de poca y comunicacin
meditica, pp. 75-90. Buenos Aires, Atuel, 1997b.
VARELA, Mirta, /DWHOHYLVLyQFULROODGHVGHVXVLQLFLRVKDVWDODOOH-
gada del hombre a la Luna (1951-1969). Buenos Aires, Edhasa,
2005.
VERN, Eliseo (1981), Construir el acontecimiento, 2da. edicin.
Barcelona, Gedisa, 1987.
VERN, Eliseo (1988), La semiosis social. Fragmentos de una teora
de la discursividad, 2da. edicin. Barcelona, Gedisa, 1993.
WOLTON, Dominique, Elogio del gran pblico. Barcelona, Gedi-
sa, 1992.

114

CAPTULO V

Tiempo, distancia e intermediacin


en el espacio pblico mediatizado

Por Mariano Fernndez

Introduccin: la mediatizacin en diacrona


y sincrona
La mediatizacin es un proceso histrico. Como tal, se des-
pliega en diacrona, esto es, debe entenderse como diferencia o
FRQWUDVWHHQWUHpSRFDV\IRUPDFLRQHVVRFLDOHVVHJ~QODVWHFQR-
logas de comunicacin y los fenmenos mediticos que le son
caractersticos, y segn la amplitud con que esas tecnologas y
esos fenmenos se inserten en las condiciones productivas del
funcionamiento del sentido en aquellas sociedades. La escritura
fue, hace al menos cinco milenios, la primera tecnologa de co-
PXQLFDFLyQ *RRG\\:DWW2QJ SHURGXUDQWHPLOHV
de aos su despliegue social fue limitado; permaneci como un
UHFXUVRHQPDQRVGHODVpOLWHVJREHUQDQWHVRGHJUXSRVFXOWXUDO-
mente privilegiados. La imprenta, en el siglo XVI, al habilitar la
reproduccin mecnica de textos, gener las condiciones para
ODFLUFXODFLyQGHGLVFXUVRVOLEURVSDQHWRVOLEHORVHQHVFDODV
colectivas ampliadas, pero esa potencialidad permaneci conte-

115

nida, entre otros factores, por la limitante de una alfabetizacin


restringida.
En perspectiva, la mediatizacin afecta, en principio, slo es-
feras circunscriptas de prcticas sociales la contabilidad y la le-
gislacin del estado (Goody, 1995); la produccin y acumulacin
GHOFRQRFLPLHQWRDFDGpPLFR\OLWHUDULR &KDUWLHU ODFLUFX-
lacin de novedades relativas a los crculos de poder (Darnton,
2003)- y, a lo largo de la historia, se expande como en formas
FRQFpQWULFDV KDVWD VXSHUSRQHUVH FRQ OD H[SUHVLyQ HV JXUD-
da- los lmites mismos de la sociedad. La aceleracin mediti-
ca del siglo XX, encarnada paradigmticamente en los medios
de comunicacin de masas y consolidada por la difusin de las
computadoras personales y, ahora, por Internet y las tecnolo-
JtDVLQWHUDFWLYDVDFHQWXyHOFRQWUDVWHGHpSRFDVOHLPSULPLyXQ
efecto de ruptura, como si no pudieran trazarse continuidades
con el pasado. Para nombrar el nuevo tipo de sociedad se pro-
pusieron rtulos, como sociedad de la informacin o sociedad
del conocimiento, que bien podran aplicarse a las formaciones
sociales anteriores1.
3RURWURODGRODPHGLDWL]DFLyQWDPELpQLUUXPSHHQVLQFURQtD
como contexto o trasfondo de fenmenos singulares. Esta es la
YDULDQWH PiV WUDQVLWDGD HQ VXV XVRV DFDGpPLFRV VH OD pre-su-
pone como el estado de situacin del cual se pretenden estudiar
PDQLIHVWDFLRQHVSXQWXDOHV3XHGHSRUORWDQWRLGHQWLFDUVHHQ
un momento determinado, a propsito de un problema deter-

1 Recomiendo la lectura del artculo de Robert Darnton (2003) titulado: Una de las
primeras sociedades informadas: las novedades y los medios de comunicacin en el
Pars del siglo XVIII, notable reconstruccin de la circulacin de novedades sobre la vida
poltica del Pars del Antiguo Rgimen.

116

minado: la socializacin poltica, el aprendizaje escolar, las ac-


tividades ldicas, el funcionamiento del espacio pblico, etc. En
estos casos, el proceso histrico se circunscribe a un conjunto de
condiciones productivas que afectan las formas de produccin,
circulacin y reconocimiento de los discursos sociales, sean las
maneras de acceder a la informacin sobre temas pblicos que
SXHGHQ GHQLU SUiFWLFDV FLXGDGDQDV R ORV HIHFWRV TXH ODV WHF-
nologas de comunicacin tienen sobre la institucin escolar y
VXUHODFLyQFRQVXVHQWRUQRV1RHVFDVXDOTXHLGHQWLTXHPRV
incluso de manera intuitiva, mediatizacin y medios de comu-
nicacin de masas; no es casual ni tampoco errado, a condicin
GHTXHVHDFHSWHTXHWDPELpQODVLQVWLWXFLRQHVGHPHGLRV\VXV
prcticas estn condicionadas, a su vez, por la emergencia de
tecnologas de comunicacin y por las modalidades de apropia-
cin y uso que cada sociedad hace de ellas.
El espacio pblico moderno, que emergi como una suerte
de intermedio entre el Estado absolutista y la sociedad civil (Ha-
bermas, 1990), es un buen ejemplo de mediatizacin en escala
reducida. Como forma de intercambio colectivo, el espacio p-
blico es, desde su origen en el siglo XVIII, una actividad me-
diatizada: est directamente articulado a la circulacin de textos
peridicos, revistas- y a la discusin sobre textos libros, obras
de teatro, etc. Pero sobre todo,est signado por la emergencia
GHODJXUDGHOS~EOLFRTXHVLELHQQRGHMDGHVHUHOUHYHUVR
estilizado de la pertenencia de clase, un colectivo con atributos
excluyentes dotado de una racionalidad, de una moral, de un
estilo- no puede reducirse slo a eso. El pblico no es slo una
magnitud emprica, sino una funcin sociolgica que se activa
cuando la produccin de discursos se hace ante el horizonte de
lo colectivo y lo annimo y tiene por efecto virtual la puesta en
comn sin proximidad, o lo que Chartier llam una comunidad
sin presencia visible.

117

Tal vez el planteo no sea sutil, pero tampoco somos tan bru-
tos: entre las formas burguesas de sociabilidad y las formas con-
WHPSRUiQHDV LQDEDUFDEOHV KHWHURJpQHDV LUUHGXFWLEOHV D XQD
norma paradigmtica- del espacio pblico hay un vaco que debe
ser completado con explicacin histrica. Aqu, lo que nos intere-
sa sealar es que lo que resulta mediatizado no es una sustancia
VLQRXQDUHODFLyQGHLQWHUFDPELRGLVFXUVLYR4XpHVHOHVSDFLR
pblico mediatizado? No es tan slo un lugar fsico una plaza,
una calle, el Parlamento- sometido a la intervencin y difusin
PHGLiWLFDWDPSRFRGHVLJQDVyORDHVRVOXJDUHVItVLFRVWDPELpQ
creados por los propios medios, como el set de televisin o el es-
WXGLRGHUDGLR(QWpUPLQRVHVWUXFWXUDOHVODPHGLDWL]DFLyQDIHFWD
ODVFRQGLFLRQHVSURGXFWLYDVGHOVHQWLGRDOOtGRQGHpVWDVLPSOLFDQ
una ruptura de escala espacio-temporal por la presencia de dis-
SRVLWLYRVWHFQROyJLFRVGHFRPXQLFDFLyQ\UHHUHDVXYH]DODDU-
ticulacin entre la produccin y el reconocimiento (Vern, 2004)
por la puesta en circulacin de discursos-de imgenes, palabras,
cuerpos, sonidos- por encima de los horizontes circunscriptos de
relaciones interpersonales y de espacios de co-presencia.
En ese doble juego de ruptura y articulacin se insertan, his-
tricamente, el periodismo (como prctica) y los medios (como
instituciones).Lo hacen introduciendo horizontes de tiempo que
condicionan las temporalidades de otras instituciones sociales;
ORKDFHQPRGLFDQGRODVPDQHUDVGHH[SHULPHQWDU\FRQRFHUODV
realidades colectivas y de vincularlas con las experiencias indi-
viduales; lo hacen instituyendo un lugar de enunciacin que los
coloca como interlocutores del pblico, lugar desde el que ob-
servan el devenir social y el funcionamiento de las dems insti-
tuciones, sean polticas, religiosas, educativas.Este ensayo estar
GHGLFDGRSUHFLVDPHQWHDUHH[LRQDUVREUHHOSHULRGLVPR\ORV
KRUL]RQWHVGHWLHPSRTXHpOPLVPRFUHDFRQORVTXHFRQYLYH\
VREUHORVTXHVH\X[WDSRQH7DPELpQDSHQVDUVREUHORVXPEUD-

118

les del mundo producido bajo condiciones de mediatizacin y


las experiencias que se sitan en el lmite de lo no mediatizado,
particularmente cuando esos umbrales expanden los lmites de
la experiencia individual y subjetiva. Finalmente, queremos re-
H[LRQDUVREUHODLQWHUPHGLDFLyQFRQFHELGDFRPRXQPRGRGH
activar la articulacin entre los polos de la circulacin discursiva
y de ocupar un lugar de enunciacin en la distancia que se abre
entre esos polos.

Ritmo y comps
En un breve ensayo titulado El pudor de la historia (1952),
%RUJHVHYRFDXQDDQpFGRWDVREUH*RHWKH&XHQWDTXHHQ
estando en Pars, el poeta alemn se entera del resultado de la
Batalla de Valmy, en la cual dos agrupamientos de tropas re-
YROXFLRQDULDVUHXQLGDVGH LPSURYLVRVLQXQDGLUHFFLyQXQL-
FDGD GHWLHQHQ HO DYDQFH GHO HMpUFLWR SUXVLDQR REOLJDGR SRU OD
GHUURWDDLQLFLDUXQDUHWLUDGDGHOWHUULWRULRIUDQFpV(VHHSLVRGLR
fue considerado, ms tarde, como un acontecimiento clave para
la consolidacin de la Revolucin, pero Goethe, frente a ese in-
esperado desenlace, en ese mismo momento, hace este comenta-
ULR(QHVWHOXJDU\HOGtDGHKR\VHDEUHXQDpSRFDHQODKLVWRULD
del mundo y podemos decir que hemos asistido a su origen. La
clarividencia puede ser asombrosa o temeraria, pero Borges no
repara en la calidad de la profeca2, sino en su tono, y escribe:

2 Desde aquel da, dice Borges, han abundado las jornadas histricas y una de las
tareas de los gobiernos () ha sido fabricarlas o simularlas, con acopio de previa propaganda y de persistente publicidad.

119

7DOHVMRUQDGDV WLHQHQPHQRVUHODFLyQFRQODKLVWRULDTXH
FRQHOSHULRGLVPR\RKHVRVSHFKDGRTXHODKLVWRULDODYHUGD-
dera historia, es ms pudorosa y que sus fechas esenciales pue-
den ser, asimismo, durante largo tiempo secretas3.
Puede que tenga razn Borges: no es difcil reconocer, en esa
pretensin anticipatoria de Goethe, la tonalidad impactada a
la que nos ha acostumbrado el periodismo, tentado siempre de
encontrar en los acontecimientos que son, al mismo tiempo, su
materia prima y los efectos de su trabajo, los signos de ruptu-
UDVFDPELRV\WUDQVIRUPDFLRQHV2VXVUHYHUVRVRUtJHQHVLQL-
FLRV\DOERUHV(QODVVXSHUFLHVPHGLiWLFDVFLUFXODQODVJXUDV
mticas de la temporalidad: las Eras, los Perodos, los Ciclos, los
Procesos Duraciones temporales imposibles de abarcar, para
el propio periodismo, por las condiciones mismas de insercin
en la temporalidad colectiva: ese entretiempo suspendido entre
el pasado y el futuro, esa suerte de presente absoluto que es la
actualidad. Imposible, adems, porque salvo la inauguracin de
obras pblicas, el ciclo lectivo o algunos matrimonios, no existen
eventos (menos an, histricos) que puedan declararse abier-
tos o clausurados de antemano. Ese es, siempre, un resultado a
posteriori. Al pudor con que la historia debe lidiar con los in-
dicadores del tiempo le corresponde, a veces, el impudor y la
temeridad con que lo hace el periodismo.
Pero sera un error imputar a una disposicin subjetiva o a
una voluntad impaciente lo que en realidad parece corresponder
a un lugar de observacin que, como tal, es antes que nada un
OtPLWHVHGHQHQRVyORSRUORTXHSHUPLWHYHUFRPRSRUDTXHOOR

3 Cursivas nuestras.

120

que deja de mirar, que no puede percibir. En la representacin


de la realidad por parte de los medios de masas, explica Luh-
mann (2000: 114), resaltan, sobre todo, las rupturas: temporales
o sociales. La conformidad, la concordancia, la repeticin de lo
habitual, las constantes de posibilidades aparecen, siempre, fue-
ra de foco. El presente es siempre una transicin; la actualidad,
WHPSRUDOLGDGPHGLDWL]DGDHVXQDFURQRPHWUtDDUWLFLDO /XK-
mann, 2000: 121). No es el pasado, no es el futuro. Es el preciso
lugar en que se genera una diferencia con lo ya conocido, all
donde puede existir algo que lleve el nombre de informacin
o su reverso inherente, el olvido sistemtico. Como dice Toms
Abraham (2003), el dispositivo meditico tiene una medicin
temporal con la que se marca el presente al mismo tiempo que
se inhibe la duracin. El presente es, en s mismo, slo un punto
de rompimiento, o slo la posicin del observador. En los dis-
cursos que circulan por encima de los horizontes de la experien-
cia individual, como el de los medios o como el de la ciencia, la
perspectiva no es slo un problema de distancia espacial. Es una
ubicacin en el tiempo.
Menos que la crtica del impulso presuntuoso (ponerse en
posicin de anunciar Eras que se cierran y Ciclos que se abren)
y de una retrica correspondiente (se abre una poca en la his-
toria del mundo) lo interesante de la observacin de Borges
es la distincin de dos modos de observar y lidiar con los acon-
tecimientos y sus duraciones. Lo que parece consustancial a una
parece no resultar evidente en el otro. La historia trabaja sobre
y con el tiempo, guiada por la necesidad de darle inteligibilidad
a duraciones que no se instituyen por s mismas pero que tam-
poco se dejan instituir de una vez y para siempre. El periodismo
parece atorado en el tiempo, o por el tiempo. Y sin embargo, tal
y como lo conocemos desde el siglo XIX, el periodismo como
discurso y como producto textual- es tanto un sistema de cla-

121

VLFDFLyQGH OD UHDOLGDG FRPR XQ PRGR GH VHFFLRQDU DUWLFXODU


y yuxtaponer tiempos individuales y tiempos colectivos, y de
intervenir sobre los horizontes de tiempo de otras instituciones
sociales que conviven en el espacio pblico.
El periodismo funciona articulado al sistema de medios, y los
medios no slo son empresas que administran su capital eco-
nmico o actores polticos que operan en funcin de intereses
e ideologas. Son, en particular, administradores de tecnologas
de comunicacin y en ellas fundan su capacidad su poder- de
ritmar los tiempos del espacio pblico: los diarios, durante bue-
na parte del siglo XIX y los medios masivos, ya bien entrado el
siglo XX, le han dado al espacio pblico un patrn temporal la
$FWXDOLGDG \ WDPELpQ VXV FRPSDVHV HO GtD HO PLQXWR HO VH-
gundo. Pero no lo han hecho como quien modela una materia
plstica sino acompaando transformaciones en la velocidad de
los intercambios sociales de las que el mismo periodismo es una
expresin, o un efecto.
En su estudio sobre el que es considerado como el primer pe-
ridico en el sentido moderno, La Presse, fundado por Emile
*LUDUGLQ HQ  7KpUHQW\ \ 9DLOODQW    VRVWLHQHQ TXH
el peridico es un artefacto cultural que surge en el marco de
transformaciones que imponen nuevos ritmos, que escanden el
devenir del tiempo y dotan a las sociedades deuna nueva per-
cepcin, individual y colectiva, de la temporalidad. El entorno
en el que el peridico se consolida como un fenmeno meditico
y comercial, es uno en el que la vida se presenta como una su-
cesin de momentos y una superposicin de ritmos, como acu-
mulacin de tiempos fragmentarios. Hay una superposicin de
ciclos inducidos por la nueva organizacin econmica y social:
ciclos de la actividad poltica y parlamentaria, de la industria y
de los transportes, de los medios, de la vida ciudadana, etc. Esta
QXHYDUHODFLyQFRQHOWLHPSRH[SOLFDQ7KpUHQW\\9DLOODQWVH

122

acompaa con una mayor movilidad en el espacio: los medios de


comunicacin se modernizan, los viajes se generalizan (). Una
de las formas ms visibles de esta civilizacin del ritmo genera-
lizado es el desarrollo, en el siglo XIX, de la prensa peridica.
Benedict Anderson comenta, en un pasaje de su libro Comu-
nidades Imaginadas ([1983] 2006), que Hegel deca que los
peridicos le servan al hombre moderno como sustituto de sus
plegarias matutinas. Anderson dedica unas breves pginas de su
libro a explicar ese nuevo rito propio del siglo XIX y que parece
estar, junto a otros procesos, en la base de la idea de nacin.
Recordemos: Anderson sostiene que la nacin es un artefac-
WRFXOWXUDOGHODPRGHUQLGDG\ODGHQHFRPRXQDFRPXQLGDG
imaginada como inherentemente limitada y soberana4. La ima-
ginacin no es la invencin incondicionada, sino el imaginario
TXHXQLFDORGLYHUVRORKHWHURJpQHRORGHVYLQFXODGR<WDOLPD-
ginario no es posible sin una concepcin del tiempo que habilite
la simultaneidad del mientras tanto, del estar compartiendo un
instante en un devenir con personas a las que, sin embargo, uno
jams conocer en su vida. Lo que ha llegado a tomar el lugar de
la concepcin medieval de la simultaneidad a lo largo del tiem-
SRFRPRGLFH%HQMDPLQHVXQDLGHDGHOWLHPSRKRPRJpQHR
vaco, donde la simultaneidad es, por decirlo as, transversa, de
WLHPSR FUX]DGR QR PDUFDGD SRU OD SUHJXUDFLyQ \ OD UHDOL]D-
cin, sino por la coincidencia temporal y medida por el reloj y el
calendario (Anderson, 1991: 46).
Anderson cree que esta idea del tiempo simultneo puede ex-
plicarse por el surgimiento de dos artefactos culturales que son,

4 No es nuestra intencin retomar esa frase para convertirla fatalmente en un eslogan.


Remitimos al libro de Anderson, del que esa frase es, apenas, el enunciado de una tesis.

123

casi, contemporneos: las novelas y el peridico. Por eso, se pre-


gunta: Cul es la convencin literaria esencial del peridico?.
Y responde: la yuxtaposicin de eventos que no tienen ninguna
conexin fctica entre s. La arbitrariedad de su inclusin y yux-
taposicin () revela dice Anderson- que la conexin existen-
te entre ellos es imaginada. La cuestin, ahora, es entender de
dnde viene tal conexin. Para el autor deriva de dos fuentes. La
primera, de la coincidencia en el calendario (1991:57), es decir,
por estar compartiendo un mismo tiempo. La segunda fuente
de conexin imaginada se encuentra en la relacin que existe
entre el libro, el peridico y el mercado. En un sentido bastan-
te especial, el libro fue el primer producto industrial producido
en masa, al estilo moderno (1991:59). El peridico, como un
bien industrial producido a escala masiva sera, segn esta idea,
slo una forma extrema del libro. Excepto por un detalle cru-
cial: a diferencia del libro, el peridico es un bien que se vuelve
obsoleto en el mismo da. Pero precisamente por eso, la lectura
del diario constituye una ceremonia masiva extraordinaria: el
consumo casi en simultneo (imaginado) del peridico como
FFLyQ    0DVLYD H[WUDRUGLQDULD \ WDPELpQ SDUDGy-
jica: la ceremonia se realiza en una intimidad silenciosa, en el
cubil del cerebro. Pero cada comunicante est consciente de que
la ceremonia est siendo repetida simultneamente por miles (o
millones) de otras personas en cuya existencia confa, aunque no
tenga la menor nocin de su identidad (2006: 61). El peridico
se lee individualmente pero con la conciencia de estar partici-
pando en un tiempo compartido.
A diferencia de otros discursos de los que es derivado y com-
SDxHUR HOOLEURHOSDQHWRHODOPDQDTXHHOOLEHOR HOGLVFXUVR
del periodismo fue el primero, en la era de lo escrito impreso
(digamos, desde el siglo XVI en adelante), que se fund en un
contrato de comunicacin basado en el puro principio de perio-

124

dicidad y no en los ciclos naturales o en la trascendencia de los


fenmenos sobre los que hablaba (Vern, 2011). El periodismo,
HQVXJpQHVLVWLHQHPHQRVTXHYHUFRQODYROXQWDGGHGRPLQD-
cin y la inoculacin de ideas que con el calendario, el reloj, el
tren y los ritmos, ahora enloquecidos, de lavida urbana. El riesgo
de la intrascendencia, de la sobrevaloracin de un evento, pero
WDPELpQGHODLQFRKHUHQFLDGHODUHXQLyQGHKHFKRVTXHQRWLH-
nen un lazo existencial ni temtico entre s, ese riesgo est ins-
FULSWRHQHOLPSHUDWLYRJHQpWLFRGHOSHULRGLVPRFXPSOLUFRQHO
SDFWR GHSHULRGLFLGDG DXQTXH VLQ VDEHU GH DQWHPDQRGH TXp
nos hablar. Y este es un imperativo del que no pueden escapar
siquiera las variantes ms nobles o menos contaminadas por ne-
xos oscuros.

La meditica
Aquella intuicin fenomenolgica (la consciencia del consu-
mo simultneo y por eso compartido) es sugerente pero incom-
probable. La volvemos a encontrar no casualmente- en obser-
vaciones contemporneas sobre el gran medio del siglo XX, la
televisin, que funciona sobre la base de un dispositivo mejor
preparado para producir el efecto de simultaneidad que Ander-
son le asigna a la lectura y a la puesta en pgina de los diarios. La
televisin, en ese sentido, pudo y puede realizar ese efecto que
HQHOFDVRGHOSHULyGLFRSHUPDQHFHFRPRFFLyQSXHGHWUDEDMDU
VREUHODLOXVLyQGHFRUUHVSRQGHQFLDHQWUHHOXMRGHVXGLVFXU-
sividad y el tiempo cotidiano no mediatizado y puede hacer que
ese mientras tanto no sea un mero efecto de imaginacin, sino
otra correspondencia, esta vez entre el momento de la expecta-
FLyQ\HOPRPHQWRHQTXHVXFHGHHOKHFKRQDUUDGRDWUDYpVGHO
vivo y en directo.

125

6LQ HPEDUJR SHUVLVWH FRPR SUREOHPD OD FRQUPDFLyQ GH


ese instante de comunin, de simultaneidad compartida que
activa el vnculo colectivo entre todos los que, aqu y ahora, es-
tn mirando lo mismo: un partido de ftbol, el funeral de un
H[SUHVLGHQWHORV-XHJRV2OtPSLFRVRODDVXQFLyQGHXQQXHYR
Papa. Para Wolton la televisin implica la realizacin indivi-
dual de una actividad colectiva (2000: 81). En su defensa de la
WHOHYLVLyQJHQHUDOLVWDRGHJUDQS~EOLFRHOVRFLyORJRIUDQFpVVH
SUHJXQWDEDTXpHUDfundamentalmente la televisin y responda
que era imgenes y vnculo social pues el espectador, mirando
la televisin, se suma a ese pblico potencialmente inmenso y
DQyQLPRTXHODPLUDVLPXOWiQHDPHQWH\PDQWLHQHFRQpOGHHVD
manera, una suerte de vnculo invisible.5
Daniel Dayan (2000), por su parte, entiende que la expe-
riencia que consiste en mirar televisin no puede describirse en
WpUPLQRV VLPSOHPHQWH LQGLYLGXDOHV (O XMR PHGLiWLFR FRUUH
hacia delante, independientemente de los lectores, de los espec-
tadores, los escuchas o los internautas. Pero el ingreso a la inter-
ID]PHGLiWLFDHVXQPRPHQWRLQGLYLGXDOTXHDFWLYDHVHXMRTXH
lo reincorpora a la temporalidad de los actores. Ver televisin,
dice Dayan, es ver con, es entrar en interaccin con un con-
tra-campo constituido por todos aquellos que miran simult-
neamente la misma imagen televisiva o, ms exactamente, con
todos aquellos que imaginamos que lo hacen. Esa experiencia
implica siempre un momento de activacin donde la enuncia-
cin se har en directo permitiendo as acceder al registro de

5 Vern (2001: 93) ha sealado que la hiptesis del gran pblico, que activa su identificacin por el vnculo social que genera la televisin, esuna definicin hecha en produccin y, en ese sentido, una hiptesis emprica a verificar en el trabajo de campo.

126

ver con, de entrar en la comunidad imaginaria de aquellos que


lo miran al mismo tiempo.
Pero compartir es un acto de ofrenda mutua, una decisin
deliberada, y lo que en realidad han creado las tecnologas de
comunicacin y las instituciones mediticas modernas es una
zona de cohabitacin sin un acuerdo de partes: el espacio pbli-
co mediatizado. No hace falta recurrir a un momento mtico en
TXHDOWRPDUFRQWDFWRFRQODVVXSHUFLHVPHGLiWLFDVPHGLDQWH
la lectura del diario, la escucha de la radio, la expectacin de la
televisin o navegando en internet, se enciende en nosotros la
conciencia de estar ingresando a un mundo comn. Lo que nos
DOFDQ]D HV OD HYLGHQFLD GH TXH HQ HVDV VXSHUFLHV VH GHVSOLH-
ga el tejido semitico de la vida colectiva y que ese despliegue
no es un espectculo dispuesto para el individuo. All estn los
cuerpos, las voces, los colectivos, las biografas, las estadsticas,
las fantasas, los tabes, los deseos, los pudores, las pasiones,
las humillaciones, las mentiras y las verdades. Y esto habr que
aceptarlo sin reparos positivistas: la meditica que no es la
economa, que no es la poltica- no remite a un mundo de simu-
lacros, sino a las condiciones de posibilidad de una experiencia
(Abraham, 2007).
=RQD\HVSDFLRQRHVIiFLOHYDGLUHOLPDJLQDULRWRSRJUiFR
Y de hecho, la meditica parece tener una relacin indirecta con
los territorios. Habermas (2005: 57), por caso, entiende que el
efecto primero de las tecnologas mediticas sobre el espacio es
una doble abstraccin: por un lado, al generalizar las estructu-
ras espaciales donde se suceden las interacciones interpersona-
les desconecta los problemas de los contextos vitales y concretos
GHODFRPXQLFDFLyQSRUHORWURHLQVWDXUDODJXUDLQDSUHQVL-
EOHGHXQS~EOLFRGHDQyQLPRV3HURWDPELpQSRGHPRVDFHSWDU
TXH ODV VXSHUFLHV PHGLiWLFDV VRQ OXJDUHV D ORV TXH VH HQWUD \
se sale, por donde circulan cuerpos, miradas, palabras, sonidos.

127

Las tecnologas mediticas6 han tenido por efecto histrico un


desenganche de lo pblico y las interacciones espaciales, pero
eso no ha llevado a una anulacin del estar-en-el-espacio sino a
un efecto de re-dimensin del espacio pblico al dotarlo de au-
tonoma temporal no limitada por la interaccin territorial. Eso
que denominamos desenganche tal vez se deje entender mejor si
se asume que la proliferacin de soportes tecnolgicos de comu-
nicacin autnomos respecto de los individuos (Vern, 2002:
130) ha multiplicado procesos descontextualizacin del sentido,
permitiendo modalidades de circulacin discursiva previamente
imposibles, y habilitando modos de existir de lo colectivo tales
como las comunidades imaginadas de las que habla Anderson.
Vale recordar, aqu, que el trabajo pionero de Habermas so-
bre la publicidad burguesa ([1962] 1990) tena como objeto un
complejo de relaciones sociales que estaban siendo condiciona-
das por el desarrollo de productos mediticos como los peridi-
cos y las revistas7. Y que el propio Kant ([1784] 2003) haba con-
cebido al uso pblico de la razn como aquel que hace alguien,
en calidad de docto, frente a su pblico de lectores. Es decir, el
primer efecto de la mediatizacin sobre el espacio pblico es el
de habilitar la concurrencia de personas ausentes a propsito
de temas que ya no conciernen slo al fuero individual. Se nos
objetar que la referencia a la sociedad del siglo XVIII es imper-
tinente, que no ofrece valor comparativo. Puede ser, pero no es-
tamos poniendo en juego la descripcin de una sociedad sino

6 Y no las instituciones de medios, que, desde el punto de vista de la evolucin histrica,


deben concebirse como un resultado contingente de esas tecnologas.
7 El propio Habermas probablemente renegara de esta evocacin en el contexto de un
escrito, como el nuestro, que prescinde del escarmiento normativo.Digamos entonces
que lo citamos a pesar de esa diferencia.

128

evocando la funcin primera de toda tecnologa meditica: vol-


ver probable lo improbable, recomponer los puntos de ruptura
de la comunicacin (Luhmann, 1998).
Decamos, entonces, que la mediatizacin del espacio pblico
introduce una ruptura en su ontologa o, para ser menos pre-
tenciosos, en sus lmites relativos.Tenemos, pues, dos modos de
ser del espacio pblico cuyo umbral es la meditica. La media-
WL]DFLyQTXHHVQDOPHQWHHOSURFHVRKLVWyULFRHQHOTXHVHYD
instituyendo la meditica- ha provocado un efecto de multipli-
cacin y expansin de los ngulos de visibilidad de lo colectivo
al romper con los lmites inmanentes del campo de experiencia
individual. Pero no slo eso. Las instituciones de medios produ-
FHQWDPELpQORS~EOLFRFRPRXQHQWRUQRDOTXHDWUDYpVGH
ellas, otros actores sociales buscan hacer circular sus discursos.
Esto instaura dos condiciones de produccin que es comn a to-
dos los discursos que se generan en los medios:la imprevisibili-
dad de los efectos (que replica, en la escala colectiva, la no linea-
lidad de la circulacin del sentido) y la exigencia consecuente de
poner en circulacin puntos de vista generalizables, sostenibles
pblicamente, que se enfrentan a la imposibilidad de controlar
el acceso a su discurso y deben lidiar, en cambio, con el fantasma
de un destinatario sin atributos individuales porque es siempre
colectivo.
Este efecto de base produce un desdoblamiento (y no un
reemplazo) de lo pblico, que por lo tanto no queda reducido a
su faz mediatizada. En el prlogo a ese libro cuyo ttulo corri
la mala suerte de convertirse en un slogan de la economa inte-
lectual en las ciencias de la comunicacin (Construir el aconte-
cimiento) Vern (1987) deca que hablar de actualidad con-
sista en pensar la produccin de la realidad como experiencia
colectiva (1987: 4). Esa propuesta implicaba dos discusiones.
Una lo decimos, ahora, sin pudores-refera a la ontologa de

129

la discursividad meditica. La actualidad, explicaba Vern -an-


ticipando bajo la forma de un enunciado terico la conclusin
de una investigacin emprica- no es un simulacro porque el
discurso que la construye no representa nada: no hay, en ningn
lado, una original8. Los medios no producen todo lo real. Pro-
ducen la realidad de una sociedad industrial en tanto realidad
en devenir, presente como experiencia colectiva para los acto-
res sociales9. La otra discusin tena que ver con la experiencia
de los lmites o, mejor dicho, de los umbrales entre el orden me-
GLDWL]DGR\HOQRPHGLDWL]DGRGHODH[SHULHQFLD'HVSXpVGHTXH
los medios los han producido, los acontecimientos sociales em-
piezan a tener mltiples existencias, fuera de los medios: se los
UHWRPDDOLQQLWRHQODSDODEUDGHORVDFWRUHVVRFLDOHVSDODEUD
que no es meditica. Es por eso que dicha realidad es nuestra
realidad, vale decir, inter-subjetiva (1987: 5).
Vern sostiene que la experiencia del devenir social en los
medios es una experiencia colectiva, autnoma respecto de la
experiencia subjetiva de cada actor social. Entre la experiencia
subjetiva (no mediatizada) y la actualidad (realidad mediatiza-
da) se abre una distancia insalvable, absoluta. Son, estrictamen-
te hablando, inconmensurables: no se puede medir un orden
de experiencia segn las exigencias existenciales del otro. Pero
aquella distancia no es una magnitud fsica. No seala el hiato
entre dos puntos en el espacio ni una suerte de lejana corporal.
Cargamos con los discursos que nos llegan o a los que accede-
mos por la meditica, los trasladamos con nosotros, los hace-

8 Luhmann (2000: 147) lo ha dicho en otros trminos: En verdad, los medios de masas
no tienen carta de exclusividad en relacin a la construccin de la realidad: toda comunicacin contribuye a la construccin de la realidad en la medida en que aporta u olvida.
9 Cursivas en el original.

130

mos circular en conversaciones y en pensamientos. La insercin


capilar y ubicua, y la circulacin fugaz y multidireccional de los
discursos mediatizados en la vida cotidiana impide trazar un l-
PLWHItVLFRFRPRVLVHGHOLPLWDUDQORVFRQQHVGHXQDSDUFHOD
de tierra.

Zona de intermediacin
5HH[LRQDQGRVREUHHOUROGHOSHULyGLFRFRPRYHKtFXORGHSX-
blicidad de textos literarios en el siglo XIX, Therenty y Vaillant
resaltan su diferencia con el rol del editor. Esa diferencia es su
carcter meditico.Notable sealamiento, que para nosotros
TXHGDLQFRUSRUDGRHQHOSODQRGHORREYLRGHTXpRWURPRGR
FRQFHELU OR HVSHFtFR GHO SHULyGLFR VLQR SRU VX FDUiFWHU PH-
GLiWLFR"/DFXHVWLyQFODURHVTXpHQWLHQGHQORVDXWRUHVSRUWDO
propiedad. Explican que el carcter meditico del peridico im-
plica que no sirve para transferir el discurso de la esfera privada
a la esfera pblica sino que est, desde el principio, situado en el
corazn del espacio pblico, funciona como un instrumento de
mediacin y de intermediacin entre las personas (2001: 11). El
peridico, as como la publicidad comercial, son dos de los nue-
vos discursos intermediarios del siglo XIX (Traversa, 2011). La
intermediacin no es el traslado de un mensaje. Es la articulacin
de las distancias por la puesta en circulacin de los discursos. En
retrospectiva, esto implica la emergencia de instituciones que ar-
ticulan la produccin y el reconocimiento de bienes (materiales
y simblicos) en sociedades que se industrializan y se urbanizan,
se vuelven crecientemente complejas y diferenciadas.
La intermediacin funciona en el plano del dispositivo tecno-
lgico y en el plano del discurso de la institucin meditica. Los
dispositivos de comunicacin son, en esencia, dispositivos de

131

FDPELR\UXSWXUDGHHVFDODWUDVODGDQORVyUGHQHVVLJQLFDQWHV
(las imgenes, el contacto, las palabras) al mbito inaprensible
de lo colectivo, los coloca por encima de los contextos de la se-
miosis interindividual (Vern, 2002: 132). Cuando Tocqueville,
hacia mitad del siglo XIX, deca que slo un diario puede poner
el mismo pensamiento, al mismo tiempo, entre miles de lecto-
res10, seguramente pensaba en la funcin de la prensa poltica
HQ(VWDGRV8QLGRVSHURWDPELpQHVWDEDGHQLHQGRODFDSDFLGDG
articulatoria del dispositivo de lo escrito impreso para reponer
OD]RVFRPXQLWDULRVSRUVREUHODVGLVWDQFLDVJHRJUiFDV
Pero el dispositivo no es la institucin. La mediatizacin es
XQ SURFHVR KLVWyULFR TXH VH GHVSOLHJD D WUDYpV GH OD LQVHUFLyQ
de las tecnologas de comunicacin en el tejido social, pero que
QR VH GHMD HQWHQGHU VyOR SRU HOODV 'HEH HQWHQGHUVH WDPELpQ
FRPRXQGREOHPRYLPLHQWRTXHQRHVKRPRJpQHRQLVLJXHORV
mismos ritmos en los distintos pases- por el cual las institucio-
nes mediticas adquieren autonoma, se despegan del sistema
poltico, el periodismo desarrolla una deontologa profesional,
gana un lugar de enunciacin;y, al mismo tiempo, de manera
correlativa, se constituye un mercado cultural, una industria
de medios y un sistema meditico. La intermediacin institu-
cional que gestiona discursivamente el periodismo es no solo la
articulacin espacio-temporal, sino la ocupacin de un lugar
de enunciacin y la produccin de estrategias discursivas para
gestionar los discursos (las opiniones, las quejas, los consejos)
de otros actores e instituciones.
Novedad histrica de la era de los medios que, como tal, de-
manda un contexto epistemolgico diverso de aquel que nutri

10 Citado en Pasley (2001: 4)

132

ODVUHH[LRQHVFOiVLFDVVREUHHOHVSDFLRS~EOLFRFRPRKRUL]RQWH
deseable. As lo entendi Ferry (1998: 19-20) cuando propuso
XQDUHGHQLFLyQVRFLROyJLFDGHOHVSDFLRS~EOLFRTXHQRVXHOH
ser asumida en toda su radicalidad:
El espacio pblico() es, en sentido lato, el marco
meditico gracias al cual el dispositivo institucional y
tecnolgico propio de las sociedades posindustriales es
capaz de presentar a un pblico los mltiples aspectos
de la vida social () Por meditico entiendo lo que me-
diatiza la comunicacin de las sociedades consigo mis-
mas y entre s () El pblico es, virtualmente, toda la
humanidad y, de modo correlativo, el espacio pblico
es el medio en el cual la humanidad se entrega a s misma
como espectculo.

/DUDGLFDOLGDGGHHVWDGHQLFLyQGHSHQGHFODURHVWiGHXQ
modo de leerla. Si ensayamos una interpretacin intransigente,
LQH[LEOHHOODVXJLHUHHOUHWRUQRDXQDVXHUWHGHgrado cero ana-
ltico del espacio pblico. Hablamos de grado cero en un sentido
histrico y conceptual. Histrico, porque hay que tomar la me-
diatizacin como un dato a partir del cualUHH[LRQDUVREUHHO
espacio pblico para evitar que el punto ciego del anlisis sea
eso que el propio Ferry llama nostalgia de un espacio pblico tal
como habra podido ser (1998:18). La imagen de un espacio p-
blico mediatizado no puede ser la de una esfera de intercambios
comunicativos sometida a una fuerza externa, la de los medios,
que la somete a una presin selectiva ajena a los intereses vitales
de los ciudadanos. Las tecnologas digitales, los dispositivos y
las aplicaciones mviles nos han permitido entenderlo: la me-
diatizacin opera como un conjunto de condiciones productivas
TXHFRPRWDOHVWDPELpQDIHFWDQODOyJLFDGHIXQFLRQDPLHQWRGH

133

las instituciones de medios. Consecuentemente, el grado cero


GHEHUiVHUWDPELpQFRQFHSWXDO\DTXHHVQHFHVDULRUHFRQVLGH-
rar los conceptos con los que se pretende estudiar y caracterizar
el complejo institucional de los medios (particularmente, ciertas
QRFLRQHV TXH KDQ JXLDGR OD LQYHVWLJDFLyQ LQXHQFLD PDQL-
pulacin, efectos, etc).
Pero no se trata de trocar una concepcin estilizada por otra:
la expansin meditica del espacio pblico, que comenz en el
siglo XIX y se profundiz a lo largo del siglo XX, no slo implic
la irrupcin de la racionalidad comercial, del entretenimiento
impregnando y diluyendo los lmites normativos con que ha-
ba sido concebido el espacio pblico clsico, con sus umbrales
morales intrnsecos y sus temas prioritarios. Consolid, al mis-
mo tiempo, el protagonismo del periodismo porque le abri un
espacio de representacin fctica del pblico. Como dice
Ferry (1998: 22), el recurso a esa norma de sustitucin que es
la opinin pblica en el sentido de los sondeos () reviste un
VLJQLFDGRVLVWHPiWLFROHJLWLPDGHPDQHUDHIHFWLYDFLHUWRSRGHU
poltico de la prensa, pues esta es la que, por excelencia, puede
representar en calidad de opinin pblica un aspecto de la
sociedad civil sociolgica y polticamente distinto del cuerpo
electoral. Si algn valor heurstico tiene hablar de los medios
en general, y del periodismo en particular, como una institu-
FLyQ SROtWLFD HV GHFLU VL HVH WpUPLQR HQ DOJR SXHGH D\XGDU D
comprender la insercin del periodismo en la vida social) es en
la medida en que tal y como lo hacen las instancias polticas
institucionales- apunta a una comunicacin privilegiada con un
pblico potencialmente interesado en los problemas de la vida
poltica.
Las instituciones mediticas, y el periodismo en particular,
mantienen un privilegio en la administracin de la dinmica
GH HVH HVSDFLR S~EOLFR PHGLDWL]DGR 2 DO PHQRV OR PDQWXYLH-

134

ron hasta ahora. Precisamente, es ese privilegio el que parece


estar en riesgo con la irrupcin y consolidacin de internet y de
las nuevas tecnologas y los nuevos medios interactivos que
introducen la posibilidad de discursos mediatizados pero que
pueden evadir la intermediacin de las instituciones de medios
para insertarse en la circulacin colectiva. El propio Ferry, con
notable lucidez prospectiva, sealaba en el artculo que estamos
glosando (que fue escrito, vale la pena recordarlo, en 1989) que
las tecnologas telemticas contenan un potencial renovador
ya que abran la perspectiva de un espacio en que la comuni-
cacin poltica es mediatizada, pero sin que por eso el pblico
deba estar representado, poniendo en crisis los fundamentos
(sociales, tecnolgicos) sobre los cuales el periodismo moderno
haba asentado su lugar de portavoz o de mediador de la opi-
nin pblica.

135

Bibliografa
Abraham, Toms (2003), La meditica, en El presente absolu-
to. Buenos Aires, Planeta, 2007.
Anderson, Benedict (1983), Comunidades Imaginadas0p[LFR
Fondo de Cultura Econmica, 2006.
Borges, Jorge Luis (1952), El pudor de la historia, en Otras
inquisiciones.%XHQRV$LUHV(PHFp\/D1DFLyQ
Chartier, Roger, Espacio pblico y opinin pblica, en Espacio
pblico, crtica y desacralizacin en el siglo XVIII. Barcelo-
na, Gedisa, 1995.
Darnton, Robert, El coloquio de los lectores. Ensayos sobre
autores, manuscritos, editores y lectores.0p[LFR'))&(
2003.
Dayan, Daniel, Televisin: le presque public, en Revista R-
seaux n 100- CENT/Herms Science Publication 2000.
Ferry, Jean-Marc (1989), Transformaciones en la publicidad
poltica, de J.-M. Ferry, D. Wolton et al., El nuevo espacio
pblico. Barcelona, Gedisa, 1998.
Goody, Jack y Watt, Ian, Las consecuencias de la cultura escri-
ta, en Goody, Jack (comp.) (1968), Cultura escrita en socie-
dades tradicionales. Barcelona, Gedisa, 2003.
Goody, Jack (1990), La lgica de la escritura y la organizacin
de la sociedad. Madrid, Alianza, 2005.
Habermas, Jrgen (1962), Historia y crtica de la opinin pbli-
ca. La transformacin estructural de la vida pblica. Barce-
lona, Gustavo Gil, 2006.
Habermas, Jrgen, Facticidad y validez. Sobre el derecho y el
Estado democrtico de derecho en trminos de teora del
discurso. Madrid. Trotta, 2005.
.DQW,PPDQXHO  5HVSXHVWDDODSUHJXQWDTXpHVODLOXV-
136

tracin?, en Filosofa de la historia-Qu es la ilustracin. La


Plata, Terramar, 2004.
Luhmann, Niklas (1984), Sistemas sociales. Lineamientos para
una teora general0p[LFR')$QWURSKRV
Luhmann, Niklas, La realidad de los medios de masas0p[LFR
DF, Antrophos, 2000.
2QJ:DOWHU  Oralidad y escritura.0p[LFR'))RQGR
de Cultura Econmica, 2006.
Pasley, Jeffrey, The thyranny of printers. Newspapers politics
in the early American Republic. Charlottesville y Londres,
University of Virginia Press, 2001.
7KpUHQW\0DULH(YH\9DLOODQW$ODLQLAn I de lre mediatique.
Analyse litteraire et historique de La Presse de Girardin. Pa-
rs, Nouveau Monde, 2001.
7UDYHUVD2VFDU&RPHQWDULRVDFHUFDGHODDSDULFLyQGHLa Pres-
se en revista Figuraciones, n 9, Buenos Aires, IUNA, 2011.
Vern, Eliseo, Construir el acontecimiento. Barcelona, Gedisa,
1987.
Vern, Eliseo, Conversacin sobre el futuro, en Espacios men-
tales. Barcelona, Gedisa, 2002.
Vern, Eliseo (1988), La semiosis social. Barcelona, Gedisa,
2004.
Vern, Eliseo, Los cuerpos efmeros, en Papeles en el tiempo.
Buenos Aires, Paids, 2011.
Wolton, Dominique, Internet, y despus?. B11arcelona, Gedisa,
2000.

137

CAPTULO VI

Primeras aproximaciones
a la esfera pblica virtual

Por Mariano Vzquez

El objetivo de este trabajo es delinear las caractersticas -y


una lectura aproximativa- sobre un modelo analtico que se de-
nomina esfera pblica virtual y que, desde nuestra perspectiva,
puede ser atenazado a partir la puesta en tensin de: una revi-
sin crtica de la teora de la esfera pblica, una perspectiva de
las denominadas nuevas tecnologas como un artefacto cultural
y el rol de la interactividad virtual.
En primer lugar, el concepto de esfera pblica se ha revestido
de una amplia popularidad en los estudios en comunicacin y
poltica, razn por la cual creemos que es fundamental revisar la
KLVWRULFLGDGGHOFRQFHSWRHQWpUPLQRVJHQHDOyJLFRVSDUDSRGHU
determinar y apreciar su potencial analtico. A su vez, para de-
tectar aplicaciones instrumentales y opacidades ideolgicas que
HYLGHQFLDQORVXVRVGHHVWHWpUPLQRDFXxDGRKDFHPiVGHPHGLR
siglo. Es en este sentido que se indagar en las construcciones
tericas de Jrgen Habermas y de Hannah Arendt y las crticas
en manos de autores como John B. Thompson y John Keane en-
tre otros.

138

A continuacin, se reconoce la masividad de las llamadas


Tecnologas de la Informacin y la Comunicacin (TIC) y las
derivaciones tericas que han buscado explicar este fenmeno,
entre la cuales se ha manifestado una gran divisoria de aguas
entre quienes tienen una mirada utpica sobre el desarrollo de
la sociedad de la informacin y aquellos que, con marcadas ob-
jeciones, descreen del gran futuro que se predice para y por las
QXHYDVWHFQRORJtDV/DSHUVSHFWLYDTXHVHFRQVWUX\HGHVGHODH-
xibilidad artefactual intenta desandar ese camino.
Al mismo tiempo se buscar desentraar los imaginarios tec-
nolgicos que abonan conceptos como sociedad de la informa-
cin, sociedad red y ver cmo se materializan en el espacio social
de la esfera pblica virtual. No obstante, es vlido aclarar que la
perspectiva que subyace a este trabajo comprende a las tecnolo-
gas como una forma cultural; en otras palabras, la vinculacin
de las TIC con la esfera pblica es abordada sin detenerse en
XQDPHUDFXHVWLyQGHWpFQLFDGRQGHODOHFWXUDGHORVPHGLRV\
la tecnologa est reducida a la de simples instrumentos neutra-
les, sino donde se entiende que la cultura atraviesa la dimensin
constitutiva de las prcticas sociales. Es decir que, Internet en
particular y las TIC en general, no son pensadas como instru-
mentos neutrales, ahistricos y aplicados a la transformacin de
la naturaleza; sino que son concebidos como parte de un proce-
so de transformacin social que involucra, en mayor o menor
medida, un desarrollo tecnolgico dnde son las condiciones
histrico-sociales en las que se desenvuelve las que otorgan un
sentido particular y distintivo1.

La comunicacin y el desarrollo manifiestan una vinculacin que es heredera de la


idea moderna que asociaba tcnica y progreso. El desarrollo recupera las nociones de
1

139

Por ltimo, el concepto de interactividad virtual es tomado de


Alejandro Rost quien en su tesis doctoral revisa el modelo tridi-
co construido por John B. Thompson y adiciona una cuarta for-
ma, denominada interactividad virtual y que se constituye en una
herramienta til para el abordaje de las interacciones en Internet
y especialmente, en la esfera pblica virtual.

Esfera pblica virtual


Con la intencin de esbozar que entendemos por esfera pblica
YLUWXDOUHFXSHUDPRVODGHQLFLyQGH-RKQ.HDQHHQODTXHXQD
esfera pblica es un tipo particular de relacin espacial entre dos
o ms personas, por lo general vinculadas por algn medio de co-
PXQLFDFLyQ WHOHYLVLyQUDGLRVDWpOLWHID[WHOpIRQRHWF \HQWUH
las cuales se suscitan disputas no violentas, durante un periodo de
tiempo breve o ms prolongado, en torno a las relaciones de poder
que operan dentro de su determinado medio de interaccin y/o
dentro de los ms amplios mbitos de las estructuras sociales y po-
lticas en los que se encuentran los adversarios (Keane, 1997: 58).
Asimismo, indagar sobre el concepto de esfera pblica respon-
GHDFDVRDXQLQWHUpVTXHXQHHOFDPSRGHODFRPXQLFDFLyQFRQ
el de la poltica y en este sentido se vuelve necesario historizar
el concepto de esfera pblica, debido a que ha llegado a formar
una parte tan intrnseca de su vocabulario que, por lo general, la

avance y optimismo en la tecnologa, pero en una dimensin ms pragmtica, referida


a polticas econmicas. El paradigma de la comunicacin sustituye al del progreso
(Cabrera, 2006: 139), en donde la comunicacin es el contenido de la nueva utopa, su
forma es la tecnologa e Internet su forma ms acabada.

140

JHQHDORJtDGHOWpUPLQRVXHOHSDVDUVHSRUDOWR  5HVXOWDLPSUHV-


cindible recordar esta genealoga, pues comprender la historia de
dichos conceptos nos permite apreciar ms profundamente sus
P~OWLSOHV VLJQLFDGRV VX XWLOLGDG HPStULFD \ VX SRWHQFLDO QRU-
mativo, as como las trampas polticas en las que se puede caer
DOHPSOHDUWpUPLQRVDFXxDGRVHQORVLQLFLRVGHODHUDPRGHUQD
FRPRHOGHODHVIHUDS~EOLFDHQHOWDQGLIHUHQWHFRQWH[WRGHQD-
les del siglo XX (Keane, 1997: 47). De este modo, volver sobre las
formulaciones que tanto Hannah Arendt como Jrgen Habermas
realizaron sobre la esfera pblica abre el juego para una historiza-
cin de los conceptos y una puesta en relacin para ver la forma
en que, en la actualidad, mantienen su validez como herramientas
analticas.
En La condicin humana, Arendt muestra que la distincin
entre pblico y privado, no es un rasgo excluyente de las socieda-
des modernas y que ya estaba presente en el pensamiento griego
antiguo. Para los griegos, la capacidad de organizacin poltica
era distinta y opuesta al tipo de asociacin natural centrado en
el hogar y en la familia. As, los ciudadanos -excluidos mujeres y
esclavos- pertenecan a dos rdenes de existencia: la vida propia
y la vida de lo comn. Lo pblico remita a la polis, a aquello
que poda ver y or todo el mundo y, por ende, se constitua en
la realidad: La presencia de otros que ven lo que vemos y oyen
lo que omos nos asegura de la realidad del mundo y de nosotros
PLVPRV $UHQGW    \ SDUDOHODPHQWH UHHUH DO
propio mundo, en cuanto es comn a todos nosotros y diferen-
FLDGRGHQXHVWUROXJDUSRVHtGRSULYDGDPHQWHHQpO  
En contrapartida, la esfera privada se replegaba al mbito de lo
GRPpVWLFRGHODIDPLOLD\FRQVWLWXtDHOHVSDFLRGRQGHORVVHUHV
humanos vivan juntos llevados por sus deseos.
Esta divisin se ve obliterada, para Arendt, por lo que llama
el auge de lo social, es decir, el fenmeno por el cual muchas de

141

ODVDFWLYLGDGHVTXHDOJXQDYH]VHUHDOL]DURQHQORVFRQQHVGHOD
casa y la familia son hechas ms all del hogar por grupos socia-
les que crecen y que ocupan progresivamente el espacio social.
El perjuicio del auge de lo social reside en no haber permitido el
establecimiento de un espacio para el tipo de acto y discurso que
los antiguos griegos haban considerado constitutivo de la esfera
S~EOLFD (Q HVWH PDUFR OD GLFXOWDG TXH SUHVHQWD OD VRFLHGDG
GHPDVDVQRHVVXQ~PHURVLQRODSpUGLGDGHSRGHUGHOPXQGR
para agruparlas y relacionarlas.
Esta breve exposicin de algunos de los puntos desarrolla-
dos en La condicin humana recupera slo un elemento ms;
$UHQGWQRVHGHWLHQHDUHH[LRQDUVREUHHOUROTXHORVPHGLRVGH
comunicacin masivos y en particular la prensa escrita ejercie-
ron en la opinin pblica. En ese sentido, podemos arriesgar que
Jrgen Habermas, en Historia y crtica de la opinin pblica,
WUDWDGHOOHQDUHVDODJXQD 7KRPSVRQ DXQTXHDWUDYpVGH
un camino distinto.
Un recorrido sucinto por Historia y crtica de la opinin p-
blicaQRVSHUPLWHLGHQWLFDUWUHVPRPHQWRVHQODIRUPDFLyQGH
la esfera pblica. En principio, el autor retrocede hasta la anti-
gua Grecia -al igual que Arendt- para, en las ciudades estado,
distinguir entre lo pblico y lo privado, siendo el primero un es-
pacio constituido en el gora donde los ciudadanos -en calidad
GHLJXDOHVGLVFXWtDQDTXHOORGHLQWHUpVFRP~Q(QFRQWUDSDUWL-
da, el mbito privado corresponda al oikos, donde se desplega-
ba la economa familiar.
En cambio, en la Edad Media Habermas no encuentra que
haya una esfera pblica diferenciada, la publicidad era un atri-
buto exclusivo de seores feudales y reyes que alcanz su mxi-
ma expresin en la vida cortesana de los siglos XV y XVI. No
obstante, esto comienza a cambiar con el desarrollo del capita-
lismo mercantil en el siglo XVI donde el objetivo de la esfera

142

pblica burguesa de la sociedad civil europea -en formacin- era


el de contrarrestar las prcticas secretas del Estado y limitar el
poder del soberano absolutista. Esta esfera pblica burguesa se
eriga en un espacio intermedio entre la autoridad pblica -el Es-
tado- y el mbito privado. Este espacio estaba conformado por
individuos reunidos para debatir respecto de los temas clave.
Era la esfera del lenguaje y el discurso, de la argumentacin y
la confrontacin, una esfera en la cual los individuos podan ex-
SUHVDUVXVSXQWRVGHYLVWDGHVDDUORVGHORVGHPiVHLPSXJQDU
el ejercicio del Estado. Se trataba, como dice Habermas, del uso
pblico de la razn por parte de individuos interesados en abrir
el debate y la discusin (Thompson, 2011: 17). En este sentido
Habermas escribe: El pouvoir como tal es puesto a debate por
una publicidad polticamente activa. Ese debate est encarga-
do de reconducir la voluntas a ratio, ratio que se elabora en
la concurrencia pblica de argumentos privados en calidad
de consenso acerca de lo prcticamente necesario en el inters
universal (Habermas, 2009:118).
Para Habermas, el surgimiento de la esfera pblica burguesa
fue posible en Inglaterra por la proliferacin de peridicos cr-
WLFRV \ OD DSDULFLyQ GH FDIpV OLWHUDULRV \ FHQWURV GH GHEDWH /D
prensa peridica, de este modo, devino un elemento clave en
lo que hace al surgimiento de una esfera pblica (Thompson,
1996: 83). Pero este espacio entr en un rpido declive debido
al incremento del intervencionismo del Estado y el devenir de
los medios de comunicacin en empresas, lo que transform el
espacio de debate racional-crtico en una esfera ms de consumo
cultural, donde las opiniones eran matizadas por los intereses
econmicos de los medios masivos de comunicacin. Este pro-
ceso, nominado refeudalizacin de la esfera pblica, evidenci
la transformacin de la poltica en un espectculo que exclua a
la poblacin de la cuestin poltica.

143

Hasta aqu una ajustada sntesis del modelo habermasiano, la


cual no puede concebirse sin un conjunto de crticas que apuntan
DVXJpQHVLV\IXQFLRQDPLHQWR(QWUHHOODVVHSXHGHQGHVWDFDUOD
exclusin de los movimientos sociales y populares; la reclusin
GHODVPXMHUHVDOiPELWRGRPpVWLFR 5HWDPR]R ODGHFD-
dencia de la esfera a causa de la pasividad de los espectadores y el
menosprecio por el impacto que los medios masivos de comuni-
cacin tuvieron en el mundo moderno (Thompson, 1998). Con el
mismo tono, Thompson resalta que ...no llegaremos a una com-
prensin satisfactoria de la naturaleza de la vida pblica en el
mundo moderno si permanecemos aferrados a una concepcin de
la publicidad (publicness) de carcter esencialmente dialgico y
que nos fuerce a interpretar el papel creciente de la comunicacin
mediada como una especie de cada histrica en desgracia. Debe-
ramos, por contra, reconocer desde el principio que el desarrollo
de los medios de comunicacin -empezando por la prensa, pero
incluyendo las ms reciente formas de comunicacin electrni-
ca- ha creado una nueva clase de publicidad (publicness) que no
puede ser adaptada al modelo tradicional. Con el desarrollo de
los medios de comunicacin, el fenmeno de la publicidad se ha
desvinculado del hecho de la participacin en un espacio comn.
Se ha des-espacializado y ha devenido no-dialgica, a la vez que
VH KD YLQFXODGR FUHFLHQWHPHQWH D OD FODVH HVSHFtFD GH YLVLELOL-
dad producida por los medios de comunicacin (especialmente
ODWHOHYLVLyQ \IDFWLEOHDWUDYpVGHHOORV 7KRPSVRQ 
Esta mutacin descrita por el autor, es objeto desde nuestra
perspectiva de un nuevo desplazamiento que, con la utilizacin
de las TIC, da lugar a una nueva instancia dialgica desespacia-
lizada mediada por las interfaces de la Web 2.0. Interaccin que
ampliaremos siguiendo a Rost con la interactividad virtual.
Por su parte John Keane crtica la limitacin que vincula a la
esfera pblica con la esfera estatal; aunque en principio se con-

144

solid en lucha contra los estados despticos esto est cambian-


do en la actualidad. Hoy da se ha vuelto obsoleto el ideal de una
HVIHUD S~EOLFD XQLFDGD   (Q OXJDU GH HOOR JXUDWLYDPHQWH
hablando la vida pblica experimenta una refeudalizacin no
HQHOVHQWLGRHQTXH+DEHUPDVXWLOL]yHVWHWpUPLQRHQVXHisto-
ria y crtica de la opinin pblica, sino en el de la conformacin
de un complejo mosaico de esferas pblicas de diversos tamaos
que se traslapan e interconectan... (Keane, 2004: 57). As, el
DXWRULQJOpVGHVFULEHPLFURPDFUR\PHVRHVIHUDVTXHUHYHODQOD
LPSRVLELOLGDGGHSHQVDUXQDHVIHUDS~EOLFDXQLFDGDGyQGHHO
PRVDLFR GH HVIHUDV VH SUHVHQWD FRPR XQ FDPSR KHWHURJpQHR
HQHOFXDOVHFRQVROLGDQSHTXHxRVDUFKLSLpODJRVGHHVIHUDVTXH
pueden agruparse en base a las estructuras sociales y los actores
que se involucran. En este punto es importante recuperar la di-
PHQVLyQFRQLFWLYDTXHHQQXHVWUDSHUVSHFWLYDHVWUXFWXUDOD
esfera pblica virtual. El disenso escribe Arditi, es una manera
de simbolizar lo comn, con la salvedad de que consiste en un
comn litigioso instituido por la parte de los que no tienen parte,
es decir, por la parte que ha sido empujada hacia la inexistencia
o por lo menos ha sido relegada al lugar de quienes, para el buen
orden imperante, realmente no cuentan (Arditi, 2011:57).

La informacin, el desacuerdo y la mercanca


en la esfera pblica virtual
Las noticias en la modernidad, en tanto productos simbli-
cos, son bienes de consumo que se compran y se venden en el
mercado (Thompson, 1998). Desde nuestra perspectiva y como
una de las premisas sobre las que se concibe a la esfera pbli-
ca virtual, este patrn de ordenamiento sigue vigente en el siglo
XXI y, an sin dejar de reconocer esta racionalidad econmica

145

y el valor de verdad que, en mayor o menor medida detentan


los medios masivos, en la esfera pblica virtual se hace presente
una nueva lgica de circulacin, transferencia y difusin para
las noticias. En otras palabras, creemos que la hegemona de la
QRWLFLDHQWDQWRTXHPHUFDQFtDFX\DQDOLGDGHVODJHQHUDFLyQ
de un valor de cambio2 comienza a ceder frente una nueva lgica
donde se genera un creciente valor de uso de las noticias.
En este punto es til una aclaracin, acaso un tanto evidente,
pero no por eso menos necesaria; s bien se considera que todas
las noticias pueden ser vistas como informacin, no toda la in-
formacin es noticia. Esto es vlido cuando, en el marco de la
HVIHUDS~EOLFDYLUWXDOWDPELpQHOVLVWHPDGHYDORUGHFDPELRTXH
mercantiliza a la informacin se enfrenta a otro orden donde el
valor de uso pone en jaque a la mercantilizacin informativa.
La informacin es un acontecimiento que reduce la incerti-
dumbre del entorno, es actual, concreto y singular (Rodrguez
Giralt, 2005: 277), en este marco se piensa a la informacin
como un valor que enriquece la polifona de voces de la demo-
FUDFLD \ SURPXHYH XQ UHQRYDGR LQWHUpV SRU OR FRP~Q (Q XQ
sentido acorde, el Programa de Investigacin sobre la Sociedad
de la Informacin del Instituto de Investigaciones Gino Ger-
PDQL )62&8%$ HQVXOLEURInternet y lucha polticaDUPD
que Internet es un nuevo campo para la lucha de las redes de
movimientos sociales mundiales. Representa otro mbito desde
donde dar batalla y proponer un espacio contrahegemnico. Un

Se sabe que en el universo de las relaciones sociales productoras de mercancas,


cuya finalidad bsica es la creacin de valores de cambio, el valor de uso de las cosas
es minimizado, reducido, subsumido a su valor de cambio. Se mantiene solamente en
cuanto condicin necesaria, para la integracin en el proceso de valorizacin del capital,
del sistema productor de mercancas (Antunes, 2003: 73).
2

146

lugar desde donde quebrar el bloqueo informativo y distorsio-


nante de los grandes medios de comunicacin... (Lago Mart-
nez, Marotias, Movia, 2006: 64).
En este contexto no pensamos a la esfera pblica virtual slo
como un canal alternativo a los medios masivos, sino como un
HVSDFLRGHGLVSXWDSROtWLFDXQDDUHQDGHOXFKDGyQGHWDPELpQ
los medios masivos van a sumergirse para seguir disputando la
construccin de los acontecimientos, el posicionamiento de las
JXUDVSROtWLFDV\QXHYRVQLFKRVSDUDODREWHQFLyQGHUHQWDELOL-
dad. Por aadidura, la informacin presente en la esfera pblica
y las prcticas materializadas en ella no pueden escindirse del
mundo real porque el espacio en el que ocurren las interaccio-
nes virtuales se produce socialmente y, a la vez, se nutre de una
WHFQRORJtDFX\DEDVHWDPELpQHVVRFLDO +LQH $VtHO
ciberespacio constituye slo uno de los campos de accin, pues
ORVJUXSRVDUWLFXODQpVWHHVFHQDULRYLUWXDO\XQWHUULWRULRJHRJUi-
FR HOEDUULRODFLXGDGODUHJLyQ \FRQHOORODDFFLyQGLUHFWD
el piquete, la ocupacin, los festivales, las muestras, las mar-
chas, los actos polticos, etc. (Martnez Lago, 2012:130). Una
FRQFOXVLyQTXHHPSLH]DDYLVOXPEUDUVHQRVSHUPLWHDUPDUTXH
aquello que se discuti, comunic y difundi en la esfera pblica
YLUWXDOSXHGHWHQHUVXVUpSOLFDVIXHUDGHODYLUWXDOLGDG\GHHVWH
modo empezar a pensar a las prcticas en la red como una ins-
tancia ms de lo social.
Reconocer a la esfera pblica virtual como una arena de lu-
FKDSROtWLFDLPSOLFDDVXPLUODLQHYLWDELOLGDGGHOFRQLFWRFRPR
estructurante de la esfera pblica virtual que, en este punto, se
GLVWDQFLDGHODFRQFHSFLyQKDEHUPDVLDQDHQODTXHHOFRQLFWR
es morigerado en una instancia dialgica consensual y racional
que niega las pasiones polticas. A decir de Chantal Mouffe, este
paradigma liberal deliberativo aspira a crear un vnculo entre la
moralidad y la poltica. Sus defensores (...) presentan el debate

147

SROtWLFRFRPRXQFDPSRHVSHFtFRGHDSOLFDFLyQGHODPRUDOLGDG
y piensan un consenso moral racional mediante la libre discu-
sin (Mouffe, 2007:20).
A su vez, se rechaza la idea de una esfera pblica nica (Kea-
ne, 1997), ordenada bajo las premisas de una interaccin equita-
WLYD\UDFLRQDO\VHUHFRQRFHDOFRQLFWRFRPRXQRGHORVHOHPHQ-
WRVFRQVWLWXWLYRVGHODHVIHUDS~EOLFDYLUWXDO8QFRQLFWRTXHVH
materializa en la confrontacin, en el desacuerdo, en el disenso
\PDQLHVWDHQHOLQWHUpVSRUORFRP~QODVGLVSXWDVTXHDWDxHQ
a lo pblico.

Artefacto cultural
8QDHOLSVLVFLQHPDWRJUiFDTXHDEDUFDXQRVFXDWURPLOORQHV
de aos, puede servir como ndice de aquello que entendemos
por artefacto. En un desierto rido, cerca de unas rocas, puede
verse a unos homnidos y en particular a uno de ellos revolver los
huesos de un animal muerto. Nada hubiera cambiado si no fuera
porque el homnido toma un hueso de entre tantos y con timi-
dez comienza a blandirlo cada vez con ms fuerza, forjando una
herramienta en el mismo momento que la usa. Desde entonces
y hasta las actuales Tecnologas de la Informacin y la Comuni-
cacin, es mucho lo que las sociedades y las tecnologas han ido
mutando, cambiando, interrelacionndose; sin embargo, lo que
se busca mostrar con la deriva flmica es la forma en que la so-
ciedad y las tecnologas no pueden pensarse por separado: Por-
TXHODVVRFLHGDGHVHVWiQWHFQROyJLFDPHQWHFRQJXUDGDVH[DFWD-
mente en el mismo momento y nivel en que las tecnologas son
socialmente construidas y puestas en uso. Todas las tecnologas
son sociales. Todas las tecnologas son humanas (por ms inhu-
manas que a veces parezcan) (Thomas; Busch, 2011: 10).

148

Raymond Williams (2011) considera que las tecnologas pue-


den ser comprendidas como formas culturales, las cuales tienen
un origen que se radica en una serie de preocupaciones parti-
culares y dnde los usos se han materializado y estabilizado so-
cialmente, se dieron en respuesta a esas mismas preocupaciones
particulares, pero que en la actualidad se presentan como obvias
y naturales.
Una vez dicho esto podemos empezar a pensar que el senti-
do de las nuevas tecnologas se encuentra bajo una permanente
disputa acerca de cul debe ser su funcin legtima, donde la
cristalizacin de determinados usos y representaciones particu-
lares es el resultado de la tensin entre diferentes sectores so-
ciales. Al no restringir los usos a las meras potencialidades de
las TIC y las representaciones a las construcciones ideolgicas
dominantes, la dimensin prctica de estas tecnologas adquie-
re una complejidad que no puede ser explicada a priori por las
caractersticas intrnsecas de los objetos, ni por los determinan-
tes sociales donde son utilizadas.
Pareciera tajante la divisoria que se traza entre los mundos
online y RILQHy son muchos los ensayos que abordan el anli-
sis de uno u otro. Nosotros creemos que fruto de la imbricacin
social de esas instancias, emerge un espacio de indetermina-
cin que debe ser atendido en su complejidad para no sesgar
su estudio. Con este propsito, retomamos la doble perspecti-
va planteada por Christine Hine, en la que Internet es pensada
tanto un artefacto cultural como una cultura. Como artefacto
cultural UHSDUDHQTXHODSHUFHSFLyQODSRVLELOLGDGGHp[L-
to y los usos a que son sometidos estas formas comunicativas,
que dependen mucho ms del contexto en que se aplican, que
de sus rasgos y utilidades supuestamente inherentes como me-
dios (Hine, 2004: 40). Paralelamente, concibe a Internet como
una cultura GRQGH ORV VLJQLFDGRV \ ODV SHUFHSFLRQHV TXH

149

aportan quienes participan en ella pueden adquirir forma segn


los entornos desde los que provienen, as como de las expec-
tativas que puedan tener (Hine, 2004:53). Sobre esto ltimo
puede decirse que el estudio de la cultura digital no se agota
en el ciberespacio (cultura online) sino que se agrega la hiper-
textualidad entre los distintos medios de comunicacin social e
industrias culturales (radio, cine, televisin, etc.) y los procesos
de interaccin social en el contexto cultural ms amplio (Mar-
tnez Lago, 2012:123).
A partir de esta dualidad podemos suponer que los mundos
online yRILQH est conectados de maneras complejas, ms all
GHODLQVWDQFLDPDTXtQLFD\SRUHQGHDUPDUTXHHOHVSDFLRGRQ-
de ocurren las interacciones virtuales se produce socialmente y,
DODYH]VHQXWUHGHXQDWHFQRORJtDFX\DEDVHWDPELpQHVVRFLDO
(Hine, 2004:53). Sin embargo, entre ambas dimensiones anal-
ticas, se abre un espacio indeterminado, el cual no es una distin-
cin lisa y llana entre lo real y lo virtual, sino un replanteamiento
de la distincin que permite explorar ambos aspectos e indagar
en las conexiones entre ellos. En otras palabras, rechazamos una
observacin fragmentada de Internet que la conciba como cul-
tura o artefacto cultural y que desemboque en la separacin del
entorno virtual del fsico y que termine perdiendo de vista el es-
pacio de la conexin.
8QDGHODVSULQFLSDOHVGLFXOWDGHVTXHSUHVHQWDQODVQXHYDV
tecnologas y los espacios de participacin virtual reside en la
indeterminacin que se extiende entre las dimensiones esboza-
das en la dualidad RILQHRQOLQHFrente a esto, Rosala Wino-
cur propone que la operacin fsica y emocional de conectarse
no se da en la mquina sino en el sujeto; esto no niega la me-
GLDFLyQ GHO VRSRUWH WHFQROyJLFR VLQR TXH KDFH KLQFDSLp HQ HO
lugar donde esta mediacin adquiere realidad y sentido para el
VXMHWR TXH QR HV HQ HO DUWHIDFWR WRWpPLFR GH OD FRPSXWDGRUD

150

sino en el ritual cotidiano que recrea su carcter fundacional


(Winocur, 2011:171).
En este sentido, el espacio donde se despliegan las prcticas
evidencia un terreno difuso dnde se entrecruzan las circuns-
tancias en que Internet se emplea -RILQH- y los espacios sociales
TXH HPHUJHQ GH VX XVR RQOLQH &RPR DUPD &KULVWLQH +LQH
Internet puede ser representada como una instancia de mlti-
ples rdenes espaciales y temporales que cruzan una y otra vez
ODIURQWHUDHQWUHORRQOLQH\ORRILQH  
(QHVWHVHQWLGRLQFRUSRUDPRVHOFRQFHSWRGHH[LELOLGDGDU-
tefactual porque revela la amplitud interpretativa en la que di-
versos grupos -sobre todos los dominantes- pueden imponer un
XVR \ XQD UHSUHVHQWDFLyQ LQFOXVR DO SXQWR GH DUPDU QR VLQ
correr riesgos- que cada persona las ve y usa de una forma par-
ticular y por ende que sus intervenciones, tanto en aspectos l-
dicos, laborales o informativos se materializarn con distintas
intensidades. Sin embargo, y a riesgo de ser contradictorio, no
se puede negar la existencia de condicionantes sociales y estruc-
turales que inciden en las prcticas y las representaciones que se
tienen sobre las tecnologas. Precisamente, aprender la lgica
GH XQ VRIWZDUH R LQWHUSUHWDU HO IXQFLRQDPLHQWR GH XQ WHOpIRQR
mvil con decenas de funciones obliga al usuario a amoldarse
a la interfaz y aclimatarse a un entorno de interaccin. Estos
procesos de adaptacin tecnolgica se han naturalizado de tal
manera que se han vuelto imperceptibles. En otras palabras, el
HQWRUQRFLEHUQpWLFRWHUPLQDSRUFRQVWUXLUXQGLVSRVLWLYRLGHROy-
gico que engulle a su usuario (Scolari, 2008:98).

151

Interactividad virtual
Como se trat de explicar en el apartado anterior, pensar el
abordaje de Internet en general y de la esfera pblica virtual en
SDUWLFXODUSXHGHSUHVHQWDUQRSRFDVGLFXOWDGHV(QWRQFHVSDUD
atender a la dimensin dual de Internet nos parece vlida la me-
tfora de la tecnologa como texto, es decir, abordarla como una
cultura conformada discursivamente o como un artefacto cul-
tural que puede ser abordado discursivamente. Sumado a esto
podemos agregar que como las interacciones entre los sujetos ya
no se dan cara a cara sino que estn mediadas por redes inter-
IDFHV\ODVFRPXQLFDFLRQHVVHPDWHULDOL]DQDWUDYpVGHSDTXHWHV
digitalizados que pueden leerse como textos (imgenes, videos,
audios, textos), la importancia reside tanto en los textos como
en las interacciones, al punto de pensarlas como dos caras de
XQDPLVPDPRQHGD6LJXLHQGRD+LQHSRGHPRVDUPDUTXHHO
uso de Internet se reduce concretamente a un proceso de leer y
escribir (Hine, 2004: 64).
En el marco de un primer y tentativo desarrollo de la esfera
pblica virtual el modelo propuesto por John B. Thompson im-
porta una amplia utilidad analtica, razn por la cual se vuelve
necesario presentarlo de manera escueta para poder proceder a
explicar la interactividad virtual.
Thompson presenta cuatro variables que caracterizan dis-
tintos tipos de interaccin: la constitucin espacio-temporal; el
alcance de las seales simblicas; la orientacin a la accin y la
GLQiPLFDPRQROyJLFDGLDOyJLFD(QHVWHPDUFRGHQHWUHVWLSRV
de interaccin entre los individuos y los grupos: la interaccin
cara a cara, la interaccin meditica y la cuasi interaccin me-
ditica. En la interaccin cara a cara se comparte una misma
referencia espacio-temporal, lo que permite una multiplicidad
de seales simblicas; la accin est orientada hacia el/los otros

152

inscripto en una matriz dialgica donde el papel de emisor y


UHFHSWRU QR HVWi MR (Q OD interaccin meditica, hay una
HYLGHQWHVHSDUDFLyQGHFRQWH[WRVGRQGHHOXVRGHPHGLRVWpFQL-
cos es fundamental porque permiten transmitir informacin o
contenido simblico a individuos que estn en lugares distantes,
alejados en el tiempo o ambos casos (Thompson, 1998: 117).
Esta separacin reduce el campo simblico de seales, aunque
la comunicacin sigue orientada hacia los otros manteniendo
ODPDWUL]GLDOyJLFD ODV FDUWDVHO WHOpIRQR  3RU~OWLPRSDUDOD
transmisin simblica llevada a cabo por los medios masivos
de comunicacin, Thompson presenta la cuasi interaccin
meditica, que se desarrolla en una separacin de contextos
espacio-temporales con una mayor reduccin de las seales sim-
EyOLFDVRULHQWDGDKDFLDXQQ~PHURLQGHQLGRGHUHFHSWRUHVSR-
tenciales y con un carcter monolgico.
La tipologa esbozada por Thompson brinda las herramien-
tas para abordar una forma de interaccin que no se reduce -en
HOFDVRGHODV7,&DODHVIHUDWpFQLFD\TXHVHGHVSOLHJDHQGRV
dimensiones (Rost, 2006). Estas dos dimensiones remiten a las
interacciones del individuo con los contenidos -la mquina o el
sistema-, denominada interactividad selectiva, y una interac-
cin dialgica interpersonal o entre grupos, llamada interacti-
vidad comunicativa. La primera modalidad posibilita el acceso,
JHVWLyQ\GLVWULEXFLyQGHODLQIRUPDFLyQDWUDYpVGHQXHYDVHV-
tructuras textuales dispuestas en forma multilineal, en las que el
OHFWRUYDGHQLHQGRORVFDPLQRVGHVXOHFWXUDHQHVWHGLiORJRFRQ
la mquina (hipertextualidad) (Rost, 2006: 200), esto permite
que el lector pregunte y el sistema responda. La segunda moda-
lidad presenta una dimensin mucho ms compleja debido a su
carcter dialgico, donde diversos individuos -o grupos- entran
en contacto en las llamadas comunidades virtuales, las cuales
son pensadas como espacios de produccin simblica colectiva.

153

En este caso slo puede agregarse la posibilidad que tienen los


usuarios de reorganizar los contenidos y ponerlos a disposicin
de otros lectores. As, en plataformas como Twitter y Facebook,
periodistas y usuarios no profesionales vuelven a jerarquizar
muchos de aquellos contenidos a los que tuvieron acceso y los
publican para sus seguidores y contactos. Es decir, generan nue-
vos contenidos.
Esta cuarta forma de interaccin entre individuos, entre gru-
pos y de los individuos con los contenidos, es denominada por
Rost como interactividad virtual y remite directamente al
concepto de lector interactivo, a ese receptor que puede inte-
ractuar ya sea con los contenidos o con otros individuos (Rost,
2006: 199). Concepto que abre una brecha sobre la dinmica
participativa que posibilitan las TIC, tanto individual como co-
lectiva, pblica o privada, y que se ve alterada por tiempos mu-
FKRVPiVFRUWRVKHUUDPLHQWDVPiVDPLJDEOHVPD\RUH[LELOL-
dad para sortear las barreras espaciales y unas estructuras de
costos mucho ms bajas. De manera predominante, en la esfera
pblica virtual se materializa una interactividad con dimensin
pblica donde el lector es productor de contenidos que adquie-
ren relevancia pblica (Rost, 2001:121) porque -y esta otra de
las premisas sobre las que se erige la esfera pblica virtual- im-
plica una ampliacin de las posibilidades para la generacin de
un discurso pblico democratizador.
3DUD DSHJDUVH D ORV HOHPHQWRV GHQLGRV SRU 7KRPSVRQ VH
puede agregar que en la interaccin virtual, hay una separa-
cin espacio-temporal de los contextos, lo que implica un estre-
chamiento de las seales simblicas respecto de la interaccin
FDUD D FDUD OD RULHQWDFLyQ WDPELpQ HVWi GHVWLQDGD KDFLD RWURV
SHURQRQHFHVDULDPHQWHLGHQWLFDGRVHVGHFLUSXHGHKDEHUXQ
GHVWLQDWDULRFRQFUHWRSHURWDPELpQSXHGHHVWDUGLVSRQLEOHKDFtD
XQ Q~PHUR LQGHQLGR $ GLIHUHQFLD GH OD UHODFLyQ PRQROyJLFD

154

que establecen los medios masivos de comunicacin, con las


7,&ODPDWUL]GLDOyJLFDVHYXHOYHSRVLEOHSHURVHUHFRQJXUDHQ
una combinatoria donde convive la relacin de uno a muchos
-tradicional del modelo broadcasting-; el uno a uno como en la
interaccin mediada y el muchos a muchos donde la estructura
reticular de la web permite una mayor proliferacin hipertextual
GHORVFRQWHQLGRV7DPELpQSRVLELOLWDXQGREOHPRYLPLHQWRGH
sincrona/asincrona en el que se vuelve posible el acceso a ac-
tualizaciones instantneas, as como a entrevistas en vivo donde
el lector interactivo puede participar realizando preguntas, co-
mentar y colocar hipervnculos a contenidos en los espacios de-
signados a los comentarios y adems el acceso asincrnico tan-
to a los contenidos como a los comentarios lo que permite que
las participaciones en los foros mantengan una matriz dialgica
pero que puede estar desplazada temporalmente.
Una limitacin que presenta la interactividad virtual est
GDGDSRUODVSRVLELOLGDGHVWpFQLFDVGHODLQWHUID]HOHVSDFLRTXH
WDQWR6FRODUL  FRPR+LQH  GHQHQFRPRHOlugar de
la interaccin. Este lugar es el espacio donde se materializan los
procesos que se estudian en la denominada esfera pblica virtual.

Consideraciones finales
De acuerdo a lo desarrollado en este ensayo se puede esta-
blecer la centralidad de algunos elementos que permiten reco-
nocer la estructura de la esfera pblica virtual. En primer lugar,
s tomamos el concepto de apariencia en el mundo, es decir, la
presencia de otros que ven lo que vemos y oyen lo que omos nos
asegura la realidad del mundo y de nosotros mismos (Arendt,
 \VXPDGRDHVWRUHFRQRFHPRVODGLPHQVLyQSROpPLFD
del desacuerdo que, en palabras de Rancire, es entendido como

155

un tipo determinado de situacin de habla: aquella en la que


uno de los interlocutores entiende y a la vez no entiende lo que
GLFH HO RWUR (O GHVDFXHUGR QR HV HO FRQLFWR HQWUH TXLHQ GLFH
blanco y quien dice negro. Es el existente entre quien dice blanco
y quien dice blanco pero no entiende lo mismo o no entiende que
el otro dice lo mismo con el nombre de la blancura (Rancire,
 3RGHPRVDUPDUTXHODFRPXQLFDFLyQVHHULJHHQFRQ-
dicin de posibilidad de la poltica, una poltica que habilita que
el disenso sobre lo pblico y, en tanto que comn, pueda conver-
tirse en aspiraciones de la sociedad civil (Mata, 2002).
No obstante, se debe aceptar que el espacio de la esfera p-
EOLFDYLUWXDOHVWpFQLFDPHQWHSXUDFRQWLQJHQFLDGHODVQXHYDV
tecnologas y sus apropiaciones, y que la reconduccin de un
discurso democratizador encuentra evidentemente una traba en
la hegemona discursiva de los medios masivos y en las opera-
ciones que despliegan como actores polticos posicionados. En
otras palabras implica reconocer que la esfera pblica virtual se
HULJH FRPR XQ HVSDFLR VRFLDO GH GLVHQVRV GH FRQLFWRV \ GHV-
acuerdos dnde distintos actores se posicionarn de acuerdo a
VXVLQWHUHVHV\VXVHVWUDWHJLDVGyQGHODVUHODFLRQHVDVLPpWULFDV
pueden convertirse en un elemento distintivo.
Si bien esta perspectiva es deudora de los trabajos de Arendt
y Habermas reconocemos que ambas, la primera por su ningu-
neo y el segundo por su mirada peyorativa - adems de su fuerte
arraigo en una concepcin clsica de esfera pblica-, negaron el
UROGHORVPHGLRVPDVLYRVGHFRPXQLFDFLyQHQODFRQJXUDFLyQ
de una esfera pblica moderna. Es as que resulta imperante ad-
mitir el sustrato tecnolgico que est presente tanto en la socie-
dad de masas como en la sociedad mediatizada (Mata, 1999) y
la forma que toma la visibilidad en la contemporaneidad, como
visibilidad meditica: con el desarrollo de los medios de comu-
nicacin que comenz con la imprenta a principios de la mo-

156

dernidad europea y continu con los medios electrnicos en los


siglos XIX, XX y XXI la visibilidad se libera de las propiedades
espaciales y temporales del aqu y el ahora. La visibilidad de los
individuos, actos y eventos, es separada del escenario comn
compartido (Thompson, 2011: 23).
3RURWUDSDUWHHOFDOLFDWLYRYLUWXDOGHHVWHPRGHORGHHVIHUD
pblica no pretende restringir su concepcin poltica y su alcan-
ce social a los estudios sobre cibercultura, sino que se remite al
lugar donde se materializa, y eso, paradjicamente, es en la web.
En los apartados anteriores se explic la forma en que la co-
nexin, en tanto que proceso social se concreta en el sujeto y que
HVWDHVIHUDHYLGHQFLDXQWHUUHQRGLIXVR\KHWHURJpQHRGyQGHVH
imbrican las circunstancias en que Internet se emplea RILQH y
los espacios sociales que emergen de su uso online. Similarmen-
WH 0DQXHO &DVWHOOV GHQH TXH OD FXOWXUD GH OD YLUWXDOLGDG UHDO
es: ...virtual porque est construida principalmente mediante
procesos virtuales de comunicacin de base electrnica. Es real
(y no imaginaria) porque es nuestra realidad fundamental, la
base material con la que vivimos nuestra existencia, construi-
mos nuestros sistemas de representacin, hacemos nuestro tra-
bajo, nos relacionamos con los dems, obtenemos informacin,
formamos nuestra opinin, actuamos en poltica y alimentamos
nuestros sueos. Esta virtualidad es nuestra realidad (Castells,
2001: 230).
6LQHPEDUJR&DVWHOOVXQLQWHOHFWXDODIHFWRGHODVDUPDFLR-
nes grandilocuentes, no se muestra dubitativo al presentar que
Internet promueve un gora electrnica y dice: Los movimien-
tos del siglo XXI, acciones colectivas intencionadas dirigidas ha-
cia la transformacin de los valores y las instituciones sociales,
VHPDQLHVWDQHQ\DWUDYpVGH,QWHUQHW(OPRYLPLHQWRREUHUR
superviviente de la era industrial, se conecta, organiza y movi-
liza con y en Internet. Lo mismo se puede decir del movimiento

157

ecologista, el movimiento feminista, los diversos grupos pro de-


UHFKRVKXPDQRVORVPRYLPLHQWRVGHLGHQWLGDGpWQLFDORVPR-
vimientos religiosos, los movimientos nacionalistas y los defen-
sores de una interminable lista de proyectos culturales y causas
polticas. El ciberespacio se ha convertido en un gora electr-
nica global donde la diversidad del descontento humano explota
en una cacofona de acentos (Castells, 2001: 160). Aunque el
modelo de la esfera pblica virtual reconoce e integra la partici-
pacin de estos movimientos y grupos se movilizan en Internet,
DGPLWHTXHVHFRPXQLFDQDWUDYpVGHODZHESDUDVRUWHDUORVREV-
tculos que ponen muchas veces las empresas de comunicacin
y que es adoptada como estrategia para organizarse ms all de
ODV GLVWDQFLDV JHRJUiFDV UHFRQRFHPRV TXH QR VRQ ORV ~QLFRV
que participan; porque la esfera pblica virtual es considerada
como un espacio que emerge para dar lugar a las disputas que se
HVWUXFWXUDQHQWRUQRDXQLQWHUpVFRP~Q<HQHVWDGLVSXWDKD\
actores que se accionan para mantener el status quo.
2WURGHORVDEUHYDGHURVGRQGHGHVFDQVDHOPRGHORGHODHV-
fera pblica virtual es la teora construida por Habermas quien
ha elaborado con ms precisiones no por eso exento de ob-
VHUYDFLRQHV\FUtWLFDVXQDUHQDGDQRFLyQGHODHVIHUDS~EOLFD
burguesa (Fraser, 1999). Con la institucin del orden social mo-
derno, es la racionalidad, la que otorga legitimidad a esa esfera,
racionalidad que resulta fundamental porque: Primero, consti-
tuye un espacio de racionalizacin ilustrado que otorga validez
al orden. Segundo, debido a su capacidad de someter al poder
a un proceso de racionalidad y racionalizacin (Retamozo,
2006:30). En este marco es el mismo Habermas quien ve que los
PHGLRVGHFRPXQLFDFLyQHPSREUHFHQHOSHUOUDFLRQDOFUtWLFR\
emancipatorio. En este punto y, en favor de la esfera pblica vir-
WXDOSRGHPRVGHFLUTXHVLELHQSHUVLVWHHOLQWHUpVSRUORFRP~Q
que busca poner en cuestin las acciones del Estado, la matriz

158

racional y dialgica, que slo es posible de manera muy clara


HQODFRQFHSFLyQFOiVLFDGHODSROLVJULHJD\\DFRQPiVGLFXO-
tades en los primeros momentos de la esfera pblica burguesa,
se va quedando de lado frente a una multiplicidad de esferas -de
diferentes dimensiones y con diferentes alcances pblicos- en
las cuales los actores no se presentan y participan en tanto que
iguales, sino que sus posiciones y sus tomas de posicin ejercen
presiones y coerciones dentro de la misma esfera para con otros
actores. A su vez no se traduce en un proceso de mediacin entre
un conjunto de individuos privados reunidos pblicamente con
su consecuente impronta normativa sobre el accionar del Estado
sino que podra propiciar el espacio para una accin poltica que
se articule dentro de un proyecto hegemnico -o contrahegem-
nico- que se posicionen dentro del campo pblico3. Esto puede
ser posible si se recupera, como se intenta en el modelo de la
HVIHUDS~EOLFDYLUWXDODOFRQLFWRFRPRHVWUXFWXUDQWHGyQGHHO
disenso y el consenso, el desacuerdo y la disputa puedan recon-
ducir los procesos en la construccin de nuevas hegemonas y
permitir inscribir en el campo pblico demandas que podran
situarse originalmente en el mbito privado.
Por ltimo, y con la pretensin de eludir los problemas que
SURYRFDUtD GHQLU GH PDQHUD FRQFUHWD D OD HVIHUD S~EOLFD YLU-
tual, se arriesgar una breve enumeracin de los elementos que
ODFRQVWLWX\HQ$VtVHSXHGHLGHQWLFDUODPXOWLSOLFLGDGGHHVIH-

Retomamos el concepto de campo pblico de Martn Retamozo porque permite introducir a la esfera pblica virtual, un contenido dinmico y una clara dimensin poltica que
evidencie que la esfera virtual no est aislada en Internet, sino tiene una fuerte raigambre
en lo histrico social. As, define Retamozo al campo pblico, no es la suma de los
espacios pblicos, sino un lugar intersubjetivo y contingente y de encuentro, disputa,
consenso y construccin de hegemona (2006: 33).
3

159

UDVQRUHVWULQJLGDVDORHVWDWDOGyQGHHOFRQLFWRVHHULJHFRPR
un elemento estructurante, en donde el valor de uso tanto de
las noticias como de la informacin confronta con la mercanti-
lizacin de ambos, y reconociendo que esta esfera es un espacio
donde los actores no se presentan en relacin de igualdad, sino
TXHODDVLPHWUtDHVORTXHGHQHWDQWRSRVLFLRQHVFRPRWRPDVGH
SRVLFLyQ$FDVRWDPELpQVHSXHGHGHFLUTXHODHVIHUDS~EOLFDYLU-
tual se presenta, en este trabajo, como un modelo analtico que
SHUPLWDLGHQWLFDUODIRUPDTXHHOLQWHUpVSRUORFRP~QHPHUJH
en esta sociedad de la informacin, donde la dicotoma informa-
cin/desinformacin, hegemona/contrahegemona, conexin/
desconexin, comienza a desplegarse y funcionan, al menos,
como un ingrediente ms de la incertidumbre de las sociedades
contemporneas.

160

Bibliografa
ANTUNES, Ricardo, $GLyV DO WUDEDMR" (QVD\R VREUH ODV PHWD-
PRUIRVLV\HOUROFHQWUDOGHOPXQGRGHOWUDEDMR. Buenos Ai-
res, Ediciones Herramienta, 2003.
ARDITI, Benjamn (2011). El reencantamiento de la poltica
como espacio de participacin ciudadana, en Hopenhayn,
Martn y Ana Sojo (comps.), Sentido de pertenencia en socie-
dades fragmentadas. Amrica Latina desde una perspectiva
global, pp.55-84. Buenos Aires, Siglo XXI, 2011.
ARENDT, Hannah, La condicin humana. Barcelona, Paids,
2008.
CASTELLS, Manuel, La galaxia Internet.0DGULG$UHWp
FRASER, Nancy, Rethinking the Public Sphere: A Contribution to
the Critique of Actually Existing Democracy, en Calhound,
Craig, Habermas and the public sphere, pp56-80. England,
The MIT Press, 1992.
HABERMAS, Jrgen, Historia y Crtica de la opinin pblica. Bar-
celona, Gustavo Gili, 2009.
HINE, Christine, Etnografa virtual.%DUFHORQD82&
KEANE, John, Transformaciones estructurales de la esfera pbli-
ca, en Estudios Sociolgicos(O&ROHJLRGH0p[LFRYRO[Y
nm. 43, enero-abril, 1997.
LAGO MARTNEZ, Silvia; Marotias, Ana; Marotias, Laura y Movia,
Guillermo, Internet y lucha poltica. Buenos Aires, Capital
Intelectual, 2006.
LAGO MARTNEZ, Silvia, Comunicacin, arte y cultura en la era
digital en Lago Martnez, Silvia (comp), Ciberespacio y re-
sistencias. Exploracin en la cultura digital. Buenos Aires,
Hekt Libros, 2012.
MATA, Mara Cristina, De la cultura masiva a la cultura medi-
161

tica, ponencia presentada al Seminario Inter nacional Ten-


GHQFLDV\UHWRVGHODLQYHVWLJDFLyQHQ&RPXQLFDFLyQHQ$Pp-
rica Latina, Felafacs-Puc del Per, Lima, Julio, 1999.
MATA, Mara Cristina, Comunicacin, ciudadana y poder. Pis-
tas para pensar su articulacin, en Dilogos de la comuni-
cacin, Felafacs, Lima, Nro. 54, pp. 66-76, noviembre, 2002.
MOUFFE, Chantal, En torno a lo poltico. Buenos Aires, Fondo de
Cultura Econmica, 2007.
RANCIRE, Jacques, (O GHVDFXHUGR 3ROtWLFD \ ORVRItD. Buenos
Aires, Ediciones Nueva Visin, 1996.
RODRGUEZ GIRALT, Israel, Las TIC y el hecho comunicativo, en
Gil Jurez, Adriana (coord.) Tecnologas sociales de la comu-
nicacin%DUFHORQD(GLWRULDO82&
RETAMOZO Martn, Notas en torno a la dicotoma pblico-priva-
do: Una perspectiva en 5HH[LyQ3ROtWLFD, diciembre, ao/
vol. 8, nmero 016, Universidad Autnoma de Bucaramanga,
Colombia, pp. 26-35, 2006.
ROST, Alejandro, La interactividad en el peridico digital. Tesis
doctoral. Universidad Autnoma de Barcelona, 2006. Dispo-
nible en:http://es.scribd.com/doc/80664643/La-interacti-
vidad-en-el-periodico-digital
SCOLARI, Carlos, Hipermediaciones. Elementos para una Teora
de la Comunicacin Digital Interactiva. Barcelona, Gedisa,
2008.
THOMAS, Hernn; Busch, Alfonso (coords.), Actos, actores y ar-
tefactos. Sociologa de la tecnologa. Bernal, Universidad
1DFLRQDOGH4XLOPHV
THOMPSON, John B, La teora de la esfera pblica. Una aproxi-
macin al pensamiento de Habermas, en Voces y culturas
N 10. Barcelona., pp. 81-96, 1996.
THOMPSON, John B, Los media y la modernidad. Barcelona, Pai-
ds, 1998.

162

THOMPSON, John B, Los lmites cambiantes de la vida pblica y


la privada en Comunicacin y Sociedad1XHYDpSRFDQ~P
15, enero-junio, pp. 11-42. Guadalajara, Universidad de Gua-
dalajara, 2011.
WILLIAMS, Raymond, Televisin. Tecnologa y forma cultural.
Buenos Aires, Paids, 2011.
WINOCUR, Rosala, Etnografa de un proceso de reconstruccin
ELRJUiFD HQ ,QWHUQHW HQ Etnografas Contemporneas,
n5, pp. 165-175. Buenos Aires, Unsam Edita, 2011.

163

CAPTULO VII

Pblico, privado, ntimo: las tramas


de la vida social

Por Vanina A. Papalini

Introduccin
En las sociedades modernas, es habitual pensar a la esfera
pblica como opuesta y complementaria a la dimensin privada.
Esta divisin, sin embargo, no tiene nada de natural ni de evi-
GHQWH&RPRFXDOTXLHUFRQJXUDFLyQVRFLDOHVQHFHVDULRSHQVDUOD
FRPR XQ VHGLPHQWR FXOWXUDO TXH VH PXHVWUD FRPR HFXPpQLFR
permanente e incuestionado en virtud de una datacin antigua:
el tiempo borra las memorias y hace parecer eterno aquello que
emergi en un determinado momento.
Por eso, parece prudente el camino que escoge Richard Sennett
(2002), que comienza su anlisis de la esfera pblica recuperando
VX KLVWRULD 6HQQHWW REVHUYD TXH HO HVSDFLR S~EOLFR HQ pSRFD GH
la Repblica, en la Antigua Roma, se organizaba bajo principios
LGpQWLFRVDDTXHOORVTXHVHDSOLFDEDQHQODYLGDSULYDGD/DDXWR-
nomizacin de las esferas acontece cuando la etapa republicana
WRFDDVXQ\ODYLGDSROtWLFDGHMDGHVHUXQHVSDFLRGHUHDOL]DFLyQ
de los sujetos. Es decir que la divisin se produce por el ahue-

164

camiento de la vida pblica que se ritualiza, se formaliza y se


vaca de contenido. La esfera privada se mantiene como refugio
en tanto constituye un mbito de espontaneidad y autenticidad.
Ms modernamente, en varios estados en los que la mayo-
ra de la poblacin profesa la religin puritana o presbiteriana
Estados Unidos, Suiza, Pases Bajos, Inglaterra o Escocia-, hay
una continuidad moral entre ambos rdenes, como se puede an
constatar cuando los escndalos adlteros de un presidente ha-
cen tambalear su investidura. Aunque no se trate de la misma
interpenetracin que la exhibida en la Roma republicana, la ce-
sura entre el espacio pblico y la vida privada no es tajante y la
religin otro de los componentes que el legado romano ubica
HQ OD GLPHQVLyQ SULYDGD VH DUWLFXOD HFD]PHQWH HQ OD YLGD HQ
UHODFLyQFRQRWURV(VWDFRPSHQHWUDFLyQHVHVSHFLDOPHQWHHFD]
para el desarrollo del capitalismo, en tanto el cultivo de ciertas
virtudes y principios impulsados por las religiones calvinistas
FRPRHOp[LWRHFRQyPLFR\ODFRQVWULFFLyQDOWUDEDMRVRQEHQH-
ciosos para la el conjunto de la sociedad (Weber, 1991).
No es mi intencin aqu discutir las diferencias numerosas e
importantes- entre modelos polticos o formas de ejercicio de la
ciudadana en los estados modernos, ni mucho menos defender
con criterios morales cmo debera organizarse la vida social.
Simplemente pretendo decir que la divisin entre las esferas no
HVQDWXUDOQLWDQQtWLGDFRPRVHSUHVXSRQH&RPRWUDWDUpGH
argumentar, los procesos culturales contemporneos colaboran
en borronear esta distincin un poco ms. De hecho, creo que
los modos en los que se despliega la existencia social y la polti-
FDODYLGDGRPpVWLFD\ODLQWLPLGDGHVWiQVLHQGRUHJXUDGDVHQ
relacin con una misma estructura del sentir (Williams, 1997)
o sensibilidad en comn.
Mis tesis son dos. La primera, que las emociones se hacen
YLVLEOHV\DXGLEOHVFRQVWLWX\HQGRXQDMXVWLFDFLyQ\XQDPRWL-

165

vacin vlidas en el seno de la vida en comn. Si bien esto no


es nuevo pues, como veremos en seguida, la necesidad de con-
trolar las emociones, las muy cuestionables pasiones humanas,
aparece como la causa de contratos sociales, leyes y cesin de
voluntades, no se tratan de los mismos sentimientos que los exa-
minados hasta ahora por la teora poltica. La segunda tesis es
que las relaciones sociales y polticas estn cobrando la misma
forma que la sociabilidad informal; la relacin interpersonal, tal
como se establece en los diversos grupos que se forman en las
sociedades, es el modelo relacional del espacio pblico.
Es necesario hacer una advertencia: no estoy muy segura de
TXHpVWHVHDXQSURFHVRJHQHUDOL]DGR(QWRGRFDVRYDOHSDUDHO
caso argentino. Los niveles de formalidad de las relaciones que
se dan en el espacio pblico en otros pases latinoamericanos
para no hablar de realidades ms distantes- son muy diferen-
tes a los nuestros. El valor de pensar el caso argentino es que
condensa en una medida mayor algunas tendencias que se estn
registrando solapadamente en otros territorios. En Argentina
convergen ciertos factores histricos, sociales y polticos que ha-
cen a su sociedad menos jerrquica. Estos factores son intrans-
IHULEOHVGHQHQVXSDUWLFXODULGDGKLVWyULFD\VRFLDO3HURH[LVWH
XQDVSHFWRPiVDFRQVLGHUDUpVWHVtSDVLEOHGHVHUREVHUYDGRHQ
otros contextos: la generalizacin del uso de las redes de comu-
nicacin sobre la plataforma web, que en Argentina se manifes-
t tempranamente. ste es un punto particularmente relevante
para comprender los grupos, las comunidades interpretativas
virtuales y los pblicos como paradigmas de las interacciones
contemporneas en un espacio capaz de conjugar lo pblico, lo
privado y lo ntimo.

166

Esfera privada: las bases morales de la institucin


social
Segn algunas teoras polticas, el orden objetivo reposa en
los atributos subjetivos de los miembros de una colectividad. As
sucede en el pensamiento de Scrates, por ejemplo, que hace de-
pender la justicia, el bien y la virtud que deben reinar en la polis,
del trabajo interior; el gobierno de la ciudad del autogobierno.
)RXFDXOW 7DPELpQD esta conclusin arriba Hanna Arendt
para quien slo la virtud que atempera las pasiones- funda insti-
tuciones duraderas (Arendt, 1992).
A la inversa: cuando los individuos se dejan conducir por sus
pasiones, la comunidad humana fundada expresar emociones ne-
gativas como el egosmo, el instinto de conservacin y la ambicin,
que pueden conducir al crimen. La instauracin y legitimidad de un
RUGHQQRUPDWLYR\VXVLQVWLWXFLRQHVGHYLHQHGHHVWDGHVFRQDQ]D
esencial hacia aquello que los seres humanos sean y hagan, movi-
dos por sus pasiones. La teora poltica de Thomas Hobbes (2009)
\ODSVLFRORJtDGH6LJPXQG)UHXG  GHQHQODVRFLHGDGFRPR
una comunidad de seres humanos interesados en s mismos y con
FDSDFLGDGGHPDWDUTXHUHQXQFLDQDHVWDSRWHVWDGDWUDYpVGHXQ
pacto. Las teoras polticas contractualistas del siglo XVII asumen
la exigencia de controlar al hombre natural, pensado ms cerca
de la maldad que de la bondad pero asimismo capaz de moderar
VXVDSHWLWRVDWUDYpVGHXQDHGXFDFLyQHQODYLUWXGRGHODFRDFFLyQ
de la ley. No necesariamente se trata de la constatacin de una per-
GLDHVHQFLDOHQODKXPDQLGDGVLPSOHPHQWHVHUHFRQRFHTXHQLHO
mal absoluto ni el bien absoluto son propios de la sociedad, pues
pVWDHVXQDFRQVWUXFFLyQGHORVFRQWUDGLFWRULRVVHUHVKXPDQRVHQ
la que no participan ni ngeles ni demonios (Arendt, 1992).
Dado que nos complace el dilogo ms que el soliloquio y la
vida en relacin ms que el enclaustramiento, la historia de los

167

FROHFWLYRV KXPDQRV KD VLGR WDPELpQ OD KLVWRULD GH ORV LQWHQWRV
para establecer reglas de convivencia que nos permitan habitar
un mismo territorio. Segn lo crean los pensadores del siglo
XVII, los principios morales no se restringen a una aplicacin
privada sino que tienen consecuencias en el espacio social: el su-
MHWRDFDUUHDDODRUJDQL]DFLyQFROHFWLYDVXFRQJXUDFLyQHPRWL-
YD\VXpWLFDRWRUJiQGROHXQDSHFXOLDUWRQDOLGDG/DOH\DSDUHFH
como un artefacto objetivo que suplanta a la virtud, un atributo
subjetivo, y hasta puede entrar en contradiccin con ella, ya que
la justicia humana est atada a las verdades humanas y no a la
verdad ntima. La ley supone enajenar cierto nmero de propen-
siones, de acciones movidas por deseos, emociones o impulsos,
que puedan daar la existencia de los otros, sus propiedades, su
dignidad o su sentido del pudor.
Las teoras que apuntan a que un conjunto de normas objeti-
vas operen como reguladores sociales no se impusieron rpida-
mente. La discusin histrica datada a principios del siglo XVIII
incluye algunos otros pensadores; las generaciones siguientes a
Hobbes y Locke proponen fundar la sociedad sobre sentimientos,
y no sobre normas: Francis Hutcheson, por ejemplo, aboga por
sociedades basadas en la benevolencia, y David Hume supone
que la simpata puede cimentar la convivencia social. En la visin
de Hutcheson, todos compartimos los mismos sentimientos; se-
gn Hume, aunque no los compartamos, los podemos comunicar
(Seoane Pinilla, 2004). Un tercer pensador, Adam Smith, famoso
SRUVXVLGHDVHFRQyPLFDV\PHQRVFRQRFLGRSRUVXUHH[LyQVR-
bre la moral, (Smith, 1992) opina que el sentimiento que permite
a los sujetos la vida en comn es la imparcialidad: aunque no par-
ticipemos de los sentimientos del otro, podemos comprenderlos
DWUDYpVGHXQDRSHUDFLyQPHQWDO
(OGHVSOD]DPLHQWRJUDGXDOTXHVHLOXVWUDDWUDYpVGHHVWRVWUHV
pensadores permite comprender el giro que desaloja a los senti-

168

mientos del ncleo de la vida social y los reemplaza por la mera


expectacin desapasionada que deviene, muy rpidamente, una
actividad raciocinante prescindente de todo afecto. El punto de
FOLYDMHPDUFDGRSRU6PLWKWDPELpQGLIHUHQFLD\VHSDUDODVHVIHUDV
de la vida privada y la vida pblica que pronto se darn la espalda,
exhibirn morales distintas y se autonomizarn. Desembocamos
as en la lectura ms generalmente compartida del mbito pbli-
co, un espacio de participacin comn pensado esencialmente
como el lugar de una comunicacin racional.
Una vez vaciado de contenido emocional y anulado el involu-
cramiento personal, el espacio pblico se convirti al menos en
la teora- en un asunto formal, un ritual vaco. La ritualizacin y la
LQVWLWXFLRQDOL]DFLyQFRQOOHYDQODFRGLFDFLyQPi[LPD\UHGXFHQOD
posibilidad de creacin. El repliegue sobre la vida privada marca
este desapasionamiento de la esfera pblica y la presuncin de
que ese espacio no puede colmar, no puede realizar a un sujeto.

Espacio pblico, entre la representacin


y la manifestacin
Las nociones de espacio pblico y de opinin pblica re-
miten, segn sostiene Jrgen Habermas (1981), al anlisis de una
esfera concebida como autnoma y enfrentada al mbito privado.
Antes de ingresar al anlisis del espacio pblico me interesa, en pri-
PHUOXJDUH[DPLQDUHOWpUPLQRRSLQLyQ/DGHQLFLyQWUDGLFLRQDO
establece su diferencia tanto de la ciencia como de la creencia; no
es ni una ntima conviccin es decir, una certidumbre subjetiva-,
ni una verdad objetiva. La opinin entraa un tipo de conocimiento
intermedio, un juicio sobre la apariencia del mundo en su devenir
TXHSHUPLWHDFFHGHUDpO\DFWXDUVREUHpO(VSDUDODORVRItDJULHJD
del perodo clsico, un tipo de juicio que permite la accin.

169

Guardando parte de las propiedades que Platn atribuye a


la opinin individual, para quien es la facultad de juzgar sobre
las apariencias, la opinin pblica aparece como un pronuncia-
miento intersubjetivo. El nivel intersubjetivo, pues, se diferencia
del nivel social que implica, tomado como un todo, la amalgama
de los elementos que lo componen- y del nivel personal, lugar de
constitucin primaria de la identidad subjetiva imaginada como
singular. Estas distinciones, por supuesto, son simplemente ana-
lticas y resultara imposible separar empricamente estos nive-
les. De hecho, estn imbricados completamente.
Segn las teoras psicolgicas y psicoanalticas, el ncleo pri-
mario es una condicin de existencia del yo que modela al sujeto
GHVGHHOQDFLPLHQWRHMHUFLHQGRPD\RULQXHQFLDHQHGDGHVWHP-
pranas. Podemos pensarlo como un orden normativo personali-
zado. Al alcanzar cierta autonoma, la institucin social como
orden impersonal- completa la tarea de legislar, sujetar y regular
las inclusiones al colectivo. Los dos rdenes, complementarios
entre s, actan como matrices renuentes a la alteracin, difciles
GHPRGLFDUGHVGHODLQVWDQFLDSHUVRQDO
En contraste, el espacio intersubjetivo es co-participado, co-
RSHUDWLYR\QRH[LVWHVLQODLQWHUYHQFLyQGHORVVXMHWRV(VH[LEOH
porque implica una interactuacin en la que quedan comprendi-
dos tanto el dilogo como la disputa. Este espacio complementa y
RIUHFHRSFLRQHVDODGHQLFLyQLGHQWLWDULDTXHHQHVWDGLPHQVLyQ
se torna singularmente mvil ya que, siguiendo la premisa de la
LGHQWLGDG FRPR FRQVWUXFFLyQ UHODFLRQDO pVWD VH FRQVWLWX\H SRU
semejanza y diferencia con otros (Cuche, 2002).
3ODQWHR HVWDV HVSHFLFDFLRQHV SDUD WUD]DU XQD GLVWLQFLyQ OD
diferencia entre el nivel intersubjetivo y el nivel social implicado
en la idea de espacio pblico tiene que ver con el diferente grado
de implicacin personal, por un lado, y con un distinto tipo de
reconocimiento identitario, que en la relacin interpersonal es

170

concreto y singular, y en la relacin social es abstracto, basado


en convenciones y legitimidades, es decir, ligado a roles y valores
\DGHQLGRVHQODLQVWLWXFLyQVRFLDO
En la modernidad, el espacio pblico se establece como lu-
JDUGHH[SUHVLyQQXHYDVRFLDELOLGDGHGLFDGDHQWRUQRDODUH-
presentacin y especialmente a la autopresentacin (Goffman,
1994; Sennett, 2002). Los vnculos que se establecen en el es-
pacio pblico, se constituyen en funcin de un reconocimiento
que pone en juego identidades sociales. Los juicios y opiniones
estn referidos a lugares, funciones, cargos, encarnados circuns-
tancialmente por una persona determinada. sta es juzgada en
relacin a su autopresentacin pblica y a la forma en que ocu-
pa esa categora identitaria abstracta, pero nada se sabe de ella
HQWpUPLQRVSHUVRQDOHV1RKD\XQGHYHQLUGHODUHODFLyQFRPR
s existe en el espacio intersubjetivo, que est en construccin
conjunta y se deshace cuando se abandona esta construccin.
La co-actuacin, el juego interpersonal en el espacio pblico po-
VLELOLWDTXHODVGHQLFLRQHVLGHQWLWDULDVSXHGDQPXOWLSOLFDUVH\
complejizarse.
(QWpUPLQRVGHORVDIHFWRVHOUHFRQRFLPLHQWRLGHQWLWDULRQR
HVQXQFDLPSDUFLDOORVUROHV\FODVLFDFLRQHVLQGHQWLWDULDVHVWiQ
emocionalmente marcados; generan antipatas y simpatas,
acercamientos y distancias, agresin o admiracin. A mayor cer-
FDQtDPiVIXHUWHUHVXOWDODLQXHQFLDGHODVHPRFLRQHV(OMXHJR
de las miradas y las actuaciones pblicas afectan la identidad
personal porque el rtulo social es una de las dimensiones de la
SHUVRQDQRHVXQURSDMHH[WHUQRVLQRSDUWHGHODGHQLFLyQGHO
s mismo (ser mujer, ser pobre, ser gay, ser polica, ser inmigran-
te). As, cualquier interaccin pblica o privada, esa distincin
es aqu irrelevante-, compromete el registro afectivo, poniendo
en juego sentimientos, simpatas y antagonismos no solamente
fundados en un plano ideolgico.

171

Dicho de otro modo: la relacin social que se establece en el


espacio pblico est fundamentalmente orientada por catego-
ras, roles y funciones que afectan a la persona que lo ejerce en
tanto constituye su encarnacin concreta. En general se trata de
juicios impersonales; los consensos y disensos se construyen con
relativa independencia de las cualidades singulares y de las con-
diciones circunstanciales y pasajeras. En el nivel interpersonal,
HVWDVRSLQLRQHVHQFXHQWUDQFRQGLFLRQHVGHPRGLFDUVHSURIXQ-
dizarse, matizarse o complejizarse. Las cualidades personales
cuentan ms decisivamente y las opiniones estn atravesadas
por la consideracin de las identidades singulares. La actuacin
pblica siempre compromete afectos pero en el nivel social es-
tn menos orientados a la persona que a la posicin identitaria
TXHRFXSD RVHUHHUHQDXQDSHUVRQDOLGDGHVWHUHRWLSDGDHQOD
representacin pblica, como en el caso de los mandatarios de
gobierno) mientras que en el nivel interpersonal es ms sensible
a al juego de la interaccin. La interaccin la relacin con los
otros- no se limita a un juicio imparcial y general sino que com-
promete sentimientos y actuaciones, ms fcilmente modelables
en la relacin interpersonal.
0H FRQFHQWUDUp DKRUD XQ SRFR PiV HQ OD H[SRVLFLyQ GH ORV
afectos en el espacio pblico. El espacio pblico es un mbito
tanto de representacin simblica como de manifestacin ex-
presiva. Es un espacio abierto a la experiencia que implica la re-
ODFLyQFRQORVRWURVHQWpUPLQRVGHUHFRQRFLPLHQWRTXHFRPR
ya he sealado, no se reduce al vector de la racionalidad. Esta
aseveracin entra en contradiccin con una de las obras que
ms fuertemente opera como horizonte de comprensin de estos
procesos: en la Teora de la accin comunicativa (1987), Haber-
mas propone una lectura de la esfera pblica que se asemeja a la
imagen de una red de espacios compartidos de carcter plural y

172

abstracto, en los cuales las representaciones sociales de las iden-


tidades se actualizan (Tavernier, 2007). El dilogo y el consenso
son sus articuladores: la escena habermasiana corresponde a la
de una democracia deliberativa desapasionada donde todos los
participantes tienden al bien comn, eligiendo diferentes cami-
QRVSHURFRPSDUWLHQGRODPHWDQDO&LHUWDPHQWHHVWDLPDJHQ
no presume de ser un espejo actual de lo que sucede sino que
es un horizonte al cual se debera tender.
Las democracias latinoamericanas tienen poco que ver con
ese cuadro, siendo repblicas democrticas modernas, estn
surcadas por enfrentamientos polticos radicales y condiciones
crticas de pobreza, autoritarismo o violencia. Inclusive valdra
ODSHQDSUHJXQWDUVHVLpVHHVQXHVWURGHVLGHUiWXP1RHVWiFOD-
ro, en nuestros casos, que se busque lo mismo por diferentes
PHGLRV ODV GHQLFLRQHV GH ELHQ FRP~Q GH DTXHOOR TXH VH
considera lo ptimo para una sociedad, es tan diferente para los
distintos grupos y tendencias polticas que los objetivos resultan
incompatibles.
Sea por una disposicin emotiva diferente, sea porque nues-
WUR HVSDFLR S~EOLFR H[SUHVD HQpUJLFDPHQWH HVWD FRQLFWLYLGDG
de base, sea porque la poltica y la vida en comn todava son
espacios de imaginacin y realizacin social, o porque no hemos
cado en el aburrimiento y la indiferencia nihilistas, cualquier
OHFWXUDGHORVHVSDFLRVS~EOLFRVODWLQRDPHULFDQRVTXHVHMHVyOR
en la representacin y no tome en cuenta la manifestacin sera
incompleta.
En tanto acontecimiento (Badiou, 1999), la manifestacin
que reclama en su integridad la presencia fsica- tiene un plus
TXHQRSXHGHVHUVLPEROL]DGRDEULpQGRVHDVtDXQDPXOWLSOLFL-
dad de sentidos cuya expresin excede los cdigos representacio-
QDOHV$XQTXHVXVLJQLFDFLyQVHWRPHGHODVUHSUHVHQWDFLRQHV
circulantes para ser socialmente inteligible, sus reverberaciones

173

rebasan las formas existentes, adquiriendo una dinmica parti-


cular, la del movimiento. Los movimientos sociales no pueden
encuadrarse en el enfoque de la representacin, ni de una esfera
S~EOLFDEXUJXHVDHQWHQGLGDFRPRXQHVSDFLRGHOLEHUDWLYRHGL-
cado en torno al debate de ideas. La existencia de movimientos
VRFLDOHVFRQGXFHDSHQVDUTXHODHVIHUDGHORS~EOLFRHVWDPELpQ
una esfera de manifestacin. (Cefa, 2008).
Dado que muchas manifestaciones colectivas producen acon-
tecimientos sociales, lo que ocurre en la esfera pblica no puede
FRPSUHQGHUVH VyOR HQ WpUPLQRV GH UHSUHVHQWDFLRQHV HVWDEOHV
Sus resonancias van ms all de cualquier simbolizacin con-
vencional: de all que se conviertan en canteras inagotables de
sentidos. Para ejemplos simples, baste con pensar en el 17 de
octubre de 1945 en Argentina o las expresiones vinculadas a la
muerte de Hugo Chvez producida en marzo de 2013, son acon-
WHFLPLHQWRVFX\DVLJQLFDFLyQQRSDUHFHFHUUDGD\TXHUHSHUFX-
ten sobre el pathos, la dimensin afectiva.
La nocin de manifestacin es especialmente til para su-
brayar la presencia de elementos emotivos, sentimentales, que
desencadenan acciones colectivas (Bougnoux, 1999). Esta ex-
SUHVLYLGDG VRFLDO HV HQVRPEUHFLGD FXDQGR VH GHQH HO HVSDFLR
pblico en relacin a la opinin entendida como un juicio o ra-
ciocinio que compromete, en el terreno intelectual, la actuacin
de un grupo, un conjunto de individuos autnomos y conscien-
WHV&RPRVHxDOpHQHODSDUWDGRSUHFHGHQWHWDOFRQFHSFLyQVLJXH
ODGHQLFLyQGHHVSHFWDGRULPSDUFLDOTXHGHVDUUROODUD6PLWK6L
en cambio, asumimos su carcter mltiple -el ser, a un tiempo,
espacio de representacin y de manifestacin, implicando tan-
to la dimensin cognitiva como la afectiva, tanto la deliberacin
como la accin-, el espacio pblico resulta un lugar de articu-
lacin de las dimensiones objetivas y subjetivas de la sociedad.

174

Pblico y masa: la antinomia racional /irracional


He sealado que las emociones gozan de mala reputacin en
cuanto a su capacidad de fundar la vida social. La nocin de que
el hombre es el lobo del hombre, que Hobbes (2009) actuali-
za tomndola de Plauto, es una expresin negativa referida al
LQGLYLGXR TXH YD D HQFRQWUDU XQD YHUVLyQ FROHFWLYD KDFLD QHV
GHOVLJOR;,;FRPRH[SUHVLyQGHODGHVFRQDQ]D\WHPRUDODV
grandes aglomeraciones de sujetos en un espacio pblico que
paulatinamente se ampliaba.
El espacio pblico se alimenta de la adquisicin de derechos
SROtWLFRV\VHDDQ]DHQODJXUDGHOFLXGDGDQR/DFRQGLFLyQGH
ciudadana universal no naci en 1789 sino que fue un proceso
de incorporacin creciente de la poblacin a los derechos emer-
gentes de la participacin poltica. En su versin ms restrictiva,
tenan derecho a sufragar los hombres que cumplan con ciertas
H[LJHQFLDVGHUHQWDPtQLPDHLQVWUXFFLyQOXHJRIXHVXFLHQWH
con saber leer y escribir. Ms tarde se ampli el derecho a votar
incorporando a las mujeres y, con ciertas limitaciones, a los ex-
tranjeros.
De maneras muy concretas, la condicin de ciudadana per-
miti a actores de los sectores subalternos, que antes tenan ve-
GDGRHODFFHVRDFLHUWDV]RQDVDFWLYLGDGHV\HGLFLRVGHODFLX-
dad, a circular libremente y a acceder a espectculos y eventos
reservados normalmente para ciudadanos acaudalados o nota-
EOHV 4XL]i XQR GH ORV HVSDFLRV PiV HPEOHPiWLFRV HQ UHODFLyQ
con este proceso sean las plazas, cerradas con rejas que permi-
tan controlar el acceso y seleccionar a los paseantes y que tar-
damente se abrieron a la libre circulacin.
La paulatina universalizacin de los derechos polticos ha re-
cibido distintos tratamientos, que van desde la idea de ascenso
GHODVPDVDV 2UWHJD\*DVVHW DGHPRFUDWL]DFLyQ7tSLFD-

175

mente, implica la presencia de nuevos actores designado bajo


GLIHUHQWHVWpUPLQRV/DGHQRPLQDFLyQPiVDQWLJXDPDVDKD
sido largamente criticada, esencialmente por la carga peyorativa
que implicaba en las teoras aristocrticas y conservadoras de
1LHW]VFKH2UWHJD\*DVVHW\/H%RQ 6ZLQJHZRRG 9DOH
la pena destacar que estas teoras subrayaban el carcter emo-
cional del comportamiento de la muchedumbre para algunos,
rayano en la irracionalidad completa - y su potencia actuante
que desembocara inexorablemente en la violencia. Este primer
grupo de teoras no slo asilaba el temor a las multitudes ac-
tuales que inundaban las ciudades, sino que guardaba los ecos
del terror desencadenado por les malhereuses de la Revolucin
Francesa.
Los totalitarismos del siglo XX dieron nuevos argumentos
contra las masas, que aparecieron en estos episodios como sus-
ceptibles de manipulacin, operando bajo los efectos de la pro-
SDJDQGD\FRQGXFLGDVSRUODLQXHQFLDTXHHMHUFtDQORVOtGHUHV
carismticos (Tchakhotine, 1982). Segn instruyeron estos mo-
mentos negros de la historia, la emocin no puede ser el fun-
damento de la sociedad ni debe ser puesta en juego en el espa-
cio pblico. La propaganda, como mecanismo manipulador de
la inclinacin irracional de los seres humanos, fue condenada,
mientras que lo que apareci como la buena poltica fue aque-
lla que se decida en un espacio racional de discusin de ideas y
de obtencin de consensos. La poltica, sin embargo, no ha de-
jado de apelar a las emociones y los sentimientos para generar
adhesiones.
La interdiccin impuesta al concepto de masa permiti el as-
censo de una concepcin muy compatible con el pensamiento
de Adam Smith: la nocin de pblico. Gabriel Tarde (1986),
introductor del concepto, postula que los pblicos se apoyan en
un pensamiento LQIRUPDGRSRUODSUHQVD/DLQH[LyQGH7DUGH

176

HQUHODFLyQDOSHQVDPLHQWRGHODpSRFDHVIXQGDPHQWDOVXWHRUtD
opera de bisagra entre la teora social refractaria a las multitu-
des las ya mencionadas teoras de la sociedad de masas- y la
perspectiva pluralista norteamericana. Los pblicos se acercan
DODGHQLFLyQGHJUXSRVFXDQGRVRQFRQVLGHUDGRVPXFKHGXP-
EUHVIUDJPHQWDGDV\GLVSHUVDVSHURWDPELpQDEUHYDHQODGH-
nicin de masa, ya que Tarde considera que estn mentalmente
unidos (Mattelart, 1996: 77-78).
Tarde limita los rasgos de irracionalidad que se le atribuan
a las masas, aunque tampoco les otorga plena autonoma racio-
FLQDQWHODQRFLyQFODYHHVODGHLPLWDFLyQ6HHQWUHYpQHQVXV
proposiciones ciertas reminiscencias de Le Bon, que hablaba
del contagio. El factor comn es la falta de autonoma que se
le adjudica a estos procederes, cuyo origen estara en otro lado
TXHHQODPXOWLWXG PLVPD/DLPLWDFLyQFRPRUDVJRHVSHFtFR
de las masas reaparece aun en la concepcin ms positiva de los
pluralistas norteamericanos de la segunda mitad del siglo XX.
Edward Shils seala como caracterstica de la cultura de masas
el ser imitativa, poco original (1974). Para Shils, la cultura de
masas es una cultura mediocre; sin embargo, aun cuando no lle-
JXHDVHUUHQDGDFRPRODGHODVpOLWHVWLHQHHOPpULWRGHDOHMDUVH
de la cultura brutal y violenta.
Como se ve, hay una valoracin particular de esta cultura
en tanto se ofrece como un sustituto de las prcticas populares
tradicionales que desatan formas de interaccin intempestivas.
La cultura de masas aparece como garanta ante el peligro de la
irracionalidad. Todava a mediados del siglo XX las democra-
cias parecen intentar sostenerse entre la invocacin terica a las
masas pero manteniendo a raya sus posibilidades de actuacin.
Segn el enfoque clsico de Tarde y Tnnies (Mattelart,
1996), la opinin pblica se expresa en actuaciones. Esta poten-
cialidad se despleg en la segunda mitad del siglo XVIII en los

177

movimientos sociales que desencadenaron revoluciones y accio-


nes directas de un pblico que no era mero espectador, tales
como las manifestaciones en contra de la guerra en Vietnam o
HO0D\RIUDQFpVGH/RVOODPDGRVS~EOLFRVVHPXHVWUDQ
como conjuntos de personas con capacidad de intervencin en
el curso de los acontecimientos, es decir que tienen la facultad
de desencadenar acciones colectivas. Su potencial no se circuns-
FULEH D XQD RSLQLyQ GHFODPDGD QL VRQ JUXSRV FX\D DQLGDG VH
limite a gustos o preferencias compartidos.
A partir de una comprensin de la nocin de pblicos como
JUXSRV GH DQLGDG 6WDQOH\ )LVK SURSRQH OD QRFLyQ GH FRPX-
nidades interpretativas (Fish, 1976; Varela, 1999). El valor de
este concepto radica en que, por un lado, retiene las condicio-
nes objetivas de la comunicacin como puesta en comn ya
que sus integrantes forman parte de una comunidad lingstica
y comparten una cultura, lo que constituye la base de su recpro-
FR HQWHQGLPLHQWR (VWH DVSHFWR VRFLDO IXQFLRQD WDPELpQ FRPR
un lmite normativo ya que reduce las posibilidades de uso de
lenguajes o convenciones personales o de microgrupos, que obs-
taculizaran la comunicabilidad de la experiencia individual. Por
otro lado, las comunidades comparten y construyen matrices de
interpretacin en torno a gustos comunes, y en este sentido, la
nocin de comunidades interpretativas incorpora la dimensin
VXEMHWLYDSRUXQODGR\XQDIRUPDGHLQWHUDFFLyQEDVDGDHQD-
nidades y sensibilidades en comn, por otro. Las comunidades
interpretativas no necesariamente se estructuran sobre determi-
naciones objetivas tales como la etnia, la nacionalidad o la clase
social.
A diferencia del concepto de comunidades lingsticas, la
nocin de comunidades interpretativas deja entrever que los
miembros de estas comunidades comparten un mismo ancla-
je de sentido (Barthes, 1995): participan de una constelacin

178

GH VLJQLFDFLRQHV FRPXQHV DUWLFXODGDV GH PDQHUD VHPHMDQWH


HVWDEOHFLHQGR FRQJXUDFLRQHV VLPLODUHV D SDUWLU GH ODV VLJQL-
caciones presentes en una produccin cultural que comparten.
Esto equivale a decir que no se trata necesariamente de grupos
KRPRJpQHRVVHJ~QORVFULWHULRVVRFLROyJLFRVODVHGDGHVODVSUR-
fesiones, los recursos econmicos, pueden ser desiguales.
Las transformaciones tecnolgicas y las posibilidades habili-
tadas por la Internet han introducido variantes en este concepto.
Muchas comunidades interpretativas son comunidades virtua-
OHVRFtUFXORVGHDPLJRVVXVFULSWRVDEORJVRDIRURVHVSHFtFRV
(VWDQRYHGDGKDDPSOLDGR\GLYHUVLFDGRODQRFLyQGHFRPXQL-
dades interpretativas, en al menos tres dimensiones: a) ya no
estn vinculadas estrictamente a pblicos sino a prosumidores
(Tapscott, 1997), b) su alcance territorial se expande, pues no
existen restricciones de distancias en la participacin virtual y
F  DTXHOOR TXH VH FRPSDUWH VH GLYHUVLFD \ PXOWLSOLFD QR VH
circunscribe a opiniones y comentarios como expresiones sub-
jetivas o intersubjetivas en relacin al orden pblico sino que
incorpora la revelacin de la intimidad. Filiadas en la lnea de
los pblicos, las comunidades interpretativas de las redes inter-
vienen en la vida social y desarrollan un modo de relacin que
ya describimos: el de la interaccin. En este sentido, trabajan
activamente en la construccin de acuerdos, organizacionales,
de contenido u opinin y pragmticos y se mantienen abiertas y
porosas, permeables a los cambios en el interjuego propio y con
sus contextos. Conjugan de manera emblemtica las dimensio-
nes y caractersticas de un espacio pblico en reformulacin.

179

Interacciones virtuales, sentimientos y acciones


sociales
Desde 1990, la llamada esfera pblica ha sido inundada por
producciones que exhiben la intimidad. Los nuevos formatos
PHGLiWLFRV SHUR WDPELpQ ODV QXHYDV FODYHV GH OHJLWLPDFLyQ GH
los discursos, remiten a la interioridad de los sujetos. No se trata
VRODPHQWHGHODSXHVWDHQHVFHQDGHODYLGDFRWLGLDQDDWUDYpV
GH WDONVKRZV \ UHDOLW\VKRZV ,OORX]   VLQR WDPELpQ GH
XQDDSHODFLyQDOVHQWLPLHQWRFRPRMXVWLFDFLyQYiOLGD
(VWRVJpQHURVVHFDUDFWHUL]DQSRUERUUDUODVPDUFDVFFLRQD-
les y los rastros del proceso productivo del que emergieron, para
erigirse en testimonios y confesiones, utilizando una retri-
ca de la espontaneidad y la autenticidad y presentndose como
la revelacin de lo ntimo y lo cotidiano. Como seala Leonor
$UIXFK  ORVPRPHQWRVELRJUiFRVGHODQDUUDWLYDPH-
ditica y el acontecimiento en boca de sus protagonistas o de sus
WHVWLJRVGLUHFWRVVRQFDSDFHVGHJHQHUDUODFRQDQ]DTXHSURFH-
de de la plenitud de la presencia y producir efectos de verdad y
certeza. Cuando no se trata de la narracin personal de boca de
ORVDXWRUHVVHDSHODDODQDUUDFLyQELRJUiFDHQERFDGHRWURV
revelada en mbitos de interaccin diversos. En otros casos,
el autor-narrador-conductor aparece en actitud de bsqueda,
encontrndose con estos relatos de las vivencias ajenas en su in-
tento por explorar el alma humana. Es casi la condicin no dicha
de las presencias instaladas en los medios: quien comparece en
sus escenarios debe estar dispuesto a contarlo todo, a vaciar su
interioridad frente a los ojos de los otros.
(VWRVJpQHURV\IRUPDWRVGLVFXUVLYRVQRVRQSDWULPRQLRH[-
clusivo de los medios sino que coexisten con blogs o bitcoras
personales y sitios de intercambio social de la web o redes socia-
les en donde el me gusta sintetiza cabalmente la orientacin

180

VXEMHWLYLVWD&XDOTXLHUDVHDHOPpGLXPODVIRUPDVGLVFXUVLYDV
TXH FRQVWLWX\HQ HO HVSDFLR ELRJUiFR VLJXLHQGR DTXt WDP-
ELpQODGHQLFLyQGH$UIXFKWRPDQFRPRWHPDFHQWUDOODQDUUD-
cin en primera persona de las vidas y se enfocan especialmen-
te en el relato de las emociones. Aun cuando estas narrativas
QR WHQJDQ PD\RU LQWHUpV R QLQJXQR HQ WpUPLQRV GHO LQWHUpV
JHQHUDOVXVFLWDQSURFHVRVGHLGHQWLFDFLyQUHFODPDQGRXQD
virtual comunidad entre el pblico-comentarista y los acto-
res-escritores que desenvuelven su vida en espacios pblicos,
semipblicos o privados, generando una unidad emocional.
Casi a la inversa de lo que ocurri con los medios masivos,
TXH SUHWHQGLHURQ GXUDQWH XQRV  DxRV VHU UHHMR GHO PXQ-
do (Vern, 1983), la Internet rpidamente proporcion una
FDQWLGDGGHIRUPDWRV\SODWDIRUPDVTXHSHUPLWLHURQHOUHHMR
del interior. Esta plataforma incluye los medios tradicionales.
Sin embargo, lo ms novedoso es su capacidad de construir una
multitud de pequeos mundos, en la forma de redes de inter-
cambio que replican la lgica y el tono de la relacin interperso-
nal. Al facilitar la incorporacin de elementos diversos, mues-
tran an ms que lo que permitira una relacin cara a cara: una
exposicin de facetas, escenas y fragmentos de las biografas
que se consideran ntimas y slo confesables a los ms cer-
canos. Como sucede en la relacin interpersonal, los usuarios
aprenden rpidamente los cuidados y prevenciones que deben
WHQHUHQVXDXWRSUHVHQWDFLyQ/DWpFQLFDGHOFXLGDGRGHODLPD-
JHQ TXpPRVWUDUFyPRPRVWUDUVHFXiQWRFRQWDU\DTXLpQHV 
fueron confundidos con una suerte de narcisismo, sin notar que
se trataba de un proceso ya conocido: el de la representacin
en un espacio interpersonal, como lo era el paseo en la plaza
pblica en donde los ciudadanos se exhiban, slo que en este
caso se utilizan nuevos dispositivos al servicio de una operacin
muy conocida.

181

&LHUWDPHQWHHVWDFDUDFWHUtVWLFDELRJUiFDHLQWLPLVWDGHODV
narrativas contemporneas, segmentadas en microrrelatos o pe-
queos relatos (Angenot, 2006), son consideradas parte de un
proceso de banalizacin de la esfera pblica. Aparentemente se
WUDWDUtDGHXQDVFHQVRGHODLQVLJQLFDQFLD &DVWRULDGLV 
Creo que pueden interpretarse mejor como un retorno de lo
reprimido, como una revancha de los sentimientos sobre una
GHQLFLyQGHORVRFLDOTXHVHHVIRU]yHQQHJDUORVRFRQWURODUORV
Como he tratado de argumentar, la vida privada y la pblica
no estn desencontradas, y la relacin social se nutre de la re-
lacin interpersonal. En el caso de las redes que actan desde
la Internet, la circulacin de informacin es velocsima y muy
HFD] 7DQWR VH RULHQWD D OD YLGD SULYDGD \ HPRFLRQDO FRPR DO
mundo circundante; tanto puede ser un espacio de autopresen-
tacin y construccin de relaciones interpersonales como cons-
WLWXLUVHHQIRURVVHPLH[SHUWRVGHDFLRQDGRV<SXHGHFRPRVH
ha revelado en numerosas ocasiones, convocar a la accin direc-
WD FRPR ODV DVKPREV R LQVWDQW FURZGV 5KHLQJROG   R
OWUDULQIRUPDFLyQUHOHYDQWHSDUDHOFRQMXQWRVRFLDO(VWiFODUR
que no reemplazan la accin colectiva organizada, pero ofrecen
un medio que posibilita esta organizacin.
4XHGDSHQGLHQWHPRVWUDUGHTXpPDQHUDODUHYHODFLyQGHOD
intimidad, la exhibicin de las emociones, podra fertilizar el es-
SDFLRS~EOLFR,QWHQWDUpHQWRQFHVDFRPHWHUHVDWDUHD
En el libro Sobre la revolucin, Hanna Arendt (1992) se in-
terroga sobre las posibilidades de transformacin del orden
social a partir de la accin poltica. En el captulo titulado La
cuestin social, analiza y compara la revolucin que dio lugar
a la independencia de Estados Unidos y la revolucin francesa.
Parte de sealar las muy distintas condiciones sociales en que
se hallaban la poblacin en uno y otro caso. En Estados Unidos,

182

la pobreza no planteaba situaciones acuciantes; la riqueza del


WHUULWRULRDPHULFDQRRIUHFtDVXFLHQWHVHJXULGDGDORVDYDWDUHV
de la subsistencia. En cambio, la esclavitud constitua un contra-
sentido con el principio de la libertad. La revolucin francesa, en
FDPELRGHEtDGDUUHVSXHVWDDPXOWLWXGHVIDPpOLFDV&RPSHOLGRV
por la gravedad de la situacin social, el discurso libertario de los
revolucionarios vir muy rpidamente y pas a concentrarse en
las necesidades del pueblo.
Los revolucionarios franceses se sintieron movidos por la
compasin. Para Arendt, la compasin es una pasin, una emo-
cin elemental que no est mediada por la razn y que, por lo
tanto, no puede traducirse en palabras sino que da lugar a ac-
tos. Es siempre singular: sentimos compasin por alguien, en
una situacin concreta. En cambio, la piedad es un sentimiento
mediado por la virtud y puede volverse parte de un discurso que
tome en cuenta, con alguna generalidad algo mayor, la situacin
de un grupo. En tanto admite esta mediacin que es racional-,
HVFDSD]WDPELpQGHFUXHOGDGFRPRHOFLUXMDQRTXHDPSXWDXQD
pierna gangrenada a un enfermo. E incluso puede revertirse para
vanagloria de quien la expresa, que aprovecha la ocasin de la
desgracia ajena para exhibir la nobleza de su corazn piadoso.
Arendt sostiene que la fundacin de una sociedad no puede
basarse ni en la compasin ni en la piedad. La compasin no ac-
ta ms que en singular; la piedad, por su parte, puede dar lugar
tanto a la crueldad como a la misericordia, pero no a la justicia.
La misericordia lleva a equilibrar situaciones desiguales, a con-
siderar de manera distinta cada situacin, atendiendo a las pe-
culiaridades. La justicia, en cambio, es una norma imparcial que
iguala. En este sentido, Arendt sigue la posicin de Adam Smith.
Para ella, los sentimientos y las emociones no pueden fundar una
sociedad humana justa. Slo el espectador imparcial da lugar a la
justicia. La alternativa que propone es la solidaridad, que implica

183

la adhesin a un principio general abstracto. Descarta, pues, que


la organizacin social pueda apoyarse en dimensiones subjetivas.
Pero un principio abstracto de este tipo reemplaza la implica-
cin con un convencimiento racional. Algo del orden de la sim-
pata, de la comunicacin de lo que se siente, necesita asociarse
como sentimiento al principio de la solidaridad para que el com-
SURPLVRUHVXOWHHFD]&RPRVDEHPRVORVVHQWLPLHQWRVQRVRQ
espontneos, forman parte del ethos colectivo y se promueven
socialmente (Le Breton, 2002). Como Hume sealaba, la simpa-
WtD RODHPSDWtDSDUDXVDUXQWpUPLQRPiVDItQDOFDPSRFRPX-
nicacional) depende de que exista un espacio compartido, una
puesta en comn. Retomando la lectura de Arendt, Luc Boltanski
(1993) desarrolla justamente esta relacin, a partir de una pers-
pectiva novedosa porque realza un sentimiento, la compasin, en
cuanto a su potencial dinamizador de acciones sociales, y a los
medios como el componente social que permite que el conjunto
se informe sobre un hecho y se movilice.
Para Boltanski, el espectculo del sufrimiento puede mover
a la accin colectiva y, en ese sentido, desencadenar acciones
polticas. Favorece el pasaje del espectador imparcial al actor
comprometido: por este lado, el sentimiento y el espacio pblico
encuentran un lugar de convergencia. Y subraya: Un espacio p-
blico no est solamente orientado como lo estar ms tarde el
laboratorio- hacia el ideal de una objetividad sin perspectiva. La
FRQVLGHUDFLyQGHOVXIULPLHQWRPRGLFDODVFRQGLFLRQHVGHOGHED-
te; somete notoriamente a la urgencia exigente de las personas,
el compromiso por las causas (Boltanski, 1993: 53. Traduccin
propia).La reaccin, este pasaje a la accin, requiere como condi-
cin que los pblicos conozcan lo que acontece.
La condicin de la visibilidad o de la informacin es necesa-
ULDSHURQRVXFLHQWHFRPRSDUHFHSHQVDU%ROWDQVNL/DHVIHUD
pblica est obligada por la institucin social que establece las

184

condiciones de posibilidad de un encuentro entre sus miembros,


MDQGROHQJXDMHV\FyGLJRVTXHSRVLELOLWDQODFRPXQLFDFLyQLP-
SRQLHQGRQRUPDV\GHQLHQGRWDQWRORViPELWRVFRPRORVDFWR-
res de la interaccin (Trom, 2008). Es, pues, la circulacin de
informacin, la publicidad de los acontecimientos, la visibilidad,
XQRGHORVWpUPLQRVLQYROXFUDGRVHQODUHVSXHVWDEXVFDGD(QOD
vida poltica, la manifestacin es mucho ms territorial que la
representacin (cuerpos concretos, versus smbolos y signos) y
las acciones sociales se despliegan en las coordenadas del tiempo
y el espacio. En ese sentido, el mundo virtual asociado al mundo
concreto no lo reemplaza. Pero todo aquello que es simbolizable
HVGLJLWDOL]DEOHLQIRUPDFLyQUPDVDPRGRGHDSR\RFRQYHU-
saciones, imgenes, opiniones, circulacin de dinero. E incluso,
sabotajes a las redes que posibilitan en sostenimiento de buena
parte del mundo concreto. Los mundos son complementarios y
estn imbricados. Las interacciones en las redes pueden ser el
ncleo de una nueva forma de las relaciones en el espacio p-
blico, ms co-operativas y en construccin conjunta, capaces de
compartir sentimientos y relacionando singularidades.
Sin duda, los medios masivos y las redes sociales desarrollan
a su manera- una tarea de informacin y de movilizacin de
afectos. /DLGHQWLFDFLyQ\ODH[KLELFLyQGHODVHPRFLRQHVQRHV
contradictoria con la accin en el espacio pblico, no necesaria-
mente desensibiliza ni es mera morbosidad. Desde este punto
de vista, y en la medida en que el relato de los padecimientos
pudiera superar la dimensin singular del personaje para identi-
FDUVHFRQXQDUHLYLQGLFDFLyQFROHFWLYDWRGRVORVPHGLRVGHORV
que disponemos podran volverse promotores de la reunin y la
coordinacin de acciones polticas.

185

Bibliografa
ANGENOT, Marc, Fin de los grandes relatos, privatizacin de la
utopa y retrica del resentimiento. Estudios, 17, 21-34. Cr-
doba, Centro de Estudios Avanzados de la Universidad Na-
cional de Crdoba, 2005.
ARENDT, Hannah (1963/1988), Sobre la revolucin (3. ed.). Bue-
nos Aires, Alianza.1992.
ARFUCH/HRQRU(OHVSDFLRELRJUiFR%XHQRV$LUHV)RQGRGH
Cultura Econmica, 2002.
BADIOU, Alain (1997), San Pablo. La fundacin del universalismo.
Barcelona, Anthropos, 1999.
BARTHES, Roland (1986), Lo obvio y lo obtuso. Barcelona, Paids.
1995.
BOLTANSKI/XF/DVRXIIUDQFHjGLVWDQFH3DULV0pWDLOLp
BOUGNOUX, Daniel (1998), Introduccin a las ciencias de la comu-
nicacin. Buenos Aires, Nueva Visin, 1999.
CASTORIADIS &RUQHOLXV   (O DYDQFH GH OD LQVLJQLFDQFLD
Buenos Aires, EUDEBA, 1997.
CEFA'DQLHO/RVPDUFRVGHODDFFLyQFROHFWLYD'HQLFLRQHV\
problemas. En Ana Natalucci (ed.), Sujetos, movimientos y
memorias. Relatos del pasado y modos de confrontacin con-
temporneos (pp. 49-80). La Plata, Al Margen, 2008.
CUCHE, Denys (1966), La nocin de cultura en las ciencias socia-
les. Buenos Aires, Nueva Visin, 2002.
FISH, Stanley, Interpreting the Variorum. Critical Inquiry, Vol.
2, 3 (Spring), pp. 465-485. The University of Chicago Press,
1976.
FOUCAULT0LFKHO  /DKHUPHQpXWLFDGHOVXMHWR&XUVRHQ
el Collge de France 1981-1982. Buenos Aires, Fondo de Cul-
tura Econmica, 2002.
186

FREUD, 6LJPXQG 2EUDV FRPSOHWDV 0DGULG %LEOLRWHFD 1XHYD


2001.
GOFFMAN, Erving (1959/1981), La presentacin de la persona en
la vida cotidiana (2 ed.). Buenos Aires, Amorrortu. 1994.
HABERMAS, Jrgen (1962), Historia y crtica de la opinin pbli-
ca. Barcelona, Gustavo Gili, 1981.
HABERMAS, Jrgen (1981), Teora de la accin comunicativa. Ma-
drid, Taurus, 1987.
HOBBES, Thomas (1651/1940), Leviatn. Madrid, Alianza. 2009.
ILLOUZ (YD 2SUDK :LQIUH\ DQG WKH *ODPRXU RI 0LVHU\ $Q
Essay on Popular Culture. New York, Columbia University
Press, 2003.
LE BRETON, David (1992), Sociologa del cuerpo. Buenos Aires,
Nueva Visin, 2002.
MATTELART $UPDQG   /D FRPXQLFDFLyQPXQGR 0p[LFR
Siglo XXI editores, 1996.
ORTEGA Y GASSET-RVp  /DUHEHOLyQGHODVPDVDV%XHQRV
Aires, Crculo de Lectores, 1983.
RHEINGOLD, Howard (2002), Smart Mobs: The Next Social Revo-
lution. New York, Perseus Books. 2003
SENNETT, Richard (1974/1978), El declive del hombre pblico (2
ed.). Barcelona, Pennsula. 2002.
SEOANE PINILLA, Julio, Del sentido moral a la moral sentimental.
Madrid, Siglo XXI de Espaa editores, 2004.
SHILS, Edward (1960), La sociedad de masas y su cultura. En
VV.AA., Industria cultural y sociedad de masas. Caracas,
Monte vila editores, 1974.
SMITH, Adam (1759/1978), Teora de los sentimientos morales
HG 0p[LFR)RQGRGH&XOWXUD(FRQyPLFD
SWINGEWOOD$ODLQ  (OPLWRGHODFXOWXUDGHPDVDV0p[L-
co, Ediciones Coyoacn, 2003.
TAPSCOTT, Don, The Digital Economy: Promise and Peril In The

187

Age of Networked Intelligence. New York, McGraw-Hill,


1997.
TARDE, Gabriel (1901), La opinin y la multitud. Madrid, Taurus,
1986.
TAVERNIER $XUpOLH 'HO VDEHU VRFLROyJLFR DO FRQRFLPLHQWR H[-
perto poltico y meditico: institucionalizacin, difusin y
fragmentacin de saberes. En Natalucci, Ana (ed.), Suje-
tos, movimientos y memorias. Relatos del pasado y modos
de confrontacin contemporneos, pp. 103-121. La Plata, Al
Margen, 2007.
TCHAKHOTINE6HUJH  (OVHFUHWRGHOp[LWRGH+LWOHU
la violencia psquica. En de Moragas Miguel (comp.), Socio-
loga de la comunicacin de masas. Barcelona, Gustavo Gili.
1982.
TROM, Danny, Gramtica de la movilizacin y vocabulario de mo-
tivos. En Natalucci, Ana (ed.), Sujetos, movimientos y memo-
rias. Relatos del pasado y modos de confrontacin contempo-
rneos (pp. 21-48). La Plata, Al Margen, 2008.
VARELA, Mirta, De las culturas populares a las comunidades in-
terpretativas. Dilogos de la comunicacin, 56, pp. 92-103,
1999.
VERN, Eliseo, Construir el acontecimiento. Buenos Aires, Gedi-
sa, 1983.
WEBER0D[  /DpWLFDSURWHVWDQWH\HOHVStULWX
del capitalismo. Puebla, Premi. 1991.
WILLIAMS, Raymond (1980), Marxismo y literatura. Barcelona,
Pennsula / Biblos, 1997.

188

CAPTULO VIII

Lugares de vida. Nueva escena


de espacios culturales emergentes
de exhibicin en la ciudad de La Plata

Por Matas David Lpez

Primeras palabras
Este trabajo se pregunta por la existencia de una nueva escena
cultural en la ciudad de La Plata a partir de la emergencia de m-
bitos de presentacin, exhibicin y circulacin de producciones
FXOWXUDOHV HVSHFtFDPHQWH GH SURGXFFLRQHV YLVXDOHV GLEXMRV
LOXVWUDFLRQHV JUDEDGRV YLGHRLQVWDODFLRQHV IRWRJUDItDV JUDI-
tis, pinturas-. El resto de los interrogantes que guan este trabajo
sern cmo es la construccin da las propuestas en cuanto a la
DJHQGD\FXUDGXUtD"4XpOXJDUOHDVLJQDQDOHVSHFWDGRUHQHVRV
QXHYRVHVSDFLRV"4XpYtQFXORVWLHQHQFRQORVHVSDFLRVLQVWLWX-
cionales-estatales dedicados a la promocin de los artistas y cul
es su posicionamiento sobre estos? Cmo es el vnculo entre de
estos espacios privados con lo pblico?
Se inici el trabajo con un revelamiento de espacios cultu-
rales y se contabilizaron ms de veinte que tienen como carac-
tersticas en comn haberse creado en los ltimos aos -desde
el 2010 muchos de ellos- y estar emplazados, la mayora, en el

189

casco urbano de la ciudad. De este total seis experiencias fueron


tomadas para el anlisis, se trata de los casos de Casa Cest la
vie, Galera Mal de Muchos, Galera y Librera Siberia, Galera
Club Csmiko, Galera del club Alborada y las muestras orga-
nizadas por Sntoma Curadores, esta ltima experiencia tiene
como particularidad de que no es ni posee un lugar propio,
VLQRGHXQDSURSXHVWDFXUDWRULDOTXHYDPRYLpQGRVHSRUGLIH-
rentes espacios, aunque la mayor parte de sus muestras se reali-
zaron en el Club Alborada.1
Siguiendo una perspectiva metodolgica principalmente cua-
OLWDWLYDHQFXDQWRDODVWpFQLFDV\KHUUDPLHQWDVGHFRQVWUXFFLyQ
de datos y fuentes, se llev adelante un trabajo de campo -desde
mediados de 2012 y que actualmente contina- que consisti en
la confeccin de un cuaderno observaciones de las muestras y
exhibiciones realizadas en todos los espacios, adems de obser-
vaciones a otras prcticas cotidianas desarrolladas all, el acopio
GHPDWHULDOHVJUiFRV FDWiORJRVSRVWDOHVDFKHV XQUHJLVWUR
IRWRJUiFRODGHVDUUROORGHXQDVHULHGHHQWUHYLVWDVDRUJDQL]D-
dores y participantes de los espacios culturales y, por ltimo, un
seguimiento de archivo virtual de sus sitios web, blogs y espacios
en redes sociales.

1 Adems de estos espacios, en el relevamiento se encontr que existen otros lugares


como: Cocina de Arte de En eso estamos, El Tallercito, El Hormiguero, Piso uno arte y
diseo, Vendrs alguna vez Espacio Cultural, Taller Tormenta, Rotisera artstica -espacio
de Felina Super Herona-, Residencia Corazn, Taller Naranja, Zule arte+taller, La Catrina
Galera Taller y Mercadito de obra, Casa 8, Azul un Ala, Taller del Caleidoscopio, Casa
Flotante, Aerosol Gallery, Piqui Pantera Multiespacio dedicados, en su mayora, al desarrollo de talleres, cursos y espacios de produccin.

190

Una aproximacin a los espacios


&RPHQ]DUHPRVSRUGHQLUORVFRPRespacios culturales para
poder conceptualizarlos desde una terminologa que no limite
al conjunto de las experiencias que se analizar. Por eso, pre-
IHULPRVQRXWLOL]DUORVWpUPLQRVJDOHUtDVQLHVSDFLRVGHDUWH
(aunque sean dos de los ms usados por las propias experien-
cias). En ese sentido, se propone utilizar y adoptar la palabra
culturales como adjetivo por el de arte. A su vez, se le agre-
gar de exhibicin para sumar una caracterstica que puede
GLVWLQJXLUORV GH RWURV HVSDFLRV FXOWXUDOHV TXH WDPELpQ WLHQHQ
importancia en la ciudad (sea por caso los centros culturales y
sociales, galpones culturales, etc.), experiencias que no entrar
para el anlisis en los propsitos de este trabajo. Adems, se los
entender como espacios emergentes ya que se trata de mbitos
generados recientemente todos datan en su constitucin de la
~OWLPDGpFDGDRGHDxRVUHFLHQWHVSHURVREUHWRGRSRUSURSR-
ner y poner en escena una nueva camada o generacin de pro-
GXFWRUHVFXOWXUDOHV HQHOGLEXMRODSLQWXUDHO JUDIWLHOJUD-
bado, la msica y la produccin audiovisual- que conformaran
un nuevo escenario cultural, integrado por prcticas de gestin
FXOWXUDOUHGHVGHDQLGDGFLUFXLWRVGHH[KLELFLyQ\FRQVXPRGH
bienes y producciones culturales.
Desde esta perspectiva, estos espacios culturales emergentes
de exhibicin por todo lo anterior no slo entendidos como es-
pacios fsicos para juntarse (y muchas veces amontonarse)- qui-
zs sean el modo de organizar cierta intelegestsia cultural con-
tempornea en la ciudad y de engendrar sus propios (micro)cli-
mas. Actualmente estos espacios culturales quizs sean como
en otros momentos fueron las revistas culturales- los lugares
de vida, de entreteje de cdigos, relaciones y amistades -pero
WDPELpQSRUHVRPLVPRGHPDQLIHVWDFLyQGHH[FOXVLRQHV\VH-

191

lecciones-, los que propician los encuentros y las apuestas, as


como los lugares donde pueden seguirse las batallas de ideas y
disputas de posiciones en el campo cultural. Adems, seran los
lugares desde donde trazar el mapa de las sensibilidades (intelec-
tuales, culturales, artsticas, relacionales, etc.) de este momento
presente.2
Ahora bien, a quienes integran y participan de estos espa-
FLRVSRGUtDPRVLGHQWLFDUORVFRPRXQDHOLWHFXOWXUDOSHURFRQ
una sustancial diferencia respecto de lo que se podran llamar
elites dirigentes. Porque estos actores son dentro del aparato
institucional-estatal local y provincial quienes ocupan all posi-
ciones subordinadas. Los gestores/organizadores y participantes
de los espacios culturales no integran un gabinete de ministros
ni forman parte de la construccin y decisiones de las polticas
culturales en el municipio, la universidad o la provincia. Si bien
muchos de ellos trabajan e integran estas maquinarias pudimos
relevar que varios son docentes, no-docentes y estudiantes uni-
versitarios, empleados estatales en ministerios e incluso en de-
pendencias ligadas a la cultura como teatros y museos, datos

2 Teniendo presente el fuerte imperativo econmico-comercial que permea todos los aspectos de la vida, Isabelle Graw, entender parte de la estrecha relacin entre mercado
y arte. En ese sentido, la autora considera que: la economizacin de las esferas incluso
ms privadas e intimas es la consecuencia del giro biopoltico y bioimperativo capaz de
influir sobre el modo en que la gente vive sus vidas, concretamente. Si se considera que la
vida es un objeto privilegiado de la actividad humana, entonces el arte, para el cual la vida
siempre represent una fuerza productiva, se vuelve a la vez una actividad prominente. Es
por eso que veo a los artistas como proveedores de vida, especialistas en inyectar vida
a las cosas. (Graw, 2013: 19). Pero sostenemos que desde la perspectiva materialista
cultural que aqu se plantea- no seran slo los artistas (o mejor, los productores) los
nicos generadores de vida sino que seran tambin los gestores culturales, los curadores y los participantes quienes al constituir una escena, ciertos lugares y circuitos de
relaciones, afinidades y redes cada vez ms amplios, mviles, reconocibles- generan y
sostienen la vida.

192

FRQORVTXHVHSXHGHQLGHQWLFDUFLHUWDVIRUPDFLRQHVHGXFDWLYDV
rasgos profesionales y accesos culturales-3 no se puede observar
el desarrollo de algn tipo de articulacin poltica; por lo que se-
ran procesos paralelos antes que imbricados.
Entonces, se trata de actores que cumplen un rol subordina-
do en el andamiaje estatal-institucional pero que consideramos
toman la posta y llevan la delantera en la gestin y produc-
cin cultural en la ciudad, porque generan eventos culturales de
pequea y mediana escala de relevancia para circulacin y movi-
miento de producciones y experiencias, de productores y parti-
cipantes/espectadores. Entonces podramos hablar de la emer-
JHQFLDGHXQDpOLWHFXOWXUDOTXHVHempodera por fuera de las
instituciones formales de las que muchas veces forman parte.
A su vez, no podemos encontrarlos como actores importantes
dentro del mercado del arte contemporneo4 aunque existan
intentos incipientes de generar un mercado de arte joven o arte
emergente. En este sentido, son espacios que se predisponen cada
vez ms con pequeas tcticas y herramientas de comercializa-
cin- a vender obra no slo en las presentaciones de las muestras
sino generando eventos o espacios permanentes de trastienda
con una cartera y seleccin productores. Como caractersticas co-
munes en todos los espacios se trata de venta minorista, a una esca-
la local y principalmente de obras de pequeo y mediano formato.

3 Si bien mayormente encontramos cierta reivindicacin a la formacin en oficios y talleres, as como a la formacin de la propia prctica, en el hacer cotidiano, -como, por
ejemplo, en la produccin y gestin de eventos-, tambin existen entre los actores recorridos por instituciones educativas formales. As, en relacin a las carreras universitarias y
terciarias que cursaron o concluyeron los entrevistados encontramos: museologa, diseo
industrial, artes plsticas -como dibujo y grabado-, escenografa, historia del arte, canto.
4 Situacin similar a las nuevas editoriales independientes y autogestivas en relacin el
mercado editorial de libros y revistas.

193

Sin embrago, si bien estos espacios todava- no son actores


destacados y sistemticos en la valoracin econmica-comercial
de obras y producciones rol de cumplen otros actores como
PXVHRVJDOHUtDVHWFVLSRGHPRVDUPDUFRQVRQDFWRUHVIXQ-
damentales en la valoracin y legitimacin simblica-cultural
de producciones y productores emergentes, constituyendo as
un capital simblico (Bourdieu, 2002, 2007; Graw, 2013) dife-
rencial para estos.5 A su vez, entendemos que se desarrolla una
sinergia comn: los espacios legitiman a ciertos productores y
producciones, estos productores legitiman a los espacios al bus-
car o aceptar mostrar sus producciones all y los participantes/es-
pectadores legitiman a los productores y los espacios culturales.
Csmiko VH GHQH FRPR JDOHUtD GH DUWHFOXE GH DPLJRV
/RVSURGXFWRUHVTXHPiVSURPXHYHVRQ$FWLYDFL|Q0RQDVWpU
Agua Helada, Felina SuperHerona, Juan Rux (Festn Mutante),
Valentino Tettamanti, Vic (Victoria Galeano) y Tormenta, entre
otros. Buscan que se presente una muestra por mes. Las princi-
pales actividades del espacio, adems de las muestras, son la pe-

5 Dentro de la literatura disponible que se dedica al anlisis del arte contemporneo


y los circuitos de exposicin y legitimacin, resulta interesante el aporte de Raymonde
Moulin que afirma la constitucin de los valores artsticos es el resultado de la articulacin del campo artstico y el mercado. En el campo artstico se producen y se revisan las
evaluaciones estticas. En el mercado se realizan las transacciones y se evalan los precios. Si bien ambos tienen su propio sistema para el establecimiento del valor, estos dos
circuitos mantienen una estrecha interdependencia en sus relaciones. () Si en todos
los mercados artsticos reina la incertidumbre sobre el valor de las obras, el mercado
de arte contemporneo constituye, en efecto, el mbito de la incertidumbre mxima.
(Moulin, 2012: 13-14). Para la autora este es un mercado estrecho y evolutivo. En
ese sentido, casi en oposicin a las galeras de arte tradicional que evitan la toma de
riesgo que se asocia a la innovacin y supeditan la eleccin de artistas por el poder
adquisitivo de su clientela; las galeras que se dedican al arte contemporneo ponen en
prctica un circuito de valoracin cultural. La ecuacin as es inversa: fabricacin de la
demanda contra sumisin a la demanda (Moulin, 2012: 32-33).

194

OXTXHUtD&RUWH6DOYDMHWDOOHUHV\HYHQWRVFRPRHVWDV\REUDV
de teatro. Muchas de las actividades que realizan se vinculan
con la escena cultural alternativa portea: recitales de Fauna,
Chancha Va Circuito, Rosario Blefari, Sara Hebe, Villa Diaman-
te, Sonido Campen, exposiciones de integrantes del street art
de Buenos Aires como Pum Pum, Nerf y Malatesta o algunos
WDOOHUHV7DPELpQVHREVHUYDXQDDUWLFXODFLyQFRQODJDOHUtDGH
arte Fiebre ubicada en la Galera Patio del Liceo, Recoleta- en
donde CSMK ha realizado muestras con artistas platenses en el
circuito porteo (llamada Invasin platense) y con el espacio
Trivenchi. En abril de 2012 Csmiko se mudo de casa pero no
de barrio; ubicado desde ese momento en una casa antigua en
calle 70 esquina 10, compone junto con el Espacio Tormenta y
el Espacio de Felina Super Herona un nuevo pequeo polo de
produccin cultural en la zona sur-este de la ciudad. Robertito y
Leandro los organizadores de Csmiko que a su vez integran al
colectivo Activacin Monastr- plantean que su propuesta:
Surge en s por el tema que haba muchsima gente pin-
tando y por ah no haba espacios en La Plata en don-
de mostrar que fueran alternativos, haba galeras ms
acadmicas o para otro tipo de artistas. Y como galeras
MyYHQHV QR KDEtD \ VXUJLy DVt LQYLWDU D HVRV DUWLVWDV D
hacer muestras. Cada un mes se cambian las muestras y
FDGDDUWLVWDVKDFHDVXDQWRMRORTXHTXLHUDKDFHU
Nos gusta darle la habitacin para que puedan llegar a
tunearla como quieran, que no sea solamente colgar un
cuadrito o una foto, darle libertad en la composicin.
Nos gusta lo que invitamos. La variedad, la cuestin
csmica, en el sentido de las variedades, de que todo

195

FRQYLYD /DLGHDGHOQRPEUHHVHOGHODFRQYLYHQFLDGH
que cada uno es un mundo, un universo y de la convivencia
de todo eso.

A su vez, la denominacin de Csmiko adems de galera es


la de Club. La idea de combinar la galera y con forma de club
surge de la idea de que un club es un espacio ms social, como
DUPD5REHUWLWRla idea inicial era asociar a la gente que vie-
ne con una acreditacin, ponele una cuota por ao, y despus
WHQtDVEHQHFLRV. Plantea que seguramente en algn momento
reactiven esa propuesta y formen legalmente un club. La forma
de funcionamiento del espacio es adems de los dos responsa-
EOHV XQD UHG GH DPLVWDGHV \ DQLGDGHV TXH KDFHQ SRVLEOH ODV
actividades.
Mal de muchos es una propuesta que integra una tienda de
ropa y accesorios (o de conceptos y cosas para la vida como
enuncia su slogan) y un espacio de galera. Ubicada en un anti-
guo local en el centro de la ciudad -49 e/ 4 y 5-, la galera bus-
ca generar una propuesta propia construyendo una agenda de
exposiciones, muestras y pequeos recitales. Algunos de los
productores que han pasado con sus muestras son: Luxor, Una
mueca rusa, Santi Casiasessino, Tormenta, Corina Arrieta y
soyGarbncompraMiscuadros, Felina SuperHerona y Valentino
Tettamanti, entre otros. Las recientes actividades que inaugura-
ron la galera en el 2013 fueron el festejo de aniversario de Una
Mueca Rusa y continu con la muestra Solo viento sin viento
compuesta por dibujos, video e instalacin de Daniel Lorenzo.
En cuanto a algunas de las bandas y msicos que realizaron re-
citales tanto como fechas propias como en el marco de alguna
de las muestras- fueron: 107 Faunos, Las Culebras, Javi Punga y
Matas Tanco; al mismo tiempo en muchos eventos hubo espa-
cio para DJs y VJs como Cristian Carracedo. En este sentido, Ve-

196

rnica, gestora del espacio sostiene que varios de estos eventos


son ms de carcter performtico / inmersivo que creo que
se destacaban de la banda que va a tocar. Desde el 2012 Mal
de Muchos a construir algunos criterios para la seleccin de las
muestras por ejemplo, habilitar un periodo de convocatoria,
buscar obras que sean particulares, privilegiar propuestas ex-
perimentales, entre otros- e incluso desde la Galera se comen-
z a participar en la organizacin y curadura de varias de las
muestras que se presentaron. En relacin al proyecto, Vernica
plantea:
La galera surgi en el mismo momento en que surgi el
proyecto de Mal de Muchos, la tienda con la galera inclui-
GD 3LHQVRD0DOGH0XFKRVFRPRXQFRQFHSWR
[los criterios de seleccin] tienen que ver ms que nada con
buscar particularidades, gente que tenga una obra pro-
SLDFRVDVTXHQRYHQJDQGHORDFDGpPLFR 3XHGHVHUXQ
colectivo de artistas que genere algo interesante. Pero me
gusta eso, la gente que va abrindose el camino, que creo
que es lo que hago yo tambin. Cuando abr no tena ningn
antecedente claro de lo que estaba haciendo. Haba centros
culturales pero no tena en mente a nadie con quien compa-
rarme, ms aun senta que iba improvisando y armando
las cosas as, aprendiendo a hacer lo que estaba haciendo,
QRWHQtDXQUHIHUHQWHFODUR 6DEtDTXHHUDDOJRPX\SHU-
sonal, eso s, de entrada. Saba que no era un centro cultu-
ral, quera plantearlo de otra forma, tena sus particulari-
GDGHV \RVHQWtDHVRTXHODJHQWHTXHH[SRQtDDKtHVWDED
como en mi casa.

197

A su vez, la apuesta del espacio es generar muestras y otras


actividades que apunten a lo experimental. En relacin a esos
momentos de espectacin9HUyQLFDDUPDQTXH
eran muy amenos, bastante ntimos y eso a la gente le
gustaba. Creo que es una caracterstica del lugar que la
JHQWHYD\VHHQFXHQWUD /DVLQDXJXUDFLRQHVVLHPSUH
tienen algo que hacen que no sean aburridas, que pase
DOJRFRSDGRTXHODJHQWHVHHQFXHQWUD\FRQYHUVD 
que se produca dilogo y eso no lo haba vivido en otro
lado, no digo que no suceda, a m no me haba pasado.

Siberia es una galera y librera de arte y diseo que se en-


cuentra en un pequeo local de diagonal 79 e/ 6 y 55. Abri sus
puertas en el ao 2011 pero con otra identidad: Isla era el nom-
bre que utiliz hasta casi la primera mitad de 2012 en la que
esa sociedad comercial y afectiva- se termin. A partir de ese
momento el local cambia de nombre y se pasa a llamar Siberia.
Tiene adems una dedicacin a la venta de libros de arte (cine,
fotografa, plstica, literatura, ensayo, cuento, etc.) que lo dis-
tingue de otros espacios culturales y lo acerca a los mbitos lite-
rarios y las editoriales independientes. La primera muestra que
abri el 2013 fue Misterio que emana la selva de Julia Dron,
OXHJR WDPELpQ VH UHDOL]DURQ XQ WDOOHU GH DUPDGR GH IDQ]LQHV \
junto a la Liga Promesa y Tempestad organizaron La unin
hace la fuerza actividad integrada por una excursin por el Bos-
que y el Museo de Ciencias Naturales, una merienda y un recital.
En palabras de Magdalena, gestora del espacio, Siberia
6HSHUODFRPRJDOHUtDGHOOHQRFRQDUWLVWDVTXHODEX-
UHQ JHQHUDU SUR\HFWRV HVSHFtFRV SDUD HO HVSDFLR TXH
en esos espacios interacten varias personas, porque

198

SDUDPtXQDGHODVFRVDVUHIXQGDPHQWDOHVHVHOWUDEDMR
HQHTXLSRHVPX\UH]DUSDGRDSUHQGHVXQPRQWyQ 
HVSDUDPtDOJRUHYDOLRVR 9DVDSUHQGLHQGRXQPRQ-
tn de cosas de otro, y uno tambin brinda eso que sabe.
(VWRVHSHUODXQSRFRHQWUHORTXHHVHOGLEXMR\ODSLQ-
tura y por el espacio de pequeo y mediano formato, me
parece que es la lnea que sigue el lugar. Que tambin
HVWDEXHQRTXHYD\DPRGLFDQGRDYHFHVSLHQVRTXHHV-
tara bueno que venga alguien y punge todo as gigante
y ya fue. Y me encanta cuando pasa eso, a pesar que sea
HQODOtQHDGHOGLEXMR\ODSLQWXUDPHUHLQWHUHVDFXDQGR
pasa.
Lo que intento que ac ocurra es que estemos siempre
en dilogo con gente de otro lugar. Eso me parece re
valioso. Porque cuando he organizado cosas que viene
gente de Capital o de otro lugar, la gente de La Plata no
viene a visitarlo, es bastante selectiva la ciudad en eso
me parece.

Cest la vie abri sus puertas en agosto de 2011 en una caso-


na antigua construida hace ms de 150 aos- compuesta por
terraza, mltiples espacios y techos altos se encuentra en la calle
55 e/ 4 y 5. La idea es que sea un casa de cultura que funcione
toda la semana.&RPRGLFHXQDGHODVFDUWLOODVGHSUHVHQWDFLyQ
8Q FHQWUR FXOWXUDO ~WHUR TXH HVWLPXOH QXWUD \ UDPLTXH OD
necesidad creadora por las calles y las mentes, el concepto de
Cest la vie vino a darnos cuerpo y cerrar el crculo. Durante
los das de semana en el espacio se desarrollan diferentes talle-
res de yoga, teatro, crnica periodstica y fotografa, literatura,
JUDIWLJXLWDUUD\FDQWRDODYH]TXHXQDFDIHWHUtD6HUHDOL]DQ
ciclos de lectura, presentaciones de libros y pequeos recitales

199

de msica en vivo de bandas y solistas. Adems, se plantea como


un espacio para muestras y exposiciones de pintura y fotografa,
por lo general, vinculando estas muestras con otras actividades,
pero recalcaron que no hay decisiones en cuanto a la curadu-
ra de las mismas. Para desarrollar las actividades que se em-
prendern desde el 2013, Cest la vie comenz a articular con
el grupo de gestores culturales Medio Limn. En abril de 2013
se abri un espacio de distribucin y venta de libros y revistas
de editoriales independientes gestionado por Malisia distribui-
dora y estantera. Se plantea como objetivo central promover
espacios de construccin artsticos orientados al intercambio y
el encuentro, por lo que la casa est abierta a recibir todo tipo
de propuestas. En ese sentido, siempre se est pendiente de la
incorporacin de nuevos talleres y propuestas de eventos. As,
la apertura a distintos proyectos artstico-culturales es una de
sus caractersticas, ya que incorpora muchas y variadas activida-
des. El corazn grande como una casa, el ttulo de una jornada
que se realiz con el objetivo de reponer dinero y herramientas
que fueron robadas en los ltimos das de 2012, puede ilustrar
el concepto que busca el espacio para con quien se acerque, que
pueda sentirse como en su casa. Natalia, la organizadora de la
Casa dice:
A qu lugar ira yo, a qu lugar me gusta ir a m, qu
es lo que quiero cuando voy a un espacio, la idea surgi
GHDKt PHJXVWDQORVOXJDUHVGRQGHFRQYHUVDQXQ
montn de disciplinas a la vez, donde poder ir a ver un
PRQWyQGHFRVDV'RQGHQRHVSHFtFDPHQWHYD\DVDYHU
una banda, o una exposicin, o ver uno que acta. (...)
y a mi particularmente no me gustan los lugares llenos
de gente [risas]

200

4XHGRODFDVDPHYR\DODFDVD (VXQDFDVRQD
cultural, la idea que sea la casa de todos. Tambin pasa
eso, como que la propuesta es re abierta que la gente
venga y proponga qu hacer en el espacio. Siempre la
pregunto eso a las personas cul es tu idea?

Alborada es un club y espacio cultural ubicado en 58 e/ 10


y 11 en el que se desarrollan actividades como Kun fu, diversos
talleres y se encuentra la biblioteca popular Florencio Ameghi-
no. Fundado hace 94 aos, se encuentra en estas instalaciones
desde 1950. A partir de 2011 una nueva Comisin Directiva de-
cidi generar cambios en el espacio e invit a jvenes producto-
res culturales de la ciudad para brindar espacios para talleres y
eventos culturales y artsticos. Ese ao se llevaron adelante los
HQFXHQWURV/D3DQWXHWDUHIUHVFDQWHHQORVTXHVHGHVDUUROOD-
URQLQWHUYHQFLRQHV GH JUDIWLVHQ HO SDWLR \ SDUHGHV LQWHUQDV \
externas del club, exposiciones y bandas en vivo. En 2012 se rea-
liz el encuentro ZigZag, que tuvo dos eventos previos denomi-
QDGRV0HJXVWDTXHWDPELpQDFHUFDURQDOHVSDFLRDGLIHUHQWHV
SURGXFWRUHVJUDIWHURVPXUDOLVWDVGLEXMDQWHVP~VLFRVHQWUH
otros- locales, nacionales e internacionales. Alborada es un lu-
gar con varias caractersticas diferentes en relacin a los otros
espacios seleccionados, entre ellas, por tratarse de un club y que
su funcionamiento se relaciona con ese tipo de organizacin ci-
vil y cultural. Para Lucas, integrante del Club que adems es
productor de pintura callejera conocido como Luxor- que se
dedica promover las actividades culturales, la idea de la Galera
surgi porque:
No haba espacios para la plstica. La idea era explo-
WDU OD SOiVWLFD QR VyOR OR PXVLFDO  /D $OERUDGD HV
un espacio interesante, que hay que apostar y que no

201

WLHQHOtPLWHV 1HFHVLWDPRVPDQRVTXHHVRVHDOLYLy
un poco el ao pasado [2012] cuando los chicos [Snto-
ma curadores] hicieron las movidas que me parecieron
muy buensimas, pero ellos vinieron como gente invi-
tada, necesitamos gente del lugar que quiera ponerse
algo al hombre y de una forma seria, creo que eso es lo
que faltara. Despus el balance lo vi brbaro, positivo,
de no tener nada, de no tener un espacio en la Alborada
para que se pueda exponer se hicieron muestras super
LQWHUHVDQWHV 6HORJUyKDFHUDOJR
[La diferencia con otros lugares de muestras] es el club.
Hay que lograr que la Alborada sea como el club de an-
tes. El club es abierto y popular. Me aburre algo que sea
raro.
Por ah lo que tiene la Alborada es que las cosas explo-
tan, viene gente y despus no, quizs esa sea la dinmi-
FD GHO HVSDFLR  (O OXJDU HV JUDQGH VRPRV SRFRV \
cuesta activar. Creo que la gente no activa los espacios
como antes, por conviccin, quiere tener algo, no es por
la conviccin de apostar a eso. Por ah es muy romnti-
co lo mo, pero bueno es una forma de ver la vida.

Sntoma curadores VXUJLy D QDOHV GH  FRPR XQD


iniciativa que busca repensar el espacio de la curadura y la
exposicin de las producciones culturales. En su pgina de
Facebook se anuncia que indaga sobre los dispositivos de
exposicin y comunicacin de las producciones simblicas. En
este tiempo lleva organizadas siete muestras, la mayor parte
de estas fueron en el espacio de galera del club Alborada y la
primera muestra en la que aportaron fue Caminates de Luxor,
aunque como grupo Sntoma curadores su primer intervencin
fue en junio de 2012 con la muestra Copias fallidas de una

202

LPDJHQPHQWDOGH-RVp)UDLUH5HDOL]DQXQWUDEDMRPLQXFLRVR
de seguimiento de la produccin de los productores que eligen,
generando charlas, entrevistas y devoluciones para escuchar y
luego proponer. Se busca en este proceso construir un guin
curatorial para proponer cmo esa produccin es leda y se
insertar dentro del campo cultural. En ese sentido, Chempes
y Daniel comentan sobre las propuestas y operatorias que
realizan desde Sntoma:

Estamos pensando que la obra, la produccin tiene
TXHVHUOHtGD KD\TXHGLVWLQJXLUODVOtQHDV\XMRV
que nos interesa resaltar para el guin que queremos
armar, una parte nos va a interesar de lo tuyo, no sos
vos, es una parte que queremos leer. Y no lo queremos
leer porque s, sino porque vamos a espacios, vamos
a lugares y nos parece que tiene que hablar con eso,
con ese lugar donde quiere incidir. Y a su vez, se da
en un lugar fsico concreto donde tens que hablar con
todo eso que tens alrededor. Entonces no es que des-
GHWDOWHRUtDFRQVWUXLUVLQRSRQHUHQMXHJRODVWHRUtDV
en funcin de tu querer hacer, de tu operacin sobre la
realidad. Por eso es que tenemos un aparato tan eclc-
WLFR  D VX YH] TXH QR FUHD WDQWR HQ OD WHRUtD VLQR
que crea en la accin en la realidad, que ponga a fun-
cionar las teoras en funcin de la realidad que quiera
operar.
Sntoma bsicamente es una cuestin de ethos, de una
voluntad de incidir sobre el campo cultural, en el cual
QRVRWURVHVWDPRVYLYRVHVWDPRVWUDEDMDQGR HOGLV-
positivo mismo, toda la forma de abordar ese disposi-
tivo es Sntoma. Es algo que en algn punto piensa la
manifestacin de algn tipo de estructura.

203

(O VtQWRPD FRPR OR TXH H[SUHVD HO RWUR \ WUDEDMDU XQ
poco a partir del sntoma que el otro muestra, y no ir a la
enfermedad. Nos interesa un montn la crtica de obra
\ XQ WUDEDMR PiV SURORQJDGR FRQ XQD GLVFXVLyQ VXSHU
profunda de por qu ests haciendo esto. Pero nuestra
idea de sntoma era bueno, corrmonos de ah, traba-
MHPRVFRQORTXH\DHVWDFRQORTXHHVWiVDOLHQGRFRQOR
que se ve.

Entonces, se busca desde Sntoma generar dispositivos de


comunicacin -de discurso y enunciacin- para leer e interpretar
GLIHUHQWHVOtQHDV\XMRVTXHWLHQHQODVSURGXFFLRQHVTXHVHOHF-
cionan buscado discutir en el campo cultural.
5HDOL]DQGRXQDVtQWHVLVGHORUHOHYDGRSRGHPRVDUPDUTXH
en relacin a la constitucin de los espacios, se encuentra una
marcada recurrencia de espacios privados incluso algunos ar-
ticulados con ciertos locales de comercios-, en donde todos es-
tos pagan alquileres y los gestores buscan ganarse la vida con
esos emprendimientos, es decir entendidos como su trabajo. La
excepcin encontrada es La Alborada al tratarse de un club, es
GHFLUIRUPDOPHQWHHVXQDDVRFLDFLyQFLYLOVLQQHVGHOXFURTXH
se organiza mediante una Comisin Directiva y asociados, a su
vez no paga alquiler ya que es tiene un espacio propio. Adems,
se encontr que se trata de pocas personas encargadas de la or-
ganizacin en cada espacio, en todos los casos sostenidos por
colaboraciones y apoyos de amigos y conocidos. Somos pocos
en todo,DUPyXQRGHORVJHVWRUHV
En relacin a la construccin de actividades cada vez ms
se dan espacios para pensarlas y organizarlas entre gestores y
productores de forma articulada, buscando en algunos casos,
construir criterios y pautas que encarrilen las actividades hacia
cierto nivel profesional. En este sentido, con mayor frecuencia

204

\ GH IRUPD VLVWHPiWLFD ORV HVSDFLRV HVWiQ SHQVDQGR HQ WpUPL-


nos de construir guiones curatoriales para las muestras (desde
Sntoma curadores, Mal de Muchos y Siberia y de forma ms
implcita desde Csmiko); dndose de este modo un trabajo de
estudio, conceptualizacin y construccin de relatos sobre las
producciones.
Por otra parte, muchos de los gestores consultados sostienen
como idea -pero no concretizada hasta ahora- la importancia de
generar lazos ms estrechos entre espacios emergentes. En
este sentido, podemos describir que si bien no estn generados
actualmente lazos estrechos entre todos los espacios, si hay
intentos de encuentro e intercambio de experiencias por ejem-
plo, una serie de reuniones de gestores y productores que se rea-
lizaron en 2012 a partir de convocatorias en redes sociales- as
como alguna coordinacin puntual en actividades entre algunos
espacios o integrantes de estos.
$GHPiVDUPDQTXHODOHJLWLPLGDGHVQHFHVDULD\TXHSULQ-
cipalmente es generada por la gente que asiste a las muestras
y eventos. En ese sentido, todos reconocen la importancia del
posicionamiento y la legitimidad para el desarrollo de las pro-
puestas, hay que posicionarse ante unos otros.

Elite cultural? Nueva? Otra?


Ya mencionamos anteriormente que lo que los gestores y
productores estaran componiendo al menos como propuesta
analtica- es una elite cultural, quizs nueva en relacin a ac-
tores establecidos que ejercen la capacidad poltica en la toma
de decisiones en la organizacin de la produccin cultural en la
ciudad tanto en instituciones pblicas como privadas-. Por lo
SURQWR VH LGHQWLFDUD D ORV DFWRUHV DQDOL]DGRV FRPR XQD RWUD

205

elite cultural, si bien el acento en nueva puede entenderse en


los propuestas novedosas que desarrollan, en sus apuestas por
desarrollar y ampliar un nuevo circuito para la exhibicin, cir-
culacin y venta de obras, as como de experiencias renovadas.
Pero, la propuesta no es delimitar a actores individuales, sino
ms bien a un conjunto de actores, prcticas y representaciones.
En este sentido, se puede encontrar ciertos crculos, circuitos de
espectadores/consumidores de los bienes culturales, pero sobre
todo de experiencias que promueve esta otra elite cultural; en
particular, pblicos que se habituaron a inauguraciones, mues-
tras y exposiciones de arte, as como propuestas musicales y
literarias, que cada vez ms abundan en la ciudad, formando es-
WRVHVSHFWDGRUHVWDPELpQSDUWHGHHVDHOLWH
Entonces una elite cultural gestora-productora-espectadora
que est inserta y quizs busque el monopolio- en la produc-
FLyQDFFHVRXVR\DGPLQLVWUDFLyQGHELHQHVVLPEyOLFRV4XL]iV
los (prximos) desafos que se estn buscando es que ese circui-
to de espectadores-consumidores no sean slo los integrantes
de la propia elite cultural (del propio sector), sino ampliar y
ensanchar al circuito a otros sectores. Si bien hoy es el princi-
pal destinatario de las actividades y eventos que se realizan en
estos espacios emergentes son actores que integran a la propia
elite cultural grupos e individuos que forman parte de redes
GHUHODFLRQHVDQLGDGHVDPLVWDGHV\FRPSOLFLGDGHVKD\DOJX-
nos intentos de salir ms all, de ampliar a los destinatarios y
apostar a nuevos pblicos-espectadores.
Si bien el componente mayoritario que podemos inferir por
las descripciones dadas por los actores implicados y por las di-
ferentes observaciones en el trabajo de campo- de esta elite
puede ser el de los jvenes, en su mayora universitarios (estu-
diantes y/o docentes), en una franja etaria que va entre los 18
a 40 aos aproximadamente, no hay que descartar que sujetos

206

que no integran la categora joven ni tampoco se encuentran


en ese corte etario, sobre todo pensando en aos mayores, tam-
ELpQIRUPDQSDUWHGHHVWDQXHYDHOLWHSURGXFWRUD\FRQVXPLGRUD
de sus propios (o cercanos) bienes y producciones culturales.
Entonces, aunque hay un importante componente en los
eventos y actividades de hacerlos para los mismos de siempre,
para los amigos y cercanos, para un nosotros delimitado, a
la vez hay un entendimiento de que hay que subir y ampliar las
apuestas.

Activar lo pblico
Cmo pensar la relacin con lo pblico de y en estos espa-
cios? Si entendemos que la esfera pblica va ms all de lo esta-
tal -de sus dominios y andamiajes- y se inscribe adems en otras
actividades, prcticas y espacios que surgen en la sociedad civil,
las propuestas de estos espacios culturales emergentes que aqu
analizamos podran encontrarse dentro de estas. Si se piensa a lo
S~EOLFR\ORSULYDGRHQWpUPLQRVGLFRWyPLFRVVyORHQFRQWUDUtD-
mos una oposicin que se resuelve hacia lo privado, al constatar
que se trata de espacios que buscan, en su mayora, desarrollar
una fuente de ingresos privados para sus organizadores/gesto-
UHVSHUVLJXLHQGRXQQGHOXFURFRPHUFLDO
Pero slo buscan eso? Entendemos que no, por lo que ma-
nejaremos que -principalmente- en esas apuestas culturales y
en esos vnculos que van tejiendo se est activando lo pblico,
porque habilitan ciertos espacios comunes de sociabilidad y de
encuentro para una parte quizs pequea- de jvenes, produc-
tores y gestores culturales y que, por eso mismo, se insertan en
el desarrollo de una cultura urbana, desplegando prcticas que
recorren el trazado urbanstico y aportan en la construccin de

207

una ciudad prctica (Delgado, 2007). As, atendiendo a sus di-


nmicas cotidianas, a muchas de las actividades que realizan y a
ciertos acontecimientos que producen los consideramos, pro-
visoriamente, como espacios privados abiertos.

Formacin, ms all de lo institucional


8QRGHORVLQWHUURJDQWHVGHHVWHWUDEDMRVHUHHUHDFXiOHVOD
visin que los gestores de espacios culturales emergentes tienen
sobre las instituciones. En este sentido, nos parece importante
poner la mirada sobre lo que hacen y proponen las instituciones,
sobre todo para este trabajo las ligadas a la cultura y las artes. En
las entrevistas y conversaciones encontramos en la mayora de
los casos por un lado, cierto rechazo y por otro, cierta decisin
de ignorar o de no tener en cuenta a lo que en esos lugares insti-
tucionales se desarrolla y propone. Sin embargo, se observaron
algunos matices que, por ejemplo, enfatizan sobre quienes estn
buscando activar dentro de esas instituciones ciertas apuestas
renovadores.
Considero que estn muy venidos a menos los museos.
Ac en general, el Provincial de Bellas Artes recin hace
un mes inaugur una muestra copada en todo el ao,
como tristsimo. El papel que desarrollo el MACLA muy
mal, esto todo muy venido a menos. De hecho yo soy una
WUDEDMDGRUDGHOPXVHR\YHRODGHVLGLD\ODGHFDGHQFLD
que hay en lo que es presupuesto, la gente que labura,
y es muy difcil, como que no hay una adecuacin a la
realidad, al momento que se est viviendo, dnde estn
ORVMyYHQHVKR\HQHVRVHVSDFLRV"ORVTXHHVWDEDQHQHO
Microespacio los sacaron a la mierda, qu onda.

208

Son arcaicos, no miran hacia fuera, no saben lo que


HVWiSDVDQGR (QHVRVOXJDUHVKD\RWURFLUFXLWRGH
artistas que ya estn metidos dentro del circuito, que ya
estn legitimados no estoy diciendo que no sean bue-
nos en lo que hacen- pero es eso, son parte de una especie
GHPDLQVWUHLPSODWHQVH &XDQGRYR\DO3DVDMH[Dar-
do Rocha] me da una sensacin de abandono, todas esas
salas grandes vacas, las obras estn paradas ah, como
a la deriva. No se cmo son las polticas culturales de
HOORVFyPRHVTXHPDQHMDQHOOXJDU\FyPRVHOHFFLRQDQ
a quien expone.
S, son como diferentes circuitos y depende de quien los
PDQHMHKD\JHQWHPiVIUHVFD
[vamos] PX\ GH YH] HQ FXDQGR $O 3DVDMH [Dardo Ro-
cha] HVWHDxRQRIXLQXQFD 1RVRQHVSDFLRVTXHQRV
interese mucho, siempre lo que ofrecen es muy aburrido.
Es otra propuesta, como distinta.

As, teniendo presente estos pareceres en relacin a las ins-


WLWXFLRQHV GHGLFDGDV D OD FXOWXUD SRGHPRV UHH[LRQDU VREUH
cul sera la posicin que estaran ocupando los nuevos espa-
cios culturales. Por lo pronto, consideramos que son mbitos de
relevo y presentacin de productores y producciones, espacios
que toman riesgos y apuestan por expresiones jvenes, algunas
experimentales, que estn realizando cierta renovacin quizs
WDPELpQSURGXFLHQGRXQFDPELRHQHOFLUFXLWRGHPXHVWUDVH[-
posiciones. Reproducimos algunos comentarios que se pudieron
recoger de las entrevistas y que puede ser clave para pensar en
este punto, tanto en relacin a lo institucional, la legitimidad en
un campo y a su vez, lo que generan estos espacios, ms que
muestras, experiencias colectivas:

209

Por eso creo que tambin existen estos espacios y que


cobran tanta potencia. Y se nota porque las muestras
se sostienen, porque estoy segura que a todos les llevan
carpetas, creo que a todos les debe a haber pasado lo
mismo, que llegas a un punto que vos tens que decir no
tengo ms lugar, este ao no se puede.
Creo que ocupan un poco el lugar que no pueden ocupar
las instituciones, de darle el lugar a otro.
Lo que me parece re valioso y creo que sera algo bue-
nsimo como proyecto de estos espacios que son emer-
gentes, que tienen para ofrecer espacios pero a la vez se
VRVWLHQHQ FRQ RWUDV FRVDV  HV TXH SRGDPRV JHQHUDU
unas redes, unos lazos ms estrechos, donde sea una
IRUWDOH]D  KD\ TXH DSURYHFKDU TXH WRGR IXH HPHU-
giendo, que todas estas cosas fueron cobrando vida y se
fueron posicionando y fueron ganando sus espacios y es
re valioso porque a nosotros no nos legitima nadie. Te
autolegitimas vos, el otro, los que vienen, porque no hay
nada, porque no somos museo, no somos institucin, no
dependemos de nada. Entonces en algn lado tienen que
KDEHUDOJRTXHWHOHGLJROHJLWLPDUSRUTXHHVXQDSDOD-
bra que tiene un poco ese valor. Yo considero que la legi-
timacin la tenemos a travs de la gente que viene y que
nos ayuda a sostener esto, esa es nuestra gran ganancia,
es lo nico que te sostienen y que te mantiene en pie, por-
TXHXQHVSDFLRDVtQRSXHGHFRQVHJXLUXQVXEVLGLR
Son ms que una muestra, se genera un evento.
FUHRTXHHVXQORJURHQORV~OWLPRVWLHPSRVORJUDU
que la gente tenga ganas de ir [a inauguraciones]. Haber
ORJUDGRTXHVHDDYHUQRGLYHUWLGRHQHOVHQWLGRFRPR
LUGHMRGDSHURXQSRFRVtTXHHVDOJRGLYHUWLGRHVXQD
propuesta que pods hacer, algo que puede convocar a

210

gente que no necesariamente es artista, eso antes no pa-


saba. No digo que sea la obra de [un espacio en particu-
lar]HVFRPRDOJRTXHVHJHQHUyGHDSRFRHQODFLXGDG
el hecho que es una alternativa ms de algo para hacer y
antes por ah no se tena en cuenta.
1RVRWURVPHSDUHFHTXHDWHUUL]DPRVDOFDPSRSRU
A, B o C ya validados, por cierto sector con el que esta-
mos operando; y la ausencia de otros competidores, si
VHTXLHUHQRVGDXQDIDFLOLGDGWRWDO SHURORTXHKDFH
IDOWD HV LQFLGLU  (O SODQ GH PtQLPD HV TXH HVWR VHD
el piso de todo lo que pasa el La Plata y empecemos a
discutir otras cosas, nosotros vamos por esa, que la de
mnima sea sta, no la de mxima. Que no es ir a colgar
HOFXDGULWR\DTXHGRSDVDGRHQDOJ~QSXQWR\DVHHP-
pieza a generar la demanda.

Por esto entenderemos a estas nuevas propuestas como parte


de una formacin, atendiendo a la conceptualizacin aporta-
da por Raymond Williams, las formaciones son ms recono-
cibles como tendencias y movimientos conscientes (literarios,
DUWtVWLFRVORVyFRVRFLHQWtFRV TXHQRUPDOPHQWHSXHGHQVHU
distinguidos de sus producciones formativas. () estas son arti-
culaciones de formaciones efectivas mucho ms amplias que de
QLQJ~QPRGRSXHGHQVHUSOHQDPHQWHLGHQWLFDGDVFRQODVLQV-
WLWXFLRQHVIRUPDOHVRFRQVXVVLJQLFDGRV\YDORUHVIRUPDOHV\
que pueden ser positivamente opuestas a ellas (Williams: 2009,
153). En este sentido, podramos entender que estos espacios
culturales emergentes de exhibicin expresan incipientemen-
te- otro movimiento cultural junto con otras prcticas y expe-
riencias ligadas a la msica, la literatura y la produccin edito-
rial independiente, que busca renovar la escena cultural local, la
organizacin de la produccin cultural.

211

Se plantearon algunos conceptos como el de elite cultural y


el de formaciones para caracterizar y distinguir a los espacios
culturales y los actores implicados en ellos. Podemos pensar en
la disputa por la supremaca cultural?. Al menos, desde la litera-
tura clave en este sentido de Gramsci a Bourdieu- sabemos que
en un campo compuesto por actores en posiciones diferenciadas
VLHPSUHH[LVWHXQDSHOHDSRUODGHQLFLyQOHJtWLPDHQHVWHFDVR
al estar inserto en el campo intelectual,6 una lucha por la nomi-
nacin de la cultura legtima. As, lo que se discute, y se pone en
disputa seria ms que arte, es ms que produccin artstica,
PiV TXH H[SHULHQFLDV HVWpWLFDV 3DUD HO DFWXDO PRPHQWR 6H
podra plantear que hay una disputa por nominar y organizar la
produccin cultural en la ciudad?. En todo caso, se tendra que
trazar esa disputa atendiendo a ciertas situaciones estructurales
(en relacin por un lado, a las polticas culturales locales, regio-
nales y nacionales, al desarrollo y posicin de la produccin cul-
tural en las sociedades capitalistas contemporneas, as como al
desarrollo de los circuitos de arte y cultura -constituidos y emer-
gentes- tomando momentos histricos presentes y pasados). Te-
ner en cuenta esas situaciones, esos campos de fuerzas no para
caer en un determinismo, pero si para entender que tienen un
poder estructurante en las prcticas y representaciones- servi-
ra para poder describir y analizar de forma ms adecuada las
diferentes posiciones de los actores y sentidos puestos en juego.
Podemos plantear a estas prcticas, espacios y apuestas

6 Se hablar de campo intelectual, atendiendo que el campo artstico, que podra ser
la categora empleada, lo integra. En este sentido, consideramos que plantear las cuestiones que aqu se trabajan solo como parte del campo artstico, campo del arte o
de prcticas artsticas lo limitara. Cf. las definiciones de campo intelectual y capital
cultural (Altamirano, 2008).

212

como FRQJXUDGRUDV de un accionar poltico, como un des-


DFXHUGRTXHSXMDSRUXQQXHYRUHSDUWRGHORVHQVLEOHHQWpU-
minos propuestos por Rancire (2007)- en el campo de la pro-
GXFFLyQFXOWXUDO"<HQWRGRFDVRTXpVHUtDORVHQVLEOHTXHVH
busca en estas experiencias. Por ahora nos quedamos con esos
interrogantes.
As, sin pretender cerrar el anlisis, consideremos que se est
constituyendo un campo de interlocucin en el que determi-
nados actores y prcticas, que comparten cdigos de lectura e
interpretacin comn, se ponen a gestionar, producir y consu-
mir producciones culturales, obras y experiencias, cultura en
movimiento, cultura viva, cultura independiente; a generar
eventos y pequeos acontecimientos que renuevan la organi-
zacin de la cultura en la ciudad, construyendo y fortaleciendo
cierto circuito alternativo de gestores, productores y espec-
tadores- en el que se plantean apuestas y visiones ligadas con la
autogestin, la independencia y lo emergente en la produccin
cultural. Pero adems, con ciertas ideas de profesionalizacin,
legitimidad y disputa de sentidos. Por esto, consideramos que ni
la nocin de subcultura ni la de tribu urbana parecen las ade-
cuadas para nominar estas experiencias, por lo que preferimos
utilizar la categora de escena cultural que integra y se pone en
GLiORJRFRQXQWLSRHVSHFtFRGHIRUPDFLyQFXOWXUDO

213

Bibliografa
ALTAMIRANO, Carlos (comp.) (2002), Trminos crticos de socio-
loga de la cultura. Buenos Aires, Editorial Paids, 2008.
BOURDIEU, Pierre, Campo de poder, campo intelectual. Buenos
Aires, Montressor, 2002
BOURDIEU, Pierre (1999), Intelectuales, poltica y poder. Buenos
Aires, Eudeba, 2007.
DELGADO, Manuel, Sociedades movedizas. Pasos hacia una an-
tropologa de las calles. Barcelona, Anagrama, 2007.
GRAW, Isabelle (2008), Cunto vale el arte? Mercado, especu-
lacin y cultura de la celebridad. Buenos Aires, Mardulce,
2013.
MOULIN, Raymonde (2003), El mercado del arte. Mundializa-
cin y nuevas tecnologas. Buenos Aires, La Marca Editora,
2012.
RANCIRE, Jacques (1996), (O GHVDFXHUGR 3ROtWLFD \ ORVRItD.
Buenos Aires, Nueva Visin, 2007.
WILLIAMS, Raymond (1977), Marxismo y literatura. Buenos Ai-
res, Las Cuarenta, 2009.

Entrevistas
Vernica y Florencia (Mal de muchos)
Leandro y Robertito (Csmiko)
Chempes y Daniel (Sntoma Curadores)
Lucas (Alborada)
Natalia (Cest la vie)
Magdalena (Siberia)

214

Fuentes virtuales
Siberia. Tumbr: http://www.holasiberia.tumblr.com
)DFHERRN SHUO https://www.facebook.com/siberia.
libreriaygaleria
Mal de Muchos. Sitio: http://www.maldemuchos.com.ar
Facebook (pagina galera): https://www.facebook.com/
maldemuchos.galeria
Facebook (pgina local): https://www.facebook.com/
maldemuchos
Cest la vie.)DFHERRN SHUO https://www.facebook.com/
CasaCultural.Cest.LaVie
Csmiko. Blog: http://cosmikogaleria.blogspot.com.ar
Facebook (comunidad): https://www.facebook.com/pages/
&&60,.2*DOHU&$'D&OXE"IU
ef=ts
Galera de Alborada. Facebook (pgina club):
https://www.facebook.com/pages/Centro-Cultural-
Alborada/156133797821135?fref=ts
Sntoma curadores. Tumbr: http://sintomacuradores.
tumblr.com
Facebook (pgina): https://www.facebook.com/
sintomacuradores

215

216

217

Cuadro 1. Espacios, muestras y productores. Perodo: aos 2011 y 2012. Se pueden observar por un lado, el aumento de muestras
realizadas entre los aos y, por otro, la recurrencia y circulacin por varios espacios de algunos productores como Luxor (6 muestras),
Valentino Tettamanti (4 muestras), Tormenta / Paula Giorgi y Brbara Visconti (4 muestras) y FelinaSuperHerona (2), Daniel Lorenzo (2).

Mapa 1. Mapeo de localizacin de los espacios culturales. En el mismo se puede observar que la mayor cantidad se encuentran ubicados en el casco urbano de la ciudad de La
Plata. Adems, se aprecia la cercana entre varios de ellos.

218

SOBRE LOS AUTORES

Gastn Cingolani
Es Licenciado en Comunicacin Social (FPyCS-UNLP), Magster
en Diseo de Estrategias en Comunicacin por la Universidad
Nacional de Rosario (UNR) y doctorando por la Universidad
de Buenos Aires (FFyL, Lingstica). Es Profesor Adjunto de la
asignatura Comunicacin y Cultura de la FPyCS (UNLP), y Prof.
Asociado de la asignatura Medios y Polticas de la Comunicacin
del rea Transdepartamental de Crtica de Artes - Instituto Uni-
YHUVLWDULR1DFLRQDOGHO$UWH ,81$ GRQGHWDPELpQGLFWDHOVH-
PLQDULR,QWURGXFFLyQDODV7HRUtDVGHOD([SHULHQFLD(VWpWLFDGH
la Maestra en Crtica y Difusin de las Artes. Desde 2007 dirige
proyectos de investigacin sobre mediatizacin. Public como
editor el libro Discursividad Televisiva (Edulp, 2006), adems
de numerosos artculos en publicaciones peridicas y libros.

Mariano Fernndez
Es Licenciado en Comunicacin Social (UNLP). Docente de la
ctedra de Comunicacin y Cultura de la FPyCS (UNLP) y de la
de Medios y Polticas de la Comunicacin del rea Transdepar-
WDPHQWDOGH&UtWLFDGH$UWHV ,81$ %HFDULRGRFWRUDOGHO&21,-
CET (IdIHCS-CISH, UNLP). Doctorando en Ciencias Sociales de
la Facultad de Humanidades y Ciencias de la Educacin (UNLP).
Su rea de investigacin es la mediatizacin de la poltica y, en
ese marco, las relaciones entre sistema meditico y sistema po-
ltico en la Argentina contempornea. Miembro del Centro de
Investigacin en Mediatizaciones (UNR) y del rea de Estudios
Polticos (IDIHCS/UNLP).
219

Matas David Lpez


Es Licenciado y Profesor en Comunicacin Social (FPyCS-
UNLP). Actualmente es Doctorando en Comunicacin Social
81/3 \%HFDULRGRFWRUDOGHO&21,&(7 ,,&RP)3\&681/3 
Docente del Liceo Vctor Mercante (UNLP) en el taller Nuevas
tecnologas y espacio pblico: territorios de intervenciones cul-
turales. Integrante del proyecto de investigacin Representa-
ciones temporales y prcticas sociales: el cambio social a partir
de la intervencin en el espacio pblico en el marco del Progra-
ma Nacional de Incentivos.

Vanina Papalini
Es Doctora en Ciencias de la Informacin y la Comunicacin por
la Universidad de Pars 8 y Doctora en Ciencias Sociales por la
Universidad de Buenos Aires (UBA), Magister en Comunicacin
y Cultura por la Universidad Nacional de Crdoba (UNC) y Es-
pecialista en Filosofa y Crtica de la Cultura por la Universidad
Nacional del Comahue. Es directora del programa Transfor-
maciones Culturales Contemporneas, un programa de inves-
tigacin de doble dependencia que pertenece al Centro de In-
YHVWLJDFLRQHV\(VWXGLRVVREUH&XOWXUD\6RFLHGDGGHO&21,&(7
y al Centro de Estudios Avanzados de la Universidad Nacional
GH&yUGRED(VLQYHVWLJDGRUDDGMXQWDGHO&21,&(7\SURIHVRUD
adjunta de la Facultad de Filosofa y Humanidades de la Uni-
versidad Nacional de Crdoba. Ha publicado los libros Anime.
0XQGRVWHFQROyJLFRVDQLPDFLyQMDSRQHVDHLPDJLQDULRVRFLDO,
editado por La Cruja y el libro colectivo La comunicacin como
ULHVJR&XHUSR\VXEMHWLYLGDG, editado por editorial Al Margen.
(VGLUHFWRUDGHODUHYLVWDFLHQWtFDAstrolabio. Nueva poca. Se
RFXSDWDPELpQGHODFRRUGLQDFLyQDFDGpPLFDGHO'RFWRUDGRHQ
Comunicacin Social de la Escuela de Ciencias de la Informa-

220

cin de la Universidad Nacional de Crdoba. Ha dictado cursos


de posgrados en Comunicacin en la Universidad de la Rep-
blica, la Universidad Autnoma de Barcelona, la Universidad
1DFLRQDOGH/D3ODWDOD8QLYHUVLGDG1DFLRQDOGH4XLOPHV\OD
Universidad Nacional de Crdoba, entre otras.

Nora Rabotnikof
$UJHQWLQDUDGLFDGDHQ0p[LFR(VLQYHVWLJDGRUDGHO,QVWLWXWRGH
,QYHVWLJDFLRQHV)LORVyFDVGHOD8QLYHUVLGDG1DFLRQDO$XWyQR-
PDGH0p[LFR\PLHPEURGHO6LVWHPD1DFLRQDOGH,QYHVWLJDGR-
res. Entre sus principales publicaciones: En busca del pasado
perdido (en colaboracin), Max Weber. Desencanto poltica y
GHPRFUDFLD(QEXVFDGHXQOXJDUFRP~QHOHVSDFLRS~EOLFRHQ
la teora poltica contempornea, Espacio pblico y democra-
cia, La tenacit de la politique, y numerosos artculos en temas
de Filosofa Poltica. Ha sido profesora invitada en L Ecole des
Hautes Etudes en Sciences Sociales (Paris), Universidad Carlos
III (Madrid), Universidad Nacional de Buenos Aires, Universi-
GDG1DFLRQDOGH/D3ODWD)/$&62 0p[LFR(FXDGRU\&KLOH 

Ramiro Segura
Es Licenciado en Antropologa (UNLP) y Doctor en Ciencias So-
FLDOHV 81*6,'(6  ,QYHVWLJDGRU GHO &21,&(7 3URIHVRU GH
Antropologa Social (UNLP) y Antropologa Urbana (IDAES/
UNSAM). Se especializa en el campo de la Antropologa Urbana,
sobre el cual ha dictado cursos, seminarios y conferencias. Ha
SXEOLFDGRDUWtFXORVFLHQWtFRVHQUHYLVWDVQDFLRQDOHV\H[WUDQMH-
ras. Public los libros La vida poltica en los barrios populares
de Buenos Aires (junto a Alejandro Grimson y Cecilia Ferraudi
Curto; Prometeo, 2009) y Ciudad, cultura y procesos de segre-

221

gacin urbana (junto a Mara Carman y Neiva Vieira Cunha;


)/$&62 (FXDGRU HQ SUHQVD  $FWXDOPHQWH UHDOL]D XQD HVWDQ-
cia postdoctoral en la Red de Investigacin sobre Desigualdades
,QWHUGHSHQGLHQWHV HQ $PpULFD /DWLQD GHVLJXDOGDGHVQHW  FRQ
sede en la Freie Universitt Berln (FU Berln).

Soledad Stoessel
Es Licenciada en Sociologa (FAHCE-UNLP), Magster (en cur-
VR  HQ &LHQFLDV 3ROtWLFDV )/$&62(FXDGRU  %HFDULD GRFWRUDO
GHO&21,&(7HQHO,QVWLWXWRGH,QYHVWLJDFLRQHVHQ+XPDQLGD-
des y Ciencias Sociales-Centro de Investigaciones Socio-Histri-
FDV 81/3 'RFHQWHGHODFiWHGUD2SLQLyQ3~EOLFDHQOD)DFXO-
tad de Periodismo y Comunicacin Social (UNLP).

Sandra Valdettaro
Es Doctora en Comunicacin por la Universidad Nacional de
5RVDULR0DVWHUHQ&LHQFLDV6RFLDOHVSRU)/$&62\/LFHQFLDGD
en Comunicacin Social por la Universidad Nacional de Rosa-
ULR(V3URIHVRUD7LWXODU2UGLQDULDGHODFiWHGUD(SLVWHPRORJtD
de la Comunicacin de la carrera de Comunicacin Social de la
Universidad Nacional de Rosario. Es Directora del CIM (Centro
de Investigaciones en Mediatizaciones) del Instituto de Investi-
gaciones de la Facultad de Ciencia Poltica y Relaciones Interna-
cionales de la Universidad Nacional de Rosario. Es Directora de
la Maestra en Estudios Culturales del CEI (Centro de Estudios
Interdisciplinarios) de la Universidad Nacional de Rosario. Es
Investigadora categora 1. Dirige distintos proyectos de investi-
gacin y es autora de libros, captulos de libros y artculos de su
especialidad. Es docente de doctorados y maestras en distintas
universidades nacionales y extranjeras.

Mariano Vzquez
Es Periodista y Licenciado en Comunicacin Social (FPyCS-
UNLP). Doctorando en Comunicacin Social (FPyCS-UNLP).
Ayudante adscripto graduado en el Taller de tecnologas de la
comunicacin y en la materia Comunicacin y Teoras.

El libro reflexiona acerca de la temporalidad de aquello que, tradicionalmente,


se concibe como espacio pblico. Al mismo tiempo, toma como punto de partida
la inestabilidad del estatuto de lo pblico, tensionado, como est,
por la yuxtaposicin entre las experiencias mediatizadas y no mediatizadas
de la vida colectiva y por el debilitamiento de las perspectivas tradicionales,
particularmente aquellas orientadas por pretensiones normativas.
Se parte de una intuicin sobre las formas del desplazamiento de lo pblico
entre el mundo no meditico y el de la mediatizacin; y entre los imaginarios
espaciales y la temporalidad de la experiencia social. En este sentido,
el umbral remite a un imaginario espacio-temporal: un intermedio
de entrada/salida en el cual tambin se puede permanecer, aunque
no indefinidamente, y en el que quedan los rastros del pasaje entre un polo
y el otro. Es decir: el umbral como respuesta a la pregunta sobre el estatus,
la entidad, la localizacin, la duracin, la emergencia o la dilucin de lo pblico.

ISBN 978-950-34-1045-5