Vous êtes sur la page 1sur 228

LEY DE CONTRATACIONES

DEL ESTADO
Y SU REGLAMENTO
CONCORDADO
Organismo Supervisor de las Contrataciones
del Estado - OSCE
Primera Edicin 2012
Responsable:
Direccin Tcnica Normativa
Diseo y Diagramacin:
Sub Direccin de Desarrollo de Capacidades
Impreso en:
Editora Imprenta Ros S.A.C.
Jr. Puno 144 - Huancayo
Telf.: (064) 213547
PRESENTACIN
Las entidades del Estado cumplen funcin pblica orientada principalmente
a la satisfaccin de necesidades de los ciudadanos, tales como brindar servicios
de salud, seguridad, educacin, administrar justicia, ejecutar obras pblicas
relacionadas con el agua y desage, construccin de carreteras, proveer energa
elctrica, entre otras. Para ello requieren contratar bienes, servicios y obras. Slo
en el ao 2011, las casi 2,800 entidades pblicas contratantes, entre el gobierno
nacional, regional y local, as como tambin a travs de empresas pblicas,
realizaron ms de 109 mil procesos de seleccin y rdenes de compra por un
valor cercano a los S/. 29 mil millones.
La magnitud y el nmero de transacciones hacen que las contrataciones
pblicas constituyan un rgimen jurdico especializado de importancia transversal
que contribuye de forma importante en la dinamizacin de la economa, sobre
todo al interior del pas, en donde la presencia de la pequea y mediana empresa
es predominante. Por ello, resulta necesario asegurar que cada una de esas
transacciones se realice con transparencia y promocin de la libre competencia,
dentro de una estrategia de calidad y eficiencia en el gasto para el cumplimiento
de la funcin pblica en concordancia con la poltica nacional de inclusin social.
En ese sentido, las recientes modificaciones a la Ley de Contrataciones
del Estado (Decreto legislativo N 1017), realizadas a travs de la Ley N 29873
y su Reglamento (aprobado mediante Decreto Supremo N 184-2008-EF),
modificado mediante Decreto Supremo N 138-2012-EF, tienen como objetivo
fortalecer las funciones de supervisin, regulacin y solucin de controversias del
OSCE, a efectos de asegurar la transparencia y la competencia en los procesos
de contratacin.
Por lo antes sealado, el Organismo Supervisor de las Contrataciones del
Estado, con la finalidad de difundir y promover el cumplimiento de la presente Ley
y su Reglamento, pone al alcance de las entidades pblicas y agentes econmicos
en general, los instrumentos normativos actualizados y concordados que regulan
los procedimientos de contratacin pblica, para su adecuada aplicacin.
MAGALI FIORELLA ROJAS DELGADO
Presidente Ejecutiva
LEY DE CONTRATACIONES
DEL ESTADO
(APROBADA MEDIANTE D.L. N 1017)
CONCORDADO
7
LEY DE CONTRATACIONES DEL ESTADO
LEY DE CONTRATACIONES DEL ESTADO
TTULO I
DISPOSICIONES GENERALES
Artculo 1.- Alcances
Artculo 2.- Objeto
Artculo 3.- mbito de aplicacin
Artculo 4.- Principios que rigen las contrataciones
Artculo 5.- Especialidad de la norma y delegacin
Artculo 6.- rganos que participan en las contrataciones
Artculo 7.- Expediente de Contratacin
Artculo 8.- Plan Anual de Contrataciones
TTULO II
DE LOS PROCESOS DE SELECCIN
CAPTULO I
DISPOSICIONES GENERALES
Artculo 9.- Registro Nacional de Proveedores
Artculo 10.- Impedimentos para ser postor y/o contratista
Artculo 11.- Prohibicin de prcticas restrictivas que afecten la mayor
concurrencia y competencia en los procesos de contratacin
Artculo 12.- Requisitos para convocar a un proceso
Artculo 13.- Caractersticas tcnicas de los bienes, servicios y obras a
contratar
Artculo 14.- Contenido de la convocatoria y plazos de los procesos de
seleccin
CAPTULO II
DE LOS PROCESOS DE SELECCIN
Artculo 15.- Mecanismos de contratacin
Artculo 16.- Licitacin pblica y concurso pblico
Artculo 17.- Adjudicacin directa
Artculo 18.- Adjudicacin de menor cuanta
Artculo 19.- Prohibicin de fraccionamiento
Artculo 20.- Exoneracin de procesos de seleccin
LEY DE CONTRATACIONES DEL ESTADO
8
Artculo 21.- Formalidades de las contrataciones exoneradas
Artculo 22.- Situacin de desabastecimiento
Artculo 23.- Situacin de emergencia
Artculo 24.- Del Comit Especial
Artculo 25.- Responsabilidad
CAPTULO III
DE LAS BASES
Artculo 26.- Condiciones mnimas de las Bases
Artculo 27.- Valor Referencial
Artculo 28.- Consultas y Observaciones a las Bases
Artculo 29.- Sujecin legal de las Bases
CAPTULO IV
DE LOS PROCEDIMIENTOS
Artculo 30.- Presentacin de propuestas y otorgamiento de la Buena Pro
Artculo 31.- Evaluacin y calificacin de propuestas
Artculo 32.- Proceso de seleccin desierto
Artculo 33.- Validez de las propuestas
Artculo 34.- Cancelacin del proceso
TTULO III
DE LAS CONTRATACIONES
Disposiciones Generales
Artculo 35.- Del contrato
Artculo 36.- Ofertas en consorcio
Artculo 37.- Subcontratacin
Artculo 38.- Adelantos
Artculo 39.- Garantas
Artculo 40.- Clusulas obligatorias en los contratos
Artculo 41.- Prestaciones adicionales, reducciones y ampliaciones
Artculo 42.- Culminacin del contrato
Artculo 43.- Requisitos especiales en los contratos de obra
Artculo 44.- Resolucin de los contratos
Artculo 45.- Registro de Procesos y Contratos
9
LEY DE CONTRATACIONES DEL ESTADO
TTULO IV
DERECHOS, OBLIGACIONES Y SANCIONES
CAPTULO I
DE LAS ENTIDADES Y FUNCIONARIOS
Artculo 46.- De las responsabilidades y sanciones
Artculo 47.- Supervisin
CAPTULO II
DE LOS CONTRATISTAS
Artculo 48.- Intereses y penalidades
Artculo 49.- Cumplimiento de lo pactado
Artculo 50.- Responsabilidad del contratista
Artculo 51.- Infracciones y sanciones administrativas
TTULO V
SOLUCIN DE CONTROVERSIAS E IMPUGNACIONES
Artculo 52.- Solucin de controversias
Artculo 53.- Recursos impugnativos
Artculo 54.- Suspensin del proceso de seleccin
Artculo 55.- Denegatoria Ficta
Artculo 56.- Nulidad de los actos derivados de los procesos de contratacin
TTULO VI
DEL ORGANISMO SUPERVISOR DE LAS CONTRATACIONES
DEL ESTADO
Artculo 57.- Definicin
Artculo 58.- Funciones
Artculo 59.- Organizacin y recursos
Artculo 60.- Del Consejo Directivo y la Presidencia Ejecutiva del Organismo
Supervisor de las Contrataciones del Estado -OSCE
Artculo 61.- Requisitos e impedimentos
Artculo 62.- Causales de remocin y vacancia
LEY DE CONTRATACIONES DEL ESTADO
10
TTULO VII
DEL TRIBUNAL DE CONTRATACIONES DEL ESTADO
Artculo 63.- Tribunal de Contrataciones del Estado
Artculo 64.- Requisitos e impedimentos para ser Vocal del Tribunal de
Contrataciones del Estado
Artculo 65.- Causal de remocin y vacancia
Artculo 66.- Publicidad de las resoluciones
TTULO VIII
DEL SISTEMA ELECTRNICO CONTRATACIONES DEL ESTADO
Artculo 67.- Definicin
Artculo 68.- Obligatoriedad
Artculo 69.- Administracin
Artculo 70.- Validez y eficacia de actos
DISPOSICIONES COMPLEMENTARIAS FINALES
DISPOSICIONES COMPLEMENTARIAS TRANSITORIAS
DISPOSICIN COMPLEMENTARIA MODIFICATORIA
DISPOSICIN COMPLEMENTARIA DEROGATORIA
11
LEY DE CONTRATACIONES DEL ESTADO
DECRETO LEGISLATIVO N 1017


EL PRESIDENTE DE LA REPBLICA

POR CUANTO:

El Congreso de la Repblica por Ley N 29157, ha delegado en el Poder
Ejecutivo la facultad de legislar, por un plazo de ciento ochenta (180) das
calendario, sobre diversas materias relacionadas con la implementacin del
Acuerdo de Promocin Comercial Per Estados Unidos y con el apoyo de la
competitividad econmica para su aprovechamiento; entre las que se encuentran
ODPHMRUDGHOPDUFRUHJXODWRULRODVLPSOLFDFLyQDGPLQLVWUDWLYD\ODPRGHUQL]DFLyQ
del Estado;
De conformidad con lo establecido en el artculo 104 de la Constitucin
Poltica del Per;
Con el voto aprobatorio del Consejo de Ministros; y,
Con cargo de dar cuenta al Congreso de la Repblica;
Ha dado el Decreto Legislativo siguiente:


DECRETO LEGISLATIVO QUE APRUEBA LA LEY
DE CONTRATACIONES DEL ESTADO

TTULO I
DISPOSICIONES GENERALES

Artculo 1.- Alcances
La presente norma contiene las disposiciones y lineamientos que deben
observar las Entidades del Sector Pblico en los procesos de contrataciones
de bienes, servicios u obras y regula las obligaciones y derechos que se
derivan de los mismos.
Concordancia: RLCE: Artculo 2.

Artculo 2.- Objeto
El objeto del presente Decreto Legislativo es establecer las normas orientadas
a maximizar el valor del dinero del contribuyente en las contrataciones que
realicen las Entidades del Sector Pblico, de manera que stas se efecten en
forma oportuna y bajo las mejores condiciones de precio y calidad, a travs del
cumplimiento de los principios sealados en el artculo 4 de la presente norma.
LEY DE CONTRATACIONES DEL ESTADO
12
Artculo 3.- mbito de aplicacin
3.1 Se encuentran comprendidos dentro de los alcances de la presente ley,
bajo el trmino genrico de Entidad(es):
a) El Gobierno Nacional, sus dependencias y reparticiones.
b) Los Gobiernos Regionales, sus dependencias y reparticiones.
c) Los Gobiernos Locales, sus dependencias y reparticiones.
d) Los Organismos Constitucionales Autnomos.
e) Las Universidades Pblicas.
I /DV6RFLHGDGHVGH%HQHFHQFLD\ODV-XQWDVGH3DUWLFLSDFLyQ6RFLDO
g) Las Fuerzas Armadas y la Polica Nacional del Per.
h) Los Fondos de Salud, de Vivienda, de Bienestar y dems de
naturaleza anloga de las Fuerzas Armadas y de la Polica Nacional
del Per.
i) Las empresas del Estado de derecho pblico o privado, ya sean de
propiedad del Gobierno Nacional, Regional o Local y las empresas
mixtas bajo control societario del Estado.
j) Los proyectos, programas, fondos, rganos desconcentrados,
organismos pblicos del Poder Ejecutivo, instituciones y dems
unidades orgnicas, funcionales, ejecutoras y/o operativas de los
Poderes del Estado; as como los organismos a los que alude
la Constitucin Poltica del Per y dems que sean creados y
reconocidos por el ordenamiento jurdico nacional, siempre que
cuenten con autonoma administrativa, econmica y presupuestal.
3.2 La presente ley se aplica a las contrataciones que deben realizar las
Entidades para proveerse de bienes, servicios u obras, asumiendo el
pago del precio o de la retribucin correspondiente con fondos pblicos,
y dems obligaciones derivadas de la calidad de contratante.
3.3. La presente ley no es de aplicacin para:
a) La contratacin de trabajadores, empleados, servidores o funcionarios
pblicos sujetos a los regmenes de la carrera administrativa o laboral
de la actividad privada.
b) La contratacin de auditoras externas en o para las Entidades, la
que se sujeta a las normas que rigen el Sistema Nacional de Control.
Todas las dems contrataciones que efecte la Contralora General
de la Repblica se sujetan a lo dispuesto en la presente ley y su
reglamento.
c) Las operaciones de endeudamiento y administracin de deuda
pblica.
G /D FRQWUDWDFLyQ GH DVHVRUtD OHJDO \ QDQFLHUD \ RWURV VHUYLFLRV
especializados, vinculados directa o indirectamente a las operaciones
de endeudamiento interno o externo y de administracin de deuda
pblica.
e) Los contratos bancarios y financieros celebrados por las
Entidades.
f) Los contratos administrativos de servicios o rgimen que haga sus
veces.
13
LEY DE CONTRATACIONES DEL ESTADO
g) Los contratos de locacin de servicios celebrados con los presidentes
de directorios, que desempeen funciones a tiempo completo en las
Entidades o empresas del Estado.
h) Los actos de disposicin y de administracin y gestin de los bienes
de propiedad estatal.
i) Las contrataciones cuyos montos, sean iguales o inferiores a tres
(3) Unidades Impositivas Tributarias, vigentes al momento de la
transaccin, lo cual no enerva la responsabilidad de la Entidad de
salvaguardar el uso de los recursos pblicos de conformidad con los
SULQFLSLRVGHPRUDOLGDG\HFLHQFLD
Este supuesto no es aplicable a las contrataciones de bienes y
servicios incluidos en el Catlogo de Convenios Marco, conforme a
lo que establezca el reglamento.
j) La contratacin de notarios pblicos para que ejerzan las funciones
previstas en la presente ley y su reglamento.
k) Los servicios brindados por conciliadores, rbitros, centros de
conciliacin, instituciones arbitrales y dems derivados de la funcin
conciliatoria y arbitral; salvo en lo que respecta a las infracciones y
sanciones previstas para los rbitros.
l) Las contrataciones que deban realizarse con determinado proveedor,
por mandato expreso de la ley o de la autoridad jurisdiccional.
m) La concesin de recursos naturales y obras pblicas de infraestructura,
bienes y servicios pblicos.
n) La transferencia al sector privado de acciones y activos de propiedad
del Estado, en el marco del proceso de privatizacin.
) La modalidad de ejecucin presupuestal directa contemplada en la
normativa de la materia, salvo las contrataciones de bienes y servicios
que se requieran para ello.
o) Las contrataciones realizadas con proveedores no domiciliados en
el pas cuyo mayor valor estimado de las prestaciones se realice en
el territorio extranjero.
p) Las contrataciones que realicen las Misiones del Servicio Exterior
de la Repblica, exclusivamente para su funcionamiento y gestin,
fuera del territorio nacional.
q) Las contrataciones de servicios de abogados, asesores legales y
de cualquier otro tipo de asesora requerida para la defensa del
Estado en las controversias internacionales sobre inversin en foros
arbitrales o judiciales.
r) Las compras de bienes que realicen las Entidades mediante remate
pblico, las que se realizarn de conformidad con la normativa de la
materia.
s) Los convenios de cooperacin, gestin u otros de naturaleza anloga,
suscritos entre Entidades, o entre stas y organismos internacionales,
siempre que se brinden los bienes, servicios u obras propios de la
IXQFLyQTXHSRUOH\OHVFRUUHVSRQGH\DGHPiVQRVHSHUVLJDQQHV
de lucro.
/RV FRQYHQLRV D TXH VH UHHUH HO SUHVHQWH QXPHUDO HQ QLQJ~Q
LEY DE CONTRATACIONES DEL ESTADO
14
caso se utilizarn para el encargo de la realizacin de procesos de
seleccin.
t) La contratacin de servicios pblicos, siempre que no exista la
posibilidad de contratar con ms de un proveedor.
u) Las contrataciones realizadas de acuerdo con las exigencias y
SURFHGLPLHQWRVHVSHFtFRVGHRUJDQLVPRVLQWHUQDFLRQDOHV(VWDGRV
o entidades cooperantes, siempre que se deriven de operaciones
de endeudamiento externo y/o donaciones ligadas a dichas
operaciones.
v) Las contrataciones realizadas de acuerdo con las exigencias y
SURFHGLPLHQWRVHVSHFtFRVGHRUJDQLVPRVLQWHUQDFLRQDOHV(VWDGRV
o entidades cooperantes, que se deriven de donaciones efectuadas
por estos, siempre que dichas donaciones representen por lo menos
el 25% del monto total de las contrataciones involucradas en el
Convenio suscrito para tal efecto.
En todos los supuestos sealados en el presente numeral, salvo el literal u),
intervendr la Contralora General de la Repblica.
1
Concordancia: RLCE: Artculo 2 y Quinta Disposicin Comple-
mentaria Transitoria
Artculo 4.- Principios que rigen las contrataciones
Los procesos de contratacin regulados por esta norma y su Reglamento se
rigen por los siguientes principios, sin perjuicio de la aplicacin de otros principios
generales del derecho pblico:
a) Principio de Promocin del Desarrollo Humano: La contratacin
pblica debe coadyuvar al desarrollo humano en el mbito nacional,
de conformidad con los estndares universalmente aceptados sobre la
materia.
b) Principio de Moralidad: Todos los actos referidos a los procesos de
contratacin de las Entidades estarn sujetos a las reglas de honradez,
veracidad, intangibilidad, justicia y probidad.
c) Principio de Libre Concurrencia y Competencia: En los procesos de
contrataciones se incluirn regulaciones o tratamientos que fomenten la
ms amplia, objetiva e imparcial concurrencia, pluralidad y participacin
de postores.
d) Principio de Imparcialidad: Los acuerdos y resoluciones de los
funcionarios y rganos responsables de las contrataciones de la
Entidad, se adoptarn en estricta aplicacin de la presente norma y su
Reglamento; as como en atencin a criterios tcnicos que permitan
objetividad en el tratamiento a los postores y contratistas.
e) Principio de Razonabilidad: En todos los procesos de seleccin el
objeto de los contratos debe ser razonable, en trminos cuantitativos y
1 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
15
LEY DE CONTRATACIONES DEL ESTADO
cualitativos, para satisfacer el inters pblico y el resultado esperado.
I 3ULQFLSLRGH(FLHQFLD/DVFRQWUDWDFLRQHVTXHUHDOLFHQODV(QWLGDGHV
debern efectuarse bajo las mejores condiciones de calidad, precio
y plazos de ejecucin y entrega y con el mejor uso de los recursos
materiales y humanos disponibles. Las contrataciones deben observar
FULWHULRVGHFHOHULGDGHFRQRPtD\HFDFLD
g) Principio de Publicidad: Las convocatorias de los procesos de seleccin
y los actos que se dicten como consecuencia debern ser objeto de
SXEOLFLGDG\GLIXVLyQDGHFXDGD\VXFLHQWHDQGHJDUDQWL]DUODOLEUH
concurrencia de los potenciales postores.
h) Principio de Transparencia: Toda contratacin deber realizarse sobre la
EDVHGHFULWHULRV\FDOLFDFLRQHVREMHWLYDVVXVWHQWDGDV\DFFHVLEOHVDORV
postores. Los postores tendrn acceso durante el proceso de seleccin
a la documentacin correspondiente, salvo las excepciones previstas en
la presente norma y su Reglamento. La convocatoria, el otorgamiento
de la Buena Pro y los resultados deben ser de pblico conocimiento.
i) Principio de Economa: En toda contratacin se aplicarn los criterios
de simplicidad, austeridad, concentracin y ahorro en el uso de los
recursos, en las etapas de los procesos de seleccin y en los acuerdos
y resoluciones recados sobre ellos, debindose evitar exigencias y
formalidades costosas e innecesarias en las Bases y en los contratos.
j) Principio de Vigencia Tecnolgica: Los bienes, servicios o la ejecucin
de obras deben reunir las condiciones de calidad y modernidad
WHFQROyJLFDVQHFHVDULDVSDUDFXPSOLUFRQHIHFWLYLGDGORVQHVSDUDORV
que son requeridos, desde el mismo momento en que son contratados,
y por un determinado y previsible tiempo de duracin, con posibilidad de
adecuarse, integrarse y repotenciarse si fuera el caso, con los avances
FLHQWtFRV\WHFQROyJLFRV
N 3ULQFLSLRGH7UDWR-XVWRH,JXDOLWDULR7RGRSRVWRUGHELHQHVVHUYLFLRV
o de obras debe tener participacin y acceso para contratar con las
Entidades en condiciones semejantes, estando prohibida la existencia
de privilegios, ventajas o prerrogativas.
l) Principio de Equidad: Las prestaciones y derechos de las partes debern
guardar una razonable relacin de equivalencia y proporcionalidad, sin
perjuicio de las facultades que corresponden al Estado en la gestin del
inters general.
m) Principio de Sostenibilidad Ambiental: En toda contratacin se aplicarn
criterios para garantizar la sostenibilidad ambiental, procurando evitar
impactos ambientales negativos en concordancia con las normas de la
materia.
Estos principios servirn tambin de criterio interpretativo e integrador para
la aplicacin de la presente norma y su Reglamento y como parmetros para
la actuacin de los funcionarios y rganos responsables de las contrataciones.

LEY DE CONTRATACIONES DEL ESTADO
16
Artculo 5.- Especialidad de la norma y delegacin
El presente Decreto Legislativo y su Reglamento prevalecen sobre las normas
de derecho pblico y sobre aquellas de derecho privado que le sean aplicables.
El Titular de la Entidad podr delegar, mediante resolucin, la autoridad que
la presente norma le otorga. No pueden ser objeto de delegacin, la aprobacin
GH H[RQHUDFLRQHV OD GHFODUDFLyQ GH QXOLGDG GH RFLR \ ODV DXWRUL]DFLRQHV GH
prestaciones adicionales de obra y otros supuestos que se establezcan en el
Reglamento.
Concordancia: RLCE: Artculos 3 y 5.

Artculo 6.- rganos que participan en las contrataciones
Cada Entidad establecer en su Reglamento de Organizacin y Funciones
u otros instrumentos de organizacin, el rgano u rganos responsables de
programar, preparar, ejecutar y supervisar los procesos de contratacin hasta su
culminacin, debiendo sealarse las actividades que competen a cada funcionario,
FRQODQDOLGDGGHHVWDEOHFHUODVUHVSRQVDELOLGDGHVTXHOHVRQLQKHUHQWHV
Los funcionarios y servidores que formen parte del rgano encargado de las
contrataciones de la Entidad, debern estar capacitados en temas vinculados con
las contrataciones pblicas, de acuerdo a los requisitos que sean establecidos
en el Reglamento.
Mediante convenio, las Entidades podrn encargar a otras del Sector
Pblico y/o Privado, nacional o internacional, la realizacin de sus procesos
de contratacin incluyendo los actos preparatorios que sean necesarios,
conforme a los procedimientos y formalidades que se establezcan en el
Reglamento.
Concordancia: RLCE: Artculos 5, 86 al 89, Segunda Disposicin
Complementaria Transitoria.

Artculo 7.- Expediente de Contratacin
La Entidad llevar un Expediente de Contratacin que contendr todas las
actuaciones del proceso de contratacin, desde el requerimiento del rea usuaria
hasta la culminacin del contrato, debiendo incluir las ofertas no ganadoras.
El referido expediente quedar bajo custodia del rgano encargado de las
contrataciones, conforme se establezca el Reglamento.
Concordancia: RLCE: Artculo 10.

Artculo 8.- Plan Anual de Contrataciones
Cada Entidad elaborar su Plan Anual de Contrataciones, el cual deber
prever todas las contrataciones de bienes, servicios y obras que se requerirn
GXUDQWHHODxRVFDOFRQLQGHSHQGHQFLDGHOUpJLPHQTXHODVUHJXOHRVXIXHQWH
GHQDQFLDPLHQWRDVtFRPRGHORVPRQWRVHVWLPDGRV\WLSRVGHSURFHVRVGH
VHOHFFLyQSUHYLVWRV/RVPRQWRVHVWLPDGRVDVHUHMHFXWDGRVGXUDQWHHODxRVFDO
correspondiente debern estar comprendidos en el presupuesto institucional. El
17
LEY DE CONTRATACIONES DEL ESTADO
Plan Anual de Contrataciones ser aprobado por el Titular de la Entidad y deber
ser publicado en el Sistema Electrnico de Contrataciones del Estado (SEACE).
El Reglamento determinar los requisitos, contenido y procedimientos para la
IRUPXODFLyQ\PRGLFDFLyQGHO3ODQ$QXDOGH&RQWUDWDFLRQHV
Concordancia: RLCE: Artculos 6 al 9.
TTULO II
DE LOS PROCESOS DE SELECCIN

CAPTULO I
DISPOSICIONES GENERALES

Artculo 9.- Registro Nacional de Proveedores
9.1. Para ser participante, postor y/o contratista se requiere estar inscrito
en el Registro Nacional de Proveedores (RNP) y no estar impedido,
sancionado ni inhabilitado para contratar con el Estado.
9.2. El reglamento establece la organizacin, funciones y procedimientos
del Registro Nacional de Proveedores (RNP), as como los requisitos
para la inscripcin y su renovacin, la asignacin de categoras y
especialidades, la inclusin y la periodicidad con que se publica la
relacin de sancionados en el Portal del Organismo Supervisor de las
Contrataciones del Estado (OSCE). En ningn caso, estos requisitos
constituyen barreras a la competencia y se establecen en cumplimiento
del principio de reciprocidad.
La publicacin de los sancionados incluye informacin de los socios,
accionistas, participacionistas o titulares, y de los integrantes de los
rganos de administracin, de conformidad con el procedimiento previsto
en el reglamento.
9.3. A los Proveedores del Estado inscritos como Ejecutores de Obra ante el
Registro Nacional de Proveedores (RNP), se les asignar una capacidad
mxima de contratacin que ser calculada en funcin de su capital social
suscrito y pagado en el Per y de la experiencia con la que cuenten
como ejecutores de obra, quedando expresamente establecido que el
capital social suscrito y pagado de las personas jurdicas inscritas como
ejecutores de obra ante el Registro Nacional de Proveedores (RNP),
no podr ser inferior al 5% de su capacidad mxima de contratacin; y
en el caso de personas jurdicas que no estuvieran constituidas en el
Per y que en consecuencia no contaran con capital social en el pas,
en funcin de la asignacin de capital que le hubiera sido efectivamente
GHSRVLWDGDHQXQDHQWLGDGGHOVLVWHPDQDQFLHURQDFLRQDOHQHOFDVR
de las sucursales y, de un mecanismo equivalente en el caso de las
personas jurdicas no domiciliadas, quienes debern acreditar haber
GHSRVLWDGRHQXQDFXHQWDDELHUWDHQXQDHPSUHVDGHOVLVWHPDQDQFLHUR
LEY DE CONTRATACIONES DEL ESTADO
18
nacional a nombre de su representante legal en el pas, el monto en
virtud del cual se calcular su capacidad mxima de contratacin. Tanto
en el caso de las sucursales de personas jurdicas extranjeras en el
Per como de personas jurdicas no domiciliadas, los aportes dinerarios
antes sealados, a efectos de tener validez frente al Registro Nacional
GH 3URYHHGRUHV 513 GHEHUiQ KDEHU VLGR DSUREDGRV SRU OD -XQWD
General de Accionistas u rgano anlogo de la Sociedad, previamente
a su depsito efectivo, de acuerdo a los estatutos de cada empresa
o a las leyes del pas en virtud de las cuales se hubiera constituido la
matriz.
Sin perjuicio de lo antes sealado, a efectos de realizar la inscripcin de
empresas extranjeras ante el Registro Nacional de Proveedores (RNP)
se aplicar el Principio de Reciprocidad.
Las empresas extranjeras recibirn el mismo trato que las empresas
peruanas reciben en su pas de origen en materia de contrataciones
del Estado.
Las disposiciones establecidas en los prrafos anteriores no se aplican a
los proveedores que provengan de pases con los cuales la Repblica del
Per tuviera vigente un tratado o compromiso internacional que incluya
disposiciones en materia de contrataciones pblicas; ni a las micro
y pequeas empresas - mypes debidamente inscritas en el Registro
Nacional de la Micro y Pequea Empresa (REMYPE).
9.4. Los proveedores cuya inscripcin en el Registro Nacional de Proveedores
(RNP) haya sido declarada nula por haber presentado documentacin
falsa o informacin inexacta, slo podrn solicitar su reinscripcin en el
referido Registro luego de transcurrido dos (2) aos desde que qued
DGPLQLVWUDWLYDPHQWHUPHODUHVROXFLyQTXHGHFODUyODQXOLGDG
El Registro Nacional de Proveedores (RNP) no debe exigir la licencia
de funcionamiento en el procedimiento de inscripcin.
El Organismo Supervisor de las Contrataciones del Estado (OSCE)
administra el Registro Nacional de Proveedores (RNP) y debe
mantenerlo actualizado en su portal institucional.
Las Entidades estn prohibidas de llevar registros de proveedores.
Slo estn facultadas para llevar y mantener un listado interno de
proveedores, consistente en una base de datos que contenga la relacin
de aquellos. Bajo ninguna circunstancia, la incorporacin en este listado
es requisito para la participacin en los procesos de seleccin que la
Entidad convoque. La incorporacin de proveedores en este listado es
discrecional y gratuita.
El Registro Nacional de Proveedores (RNP) tiene carcter
GHVFRQFHQWUDGR D Q GH QR SHUMXGLFDU QL JHQHUDU PD\RUHV FRVWRV
de transaccin a las pequeas y micro empresas localizadas en las
diversas regiones del pas.
19
LEY DE CONTRATACIONES DEL ESTADO
Bajo responsabilidad, en el marco de la legislacin vigente sobre la
PDWHULDHO5HJLVWUR1DFLRQDOGH,GHQWLFDFLyQ\(VWDGR&LYLO5(1,(&
la Superintendencia Nacional de Aduanas y de Administracin Tributaria
(SUNAT), la Superintendencia Nacional de los Registros Pblicos
(SUNARP), el Instituto Nacional de Defensa de la Competencia y de la
Proteccin de la Propiedad Intelectual (INDECOPI), la Superintendencia
de Banca, Seguros y Administradoras Privadas de Fondos de
3HQVLRQHV6%6HO3RGHU-XGLFLDOOD3ROLFtD1DFLRQDOGHO3HU~313
y otras Entidades de las que pueda requerirse informacin, deben
proporcionar el acceso a la informacin pertinente, salvaguardando las
UHVHUYDVSUHYLVWDVSRUOH\FRQODQDOLGDGTXHHO5HJLVWUR1DFLRQDOGH
Proveedores (RNP) cuente con informacin actualizada que permita
HMHUFHUODVFDOL]DFLyQSRVWHULRUGHODLQIRUPDFLyQSUHVHQWDGDSRUORV
proveedores.
Mediante Decreto Supremo refrendado por el Ministro de Economa y
Finanzas puede disponerse el acceso a la informacin que posean otras
Entidades y que sea relevante para el Registro Nacional de Proveedores
(RNP).
9.5. En ningn caso, las Bases de los procesos de seleccin exigen a los
postores la documentacin que estos hubiesen tenido que presentar
para su inscripcin ante el Registro Nacional de Proveedores (RNP).
2
Concordancia: RLCE: Artculos 52, 251 al 282

Artculo 10.- Impedimentos para ser postor y/o contratista
Cualquiera sea el rgimen legal de contratacin aplicable, estn impedidos
de ser participantes, postores y/o contratistas:
a) En todo proceso de contratacin pblica, hasta doce (12) meses
despus de haber dejado el cargo, el Presidente y los Vicepresidentes
de la Repblica, los Congresistas de la Repblica, los Ministros y
9LFHPLQLVWURVGH(VWDGRORV9RFDOHVGHOD&RUWH6XSUHPDGH-XVWLFLD
de la Repblica, los titulares y los miembros del rgano colegiado de
los Organismos Constitucionales Autnomos;
b) En el mbito regional, hasta doce (12) meses despus de haber deja-
do el cargo, los Presidentes, Vicepresidentes y los Consejeros de los
Gobiernos Regionales;
c) En el mbito de su jurisdiccin, hasta doce (12) meses despus de haber
GHMDGRHOFDUJRORV9RFDOHVGHODV&RUWHV6XSHULRUHVGH-XVWLFLDORV
Alcaldes y Regidores;
d) En la Entidad a la que pertenecen, los titulares de instituciones o de
organismos pblicos del Poder Ejecutivo, los directores, gerentes y
trabajadores de las empresas del Estado, los funcionarios pblicos,
HPSOHDGRVGHFRQDQ]D\VHUYLGRUHVS~EOLFRVVHJ~QODOH\HVSHFLDO
de la materia;
0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
20
e) En el correspondiente proceso de contratacin, las personas naturales
o jurdicas que tengan intervencin directa en la determinacin de
las caractersticas tcnicas y valor referencial, elaboracin de Bases,
seleccin y evaluacin de ofertas de un proceso de seleccin y en la
autorizacin de pagos de los contratos derivados de dicho proceso,
salvo en el caso de los contratos de supervisin;
f) En el mbito y tiempo establecidos para las personas sealadas en los
literales precedentes, el cnyuge, conviviente o los parientes hasta el
FXDUWRJUDGRGHFRQVDQJXLQLGDG\VHJXQGRGHDQLGDG
g) En el mbito y tiempo establecidos para las personas sealadas en los
literales precedentes, las personas jurdicas en las que aquellas tengan
o hayan tenido una participacin superior al cinco por ciento (5%) del
capital o patrimonio social, dentro de los doce (12) meses anteriores a
la convocatoria;
h) En el mbito y tiempo establecidos para las personas sealadas en los
OLWHUDOHVSUHFHGHQWHVODVSHUVRQDVMXUtGLFDVVLQQHVGHOXFURHQODVTXH
aquellas participen o hayan participado como asociados o miembros
de sus consejos directivos, dentro de los doce (12) meses anteriores a
la convocatoria;
i) En el mbito y tiempo establecidos para las personas sealadas en los
literales precedentes, las personas jurdicas cuyos integrantes de los
rganos de administracin, apoderados o representantes legales sean
las personas sealadas en los literales precedentes. Idntica prohibicin
se extiende a las personas naturales que tengan como apoderados o
representantes a las personas sealadas en los literales precedentes;
j) Las personas naturales o jurdicas que se encuentren sancionadas
administrativamente con inhabilitacin temporal o permanente en el
ejercicio de sus derechos para participar en procesos de seleccin y
para contratar con Entidades, de acuerdo a lo dispuesto por la presente
norma y su Reglamento;
k) Las personas jurdicas cuyos socios, accionistas, participacionistas,
titulares, integrantes de los rganos de administracin, apoderados o
representantes legales formen o hayan formado parte, en los ltimos
doce (12) meses de impuesta la sancin, de personas jurdicas que se
encuentren sancionadas administrativamente con inhabilitacin temporal
o permanente para participar en procesos de seleccin y para contratar
con el Estado; o que habiendo actuado como personas naturales hayan
sido sancionadas por la misma infraccin; conforme a los criterios
sealados en el presente Decreto Legislativo y su Reglamento. Para
el caso de socios, accionistas, participacionistas o titulares, este
impedimento se aplicar siempre y cuando la participacin sea superior
al cinco por ciento (5%) del capital o patrimonio social y por el tiempo
que la sancin se encuentre vigente;
l) Otros establecidos por ley o por el Reglamento de la presente norma.
21
LEY DE CONTRATACIONES DEL ESTADO
Las propuestas que contravengan lo dispuesto en el presente artculo se
tendrn por no presentadas. Los contratos celebrados en contravencin de lo
dispuesto por el presente artculo son nulos, sin perjuicio de las responsabilidades
a que hubiere lugar de los funcionarios y servidores de la Entidad contratante y
de los contratistas que celebraron dichos contratos.
Concordancia: RLCE: Artculo 237.

Artculo 11.- Prohibicin de prcticas que afecten la mayor concurrencia
y competencia en los procesos de contratacin.
Se encuentra prohibida la concertacin de precios, condiciones o ventajas,
entre proveedores o entre proveedores y terceros, que pueda afectar la mayor
concurrencia y/o competencia en los procesos de contratacin. Esta afectacin
a la libre competencia tambin puede materializarse mediante acuerdos para no
participar o no presentar propuestas en los procesos de contratacin. El funcionario
o servidor pblico que intervenga o favorezca estas prcticas ser sancionado
administrativa o penalmente de acuerdo a la normativa correspondiente.
3
Artculo 12.- Requisitos para convocar a un proceso
Es requisito para convocar a proceso de seleccin, bajo sancin de
nulidad, que el mismo est incluido en el Plan Anual de Contrataciones y
cuente con el Expediente de Contratacin debidamente aprobado conforme
a lo que disponga el Reglamento, el mismo que incluir la disponibilidad de
UHFXUVRV\VXIXHQWHGHQDQFLDPLHQWRDVtFRPRODV%DVHVGHELGDPHQWH
aprobadas, salvo las excepciones establecidas en el Reglamento.
Se podrn efectuar procesos cuya ejecucin contractual se prolongue
por ms de un (1) ejercicio presupuestario, en cuyo caso deber adoptarse
la debida reserva presupuestaria en los ejercicios correspondientes, para
garantizar el pago de las obligaciones.
Concordancia: LCE: Artculo 8.
RLCE: Artculos 10 y 35.
Artculo 13.- Caractersticas tcnicas de los bienes, servicios y obras
a contratar
Sobre la base del Plan Anual de Contrataciones, el rea usuaria deber
requerir la contratacin de los bienes, servicios u obras, teniendo en cuenta
los plazos de duracin establecidos para cada proceso de seleccin, con el
QGHDVHJXUDUODRSRUWXQDVDWLVIDFFLyQGHVXVQHFHVLGDGHV
Al plantear su requerimiento, el rea usuaria deber describir el bien,
VHUYLFLRXREUDDFRQWUDWDUGHQLHQGRFRQSUHFLVLyQVXFDQWLGDG\FDOLGDG
LQGLFDQGRODQDOLGDGS~EOLFDSDUDODTXHGHEHVHUFRQWUDWDGR
/DIRUPXODFLyQGHODVHVSHFLFDFLRQHVWpFQLFDVGHEHUiVHUUHDOL]DGDSRUHO
rea usuaria en coordinacin con el rgano encargado de las contrataciones
0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
22
de la Entidad, evaluando en cada caso las alternativas tcnicas y las posibi-
lidades que ofrece el mercado para la satisfaccin del requerimiento. Esta
evaluacin deber permitir la concurrencia de la pluralidad de proveedores
en el mercado para la convocatoria del respectivo proceso de seleccin,
evitando incluir requisitos innecesarios cuyo cumplimiento slo favorezca
a determinados postores.
/DV HVSHFLFDFLRQHV WpFQLFDV GHEHQ FXPSOLU REOLJDWRULDPHQWH FRQ ORV
reglamentos tcnicos, normas metrolgicas y/o sanitarias nacionales, si las
hubiere. Estas podrn recoger las condiciones determinadas en las normas
tcnicas, si las hubiere.
En el caso de obras, adems, se deber contar con la disponibilidad
fsica del terreno o lugar donde se ejecutar la misma y con el expediente
tcnico aprobado, debiendo cumplir con los requisitos establecidos en el
5HJODPHQWR /D(QWLGDGFDXWHODUiVXDGHFXDGD IRUPXODFLyQ FRQHOQGH
asegurar la calidad tcnica y reducir al mnimo la necesidad de su reformu-
ODFLyQSRUHUURUHVRGHFLHQFLDVWpFQLFDVTXHUHSHUFXWDQHQHOSURFHVRGH
ejecucin de obras.
En los procesos de seleccin segn relacin de tems, etapas, tramos,
paquetes o lotes se podr convocar la contratacin de bienes, servicios
y obras en un solo proceso, establecindose un valor referencial para
cada tem, etapa, tramo, paquete o lote. El Reglamento establecer los
procedimientos adicionales a seguir en stos casos.
Concordancia: RLCE: Artculo 11.
Artculo 14.- Contenido de la convocatoria y plazos de los procesos de
seleccin
(OFRQWHQLGRGHODFRQYRFDWRULDGHORVSURFHVRVGHVHOHFFLyQVHMDUiHQHO
Reglamento, debiendo existir un plazo razonable entre la convocatoria y la pre-
sentacin de propuestas atendiendo a las caractersticas propias de cada proceso.
Los plazos de los procesos de seleccin se computan por das hbiles,
GHELHQGRMDUVHHQHO5HJODPHQWRORVTXHFRUUHVSRQGHUiQDFDGDXQDGHODV
etapas del proceso.
Concordancia: RLCE: Artculos 22 al 24.
CAPTULO II
DE LOS PROCESOS DE SELECCIN
Artculo 15.- Mecanismos de contratacin
Los procesos de seleccin son: licitacin pblica, concurso pblico, adjudicacin
directa y adjudicacin de menor cuanta, los cuales se podrn realizar de manera
corporativa o sujeto a las modalidades de seleccin de Subasta Inversa o Convenio
0DUFRGHDFXHUGRDORTXHGHQDHO5HJODPHQWR
En el Reglamento se determinar las caractersticas, requisitos, procedimientos,
23
LEY DE CONTRATACIONES DEL ESTADO
metodologas, modalidades, plazos, excepciones y sistemas aplicables a cada
proceso de seleccin.
Concordancia: RLCE: Artculos 21, 80 al 85, 90 al 103.
Artculo 16.- Licitacin pblica y concurso pblico
La licitacin pblica se convoca para la contratacin de bienes, suministros y
obras. El concurso pblico se convoca para la contratacin de servicios de toda
naturaleza.
En ambos casos, se aplican los mrgenes que establece la Ley de Presupuesto
del Sector Pblico.
Artculo 17.- Adjudicacin directa
La adjudicacin directa se aplica para las contrataciones que realice la Entidad,
dentro de los mrgenes que establece la Ley de Presupuesto del Sector Pblico.
La adjudicacin directa puede ser pblica o selectiva. El Reglamento sealar la
forma, requisitos y procedimiento en cada caso.
Artculo 18.- Adjudicacin de menor cuanta
La adjudicacin de menor cuanta se aplica a las contrataciones que realice la
Entidad, cuyo monto sea inferior a la dcima parte del lmite mnimo establecido
por la Ley de Presupuesto del Sector Pblico para los casos de licitacin pblica
y concurso pblico.
El Reglamento sealar los requisitos y las formalidades mnimas para el
GHVDUUROORGHORVSURFHVRVGHVHOHFFLyQDTXHVHUHHUHHOSUHVHQWHDUWtFXOR/DV
Entidades debern publicar en su portal institucional los requerimientos de bienes
o servicios a ser adquiridos bajo la modalidad de menor cuanta.
En las adjudicaciones de menor cuanta, las contrataciones se realizarn
obligatoriamente en forma electrnica a travs del Sistema Electrnico de
Contrataciones del Estado (SEACE), con las excepciones que establezca el
Reglamento.
Asimismo, el Reglamento de la presente norma, establecer la forma en que
se aplicarn progresiva y obligatoriamente las contrataciones electrnicas a los
procesos de licitacin pblica, concurso pblico y adjudicacin directa en sus
distintas modalidades.
Artculo 19.- Prohibicin de fraccionamiento
Queda prohibido fraccionar la contratacin de bienes, de servicios y la ejecucin
de obras con el objeto de evitar el tipo de proceso de seleccin que corresponda
segn la necesidad anual, o de evadir la aplicacin de la normativa de contrata-
ciones del Estado para dar lugar a contrataciones menores a tres (3) UIT, y/o de
acuerdos comerciales suscritos por el Estado peruano en materia de contratacin
pblica. No se considera fraccionamiento a las contrataciones por etapas, tramos,
paquetes o lotes posibles en funcin a la naturaleza del objeto de la contratacin o
para propiciar la participacin de las microempresas y de las pequeas empresas
LEY DE CONTRATACIONES DEL ESTADO
24
en aquellos sectores econmicos donde exista oferta competitiva.
El Ministerio de Economa y Finanzas, previa opinin favorable del Ministerio
de la Produccin y del Ministerio de Trabajo y Promocin del Empleo, establece
mediante Decreto Supremo los sectores que son materia de inters del Estado
para promover la participacin de la microempresa y de la pequea empresa.
La prohibicin se aplica sobre el monto total de la etapa, tramo, paquete o
lote a ejecutar.
El rgano encargado de las contrataciones en cada Entidad es responsable
HQFDVRGHLQFXPSOLPLHQWRGHODSURKLELFLyQDTXHVHUHHUHHOSUHVHQWHDUWtFXOR
4
Concordancia: RLCE: Artculo 20.
Artculo 20.- Exoneracin de procesos de seleccin
Estn exoneradas de los procesos de seleccin las contrataciones que se realicen:
a) Entre Entidades, siempre que en razn de costos de oportunidad
UHVXOWHQ PiV HFLHQWHV \ WpFQLFDPHQWH YLDEOHV SDUD VDWLVIDFHU OD
QHFHVLGDG \ QR VH FRQWUDYHQJD OR VHxDODGR HQ HO DUWtFXOR GH OD
Constitucin Poltica del Per.
b) Ante una situacin de emergencia derivada de acontecimientos
FDWDVWUyFRVRGHDFRQWHFLPLHQWRVTXHDIHFWHQODGHIHQVDRVHJXULGDG
nacional, o de situaciones que supongan el grave peligro de que ocurra
alguno de los supuestos anteriores.
c) Ante una situacin de desabastecimiento debidamente comprobada, que
afecte o impida a la Entidad cumplir con sus actividades u operaciones,
debiendo determinarse, de ser el caso, las responsabilidades de
los funcionarios o servidores cuya conducta hubiera originado la
FRQJXUDFLyQGHHVWDFDXVDO
d) Con carcter de secreto, secreto militar o por razones de orden interno,
por parte de las Fuerzas Armadas, la Polica Nacional del Per y los
organismos conformantes del Sistema Nacional de Inteligencia, que
deban mantenerse en reserva conforme a ley, previa opinin favorable
de la Contralora General de la Repblica.
e) Cuando exista proveedor nico de bienes o servicios que no admiten
sustitutos, o cuando por razones tcnicas o relacionadas con la
proteccin de derechos, se haya establecido la exclusividad del
proveedor.
f) Para los servicios personalsimos prestados por personas naturales,
con la debida sustentacin objetiva.
El Reglamento establece las formalidades, condiciones y requisitos
complementarios que corresponden a cada una de las causales de exoneracin.
5
Concordancia: RLCE: Artculos 127 al 132.
4,5 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
25
LEY DE CONTRATACIONES DEL ESTADO
Artculo 21.- Formalidades de las contrataciones exoneradas
Las contrataciones derivadas de exoneracin de procesos de seleccin
se realizarn de manera directa, previa aprobacin mediante Resolucin del
Titular de la Entidad, Acuerdo del Directorio, del Consejo Regional o del Concejo
Municipal, segn corresponda, en funcin a los informes tcnico y legal previos
que obligatoriamente debern emitirse.
Copia de dichas Resoluciones o Acuerdos y los informes que los sustentan
deben remitirse a la Contralora General de la Repblica y publicarse en el Sistema
Electrnico de Contrataciones del Estado (SEACE), dentro de los diez (10) das
hbiles de su aprobacin, bajo responsabilidad del Titular de la Entidad. Estn
H[RQHUDGRVGHODVSXEOLFDFLRQHVORVFDVRVDTXHVHUHHUHHOLQFLVRGGHODUWtFXOR
20 de la presente norma.
Est prohibida la aprobacin de exoneraciones en va de regularizacin, a
excepcin de la causal de situacin de emergencia.
Concordancias: RLCE: Artculos 133 al 136.
Artculo 22.- Situacin de desabastecimiento
Se considera desabastecimiento a aquella situacin inminente, extraordinaria
e imprevisible en la que la ausencia de un bien o servicio compromete en forma
directa e inminente la continuidad de las funciones, servicios, actividades u
operaciones que la Entidad tiene a su cargo. Dicha situacin faculta a la Entidad
a la contratacin de los bienes y servicios slo por el tiempo y/o cantidad, segn
sea el caso, necesario para resolver la situacin y llevar a cabo el proceso de
seleccin que corresponda.
La aprobacin de la exoneracin en virtud de la causal de situacin de
desabastecimiento no constituye dispensa, exencin o liberacin de las
responsabilidades de los funcionarios o servidores de la Entidad cuya conducta
KXELHVH RULJLQDGR OD SUHVHQFLD R FRQJXUDFLyQ GH GLFKD FDXVDO &RQVWLWX\H
agravante de responsabilidad si la situacin fue generada por dolo o culpa
inexcusable del funcionario o servidor de la Entidad. En estos casos, la autoridad
competente para autorizar la exoneracin debe ordenar, en el acto aprobatorio
de la misma, el inicio de las acciones que correspondan, de acuerdo al artculo
46 de la presente ley.
Tratndose de contrataciones bajo la cobertura de un tratado o compromiso
internacional que incluya disposiciones sobre contrataciones pblicas, la
exoneracin slo procede si la situacin de desabastecimiento rene las
condiciones indicadas en el primer prrafo del presente artculo.
Cuando no corresponda realizar un proceso de seleccin posterior, en
los informes tcnico y legal previos que sustentan la Resolucin o el Acuerdo
que autoriza la exoneracin, se debe fundamentar las razones que motivan la
FRQWUDWDFLyQGHQLWLYDPDWHULDGHODH[RQHUDFLyQ(VWDGLVSRVLFLyQWDPELpQHVGH
aplicacin, de ser el caso, para la situacin de emergencia.
6
Concordancia: RLCE: Artculo 129.
6 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
26
Artculo 23.- Situacin de emergencia
Se entiende como situacin de emergencia aquella en la cual la Entidad tenga
TXHDFWXDUGHPDQHUDLQPHGLDWDDFDXVDGHDFRQWHFLPLHQWRVFDWDVWUyFRVRGH
acontecimientos que afecten la defensa o seguridad nacional, o de situaciones
que supongan el grave peligro de que alguno de los supuestos anteriores ocurra.
En este caso, la Entidad queda exonerada de la tramitacin del expediente
administrativo, debiendo obtener en forma inmediata lo estrictamente necesario
para prevenir y atender los requerimientos generados como consecuencia del
evento producido, sin sujetarse a los requisitos formales de la presente norma.
El reglamento establece los mecanismos y plazos para la regularizacin del
procedimiento correspondiente.
Las dems actividades necesarias para completar el objetivo propuesto por
la Entidad no tienen el carcter de emergencia y se contratan de acuerdo a lo
establecido en la presente norma.
Los funcionarios pblicos que aprovechando de las disposiciones de este
artculo dispusieran las adquisiciones de bienes, servicios y obras, sin que se
haya dado una real situacin de emergencia y/o adquieran los mismos ms all
de lo estrictamente necesario, sern pasibles de las sanciones penales y admi-
nistrativas que correspondan.
7
Concordancia: RLCE: Artculo 128.
Artculo 24.- Del Comit Especial
En las licitaciones pblicas y concursos pblicos, la Entidad designar a un
Comit Especial que deber conducir el proceso.
Para las adjudicaciones directas, el Reglamento establecer las reglas
para la designacin y conformacin de Comits Especiales Permanentes o el
nombramiento de un Comit Especial ad hoc.
El rgano encargado de las contrataciones tendr a su cargo la realizacin
de los procesos de adjudicacin de menor cuanta. En estos casos el Titular de
la Entidad podr designar a un Comit Especial ad hoc o permanente, cuando
lo considere conveniente.
El Comit Especial estar integrado por tres (3) miembros, de los cuales uno
(1) deber pertenecer al rea usuaria de los bienes, servicios u obras materia de
la convocatoria, y otro al rgano encargado de las contrataciones de la Entidad.
Necesariamente alguno de los miembros deber tener conocimiento tcnico
HQ HO REMHWR GH OD FRQWUDWDFLyQ (Q HO FDVR GH ELHQHV VRVWLFDGRV VHUYLFLRV
especializados, obras o cuando la Entidad no cuente con un especialista, podrn
integrar el Comit Especial uno o ms expertos independientes, ya sean personas
naturales o jurdicas que no laboren en la Entidad contratante o funcionarios que
laboran en otras Entidades.
El Comit Especial tendr a su cargo la elaboracin de las Bases y la
7 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
27
LEY DE CONTRATACIONES DEL ESTADO
organizacin, conduccin y ejecucin del proceso de seleccin, hasta que la
%XHQD3URTXHGHFRQVHQWLGDRDGPLQLVWUDWLYDPHQWHUPHRVHFDQFHOHHOSURFHVR
de seleccin.
Si el Comit Especial toma conocimiento que en las propuestas obra un
documento sobre cuya veracidad o exactitud existe duda razonable, informar el
hecho al rgano encargado de las contrataciones para que efecte la inmediata
VFDOL]DFLyQ(OORQRVXVSHQGHUiHQQLQJ~QFDVRODFRQWLQXLGDGGHOSURFHVRGH
seleccin.
(QORVFDVRVDTXHVHUHHUHHODUWtFXORGHOSUHVHQWH'HFUHWR/HJLVODWLYR
los procesos de seleccin sern conducidos por el mismo Comit Especial que
condujo el proceso de seleccin original.
Concordancia: LCE: Artculo 32.
RLCE: Artculos 27, 28, 30 al 31.
Artculo 25.- Responsabilidad
Los miembros del Comit Especial son solidariamente responsables de que
el proceso de seleccin realizado se encuentre conforme a ley y responden
administrativa y/o judicialmente, en su caso, respecto de cualquier irregularidad
cometida en el mismo que les sea imputable por dolo, negligencia y/o culpa
inexcusable. Es de aplicacin a los miembros del Comit Especial lo establecido
en el artculo 46 del presente Decreto Legislativo.
En caso se determine responsabilidad en los expertos independientes que
participen en el Comit Especial, sean stos personas naturales o jurdicas, el
hecho se comunicar al Tribunal de Contrataciones del Estado para que previa
evaluacin se les incluya en el Captulo de Inhabilitados para Contratar con el
Estado del Registro Nacional de Proveedores (RNP).
Concordancia: LCE: Artculo 46.
RLCE: Artculo 34.
LEY DE CONTRATACIONES DEL ESTADO
28
CAPTULO III
DE LAS BASES
Artculo 26.- Condiciones mnimas de las Bases
Las Bases de un proceso de seleccin sern aprobadas por el Titular de
la Entidad o por el funcionario al que le hayan delegado esta facultad y deben
contener obligatoriamente, con las excepciones establecidas en el Reglamento
para la adjudicacin de menor cuanta, lo siguiente:
a) Los mecanismos que fomenten la mayor concurrencia y participacin
de postores en funcin al objeto del proceso y la obtencin de la
propuesta tcnica y econmica ms favorable. No constituye tratamiento
discriminatorio la exigencia de requisitos tcnicos y comerciales de
carcter general establecidos por las Bases;
b) El detalle de las caractersticas tcnicas de los bienes, servicios u obras
a contratar; el lugar de entrega, elaboracin o construccin, as como
el plazo de ejecucin, segn el caso. Este detalle puede constar en
XQ$QH[RGH(VSHFLFDFLRQHV7pFQLFDVRHQHOFDVRGHREUDVHQXQ
Expediente Tcnico;
c) Las garantas, de acuerdo a lo que establezca el Reglamento;
d) Los plazos y mecanismos de publicidad que garanticen la efectiva
posibilidad de participacin de los postores;
H /DGHQLFLyQGHOVLVWHPD\RPRGDOLGDGDVHJXLUFRQIRUPHDORGLVSXHVWR
en la presente norma y su Reglamento.
f) El cronograma del proceso de seleccin;
J (OPpWRGRGHHYDOXDFLyQ\FDOLFDFLyQGHSURSXHVWDV
h) La proforma de contrato, en la que se seale las condiciones de
la contratacin, salvo que corresponda slo la emisin de una
orden de compra o de servicios. En el caso de contratos de obras,
JXUDUiQ QHFHVDULDPHQWH FRPR DQH[RV HO &URQRJUDPD *HQHUDO GH
Ejecucin de la obra, el Cronograma de los Desembolsos previstos
presupuestalmente y el Expediente Tcnico;
i) El Valor Referencial y las frmulas de reajuste en los casos que deter-
mine el Reglamento;
M /DVQRUPDVTXHVHDSOLFDUiQHQFDVRGHQDQFLDPLHQWRRWRUJDGRSRU
entidades Multilaterales o Agencias Gubernamentales; y,
N /RVPHFDQLVPRVTXHDVHJXUHQODFRQGHQFLDOLGDGGHODVSURSXHVWDV
Lo establecido en las Bases, en la presente norma y su Reglamento obliga a
todos los postores y a la Entidad convocante.
El Organismo Supervisor de las Contrataciones del Estado - OSCE, mediante
Directivas, aprobar Bases Estandarizadas, cuyo uso ser obligatorio por las
Entidades.
Concordancia: RLCE: Artculos 35 al 49, Cuarta Disposicin
Complementaria Transitoria.
29
LEY DE CONTRATACIONES DEL ESTADO
Artculo 27.- Valor Referencial
El rgano encargado de las contrataciones en cada Entidad determina el
9DORU5HIHUHQFLDOGHFRQWUDWDFLyQFRQHOQGHHVWDEOHFHUHOWLSRGHSURFHVRGH
seleccin correspondiente y gestionar la asignacin de los recursos presupuestales
necesarios. En los procesos de seleccin sujetos a la modalidad de Convenio
Marco, la determinacin del valor referencial es facultativa.
El Valor Referencial es determinado sobre la base de un estudio de las
posibilidades de precios y condiciones que ofrece el mercado, efectuado en funcin
GHODQiOLVLVGHORVQLYHOHVGHFRPHUFLDOL]DFLyQDSDUWLUGHODVHVSHFLFDFLRQHV
tcnicas o trminos de referencia y los costos estimados en el Plan Anual de
Contrataciones, de acuerdo a los criterios sealados en el reglamento. Cuando
se trate de proyectos de inversin, el valor referencial se establece de acuerdo
al monto de inversin consignado en el estudio de preinversin que sustenta la
declaracin de viabilidad.
Tratndose de obras, el Valor Referencial no puede tener una antigedad
mayor a los seis (6) meses contados desde la fecha de determinacin del
presupuesto consignado en el Expediente Tcnico.
En el caso de bienes y servicios, la antigedad del Valor Referencial no puede
ser mayor a tres (3) meses contados a partir de la aprobacin del Expediente
de Contratacin. Para los casos en que se requiera un perodo mayor a los
consignados, el rgano encargado de las contrataciones, responsable de
determinar el Valor Referencial, debe indicar el perodo de actualizacin del mismo.
El Valor Referencial tiene carcter pblico. Slo de manera excepcional,
la Entidad determina que ste tenga carcter reservado, mediante decisin
debidamente sustentada, bajo responsabilidad del Titular de la Entidad. El Valor
Referencial siempre es informado al Sistema Electrnico de Contrataciones del
Estado (SEACE).
El reglamento seala los mecanismos para la determinacin del Valor
Referencial, incluyendo la contratacin de servicios de cobranza, recuperaciones
o similares, y honorarios de xito.
8
Concordancia: RLCE: Artculos 13 al 17.
Artculo 28.- Consultas y Observaciones a las Bases
(OFURQRJUDPDDTXHVHUHHUHHOOLWHUDOIGHODUWtFXORGHODSUHVHQWHOH\GHEH
establecer plazos para la presentacin y absolucin de consultas y observaciones
al contenido de las Bases.
A travs de las consultas, se formulan pedidos de aclaracin a las disposiciones
de las Bases y mediante las observaciones se cuestionan las mismas en lo relativo
al incumplimiento de las condiciones mnimas o de cualquier disposicin en materia
de contrataciones del Estado u otras normas complementarias o conexas que
tengan relacin con el proceso de seleccin.
0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
30
Las respuestas a las consultas y observaciones deben ser fundamentadas
y sustentadas y se comunicarn, de manera oportuna y simultnea, a todos los
participantes a travs del Sistema Electrnico de Contrataciones del Estado
(SEACE), considerndose como parte integrante de las Bases.
Los participantes pueden solicitar que las Bases y los actuados del proceso
sean elevados para pronunciamiento del Organismo Supervisor de las
Contrataciones del Estado (OSCE), siempre que se cumpla con los supuestos
de elevacin establecidos en el reglamento.
El procedimiento y plazo para tramitar las consultas y observaciones son
MDGRVHQHOUHJODPHQWR
9
Concordancia: RLCE: Artculos 54, 56 y 58.
Artculo 29.- Sujecin legal de las Bases
La elaboracin de las Bases recoger lo establecido en la presente norma
y su Reglamento y otras normas complementarias o conexas que tengan
relacin con el proceso de seleccin, las que se aplicarn obligatoriamente.
Slo en caso de vacos normativos se observarn los principios y normas de
derecho pblico que le sean aplicables.
Concordancia: RLCE: Artculos 35 al 49.
CAPTULO IV
DE LOS PROCEDIMIENTOS
Artculo 30.- Presentacin de propuestas y otorgamiento de la Buena Pro
La presentacin de propuestas y el otorgamiento de la Buena Pro, en los casos
que seale el Reglamento, se realizar en acto pblico en una o ms fechas
VHxDODGDVHQODFRQYRFDWRULDFRQSUHVHQFLDGHQRWDULRS~EOLFRR-XH]GH3D]
cuando en la localidad donde se efecte no hubiera el primero. Los procedimientos
y requisitos de dicha presentacin sern regulados por el Reglamento.
Las etapas y los actos del proceso de seleccin podrn ser materia de
prrroga o postergacin por el Comit Especial siempre y cuando medien
FDXVDVGHELGDPHQWHMXVWLFDGDVGDQGRDYLVRGHHOORDWRGRVORVSDUWLFLSDQWHV
del proceso de seleccin. Adems, se deber remitir un informe al Titular de la
Entidad explicando el motivo de la prrroga o de la postergacin.
La postergacin o prrroga no podr conducir a la Entidad a una situacin de
desabastecimiento, bajo responsabilidad del Titular de la Entidad.
Del acto de presentacin de propuestas y de otorgamiento de Buena Pro se
levantar un acta que ser suscrita por todos los miembros del Comit Especial,
por todos los veedores y por los postores que deseen hacerlo.
El procedimiento para la presentacin de propuestas, el otorgamiento de la
9 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
31
LEY DE CONTRATACIONES DEL ESTADO
Buena Pro y la publicacin de resultados a travs del Sistema Electrnico de
&RQWUDWDFLRQHVGHO(VWDGR6($&(VHMDUiQHQHO5HJODPHQWR
Concordancia: RLCE: Artculos 26, 64, 72 y 75.
Artculo 31.- Evaluacin y calificacin de propuestas
(OPpWRGRGHHYDOXDFLyQ\FDOLFDFLyQGHSURSXHVWDVTXHVHUiHVWDEOHFLGR
en el Reglamento debe objetivamente permitir una seleccin de la calidad y
tecnologa requeridas, dentro de los plazos ms convenientes y al mejor costo
total.
El referido mtodo deber exigir la presentacin de los documentos
estrictamente necesarios por parte de los postores.
El Reglamento establecer los criterios, el sistema y los factores aplicables
para cada tipo de bien, servicio u obra a contratarse.
En las contrataciones sujetas a la modalidad de Subasta Inversa se adjudicar
la Buena Pro a la propuesta de menor costo, no siendo aplicable puntajes,
ERQLFDFLRQHVSURPRFLRQHVXRWURVEHQHFLRVDGLFLRQDOHVTXHLPSOLTXHQXQD
evaluacin distinta.
Concordancia: RLCE: Artculos 43 al 47, 69.
Artculo 32.- Proceso de seleccin desierto
El Comit Especial otorga la Buena Pro en una licitacin pblica, concurso
pblico o adjudicacin directa an en los casos en los que se declare como vlida
una nica oferta.
El proceso de seleccin ser declarado desierto cuando no quede vlida
ninguna oferta; y, parcialmente desierto cuando no quede vlida ninguna oferta
HQDOJXQRGHORVtWHPVLGHQWLFDGRVSDUWLFXODUPHQWH
La declaracin de desierto de un proceso de seleccin obliga a la Entidad
a formular un informe que evale las causas que motivaron dicha declaratoria,
debindose adoptar las medidas correctivas antes de convocar nuevamente,
bajo responsabilidad.
En el supuesto que una licitacin pblica, concurso pblico o adjudicacin
directa sean declaradas desiertas, se convocar a un proceso de adjudicacin
de menor cuanta.
El proceso de adjudicacin de menor cuanta derivado de un proceso de
seleccin declarado desierto, debe contar con las mismas formalidades del
proceso principal.
Para otorgar la Buena Pro en los procesos de seleccin convocados bajo la
modalidad de Subasta Inversa se requerir la existencia de dos (2) ofertas vlidas
como mnimo; de lo contrario, el proceso se declarar como desierto.
10
Concordancia: RLCE: Artculos 10 y 78.
Artculo 33.- Validez de las propuestas
En todos los procesos de seleccin slo se considerarn como ofertas vlidas
aquellas que cumplan con los requisitos establecidos en las Bases.
10 0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
32
Las propuestas que excedan el Valor Referencial sern devueltas por el Comit
Especial, tenindose por no presentadas; salvo que se trate de la ejecucin
de obras, en cuyo caso sern devueltas las propuestas que excedan el Valor
Referencial en ms del diez por ciento (10%) del mismo.
El Reglamento de la presente norma sealar los lmites inferiores en el caso
de la ejecucin y consultora de obras.
Para otorgar la Buena Pro a propuestas que superen el Valor Referencial hasta
el lmite antes establecido, se deber contar con la aprobacin del Titular de la
Entidad y la disponibilidad necesaria de recursos.
Concordancia: RLCE: Artculos 39 y 76.
Artculo 34.- Cancelacin del proceso
En cualquier estado del proceso de seleccin, hasta antes del otorgamiento
de la Buena Pro, la Entidad que lo convoca puede cancelarlo por razones de
fuerza mayor o caso fortuito, cuando desaparezca la necesidad de contratar, o
cuando persistiendo la necesidad, el presupuesto asignado tenga que destinarse
a otros propsitos de emergencia declarados expresamente, bajo su exclusiva
responsabilidad. En ese caso, la Entidad deber reintegrar el costo de las Bases
a quienes las hayan adquirido.
La formalizacin de la cancelacin del proceso deber realizarse mediante
Resolucin o Acuerdo debidamente sustentado, del mismo o superior nivel de
aqul que dio inicio al expediente de contratacin, debindose publicar conforme
lo disponga el Reglamento.
Concordancia: RLCE: Artculo 79.
TTULO III
DE LAS CONTRATACIONES
Disposiciones Generales
Artculo 35.- Del contrato
El contrato deber celebrarse por escrito y se ajustar a la proforma incluida en
ODV%DVHVFRQODVPRGLFDFLRQHVDSUREDGDVSRUOD(QWLGDGGXUDQWHHOSURFHVRGH
seleccin. El Reglamento sealar los casos en que el contrato puede formalizarse
con una orden de compra o servicio, no debiendo necesariamente en estos casos
incorporarse las clusulas a que se hace referencia en el artculo 40 de la presente
norma, sin perjuicio de su aplicacin legal.
El contrato entra en vigencia cuando se cumplan las condiciones establecidas
para dicho efecto en las Bases y podr incorporar otras modificaciones
expresamente establecidas en el Reglamento.
Concordancia: RLCE: Artculo 138.
33
LEY DE CONTRATACIONES DEL ESTADO
Artculo 36.- Ofertas en consorcio
En los procesos de seleccin podrn participar distintos postores en consorcio,
sin que ello implique crear una persona jurdica diferente. Para ello, ser necesario
acreditar la existencia de una promesa formal de consorcio, la que se perfeccionar una
vez consentido el otorgamiento de la Buena Pro y antes de la suscripcin del contrato.
Las partes del consorcio respondern solidariamente ante la Entidad por todas
las consecuencias derivadas de su participacin individual en el consorcio durante
los procesos de seleccin, o de su participacin en conjunto en la ejecucin del
contrato derivado de ste. Debern designar un representante comn con poderes
VXFLHQWHVSDUDHMHUFLWDUORVGHUHFKRV\FXPSOLUODVREOLJDFLRQHVTXHVHGHULYHQ
de su calidad de postores y del contrato hasta la liquidacin del mismo.
Las partes del consorcio deben estar inscritas en el Registro Nacional de
Proveedores (RNP) y encontrarse hbiles para contratar con el Estado.
Concordancia: RLCE: Artculos 42 y 48.
Artculo 37.- Subcontratacin
El contratista podr subcontratar, previa aprobacin de la Entidad, parte de sus
prestaciones en el contrato, salvo prohibicin expresa contenida en las Bases.
El contratista mantendr la responsabilidad por la ejecucin total de su contrato
frente a la Entidad, sin perjuicio de la responsabilidad que le puede corresponder
al subcontratista.
Para ser subcontratista se requiere no estar inhabilitado para contratar con el
Estado y estar inscrito en el Registro Nacional de Proveedores (RNP).
Sin perjuicio de lo dispuesto en los prrafos precedentes, los contratistas
extranjeros podrn subcontratar con sus similares nacionales asegurando
capacitacin y transferencia de tecnologa a sus subcontratistas.
Concordancia: RLCE: Artculos 146 y 253.
Artculo 38.- Adelantos
A solicitud del contratista, y siempre que haya sido previsto en las Bases, la
Entidad podr entregar adelantos en los casos, montos y condiciones sealados
en el Reglamento.
Para que proceda el otorgamiento del adelanto, el contratista garantizar el
monto total de ste.
El adelanto se amortizar en la forma que establezca el Reglamento.
Concordancia: RLCE: Artculos 162, 186, 171 al 173.
Artculo 39.- Garantas
Las garantas que deben otorgar los postores y/o contratistas, segn corres-
SRQGDVRQODVGHHOFXPSOLPLHQWRGHOFRQWUDWRSRUORVDGHODQWRV\SRUHOPRQWR
diferencial de propuesta. Sus modalidades, montos, condiciones y excepciones
son regulados en el reglamento.
Las garantas que acepten las Entidades deben ser incondicionales, solidarias,
LEY DE CONTRATACIONES DEL ESTADO
34
irrevocables y de realizacin automtica en el pas, al solo requerimiento de la
respectiva Entidad, bajo responsabilidad de las empresas que las emiten. Dichas
empresas deben encontrarse bajo la supervisin de la Superintendencia de
Banca y Seguros y Administradoras Privadas de Fondos de Pensiones y deben
estar autorizadas para emitir garantas; o estar consideradas en la ltima lista de
bancos extranjeros de primera categora que peridicamente publica el Banco
Central de Reserva del Per.
En virtud de la realizacin automtica, a primera solicitud, las empresas emiso-
ras no pueden oponer excusin alguna a la ejecucin de las garantas debiendo
limitarse a honrarlas de inmediato dentro del plazo mximo de tres (3) das. Toda
demora genera responsabilidad solidaria para el emisor de la garanta y para el
postor o contratista, y da lugar al pago de intereses en favor de la Entidad.
El reglamento seala el tratamiento a seguirse en los casos de contratos de
arrendamiento y de aquellos donde la prestacin se cumpla por adelantado al
pago.
En los contratos peridicos de suministro de bienes o de prestacin de servi-
cios, as como en los contratos de ejecucin y consultora de obras que celebren
las Entidades con las Micro y Pequeas Empresas, stas ltimas pueden otorgar
FRPRJDUDQWtDGHHOFXPSOLPLHQWRHOGLH]SRUFLHQWRGHOPRQWRWRWDOD
contratar, porcentaje que ser retenido por la Entidad.
(QHOFDVRGHORVFRQWUDWRVSDUDODHMHFXFLyQGHREUDVWDOEHQHFLRVyORHV
procedente cuando:
a) Por el monto, el contrato a suscribirse corresponda a un proceso de
seleccin de adjudicacin de menor cuanta, a una adjudicacin directa
selectiva o a una adjudicacin directa pblica.
b) El plazo de ejecucin de la obra sea igual o mayor a sesenta (60) das
calendario.
c) El pago a favor del contratista considere, al menos, dos (2) valorizaciones
peridicas en funcin del avance de la obra.
Sin perjuicio de la conservacin definitiva de los montos retenidos, el
LQFXPSOLPLHQWR LQMXVWLFDGR SRU SDUWH GH ORV FRQWUDWLVWDV EHQHFLDGRV FRQ OR
dispuesto en el presente artculo, que motive la resolucin del contrato, da lugar
a la inhabilitacin temporal para contratar con el Estado por un perodo no menor
a un (1) ao ni mayor a dos (2) aos.
11
Concordancia: RLCE: Artculos 141, 155 al 164.
Artculo 40.- Clusulas obligatorias en los contratos
Los contratos regulados por la presente norma incluirn necesariamente y
bajo responsabilidad clusulas referidas a:
a) Garantas: La Entidad establecer en el contrato las garantas que debern
otorgarse para asegurar la buena ejecucin y cumplimiento del mismo.
11 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
35
LEY DE CONTRATACIONES DEL ESTADO
b) Solucin de controversias: Toda controversia surgida durante la etapa
de ejecucin del contrato deber resolverse mediante conciliacin o
arbitraje. En caso que en las Bases o el contrato no se incluya la clusula
correspondiente, se entender incorporada de pleno derecho la clusula
modelo que establezca el Reglamento.
c) Resolucin de contrato por incumplimiento: En caso de incumplimiento
por parte del contratista de alguna de sus obligaciones, que haya sido
previamente observada por la Entidad, y no haya sido materia de
subsanacin, esta ltima podr resolver el contrato en forma total o
parcial, mediante la remisin por la va notarial del documento en el que
VHPDQLHVWHHVWDGHFLVLyQ\HOPRWLYRTXHODMXVWLFD'LFKRGRFXPHQWR
ser aprobado por autoridad del mismo o superior nivel jerrquico de
aquella que haya suscrito el contrato. El contrato queda resuelto de pleno
derecho a partir de la recepcin de dicha comunicacin por el contratista.
El requerimiento previo por parte de la Entidad podr omitirse en los
casos que seale el Reglamento. Igual derecho asiste al contratista
ante el incumplimiento por la Entidad de sus obligaciones esenciales,
siempre que el contratista la haya emplazado mediante carta notarial y
sta no haya subsanado su incumplimiento.
Concordancia: RLCE: Artculo 167.
Artculo 41.- Prestaciones adicionales, reducciones y ampliaciones
41.1 Excepcionalmente y previa sustentacin por el rea usuaria de la
contratacin, la Entidad puede ordenar y pagar directamente la
ejecucin de prestaciones adicionales en caso de bienes y servicios
hasta por el veinticinco por ciento (25%) de su monto, siempre que sean
LQGLVSHQVDEOHVSDUDDOFDQ]DUODQDOLGDGGHOFRQWUDWR$VLPLVPRSXHGH
reducir bienes, servicios u obras hasta por el mismo porcentaje.
41.2 Tratndose de obras, las prestaciones adicionales pueden ser hasta por
el quince por ciento (15%) del monto total del contrato original, restndole
los presupuestos deductivos vinculados, entendidos como aquellos
derivados de las sustituciones de obra directamente relacionadas con
las prestaciones adicionales de obra, siempre que ambas respondan a la
QDOLGDGGHOFRQWUDWRRULJLQDO3DUDWDOHIHFWRORVSDJRVFRUUHVSRQGLHQWHV
sern aprobados por el Titular de la Entidad.
En el supuesto de que resulte indispensable la realizacin de
SUHVWDFLRQHVDGLFLRQDOHVGHREUDSRUGHFLHQFLDVGHO([SHGLHQWH7pFQLFR
o situaciones imprevisibles posteriores a la suscripcin del contrato,
mayores a las establecidas en el segundo prrafo del presente artculo y
hasta un mximo de cincuenta por ciento (50%) del monto originalmente
contratado, sin perjuicio de la responsabilidad que pueda corresponder
al proyectista, el Titular de la Entidad puede decidir autorizarlas. Para
ello se requiere contar con la autorizacin del Titular de la Entidad,
debiendo para la ejecucin y el pago contar con la autorizacin previa
de la Contralora General de la Repblica y con la comprobacin de
LEY DE CONTRATACIONES DEL ESTADO
36
que se cuentan con los recursos necesarios. En el caso de adicionales
con carcter de emergencia dicha autorizacin se emite previa al
pago. La Contralora General de la Repblica cuenta con un plazo
mximo de quince (15) das hbiles, bajo responsabilidad, para emitir
su pronunciamiento. Dicha situacin debe ponerse en conocimiento
de la Comisin de Presupuesto y Cuenta General de la Repblica del
Congreso de la Repblica y del Ministerio de Economa y Finanzas, bajo
responsabilidad del Titular de la Entidad.
41.3 Respecto a los servicios de supervisin, cuando en los casos distintos
a los de adicionales de obras, se produzcan variaciones en el plazo
de la obra o variaciones en el ritmo de trabajo de la obra, autorizadas
por la Entidad, y siempre que impliquen prestaciones adicionales en
la supervisin que resulten indispensables para el adecuado control
de la obra, el Titular de la Entidad puede autorizarlas, bajo las mismas
condiciones del contrato original y hasta por un monto mximo del quince
por ciento (15%) del monto contratado de la supervisin, considerando
para el clculo todas las prestaciones adicionales previamente
aprobadas. Cuando se supere el citado porcentaje, se requerir la
autorizacin, previa al pago, de la Contralora General de la Repblica,
no siendo aplicable para este caso el lmite establecido en el numeral
41.1 del presente artculo.
41.4 Alternativamente, la Entidad puede resolver el contrato, mediante
comunicacin escrita al contratista.
41.5 La decisin de la Entidad o de la Contralora General de la Repblica
de aprobar o no la ejecucin de prestaciones adicionales, no puede
ser sometida a arbitraje. Tampoco pueden ser sometidas a arbitraje las
controversias referidas a la ejecucin de las prestaciones adicionales de
obra y mayores prestaciones de supervisin que requieran aprobacin
previa de la Contralora General de la Repblica.
41.6 El contratista puede solicitar la ampliacin del plazo pactado por atrasos
y paralizaciones ajenas a su voluntad debidamente comprobados y que
PRGLTXHQHOFURQRJUDPDFRQWUDFWXDO
41.7 Las discrepancias respecto de la procedencia de la ampliacin del plazo
se resuelven de conformidad con lo establecido en el literal b) del artculo
40 de la presente ley.
12
Concordancia: RLCE: Artculos 174, 175, 207 y 208.
Artculo 42.- Culminacin del contrato
Los contratos de bienes y servicios culminan con la conformidad de
recepcin de la ltima prestacin pactada y el pago correspondiente.
Tratndose de contratos de ejecucin o consultora de obras, el contrato
culmina con la liquidacin y pago correspondiente, la misma que ser elaborada y
presentada a la Entidad por el contratista, segn los plazos y requisitos sealados
12 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
37
LEY DE CONTRATACIONES DEL ESTADO
HQ HO 5HJODPHQWR GHELHQGR DTXpOOD SURQXQFLDUVH HQ XQ SOD]R Pi[LPR MDGR
tambin en el Reglamento bajo responsabilidad del funcionario correspondiente.
De no emitirse resolucin o acuerdo debidamente fundamentado en el plazo antes
sealado, la liquidacin presentada por el contratista se tendr por aprobada para
todos los efectos legales.
El expediente de contratacin se cerrar con la culminacin del contrato.
Concordancia: LCE: Artculo 7.
RLCE: Artculos 149 y 177.
Artculo 43.-Requisitos especiales en los contratos de obra
Para efectos de la ejecucin de los contratos de obra, el Reglamento
establecer los requisitos que debe cumplir el ingeniero o arquitecto colegiado
residente designado por el contratista y el inspector designado por la Entidad o
el supervisor contratado por la Entidad, as como las caractersticas, funciones y
las responsabilidades que stos asumen. Asimismo, el Reglamento establecer
las caractersticas del cuaderno de obra y las formalidades para la recepcin de
obras y liquidacin del contrato.
Concordancia: RLCE: Artculos 185, 190, 194, 210, 211.
Artculo 44.- Resolucin de los contratos
Cualquiera de las partes podr resolver el contrato, sin responsabilidad de
ninguna de ellas, en caso fortuito o fuerza mayor que imposibilite de manera
GHQLWLYDODFRQWLQXDFLyQGHOFRQWUDWR
Cuando se resuelva el contrato, por causas imputables a alguna de las partes,
se deber resarcir los daos y perjuicios ocasionados.
En caso de resolucin de contrato de obra y de existir saldo de obra por ejecutar,
la Entidad contratante podr optar por culminar la obra mediante administracin
directa, convenio con otra Entidad o, teniendo en cuenta el orden de prelacin,
podr invitar a los postores que participaron en el proceso de seleccin que dio
RULJHQDODHMHFXFLyQGHODREUDSDUDTXHPDQLHVWHQVXLQWHQFLyQGHUHDOL]DU
el saldo de la misma. El procedimiento ser establecido en el Reglamento del
presente Decreto Legislativo.
De no proceder ninguno de los mecanismos antes mencionados, se deber
convocar el proceso de seleccin que corresponda, teniendo en cuenta el Valor
Referencial respectivo.
Concordancia: RLCE: Artculos 167, 168, 209.
Artculo 45.- Registro de Procesos y Contratos
La Entidad, bajo responsabilidad, deber registrar en el Sistema Electrnico de
Contrataciones del Estado (SEACE), todos los actos realizados en cada proceso
de seleccin que convoque, los contratos suscritos y su ejecucin, en la forma
que establezca el Reglamento.
Las Entidades exceptuadas de registrar informacin en el Sistema Electrnico
LEY DE CONTRATACIONES DEL ESTADO
38
de Contrataciones del Estado (SEACE), estarn obligadas a remitir dentro de los
quince (15) das siguientes al cierre de cada trimestre a la Contralora General de
la Repblica, una relacin de todas las convocatorias realizadas en dicho perodo,
con la documentacin que permita apreciar su resultado.
Concordancia: RLCE: Artculo 287.
TTULO IV
DERECHOS, OBLIGACIONES Y SANCIONES
CAPTULO I
DE LAS ENTIDADES Y FUNCIONARIOS
Artculo 46.-De las responsabilidades y sanciones
Los funcionarios y servidores, as como los miembros del Comit Especial
que participan en los procesos de contratacin de bienes, servicios y obras, son
responsables del cumplimiento de la presente norma y su Reglamento.
En caso que las normas permitan mrgenes de discrecionalidad para la
actuacin del servidor o funcionario, ste deber ejercerla de acuerdo a los
principios establecidos en el artculo 4 del presente Decreto Legislativo.
La evaluacin del adecuado desempeo de los servidores o funcionarios en las
GHFLVLRQHVGLVFUHFLRQDOHVDTXHVHUHHUHHOSiUUDIRSUHFHGHQWHHVUHDOL]DGDSRUOD
PiVDOWDDXWRULGDGGHOD(QWLGDGDODTXHSHUWHQHFHDQGHPHGLUHOGHVHPSHxR
de los mismos en sus cargos. Para tal efecto, la Entidad podr disponer, en forma
peridica y selectiva, la realizacin de exmenes y auditoras especializadas.
En el caso de las empresas del Estado, dicha evaluacin es efectuada por
el Directorio.
En caso de incumplimiento de las disposiciones establecidas en el presente
Decreto Legislativo se aplicarn, de acuerdo a su gravedad, las siguientes
sanciones:
a) Amonestacin escrita;
b) Suspensin sin goce de remuneraciones de treinta (30) a noventa (90)
das;
c) Cese temporal sin goce de remuneraciones hasta por doce (12) meses;
y,
d) Destitucin o despido.
Concordancia: LCE: Artculo 25.
Artculo 47.- Supervisin
La Entidad supervisar, directamente o a travs de terceros, todo el proceso
de ejecucin, para lo cual el contratista deber ofrecer las facilidades necesarias.
39
LEY DE CONTRATACIONES DEL ESTADO
En virtud de ese derecho de supervisin, la Entidad tiene la potestad de aplicar
los trminos contractuales para que el contratista corrija cualquier desajuste
respecto del cumplimiento exacto de las obligaciones pactadas.
El hecho que la Entidad no supervise los procesos, no exime al contratista
de cumplir con sus deberes ni de la responsabilidad que le pueda corresponder.
Concordancia: RLCE: Artculo 190.
CAPTULO II
DE LOS CONTRATISTAS
Artculo 48.- Intereses y penalidades
En caso de atraso en el pago por parte de la Entidad, salvo que se deba a
caso fortuito o fuerza mayor, sta reconocer al contratista los intereses legales
correspondientes. Igual derecho corresponde a la Entidad en caso sea la
acreedora.
El contrato establecer las penalidades que debern aplicarse al contratista
DQWHHOLQFXPSOLPLHQWRLQMXVWLFDGRGHVXVREOLJDFLRQHVFRQWUDFWXDOHVGHDFXHUGR
a lo dispuesto en el Reglamento.
Concordancias: RLCE: Artculos 165, 166 y 181.
Artculo 49.- Cumplimiento de lo pactado
Los contratistas estn obligados a cumplir cabalmente con lo ofrecido en su
propuesta y en cualquier manifestacin formal documentada que hayan apor-
tado adicionalmente en el curso del proceso de seleccin o en la formalizacin
del contrato, as como a lo dispuesto en los incisos 2) y 3) del artculo 1774 del
Cdigo Civil.
Artculo 50.- Responsabilidad del contratista
El contratista es el responsable por la calidad ofrecida y por los vicios ocultos
de los bienes o servicios ofertados por un plazo no menor de un (1) ao contado
a partir de la conformidad otorgada por la Entidad. El contrato podr establecer
excepciones para bienes fungibles y/o perecibles, siempre que la naturaleza
de estos bienes no se adecue a este plazo. En el caso de obras, el plazo de
responsabilidad no podr ser inferior a siete (7) aos, contado a partir de la
conformidad de la recepcin total o parcial de la obra, segn corresponda.
Las Bases debern establecer el plazo mximo de responsabilidad del
contratista.
Artculo 51.- Infracciones y sanciones administrativas
51.1. Infracciones
Se impondr sancin administrativa a los proveedores, participantes,
postores y contratistas que:
LEY DE CONTRATACIONES DEL ESTADO
40
a) No mantengan su oferta hasta el consentimiento de la Buena
Pro, de resultar ganadores hasta la suscripcin del contrato, no
VXVFULEDQLQMXVWLFDGDPHQWHHOFRQWUDWRRDFXHUGRGH&RQYHQLR
0DUFRRQRUHFLEDQLQMXVWLFDGDPHQWHODRUGHQGHFRPSUDRGH
servicio emitida a su favor.
b) Den lugar a la resolucin del contrato, orden de compra o de
servicios por causal atribuible a su parte.
c) Hayan entregado el bien, prestado el servicio o ejecutado la obra
FRQH[LVWHQFLDGHYLFLRVRFXOWRVSUHYLDVHQWHQFLDMXGLFLDOUPHR
laudo arbitral.
d) Contraten con el Estado estando impedidos para ello, de acuerdo
a la presente ley.
e) Se registren como participantes, presenten propuestas, o
suscriban un contrato o acuerdo de Convenio Marco sin contar
con inscripcin vigente en el Registro Nacional de Proveedores
(RNP).
f) Suscriban un contrato, en el caso de ejecucin o consultora de
obras, por montos mayores a su capacidad libre de contratacin,
o en especialidades distintas, segn sea el caso.
J 6XVFULEDQFRQWUDWRSHVHDKDEHUVLGRQRWLFDGRVGHODVXVSHQVLyQ
o nulidad del proceso de contratacin, dispuesta por el Organismo
Supervisor de las Contrataciones del Estado (OSCE) en ejercicio
de sus funciones.
h) Realicen subcontrataciones sin autorizacin de la Entidad o por
un porcentaje mayor al permitido en el reglamento.
i) Incurran en la transgresin de la prohibicin prevista en el artculo
11 de la presente ley o cuando incurran en los supuestos de socios
comunes no permitidos segn lo que establece el reglamento.
j) Presenten documentos falsos o informacin inexacta a las
Entidades, al Tribunal de Contrataciones del Estado o al
Organismo Supervisor de las Contrataciones del Estado (OSCE).
k) Interpongan recursos impugnativos contra los actos inimpugnables
establecidos en el reglamento.
l) Se constate, despus de otorgada la conformidad, que
LQFXPSOLHURQ LQMXVWLFDGDPHQWH ODV REOLJDFLRQHV GHO FRQWUDWR
hasta los plazos de responsabilidad establecidos en las Bases.
m) Otras infracciones que se establezcan en el reglamento.
51.2. Sanciones
En los casos que la presente ley o su reglamento lo sealen, el Tribunal
de Contrataciones del Estado impondr a los proveedores, participantes,
postores, contratistas, las sanciones siguientes:
41
LEY DE CONTRATACIONES DEL ESTADO
a) Inhabilitacin temporal: Consiste en la privacin, por un perodo
determinado, de los derechos a participar en procesos de
seleccin y a contratar con el Estado. Esta inhabilitacin en ningn
caso puede ser menor de seis (6) meses ni mayor de tres (3) aos.
E ,QKDELOLWDFLyQ GHQLWLYD &RQVLVWH HQ OD SULYDFLyQ SHUPDQHQWH
del ejercicio de los derechos de los proveedores, participantes,
postores y contratistas a participar en procesos de seleccin y
a contratar con el Estado. Cuando en un perodo de cuatro (4)
aos a una persona natural o jurdica se le impongan dos (2) o
ms sanciones que en conjunto sumen treinta y seis (36) o ms
meses de inhabilitacin temporal, el Tribunal de Contrataciones
GHO (VWDGR UHVROYHUi OD LQKDELOLWDFLyQ GHQLWLYD GHO SURYHHGRU
participante, postor o contratista.
c) Econmicas: Son aquellas que resultan de la ejecucin de las
garantas otorgadas a la presentacin de recursos de apelacin
que son declarados infundados o improcedentes por la Entidad
o el Tribunal de Contrataciones del Estado. Si el recurso de
apelacin es declarado fundado en todo o en parte, se devuelve
la garanta por el Tribunal o la Entidad. En caso de desistimiento,
se ejecuta el cien por ciento (100%) de la garanta.
Los proveedores, participantes, postores o contratistas que incurran en las
causales establecidas en el numeral 51.1 del presente artculo, sern sanciona-
dos con inhabilitacin temporal para contratar con el Estado o con inhabilitacin
GHQLWLYDVHJ~QFRUUHVSRQGD
En el caso de la infraccin prevista en el literal j) del numeral 51.1 del presente
artculo, la sancin ser de inhabilitacin temporal no menor de tres (3) aos ni
mayor de cinco (5) aos. En caso de reincidencia en esta causal, la inhabilitacin
VHUiGHQLWLYDLQGHSHQGLHQWHPHQWHGHOSHUtRGRHQHOTXHVHKDUHLQFLGLGR\HO
nmero de sanciones impuestas.
En caso de concurrir ms de una infraccin en el proceso de seleccin o en
la ejecucin de un contrato se aplica la sancin prevista para la infraccin de
mayor gravedad.
Las sanciones que se imponen no constituyen impedimento para que el contra-
tista cumpla con las obligaciones derivadas de contratos anteriormente suscritos
con Entidades; por lo tanto, debe proseguir con la ejecucin de los contratos que
tuviera suscritos hasta la culminacin de los mismos.
La imposicin de las sanciones es independiente de la responsabilidad civil o
penal que pueda originarse por las infracciones cometidas.
Asimismo, el Organismo Supervisor de las Contrataciones del Estado (OSCE)
puede imponer sanciones econmicas a las Entidades que trasgredan la normativa
de contratacin pblica, cuando acten como proveedor.
13
Concordancia: RLCE: Artculos 235 al 250.
0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
42
TTULO V
SOLUCIN DE CONTROVERSIAS E IMPUGNACIONES
Artculo 52.- Solucin de controversias
52.1. Las controversias que surjan entre las partes sobre la ejecucin,
LQWHUSUHWDFLyQ UHVROXFLyQ LQH[LVWHQFLD LQHFDFLD QXOLGDG R LQYDOLGH]
del contrato, se resuelven mediante conciliacin o arbitraje, segn el
acuerdo de las partes. La conciliacin debe realizarse en un centro de
FRQFLOLDFLyQS~EOLFRRDFUHGLWDGRSRUHO0LQLVWHULRGH-XVWLFLD
52.2. Los procedimientos de conciliacin y/o arbitraje deben solicitarse en
cualquier momento anterior a la fecha de culminacin del contrato.
3DUD ORV FDVRV HVSHFtFRV HQ ORV TXH OD PDWHULD HQ FRQWURYHUVLD VH
UHHUDDQXOLGDGGHFRQWUDWRUHVROXFLyQGHFRQWUDWRDPSOLDFLyQGHSOD]R
contractual, recepcin y conformidad de la prestacin, valorizaciones o
metrados, liquidacin del contrato y pago, se debe iniciar el respectivo
procedimiento dentro del plazo de quince (15) das hbiles conforme lo
sealado en el reglamento. La parte que solicita la conciliacin y/o el
arbitraje debe ponerla en conocimiento del Organismo Supervisor de
las Contrataciones del Estado (OSCE) en el plazo establecido en el
reglamento, salvo cuando se trate de un arbitraje administrado por dicho
organismo o cuando ste designe a los rbitros.
Para los reclamos que formulen las Entidades por vicios ocultos en
los bienes, servicios y obras entregados por el contratista, el plazo de
FDGXFLGDGHVHOTXHVHMHHQIXQFLyQGHODUWtFXORGHODSUHVHQWHOH\
y se computa a partir de la conformidad otorgada por la Entidad.
Todos los plazos previstos son de caducidad.
52.3. El arbitraje ser de derecho y resuelto por rbitro nico o tribunal arbitral
mediante la aplicacin de la Constitucin Poltica del Per, de la presente
ley y su reglamento, as como de las normas de derecho pblico y
las de derecho privado; manteniendo obligatoriamente este orden de
preferencia en la aplicacin del derecho. Esta disposicin es de orden
pblico. El incumplimiento de lo dispuesto en este numeral es causal
de anulacin del laudo.
52.4. El rbitro nico y el presidente del tribunal arbitral deben ser
necesariamente abogados, que cuenten con especializacin
acreditada en derecho administrativo, arbitraje y contrataciones con
el Estado, pudiendo los dems integrantes del colegiado ser expertos
o profesionales en otras materias. La designacin de los rbitros y los
dems aspectos de la composicin del tribunal arbitral son regulados
en el reglamento.
52.5. Cuando exista un arbitraje en curso y surja una nueva controversia
derivada del mismo contrato, cualquiera de las partes puede solicitar
a los rbitros la acumulacin de las pretensiones a dicho arbitraje,
debiendo hacerlo dentro del plazo de caducidad previsto en el numeral
52.2 del presente artculo. No obstante, en el convenio arbitral se puede
43
LEY DE CONTRATACIONES DEL ESTADO
establecer que solo procede la acumulacin de pretensiones cuando
ambas partes estn de acuerdo y se cumpla con las formalidades
establecidas en el propio convenio arbitral; de no mediar dicho acuerdo,
no procede la acumulacin.
(OODXGRDUELWUDOHVLQDSHODEOHGHQLWLYR\REOLJDWRULRSDUDODVSDUWHV
GHVGHHOPRPHQWRGHVXQRWLFDFLyQGHELpQGRVHQRWLFDUDODVSDUWHV
en forma personal y a travs del Sistema Electrnico de Contrataciones
del Estado (SEACE) para efecto de su validez. Dicho sistema debe
SHUPLWLURSHUDWLYDPHQWHODQRWLFDFLyQGHOODXGR/DQRWLFDFLyQVHGDUi
por efectuada desde ocurrido el ltimo acto. Contra dicho laudo solo
cabe interponer recurso de anulacin de acuerdo a lo establecido en la
presente ley y al Decreto Legislativo 1071, Ley de Arbitraje.
52.7. El arbitraje a que se refiere la presente norma se desarrolla en
cumplimiento del Principio de Transparencia. El Organismo Supervisor
de las Contrataciones del Estado (OSCE) dispone la publicacin de los
laudos y actas de conciliacin, as como su utilizacin para el desarrollo
de estudios especializados en materia de arbitraje administrativo.
52.8. Los rbitros deben cumplir con la obligacin de informar oportunamente
si existe alguna circunstancia que les impida ejercer el cargo con
independencia, imparcialidad y autonoma; actuar con transparencia;
y sustentar el apartarse cuando corresponda del orden de prelacin
previsto en el numeral 52.3 del presente artculo. El deber de informar
se mantiene a lo largo de todo el arbitraje.
El incumplimiento de cualquiera de estas obligaciones configura
infraccin y es sancionable administrativamente, segn la gravedad de
la falta cometida, con suspensin temporal o inhabilitacin permanente
para ejercer el cargo de rbitro en las controversias que se produzcan
dentro del marco de la presente ley y su reglamento; con la consecuente
suspensin o exclusin del Registro de rbitros del Organismo
Supervisor de Contrataciones del Estado (OSCE), segn la sancin
impuesta.
La sancin administrativa se aplica sin perjuicio de la que pudiera
corresponder conforme al Cdigo de tica para el arbitraje administrado
por el Organismo Supervisor de las Contrataciones del Estado (OSCE)
o por otra institucin que lleve adelante el proceso.
52.9. Las partes pueden dispensar a los rbitros de las causales de recusacin
que no constituyan impedimento absoluto.
52.10. En el caso que el convenio arbitral establezca que el arbitraje
es institucional, y no se haga referencia a una institucin arbitral
determinada, se entender que el arbitraje se rige bajo la organizacin
y administracin de los rganos del Sistema Nacional de Arbitraje del
Organismo Supervisor de las Contrataciones del Estado (OSCE) de
acuerdo a su reglamento.
52.11. El Sistema Nacional de Arbitraje del Organismo Supervisor de las
Contrataciones del Estado (SNA-OSCE) constituye un rgimen
LEY DE CONTRATACIONES DEL ESTADO
44
institucional de arbitraje especializado para la resolucin de controversias
en las contrataciones con el Estado. Es autnomo, especializado y se rige
por su propio reglamento que es aprobado por el Organismo Supervisor
de Contrataciones del Estado (OSCE) y supletoriamente por la Ley de
Arbitraje. El reglamento establece su conformacin y atribuciones.
52.12. Los procedimientos de conciliacin y arbitraje se sujetan supletoriamente
a lo dispuesto por las leyes de la materia, siempre que no se opongan
a lo establecido en la presente ley y su reglamento.
14
Concordancia: RLCE: Artculos 214 al 233.
Artculo 53.- Recursos impugnativos
Las discrepancias que surjan entre la Entidad y los participantes o postores
en un proceso de seleccin, solamente podrn dar lugar a la interposicin del
recurso de apelacin. Mediante el recurso de apelacin se pueden impugnar
los actos dictados desde la convocatoria hasta antes de la celebracin del
contrato. Por esta va no se pueden impugnar las Bases ni su integracin, as
como tampoco las resoluciones o acuerdos que aprueben las exoneraciones.
El recurso de apelacin slo puede interponerse luego de otorgada la
Buena Pro. El reglamento establece el procedimiento, requisitos y plazo para su
presentacin y resolucin.
El recurso de apelacin es conocido y resuelto por el Tribunal de Contrataciones
del Estado, cuando se trate de procesos de seleccin de adjudicacin directa
pblica, licitaciones pblicas y concursos pblicos, incluidos los procesos de
menor cuanta cuando deriven de procesos declarados desiertos. En los procesos
de menor cuanta y en las adjudicaciones directas selectivas, corresponde dicha
competencia al Titular de la Entidad. La resolucin que resuelva el recurso de
apelacin agota la va administrativa.
El Titular de la Entidad puede delegar la potestad de resolver el recurso de
apelacin. El funcionario a quien se otorgue dicha facultad es responsable por la
emisin del acto que resuelve el recurso.
Cuando la apelacin se haya interpuesto ante el Tribunal de Contrataciones del
Estado, la Entidad est obligada a remitir el expediente correspondiente, dentro
del plazo mximo de tres (3) das de requerida, bajo responsabilidad del Titular
de la Entidad. El incumplimiento de dicha obligacin por parte de la Entidad ser
comunicada a la Contralora General de la Repblica.
La garanta por interposicin del recurso de apelacin debe otorgarse a favor
del Organismo Supervisor de las Contrataciones del Estado (OSCE) y de la
Entidad, cuando corresponda. Esta garanta ser equivalente al tres por ciento
(3%) del Valor Referencial del proceso de seleccin o del tem que se decida
impugnar. La garanta no puede ser menor al cincuenta por ciento (50%) de una
(1) UIT.
14 0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
45
LEY DE CONTRATACIONES DEL ESTADO
La interposicin de la accin contencioso-administrativa procede contra lo
resuelto en ltima instancia administrativa, sin suspender su ejecucin.
Mediante acuerdos adoptados en Sala Plena, los cuales constituyen
precedentes de observancia obligatoria, el Tribunal de Contrataciones del Estado
interpreta de modo expreso y con carcter general las normas establecidas en la
presente ley y su reglamento.
15
Concordancia: RLCE: Artculos 104 al 126.
Artculo 54.- Suspensin del proceso de seleccin
La presentacin de los recursos interpuestos de conformidad con lo establecido
en el artculo precedente dejar en suspenso el proceso de seleccin hasta que
el recurso sea resuelto por la instancia competente, conforme a lo establecido en
el Reglamento, siendo nulos los actos posteriores practicados hasta antes de la
expedicin de la respectiva resolucin.
Concordancia: RLCE: Artculo 108.
Artculo 55.- Denegatoria Ficta
En el caso que la Entidad o cuando el Tribunal de Contrataciones del Estado
VHJ~QFRUUHVSRQGDQRUHVXHOYDQ\QRWLTXHQVXVUHVROXFLRQHVGHQWURGHOSOD]R
TXHMDHO5HJODPHQWRORVLQWHUHVDGRVFRQVLGHUDUiQGHQHJDGRVVXVUHFXUVRV
de apelacin, pudiendo interponer la accin contencioso-administrativa contra la
GHQHJDWRULDFWDGHQWURGHOSOD]ROHJDOFRUUHVSRQGLHQWH
En estos casos, la Entidad o el Tribunal de Contrataciones del Estado devolver
lo pagado por los interesados como garanta al momento de interponer su recurso
de apelacin.
Concordancias: RLCE: Artculos 115 y 121.
Artculo 56.- Nulidad de los actos derivados de los procesos de contratacin
El Tribunal de Contrataciones del Estado, en los casos que conozca, declara
nulos los actos expedidos, cuando hayan sido dictados por rgano incompetente,
contravengan las normas legales, contengan un imposible jurdico o prescindan de
las normas esenciales del procedimiento o de la forma prescrita por la normatividad
aplicable, debiendo expresar en la Resolucin que expida la etapa a la que se
retrotraer el proceso de seleccin.
(O7LWXODUGHOD(QWLGDGGHFODUDGHRFLRODQXOLGDGGHOSURFHVRGHVHOHFFLyQ
por las mismas causales previstas en el prrafo anterior, slo hasta antes de la
celebracin del contrato, sin perjuicio que pueda ser declarada en la resolucin
recada sobre el recurso de apelacin.
Despus de celebrados los contratos, la Entidad puede declarar la nulidad de
RFLRHQORVVLJXLHQWHVFDVRV
a) Por haberse suscrito en contravencin con el artculo 10 de la
presente ley.
15 0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
46
E &XDQGR VH YHULTXH OD WUDVJUHVLyQ GHO SULQFLSLR GH SUHVXQFLyQ GH
veracidad durante el proceso de seleccin o para la suscripcin del
contrato.
c) Cuando se haya suscrito el contrato no obstante encontrarse en
trmite un recurso de apelacin.
d) Cuando no se haya cumplido con las condiciones y/o requisitos
HVWDEOHFLGRVHQODQRUPDWLYDDQGHODFRQJXUDFLyQGHDOJXQDGH
las causales de exoneracin.
e) Cuando no se haya utilizado los procedimientos previstos en la
presente ley, pese a que la contratacin se encontraba bajo su
mbito de aplicacin. En este supuesto, asumirn responsabilidad los
funcionarios y servidores de la Entidad contratante, conjuntamente
con los contratistas que celebraron irregularmente el contrato.
En caso de contratarse bienes, servicios u obras, sin el previo proceso de
seleccin que correspondiera, se incurrir en causal de nulidad del proceso y
del contrato, asumiendo responsabilidades los funcionarios y servidores de la
Entidad contratante conjuntamente con los contratistas que celebraron dichos
contratos irregulares.
Cuando corresponda al rbitro nico o al Tribunal Arbitral evaluar la nulidad del
contrato, se considerarn en primer lugar las causales previstas en la presente
ley y su reglamento, y luego las causales de nulidad aplicables reconocidas en
el derecho nacional.
16
Concordancia: RLCE: Artculo 144.
TTULO VI
DEL ORGANISMO SUPERVISOR DE LAS
CONTRATACIONES
DEL ESTADO
Artculo 57.- Definicin
El Organismo Supervisor de las Contrataciones del Estado - OSCE es
un organismo pblico adscrito al Ministerio de Economa y Finanzas, con
personera jurdica de derecho pblico, que goza de autonoma tcnica,
IXQFLRQDODGPLQLVWUDWLYDHFRQyPLFD\QDQFLHUDFRQUHSUHVHQWDFLyQMXGLFLDO
propia, sin perjuicio de la defensa coadyuvante de la Procuradura Pblica
del Ministerio de Economa y Finanzas. Su personal est sujeto al rgimen
laboral de la actividad privada.
16 0RGLFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
47
LEY DE CONTRATACIONES DEL ESTADO
Artculo 58.- Funciones
El Organismo Supervisor de las Contrataciones del Estado (OSCE) tiene
las siguientes funciones:
a) Velar y promover el cumplimiento y difusin de esta ley,
su reglamento y normas complementarias y proponer las
PRGLFDFLRQHVTXHFRQVLGHUHQHFHVDULDV
b) Implementar actividades y mecanismos de desarrollo de
capacidades y competencias en la gestin de las contrataciones
del Estado.
c) Emitir directivas, lineamientos, manuales y comunicados sobre
materias de su competencia.
d) Resolver los asuntos de su competencia en ltima instancia
administrativa.
H 6XSHUYLVDU\VFDOL]DUGHIRUPDVHOHFWLYD\RDOHDWRULDORVSURFHVRV
de contratacin que realicen las Entidades para proveerse de
bienes, servicios u obras, asumiendo el pago con fondos pblicos,
independientemente del rgimen legal. Esta supervisin tambin
alcanza a las contrataciones previstas en los literales i), o), s), t) y
v) del numeral 3.3 del artculo 3 de la presente ley.
f) Administrar y operar el Registro Nacional de Proveedores (RNP), as
como cualquier otro instrumento necesario para la implementacin
y operacin de los diversos procesos de contrataciones del Estado.
g) Desarrollar, administrar y operar el Sistema Electrnico de las
Contrataciones del Estado (SEACE).
h) Organizar y administrar arbitrajes, de conformidad con los
reglamentos que apruebe para tal efecto.
i) Designar rbitros y resolver las recusaciones sobre los mismos en
arbitrajes que no se encuentren sometidos a una institucin arbitral,
en la forma establecida en el reglamento.
j) Absolver consultas sobre las materias de su competencia. Las
consultas que le efecten las Entidades son gratuitas.
k) Imponer sanciones a los proveedores que contravengan las
disposiciones de esta ley, su reglamento y normas complementarias,
as como los rbitros en los casos previstos en la presente ley.
l) Poner en conocimiento de la Contralora General de la Repblica, de
manera fundamentada, las trasgresiones observadas en el ejercicio
de sus funciones cuando existan indicios razonables de perjuicio
econmico al Estado o de comisin de delito o de comisin de
infracciones graves o muy graves por responsabilidad administrativa
funcional de acuerdo al marco legal vigente.
m) Suspender los procesos de contratacin, en los que como
consecuencia del ejercicio de sus funciones observe trasgresiones
LEY DE CONTRATACIONES DEL ESTADO
48
a la normativa aplicable, pudiendo adoptar y/o disponer las medidas
que resulten necesarias para tal efecto, incluida la no emisin de las
constancias necesarias para la suscripcin del respectivo contrato,
sin perjuicio de la atribucin del Titular de la Entidad, de declarar
ODQXOLGDGGHRFLRGHGLFKRVSURFHVRV
n) Promover la Subasta Inversa, determinando las caractersticas
tcnicas de los bienes o servicios que sern provistos a travs de
esta modalidad.
o) Desconcentrar sus funciones en sus rganos de alcance regional
o local de acuerdo a lo que establezca su Reglamento de
Organizacin y Funciones.
p) Realizar estudios conducentes a evaluar el funcionamiento de los
regmenes de contratacin del Estado, analizar y proponer nuevos
mecanismos idneos de contratacin segn mercados, as como
SURSRQHU HVWUDWHJLDV GHVWLQDGDV DO XVR HFLHQWH GH ORV UHFXUVRV
pblicos.
q) Las dems que le asigne la normativa.
17
Concordancia: RLCE: Artculo 4 y Segunda Disposicin
Complementaria Final.
Artculo 59.- Organizacin y recursos
La organizacin del Organismo Supervisor de las Contrataciones del
Estado - OSCE, las caractersticas de los registros referidos en el presente
Decreto Legislativo y dems normas complementarias para su funcionamiento
sern establecidas en su Reglamento de Organizacin y Funciones.
Los recursos del Organismo Supervisor de las Contrataciones del Estado
- OSCE son los siguientes:
a) Los generados por el cobro de tasas previstas en el Texto nico
de Procedimientos Administrativos del Organismo Supervisor de
las Contrataciones del Estado - OSCE;
b) Los generados por la venta de bienes y prestacin de servicios;
c) Los generados por la ejecucin de las garantas;
d) Los generados por la capacitacin y difusin de la normativa en
materia de su competencia;
e) Los provenientes de la cooperacin tcnica nacional o internacional;
f) Los provenientes de las donaciones que se efecten a su favor;
g) Los provenientes de la imposicin de multas; y,
h) Los dems que le asigne la normativa.
/DDGPLQLVWUDFLyQ\FREUDQ]DGHORVUHFXUVRV\WULEXWRVDTXHVHUHHUH
el presente artculo es competencia del Organismo Supervisor de las Con-
trataciones del Estado - OSCE, para lo cual tiene facultad coactiva.
0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
49
LEY DE CONTRATACIONES DEL ESTADO
Artculo 60. El Consejo Directivo y la Presidencia Ejecutiva del
Organismo Supervisor de las Contrataciones del Estado (OSCE)
60.1. El Consejo Directivo es el mximo rgano del Organismo Supervisor de
las Contrataciones del Estado (OSCE). Se encuentra integrado por tres
(3) miembros, los que son designados por un perodo de tres (3) aos
renovables por un periodo adicional, mediante Resolucin Suprema
refrendada por el Ministro de Economa y Finanzas. Los miembros
del Consejo Directivo perciben dietas a excepcin de su Presidente
Ejecutivo.
Son funciones del Consejo Directivo:
a) Aprobar las Directivas referidas en el inciso b) del artculo 58
de la presente ley.
b) Proponer estrategias de gestin institucional.
F 3URSRQHUODVHVWUDWHJLDVGHVWLQDGDVDSURPRYHUHOXVRHFLHQWH
de los recursos pblicos y de reduccin de costos en materia
de contrataciones del Estado.
d) Aprobar los lineamientos de gestin de sus rganos descon-
centrados.
e) Otras que se le asigne en el Reglamento de Organizacin y
Funciones.
60.2. El Presidente Ejecutivo del Consejo Directivo es uno de sus miembros,
el cual es designado mediante Resolucin Suprema refrendada por el
Ministro de Economa y Finanzas. El cargo de Presidente Ejecutivo es
remunerado.
Son funciones del Presidente Ejecutivo:
a) Convocar y presidir las sesiones del Consejo Directivo.
b) Actuar como Titular del Pliego, mxima autoridad administra-
tiva y representante legal del Organismo Supervisor de las
Contrataciones del Estado (OSCE).
c) Supervisar la marcha institucional y administrativa.
d) Designar a los altos funcionarios de acuerdo a las normas que
resulten aplicables.
e) Otras que se le asigne en el Reglamento de Organizacin y
Funciones.
18
Artculo 61.- Requisitos e impedimentos
Para ser designado miembro del Consejo Directivo o Presidente Ejecu-
tivo del Organismo Supervisor de las Contrataciones del Estado - OSCE,
se requiere:
a) Contar con reconocida solvencia e idoneidad profesional. Este
requisito se acredita demostrando no menos de tres (3) aos de
0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
50
experiencia en un cargo de gestin ejecutiva; o, no menos de cinco
DxRVGHH[SHULHQFLDHQWHPDVDQHVDODVPDWHULDVUHJXODGDV
en esta norma;
b) Contar con ttulo profesional universitario;
c) No estar inhabilitado para ejercer la funcin pblica por sentencia
judicial o resolucin del Congreso de la Repblica;
d) No haber sido declarado insolvente o haber ejercdido cargos di-
rectos en personas jurdicas declaradas en quiebra, durante por lo
menos en (1) ao, previo a la declaracin;
e) No haber sido inhabilitado para contratar con el Estado;
f) No tener participacin en personas jurdicas que contraten con el
Estado; y,
g) No estar inmerso en causal de impedimento pra el ejercicio de la
funcin pblica conforme a la normativa sobre la materia.
Artculo 62.- Causales de remocin
Los miembros del Consejo Directivo y el Presidente Ejecutivo del Or-
ganismo Supervisor de las Contrataciones del Estado (OSCE) pueden ser
removidos de su cargo, mediante resolucin suprema, por permanente
incapacidad fsica o incapacidad moral sobreviniente, por falta grave o
SpUGLGDGHFRQDQ]D
La remocin genera la vacancia del cargo, la que tambin se produce
por renuncia.
19
TTULO VII
DEL TRIBUNAL DE CONTRATACIONES DEL ESTADO
Artculo 63.- Tribunal de Contrataciones del Estado
El Tribunal de Contrataciones del Estado es un rgano resolutivo que
forma parte de la estructura administrativa del Organismo Supervisor de las
Contrataciones del Estado (OSCE). Cuenta con plena autonoma e independencia
en el ejercicio de sus funciones.
Tiene las siguientes funciones:
a) Resolver, de ser el caso, las controversias que surjan entre las
Entidades, los participantes y los postores durante el proceso de
seleccin.
E $SOLFDU ODV VDQFLRQHV GH LQKDELOLWDFLyQ WHPSRUDO \ GHQLWLYD D ORV
proveedores, participantes, postores, contratistas, rbitros y expertos
independientes, segn corresponda para cada caso.
c) Las dems funciones que le otorga la normativa.
Su conformacin y el nmero de Salas son establecidos por Decreto Supremo,
190RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
51
LEY DE CONTRATACIONES DEL ESTADO
refrendado por el Ministro de Economa y Finanzas.
20
Artculo 64. Requisitos e impedimentos para ser Vocal del Tribunal de
Contrataciones del Estado
Los Vocales del Tribunal de Contrataciones del Estado son elegidos por
concurso pblico y designados por un periodo de tres (03) aos. Para ello se
requiere:
a) Contar con ttulo profesional universitario.
b) Experiencia acreditada no menor a cinco (5) aos en las materias
relacionadas con la presente norma.
F $FUHGLWDUHVWXGLRVGHHVSHFLDOL]DFLyQHQWHPDVDQHVDODVPDWHULDVGH
esta ley.
d) Contar con reconocida solvencia moral.
e) No tener sentencia condenatoria por delito doloso o encontrarse
inhabilitado para ejercer la funcin pblica por sentencia judicial o por
resolucin del Congreso de la Repblica.
f) No haber sido declarado insolvente o haber ejercido cargos directos en
personas jurdicas declaradas en quiebra, durante por lo menos un (1)
ao, previo a la declaracin.
g) No haber sido inhabilitado para contratar con el Estado.
h) No tener participacin en personas jurdicas que contraten con el Estado.
i) No estar inmerso en causal de impedimento para el ejercicio de la
funcin pblica.
El Presidente del Tribunal de Contrataciones del Estado es elegido de acuerdo
a lo previsto en el reglamento de la presente ley, conforme al marco previsto en
sta.
21
Artculo 65.- Causal de remocin y vacancia
Los Vocales del Tribunal de Contrataciones del Estado podrn ser removidos
mediante Resolucin Suprema refrendada por el Ministro de Economa y Finanzas
por falta grave, permanente incapacidad fsica o incapacidad moral sobreviniente.
La vacancia en el cargo tambin se produce por renuncia.
Artculo 66.- Publicidad de las resoluciones
El Tribunal de Contrataciones del Estado deber publicar en el Sistema
Electrnico de Contrataciones del Estado (SEACE) las resoluciones que expida
como ltima instancia administrativa.
Concordancia: RLCE: Artculo 287.
20, 21 0RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
52
TTULO VIII
DEL SISTEMA ELECTRNICO DE CONTRATACIONES DEL ESTADO
Artculo 67.- Definicin
El Sistema Electrnico de Contrataciones del Estado (SEACE), es el sistema
electrnico que permite el intercambio de informacin y difusin sobre las
contrataciones del Estado, as como la realizacin de transacciones electrnicas.
Concordancia: RLCE: Artculos 285 al 290.
Artculo 68.- Obligatoriedad
Las Entidades estn obligadas a utilizar el Sistema Electrnico de
Contrataciones del Estado (SEACE), independientemente del rgimen legal de
FRQWUDWDFLyQS~EOLFDRIXHQWHGHQDQFLDPLHQWRDOTXHVHVXMHWHODFRQWUDWDFLyQ
conforme a los requisitos que se establezca en el reglamento.
En los procesos de menor cuanta, las contrataciones se realizan
obligatoriamente en forma electrnica a travs del Sistema Electrnico de
Contrataciones del Estado (SEACE), con las excepciones que establezca el
reglamento.
El reglamento establece los criterios de incorporacin gradual de las Entidades
al Sistema Electrnico de Contrataciones del Estado (SEACE), considerando
la infraestructura y condiciones tecnolgicas que stas posean o los medios
disponibles para estos efectos, as como la forma en que se aplican progresiva
y obligatoriamente las contrataciones electrnicas a los procesos de licitacin
pblica, concurso pblico, adjudicacin directa pblica y adjudicacin directa
selectiva en sus distintas modalidades.
Las Entidades estn obligadas a registrar, mensualmente, sus contrataciones
por montos de una (1) a tres (3) Unidades Impositivas Tributarias (UIT), en el
Sistema Electrnico de Contrataciones del Estado (SEACE).
22
Concordancia: RLCE: Artculo 287.
Artculo 69.- Administracin
El Organismo Supervisor de las Contrataciones del Estado - OSCE desarrollar,
administrar y operar el Sistema Electrnico de Contrataciones del Estado
(SEACE). El Reglamento de la materia establecer su organizacin, funciones y
procedimientos, con sujecin estricta a los lineamentos de poltica de contrataciones
electrnicas del Estado que disponga la Presidencia del Consejo de Ministros.
Artculo 70.- Validez y eficacia de los actos
Los actos realizados por medio del Sistema Electrnico de Contrataciones del
Estado (SEACE) que cumplan con las disposiciones vigentes poseen la misma
YDOLGH]\HFDFLDTXHORVDFWRVUHDOL]DGRVSRUPHGLRVPDQXDOHVSXGLpQGRORV
sustituir para todos los efectos legales.
220RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
53
LEY DE CONTRATACIONES DEL ESTADO
Todos los actos realizados a travs del Sistema Electrnico de Contrataciones
del Estado (SEACE), incluidos los efectuados por el Organismo Supervisor de las
Contrataciones del Estado (OSCE) en el ejercicio de sus funciones, se entienden
QRWLFDGRVHOPLVPRGtDGHVXSXEOLFDFLyQVDOYRORGLVSXHVWRHQHOQXPHUDO
del artculo 52 de la presente ley en cuanto fuera aplicable.
La intervencin de los notarios pblicos se efecta en las oportunidades y
formas que establezca el reglamento.
23
DISPOSICIONES COMPLEMENTARIAS FINALES
PRIMERA.-(QHO'LDULR2FLDO(O3HUXDQRVHLQVHUWDUiXQDVHFFLyQHVSHFLDO
dedicada exclusivamente a las contrataciones pblicas.
SEGUNDA.- Mediante Decreto Supremo refrendado por el Ministro de
Economa y Finanzas, se aprobar el Reglamento de la presente norma, dentro
de los cuarenta y cinco (45) das hbiles siguientes a su publicacin, el cual
contendr un Glosario de Trminos.
TERCERA.- Mediante Decreto Supremo refrendado por el Ministro de
Economa y Finanzas, se aprobar el Reglamento de Organizacin y Funciones
y el Texto nico de Procedimientos Administrativos del Organismo Supervisor de
Contrataciones del Estado - OSCE.
CUARTA.- El personal del Organismo Supervisor de las Contrataciones del
Estado OSCE se encontrar sujeto al rgimen laboral de la actividad privada.
QUINTA.- El Organismo Supervisor de las Contrataciones del Estado (OSCE)
XWLOL]DUiORVPHGLRVHOHFWUyQLFRVGHFRPXQLFDFLyQSDUDQRWLFDUWRGRVORVDFWRV
que emita en el ejercicio de sus funciones, los que poseen la misma validez y
HFDFLDTXHORVUHDOL]DGRVSRUORVPHGLRVPDQXDOHV
$GLFLRQDOPHQWH D ORV PpWRGRV GH QRWLFDFLyQ WUDGLFLRQDOHV ODV (QWLGDGHV
podrn utilizar medios electrnicos de comunicacin para el cumplimiento de los
distintos actos que se disponen en la presente ley y su reglamento.
En todos los casos, se debern utilizar las tecnologas necesarias que
JDUDQWLFHQ OD LGHQWLFDFLyQ GH ORV SDUWLFLSDQWHV \ OD FRQGHQFLDOLGDG GH ODV
propuestas.
El reglamento de la presente ley establece las condiciones necesarias para
la utilizacin de los medios electrnicos de comunicacin.
24
Concordancia: RLCE: Artculo 25.
SEXTA.- En aquellas contrataciones que se encuentren bajo el mbito de
tratados u otros compromisos internacionales, que impliquen la aplicacin de
230RGLILFDGRPHGLDQWH/H\1SXEOLFDGDHOGHMXQLRGH
LEY DE CONTRATACIONES DEL ESTADO
54
los principios de Trato Nacional y No Discriminacin, las Entidades contratantes
debern conceder incondicionalmente los bienes, servicios y proveedores de la
otra parte, un trato similar o no menos favorable que el otorgado por la normativa
peruana a los bienes, servicios y proveedores nacionales, de conformidad con
las reglas, requisitos procedimientos establecidos en la presente norma, su
Reglamento y en la normativa de la materia.
SPTIMA.- La Contralora General de la Repblica tendr acceso a la
informacin registrada en el Sistema Electrnico de Contrataciones del Estado
(SEACE).
OCTAVA.- Los insumos directamente utilizados en los procesos productivos por
las empresas del Estado que se dediquen a la produccin de bienes o prestacin
de servicios, pueden ser contratados a proveedores nacionales o internacionales
mediante el proceso de adjudicacin de menor cuanta, a precios de mercado,
VLHPSUHTXHVHYHULTXHXQDVLWXDFLyQGHHVFDVH]DFUHGLWDGDSRUHO7LWXODUGHOD
(QWLGDG1RVHUHTXLHUHODYHULFDFLyQGHXQDVLWXDFLyQGHHVFDVH]HQHOFDVRGH
empresas que por la naturaleza de su actividad requieran un suministro peridico o
continuo, incluyendo la entrega en un solo acto de los insumos, bienes o servicios.
La lista de los insumos directamente vinculados en los procesos productivos,
que corresponden a cada empresa, es establecida mediante Resolucin Ministerial
del Ministerio de Economa y Finanzas.
Las contrataciones deben aprobarse mediante resolucin del Titular de la
Entidad e informarse mensualmente al Fondo Nacional de Financiamiento de
la Actividad Empresarial del Estado - FONAFE, y a la Contralora General de la
Repblica, bajo responsabilidad del Directorio.
En el proceso necesariamente se designa a un Comit Especial conforme
a las reglas de contrataciones del Estado. El otorgamiento de la Buena Pro se
realiza mediante acto pblico.
Los rganos de control institucional participan como veedores en el proceso
de adjudicacin de menor cuanta, conforme a la normativa del Sistema Nacional
de Control.
Todos los actos realizados dentro de los procesos a que se refiere la
presente disposicin se comunican obligatoriamente al Sistema Electrnico de
Contrataciones del Estado (SEACE) en la oportunidad y forma que seale la
presente norma, el Reglamento y las directivas que emite el Organismo Supervisor
de las Contrataciones del Estado - OSCE.
Las contrataciones que se realicen de acuerdo a la presente disposicin no
UHTXLHUHQGHODFRQVWLWXFLyQGHODJDUDQWtDGHHOFXPSOLPLHQWRVLHPSUHTXHOD
prestacin se cumpla por adelantado.
NOVENA.- En adelante, cualquier referencia al Consejo Superior de
Contrataciones y Adquisiciones del Estado CONSUCODE y al Tribunal de
55
LEY DE CONTRATACIONES DEL ESTADO
Contrataciones y Adquisiciones del Estado se entender hechas al Organismo
Supervisor de las Contrataciones del Estado OSCE y al Tribunal de
Contrataciones del Estado, respectivamente. Asimismo, toda referencia hecha
al CONSUCODE o a las competencias, funciones y atribuciones que ste vena
HMHUFLHQGRDVtFRPRDVXVDVSHFWRVSUHVXSXHVWDULRVFRQWDEOHVQDQFLHURVGH
tesorera, inversin y otros sistemas administrativos se entendern hechas al
Organismo Supervisor de las Contrataciones del Estado OSCE.
Los entes rectores de los Sistemas Administrativos quedan autorizados a
emitir, de ser necesario, las disposiciones que resulten necesarias para la mejor
aplicacin de lo establecido en el prrafo precedente.
DCIMA.- Para efectos de lo dispuesto en el articulo 60 de la presente norma,
OD5HVROXFLyQ6XSUHPD1()VXUWLUiHIHFWRVUHVSHFWRDODGHVLJQDFLyQ
de un miembro del Consejo Directivo y del Presidente Ejecutivo del Organismo
Supervisor de las Contrataciones del Estado - OSCE, bajo los trminos de la
presente norma.
DCIMO PRIMERA.- Los Vocales del Tribunal de Contrataciones y
Adquisiciones del Estado mantendrn su cargo hasta el cumplimiento del plazo
por el cual fueron designados, sin perjuicio de lo dispuesto en los artculos 64 y
65 de la presente norma.
DCIMO SEGUNDA.- La presente norma entrar en vigencia a los treinta
(30) das calendario contados a partir de la publicacin de su Reglamento y del
Reglamento de Organizacin y Funciones del Organismo Supervisor de las
Contrataciones del Estado - OSCE, excepto la Segunda y Tercera Disposiciones
Complementarias Finales, que entrarn en vigencia a partir del da siguiente de
ODSXEOLFDFLyQGHODSUHVHQWHQRUPDHQHO'LDULR2FLDO(O3HUXDQR
DCIMO TERCERA.- (*)
'HURJDGRSRUOD&XDUWD'LVSRVLFLyQ&RPSOHPHQWDULD)LQDOGHOD/H\1
29873, publicada el 1 de junio de 2012.
LEY DE CONTRATACIONES DEL ESTADO
56
DISPOSICIONES COMPLEMENTARIAS TRANSITORIAS
PRIMERA.- Mediante acuerdo de su Directorio, la Agencia de la Promocin
de la Inversin Privada (PROINVERSION) podr exceptuar de la aplicacin total
o parcial de la presente norma a las contrataciones vinculadas a los procesos a
TXHVHUHHUHQHO'HFUHWR/HJLVODWLYR1HO'HFUHWR6XSUHPR13&0
HO'HFUHWR/HJLVODWLYR1\VXVQRUPDVPRGLFDWRULDV
SEGUNDA.- Los procesos de contratacin iniciados antes de la entrada en
vigencia del presente Decreto Legislativo se rigen por sus propias normas.
Concordancias: Comunicado N 003-2009-OSCE/PRE
TERCERA.- (*)
'HURJDGRSRUOD&XDUWD'LVSRVLFLyQ&RPSOHPHQWDULD)LQDOGHOD/H\1
29873, publicada el 1 de junio de 2012.
DISPOSICIN COMPLEMENTARIA MODIFICATORIA
NICA.- Modifquese la Quinta Disposicin Final de la Ley N 28411, Ley
General del Sistema del Presupuesto Pblico, en los trminos siguientes:
QUINTA.- Slo proceder la ejecucin de obras adicionales cuando se
cuente, previamente, con disponibilidad presupuestal, con aprobacin del Titular
de Entidad mediante la resolucin correspondiente, o en el caso de empresas,
incluyendo aquellas bajo el mbito de FONAFE, por Acuerdo del Directorio de la
empresa, y en los casos en que su valor, restndole los presupuestos deductivos
vinculados a tales adicionales, no superen el quince por ciento (15%) del monto
total del contrato original.
Para el caso de las obras adicionales que superen el quince por ciento (15%)
del contrato original, luego de ser aprobadas por el Titular de la Entidad o el
Directorio de la empresa, segn corresponda, se requiere contar, previamente,
para su ejecucin y pago, con la disponibilidad presupuestaria y la autorizacin
expresa de la Contralora General de la Repblica, independientemente de la fecha
del contrato de obra. Para estos efectos, la Contralora General de la Repblica
debe observar los plazos y procedimientos establecidos en la ley de contrataciones
del Estado y su reglamento.
Cuando se trate de la ejecucin de obras adicionales en el marco de un
proyecto de inversin pblica, cuya viabilidad se haya visto afectada, el rgano
FRPSHWHQWHGHEHUiSURFHGHUDODYHULFDFLyQGHODPLVPD
57
LEY DE CONTRATACIONES DEL ESTADO
DISPOSICIN COMPLEMENTARIA DEROGATORIA
NICA.- A partir de la vigencia de la presente norma, derguense los siguientes
dispositivos:
a) Ley N 26850, Ley de Contrataciones y Adquisiciones del Estado y
QRUPDVPRGLFDWRULDV
b) Las dems normas que se opongan a lo dispuesto en la presente norma.
POR TANTO:
Mando se publique y cumpla dando cuenta al Congreso de la Repblica.
Dado en la Casa de Gobierno, en Lima, a los tres das del mes de junio del
ao dos mil ocho.
ALAN GARCA PREZ
Presidente Constitucional de la Repblica
-25*('(/&$67,//2*/9(=
Presidente del Consejo de Ministros
LUIS CARRANZA UGARTE
Ministro de Economa y Finanzas
MERCEDES AROZ FERNNDEZ
Ministra de Comercio Exterior y Turismo
REGLAMENTO DE LA LEY
DE CONTRATACIONES
DEL ESTADO
(APROBADO MEDIANTE D.S. N 184-2008-EF)
CONCORDADO
61
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
DECRETO SUPREMO N 184-2008-EF
EL PRESIDENTE DE LA REPBLICA
CONSIDERANDO:
Que, mediante el Decreto Legislativo N 1017, se aprob la Ley de
Contrataciones del Estado que establece las disposiciones y lineamientos que
deben observar las Entidades del Sector Pblico en los procesos de contrataciones
de bienes, servicios u obras que realicen;
Que, la Segunda Disposicin Complementaria Final del mencionado Decreto
Legislativo, dispone que el Reglamento de la Ley de Contrataciones del Estado
ser aprobado por decreto supremo refrendado por el Ministro de Economa y
Finanzas;
De conformidad con el inciso 8) del artculo 118 de la Constitucin Poltica del
Per, la Ley N 29158, Ley Orgnica del Poder Ejecutivo y el Decreto Legislativo
N 1017;
DECRETA:
Artculo 1.- Objeto
Aprubese el Reglamento del Decreto Legislativo N 1017 Ley de
Contrataciones del Estado, el mimo que consta de seis (6) Ttulos, doscientos
noventa y ocho (298) artculos, cinco (5) disposiciones complementarias
transitorias y un (1) Anexo, que forma parte del presente Decreto Supremo.
Artculo 2.- Vigencia
El presente Reglamento entrar en vigencia cuando se cumpla con lo dispuesto
en el Dcimo Segunda Disposicin Complementaria Final del Decreto Legislativo
N 1017 Ley de Contrataciones del Estado.
1
Artculo 3.- Refrendo
El presente Decreto Supremo ser refrendado por el Ministro de Economa
y Finanzas.
Dado en la Casa de Gobierno, en Lima, a los treintin das del mes de diciembre
del ao dos mil ocho.
ALAN GARCA PREZ
Presidente Constitucional de la Repblica
LUIS M. VALDIVIESO M.
Ministro de Economa y Finanzas
3RUGLVSRVLFLyQGHODUWtFXORGHO'HFUHWRGH8UJHQFLD1SXEOLFDGRHOGHHQHUR
GHVHGLVSRQHODHQWUDGDHQYLJHQFLDGHO'HFUHWR/HJLVODWLYR1DSDUWLUGHOGH
febrero de 2009.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
62
REGLAMENTO DE LA LEY DE CONTRATACIONES DEL ESTADO
TTULO I
DISPOSICIONES GENERALES
Artculo 1.- Referencias
Artculo 2.- mbito de aplicacin de la Ley
Artculo 3.- Aplicacin supletoria de la Ley
Artculo 4.- Competencias en materia de contrataciones del Estado
Artculo 5.- Funcionarios y rganos encargados de las contrataciones
Artculo 6.- Elaboracin del Plan Anual de Contrataciones
Artculo 7.- Contenido mnimo del Plan Anual de Contrataciones
Artculo 8.- Aprobacin del Plan Anual de Contrataciones
$UWtFXOR 0RGLFDFLyQGHO3ODQ$QXDOGH&RQWUDWDFLRQHV
Artculo 10.- Expediente de Contratacin
Artculo 11.- Caractersticas tcnicas de lo que se va a contratar
Artculo 12.- Estudio de posibilidades que ofrece el mercado
Artculo 13.- Valor referencial
Artculo 14.- Valor referencial para ejecucin y consultora de obras
Artculo 15.- Valor referencial en cobranzas o recuperaciones y en servicios
con honorarios de xito
Artculo 16.- Antigedad del valor referencial
Artculo 17.- Publicidad o reserva del valor referencial
Artculo 18.- Disponibilidad presupuestal
TITULO II
PROCESOS DE SELECCIN
CAPTULO I
ASPECTOS GENERALES
Artculo 19.- Tipos de Procesos de Seleccin
Artculo 20.- Prohibicin de fraccionamiento
Artculo 21.- Modalidades Especiales de Seleccin
Artculo 22.- Etapas de los Procesos de Seleccin
Artculo 23.- Cmputo de plazos durante el Proceso de Seleccin
Artculo 24.- Plazos generales para Procesos de Seleccin
$UWtFXOR 5pJLPHQGHQRWLFDFLRQHV
Artculo 26.- Prrrogas o postergaciones
63
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
CAPTULO II
COMIT ESPECIAL
Artculo 27.- Designacin
Artculo 28.- Participacin de expertos independientes
Artculo 29.- Impedimentos para ser miembro del Comit Especial
Artculo 30.- Comit Especial Permanente
Artculo 31.- Competencias
Artculo 32.- Qurum y acuerdos
Artculo 33.- Intervencin de los miembros suplentes
Artculo 34.- Responsabilidad, remocin e irrenunciabilidad
CAPTULO III
BASES
Artculo 35.- Aprobacin
Artculo 36.- Acceso a las Bases
Artculo 37.- Prepublicacin
Artculo 38.- Estandarizacin de las Bases
Artculo 39.- Contenido mnimo
Artculo 40.- Sistemas de Contratacin
Artculo 41.- Modalidades de Ejecucin Contractual
$UWtFXOR (VSHFLFDFLyQGHO&RQWHQLGRGHORVVREUHVGHSURSXHVWD
Artculo 43.- Mtodo de evaluacin de propuestas
Artculo 44.- Factores de evaluacin para la contratacin de bienes
Artculo 45.- Factores de evaluacin para la contratacin de servicios en
general
Artculo 46.- Factores de evaluacin para la contratacin de servicios de
consultora
Artculo 47.- Factores de evaluacin para la contratacin de obras
Artculo 48.- Acreditacin de la experiencia del Consorcio
Artculo 49.- Frmulas de reajuste
CAPTULO IV
CONVOCATORIA, REGISTRO, CONSULTAS Y OBSERVACIONES A LAS BASES
Artculo 50.- Convocatoria
Artculo 51.- Publicacin en el SEACE
Artculo 52.- Registro de participantes
Artculo 53.- Oportunidad del registro
Artculo 54.- Formulacin y absolucin de consultas
Artculo 55.- Plazos para formulacin y absolucin de Consultas
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
64
Artculo 56.- Formulacin y absolucin de observaciones a las Bases
Artculo 57.- Plazos para formulacin y absolucin de observaciones
Artculo 58.- Elevacin de observaciones
Artculo 59.- Integracin de Bases
Artculo 60.- Publicacin de Bases Integradas
CAPTULO V
PRESENTACIN DE PROPUESTAS
Artculo 61.- Requisitos para la admisin de propuestas
Artculo 62.- Presentacin de documentos
Artculo 63.- Forma de presentacin y alcance de las propuestas
Artculo 64.- Acto de presentacin de propuestas
Artculo 65.- Acreditacin de representantes en acto pblico
Artculo 66.- Acto pblico de presentacin de propuestas
Artculo 67.- Acto privado de presentacin de propuestas
Artculo 68.- Subsanacin de propuestas
CAPTULO VI
CALIFICACIN Y EVALUACIN DE PROPUESTAS
$UWtFXOR 2SRUWXQLGDGSDUDODFDOLFDFLyQ\HYDOXDFLyQGHSURSXHVWDV
$UWtFXOR 3URFHGLPLHQWRGHFDOLFDFLyQ\HYDOXDFLyQGHSURSXHVWDV
Artculo 71.- Evaluacin de propuestas

CAPTULO VII
OTORGAMIENTO DE LA BUENA PRO
Artculo 72.- Otorgamiento de la Buena Pro
Artculo 73.- Solucin en caso de empate
Artculo 74.- Distribucin de la Buena Pro
$UWtFXOR 1RWLFDFLyQGHORWRUJDPLHQWRGHOD%XHQD3UR
Artculo 76.- Otorgamiento de la Buena Pro a propuestas que excedan el
valor referencial
Artculo 77.- Consentimiento del otorgamiento de la Buena Pro
Artculo 78.- Declaracin de Desierto
Artculo 79.- Cancelacin del Proceso de Seleccin
65
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
CAPITULO VIII
COMPRAS CORPORATIVAS
Artculo 80.- Caractersticas del proceso de Compra Corporativa
Artculo 81.- Alcances del encargo en el caso de Compras Corporativas
Artculo 82.- Compras Corporativas Obligatorias y entidad a cargo
Artculo 83.- Entidades participantes y entidad tcnica
Artculo 84.- Sustento presupuestal
Artculo 85.- Compras Corporativas Facultativas
CAPTULO IX
SELECCIN POR ENCARGO
Artculo 86.- Caractersticas del Proceso de Seleccin por Encargo
Artculo 87.- Encargo a una Entidad Pblica
Artculo 88.- Encargo a una Entidad Privada, nacional o internacional
Artculo 89.- Encargo a Organismos Internacionales
CAPTULO X
SUBASTA INVERSA
$UWtFXOR 'HQLFLyQ\DSOLFDFLyQ
Artculo 91.- Uso de la modalidad de Subasta Inversa
Artculo 92.- Convocatoria y desarrollo del Proceso
Artculo 93.- Presuncin de cumplimiento
Artculo 94.- Recurso de apelacin
Artculo 95.- Particularidades de la Subasta Inversa Presencial
Artculo 96.- Particularidades de la Subasta Inversa Electrnica
CAPTULO XI
CONVENIOS MARCO
$UWtFXOR 'HQLFLyQ\DSOLFDFLyQ
Artculo 98.- Reglas para la realizacin y ejecucin de los Convenios Marco
Artculo 99.- Reglas especiales del proceso de seleccin
Artculo 100.- Contratacin de bienes y servicios por Convenio Marco
Artculo 101.- Responsabilidad del pago
Artculo 102.- Vigencia y renovacin del Convenio Marco
$UWtFXOR &DXVDOHVGHH[FOXVLyQGHODVFKDVRGHO3URYHHGRUGHO
Catlogo Electrnico de Convenios Marco
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
66
CAPTULO XII
SOLUCION DE CONTROVERSIAS DURANTE EL PROCESO
DE SELECCIN
Artculo 104.- Recurso de apelacin
Artculo 105.- Actos impugnables
Artculo 106.- Actos no impugnables
Artculo 107.- Plazos de la interposicin del recurso de apelacin
Artculo 108.- Efectos de la interposicin del recurso de apelacin
Artculo 109.- Requisitos de admisibilidad del recurso de apelacin
Artculo 110.- Trmite de admisibilidad del recurso de apelacin
Artculo 111.- Improcedencia del recurso de apelacin
Artculo 112.- Garanta por interposicin de recurso de apelacin
Artculo 113.- Recurso de apelacin ante la Entidad
Artculo 114.- Contenido de la resolucin de la Entidad
Artculo 115.- Agotamiento de la va administrativa
Artculo 116.- Recurso de apelacin ante el Tribunal
Artculo 117.- Uso de la palabra
Artculo 118.- Contenido de la resolucin del Tribunal
Artculo 119.- Alcances de la resolucin
Artculo 120.- Desistimiento
$UWtFXOR 'HQHJDWRULDFWD
Artculo 122.- Agotamiento de la va administrativa
Artculo 123.- Cumplimiento de las resoluciones del Tribunal
Artculo 124.- Precedentes de Observancia Obligatoria
Artculo 125.- Ejecucin de la garanta
Artculo 126.- Accin contencioso administrativa
CAPTULO XIII
EXONERACIN DEL PROCESO DE SELECCIN
Artculo 127.- Contratacin entre Entidades
Artculo 128.- Situacin de Emergencia
Artculo 129.- Situacin de Desabastecimiento
Artculo 130.- Carcter de secreto, secreto militar o de orden interno
Artculo 131.- Proveedor nico de bienes o servicios que no admiten
sustitutos
Artculo 132.- Servicios Personalsimos
Artculo 133.- Informes previos en caso de exoneraciones
Artculo 134.- Publicacin de las resoluciones o acuerdos que aprueban las
Exoneraciones
Artculo 135.- Procedimiento para las contrataciones exoneradas
Artculo 136.- Limitaciones a las contrataciones exoneradas
67
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
TITULO III
EJECUCIN CONTRACTUAL
CAPTULO I
DEL CONTRATO
Artculo 137.- Obligacin de contratar
Artculo 138.- Perfeccionamiento del Contrato
Artculo 139.- Suscripcin del Contrato
Artculo 140.- Sujetos de la relacin contractual
Artculo 141.- Requisitos para suscribir el Contrato
Artculo 142.- Contenido del Contrato
$UWtFXOR 0RGLFDFLyQHQHO&RQWUDWR
Artculo 144.- Nulidad del Contrato
Artculo 145.- Consorcio
Artculo 146.- Subcontratacin
Artculo 147.- Cesin de Derechos y de Posicin Contractual
Artculo 148.- Plazos y procedimiento para suscribir el Contrato
Artculo 149.- Vigencia del Contrato
Artculo 150.- Casos especiales de vigencia contractual
Artculo 151.- Cmputo de los plazos
Artculo 152.- Fallas o defectos percibidos por el contratista luego del
perfeccionamiento del contrato
Artculo 153.- Responsabilidad de la Entidad
Artculo 154.- Tributos, gravmenes y otros
CAPTULO II
GARANTAS
Artculo 155.- Garantas
Artculo 156.- Clases de garantas
Artculo 157.- Garanta de seriedad de oferta
Artculo 158.- Derogado
$UWtFXOR *DUDQWtDVGHHOFXPSOLPLHQWRSRUSUHVWDFLRQHVDFFHVRULDV
Artculo 160.- Garanta por el monto diferencial de propuesta
Artculo 161.- Excepciones
Artculo 162.- Garanta por adelantos
Artculo 163.- Garantas a cargo de la Entidad
Artculo 164.- Ejecucin de garantas
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
68
CAPTULO III
INCUMPLIMIENTO DEL CONTRATO
Artculo 165.- Penalidad por mora en la ejecucin de la prestacin
Artculo 166.- Otras penalidades
Artculo 167.- Resolucin de Contrato
Artculo 168.- Causales de resolucin por incumplimiento
Artculo 169.- Procedimiento de resolucin de Contrato
Artculo 170.- Efectos de la resolucin
CAPTULO IV
ADELANTOS, ADICIONALES, REDUCCIONES Y AMPLIACIONES
Artculo 171.- Clases de Adelantos
Artculo 172.- Entrega de Adelantos
Artculo 173.- Amortizacin de los Adelantos
Artculo 174.- Adicionales y Reducciones
Artculo 175.- Ampliacin del plazo contractual
CAPITULO V
CULMINACIN DE LA EJECUCIN CONTRACTUAL
Artculo 176.- Recepcin y conformidad
Artculo 177.- Efectos de la conformidad
Artculo 178.- Constancia de prestacin
Artculo 179.- Liquidacin del Contrato de Consultora de Obra

CAPTULO VI
EL PAGO
Artculo 180.- Oportunidad del pago
Artculo 181.- Plazos para los pagos
Artculo 182.- Contrataciones Complementarias
CAPTULO VII
OBRAS
Artculo 183.- Requisitos adicionales para la suscripcin del Contrato de Obra
Artculo 184.- Inicio del plazo de Ejecucin de Obra
Artculo 185.- Residente de Obra
69
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 186.- Clases de Adelantos en Obras
Artculo 187.- Entrega del Adelanto Directo
Artculo 188.- Entrega del Adelanto para Materiales e Insumos
Artculo 189.- Amortizacin de Adelantos
Artculo 190.- Inspector o Supervisor de Obras
Artculo 191.- Costo de la supervisin o inspeccin
Artculo 192.- Obligaciones del contratista de obra en caso de atraso en la
QDOL]DFLyQGHODREUD
Artculo 193.- Funciones del Inspector o Supervisor
Artculo 194.- Cuaderno de Obra
Artculo 195.- Anotacin de ocurrencias
Artculo 196.- Consultas sobre ocurrencias en la obra
Artculo 197.- Valorizaciones y Metrados
Artculo 198.- Reajustes
Artculo 199.- Discrepancias respecto de valorizaciones o metrados
Artculo 200.- Causales de ampliacin de plazo
Artculo 201.- Procedimiento de ampliacin de plazo
$UWtFXOR (IHFWRVGHODPRGLFDFLyQGHOSOD]RFRQWUDFWXDO
Artculo 203.- Clculo del Gasto General Diario
Artculo 204.- Pago de Gastos Generales
$UWtFXOR 'HPRUDVLQMXVWLFDGDVHQOD(MHFXFLyQGHOD2EUD
Artculo 206.- Intervencin Econmica de la Obra
Artculo 207.- Prestaciones adicionales de obras menores al quince por ciento
(15%)
Artculo 208. - Prestaciones adicionales de obras mayores al quince por ciento
(15%)
Artculo 209.- Resolucin del Contrato de Obras
Artculo 210.- Recepcin de la Obra y plazos
Artculo 211.- Liquidacin del Contrato de Obra
Artculo 212.- Efectos de la liquidacin
Artculo 213.- Declaratoria de fbrica o memoria descriptiva valorizada
CAPTULO VIII
CONCILIACIN Y ARBITRAJE
Artculo 214.- Conciliacin
Artculo 215.- Inicio del Arbitraje
Artculo 216.- Convenio Arbitral
Articulo 217.- Estipulaciones adicionales al Convenio Arbitral
Artculo 218.- Solicitud de Arbitraje
Artculo 219.- Respuesta de Arbitraje
Artculo 220.- rbitros
Artculo 221.- Impedimentos
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
70
Artculo 222.- Designacin
Artculo 223.- Aceptacin de los rbitros
Articulo 224.- Independencia, imparcialidad y deber de informacin
Articulo 225.- Causales de Recusacin
Artculo 226.- Procedimiento de Recusacin
Artculo 227.- Instalacin
Artculo 228.- Regulacin del Arbitraje
Artculo 229.- Acumulacin
Artculo 230.- Gastos Arbitrales
Artculo 231.- Laudo
Artculo 232.- Registro de rbitros
Artculo 233.- Organizacin y Administracin de Arbitrajes
Articulo 234.- Derogado
TITULO IV
SANCIONES
Artculo 235.- Potestad sancionadora del Tribunal
Artculo 236.- Causal de imposicin de sancin a los expertos independientes
Artculo 237.- Infracciones y sanciones administrativas
Artculo 238.- Causal de imposicin de sancin a rbitros en materia de
contratacin pblica
Artculo 239.- Sanciones a Consorcios
Artculo 240.- Sanciones econmicas a las Entidades cuando acten como
proveedores
Artculo 241.- Obligacin de informar sobre supuestas infracciones
Artculo 242.- Debido Procedimiento
Artculo 243.- Prescripcin
Artculo 244.- Suspensin del plazo de prescripcin
Artculo 245.- Determinacin gradual de la sancin
$UWtFXOR ,QKDELOLWDFLyQ'HQLWLYD
$UWtFXOR 1RWLFDFLyQ\YLJHQFLDGHODVVDQFLRQHV
Artculo 248.- Suspensin de las sanciones
Artculo 249.- Recurso de reconsideracin
Artculo 250.- Accin Contencioso Administrativo
71
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
TITULO V
REGISTROS
CAPTULO I
REGISTRO NACIONAL DE PROVEEDORES
Artculo 251.- Conformacin
Artculo 252.- Inscripcin en los Registros del RNP y vigencia de la inscripcin
$UWtFXOR &DOLFDFLyQGHVXEFRQWUDWRVGHHMHFXFLRQGHREUDVS~EOLFDV
Artculo 254.- Fiscalizacin posterior a los procedimientos tramitados ante el
RNP
Artculo 255.- Proveedores extranjeros
Artculo 256.- Excepciones
Artculo 257.- Categoras y Especialidades
Artculo 258.- Comunicacin de ocurrencias
Artculo 259.- Impedimentos
Artculo 260.- Socios Comunes
Artculo 261.- Inscripcin en el Registro de Proveedores de Bienes
Artculo 262.- Obligaciones de los proveedores de bienes
Artculo 263.- Inscripcin en el Registro de Proveedores de Servicios
Artculo 264.- Obligaciones de los proveedores de servicios
Artculo 265.- Inscripcin en el Registro de Consultores de Obras
Artculo 266.- Profesin de las personas naturales
Artculo 267.- Asignacin de Especialidades de los Consultores de Obras
Artculo 268.- Especialidades de los Consultores de Obras
Artculo 269.- Ampliacin de la Especialidad
Artculo 270.- Obligaciones de los Consultores de Obras
Artculo 271.- Rcord de Consultora de Obras
Artculo 272.- Inscripcin en el Registro de Ejecutores de Obras
Artculo 273.- Profesin de las personas naturales
Artculo 274.- Asignacin de la capacidad de mxima contratacin para los
ejecturores de obras
Artculo 275.- Capacidad Mxima de Contratacin
Artculo 276.- Aumento de capacidad mxima de contratacin
Artculo 277.- Capacidad Libre de Contratacin
Artculo 278.- Obligaciones de los ejecutores de obras
Artculo 279.- Rcord de Obras
Artculo 280.- Registro de Inhabilitados para contratar con el Estado
Artculo 281.- Publicacin del Registro de Inhabilitados
Artculo 282.- Constancia de no estar Inhabilitado para contratar con el Estado
y de capacidad de libre contratacin.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
72
CAPTULO II
REGISTRO DE ENTIDADES CONTRATANTES
Artculo 283.- Registro de las Entidades Contratantes
Artculo 284.- Registro de la informacin en el Registro de Entidades
Contratantes
TITULO VI
SISTEMA ELECTRNICO DE CONTRATACIONES DEL ESTADO - SEACE
CAPTULO I
GENERALIDADES
Artculo 285.- Objeto
Artculo 286.- Acceso al SEACE
Artculo 287.- Obligatoriedad
Artculo 288.- Registro de la informacin
Artculo 289.- Condiciones de continuidad del sistema
$UWtFXOR 5pJLPHQGHQRWLFDFLRQHV
CAPTULO II
PROCESOS ELECTRONICOS
Artculo 291.- Alcances
Artculo 292.- Procesos electrnicos
Artculo 293.- Nomenclatura de un proceso electrnico
Artculo 294.- Propuestas electrnicas
Artculo 295.- Contenido de las propuestas electrnicas
Artculo 296.- Apertura electrnica de las propuestas tcnicas
Artculo 297.- Evaluacin de la propuesta tcnica
Artculo 298.- Evaluacin y Buena Pro
DISPOSICIONES COMPLEMENTARIAS FINALES
DISPOSICIONES COMPLEMENTARIAS TRANSITORIAS
ANEXO NICO - ANEXO DE DEFINICIONES
73
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
REGLAMENTO DE LA LEY DE CONTRATACIONES DEL ESTADO
TTULO I
DISPOSICIONES GENERALES
Artculo 1.- Referencias
Cuando en el presente Reglamento se mencione la palabra Ley, se entender
que se est haciendo referencia al Decreto Legislativo N 1017 - Ley de Contrata-
ciones del Estado; la mencin al OSCE estar referida al Organismo Supervisor
de las Contrataciones del Estado; la alusin a la Entidad estar referida a las
(QWLGDGHVVHxDODGDVHQHODUWtFXORGHOD/H\ODUHIHUHQFLDDHO7ULEXQDOVH
entender que alude al Tribunal de Contrataciones del Estado, al SEACE al
Sistema Electrnico de Contrataciones del Estado y al RNP al Registro Nacional
de Proveedores. Asimismo, cuando se mencione un artculo sin hacer referencia
a norma alguna, estar referido al presente Reglamento.
Artculo 2.- mbito de aplicacin de la Ley
La Ley y el presente Reglamento son aplicables a la contratacin de
bienes, servicios y obras, siempre que sean brindados por terceros y que la
contraprestacin sea pagada por la Entidad con fondos pblicos.
Concordancia: LCE: Artculos 1 y 3.
Artculo 3.- Aplicacin supletoria de la Ley
La Ley y el presente Reglamento sern de aplicacin supletoria a todas aquellas
contrataciones de bienes, servicios u obras sujetas a regmenes especiales bajo
OH\ HVSHFtFD VLHPSUH TXH GLFKD DSOLFDFLyQ QR UHVXOWH LQFRPSDWLEOH FRQ ODV
QRUPDVHVSHFtFDVTXHODVUHJXODQ\VLUYDQSDUDFXEULUXQYDFtRRGHFLHQFLD
de dichas normas.
Concordancia: LCE: Artculo 5.
Artculo 4.- Competencias en materia de contrataciones del Estado
Las normas sobre contrataciones del Estado establecidas en la Ley y el
presente Reglamento son de mbito nacional, siendo competencia exclusiva del
Ministerio de Economa y Finanzas el diseo de polticas sobre dicha materia y
su regulacin. Corresponde al OSCE emitir directivas, lineamientos, manuales,
instructivos, formatos y comunicados respecto a la aplicacin de la Ley y su
Reglamento, y aquellas que la normativa le asigne. Las actuaciones administrativas
que aprueban las directivas y lineamientos debern ser publicadas en el Diario
2FLDO(O3HUXDQR
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
74
Es nulo de pleno derecho cualquier disposicin o acto que se emita en
contravencin de lo dispuesto en el prrafo anterior.
1
Concordancia: LCE: Artculo 58 inciso c).

Artculo 5.- Funcionarios y rganos encargados de las contrataciones
Para los efectos de la aplicacin de la Ley y el presente Reglamento estn
a cargo de las contrataciones los siguientes funcionarios y dependencias de la
Entidad:
1. Titular de la Entidad es la ms alta autoridad ejecutiva, de conformidad
con sus normas de organizacin, que ejerce las funciones previstas en
la Ley y en el presente Reglamento para la aprobacin, autorizacin y
supervisin de los procesos de contrataciones del Estado. En el caso de
las empresas del Estado, el Titular de la Entidad es el Gerente General o
el que haga sus veces.
2. rea usuaria es la dependencia cuyas necesidades pretenden ser
atendidas con determinada contratacin, o que, dada su especialidad y
funciones, canaliza los requerimientos formulados por otras dependencias.
3. rgano encargado de las contrataciones es aqul rgano o unidad
orgnica que realiza las actividades relativas a la gestin del abastecimiento
al interior de una Entidad.
4. Comit Especial es el rgano colegiado encargado de seleccionar al
proveedor que brindar los bienes, servicios u obras requeridos por el
rea usuaria a travs de determinada contratacin.
Los funcionarios y servidores del rgano encargado de las contrataciones de
la Entidad que, en razn de sus funciones intervienen directamente en alguna de
las fases de contratacin, debern ser profesionales y/o tcnicos debidamente
FHUWLFDGRVGHELHQGRUHXQLUFRPRPtQLPRORVVLJXLHQWHVUHTXLVLWRV
1. Capacitacin tcnica en contrataciones pblicas o gestin logstica en
general, no menor a ochenta (80) horas lectivas;
2. Experiencia laboral en general, no menor a tres (3) aos;
3. Experiencia laboral en materia de contrataciones pblicas o en logstica
privada, no menor de un (1) ao.
/RVUHTXLVLWRVDQWHVVHxDODGRVSRGUiQVHUSUHFLVDGRVRPRGLFDGRVPHGLDQWH
directiva emitida por el OSCE.
(OSURFHGLPLHQWRGHFHUWLFDFLyQVHUiHVWDEOHFLGRVHJ~QGLUHFWLYDVHPLWLGDV
por el OSCE. El OSCE administrar una base de datos de los profesionales y
WpFQLFRVTXHFXHQWHQFRQODUHVSHFWLYDFHUWLFDFLyQ(VWDLQIRUPDFLyQVHUiS~EOLFD
y de libre acceso en su portal institucional.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
75
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Asimismo, el OSCE emitir directivas para la acreditacin de las instituciones o
HPSUHVDVFDSDFLWDGRUDVFRQODQDOLGDGGHTXHpVWDVFDSDFLWHQDORVRSHUDGRUHV
de la norma en aspectos vinculados con las contrataciones del Estado.
La Entidad podr realizar contrataciones a travs de sus rganos
desconcentrados, siempre que stos cuenten con capacidad para contratar; o
por medio de otros rganos funcionales con presupuesto propio y autonoma
administrativa.
'HDFXHUGRDORHVWDEOHFLGRHQHO$UWtFXORGHOD/H\HO7LWXODUGHOD(QWLGDG
podr delegar, mediante resolucin, la autoridad que la Ley le otorga, excepto
HQ OD DSUREDFLyQ GH H[RQHUDFLRQHV OD GHFODUDFLyQ GH QXOLGDG GH RFLR ODV
autorizaciones de prestaciones adicionales de obra y otros supuestos que se
establecen en el presente Reglamento.
2
Concordancia: LCE: Artculos 5, 6 y 24.
RLCE: Segunda Disposicin Complementaria
Transitoria.
Artculo 6.- Elaboracin del Plan Anual de Contrataciones
En la fase de programacin y formulacin del Presupuesto Institucional, cada
una de las dependencias de la Entidad determinar, dentro del plazo sealado por
la normativa correspondiente, sus requerimientos de bienes, servicios y obras, en
funcin de sus metas presupuestarias establecidas, sealando la programacin de
acuerdo a sus prioridades. Las Entidades utilizarn el Catlogo nico de Bienes,
Servicios y Obras que administra el OSCE, siendo el rgano encargado de las
contrataciones de la Entidad responsable de esta actividad.
Los requerimientos sern incluidos en el cuadro de necesidades que ser
remitido al rgano encargado de las contrataciones para su consolidacin,
valorizacin y posterior inclusin en el Plan Anual de Contrataciones.
Una vez aprobado el Presupuesto Institucional, el rgano encargado de
las contrataciones revisar, evaluar y actualizar el proyecto de Plan Anual
de Contrataciones sujetndolo a los montos de los crditos presupuestarios
establecidos en el citado Presupuesto Institucional.
Concordancia: LCE: Artculos 8 y 12.
Artculo 7.- Contenido mnimo del Plan Anual de Contrataciones
El Plan Anual de Contrataciones contendr, por lo menos, la siguiente
informacin:
1. El objeto de la contratacin;
2. La descripcin de los bienes, servicios u obras a contratar y el
correspondiente cdigo asignado en el Catlogo;
3. El valor estimado de la contratacin;
4. El tipo de proceso que corresponde al objeto y su valor estimado, as
como la modalidad de seleccin;
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
76
/DIXHQWHGHQDQFLDPLHQWR
6. El tipo de moneda;
7. Los niveles de centralizacin o desconcentracin de la facultad de
contratar; y
8. La fecha prevista de la convocatoria.
El Plan Anual de Contrataciones considerar todas las contrataciones, con
independencia del tipo del proceso de seleccin y/o el rgimen legal que las regule.
No ser obligatorio incluir en el Plan Anual de Contrataciones las Adjudica-
ciones de Menor Cuanta no programables.
Concordancia: LCE: Artculo 13.
Artculo 5 del DU N 078-2009
Artculo 8.- Aprobacin del Plan Anual de Contrataciones
El Plan Anual de Contrataciones ser aprobado por el Titular de la Entidad
dentro de los quince (15) das hbiles siguientes a la aprobacin del Presupuesto
Institucional y publicado por cada Entidad en el SEACE en un plazo no mayor
de cinco (5) das hbiles de aprobado, incluyendo el dispositivo o documento de
aprobacin. Excepcionalmente y previa autorizacin del OSCE, las Entidades que
no tengan acceso a Internet en su localidad, debern remitirlos a este organismo
por medios magnticos, pticos u otros que determine el OSCE, segn el caso.
La contratacin de bienes, servicios y obras, con carcter de secreto, secreto
PLOLWDURSRUUD]RQHVGHRUGHQLQWHUQRFRQWHQLGRVHQHO'HFUHWR6XSUHPR1
2001-PCM, estn exceptuados de su difusin en el SEACE, mas no de su registro.
El Ministerio competente tendr acceso permanente a la base de datos de
los Planes Anuales de Contrataciones registrados en el SEACE para su anlisis
y difusin entre las microempresas y pequeas empresas.
Adicionalmente, el Plan Anual de Contrataciones aprobado estar a disposicin
de los interesados en el rgano encargado de las contrataciones de la Entidad y
en el portal institucional de sta, si lo tuviere, pudiendo ser adquirido por cualquier
interesado al precio equivalente al costo de reproduccin.
Concordancia: LCE: Artculo 8.
Artculo 9.- Modificacin del Plan Anual de Contrataciones
(O3ODQ$QXDOGH&RQWUDWDFLRQHVSRGUiVHUPRGLFDGRGHFRQIRUPLGDGFRQOD
asignacin presupuestal o en caso de reprogramacin de las metas institucionales:
cuando se tenga que incluir o excluir procesos de seleccin o el valor referencial
GLHUDHQPiVGHYHLQWLFLQFRSRUFLHQWRGHOYDORUHVWLPDGR\HOORYDUtHHO
tipo de proceso de seleccin.
3
/DDSUREDFLyQ\GLIXVLyQGHODVPRGLFDFLRQHVVHKDUiHQODIRUPDSUHYLVWD
en el artculo anterior.
El Titular de la Entidad evaluar semestralmente la ejecucin del Plan Anual
de Contrataciones debiendo adoptar las medidas correctivas pertinentes para
alcanzar las metas y objetivos previstos en el Plan Operativo Institucional y, de
3 Segn Fe de Erratas publicada el 15 de enero de 2009.
77
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
corresponder, disponer el deslinde de las responsabilidades respectivas. Ello sin
perjuicio de las evaluaciones peridicas que cada Entidad considere pertinente
efectuar.
Artculo 10.- Expediente de Contratacin
El Expediente de Contratacin se inicia con el requerimiento del rea usuaria.
Dicho Expediente debe contener la informacin referida a las caractersticas
tcnicas de lo que se va a contratar, el estudio de las posibilidades que ofrece el
mercado, el valor referencial, la disponibilidad presupuestal, el tipo de proceso de
seleccin, la modalidad de seleccin, el sistema de contratacin, la modalidad de
contratacin a utilizarse y la frmula de reajuste de ser el caso.
En todos los casos en que las contrataciones estn relacionadas a la ejecucin
de un proyecto de inversin pblica, es responsabilidad de la Entidad:
1. Que los proyectos hayan sido declarados viables, en el marco del
Sistema Nacional de Inversin Pblica.
2. Que se tomen las previsiones necesarias para que se respeten los
parmetros bajo los cuales fue declarado viable el proyecto, incluyendo
costos, cronograma, diseo u otros factores que pudieran afectar la
viabilidad del mismo.
Tratndose de obras, se adjuntar el Expediente Tcnico respectivo y,
cuando corresponda, la declaratoria de viabilidad conforme al Sistema Nacional
de Inversin Pblica. En la modalidad de concurso oferta no se requerir el
Expediente Tcnico, debindose anexar el estudio de preinversin y el informe
tcnico que sustent la declaratoria de viabilidad, conforme al Sistema Nacional
de Inversin Pblica.
En el caso de obras bajo la modalidad de llave en mano, si stas incluyen la
elaboracin del Expediente Tcnico, se deber anexar el estudio de preinversin
y el informe tcnico que sustent la declaratoria de viabilidad, conforme al Sistema
Nacional de Inversin Pblica.
Una vez aprobado el Expediente de Contratacin, se incorporarn todas las
actuaciones que se realicen desde la designacin del Comit Especial hasta la
culminacin del contrato, incluyendo las ofertas no ganadoras. Debe entenderse
por ofertas no ganadoras aquellas que fueron admitidas y a las que no se les
otorg la Buena Pro.
El rgano encargado de las contrataciones tiene a su cargo la custodia y
responsabilidad del Expediente de Contratacin, salvo en el perodo en el que
dicha custodia est a cargo del Comit Especial. Tambin es responsable de remitir
el Expediente de Contratacin al funcionario competente para su aprobacin, de
acuerdo a sus normas de organizacin interna.
En el caso que un proceso de seleccin sea declarado desierto, la nueva
convocatoria deber contar con una nueva aprobacin del Expediente de
&RQWUDWDFLyQVyORHQFDVRTXHKD\DVLGRPRGLFDGRHQDOJ~QH[WUHPR
Concordancia: LCE: Artculos 7, 12, 32 y 42.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
78
Artculo 11.- Caractersticas tcnicas de lo que se va a contratar
(OiUHDXVXDULDHVODUHVSRQVDEOHGHGHQLUFRQSUHFLVLyQODVFDUDFWHUtVWLFDV
condiciones, cantidad y calidad de los bienes, servicios u obras que requiera
para el cumplimiento de sus funciones, debiendo desarrollar esta actividad de
DFXHUGRDORLQGLFDGRHQHO$UWtFXORGHOD/H\(OyUJDQRHQFDUJDGRGHODV
contrataciones, con la autorizacin del rea usuaria y, como producto del estudio
de las posibilidades que ofrece el mercado, podr ajustar las caractersticas de
lo que se va a contratar.
Para la descripcin de los bienes y servicios a contratar no se har referencia a
marcas o nombres comerciales, patentes, diseos o tipos particulares, fabricantes
determinados, ni descripcin que oriente la adquisicin o contratacin de marca,
IDEULFDQWHRWLSRGHSURGXFWRHVSHFtFR6yORVHUiSRVLEOHVROLFLWDUXQDPDUFDRWLSR
de producto determinado cuando ello responda a un proceso de estandarizacin
debidamente sustentado, bajo responsabilidad del Titular de la Entidad.
(QDGLFLyQDORHVWDEOHFLGRHQHO$UWtFXORGHOD/H\VHUiQREOLJDWRULRVORV
requisitos tcnicos establecidos en reglamentos sectoriales dentro del mbito de su
aplicacin, siempre y cuando cuenten con el refrendo del Ministro de Economa y
Finanzas de acuerdo a lo dispuesto por los Decretos Leyes N 25629 y N 25909.
Las normas tcnicas nacionales, emitidas por la Comisin competente de
Reglamentos Tcnicos y Comerciales del Instituto Nacional de Defensa de la
Competencia y de la Proteccin de la Propiedad Intelectual - INDECOPI, podrn
VHUWRPDGDVHQFXHQWDSDUDODGHQLFLyQGHORVELHQHVVHUYLFLRVXREUDVTXH
se van a contratar mediante los procesos de seleccin regulados por la Ley y el
Reglamento.
Concordancia: LCE: Artculo 13.
Directiva N 010-2009-OSCE/CD.
Artculo 12.- Estudio de posibilidades que ofrece el mercado
6REUH OD EDVH GH ODV HVSHFLFDFLRQHV WpFQLFDV R WpUPLQRV GH UHIHUHQFLD
GHQLGRVSRUHOiUHDXVXDULDHOyUJDQRHQFDUJDGRGHODVFRQWUDWDFLRQHVWLHQHOD
obligacin de evaluar las posibilidades que ofrece el mercado para determinar
lo siguiente:
1. El valor referencial;
2. La existencia de pluralidad de marcas y/o postores;
3. La posibilidad de distribuir la Buena Pro;
4. Informacin que pueda utilizarse para la determinacin de los factores
de evaluacin, de ser el caso;
5. La pertinencia de realizar ajustes a las caractersticas y/o condiciones
de lo que se va a contratar, de ser necesario;
2WURVDVSHFWRVQHFHVDULRVTXHWHQJDQLQFLGHQFLDHQODHFLHQFLDGHOD
contratacin.
Para realizar el estudio de las posibilidades que ofrece el mercado, debe
emplearse, como mnimo, dos (2) fuentes, pudiendo emplearse las siguientes:
79
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
presupuestos y cotizaciones actualizados, los que debern provenir de personas
naturales o jurdicas que se dediquen a actividades materia de la convocatoria,
incluyendo fabricantes, cuando corresponda; portales y/o pginas Web, catlogos,
precios histricos, estructuras de costos, la informacin de procesos con buena
pro consentida publicada en el SEACE, entre otros, segn corresponda al objeto
GHODFRQWUDWDFLyQ\VXVFDUDFWHUtVWLFDVSDUWLFXODUHVGHELHQGRYHULFDUVHTXHOD
informacin obtenida en cada fuente corresponda a contrataciones iguales o
similares a la requerida. En caso exista la imposibilidad de emplear ms de una
fuente, en el estudio deber sustentarse dicha situacin.
Asimismo, el estudio de las posibilidades que ofrece el mercado debe tener
en consideracin las alternativas existentes segn el nivel de comercializacin,
descuentos por volmenes, disponibilidad inmediata de ser el caso, mejoras en las
FRQGLFLRQHVGHYHQWDJDUDQWtDV\RWURVEHQHFLRVDGLFLRQDOHVDVtFRPRWDPELpQ
la vigencia tecnolgica del objeto de la contratacin de las Entidades.
El estudio de las posibilidades que ofrece el mercado debe indicar los criterios,
procedimiento y/o metodologa utilizados, a partir de las fuentes previamente
LGHQWLFDGDVSDUDGHWHUPLQDUHOYDORUUHIHUHQFLDO
4
Concordancia: LCE: Artculo 27.
Artculo 13.- Valor referencial
El valor referencial es el monto determinado por el rgano encargado de las
FRQWUDWDFLRQHVGHDFXHUGRDORHVWDEOHFLGRHQHO$UWtFXORGHOD/H\FRPR
UHVXOWDGRGHOHVWXGLRDTXHVHUHHUHHODUWtFXORDQWHULRU
El valor referencial se calcular incluyendo todos los tributos, seguros,
transporte, inspecciones, pruebas y, de ser el caso, los costos laborales respectivos
conforme a la legislacin vigente, as como cualquier otro concepto que le sea
aplicable y que pueda incidir sobre el valor de los bienes y servicios a contratar. Las
cotizaciones de los proveedores debern incluir los mencionados componentes.
Para la determinacin del valor referencial, el rgano encargado de las
contrataciones est facultado para solicitar el apoyo que requiera del rea usuaria,
la que estar obligada a brindarlo bajo responsabilidad.
En el caso de los procesos de seleccin convocados segn relacin de tems,
el valor referencial del conjunto se determinar en funcin a la sumatoria de los
valores referenciales de cada uno de los tems considerados. En las Bases deber
HVSHFLFDUVHWDQWRHOYDORUUHIHUHQFLDOGHORVtWHPVFXDQWRHOYDORUUHIHUHQFLDOGHO
proceso de seleccin.
El Comit Especial puede observar el valor referencial y solicitar su revisin o
actualizacin al rgano encargado de las contrataciones de la Entidad, de acuerdo
FRQHODUWtFXORGHOD/H\
Cuando el valor referencial es observado por los participantes, el Comit
Especial deber poner en conocimiento del rgano encargado de las
contrataciones para su opinin y, si fuera el caso, para que apruebe un nuevo
YDORUUHIHUHQFLDOYHULFDQGRTXHVHFXHQWHFRQODGLVSRQLELOLGDGSUHVXSXHVWDO\
4 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
80
poniendo en conocimiento de tal hecho al funcionario que aprob el Expediente
GH&RQWUDWDFLyQ(QFDVRHOQXHYRYDORUUHIHUHQFLDOLPSOLTXHODPRGLFDFLyQGHO
tipo de proceso de seleccin convocado ste ser declarado nulo.
Concordancia: LCE: Artculos 13 y 27.
Artculo 14.- Valor referencial para ejecucin y consultora de obras
En el caso de ejecucin y consultora de obras la determinacin del valor
referencial se sujetar a lo siguiente:
1. En la contratacin para la ejecucin de obras, corresponder al monto
del presupuesto de obra establecido en el Expediente Tcnico. Este
SUHVXSXHVWR GHEHUi GHWDOODUVH FRQVLGHUDQGR OD LGHQWLFDFLyQ GH ODV
partidas y subpartidas necesarias de acuerdo a las caractersticas de
la obra, sustentndose en anlisis de precios unitarios por cada partida
y subpartida, elaborados teniendo en cuenta los insumos requeridos en
las cantidades y precios o tarifas que se ofrezcan en las condiciones
ms competitivas en el mercado. Adems, debe incluirse los gastos
JHQHUDOHVYDULDEOHV\MRVDVtFRPRODXWLOLGDG
El presupuesto de obra deber estar suscrito por los consultores y/o
servidores pblicos que participaron en su elaboracin y/o aprobacin,
segn corresponda.
En la ejecucin de obras bajo las modalidades de concurso oferta y llave
en mano que comprenda la elaboracin del expediente tcnico, el valor
referencial deber determinarse teniendo en cuenta el objeto de la obra
y su alcance previsto en los estudios de preinversin que dieron lugar
a la viabilidad del correspondiente proyecto, as como el resultado del
estudio de las posibilidades de precios de mercado.
2. En el caso de consultora de obras deber detallarse, en condiciones
competitivas en el mercado, los honorarios del personal propuesto,
incluyendo gastos generales y la utilidad, de acuerdo a los plazos y
FDUDFWHUtVWLFDV GHQLGRV HQ ORV WpUPLQRV GH UHIHUHQFLD GHO VHUYLFLR
requerido.
El presupuesto de obra o de la consultora de obra deber incluir todos los
tributos, seguros, transporte, inspecciones, pruebas, seguridad en el trabajo y los
costos laborales respectivos conforme a la legislacin vigente, as como cualquier
otro concepto que le sea aplicable y que pueda incidir sobre el presupuesto.
Cuando el valor referencial es observado por los participantes, el Comit
Especial deber poner en conocimiento de la unidad orgnica competente para su
RSLQLyQ\VLIXHUDHOFDVRSDUDTXHDSUXHEHXQQXHYRYDORUUHIHUHQFLDOYHULFDQGR
que se cuente con la disponibilidad presupuestal y poniendo en conocimiento de
tal hecho al funcionario que aprob el Expediente de Contratacin. En caso el
QXHYRYDORUUHIHUHQFLDOLPSOLTXHODPRGLFDFLyQGHOWLSRGHSURFHVRGHVHOHFFLyQ
convocado, este ser declarado nulo.
5
Concordancia: LCE: Artculo 27.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
81
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 15.- Valor referencial en cobranzas o recuperaciones y en servicios
con honorarios de xito
El valor referencial en la contratacin de servicios de cobranzas o
UHFXSHUDFLRQHVGHEHUiVHUGHWHUPLQDGRDSOLFDQGRHOSRUFHQWDMHTXHVHMHHQODV
Bases, sobre el monto mximo a cobrar o recuperar. Dicho porcentaje incluye todos
los conceptos que comprende la contraprestacin que le corresponde al contratista.
Para la contratacin de servicios ser posible considerar honorarios de xito,
VLHPSUH \ FXDQGR pVWRV VHDQ XVXDOHV HQ HO PHUFDGR GHELHQGR MXVWLFDUVH
la necesidad y su monto a travs de un informe tcnico emitido por el rgano
encargado de las contrataciones de la Entidad. En caso que se considere el
pago de honorarios de xito, el valor referencial estar conformado por la suma
GHOKRQRUDULRMRPiVHOKRQRUDULRGHp[LWR3DUDHIHFWRVGHODLQFOXVLyQGHHVWH
ltimo en el valor referencial, se tomar en cuenta el monto mximo que la Entidad
pagara como honorario de xito.
Concordancia: LCE: Artculo 27.
Artculo 16.- Antigedad del valor referencial
Para convocar a un proceso de seleccin, el valor referencial no podr tener
una antigedad mayor a los seis (6) meses, tratndose de ejecucin de obras,
ni mayor a tres (3) meses en el caso de bienes y servicios.
Para el caso de ejecucin de obras que cuenten con expediente tcnico, la
antigedad del valor referencial se computar desde la fecha de determinacin
del presupuesto de obra que forma parte del expediente tcnico. Asimismo, en
el caso de consultora de obras, la antigedad del valor referencial se computar
desde la fecha de determinacin del presupuesto de consultora de obra obtenido
por la Entidad producto del estudio de las posibilidades que ofrece el mercado
consignado en el expediente de contratacin.
En el caso de bienes y servicios, la antigedad del valor referencial se com-
putar desde la aprobacin del expediente de contratacin.
La fecha de aprobacin del expediente de contratacin deber ser consignada
en las Bases.
6
Concordancia: LCE: Artculos 7 y 27.
Artculo 17.- Publicidad o reserva del valor referencial
El valor referencial es pblico. Sin embargo, podr ser reservado cuando
la naturaleza de la contratacin lo haga necesario, previo informe del rgano
encargado de las contrataciones de la Entidad, el cual deber ser aprobado por
el Titular de sta. La reserva del valor referencial deber ser establecida en el
Expediente de Contratacin.
En los casos de reserva del valor referencial, sta cesa cuando el Comit
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH\
UHFWLFDGRPHGLDQWH)HGH(UUDWDVSXEOLFDGDHQHO'LDULR2ILFLDO(O3HUXDQRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
82
Especial lo haga de conocimiento de los participantes en el acto de apertura de
los sobres.
En los procesos de seleccin con valor referencial reservado no ser de
aplicacin los lmites mnimos y mximos para admitir la oferta econmica,
previstos en la Ley y el Reglamento.
En cualquiera de los supuestos, es obligatorio registrar el valor referencial
HQHO6($&(GHELHQGRJDUDQWL]DUVHORVPHFDQLVPRVGHFRQGHQFLDOLGDGHQHO
caso de ser reservado.
Concordancia: LCE: Artculo 27.
Artculo 18.- Disponibilidad presupuestal
Una vez que se determine el valor referencial de la contratacin, se debe
VROLFLWDUDOD2FLQDGH3UHVXSXHVWRRODTXHKDJDVXVYHFHVODGLVSRQLELOLGDG
SUHVXSXHVWDO D Q GH JDUDQWL]DU TXH VH FXHQWD FRQ HO FUpGLWR SUHVXSXHVWDULR
VXFLHQWHSDUDFRPSURPHWHUXQJDVWRHQHODxRVFDOFRUUHVSRQGLHQWH3DUDVX
solicitud, deber sealarse el perodo de contratacin programado.
Para otorgar la disponibilidad presupuestal debe observarse lo sealado en
HOQXPHUDOGHODUWtFXORGHOD/H\1/H\GHO6LVWHPD1DFLRQDOGH
3UHVXSXHVWR\PRGLFDWRULDV
7
Concordancia: LCE: Artculo 27.
TITULO II
PROCESOS DE SELECCIN
CAPTULO I
ASPECTOS GENERALES
Artculo 19.- Tipos de procesos de seleccin
'HFRQIRUPLGDGFRQORHVWDEOHFLGRHQORVDUWtFXORV\GHOD
Ley, son procesos de seleccin los siguientes:
1. Licitacin Pblica, que se convoca para la contratacin de bienes y obras,
dentro de los mrgenes que establecen las normas presupuestarias.
2. Concurso Pblico, que se convoca para la contratacin de servicios,
dentro de los mrgenes establecidos por las normas presupuestarias.
3. Adjudicacin Directa, que se convoca para la contratacin de bienes,
servicios y ejecucin de obras, conforme a los mrgenes establecidos
por las normas presupuestarias.
La Adjudicacin Directa puede ser Pblica o Selectiva.
La Adjudicacin Directa Pblica se convoca cuando el monto de la
contratacin es mayor al cincuenta por ciento (50%) del lmite mximo
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
83
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
establecido para la Adjudicacin Directa en las normas presupuestarias.
En caso contrario, se convoca a Adjudicacin Directa Selectiva.
4. Adjudicacin de Menor Cuanta, puede ser Adjudicacin de Menor
Cuanta y Adjudicacin de Menor Cuanta Derivada.
La Adjudicacin de Menor Cuanta, se convoca para:
a) La contratacin de bienes, servicios y obras, cuyos montos sean infe-
riores a la dcima parte del lmite mnimo establecido por las normas
presupuestarias para las Licitaciones Pblicas o Concursos Pblicos,
segn corresponda;
b) La contratacin de expertos independientes para que integren los Co-
mits Especiales.
La Adjudicacin de Menor Cuanta Derivada, se convoca para los procesos
declarados desiertos, cuando corresponda, de acuerdo a lo establecido en
HODUWtFXORGHOD/H\
Para la determinacin del proceso de seleccin se considerar el objeto
principal de la contratacin y el valor referencial establecido por la Entidad para
la contratacin prevista. En el caso de contrataciones que involucren un conjunto
de prestaciones, el objeto principal del proceso de seleccin se determinar en
funcin a la prestacin que represente la mayor incidencia porcentual en el costo.
En cualquier caso, los bienes o servicios que se requieran como complementarios
entre s, se consideran incluidos en la contratacin objeto del contrato.
Mediante el proceso de seleccin segn relacin de tems, la Entidad, teniendo
en cuenta la viabilidad econmica, tcnica y/o administrativa de la vinculacin,
podr convocar en un solo proceso la contratacin de bienes, servicios u obras
distintas pero vinculadas entre s con montos individuales superiores a tres (3) UIT.
A cada caso les sern aplicables las reglas correspondientes al proceso principal,
con las excepciones previstas en el presente Reglamento, respetndose el objeto
y monto de cada tem.
En el caso de declaracin de desierto de uno o varios tems, el proceso de
seleccin que corresponde para la segunda convocatoria ser la Adjudicacin de
Menor Cuanta Derivada.
Mediante el proceso de seleccin por paquete, la Entidad agrupa, en el objeto
del proceso, la contratacin de varios bienes o servicios de igual o distinta clase,
FRQVLGHUDQGRTXHODFRQWUDWDFLyQFRQMXQWDHVPiVHFLHQWHTXHHIHFWXDUFRQWUD-
taciones separadas de dichos bienes o servicios.
Las entidades preferentemente contratarn por paquete la elaboracin de los
HVWXGLRVGHSUHLQYHUVLyQGHSHUOSUHIDFWLELOLGDG\IDFWLELOLGDGVHJ~QFRUUHVSRQGD
debiendo preverse en los trminos de referencia que los resultados de cada nivel
de estudio sean considerados en los niveles siguientes.
Para la contratacin de estudios de preinversin el rea usuaria en coordina-
cin con el rgano encargado de las contrataciones sustentar la convocatoria
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
84
de los procesos de seleccin cuando tenga que realizarse por paquete, o en
forma separada.
Los tipos de procesos de seleccin previstos en el presente artculo, podrn
sujetarse a las modalidades especiales de Convenio Marco y Subasta Inversa,
de acuerdo a lo indicado en este Reglamento.
8
Concordancia: LCE: Artculos 13, 15 al 18 y 32.
Artculo 20.- Prohibicin de fraccionamiento
La contratacin de bienes o servicios de carcter permanente, cuya provisin
se requiera de manera continua o peridica se realizar por periodos no menores
a un (1) ao.
No se considerar fraccionamiento cuando:
(VWDQGRDFUHGLWDGDODQHFHVLGDGHQODHWDSDGHSODQLFDFLyQOD(QWLGDG
restringi la cantidad a contratar por no disponer a dicha fecha la dis-
ponibilidad presupuestal correspondiente, situacin que vara durante
la ejecucin del Plan Anual de Contrataciones al contarse con mayores
crditos presupuestarios no previstos, provenientes de, entre otros,
transferencias de partidas, crditos suplementarios y recursos pblicos
captados o percibidos directamente por la Entidad.
2. Con posterioridad a la aprobacin del Plan Anual de Contrataciones,
surja una necesidad extraordinaria e imprevisible adicional a la progra-
mada, siempre que la contratacin programada cuente con Expediente
de Contratacin aprobado, debiendo atenderse la nueva necesidad a
travs de una contratacin independiente.
3. Se contrate con el mismo proveedor como consecuencia de procesos de
seleccin con objetos contractuales distintos o en el caso que concurran
procesos de seleccin con contratos complementarios, exoneraciones
o con procesos bajo regmenes especiales.
4. La contratacin se efecte a travs del Catlogo de Convenios Marco.
5. Se requiera propiciar la participacin de las microempresas y pequeas
empresas, en aquellos sectores donde exista oferta competitiva, siempre
que sus bienes, servicios y obras sean de la calidad necesaria para
que la Entidad se asegure el cumplimiento oportuno y los costos sean
razonables en funcin a las condiciones del mercado.
9
Concordancia: LCE: Artculo 19.
Artculo 21.- Modalidades Especiales de Seleccin
Los tipos de procesos de seleccin previstos en el artculo anterior, podrn
sujetarse a las modalidades especiales de Convenio Marco y Subasta Inversa,
de acuerdo a lo indicado en este Reglamento.
Concordancia: LCE: Artculo 15.
RLCE: Artculos 90 al 96, 97 al 103.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
85
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 22.- Etapas de los Procesos de Seleccin
Los procesos de seleccin contendrn las etapas siguientes, salvo las
excepciones establecidas en el presente artculo:
1. Convocatoria.
2. Registro de participantes.
3. Formulacin y absolucin de consultas.
4. Formulacin y absolucin de observaciones.
5. Integracin de las Bases.
6. Presentacin de propuestas.
&DOLFDFLyQ\HYDOXDFLyQGHSURSXHVWDV
8. Otorgamiento de la Buena Pro.
En los procesos de Adjudicacin Directa y Adjudicacin de Menor Cuanta
para obras y consultora de obras se fusionarn las etapas 3 y 4. Asimismo, en
los procesos de Adjudicacin de Menor Cuanta para bienes y servicios no se
incluirn en el proceso las etapas 3, 4 y 5.
El incumplimiento de alguna de las disposiciones que regulan el desarrollo de
estas etapas constituye causal de nulidad de las etapas siguientes del proceso, de
FRQIRUPLGDGFRQORGLVSXHVWRHQHODUWtFXORGHOD/H\\ORUHWURWUDHDOPRPHQWR
anterior a aqul en que se produjo dicho incumplimiento.
Los procesos de seleccin culminan cuando se produce alguno de los
siguientes eventos:
1. Se suscribe el contrato respectivo o se perfecciona ste.
2. Se cancela el proceso.
3. Se deja sin efecto el otorgamiento de la Buena Pro por causa imputable
a la Entidad.
1RVHVXVFULEDHOFRQWUDWRSRUODVFDXVDOHVHVWDEOHFLGDVHQHODUWtFXOR
Concordancia: LCE: Artculos 14 y 56

Artculo 23.- Cmputo de plazos durante el Proceso de Seleccin
Los plazos en los procesos de seleccin, desde su convocatoria hasta la
suscripcin del contrato, se computan por das hbiles. Son inhbiles los das
sbado, domingo y feriados no laborables, y los declarados por el Poder Ejecutivo
o autoridades competentes. El plazo excluye el da inicial e incluye el da de
vencimiento, salvo disposicin distinta establecida en el presente Reglamento.
Concordancia: LCE: Artculo 14.
Artculo 24.- Plazos generales para Procesos de Seleccin
En las Licitaciones Pblicas y Concursos Pblicos, entre las fechas de
convocatoria y de presentacin de propuestas no debern mediar menos de
veintids (22) das hbiles, computados a partir del da siguiente de la publicacin
de la convocatoria en el SEACE. Asimismo, entre la integracin de las Bases y la
presentacin de propuestas no podrn mediar menos de cinco (5) das hbiles,
computados a partir del da siguiente de la publicacin de las Bases integradas
en el SEACE.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
86
En las Adjudicaciones Directas mediarn no menos de diez (10) das hbiles
entre la convocatoria y la presentacin de propuestas y tres (3) das hbiles entre
la integracin de las bases y la presentacin de las propuestas.
En las Adjudicaciones de Menor Cuanta para bienes y servicios, debe mediar
entre la convocatoria y la fecha de presentacin de las propuestas existir un
plazo no menor de dos (2) das hbiles. En el caso de Adjudicaciones de Menor
Cuanta Derivada, el plazo ser no menor de seis (6) das hbiles.
En las Adjudicaciones de Menor Cuanta para la consultora de obras o
ejecucin de obras, desde la convocatoria hasta la fecha de presentacin de
propuestas debern mediar no menos de seis (6) das hbiles. En el caso de
Adjudicaciones de Menor Cuanta Derivada, el plazo ser no menor de ocho (8)
das hbiles.
10
Concordancia: LCE: Artculo 14.

Artculo 25.- Rgimen de notificaciones
Todos los actos realizados a travs SEACE durante los procesos de seleccin,
incluidos los realizados por el OSCE en el ejercicio de sus funciones, se entendern
QRWLFDGRVHOPLVPRGtDGHVXSXEOLFDFLyQ
/D QRWLFDFLyQ D WUDYpV GHO 6($&( SUHYDOHFH VREUH FXDOTXLHU PHGLR TXH
se haya utilizado adicionalmente, siendo responsabilidad del participante el
permanente seguimiento del respectivo proceso a travs del SEACE.
11
Concordancia: LCE: Quinta Disposicin Complementaria Final.
RLCE: Artculo 290.
Artculo 26.- Prrrogas o postergaciones
La prrroga o postergacin de las etapas de un proceso de seleccin deben
UHJLVWUDUVHHQHO6($&(PRGLFDQGRHOFURQRJUDPDRULJLQDO
El Comit Especial comunicar dicha decisin a los participantes o postores,
segn sea el caso, a travs del SEACE, y simultneamente en la propia Entidad
o al correo electrnico que hayan consignado al registrarse como participantes.
Concordancia: LCE: Artculo 30.
CAPTULO II
COMIT ESPECIAL
Artculo 27.- Designacin
El Titular de la Entidad o el funcionario a quien se hubiera delegado esta
atribucin, designar por escrito a los integrantes titulares y suplentes del Comit
Especial, indicando los nombres completos y quin actuar como presidente y
cuidando que exista correspondencia entre cada miembro titular y su suplente.
/DGHFLVLyQVHUiQRWLFDGDDFDGDXQRGHORVPLHPEURV
10,11 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
87
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
&RQMXQWDPHQWHFRQODQRWLFDFLyQGHGHVLJQDFLyQVHHQWUHJDUiDOSUHVLGHQWH
del Comit Especial el Expediente de Contratacin aprobado y toda la informacin
tcnica y econmica necesaria que pudiera servir para cumplir el encargo.
Una vez recibida la documentacin sealada en el prrafo anterior, el
presidente del Comit Especial, a ms tardar al da siguiente hbil de recibida,
deber convocar a los dems miembros para la instalacin respectiva, dejando
constancia en actas.
El Comit Especial elaborar las Bases y las elevar para la aprobacin de
la autoridad competente. Luego de aprobadas, el Comit Especial dispondr la
convocatoria del proceso.
Durante el desempeo de su encargo, el Comit Especial est facultado para
solicitar el apoyo que requiera de las dependencias o reas pertinentes de la
Entidad, las que estarn obligadas a brindarlo bajo responsabilidad.
Los acuerdos que adopte el Comit Especial debern constar en actas, cuyas
copias debern incorporarse al Expediente de Contratacin.
Para tal efecto, toda Entidad contar con un libro de actas de Licitaciones
Pblicas, Concursos Pblicos y Adjudicaciones Directas, o con un libro de actas
por cada tipo de proceso de seleccin, debidamente foliado y legalizado, el mismo
que podr ser llevado en hojas mecanizadas. Facultativamente, tambin podr
incluir las actas de las Adjudicaciones de Menor Cuanta o contar con un libro
de actas para este tipo de procesos de seleccin. El rgano encargado de las
contrataciones ser el responsable de la custodia de los indicados libros.
Concordancia: LCE: Artculo 24.

Artculo 28.- Participacin de expertos independientes
Los expertos independientes podrn ser personas jurdicas o naturales. En el
caso que se designe como experto independiente a una persona jurdica del sector
privado, sta deber tener como giro principal de su negocio aqul vinculado con
el objeto de la convocatoria, debiendo adems designar a la persona natural que
la representar dentro del Comit Especial.
Podrn ser invitados expertos independientes que provengan de otras
Entidades del sector pblico. Para estos efectos, ser necesaria la autorizacin
del Titular de la Entidad de la que provenga el experto independiente.
(OH[SHUWRLQGHSHQGLHQWHGHEHUiJXDUGDUFRQGHQFLDOLGDGUHVSHFWRGHWRGD
la informacin a que tenga acceso con ocasin del servicio.
Concordancia: LCE: Artculo 24.
Artculo 29.- Impedimentos para ser miembro del Comit Especial
Se encuentran impedidos de formar parte de un Comit Especial:
1. El Titular de la Entidad.
7RGRVORVIXQFLRQDULRVTXHWHQJDQDWULEXFLRQHVGHFRQWURORVFDOL]DFLyQ
tales como regidores, consejeros regionales, directores de empresas,
auditores, entre otros, salvo que el rgano de Control Institucional de
la Entidad sea el rea usuaria.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
88
3. Los funcionarios que por delegacin hayan aprobado el Expediente
de Contratacin, designado el Comit Especial, aprobado las Bases o
tengan facultades para resolver el recurso de apelacin.
4. Los funcionarios o servidores que hayan sido sancionados por su
actuacin como integrantes de un Comit Especial, mediante decisin
GHELGDPHQWHPRWLYDGD\FRQVHQWLGDRDGPLQLVWUDWLYDPHQWHUPHFRQ
suspensin o cese temporal, mientras se encuentre vigente; o hayan
sido sancionados con destitucin o despido. Si la sancin a un miembro
del Comit Especial es impuesta luego de ser designado, dejar de ser
integrante de dicho Comit.
En el caso del inciso 3), el impedimento se circunscribe al proceso de
FRQWUDWDFLyQDTXHVHUHHUHQODVGHOHJDFLRQHVHQpOVHxDODGDV
Artculo 30.- Comit Especial Permanente
Tratndose de Adjudicaciones Directas y Adjudicaciones de Menor Cuanta,
podr designarse uno o ms Comits Especiales Permanentes para objetos de
FRQWUDWDFLRQHVDQHVH[FHSWRHQHOFDVRGH$GMXGLFDFLRQHVGH0HQRU&XDQWtD
Derivada, los que sern conducidos por el mismo Comit Especial designado
inicialmente.
En la conformacin del Comit Especial Permanente slo ser exigible
que uno de sus integrantes sea representante del rgano encargado de las
contrataciones.
12
Concordancia: LCE: Artculo 24.
Artculo 31.- Competencias
El Comit Especial conducir el proceso encargndose de su organizacin,
conduccin y ejecucin, desde la preparacin de las Bases hasta la culminacin
del proceso. El Comit Especial es competente para:
1. Consultar los alcances de la informacin proporcionada en el
([SHGLHQWHGH&RQWUDWDFLyQ\VXJHULUGHVHUHOFDVRODVPRGLFDFLRQHV
TXH FRQVLGHUH SHUWLQHQWHV &XDOTXLHU PRGLFDFLyQ UHTXHULUi FRQWDU
previamente con la conformidad del rea usuaria y/o del rgano
HQFDUJDGRGHODVFRQWUDWDFLRQHVVHJ~QFRUUHVSRQGD/DPRGLFDFLyQ
requerir una nueva aprobacin del Expediente de Contratacin.
2. Elaborar las Bases.
3. Convocar el proceso.
4. Absolver las consultas y observaciones.
5. Integrar las Bases.
6. Evaluar las propuestas.
7. Adjudicar la Buena Pro.
12 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
89
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
8. Declarar desierto.
9. Todo acto necesario para el desarrollo del proceso de seleccin hasta
el consentimiento de la Buena Pro.
(O&RPLWp(VSHFLDOQRSRGUiGHRFLRPRGLFDUODV%DVHVDSUREDGDV
Concordancia: LCE: Artculo 24.
Artculo 32.- Qurum y acuerdos
Para sesionar y adoptar acuerdos vlidos, el Comit Especial se sujetar a
las siguientes reglas:
1. El qurum para el funcionamiento del Comit Especial se da con la
presencia del nmero total de miembros titulares. En caso de ausencia
de alguno de stos, se proceder conforme a lo dispuesto en los artculos
\
2. Los acuerdos se adoptan por unanimidad o por mayora. No cabe la
abstencin por parte de ninguno de los miembros.
Los actos del Comit Especial constan en actas que, debidamente suscritas,
quedan en poder de la Entidad. La fundamentacin de los acuerdos y de los votos
discrepantes se har constar en el acta.
Artculo 33.- Intervencin de los miembros suplentes
En caso de ausencia de un titular, ste deber ser reemplazado por su
correspondiente suplente, respetndose la conformacin establecida en el artculo
GHOD/H\VDOYRORHVWDEOHFLGRHQHODUWtFXOR
La Entidad evaluar el motivo de la ausencia del titular, a efectos de determinar
responsabilidad, si la hubiere, sin que ello impida la participacin del suplente.
Una vez que el miembro titular ha sido reemplazado por el suplente, aqul podr
reincorporarse como miembro suplente al Comit Especial, previa autorizacin a
partir de la evaluacin sealada en el prrafo anterior.
Concordancia: LCE: Artculos 24 y 30.
Artculo 34.- Responsabilidad, remocin e irrenunciabilidad
El Comit Especial acta en forma colegiada y es autnomo en sus
GHFLVLRQHVODVFXDOHVQRUHTXLHUHQUDWLFDFLyQDOJXQDSRUSDUWHGHOD(QWLGDG
Todos los miembros del Comit Especial gozan de las mismas facultades, no
existiendo jerarqua entre ellos. Sus integrantes son solidariamente responsables
por su actuacin, salvo el caso de aquellos que hayan sealado en el acta
correspondiente su voto discrepante.
Los integrantes del Comit Especial slo podrn ser removidos por caso fortuito
o fuerza mayor, o por cese en el servicio, mediante documento debidamente
motivado. En el mismo documento podr designarse al nuevo integrante.
Los integrantes del Comit Especial no podrn renunciar al cargo encomendado.
Concordancia: LCE: Artculos 25 y 46.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
90
CAPTULO III
BASES
Artculo 35.- Aprobacin
Las Bases de los procesos de seleccin sern aprobadas por el Titular de la
Entidad, el mismo que podr delegar expresamente y por escrito dicha funcin.
La aprobacin de las Bases debe ser por escrito, ya sea mediante resolucin,
acuerdo o algn otro documento en el que exprese de manera indubitable la
voluntad de aprobacin. En ningn caso esta aprobacin podr ser realizada por
el Comit Especial o el rgano a cargo del proceso de seleccin.
Para la aprobacin, los originales de las Bases debern estar visados en
todas sus pginas por los miembros del Comit Especial o el rgano a cargo del
proceso de seleccin, segn corresponda.
Las Entidades utilizarn obligatoriamente las Bases estandarizadas que
aprobar el OSCE y divulgar a travs del SEACE.
Concordancia: LCE: Artculos 12 y 26.
RLCE: Artculo 38.
Artculo 36.- Acceso a las Bases
Todo proveedor, sin restricciones ni pago de derechos, puede tener acceso
a las Bases de un proceso de seleccin a travs del SEACE. En caso opten
por solicitar copia directamente a la Entidad, abonarn el costo de reproduccin
correspondiente.
Artculo 37.- Prepublicacin
Las Bases aprobadas de los procesos de seleccin podrn ser prepublicadas
en el SEACE y en el portal institucional de la Entidad convocante.
/RDQWHULRUPHQWHGLVSXHVWRQRUHSUHVHQWDXQDHWDSDDGLFLRQDODODVGHQLGDV
en cada uno de los procesos de seleccin, por lo que cualquier consulta u
observacin respecto del contenido de las Bases slo podrn efectuarse en la
etapa correspondiente del proceso.
Artculo 38.- Estandarizacin de las Bases
'HDFXHUGRDORHVWDEOHFLGRHQHO$UWLFXORGHOD/H\HO26&(DSUREDUi
Bases Estandarizadas para facilitar el monitoreo y procesamiento de las
FRQWUDWDFLRQHV3DUDWDOQODV%DVHVWHQGUiQXQDVHFFLyQJHQHUDO\XQDVHFFLyQ
HVSHFLFD /D VHFFLyQ JHQHUDO FRQWHQGUi GLVSRVLFLRQHV FRPXQHV D WRGRV ORV
procesos incluyendo las bases administrativas y el contrato respectivo. La seccin
HVSHFtFDFRQWHQGUiXQFRQMXQWRGHDQH[RVHVSHFtFRVSDUDFDGDSURFHVRTXH
sern preparadas por la Entidad.
El OSCE aprobara como mnimo Bases Estandarizadas para los siguientes
procesos:
1. Contratacin de bienes por licitacin publica
2. Contratacin de suministros por licitacin publica
91
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
3. Contratacin de obras por licitacin publica
4. Contratacin de servicios por concurso publico
5. Contratacin de bienes por adjudicacin directa pblica
6. Contratacin de suministros por adjudicacin directa pblica
7. Contratacin de obras por adjudicacin directa pblica
8. Contratacin de servicios por adjudicacin directa pblica
9. Contratacin de bienes por adjudicacin directa selectiva
10. Contratacin de suministros por adjudicacin directa selectiva
11. Contratacin de obras por adjudicacin directa selectiva
12. Contratacin de servicios por adjudicacin directa selectiva
13. Contratacin de bienes por adjudicacin de menor cuanta
14. Contratacin de suministros por adjudicacin de menor cuanta
15. Contratacin de obras por adjudicacin de menor cuanta
16. Contratacin de servicios por adjudicacin de menor cuanta
Concordancias: LCE: Artculo 26.
RLCE: Cuarta Disposicin Complementaria Transitoria.
Artculo 39.- Contenido mnimo
El Comit Especial o el rgano encargado de las contrataciones, segn
corresponda, elaborar las Bases del proceso de seleccin a su cargo, conforme a
lo establecido en el artculo anterior y la informacin tcnica y econmica contenida
en el Expediente de Contratacin.
Las Bases de los procesos de seleccin debern contener las condiciones
PtQLPDVVHxDODGDVHQHODUWtFXORGHOD/H\(QHOFDVRGHODV$GMXGLFDFLRQHVGH
Menor Cuanta para bienes y servicios, las bases debern contener las condiciones
establecidas en los literales a), b), d), e), f), g), i) y k) del citado artculo de la Ley.
'HFRQIRUPLGDGFRQHODUWtFXORGHOD/H\ODV%DVHVGHEHUiQFRQVLJQDUHO
lmite superior para determinar la admisin de la propuesta econmica, el cual
corresponde al cien por ciento (100%) del valor referencial en los procesos para
la contratacin de bienes, servicios y consultora de obras, y al ciento diez por
ciento (110%) del valor referencial en el caso de los procesos para la ejecucin de
obras. Asimismo, las Bases debern consignar el lmite inferior para determinar
la admisin de la propuesta econmica de noventa por ciento (90%) del valor
referencial en el caso de los procesos para la ejecucin y consultora de obras.
Para tal efecto, los lmites del valor referencial se calcularn considerando
dos (2) decimales. Para ello, si el lmite inferior del valor referencial tiene ms de
dos (2) decimales, se aumentar en un dgito el valor del segundo decimal. En el
caso del lmite superior del valor referencial, se consignar el valor del segundo
decimal, sin efectuar redondeo.
/DV%DVHVGHEHQHVSHFLFDUODPRQHGDRPRQHGDVHQTXHVHH[SUHVDUiQ
las propuestas.
En el caso de procesos de ejecucin de obras, las Bases establecern el
UHTXLVLWRGHFDOLFDFLyQSUHYLDGHSRVWRUHVVLHPSUHTXHHOYDORUUHIHUHQFLDOGHO
proceso de seleccin sea igual o superior a veinticinco mil Unidades Impositivas
Tributarias (25,000 UIT).
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
92
En estos procesos de seleccin slo podrn presentar propuestas tcnica y
HFRQyPLFDDTXHOORVSRVWRUHVTXHKD\DQVLGRDSUREDGRVHQODHWDSDGHFDOLFDFLyQ
previa. Las Bases establecern el plazo de esta etapa.
Las Bases debern indicar las condiciones especiales, criterios y factores a
FRQVLGHUDUHQODFDOLFDFLyQSUHYLDHQODTXHVyORFDEHHYDOXDUDORVSRVWRUHV
FRQ HO Q GH GHWHUPLQDU VX FDSDFLGDG \R VROYHQFLD WpFQLFD \ HFRQyPLFD VX
experiencia en la actividad y en la ejecucin de prestaciones similares y, de ser
el caso, en equipamiento y/o infraestructura fsica y de soporte en relacin con
la obra por contratar.
El OSCE emitir una directiva que establezca las normas complementarias
SDUD OD FDOLFDFLyQ SUHYLD /DV FRQWURYHUVLDV TXH VXUMDQ VREUH OD FDOLFDFLyQ
previa se tramitan de conformidad con el Captulo XII del Ttulo II del presente
Reglamento.
El plazo de ejecucin contractual y el plazo de entrega mximo sern los
indicados en el Expediente de Contratacin, los cuales sern recogidos en las
Bases, constituyendo requerimientos tcnicos de obligatorio cumplimiento.
13
Concordancia: LCE: Artculos 26 y 33.
Artculo 40.- Sistemas de Contratacin
'HDFXHUGRDORHVWDEOHFLGRHQHO$UWtFXORLQFLVRHGHOD/H\ODV%DVHV
LQFOXLUiQODGHQLFLyQGHOVLVWHPDGHFRQWUDWDFLyQ
Los sistemas de contratacin son:
1. Sistema a suma alzada, aplicable cuando las cantidades, magnitudes
y calidades de la prestacin estn totalmente definidas en las
HVSHFLFDFLRQHVWpFQLFDVHQORVWpUPLQRVGHUHIHUHQFLDRHQHOFDVRGH
REUDVHQORVSODQRV\HVSHFLFDFLRQHVWpFQLFDVUHVSHFWLYDV(OSRVWRU
IRUPXODUiVXSURSXHVWDSRUXQPRQWRMRLQWHJUDO\SRUXQGHWHUPLQDGR
plazo de ejecucin.
Tratndose de obras, el postor formular dicha propuesta considerando
los trabajos que resulten necesarios para el cumplimiento de la
SUHVWDFLyQ UHTXHULGD VHJ~Q ORV SODQRV HVSHFLFDFLRQHV WpFQLFDV
memoria descriptiva y presupuesto de obra que forman parte del
Expediente Tcnico, en ese orden de prelacin; considerndose que
el desagregado por partidas que da origen a su propuesta y que debe
presentar para la suscripcin del contrato, es referencial. El mismo orden
de prelacin se aplicar durante la ejecucin de la obra.
2. Sistema de precios unitarios, tarifas o porcentajes, aplicable cuando la
naturaleza de la prestacin no permita conocer con exactitud o precisin
las cantidades o magnitudes requeridas.
En este sistema, el postor formular su propuesta ofertando precios
unitarios, tarifas o porcentajes en funcin de las partidas o cantidades
referenciales contenidas en las Bases y que se valorizan en relacin a
su ejecucin real y por un determinado plazo de ejecucin.
13 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
93
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En el caso de obras, el postor formular su propuesta ofertando precios
unitarios considerando las partidas contenidas en las Bases, las
FRQGLFLRQHVSUHYLVWDVHQORVSODQRV\HVSHFLFDFLRQHVWpFQLFDV\ODV
cantidades referenciales, y que se valorizan en relacin a su ejecucin
real y por un determinado plazo de ejecucin.
3. Esquema mixto de Suma Alzada y Precios Unitarios, al que podrn optar
las Entidades si en el Expediente Tcnico uno o varios componentes
WpFQLFRV FRUUHVSRQGHQ D PDJQLWXGHV \ FDQWLGDGHV QR GHQLGDV FRQ
precisin, los que podrn ser contratados bajo el sistema de precios
unitarios, en tanto, los componentes cuyas cantidades y magnitudes
HVWpQWRWDOPHQWHGHQLGDVHQHO([SHGLHQWH7pFQLFRVHUiQFRQWUDWDGRV
bajo el sistema de suma alzada.
14
Concordancia: LCE: Artculo 26.
Artculo 41.- Modalidades de Ejecucin Contractual
Cuando se trate de bienes u obras, las bases indicarn la modalidad en que
se realizar la ejecucin del contrato, pudiendo sta ser:
1. Llave en mano: Si el postor debe ofertar en conjunto la construccin,
equipamiento y montaje hasta la puesta en servicio de determinada obra,
y de ser el caso la elaboracin del Expediente Tcnico. En el caso de
contratacin de bienes el postor oferta, adems de stos, su instalacin
y puesta en funcionamiento.
2. Concurso oferta: Si el postor debe ofertar la elaboracin del Expediente
Tcnico, ejecucin de la obra y, de ser el caso el terreno. Esta modalidad
slo podr aplicarse en la ejecucin de obras que se convoquen bajo el
sistema a suma alzada y siempre que el valor referencial corresponda
a una Licitacin Pblica. Para la ejecucin de la obra es requisito previo
la presentacin y aprobacin del Expediente Tcnico por el ntegro de
la obra.
En el caso de obras convocadas bajo las modalidades anteriores, en que deba
elaborarse el Expediente Tcnico y efectuarse la ejecucin de la obra, el postor
deber acreditar su inscripcin en el RNP como ejecutor de obras y consultor de
obras. En caso que el postor sea un consorcio, la acreditacin de la inscripcin
en el RNP se efectuar de acuerdo a lo dispuesto en la Directiva que el OSCE
apruebe para tal efecto.
15
Concordancia: LCE: Artculo 26.
Artculo 42.- Especificacin del Contenido de los sobres de propuesta
Las bases establecern el contenido de los sobres de propuesta para los
procesos de seleccin. El contenido mnimo ser el siguiente:
1. Propuesta Tcnica:
140RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH

REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
94
a) Documentacin de presentacin obligatoria
i. Declaracin jurada simple declarando que:
a. No tiene impedimento para participar en el proceso de
seleccin ni para contratar con el Estado, conforme al
DUWtFXORGHOD/H\
b. Conoce, acepta y se somete a las Bases, condiciones
y procedimientos del proceso de seleccin;
c. Es responsable de la veracidad de los documentos e
informacin que presenta para efectos del proceso;
d. Se compromete a mantener su oferta durante el proceso
de seleccin y a suscribir el contrato en caso de resultar
favorecido con la Buena Pro; y
e. Conoce las sanciones contenidas en la Ley y su Regla-
PHQWRDVtFRPRHQOD/H\1/H\GHO3URFHGL-
miento Administrativo General.
ii. Declaracin jurada y/o documentacin que acredite el
cumplimiento de los requerimientos tcnicos mnimos.
iii. Promesa de consorcio, de ser el caso, en la que se consigne
los integrantes, el representante comn, el domicilio comn
y las obligaciones a las que se compromete cada uno de los
integrantes del consorcio as como el porcentaje equivalente
a dichas obligaciones. La promesa formal de consorcio
deber ser suscrita por cada uno de sus integrantes.
Se presume que el representante comn del consorcio se
encuentra facultado para actuar en nombre y representacin
del mismo en todos los actos referidos al proceso de
seleccin, suscripcin y ejecucin del contrato, con amplias
\VXFLHQWHVIDFXOWDGHV
b) Documentacin de presentacin facultativa
L &HUWLFDGRGHLQVFULSFLyQRUHLQVFULSFLyQHQHO5HJLVWURGH
la Micro y Pequea Empresa-REMYPE, de ser el caso.
ii. Documentacin relativa a los factores de evaluacin, de as
considerarlo el postor.
2. Propuesta Econmica:
Oferta econmica y el detalle de precios unitarios cuando este sistema
haya sido establecido en las Bases.
16
Concordancia: LCE: Artculos 26 y 36.
16 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
95
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 43.- Mtodo de evaluacin de propuestas
/DV %DVHV GHEHUiQ HVSHFLFDU ORV IDFWRUHV GH HYDOXDFLyQ SUHFLVDQGR
los criterios que se emplearn para su aplicacin, as como los puntajes, la
forma de asignacin de stos a cada postor y la documentacin sustentatoria
para la asignacin de stos.
El Comit Especial determinar los factores de evaluacin tcnicos a
ser utilizados, los que debern ser objetivos y congruentes con el objeto
de la convocatoria, debiendo sujetarse a criterios de razonabilidad y
proporcionalidad.
6HSRGUiFDOLFDUDTXHOORTXHVXSHUHRPHMRUHHOUHTXHULPLHQWRPtQLPR
siempre que no desnaturalice el requerimiento efectuado.
En los procesos de seleccin convocados bajo la modalidad de Convenio
Marco, es facultativa la utilizacin de factores de evalucin como parte de
la metodologa de evaluacin, de acuerdo a lo que seale el respectivo
Expediente de Contratacin.
El nico factor de evaluacin econmica es el monto total de la oferta.
17
Concordancia: LCE: Artculos 26 y 31.
Artculo 44.- Factores de evaluacin para la contratacin de bienes
1. En caso de contratacin de bienes podrn considerarse los si-
guientes factores de evaluacin de la propuesta tcnica, segn
FRUUHVSRQGDDOWLSRGHOELHQVXQDWXUDOH]DQDOLGDGIXQFLRQDOLGDG
y a la necesidad de la Entidad:
a) El plazo de entrega.
b) La garanta comercial del postor y/o del fabricante.
c) La disponibilidad de servicios y repuestos.
d) La capacitacin del personal de la Entidad.
e) Mejoras a las caractersticas tcnicas de los bienes y a las
condiciones previstas en las Bases, que no generen costo
adicional para la Entidad. Las Bases debern precisar aquellos
aspectos que sern considerados como mejoras.
I /D H[SHULHQFLD GHO SRVWRU OD FXDO VH FDOLFDUi FRQVLGHUDQGR
el monto facturado acumulado por el postor durante un
perodo determinado de hasta ocho (8) aos a la fecha de la
presentacin de propuestas, por un monto mximo acumulado
de hasta cinco (5) veces el valor referencial de la contratacin
o tem materia de la convocatoria, sin que las Bases puedan
establecer limitaciones referidas a la cantidad, monto o a la duracin
de cada contratacin que se pretenda acreditar.
La experiencia se acreditar con un mximo de veinte (20)
contrataciones, sin importar el nmero de documentos que las
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
96
sustenten. Tal experiencia se acreditar mediante contratos y su
respectiva conformidad por la venta o suministro efectuados o
mediante comprobantes de pago cuya cancelacin se acredite
documental y fehacientemente. En el caso de suministro de bienes,
slo se considerar la parte que haya sido ejecutada hasta la fecha
de presentacin de propuestas, debiendo adjuntar la conformidad
de la misma o acreditar su pago.
En las Bases deber sealarse los bienes, iguales y similares, cuya
venta o suministro servir para acreditar la experiencia del postor.
g) Cumplimiento de la prestacin, el cual se evaluar en funcin al
Q~PHURGHFHUWLFDGRVRFRQVWDQFLDVTXHDFUHGLWHQTXHDTXpOVH
efectu sin que se haya incurrido en penalidades, no pudiendo
ser mayor de veinte (20) contrataciones. Tales certificados
o constancias deben referirse a todos los contratos que se
presentaron para acreditar la experiencia del postor. En el caso de
VXPLQLVWURGHELHQHVVHHYDOXDUiQORVFHUWLFDGRVRFRQVWDQFLDV
emitidos respecto de la parte del contrato ejecutado.
Asimismo, el Comit Especial podr establecer otros factores de evaluacin.
2. El nico factor de evaluacin de la propuesta econmica ser el
monto total indicado en la misma y, en su caso, el monto total de
cada tem, paquete o lote.
18
Concordancia: LCE: Artculo 31.
Artculo 45.- Factores de evaluacin para la contratacin de servicios en general
1. En caso de contratacin de servicios en general debe considerarse como
IDFWRUUHIHULGRDOSRVWRUODH[SHULHQFLDHQHOTXHVHFDOLFDUiODHMHFXFLyQ
de servicios en la actividad y/o en la especialidad, considerando el monto
facturado acumulado por el postor durante un perodo determinado de
hasta ocho (8) aos a la fecha de la presentacin de propuestas, por un
monto mximo acumulado de hasta cinco (5) veces el valor referencial
de la contratacin o tem materia de la convocatoria.
Se acreditar mediante contratos y la respectiva conformidad por
la prestacin efectuada o mediante comprobantes de pago cuya
cancelacin se acredite documental y fehacientemente, con un mximo
de diez (10) servicios en cada caso, prestados a uno o ms clientes, sin
establecer limitaciones por el monto o el tiempo de cada servicio que
se pretenda acreditar. En el caso de servicios de ejecucin peridica,
slo se considerar la parte que haya sido ejecutada hasta la fecha de
presentacin de propuestas, debiendo adjuntar la conformidad de la
misma o acreditar su pago.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHIHEUHURGH
97
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En las Bases deber sealarse los servicios, iguales y/o similares, cuya
prestacin servir para acreditar la experiencia del postor. El servicio
presentado para acreditar la experiencia en la especialidad sirve para
acreditar la experiencia en la actividad.
El factor referido a la experiencia del postor ser facultativo en el caso
de la contratacin del servicio de arrendamiento de inmuebles.
2. Adicionalmente, podrn considerarse los siguientes factores de
evaluacin de la propuesta tcnica, segn corresponda al tipo del
VHUYLFLRVXQDWXUDOH]DQDOLGDG\DODQHFHVLGDGGHOD(QWLGDG
a) Cumplimiento del servicio, el cual se evaluar en funcin al nmero
GHFHUWLFDGRVRFRQVWDQFLDVTXHDFUHGLWHQTXHDTXpOVHHIHFWXy
sin que se haya incurrido en penalidades, no pudiendo ser mayor
GHGLH]VHUYLFLRV7DOHVFHUWLFDGRVRFRQVWDQFLDVGHEHUiQ
referirse a los servicios que se presentaron para acreditar la
experiencia del postor.
b) Personal propuesto para la prestacin del servicio, el cual
se evaluar por el tiempo de experiencia en la especialidad
del personal propuesto para la ejecucin del servicio, que se
DFUHGLWDUiFRQFRQVWDQFLDVRFHUWLFDGRV
En el supuesto que el postor fuera una persona natural, la
experiencia que acredite como tal, podr acreditarla tambin
como personal propuesto para el servicio, si fuera el caso.
c) Mejoras a las condiciones previstas. Las Bases debern precisar
aquellos aspectos que sern considerados como mejoras.
d) Otros factores referidos al objeto de la convocatoria tales como
equipamiento, infraestructura, siempre y cuando cumplan con lo
GLVSXHVWRHQHODUWtFXOR
3. El nico factor de evaluacin de la propuesta econmica ser el monto
total indicado en la misma y, en su caso, el monto total de cada tem.
19
Concordancia: LCE: Artculo 31.
Artculo 46.- Factores de evaluacin para la contratacin de servicios de consultora
1. En caso de contratacin de servicios de consultora debern
considerarse los siguientes factores de evaluacin:
a) Experiencia
D /DH[SHULHQFLDHQODDFWLYLGDGVHFDOLFDUiFRQVLGHUDQGR
el monto facturado acumulado por el postor durante un
perodo determinado de hasta quince (15) aos a la
fecha de la presentacin de propuestas, por un monto
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
98
acumulado de hasta cinco (5) veces el valor referencial
de la contratacin o tem materia de la convocatoria.
Tales experiencias se acreditarn mediante contratos y
su respectiva conformidad por la prestacin efectuada o
mediante comprobantes de pago cuya cancelacin se
acredite documental y fehacientemente, con un mximo
de diez (10) servicios prestados a uno o ms clientes,
sin establecer limitaciones por el monto o el tiempo del
servicio ejecutado.
a.2) La experiencia en la especialidad se calificar
considerando el monto facturado acumulado por el
postor durante un perodo determinado de hasta diez
(10) aos a la fecha de la presentacin de propuestas,
por un monto mximo acumulado de hasta dos (2)
veces el valor referencial de la contratacin o tem
materia de la convocatoria. Tales experiencias se
acreditarn mediante contratos y su respectiva
conformidad por la prestacin efectuada o mediante
comprobantes de pago cuya cancelacin se acredite
documental y fehacientemente, con un mximo de
diez (10) servicios prestados a uno o ms clientes,
sin establecer limitaciones por el monto o el tiempo
del servicio ejecutado. En las Bases deber sealarse
los servicios cuya prestacin servir para acreditar la
experiencia del postor. El servicio presentado para
acreditar la experiencia en la especialidad sirve para
acreditar la experiencia en la actividad.
E ([SHULHQFLD \ FDOLFDFLRQHV GHO SHUVRQDO SURSXHVWR SDUD OD
prestacin del servicio: El tiempo de experiencia en la especialidad
\ODVFDOLFDFLRQHVGHOSHUVRQDOVHDFUHGLWDUiFRQFRQVWDQFLDV
o certificados. Las Bases establecern los requisitos de
conformacin y permanencia del personal propuesto.
c) Mejoras a las condiciones previstas. Las Bases debern precisar
aquellos aspectos que sern considerados como mejoras.
En el supuesto que el postor fuera una persona natural, la experiencia
que acredite como tal, podr acreditarla tambin como personal
propuesto para el servicio, si fuera el caso.
2. Adicionalmente, podr considerarse el factor de evaluacin cumplimiento
GHOVHUYLFLRHOTXHVHHYDOXDUiHQIXQFLyQDOQ~PHURGHFHUWLFDGRV
o constancias que acrediten que aqul se efectu sin que se haya
incurrido en penalidades, no pudiendo ser mayor de diez (10) servicios.
7DOHVFHUWLFDGRVRFRQVWDQFLDVGHEHUiQUHIHULUVHDORVVHUYLFLRVTXHVH
99
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
presentaron para acreditar la experiencia del postor. Tambin podrn
considerarse factores referidos al objeto de la convocatoria, como
equipamiento, infraestructura, entre otros, siempre y cuando cumplan
FRQORGLVSXHVWRHQHODUWtFXOR
3. Las Bases debern establecer los siguientes mrgenes de puntaje para
los factores de evaluacin:
3.1. Experiencia: De 25 a 35 puntos, puntaje que deber incluir
el que corresponda a la experiencia en la actividad, en la
especialidad y al cumplimiento del servicio, cuando ste ltimo
se haya incorporado como factor de evaluacin.
3.2. Personal propuesto para la prestacin del servicio: De 30 a 40
puntos.
3.3. Mejoras a las condiciones previstas en las Bases: De 20 a 25
puntos.
4. El nico factor de evaluacin de la propuesta econmica ser el monto
total de la oferta y, en su caso, el monto total de cada tem.
20
Concordancia: LCE: Artculo 31.
Artculo 47.- Factores de evaluacin para la contratacin de obras
1. Para la contratacin de obras que correspondan a Adjudicaciones
Directas Selectivas y Adjudicaciones de Menor Cuanta no se
establecern factores tcnicos de evaluacin, slo se evaluar la
propuesta econmica de aquellos postores cuya propuesta cumpla
con lo sealado en el expediente tcnico.
2. En las obras que correspondan a Licitaciones Pblicas y
Adjudicaciones Directas Pblicas, as como a procesos de
Adjudicacin de Menor Cuanta Derivada de Licitacin Pblica y
Adjudicacin Directa Pblica, debern considerarse los siguientes
factores de evaluacin de la propuesta tcnica:
a) Experiencia en obras en general ejecutadas hasta en los ltimos
diez (10) aos a la fecha de presentacin de propuestas, por
un monto acumulado equivalente de hasta cinco (5) veces el
valor referencial de la obra materia de la convocatoria.
b) Experiencia de obras similares ejecutadas hasta en los ltimos
diez (10) aos a la fecha de presentacin de propuestas, por un
mximo acumulado equivalente al valor referencial de la obra
materia de la convocatoria, siendo el valor mnimo de cada obra
similar al quince por ciento (15%) del valor referencial. En las
Bases deber sealarse las obras similares que servirn para
acreditar la experiencia del postor.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
100
La obra presentada para acreditar la experiencia en obras
similares sirve para acreditar la experiencia en obras en
general.
La experiencia del postor se acreditar con copias simples de
contratos y sus respectivas actas de recepcin y conformidad;
contratos y sus respectivas resoluciones de liquidacin;
o contratos y cualquier otra documentacin de la cual se
desprenda fehacientemente que la obra fue concluida, as
como su monto total.
F ([SHULHQFLD\FDOLFDFLRQHVGHOSHUVRQDOSURIHVLRQDOSURSXHVWR
las que sern establecidas en forma objetiva en las Bases,
las cuales establecern los requisitos de conformacin y
permanencia del personal profesional propuesto.
d) Cumplimiento de ejecucin de obras, el cual se evaluar en
IXQFLyQDOQ~PHURGHFHUWLFDGRVRFRQVWDQFLDVTXHDFUHGLWHQ
que aquella se efectu y liquid sin que se haya incurrido en
penalidades, no pudiendo ser mayor de diez (10) contratos de
REUDVHQJHQHUDO\RVLPLODUHV(VWRVFHUWLFDGRVRFRQVWDQFLDV
deben referirse a las obras que se presentaron para acreditar
la experiencia del postor.
En los casos de contratacin de obras bajo las modalidades por
el alcance del contrato, las Bases incluirn, adems, factores que
permitan evaluar la calidad de las soluciones tcnicas de diseo,
de equipamiento o similares ofertadas por el postor.
El plazo de ejecucin, al ser un requerimiento tcnico mnimo, no
podr ser considerado como factor de evaluacin.
3. Las Bases debern considerar los siguientes mrgenes de puntaje
para los factores de evaluacin:
3.1 Experiencia en obras en general: De 15 a 20 puntos.
3.2 Experiencia en obras similares: De 30 a 35 puntos.
([SHULHQFLD\FDOLFDFLRQHVGHSHUVRQDOSURIHVLRQDO'H
a 35 puntos.
3.4 Cumplimiento de ejecucin de obras: De 15 a 20 puntos.
4. El nico factor de evaluacin de la propuesta econmica ser el
monto total de la oferta.
21
Concordancia: LCE: Artculo 31.
Artculo 48.- Acreditacin de la experiencia del Consorcio
El consorcio podr acreditar como experiencia la sumatoria de los montos
facturados, previamente ponderados, de aquellos integrantes que se hubieran
comprometido a ejecutar conjuntamente el objeto materia de la convocato-
ria. La ponderacin de tales montos facturados se efectuar sobre la base
21 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
101
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
de la informacin sealada en la promesa formal de consorcio, referida al
porcentaje de las obligaciones asumidas por cada uno de sus integrantes.
La documentacin vlida para acreditar la experiencia del consorcio, as
como el mtodo de evaluacin, sern indicados en la Directiva que el OSCE
apruebe para tal efecto.
22
Concordancia: LCE: Artculo 36.
Artculo 49.- Frmulas de reajuste
1. En los casos de contratos de tracto sucesivo o de ejecucin
peridica o continuada de bienes o servicios, pactados en moneda
nacional, las Bases podrn considerar frmulas de reajuste de los
pagos que corresponden al contratista, conforme a la variacin
del ndice de Precios al Consumidor que establece el Instituto
Nacional de Estadstica e Informtica - INEI, correspondiente al
mes en que debe efectuarse el pago.
Cuando se trate de bienes sujetos a cotizacin internacional o cuyo
SUHFLRHVWpLQXLGRSRUpVWDQRVHDSOLFDUiODOLPLWDFLyQGHOQGLFH
GH3UHFLRVDO&RQVXPLGRUDTXHVHUHHUHHOSiUUDIRSUHFHGHQWH
2. En el caso de contratos de obras pactados en moneda
nacional, las Bases establecern las frmulas de reajuste. Las
valorizaciones que se efecten a precios originales del contrato
y sus ampliaciones sern ajustadas multiplicndolas por el
UHVSHFWLYRFRHFLHQWHGHUHDMXVWH.TXHVHREWHQJDGHDSOLFDU
HQODIyUPXODRIyUPXODVSROLQyPLFDVORVQGLFHV8QLFDGRVGH
Precios de la Construccin que publica el Instituto Nacional de
Estadstica e Informtica - INEI, correspondiente al mes en que
debe ser pagada la valorizacin.
Tanto la elaboracin como la aplicacin de las frmulas
polinmicas se sujetan a lo dispuesto en el Decreto Supremo N
9&\VXVPRGLFDWRULDVDPSOLDWRULDV\FRPSOHPHQWDULDV
3. En el caso de contratos de consultora de obras pactados
en moneda nacional, los pagos estarn sujetos a reajuste
por aplicacin de frmulas monmicas o polinmicas, segn
corresponda, las cuales debern estar previstas en las Bases.
Para tal efecto, el consultor calcular y consignar en sus facturas
el monto resultante de la aplicacin de dichas frmulas, cuyas
variaciones sern mensuales, hasta la fecha de pago prevista
en el contrato respectivo, utilizando los ndices de Precios al
Consumidor publicados por el Instituto Nacional de Estadstica e
Informtica - INEI a la fecha de facturacin. Una vez publicados
los ndices correspondientes al mes en que debi efectuarse el
pago, se realizarn las regularizaciones necesarias.
22 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
102
4. No son de aplicacin las frmulas de reajuste cuando las
Bases establezcan que las propuestas se expresen en moneda
extranjera, salvo el caso de los bienes sujetos a cotizacin
LQWHUQDFLRQDORFX\RSUHFLRHVWpLQXLGRSRUpVWD
Concordancia: LCE: Artculo 26.
RLCE: Artculo 198.
CAPTULO IV
CONVOCATORIA, REGISTRO, CONSULTAS
Y OBSERVACIONES A LAS BASES
Artculo 50.- Convocatoria
La convocatoria de todo proceso de seleccin deber contener obligatoriamente
lo siguiente:
/DLGHQWLFDFLyQGRPLFLOLR\58&GHOD(QWLGDGTXHFRQYRFD
/DLGHQWLFDFLyQGHOSURFHVRGHVHOHFFLyQ
3. La indicacin de la modalidad de seleccin, de ser el caso.
4. La descripcin bsica del objeto del proceso.
5. El valor referencial.
6. El lugar y la forma en que se realizar la inscripcin o registro de
participantes.
7. El costo de reproduccin de las Bases.
8. El calendario del proceso de seleccin.
9. El plazo de entrega requerido o de ejecucin del contrato.
10. La indicacin de los instrumentos internacionales bajo cuyos alcances
se encuentra cubierto el proceso de seleccin, de ser el caso.
El OSCE ser el responsable de incluir en el SEACE la informacin sealada
en el inciso 10. Asimismo, para todos aquellos procesos de seleccin que se
encuentren bajo la cobertura de uno o ms instrumentos internacionales, el
OSCE se encargar de elaborar y publicar una versin en idioma ingls de la
convocatoria.
23
Artculo 51.- Publicacin en el SEACE
La convocatoria de las Licitaciones Pblicas, Concursos Pblicos y
Adjudicaciones Directas se realizar a travs de su publicacin en el SEACE,
oportunidad en la que se debern publicar las Bases y un resumen ejecutivo
del estudio de posibilidades que ofrece el mercado, bajo sancin de nulidad. No
corresponde publicar el resumen ejecutivo en los procesos de seleccin sujetos
a la modalidad de Convenio Marco en los que se haya optado no utilizar valor
referencial.
23 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
103
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
El Ministerio competente tendr acceso permanente a la informacin de
los procesos de seleccin registrados en el SEACE para su difusin entre las
microempresas y pequeas empresas.
/DV (QWLGDGHV SRGUiQ XWLOL]DU DGLFLRQDOPHQWH RWURV PHGLRV D Q GH TXH
los proveedores puedan tener conocimiento de la convocatoria del proceso de
seleccin.
La convocatoria a un proceso de Adjudicacin de Menor Cuanta se realiza a
travs de su publicacin en el SEACE, oportunidad en la que deber publicarse
las Bases, sin perjuicio de las invitaciones que se pueda cursar a uno (1) o ms
proveedores, segn corresponda, en atencin a la oportunidad, al monto, a la
FRPSOHMLGDG HQYHUJDGXUD R VRVWLFDFLyQ GH OD FRQWUDWDFLyQ EDMR VDQFLyQ GH
nulidad.
24
Concordancia: LCE: Artculo 68.
RLCE: Art cul o 287 y Sexta Di sposi ci n
Complementaria Transitoria.

Artculo 52.- Registro de participantes
La persona natural o jurdica que desee participar en un proceso de seleccin,
deber registrarse como participante conforme a las reglas establecidas en las
Bases, para cuyo efecto debe contar con inscripcin vigente en el RNP conforme
DOREMHWRGHODFRQYRFDWRULD/D(QWLGDGYHULFDUiODYLJHQFLDGHODLQVFULSFLyQHQHO
RNP y que no se encuentre inhabilitado para contratar con el Estado. El registro
de participantes es electrnico y gratuito. Dicho registro podr ser visualizado por
los usuarios a partir del da siguiente de la presentacin de propuestas.
En la oportunidad del registro, el participante podr solicitar a la Entidad un
ejemplar de las Bases, estando la Entidad obligada a su entrega, previo pago del
costo de reproduccin de estas. En el caso de la contratacin de la ejecucin de
obras, el ejemplar de las Bases deber comprender el expediente tcnico de obra.
La persona que se registra como participante se adhiere al proceso de
seleccin en el estado en que ste se encuentre.
25
Concordancia: LCE: Artculo 9.
Artculo 53.- Oportunidad del registro
El registro de participantes electrnico se lleva a cabo desde el da siguiente
de la convocatoria hasta antes del inicio de la presentacin de propuestas, de
forma ininterrumpida. En el caso de propuestas presentadas por un consorcio,
bastar que se registre uno (1) de sus integrantes.
26
Artculo 54.- Formulacin y absolucin de consultas
A travs de consultas, los participantes podrn solicitar la aclaracin de
cualquiera de los extremos de las Bases, o plantear solicitudes respecto a ellas.
El Comit Especial absolver las consultas mediante un pliego absolutorio,
GHELGDPHQWHIXQGDPHQWDGRHOTXHGHEHUiFRQWHQHUODLGHQWLFDFLyQGHFDGD
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
104
participante que las formul, las consultas presentadas y la respuesta para cada
una de ellas.
El mencionado pliego deber ser publicado en el SEACE en la fecha prevista
en el cronograma del proceso.
Las respuestas se consideran como parte integrante de las Bases y del
contrato.
27
Concordancia: LCE: Artculo 28.
Artculo 55.- Plazos para formulacin y absolucin de Consultas
El Comit Especial recibir las consultas por un perodo mnimo de cinco (5)
das hbiles contados desde el da siguiente de la convocatoria para Licitaciones
y Concursos Pblicos. El perodo mnimo ser de tres (3) das hbiles para
Adjudicaciones Directas y de dos (2) das hbiles para Adjudicaciones de Menor
Cuanta para obras y consultora de obras.
(OSOD]RSDUDODDEVROXFLyQ\VXUHVSHFWLYDQRWLFDFLyQDWUDYpVGHO6($&(\
a los correos electrnicos de los participantes, de ser el caso, no podr exceder
de cinco (5) das hbiles contados desde el vencimiento del plazo para recibir las
consultas en el caso de Licitaciones y Concursos Pblicos. Para Adjudicaciones
Directas no podr exceder de tres (3) das hbiles y para Adjudicaciones de Menor
Cuanta para obras y consultora de obras de dos (2) das hbiles.
28

Artculo 56.- Formulacin y absolucin de observaciones a las Bases
Mediante escrito debidamente fundamentado, los participantes podrn formular
observaciones a las Bases, las que debern versar sobre el incumplimiento
GH ODV FRQGLFLRQHV PtQLPDV D TXH VH UHHUH HO DUWtFXOR GH OD /H\ GH
cualquier disposicin en materia de contrataciones del Estado u otras normas
complementarias o conexas que tengan relacin con el proceso de seleccin.
El Comit Especial deber absolverlas de manera fundamentada y
sustentada, sea que las acoja, las acoja parcialmente o no las acoja, mediante
XQSOLHJRDEVROXWRULRTXHGHEHUiFRQWHQHUODLGHQWLFDFLyQGHFDGDREVHUYDQWH
las observaciones presentadas y la respuesta del Comit Especial para cada
observacin presentada.
El mencionado pliego deber ser publicado a travs del SEACE en la fecha
prevista en el cronograma del proceso.
El Comit Especial debe incluir en el pliego de absolucin de observaciones
el requerimiento de pago de la tasa por concepto de elevacin de observaciones
al OSCE.
29
Concordancia: LCE: Artculo 28.
Artculo 57.- Plazos para formulacin y absolucin de observaciones
En Licitaciones Pblicas y Concursos Pblicos, las observaciones a las
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHIHEUHURGH
29 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
105
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Bases sern presentadas dentro de los cinco (5) das hbiles siguientes de haber
QDOL]DGR HO WpUPLQR SDUD OD DEVROXFLyQ GH ODV FRQVXOWDV (O &RPLWp (VSHFLDO
QRWLFDUiODDEVROXFLyQDWUDYpVGHO6($&(\DORVFRUUHRVHOHFWUyQLFRVGHORV
participantes, de ser el caso, en un plazo mximo de cinco (5) das hbiles desde
el vencimiento del plazo para recibir las observaciones.
En Adjudicaciones Directas y Adjudicaciones de Menor Cuanta para ejecucin
y consultora de obras, las observaciones sern presentadas y absueltas en forma
simultnea a la presentacin de las consultas.
30
Artculo 58.- Elevacin de observaciones
El plazo para solicitar la elevacin de observaciones para el pronunciamiento
del OSCE es de tres (3) das hbiles, computados desde el da siguiente de la
QRWLFDFLyQGHOSOLHJRDEVROXWRULRDWUDYpVGHO6($&(
Los participantes pueden solicitar la elevacin de las observaciones para la
emisin de pronunciamiento, en los siguientes supuestos:
a) Cuando las observaciones presentadas por el participante no fueron
acogidas o fueron acogidas parcialmente;
b) Cuando a pesar de ser acogidas sus observaciones, el participante
considere que tal acogimiento contina siendo contrario a lo dispuesto
SRUHODUWtFXORGHOD/H\FXDOTXLHURWUDGLVSRVLFLyQGHODQRUPDWLYD
sobre contrataciones del Estado u otras normas complementarias o
conexas que tengan relacin con el proceso de seleccin; y
c) Cuando el participante considere que el acogimiento de una observacin
formulada por otro participante resulta contrario a lo dispuesto por el
DUWtFXORGHOD/H\FXDOTXLHURWUDGLVSRVLFLyQGHODQRUPDWLYDVREUH
contrataciones del Estado u otras normas complementarias o conexas
que tengan relacin con el proceso de seleccin. En este caso, el
participante debe haberse registrado como tal hasta el vencimiento del
plazo para formular observaciones.
El pronunciamiento deber estar motivado y expresado de manera objetiva
y clara; en l se absolver las observaciones y, de ser el caso, se emitir
SURQXQFLDPLHQWRGHRFLRVREUHFXDOTXLHUDVSHFWRGHODV%DVHVTXHFRQWUDYHQJD
ODQRUPDWLYDVREUHFRQWUDWDFLRQHVGHO(VWDGR(OSOD]RSDUDHPLWLU\QRWLFDUHO
pronunciamiento a travs del SEACE ser no mayor de diez (10) das hbiles. El
plazo ser improrrogable y se computar desde el da siguiente de la recepcin
del expediente completo por el OSCE.
Una vez publicado el pronunciamiento a travs del SEACE, ste deber ser
implementado por el Comit Especial, aun cuando ello implique la suspensin
temporal del proceso y/o la prrroga de las etapas del mismo, en atencin a la
complejidad de las correcciones, adecuaciones o acreditaciones que sea necesario
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHIHEUHURGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
106
realizar. El Comit Especial no puede continuar con la tramitacin del proceso de
seleccin si no ha cumplido con implementar adecuadamente lo dispuesto en el
pronunciamiento, bajo sancin de nulidad y sin perjuicio de las responsabilidades
a que hubiere lugar.
Contra el pronunciamiento emitido por el OSCE, no cabe la interposicin de
recurso administrativo alguno, siendo de obligatorio cumplimiento para la Entidad
y los participantes del proceso de seleccin.
31
Concordancia: LCE: Artculo 28.
Artculo 59.- Integracin de Bases
Una vez absueltas todas las consultas y/u observaciones, o si las mismas
QRVHKDQSUHVHQWDGRODV%DVHVTXHGDUiQLQWHJUDGDVFRPRUHJODVGHQLWLYDV
\QRSRGUiQVHUFXHVWLRQDGDVHQQLQJXQDRWUDYtDQLPRGLFDGDVSRUDXWRULGDG
administrativa alguna, bajo responsabilidad del Titular de la Entidad. Esta
restriccin no afecta la competencia del Tribunal para declarar la nulidad del
SURFHVRSRUGHFLHQFLDVHQODV%DVHV
/DV%DVHVLQWHJUDGDVGHEHQLQFRUSRUDUREOLJDWRULDPHQWHODVPRGLFDFLRQHV
que se hayan producido como consecuencia de las consultas, observaciones,
SURQXQFLDPLHQWRVDVtFRPRODVPRGLFDFLRQHVUHTXHULGDVSRUHO26&(HQHO
marco de sus acciones de supervisin.
En las Licitaciones Pblicas, Concursos Pblicos, Adjudicaciones Directas y
Adjudicaciones de Menor Cuanta para obras y consultora de obras, el Comit
Especial o el rgano encargado, cuando corresponda y bajo responsabilidad,
deber integrar y publicar las Bases Integradas al da siguiente de vencido el plazo
para formular las observaciones, de no haberse presentado stas.
En el caso que se hubieren presentado observaciones a las Bases, la
integracin y publicacin se efectuar al da siguiente de vencido el plazo para
solicitar la elevacin de las Bases al OSCE, correspondiendo al Comit Especial,
bajo responsabilidad, integrar las Bases conforme a lo dispuesto en el pliego de
absolucin de consultas y observaciones.
Si se solicita la elevacin, la integracin y publicacin se efectuar dentro de
ORVGRVGtDVKiELOHVVLJXLHQWHVGHQRWLFDGRHOSURQXQFLDPLHQWR
32
Artculo 60.- Publicacin de Bases Integradas
Si no se cumple con publicar las Bases Integradas a travs del SEACE en la
fecha establecida en el cronograma del proceso, el Comit Especial no puede
continuar con la tramitacin del proceso de seleccin, bajo sancin de nulidad
de todo lo actuado posteriormente y sin perjuicio de las responsabilidades a que
hubiere lugar.
La publicacin de las Bases Integradas es obligatoria, aun cuando no se
hubieran presentado consultas y observaciones.
33
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
107
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
CAPTULO V
PRESENTACIN DE PROPUESTAS
Artculo 61.- Requisitos para la admisin de propuestas
Para que una propuesta sea admitida deber incluir, cumplir y, en su caso,
acreditar la documentacin de presentacin obligatoria que se establezca en las
Bases y los requerimientos tcnicos mnimos que constituyen las caractersticas
tcnicas, normas reglamentarias y cualquier otro requisito establecido como tal
en las Bases y en las disposiciones legales que regulan el objeto materia de la
contratacin.
Artculo 62.- Presentacin de documentos
Todos los documentos que contengan informacin referida a los requisitos
para la admisin de propuestas y factores de evaluacin se presentarn en idioma
FDVWHOODQR R HQ VX GHIHFWR DFRPSDxDGRV GH WUDGXFFLyQ RFLDO R FHUWLFDGD
HIHFWXDGD SRU WUDGXFWRU S~EOLFR MXUDPHQWDGR R WUDGXFWRU FROHJLDGR FHUWLFDGR
segn corresponda, salvo el caso de la informacin tcnica complementaria
contenida en folletos, instructivos, catlogos o similares, que podr ser presentada
en el idioma original. El postor ser responsable de la exactitud y veracidad de
dichos documentos.
Cuando se exija la presentacin de documentos que sean emitidos por
autoridad pblica en el extranjero, el postor podr presentar copia simple de los
mismos sin perjuicio de su ulterior presentacin, la cual necesariamente deber
VHUSUHYLDDODUPDGHOFRQWUDWR'LFKRVGRFXPHQWRVGHEHUiQHVWDUGHELGDPHQWH
legalizados por el Consulado respectivo y por el Ministerio de Relaciones
Exteriores, en caso sea favorecido con la Buena Pro.
34
Artculo 63.- Forma de presentacin y alcance de las propuestas
Las propuestas se presentarn en dos (2) sobres cerrados, de los cuales el
primero contendr la propuesta tcnica y el segundo la propuesta econmica.
La propuesta tcnica se presentar en original y en el nmero de copias
requerido en las Bases, el que no podr exceder de la cantidad de miembros
que conforman el Comit Especial. La propuesta econmica slo se presentar
en original.
En el caso de las contrataciones electrnicas, deber observarse lo dispuesto
en este Reglamento.
En los procesos de seleccin convocados bajo la modalidad de Convenio
Marco se puede prever que los proveedores presenten ms de una propuesta
SRUFDGDtWHPVHJ~QORGLVSXHVWRHQHODUWtFXORGHO5HJODPHQWR
Cuando las propuestas se presenten en hojas simples se redactarn por
medios mecnicos o electrnicos y sern foliadas correlativamente empezando
por el nmero uno.
34 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
108
Cuando las propuestas tengan que ser presentadas total o parcialmente
mediante formularios o formatos, stos podrn ser llenados por cualquier medio,
incluyendo el manual. En ambos supuestos, las propuestas deben llevar el sello
y la rbrica del postor o de su representante legal o mandatario designado para
GLFKR Q VDOYR HQ HO FDVR TXH HO SRVWRU VHD SHUVRQD QDWXUDO HQ FX\R FDVR
bastar que ste o su apoderado, indique debajo de la rbrica sus nombres y
apellidos completos.
Las propuestas econmicas debern incluir todos los tributos, seguros,
transporte, inspecciones, pruebas y, de ser el caso, los costos laborales
conforme la legislacin vigente, as como cualquier otro concepto que pueda
tener incidencia sobre el costo del bien, servicio u obra a adquirir o contratar;
excepto la de aquellos postores que gocen de exoneraciones legales.
El monto total de la propuesta econmica y los subtotales que lo componen
debern ser expresados con dos decimales. Los precios unitarios podrn ser
expresados con ms de dos decimales.
Los integrantes de un consorcio no podrn presentar propuestas individuales
ni conformar ms de un consorcio en un proceso de seleccin, o en un
determinado tem cuando se trate de procesos de seleccin segn relacin
de tems.
35
Artculo 64.- Acto de presentacin de propuestas
El acto de presentacin de propuestas ser pblico cuando el proceso
convocado sea Licitacin Pblica, Concurso Pblico y Adjudicacin Directa
Pblica, y podr ser privado cuando se trate de una Adjudicacin Directa Selectiva
o Adjudicacin de Menor Cuanta. En los procesos de Adjudicacin de Menor
Cuanta Derivada, el acto de presentacin de propuestas se realiza bajo la
formalidad que corresponde al proceso principal.
El acto pblico se realiza, cuando menos, en presencia del Comit Especial,
ORVSRVWRUHV\FRQODSDUWLFLSDFLyQGH1RWDULRR-XH]GH3D]VHJ~QFRUUHVSRQGD
(O-XH]GH3D]SDUWLFLSDUiHQORVDFWRVS~EOLFRVGHSUHVHQWDFLyQGHSURSXHVWDV
y otorgamiento de la buena pro cuando en la localidad en donde se efecten no
KXELHUD1RWDULR3RUORFDOLGDGVHHQWLHQGHHOOXJDURiPELWRJHRJUiFRGRQGHOD
Entidad realiza el acto pblico.
Excepcionalmente y previa sustentacin, la Entidad podr considerar la
SDUWLFLSDFLyQGHXQ-XH]GH3D]HQDTXHOORVVXSXHVWRVHQORVTXHH[LVWLHQGR
Notario, este no puede concurrir al acto debido a que se encuentra de vacaciones,
de licencia o no cuenta con disponibilidad de atencin.
Los actos se llevan a cabo en la fecha y hora sealadas en la convocatoria,
salvo que stos se posterguen, de acuerdo con lo establecido en la Ley y el
presente Reglamento.
En todos los actos de presentacin de propuestas y otorgamiento de la
Buena Pro, se podr contar con la presencia de un representante del Sistema
350RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
109
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Nacional de Control, quien participar como veedor y deber suscribir el acta
correspondiente. La no asistencia del mismo no vicia el proceso.
36
Concordancia: LCE: Artculo 30.

Artculo 65.- Acreditacin de representantes en acto pblico
Las personas naturales concurren personalmente o a travs de su apoderado
debidamente acreditado ante el Comit Especial mediante carta poder simple.
Las personas jurdicas lo hacen por medio de su representante legal o
apoderado. El representante legal acreditar tal condicin con copia simple
del documento registral vigente que consigne dicho cargo y, en el caso del
apoderado, ser acreditado con carta poder simple suscrita por el representante
legal, a la que se adjuntar el documento registral vigente que acredite la
condicin de ste, expedido con una antigedad no mayor de treinta (30) das
a la presentacin de propuestas.
En el caso de consorcios, la propuesta puede ser presentada por el
representante legal comn del consorcio, o por el apoderado designado por ste,
o por el representante legal o apoderado de uno de los integrantes del consorcio
que se encuentre registrado como participante, conforme a lo siguiente:
1. En el caso que el representante legal comn del consorcio presente
la propuesta, ste debe presentar copia simple de la promesa formal
de consorcio.
2. En el caso que el apoderado designado por el representante legal
comn del consorcio presente propuesta, este debe presentar carta
poder simple suscrita por el representante legal comn del consorcio
y copia simple de la promesa formal de consorcio.
3. En el caso del representante legal o apoderado de uno de los
integrantes del consorcio que se encuentre registrado como
participante, la acreditacin se realizar conforme a lo dispuesto por
el primer y segundo prrafo del presente artculo, segn corresponda.
En el caso que el Comit Especial rechace la acreditacin del apoderado,
representante legal, representante legal comn, segn corresponda, y este
exprese su disconformidad, se anotar tal circunstancia en el acta y el Notario
R-XH]GH3D]PDQWHQGUiODSURSXHVWD\ORVGRFXPHQWRVGHDFUHGLWDFLyQHQVX
poder hasta el momento en que el participante formule apelacin.
37
Artculo 66.- Acto pblico de presentacin de propuestas
El acto se inicia cuando el Comit Especial empieza a llamar a los
participantes en el orden en que se registraron para participar en el proceso,
para que entreguen sus propuestas. Si al momento de ser llamado el participante
no se encuentra presente, se le tendr por desistido.
36, 37 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
110
El Comit Especial proceder a abrir los sobres que contienen la propuesta
WpFQLFDGHFDGDSRVWRUDQGHYHULFDUVXDGPLVLELOLGDGSXGLHQGRUHTXHULUOD
VXEVDQDFLyQFRQIRUPHDODUWtFXORGHO5HJODPHQWR
De advertirse que la propuesta no cumple con lo requerido por las Bases o no
se cumpla con la subsanacin en el plazo otorgado, se devolver la propuesta,
tenindola por no admitida, salvo que el postor exprese su disconformidad, en cuyo
FDVRVHDQRWDUiWDOFLUFXQVWDQFLDHQHODFWD\HO1RWDULRR-XH]GH3D]PDQWHQGUi
la propuesta en su poder hasta el momento en que el postor formule apelacin.
6LVHIRUPXODDSHODFLyQVHHVWDUiDORTXHQDOPHQWHVHUHVXHOYDDOUHVSHFWR
6LODV%DVHVKDQSUHYLVWRTXHODHYDOXDFLyQ\FDOLFDFLyQGHODVSURSXHVWDV
WpFQLFDVVHUHDOLFHHQIHFKDSRVWHULRUHO1RWDULRR-XH]GH3D]SURFHGHUiDFRORFDU
los sobres cerrados que contienen las propuestas econmicas dentro de uno o ms
VREUHVORVTXHVHUiQGHELGDPHQWHVHOODGRV\UPDGRVSRUpOSRUORVPLHPEURV
del Comit Especial y por los postores que as lo deseen, conservndolos hasta
la fecha en que el Comit Especial, en acto pblico, comunique verbalmente a
los postores el resultado de la evaluacin de las propuestas tcnicas.
El Comit levantar el acta respectiva, la cual deber ser suscrita por todos
sus miembros, as como por los veedores y los postores que lo deseen.
38
Concordancia: LCE: Artculo 30.
Artculo 67.- Acto privado de presentacin de propuestas
Tratndose de acto privado, los participantes presentarn sus propuestas,
con cargo y en sobre cerrado, en la direccin, en el da y horario sealados en
las Bases, bajo responsabilidad del Comit Especial.
En el caso que la propuesta del postor no fuera admitida, el Comit Especial
incluir el motivo de esa decisin en el acta de los resultados del proceso que
publicar en el SEACE, debiendo devolverse los sobres que contienen la propuesta
tcnica y econmica, una vez consentido el otorgamiento de la Buena Pro.
(QFDVRGHODGHVFDOLFDFLyQGHSURSXHVWDVHO&RPLWp(VSHFLDOLQFOXLUiHO
motivo de esa decisin en el acta de los resultados del proceso que publicar
en el SEACE.
Artculo 68.- Subsanacin de propuestas
Si existieran defectos de forma, tales como errores u omisiones subsanables
HQORVGRFXPHQWRVSUHVHQWDGRVTXHQRPRGLTXHQHODOFDQFHGHODSURSXHVWD
tcnica, el Comit Especial otorgar un plazo entre uno (1) o dos (2) das, salvo
que el defecto pueda corregirse en el mismo acto.
Asimismo, en caso que algn postor haya omitido la presentacin de uno o
ms documentos que acrediten el cumplimiento de los requerimientos tcnicos
mnimos, el Comit Especial podr otorgar un plazo entre uno (1) o dos (2) das
para que el postor subsane dicha omisin, siempre que se trate de documentos
emitidos por autoridad pblica nacional o un privado en ejercicio de funcin
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
111
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
S~EOLFDWDOHVFRPRDXWRUL]DFLRQHVSHUPLVRVWtWXORVFRQVWDQFLDV\RFHUWLFDGRV
que acrediten estar inscrito o integrar un registro, y otros de naturaleza anloga,
para lo cual deben haber sido obtenidos por el postor con anterioridad a la fecha
establecida para la presentacin de propuestas.
El plazo otorgado por el Comit Especial se computar de la siguiente forma:
1. Cuando la presentacin de propuestas se realiza en acto pblico, desde
el da siguiente de efectuado el requerimiento al postor en el mismo acto.
2. Cuando la presentacin de propuestas se realiza en acto privado, desde
HOGtDVLJXLHQWHGHQRWLFDGRHOUHTXHULPLHQWRDOSRVWRUHQHO6($&(
En ambos supuestos, la propuesta continuar vigente para todo efecto, a
condicin de la efectiva enmienda del error o la omisin dentro del plazo previsto.
La presentacin de los documentos a ser subsanados se realiza a travs de
la Unidad de Trmite Documentario de la Entidad, a efectos de evidenciar el
cumplimiento del plazo otorgado por el Comit Especial. Si luego de vencido el
plazo otorgado, no se cumple con la subsanacin, el Comit Especial tendr la
propuesta por no admitida.
No cabe subsanacin alguna por omisiones o errores en la propuesta
econmica, salvo defectos de foliacin y de rbrica de cada uno de los folios que
FRPSRQHQODRIHUWDVLQSHUMXLFLRGHORGLVSXHVWRHQHOLQFLVRGHODUWtFXOR
del Reglamento.
39
CAPTULO VI
CALIFICACIN Y EVALUACIN DE PROPUESTAS
Artculo 69.- Oportunidad para la calificacin y evaluacin de propuestas
(QWRGRVORVSURFHVRVGHVHOHFFLyQODV%DVHVGHEHQGHQLUXQPpWRGRGH
FDOLFDFLyQ\HYDOXDFLyQGHSURSXHVWDVSXGLHQGRHVWDEOHFHUTXHHORWRUJDPLHQWR
de la Buena Pro se realice en acto separado.
En los procesos de seleccin convocados bajo la modalidad de Convenio
Marco, lo establecido en los artculos 70 y 71 se aplicarn cuando corresponda.
/DFDOLFDFLyQGHODVSURSXHVWDVSRGUiVXMHWDUVHH[FOXVLYDPHQWHDOFXPSOLPLHQWR
de los requisitos de admisin establecidos en las Bases, de acuerdo a lo que
seale el respectivo Expediente de Contratacin.
40
Concordancia: LCE: Artculo 31.
Artculo 70.- Procedimiento de calificacin y evaluacin de propuestas
/DFDOLFDFLyQ\HYDOXDFLyQGHODVSURSXHVWDVHVLQWHJUDOUHDOL]iQGRVHHQ
GRVHWDSDV/DSULPHUDHVODWpFQLFDFX\DQDOLGDGHVFDOLFDU\HYDOXDUOD
39 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
112
SURSXHVWDWpFQLFD\ODVHJXQGDHVODHFRQyPLFDFX\RREMHWRHVFDOLFDU\HYDOXDU
el monto de la propuesta.
Las propuestas tcnica y econmica se evalan asignndoles puntajes de
acuerdo a los factores y criterios que se establezcan en las Bases del proceso,
as como a la documentacin que se haya presentado para acreditarlos.
En ningn caso y bajo responsabilidad del Comit Especial y del funcionario
que aprueba las Bases se establecern factores cuyos puntajes se asignen
utilizando criterios subjetivos.
(OSURFHGLPLHQWRJHQHUDOGHFDOLFDFLyQ\HYDOXDFLyQVHUiHOVLJXLHQWH
1. A efecto de la admisin de las propuestas tcnicas, el Comit Especial
YHULFDUiTXHODVRIHUWDVFXPSODQFRQORVUHTXLVLWRVGHDGPLVLyQGHODV
propuestas establecidos en las Bases.
Slo una vez admitidas las propuestas, el Comit Especial aplicar los
factores de evaluacin previstos en las Bases y asignar los puntajes
correspondientes, conforme a los criterios establecidos para cada factor
y a la documentacin sustentatoria presentada por el postor.
Las propuestas que en la evaluacin tcnica alcancen el puntaje
PtQLPRMDGRHQODV%DVHVDFFHGHUiQDODHYDOXDFLyQHFRQyPLFD/DV
SURSXHVWDVWpFQLFDVTXHQRDOFDQFHQGLFKRSXQWDMHVHUiQGHVFDOLFDGDV
en esta etapa.
Los miembros del Comit Especial no tendrn acceso ni evaluarn a
las propuestas econmicas sino hasta que la evaluacin tcnica haya
concluido.
2. A efectos de la admisin de la propuesta econmica, el Comit Especial
YHULFDUiTXHVHHQFXHQWUHGHQWURGHORVWRSHVMDGRVSRUOD/H\\HO
presente Reglamento. Las propuestas que excedan o estn por debajo
GHORVUHIHULGRVWRSHVVHUiQGHVFDOLFDGDV
La evaluacin econmica consistir en asignar el puntaje mximo
establecido a la propuesta econmica de menor monto. Al resto de
propuestas se les asignar un puntaje inversamente proporcional, segn
la siguiente frmula:
Pi = Om x PMPE
Oi
Donde:
i = Propuesta
Pi = Puntaje de la propuesta econmica i
Oi = Propuesta econmica i
Om = Propuesta econmica de monto o precio ms bajo
PMPE = Puntaje mximo de la propuesta econmica
6LODSURSXHVWDHFRQyPLFDLQFOX\HXQDSURSXHVWDGHQDQFLDPLHQWRODSULPHUD
VHHYDOXDUiXWLOL]DQGRHOPpWRGRGHOYDORUSUHVHQWHQHWRGHOXMRQDQFLHURTXH
113
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
FRPSUHQGDORVFRVWRVQDQFLHURV\HOUHSDJRGHODGHXGD6HWRPDUiQHQFXHQWD
WRGRVORVFRVWRVGHOQDQFLDPLHQWRWDOHVFRPRODWDVDGHLQWHUpVFRPLVLRQHV
seguros y otros, as como la contrapartida de la Entidad si fuere el caso.
3DUDHOFiOFXORGHOYDORUSUHVHQWHQHWRGHOXMRQDQFLHURVHDSOLFDUiORGLV-
puesto por la Ley de Endeudamiento del Sector Pblico y la Ley de Equilibrio
Financiero, utilizndose como tasa de descuento, la tasa de inters activa en
moneda nacional o en moneda extranjera, vigente al da anterior a la realizacin
de la evaluacin econmica. La frmula de valor presente es la siguiente:

VP

=
+
=
n
i
n
i
i
I
1
) 1 (
Donde,
VP = Valor Presente.
I = Pagos peridicos por parte de la Entidad.
i = Tasa de inters activa en la moneda correspondiente.
n = Nmero de perodos de pago.
Concordancia: LCE: Artculo 31.

Artculo 71.- Evaluacin de propuestas
La evaluacin de propuestas se sujeta a las siguientes reglas:
1. Etapa de evaluacin tcnica:
a) El Comit Especial evaluar cada propuesta de acuerdo con las
Bases y conforme a una escala que sumar cien (100) puntos.
b) Para acceder a la evaluacin de las propuestas econmicas,
las propuestas tcnicas debern alcanzar el puntaje mnimo de
sesenta (60), salvo en el caso de la contratacin de servicios
y consultora en que el puntaje mnimo ser de ochenta (80).
Las propuestas tcnicas que no alcancen dicho puntaje sern
GHVFDOLFDGDVHQHVWDHWDSD
2. Etapa de evaluacin econmica:
El puntaje de la propuesta econmica se calcular siguiendo las pautas
GHODUWtFXORGRQGHHOSXQWDMHPi[LPRSDUDODSURSXHVWDHFRQyPLFD
ser de cien (100) puntos.
3. Determinacin del puntaje total:
Una vez evaluadas las propuestas tcnica y econmica se proceder
a determinar el puntaje total de las mismas.
7DQWRODHYDOXDFLyQWpFQLFDFRPRODHYDOXDFLyQHFRQyPLFDVHFDOLFDQ
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
114
sobre cien (100) puntos. El puntaje total de la propuesta ser el promedio
ponderado de ambas evaluaciones, obtenido de la aplicacin de la
siguiente frmula:
PTPi = c1PTi + c2PEi
Donde:
PTPi = Puntaje total del postor i
PTi = Puntaje por evaluacin tcnica del postor i
PEi = Puntaje por evaluacin econmica del postor i
F &RHFLHQWHGHSRQGHUDFLyQSDUDODHYDOXDFLyQ
tcnica
F &RHFLHQWHGHSRQGHUDFLyQSDUDODHYDOXDFLyQ
econmica
Los coeficientes de ponderacin debern cumplir las siguientes
condiciones:
D /DVXPDGHDPERVFRHFLHQWHVGHEHUiVHULJXDODODXQLGDG
b) Los valores que se aplicarn en cada caso debern estar
comprendidos dentro de los mrgenes siguientes:
b.1) En todos los casos de contrataciones se aplicar las
siguientes ponderaciones:
0.60 < c1 < 0.70; y
0.30 < c2 < 0.40
b.2) Slo en el caso de servicios de consultora se aplicar las
siguientes ponderaciones:
0.70 < c1 < 0.80; y
0.20 < c2 < 0.30
La propuesta evaluada como la mejor ser la que obtenga el
mayor puntaje total.
4. Para la contratacin de obras que correspondan a Adjudicaciones
Directas Selectivas o Adjudicaciones de Menor Cuanta, la evaluacin se
realizar sobre cien (100) puntos atendiendo nicamente a la propuesta
econmica.
5. En el caso de los procesos de seleccin convocados bajo el sistema
de precios unitarios, tarifas o porcentajes, el Comit Especial deber
YHULFDUODVRSHUDFLRQHVDULWPpWLFDVGHODSURSXHVWDTXHREWXYRHOPD\RU
SXQWDMHWRWDO\GHH[LVWLUDOJXQDLQFRUUHFFLyQGHEHUiFRUUHJLUODDQGH
consignar el monto correcto y asignarle el lugar que le corresponda.
'LFKDFRUUHFFLyQGHEHJXUDUH[SUHVDPHQWHHQHODFWDUHVSHFWLYD
6. Tratndose de la contratacin de obras y servicios que se ejecuten
o presten fuera de la provincia de Lima y Callao, cuyos montos
correspondan a Adjudicacin Directa Selectiva o Adjudicacin de Menor
&XDQWtDDVROLFLWXGGHOSRVWRUVHDVLJQDUiXQDERQLFDFLyQHTXLYDOHQWH
al diez por ciento (10%) sobre la sumatoria de las propuestas tcnica
115
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
y econmica de los postores con domicilio en la provincia donde se
ejecutar la obra o se prestar el servicio objeto del proceso de seleccin
o en las provincias colindantes, sean o no pertenecientes al mismo
departamento o regin. El domicilio ser el consignado en la constancia
de inscripcin ante el RNP.
41
CAPTULO VII
OTORGAMIENTO DE LA BUENA PRO
Artculo 72.- Otorgamiento de la Buena Pro
El otorgamiento de la Buena Pro se realizar en acto pblico para todos los
procesos de seleccin. Sin embargo, tratndose de Adjudicaciones Directas
Selectivas y Adjudicaciones de Menor Cuanta, el otorgamiento de la Buena Pro
podr ser realizado en acto privado.
En la fecha sealada en las Bases, el Comit Especial proceder a otorgar la
Buena Pro a la propuesta ganadora, dando a conocer los resultados del proceso
de seleccin a travs de un cuadro comparativo, en el que se consignar el orden
de prelacin y el puntaje tcnico, econmico y total obtenidos por cada uno de
los postores.
Una vez otorgada la Buena Pro, el Comit Especial est en la obligacin de
permitir el acceso de los postores al Expediente de Contratacin, a ms tardar
dentro del da siguiente de haberse solicitado por escrito.
El acceso a la informacin contenida en un Expediente de Contratacin
se regular por lo establecido en la Ley de Transparencia y Acceso a la
Informacin Pblica y su Reglamento, incluidas las excepciones y limitaciones
al ejercicio del derecho de acceso a la informacin pblica all establecidas
o en los compromisos internacionales asumidos por el Estado Peruano.
Concordancia: LCE: Artculo 30.
Artculo 73.- Solucin en caso de empate
En el supuesto que dos (2) o ms propuestas empaten, el otorgamiento de la
Buena Pro se efectuar observando estrictamente el siguiente orden:
1. En Adjudicaciones Directas y Adjudicaciones de Menor Cuanta, a favor
de las microempresas y pequeas empresas integradas por personas
con discapacidad o a los consorcios conformados en su totalidad por
estas empresas, siempre que acrediten tener tales condiciones de
acuerdo con la normativa de la materia; o
2. En Adjudicaciones Directas y Adjudicaciones de Menor Cuanta, a
favor de las microempresas y pequeas empresas o a los consorcios
conformados en su totalidad por stas, siempre que acrediten tener tal
condicin de acuerdo con la normativa de la materia; o
3. A favor del postor que haya obtenido el mejor puntaje econmico, en
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHIHEUHURGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
116
el caso de bienes u obras; o el mejor puntaje tcnico, tratndose de
servicios; o
4. A prorrata entre los postores ganadores, de acuerdo con el monto de
sus propuestas, siempre que el objeto de la contratacin sea divisible y
DTXHOORVPDQLHVWHQVXYROXQWDGGHFXPSOLUODSDUWHFRUUHVSRQGLHQWHGHO
contrato. Este criterio no ser de aplicacin para el caso de consultora
en general, consultora y ejecucin de obras; o
5. A travs de sorteo en el mismo acto.
Cuando el otorgamiento de la Buena Pro se desarrolle en acto privado, la
aplicacin de los dos ltimos criterios de desempate requiere de la citacin
oportuna a los postores que hayan empatado, pudiendo participar el veedor del
Sistema Nacional de Control.
Artculo 74.- Distribucin de la Buena Pro
En el caso que el resultado del estudio de las posibilidades que ofrece el
mercado hubiere establecido que el requerimiento de la Entidad no puede ser
cubierto por un solo proveedor, las Bases debern prever la posibilidad de distribuir
la Buena Pro.
El Comit Especial otorgar la Buena Pro al postor que hubiera obtenido el
mejor puntaje total, en los trminos de su propuesta y por la cantidad que hubiese
ofertado. El saldo del requerimiento no atendido por el postor ganador ser
otorgado a los postores que le sigan, respetando el orden de prelacin, siempre
que las propuestas econmicas presentadas no sean superiores al cinco por
ciento (5%) de aquella del postor ganador.
En caso que las propuestas econmicas superen dicho lmite, para efectos de
otorgarse la Buena Pro, los postores tendrn la opcin de reducir su propuesta
para adecuarse a la condicin establecida en el prrafo anterior.
Concordancia: RLCE: Artculo 12.
Artculo 75.- Notificacin del otorgamiento de la Buena Pro
(ORWRUJDPLHQWRGHOD%XHQD3URHQDFWRS~EOLFRVHSUHVXPLUiQRWLFDGRD
todos los postores en la misma fecha, oportunidad en la que se entregar a los
postores copia del acta de otorgamiento de la Buena Pro y el cuadro comparativo,
detallando los resultados en cada factor de evaluacin. Dicha presuncin no admite
prueba en contrario. Esta informacin se publicar el mismo da en el SEACE.
El otorgamiento de la Buena Pro en acto privado se publicar y se entender
QRWLFDGRDWUDYpVGHO6($&(HOPLVPRGtDGHVXUHDOL]DFLyQEDMRUHVSRQVDELOLGDG
del Comit Especial u rgano encargado de conducir el proceso, debiendo incluir
el acta de otorgamiento de la Buena Pro y el cuadro comparativo, detallando los
UHVXOWDGRVHQFDGDIDFWRUGHHYDOXDFLyQ$GLFLRQDOPHQWHVHSRGUiQRWLFDUDORV
correos electrnicos de los postores, de ser el caso.
Concordancia: LCE: Artculo 30.
117
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 76.- Otorgamiento de la Buena Pro a propuestas que excedan el
valor referencial
(QHOFDVRSUHYLVWRHQHODUWtFXORGHOD/H\SDUDTXHHO&RPLWp(VSHFLDO
otorgue la Buena Pro a propuestas que superen el valor referencial en procesos
de seleccin para la ejecucin de obras, hasta el lmite mximo previsto en dicho
DUWtFXORVHGHEHUiFRQWDUFRQODDVLJQDFLyQVXFLHQWHGHFUpGLWRVSUHVXSXHVWDULRV
y la aprobacin del Titular de la Entidad, salvo que el postor que hubiera obtenido
el mejor puntaje total acepte reducir su oferta econmica a un monto igual o menor
al valor referencial. En los procesos realizados en acto pblico, la aceptacin
deber efectuarse en dicho acto; en los procesos en acto privado la aceptacin
constar en documento escrito.
El plazo para otorgar la Buena Pro no exceder de diez (10) das hbiles,
contados desde la fecha prevista en el calendario para el otorgamiento de la
Buena Pro, bajo responsabilidad del Titular de la Entidad.
Concordancia: LCE: Artculo 33.
Artculo 77.- Consentimiento del otorgamiento de la Buena Pro
Cuando se hayan presentado dos (2) o ms propuestas, el consentimiento
GHOD%XHQD3URVHSURGXFLUiDORVRFKRGtDVKiELOHVGHODQRWLFDFLyQGHVX
otorgamiento, sin que los postores hayan ejercido el derecho de interponer el
recurso de apelacin. En el caso de Adjudicaciones Directas y de Adjudicaciones
de Menor Cuanta, el plazo ser de cinco (5) das hbiles. Para constatar que la
Buena Pro qued consentida, en el caso que corresponda interponer recurso de
DSHODFLyQDQWHHO7ULEXQDOOD(QWLGDGGHEHUiYHULFDUHQHOGHWDOOHGHOSURFHVR
de seleccin registrado en el SEACE, si se interpuso el respectivo recurso
impugnativo.
En caso que se haya presentado una sola oferta, el consentimiento de la Buena
3URVHSURGXFLUiHOPLVPRGtDGHODQRWLFDFLyQGHVXRWRUJDPLHQWR
Una vez consentido el otorgamiento de la Buena Pro, el Comit Especial
remitir el Expediente de Contratacin al rgano encargado de las contrataciones
de la Entidad, el que asumir competencia desde ese momento para ejecutar los
actos destinados a la formalizacin del contrato.
El consentimiento del otorgamiento de la Buena Pro deber ser publicado en
el SEACE al da siguiente de producido.
Artculo 78.- Declaracin de Desierto
El proceso de seleccin ser declarado desierto cuando no quede ninguna
propuesta vlida. En caso no se haya registrado ningn participante, dicha
declaracin podr efectuarse culminada la etapa de Registro de Participantes.
La publicacin sobre la declaratoria de desierto de un proceso de seleccin
deber registrarse en el SEACE, dentro del da siguiente de producida.
Cuando un proceso de seleccin es declarado desierto total o parcialmente, el
Comit Especial o el rgano encargado de las contrataciones, segn corresponda,
deber emitir informe al Titular de la Entidad o al funcionario a quien haya delegado
ODIDFXOWDGGHDSUREDFLyQGHO([SHGLHQWHGH&RQWUDWDFLyQHQHOTXHMXVWLTXH\
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
118
evale las causas que no permitieron la conclusin del proceso, debindose
adoptar las medidas correctivas antes de convocar nuevamente.
En caso el motivo de declaratoria de desierto est referido al valor referencial o
a las caractersticas del objeto contractual, el Comit Especial solicitar informacin
al rgano encargado de las contrataciones o al rea usuaria, segn corresponda.
La siguiente convocatoria se realizar mediante un proceso de Adjudicacin
de Menor Cuanta Derivada, que no se podr realizar en forma electrnica.
42
Concordancia: LCE: Artculo 32.
RLCE: Artculo 10.
Artculo 79.- Cancelacin del Proceso de Seleccin
Cuando la Entidad decida cancelar total o parcialmente un proceso de
seleccin, por causal debidamente motivada de acuerdo a lo establecido en el
DUWtFXORGHOD/H\GHEHFRPXQLFDUVXGHFLVLyQGHQWURGHOGtDVLJXLHQWH\SRU
escrito al Comit Especial, debiendo registrarse en el SEACE la resolucin o
acuerdo cancelatorio al da siguiente de esta comunicacin y, de ser el caso, al
correo electrnico sealado por los participantes.
La resolucin o acuerdo que formaliza la cancelacin deber ser emitida
por el funcionario que aprob el Expediente de Contratacin u otro de igual o
superior nivel.
En este caso, el plazo para el reintegro del pago efectuado como derecho
de participacin no podr exceder de los cinco (5) das hbiles posteriores a
OD QRWLFDFLyQ GH OD FDQFHODFLyQ VLHQGR VXFLHQWH SDUD OD GHYROXFLyQ OD VROD
presentacin del comprobante de pago.
Concordancia: LCE: Artculo 34.
CAPITULO VIII
COMPRAS CORPORATIVAS
Artculo 80.- Caractersticas del proceso de Compra Corporativa
Las Entidades podrn contratar bienes y servicios en forma conjunta, a travs
GHXQSURFHVRGHVHOHFFLyQ~QLFRDSURYHFKDQGRORVEHQHFLRVGHODVHFRQR-
mas de escala, en las mejores y ms ventajosas condiciones para el Estado.
Las Compras Corporativas podrn ser facultativas, para lo cual las Entidades
celebrarn un convenio interinstitucional, u obligatorias, cuando se establezca
por Decreto Supremo emitido por el Ministerio de Economa y Finanzas, con el
voto aprobatorio del Consejo de Ministros.
Los bienes y servicios que pueden ser objeto de Compras Corporativas
deben ser susceptibles de ser homogenizados.
Para la agregacin de la demanda de las Entidades se podr utilizar criterios
WDOHVFRPRHOJHRJUiFRHOVHFWRULDOHOWHPSRUDORODFRPELQDFLyQGHpVWRV
entre otros.
42 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
119
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
El proceso de seleccin se realizar conforme a las reglas establecidas en
la Ley y el presente Reglamento.
Concordancia: LCE: Artculo 15.
Artculo 81.- Alcances del encargo en el caso de Compras Corporativas
El encargo que se efecte en las Compras Corporativas slo alcanza las
acciones necesarias que permitan a la Entidad encargada realizar el proceso de
seleccin para obtener, de parte de los proveedores del Estado, una oferta por
el conjunto de los requerimientos similares de las Entidades participantes, y slo
hasta el momento en el que se determine al proveedor seleccionado y la Buena
Pro quede consentida, luego de lo cual, cada una de las Entidades suscribir
los contratos correspondientes con el proveedor o proveedores seleccionados
por el o los requerimientos que hubiesen sido encargados.
Una vez consentida la Buena Pro, la Entidad encargada deber comunicar
a las Entidades participantes los resultados del proceso, dentro de un plazo no
mayor de tres (3) das hbiles. El plazo del procedimiento para la suscripcin
del contrato previsto en el presente Reglamento se computar a partir del da
siguiente de recibida la indicada comunicacin.
Del mismo modo, el encargo efectuado no podr, en ningn caso, ser
interpretado como extensivo a la ejecucin de las obligaciones y/o prestaciones
que se generan en la fase de ejecucin contractual propiamente dicha, tales
como el pago del precio, la supervisin de la ejecucin de las prestaciones,
la liquidacin de contrato y dems prestaciones inherentes a las Entidades
participantes.
Artculo 82.- Compras Corporativas Obligatorias y entidad a cargo
Mediante Decreto Supremo del Ministerio de Economa y Finanzas, con el
voto aprobatorio del Consejo de Ministros, se establecern los bienes y servicios
que se contratarn mediante Compras Corporativas Obligatorias, as como las
Entidades participantes y tcnicas.
La Central de Compras Pblicas - PERU COMPRAS es la Entidad encargada
de realizar las Compras Corporativas Obligatorias, de acuerdo a lo establecido
HQHO'HFUHWR/HJLVODWLYR1\DVXVQRUPDVGHRUJDQL]DFLyQ\IXQFLRQHV
La Central de Compras Pblicas - PERU COMPRAS se encargar de
consolidar los requerimientos de las Entidades participantes, para cuyo efecto
determinar el contenido, cantidad y oportunidad de remisin de la informacin
que debern proporcionar las mismas.
La Central de Compras Pblicas - PERU COMPRAS se encuentra obligada
a remitir informacin que, para el cumplimiento de sus funciones de supervisin,
le solicite el OSCE.
Artculo 83.- Entidades participantes y entidad tcnica
Se consideran Entidades participantes aquellas que estn obligadas a
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
120
contratar los bienes y servicios contenidos en sus respectivos Planes Anuales
de Contratacin, mediante Compra Corporativa Obligatoria.
Designadas las Entidades participantes, stas tendrn la obligacin de
homogenizar y consolidar los requerimientos de todas sus unidades orgnicas y
remitirlas a la Central de Compras Pblicas - PERU COMPRAS dentro del plazo
TXHpVWDMHEDMRUHVSRQVDELOLGDG
Las Entidades participantes se encuentran obligadas a contratar directa y
exclusivamente con los proveedores seleccionados, los bienes y/o servicios cuyo
requerimiento haya sido materia del proceso de Compra Corporativa Obligatoria.
Asimismo, se encuentran obligadas a suscribir todos los documentos que
resulten necesarios para la formalizacin del o los contratos que se deriven del
o los procesos de seleccin, pagar al proveedor o proveedores seleccionados la
contraprestacin acordada, previa conformidad con la prestacin ejecutada, as
como los dems actos relacionados con la ejecucin del contrato.
La Entidad Tcnica de la Compra Corporativa es la que determina las
caractersticas homogenizadas de los bienes y servicios requeridos por las
Entidades participantes, teniendo como base la consolidacin remitida por la
Central de Compras Pblicas - PERU COMPRAS.
Artculo 84.- Sustento presupuestal
En el caso que la consolidacin y/o agregacin de la cantidad total de
UHTXHULPLHQWRVGHELHQHV\RVHUYLFLRVVHUHDOLFHGXUDQWHXQSHUtRGRVFDOSDUD
ODDWHQFLyQGHUHTXHULPLHQWRVSDUDHOVLJXLHQWHDxRVFDOOD&HQWUDOGH&RPSUDV
Pblicas - PER COMPRAS requerir a cada Entidad participante en la Compra
Corporativa Obligatoria, que gestione la disponibilidad de crditos presupuestarios
DQWHVXUHVSHFWLYD2FLQDGH3UHVXSXHVWRRODTXHKDJDVXVYHFHVWRPDQGR
como referencia el proyecto de Ley de Presupuesto del Sector Pblico para el Ao
Fiscal siguiente que el Poder Ejecutivo haya remitido al Congreso de la Repblica,
GHFRQIRUPLGDGFRQORGLVSXHVWRHQHODUWtFXORGHOD&RQVWLWXFLyQ3ROtWLFD\
que le remita dicha informacin.
$VLPLVPRODV(QWLGDGHVSDUWLFLSDQWHVQRSRGUiQHIHFWXDUPRGLFDFLyQDOJXQDHQ
sus marcos presupuestales que pueda afectar el cumplimiento de las obligaciones
que se deriven de la suscripcin y ejecucin de los contratos que se celebren
luego de efectuada la Compra Corporativa, salvo los casos de desabastecimiento
inminente o situacin de emergencia previstos en la normativa.
Artculo 85.- Compras Corporativas Facultativas
Para las Compras Corporativas que se realicen de manera facultativa,
se deber elaborar un convenio que deber ser suscrito por los funcionarios
competentes de todas las Entidades participantes, en el que se establezca el
objeto y alcances del mismo, las obligaciones y responsabilidades de las partes,
as como la designacin de la Entidad encargada de la compra corporativa.
La Entidad encargada de la Compra Corporativa tendr a su cargo las
121
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
siguientes tareas:
a) Recibir los requerimientos de las Entidades participantes;
b) Consolidar y homogenizar las caractersticas de los bienes y servicios,
as como determinar el valor referencial para cada proceso de seleccin
a convocarse en forma conjunta;
c) Efectuar todos aquellos actos previos y necesarios para conformar y
aprobar el Expediente de Contratacin;
d) Designar al o a los Comits Especiales que tendrn a su cargo los
procesos de seleccin para las compras corporativas;
e) Aprobar las Bases;
f) Resolver los recursos de apelacin, en los casos que corresponda.
El funcionamiento, competencia, obligaciones y dems atribuciones del Comit
Especial son las previstas en la Ley y el presente Reglamento, teniendo a su cargo:
a) Elaborar las Bases, conforme al contenido del Expediente de
Contratacin. En las Bases deber distinguirse claramente el
requerimiento de cada Entidad participante del convenio, para los efectos
de la suscripcin y ejecucin del contrato respectivo.
b) Una vez que quede consentido el otorgamiento de la Buena Pro, elevar el
expediente al Titular de la Entidad encargada de la Compra Corporativa
para su remisin a las Entidades participantes.
Las Entidades participantes se encuentran obligadas a contratar directa y
exclusivamente con los proveedores seleccionados los bienes y/o servicios cuyo
requerimiento haya sido materia del proceso de Compra Corporativa, conforme al
procedimiento establecido en el presente Reglamento. Asimismo, se encuentran
obligadas a suscribir todos los documentos que resulten necesarios para la
formalizacin del o los contratos que se deriven del o los procesos de seleccin,
as como a pagar al proveedor o proveedores seleccionados la contraprestacin
acordada, previa conformidad con la prestacin ejecutada.
/DV&RPSUDV&RUSRUDWLYDVQRUHTXLHUHQGHODPRGLFDFLyQGHO3ODQ$QXDOGH
Contrataciones de las Entidades participantes, aunque debe indicarse que se
proceder a contratar mediante Compra Corporativa Facultativa, con expresa
mencin de la Entidad encargada de la Compra Corporativa.
La Entidad encargada de la Compra Corporativa y el o los Comits Especiales
TXH VH GHVLJQHQ SDUD WDO Q GHEHUiQ REVHUYDU OR GLVSXHVWR HQ OD /H\ HO
Reglamento y dems disposiciones complementarias.
En caso que se desee complementar o incorporar requerimientos adicionales a
los previstos en el convenio, las Entidades participantes podrn hacerlo mediante
la suscripcin de clusulas adicionales.
El convenio permitir la adhesin de cualquier otra Entidad siempre y cuando
esta se efecte antes de la convocatoria.
Los contratos derivados de la Compra Corporativa, as como la informacin
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
122
referida a su ejecucin debern ser ingresados al SEACE, por cada una de las
Entidades participantes, en un plazo no mayor de diez (10) das hbiles siguientes
a su perfeccionamiento, ocurrencia o aprobacin, segn corresponda.
Artculo 85 A.- Otras compras corporativas
43
Las Entidades del Gobierno Nacional que formulen las polticas nacionales
y/o sectoriales del Estado estn facultadas a establecer, mediante Resolucin del
Titular de la Entidad, la relacin de bienes y servicios que se contratarn a travs
de compra corporativa, debiendo sealar la Entidad encargada de la compra
corporativa, las Entidades participantes, as como las obligaciones y responsa-
bilidades de estas ltimas.
Una copia del Informe tcnico y legal que acompaa la Resolucin del Titular
de la Entidad ser remitida al Ministerio de Economa y Finanzas y al OSCE en
un plazo no mayor a cinco (5) das hbiles a su emisin.
Los bienes y servicios que se contraten a travs de la compra corporativa
sern aquellos que sean necesarios para la ejecucin de las polticas nacionales
y/o sectoriales que tengan a su cargo las Entidades del Gobierno Nacional.
Las funciones de las Entidades participantes, de la Entidad encargada, as
como las del Comit Especial que sta designe, sern las establecidas en el
Artculo 85.
CAPTULO IX
SELECCIN POR ENCARGO
Artculo 86.- Caractersticas del Proceso de Seleccin por Encargo
Por razones econmicas o de especialidad en el objeto de la convocatoria, una
Entidad podr encargar a otra Entidad pblica o privada, nacional o internacional u
organismos internacionales, mediante convenio interinstitucional, la realizacin del
proceso de seleccin que aqulla requiera para la contratacin de bienes, servicios
y obras, previo informe tcnico legal que sustente la necesidad y viabilidad del
Encargo, el mismo que ser aprobado por el Titular de la Entidad.
La aprobacin del Expediente de Contratacin y de las Bases ser competencia
de la Entidad encargante.
Concordancia: LCE: Artculo 6.
RLCE: Octava Disposicin Complementaria Transitoria.
Artculo 87.- Encargo a una Entidad Pblica
1. La Entidad pblica encargada designar a un Comit Especial que,
adems de conducir el proceso de seleccin, elaborar las Bases,
43 Artculo incluido de conformidad con el Decreto Supremo N 046-2011-EF, publicado el 25
de marzo de 2011
123
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
las mismas que deben ser aprobadas por el funcionario responsable
de la Entidad encargante. Una vez que ha quedado consentido o
DGPLQLVWUDWLYDPHQWH UPH HO RWRUJDPLHQWR GH OD %XHQD 3UR GHEHUi
remitirse el expediente a la Entidad encargante para la suscripcin
y ejecucin del contrato respectivo. La designacin, conformacin y
funcionamiento del Comit Especial se sujetar a lo estipulado en este
Reglamento, en lo que le sea aplicable.
2. En caso de presentarse recurso de apelacin, el mismo ser resuelto por
el Titular de la Entidad encargada o por el Tribunal, segn corresponda.
Artculo 88.- Encargo a una Entidad Privada, nacional o internacional
1. La Entidad encargada ser seleccionada, mediante el proceso de
seleccin que corresponda, teniendo en cuenta el objeto y la cuanta de
la comisin, conforme a lo dispuesto en la Ley y el presente Reglamento.
La decisin de encargar la contratacin corresponde al Titular de la
Entidad, siendo esta facultad indelegable.
2. Las Entidades participantes debern acreditar una experiencia de
contratacin pblica o privada, no menor a dos (2) aos en el mercado
nacional o internacional, en bienes, servicios u obras, segn corresponda
al requerimiento de la Entidad encargante. Asimismo, debern estar
inscritas en el RNP y no encontrarse impedidas para contratar con el
Estado.
3. La Entidad encargada celebrar un convenio con la Entidad encargante,
el que deber ser especfico y concreto para cada proceso de
contratacin encargado. Cada convenio detallar las obligaciones
y responsabilidades de cada una de las partes. La solucin de
controversias derivadas del convenio se realizar por conciliacin o
arbitraje.
4. Los procesos de contratacin que realicen las Entidades encargadas
se sujetarn a lo dispuesto en la Ley y el presente Reglamento. De
interponerse un recurso de apelacin, ste ser resuelto por la Entidad
encargante o por el Tribunal, segn corresponda.
El OSCE establecer mediante directiva un Convenio Modelo, que ser
empleado obligatoriamente para realizar procesos por encargo a Entidades
Privadas nacionales o internacionales; as como otros requerimientos necesarios
y aspectos complementarios para la participacin de las Entidades Privadas
nacionales o internacionales en el proceso de seleccin por Encargo.
44
Artculo 89.- Encargo a Organismos Internacionales
1. Los convenios de encargo se aprueban para el caso de las Entidades del
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHIHEUHURGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
124
Gobierno Nacional y los Organismos Constitucionalmente Autnomos,
mediante resolucin de su Titular.
En el caso de los Gobiernos Regionales y Locales, los convenios se
aprueban mediante Acuerdo del Consejo Regional o Municipal, respec-
tivamente.
2. Para adoptar la decisin de encargo y para designar el organismo
internacional se debe contar previamente con:
D ,QIRUPHIDYRUDEOHGHOD2FLQDGH3UHVXSXHVWRRODTXHKDJDVXV
YHFHVVREUHODGLVSRQLELOLGDGGHORVUHFXUVRVSDUDHOQDQFLDPLHQWR
de la contratacin objeto del encargo.
E ,QIRUPHGHOD2FLQDGH$GPLQLVWUDFLyQRODTXHKDJDVXVYHFHV
VREUHODVYHQWDMDV\EHQHFLRVGHODFRQFHUWDFLyQGHOFRQYHQLR
3. Los organismos o instituciones internacionales con los cuales las
Entidades suscriban los referidos convenios debern encontrarse
acreditadas en el Per de acuerdo con las normas sobre la materia,
debiendo presentar a la Entidad el documento correspondiente.
4. La Entidad encargante celebrar un convenio con el organismo encar-
JDGRHOTXHGHEHUiVHUHVSHFtFR\FRQFUHWRSDUDFDGDSURFHVRGH
contratacin encargado. Cada convenio detallar las obligaciones y
responsabilidades de cada una de las partes.
5. Los convenios contendrn los siguientes aspectos:
a) El compromiso por parte del organismo internacional de que los
procesos se sujetarn a normas uniformes aplicables a nivel in-
ternacional y que cumplan los principios establecidos en la Ley de
Contrataciones del Estado.
b) El compromiso del organismo internacional de llevar a cabo procesos
de capacitacin en materia de compras al personal que la Entidad
designe.
c) Obligacin por parte de la Entidad de incluir las contrataciones en el
Plan Anual de Contrataciones, as como de registrar en el SEACE, di-
rectamente o a travs del organismo internacional, la convocatoria de
los procesos de contratacin que realice el organismo internacional
encargado, el resultado de los mismos, los proveedores adjudicados,
los montos y contratos celebrados.
d) Provisin de informacin peridica al Ministerio de Economa y Fi-
nanzas, Contralora General de la Repblica y al OSCE, respecto de
la ejecucin del encargo, sin perjuicio de aquella que sea solicitada
por estas entidades.
45
45 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
125
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
CAPTULO X
SUBASTA INVERSA
Artculo 90.- Definicin y aplicacin
La Subasta Inversa es la modalidad de seleccin por la cual una Entidad
realiza la contratacin de bienes y servicios comunes a travs de una convocatoria
pblica, y en la cual el postor ganador ser aquel que oferte el menor precio por
los bienes o servicios objeto de la convocatoria. Esta modalidad de seleccin
puede realizarse de manera presencial o electrnica.
Se consideran bienes o servicios comunes, aquellos respecto de los cuales
existe ms de un proveedor, tienen patrones de calidad y de desempeo
REMHWLYDPHQWH GHQLGRV SRU FDUDFWHUtVWLFDV R HVSHFLFDFLRQHV XVXDOHV HQ HO
mercado o han sido estandarizados como consecuencia de un proceso de
homogenizacin llevado a cabo al interior del Estado, de tal manera que el factor
diferenciador entre ellos lo constituye el precio al cual se transan.
(O26&(DSUREDUiODVFKDVWpFQLFDVGHORVELHQHV\VHUYLFLRVWUDQVDEOHV
que puedan contratarse bajo esta modalidad, observando las normas tcnicas,
PHWUROyJLFDV\RVDQLWDULDVDVtFRPRODQRUPDWLYDDSOLFDEOH'LFKDVFKDVWpFQLFDV
sern incluidas en el Listado de Bienes y Servicios Comunes publicado en el
SEACE, debiendo ser revisadas permanentemente por el OSCE, pudiendo ser
REMHWRGHPRGLFDFLyQRH[FOXVLyQSUHYLRVXVWHQWRWpFQLFROHJDO
La Subasta Inversa Presencial se realiza en acto pblico por medio de
propuestas de precios escritos y lances verbales. La Subasta Inversa Electrnica
se realiza a travs del SEACE.
Concordancia: LCE: Artculo 15.
Artculo 91.- Uso de la modalidad de Subasta Inversa
La contratacin de un bien o servicio que se encuentra incluido en el Listado
de Bienes y Servicios Comunes resulta obligatoria utilizando la modalidad de
Subasta Inversa, a partir de los treinta (30) das calendario desde la publicacin
GH ODV FKDV WpFQLFDV UHVSHFWLYDV HQ HO 6($&( VLHPSUH TXH GLFKR ELHQ R
servicio no se encuentre incluido en el Catlogo de Convenios Marco, en cuyo
caso deber adquirirlo empleando tal modalidad. Antes del cumplimiento de
dicho plazo, la utilizacin de la modalidad de Subasta Inversa es facultativa.
Las Entidades podrn convocar un proceso de seleccin tradicional, en caso
de la existencia de condiciones ms ventajosas que sean objetivas, demostrables
y sustanciales para la Entidad, para lo cual debern obtener la autorizacin del
OSCE, antes de efectuar la contratacin. En el caso que el valor referencial de
la contratacin de bienes o servicios comunes corresponda a una Adjudicacin
de Menor Cuanta, ser potestad de la Entidad utilizar la modalidad de Subasta
Inversa, en cuyo caso deber realizarse de manera electrnica.
(QFDVRTXHFRQDQWHULRULGDGDODSXEOLFDFLyQGHODVFKDVWpFQLFDVODV
Entidades hayan convocado un proceso de seleccin sobre los mismos bienes
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
126
y servicios, debern continuar con dicho proceso. En caso que el proceso de
seleccin convocado sea declarado desierto, la convocatoria ulterior deber
efectuarse por Subasta Inversa.
Si un proceso de seleccin sujeto a la modalidad de Subasta Inversa es
declarado desierto, la siguiente convocatoria se realizar bajo dicha modalidad,
VDOYRTXHVHKD\DH[FOXLGRODFKDWpFQLFDREMHWRGHOSURFHVRHQFX\RFDVR
la contratacin ulterior deber efectuarse por un proceso de Adjudicacin de
Menor Cuanta no sujeto a esta modalidad.
Artculo 92.- Convocatoria y desarrollo del Proceso
La conformacin y actuacin del Comit Especial se sujeta a las reglas
previstas en el presente Reglamento, con las particularidades que se establezcan
en el presente Captulo.
/DV %DVHV GHEHUiQ FRQWHQHU OD FRQYRFDWRULD OD FKD WpFQLFD GHO ELHQ R
servicio requerido, la misma que se obtendr del Listado de Bienes o Servicios
Comunes publicado en el SEACE, la proforma del contrato, los plazos, la forma,
el lugar y las dems condiciones para el cumplimiento de la prestacin, siguiendo
ORHVWDEOHFLGRHQHODUWtFXORGHOD/H\HQORTXHUHVXOWHDSOLFDEOHHQWUHRWUDV
condiciones mnimas que establezca el OSCE a travs de directivas.
La Subasta Inversa puede ser presencial o electrnica.
Cualquiera que sea el tipo de proceso de seleccin, la convocatoria ser
efectuada a travs de su publicacin en el SEACE, oportunidad en la que deber
publicarse las Bases y, cuando corresponda, un resumen ejecutivo del estudio
de posibilidades que ofrece el mercado, bajo sancin de nulidad de todos los
actos desarrollados con posterioridad.
La descripcin del objeto de la contratacin deber estar acompaada
GHO FyGLJR UHVSHFWLYR GH DFXHUGR D OD FODVLFDFLyQ DGRSWDGD SRU HO /LVWDGR
correspondiente.
La utilizacin de la modalidad de seleccin por Subasta Inversa no exime
a la Entidad del cumplimiento de las disposiciones referidas a las fases de
Programacin y Actos Preparatorios y de Ejecucin Contractual, salvo las
particularidades expresamente sealadas en el presente Captulo.
Concordancia: LCE: Artculos 24 y 26.
RLCE: Artculos 27 al 34.
Artculo 93.- Presuncin de cumplimiento
Se presume que los bienes y/o servicios ofertados cumplen con las
FDUDFWHUtVWLFDVH[LJLGDVHQODVFKDVWpFQLFDV\FRQODVFRQGLFLRQHVSUHYLVWDVHQ
las Bases. Esta presuncin no admite prueba en contrario.
Artculo 94.- Recurso de apelacin
Las discrepancias que surjan desde la convocatoria hasta la celebracin del
127
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
contrato inclusive, podrn dar lugar a la interposicin del recurso de apelacin ante
el Titular de la Entidad o el Tribunal, segn corresponda, debiendo cumplirse los
requisitos y garantas establecidos en la Ley y el presente Reglamento.
El Titular de la Entidad o el Tribunal, debern resolver dentro del trmino no
mayor de diez (10) das hbiles de admitido el recurso, salvo que hubiese requerido
informacin adicional, en cuyo caso deber pronunciarse dentro del trmino de
quince (15) das hbiles.
Concordancia: LCE: Artculo 53.
RLCE: Artculos 104 al 126.
Artculo 95.- Particularidades de la Subasta Inversa Presencial
Cualquiera sea el tipo de proceso de seleccin convocado, el registro de
participantes se realizar desde el da siguiente de publicada la convocatoria
en el SEACE, hasta un da (1) antes de la fecha prevista para el acto pblico de
presentacin de propuestas, puja y otorgamiento de la Buena Pro.
En el caso de Licitaciones Pblicas y Concursos Pblicos, el plazo entre la
convocatoria y la presentacin de propuestas no ser menor a ocho (8) das
hbiles. En las Adjudicaciones Directas, dicho plazo no ser menor a cinco (5)
das hbiles. En esta modalidad de seleccin no se considerarn las etapas de
consulta ni de observaciones a las Bases.
En el da, hora y lugar indicados se realizar el acto pblico para la presentacin
de propuestas, puja y otorgamiento de la Buena Pro, en presencia de Notario o
-XH]GH3D]VLHVTXHHQODORFDOLGDGQRKXELHUDDFFHVRDOSULPHUR
Las personas naturales concurren personalmente o a travs de su apoderado
debidamente acreditado ante el Comit Especial mediante carta poder simple.
Las personas jurdicas lo hacen por medio de su representante legal o
apoderado. El representante legal acreditar tal condicin con copia simple del
documento registral vigente que consigne dicho cargo y, en el caso del apoderado,
ser acreditado con carta poder simple suscrita por el representante legal, a la
que se adjuntar el documento registral vigente que acredite la condicin de ste.
En ambos casos, en la carta poder debe establecerse la representacin
para formular propuestas, efectuar lances y para ejercer todos los dems actos
inherentes a la Subasta Inversa durante el acto pblico.
El Comit Especial llamar a todos los participantes en el orden en que se
KXELHUHQLQVFULWRFRQODQDOLGDGTXHSUHVHQWHQVXVGRVVREUHVGHORVFXDOHV
el primero, denominado sobre de habilitacin, contendr la documentacin que
acredite que el postor se encuentra habilitado para participar en el proceso de
seleccin y cumple con el objeto de la contratacin, y el segundo su propuesta
econmica.
Se entender que la Buena Pro ha quedado consentida el da de su
otorgamiento, si otorgada la Buena Pro del proceso o del tem, de ser el caso,
ningn postor hubiera dejado constar en el acta su intencin de impugnar el
proceso.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
128
En caso de empate el otorgamiento de la Buena Pro se efectuar a travs de
sorteo en el mismo acto.
3DUDRWRUJDUOD%XHQD3URHO&RPLWp(VSHFLDOYHULFDUiTXHSRUORPHQRV
haya dos (2) propuestas vlidas, caso contrario el proceso se declarar desierto.
El recurso de apelacin contra los actos producidos durante el acto pblico de
presentacin de propuestas, puja y otorgamiento de la Buena Pro, y contra los
actos que afecten su validez, deber ser interpuesto por los postores dentro de los
ocho (8) das hbiles siguientes de dicho acto pblico, en el caso de Licitaciones
Pblicas y Concursos Pblicos, y cinco (5) das hbiles siguientes de dicho acto
pblico en el caso de Adjudicaciones Directas.
En el caso de procesos de seleccin segn relacin de tems, el plazo indicado
en el prrafo anterior se contar a partir de la culminacin del acto pblico de
otorgamiento de la Buena Pro de la totalidad de los tems.
Para los actos posteriores al otorgamiento de la Buena Pro, el recurso de
apelacin deber interponerse dentro de los ocho (8) das hbiles siguientes de
haberse tomado conocimiento del acto que se desea impugnar, en el caso de
Licitaciones Pblicas y Concursos Pblicos, y cinco (5) das hbiles siguientes
en el caso de Adjudicaciones Directas.
Artculo 96.- Particularidades de la Subasta Inversa Electrnica
La convocatoria, el registro de participantes, el registro y presentacin de
propuestas, la apertura de propuestas y el periodo de lances, as como el
otorgamiento de la buena pro se efectuarn y difundirn a travs del SEACE.
Cualquiera sea el tipo de proceso de seleccin convocado, el registro de
participantes, registro y presentacin de propuestas se realizar desde el da
siguiente de publicada la convocatoria en el SEACE hasta la fecha y hora
sealadas en el calendario para tales efectos y se efectuar a travs del SEACE,
de acuerdo al procedimiento establecido por el OSCE.
En los procesos de seleccin que correspondan a Licitaciones Pblicas y
Concursos Pblicos, la etapa de registro de participantes, registro y presentacin
de propuestas no podr tener un plazo menor a ocho (8) das hbiles. En los
procesos de Adjudicaciones Directas, dicho plazo no podr ser menor a cinco (5)
das hbiles. En los procesos de seleccin de Adjudicaciones de Menor cuanta,
el plazo no podr ser menor a dos (2) das hbiles.
La apertura de propuestas y perodo de lances se realizar a travs del SEACE,
de acuerdo al procedimiento establecido por el OSCE.
Una vez culminada la etapa de apertura de propuestas y perodo de lances, el
sistema registrar los resultados y el orden de prelacin de los postores, generando
y publicando el acta electrnica con el detalle del desarrollo de dicha etapa.
(O&RPLWp(VSHFLDOYHULFDUiTXHHOSRVWRUTXHKD\DREWHQLGRHOSULPHUOXJDUHQ
el orden de prelacin, haya presentado la documentacin exigida por las Bases;
HQFDVRFRQWUDULRSURFHGHUiDGHVFDOLFDUOR\HYDOXDUiODGRFXPHQWDFLyQGHO
siguiente postor en estricto orden de prelacin, y as de manera sucesiva. Para
129
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
RWRUJDUOD%XHQD3URHO&RPLWp(VSHFLDOYHULFDUiTXHSRUORPHQRVKD\DGRV
propuestas vlidas, caso contrario el proceso se declarar desierto.
Se entender que la Buena Pro ha quedado consentida, si dentro de los ocho
(8) das hbiles siguientes de la publicacin en el SEACE del acta de otorgamiento
de la Buena Pro, en el caso de Licitaciones Pblicas y Concursos Pblicos, o de
cinco (5) das en el caso de Adjudicaciones Directas o Adjudicaciones de Menor
Cuanta, no se ha interpuesto recurso de apelacin.
En caso de empate el otorgamiento de la Buena Pro se efectuar a travs de
sorteo en el mismo acto.
El recurso de apelacin contra los actos que se produzcan desde la
convocatoria hasta el otorgamiento de la Buena Pro y contra los actos que afecten
su validez, deber ser interpuesto por los postores dentro de los ocho (8) das
hbiles siguientes de la publicacin en el SEACE del acta de otorgamiento de
la Buena Pro, en el caso de Licitaciones Pblicas y Concursos Pblicos, y cinco
(5) das hbiles siguientes de dicho acto pblico en el caso de Adjudicaciones
Directas y Adjudicaciones de Menor Cuanta.
Para los actos posteriores al otorgamiento de la Buena Pro, el recurso de
apelacin deber interponerse dentro de los ocho (8) das hbiles siguientes de
haberse tomado conocimiento del acto que se desea impugnar, en el caso de
Licitaciones Pblicas y Concursos Pblicos, y cinco (5) das hbiles siguientes en
el caso de Adjudicaciones Directas y Adjudicaciones de Menor Cuanta.
CAPTULO XI
CONVENIOS MARCO
Artculo 97.- Definicin y aplicacin
El Convenio Marco es la modalidad por la cual se selecciona a aquellos
proveedores con los que las Entidades debern contratar los bienes y servicios
que requieran y que son ofertados a travs del Catlogo Electrnico de Convenios
Marco.
/DGHQLFLyQGHORVELHQHV\VHUYLFLRVDFRQWUDWDUPHGLDQWHHVWDPRGDOLGDG
la conduccin de los procesos de seleccin, la suscripcin de los acuerdos
correspondientes y la administracin de los Convenios Marco, estarn a cargo
de la Central de Compras Pblicas - PERU COMPRAS.
El Catlogo Electrnico de Convenios Marco est a cargo del OSCE.
(V SXEOLFDGR \ GLIXQGLGR D WUDYpV GHO 6($&( \ FRQWLHQH ODV FKDV FRQ ODV
caractersticas de los bienes y servicios en las que son ofertados bajo la modalidad
GH&RQYHQLR0DUFR'LFKDVFKDVLQFOX\HQORVSURYHHGRUHVDGMXGLFDWDULRVSUHFLRV
lugares de entrega y dems condiciones de la contratacin.
La contratacin de un bien o servicio utilizando el Catlogo Electrnico de
Convenios Marco resulta obligatoria desde el da siguiente a la publicacin de las
FKDVUHVSHFWLYDVHQHO6($&(H[FHSWRHQODViUHDVJHRJUiFDVTXHQRFXHQWDQ
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
130
con cobertura ofertada por los proveedores incorporados al Catlogo Electrnico,
en cuyo caso deber solicitar al OSCE la autorizacin para contratar sin sujetarse
a los alcances del citado Catlogo. Las Entidades domiciliadas en dichas reas
JHRJUiFDVDXWRUL]DGDVDQRXWLOL]DUHO&DWiORJR(OHFWUyQLFRGHEHUiQSURJUDPDU
sus necesidades y realizar el proceso de seleccin que corresponda de acuerdo
a la normativa general.
En las Bases se podr establecer montos de transaccin mnimos a partir de
los cuales los proveedores debern atender a las Entidades.
Las Entidades podrn emplear otro mecanismo de contratacin, en caso de
la existencia de condiciones ms ventajosas que sean objetivas, demostrables
y sustanciales para la Entidad, para lo cual debern obtener la autorizacin del
OSCE antes de efectuar la contratacin.
(QFDVRTXHFRQDQWHULRULGDGDODSXEOLFDFLyQGHODVFKDVODV(QWLGDGHVKD\DQ
convocado un proceso de seleccin sobre los mismos bienes y servicios, debern
continuar con dicho proceso. En caso que el proceso de seleccin convocado sea
declarado nulo por vicios en los actos preparatorios, o sea declarado desierto, la
contratacin ulterior deber efectuarse por Convenio Marco.
46
Concordancia: LCE: Artculo 15.
Artculo 98.- Reglas para la realizacin y ejecucin de los Convenios Marco
La realizacin y ejecucin de los Convenios Marco se sujetarn a las siguien-
tes reglas:
1. Los Convenios Marco para la contratacin de bienes y servicios sern
iniciados por la Central de Compras Pblicas - PERU COMPRAS
GH RFLR R D VXJHUHQFLD GH XQD R PiV (QWLGDGHV R GH ORV JUHPLRV
legalmente constituidos, previa evaluacin de su factibilidad, oportunidad,
utilidad y conveniencia.
2. Los Convenios Marco se desarrollarn a travs de las fases de actos
preparatorios, de seleccin, de catalogacin y de ejecucin contractual,
rigindose por lo previsto en el presente Captulo y en la Directiva
correspondiente, siendo de aplicacin supletoria lo dispuesto en la Ley
y en el presente Reglamento.
3. Las fases de actos preparatorios, de seleccin y catalogacin sern
conducidas por la Central de Compras Pblicas - PERU COMPRAS y
la de ejecucin contractual por cada Entidad.
4. El desarrollo de las fases de seleccin y de ejecucin contractual de los
Convenios Marco ser publicado y difundido a travs del SEACE.
5. Cada Convenio Marco se regir en orden de prelacin por las Bases
Integradas, los trminos del Acuerdo de Convenio Marco suscrito y la
correspondiente orden de compra o de servicio.
6. La Central de Compras Pblicas - PERU COMPRAS no asumir
responsabilidad alguna en caso que un determinado bien o servicio
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
131
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
incluido en el Catlogo no sea objeto de contratacin por parte de las
Entidades, ni por la falta de pago al proveedor adjudicatario por parte
de las Entidades.
7. Los proveedores adjudicatarios debern mantener las condiciones
ofertadas en virtud a las cuales suscribieron el respectivo Acuerdo de
Convenio Marco; no obstante, tienen la posibilidad de registrar o proponer
mejoras a dichas condiciones, de acuerdo al procedimiento que seale
la Directiva de Convenio Marco.
8. Los proveedores adjudicatarios podrn solicitar a la Central de
Compras Pblicas - PERU COMPRAS el reajuste de sus precios en un
determinado Convenio Marco cuando tal posibilidad est contemplada
expresamente en las Bases y segn los criterios establecidos en ellas.
9. Las Entidades tienen la obligacin de registrar en el SEACE las rdenes
de compra o de servicio que se hubieran generado en el empleo de esta
modalidad.
47
Artculo 99.- Reglas especiales del proceso de seleccin
El desarrollo de la fase de seleccin se realizar a travs de una Licitacin
Pblica o Concurso Pblico que contendr las siguientes reglas especiales:
1. La elaboracin de las Bases y desarrollo del proceso de seleccin para
la generacin de un Convenio Marco estar a cargo de la dependencia
u rgano especializado de la Central de Compras Pblicas PER
COMPRAS.
2. La absolucin de consultas y de observaciones se efectuar en un
plazo mximo de diez (10) das hbiles en cada caso, contados desde
el vencimiento del plazo para su recepcin.
3. Los observantes tienen la opcin de que las Bases y los actuados del
proceso sean elevados al OSCE, siendo de aplicacin lo dispuesto en
HODUWtFXOR
4. Los proveedores estn facultados a presentar ms de una propuesta
para cada tem del proceso de seleccin, siempre que las Bases as lo
hayan previsto y de acuerdo a lo sealado en la Directiva de Convenio
Marco.
5. Todas las etapas de la fase seleccin, desde la convocatoria hasta la
suscripcin de acuerdos de Convenio Marco, se sujetan a las reglas
sealadas en la Directiva de Convenio Marco y las reglas especiales
previstas en las Bases de cada proceso de seleccin.
6. La Buena Pro ser otorgada a los proveedores que cumplan con las
condiciones indicadas en las respectivas Bases.
7. Una vez que quede consentida la adjudicacin de la Buena Pro, los
proveedores adjudicatarios procedern a suscribir el correspondiente
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
132
Acuerdo de Convenio Marco, mediante el cual stos slo adquieren
el derecho de incluir sus productos en el Catlogo Electrnico de
Convenios Marco.
8. Las controversias que surjan en la seleccin darn lugar a la interposicin
del recurso de apelacin ante el Tribunal, segn las disposiciones
contenidas en el presente Reglamento.
9. Cuando no exista ms de un (1) proveedor que oferten cobertura
HQGHWHUPLQDGDiUHDJHRJUiFDSUHYLRLQIRUPHTXHDVtORMXVWLTXH
ser necesario realizar una convocatoria adicional del proceso de
VHOHFFLyQDSOLFDEOHDODViUHDVJHRJUiFDVFRPSURPHWLGDVVLQDIHFWDU
la continuacin del proceso original, la suscripcin de los acuerdos, la
catalogacin de los tems adjudicados y la obligatoriedad de contratar
a travs del Catlogo Electrnico.
10. Las controversias que surjan durante la ejecucin contractual involucran
nicamente a la Entidad contratante y al proveedor adjudicatario, y se
resolvern mediante conciliacin y/o arbitraje.
48
Artculo 100.- Contratacin de bienes y servicios por Convenio Marco
Cuando el rea usuaria requiera la contratacin de un bien o servicio deber
FRQVXOWDUHO&DWiORJR(OHFWUyQLFRGH&RQYHQLRV0DUFR\YHULFDUVLOD(QWLGDG
VHHQFXHQWUDGHQWURGHODOFDQFHJHRJUiFRGHDSOLFDFLyQGHO&RQYHQLR0DUFR
comprometido.
Si el Catlogo contiene el bien o servicio con las condiciones requeridas y la
(QWLGDGVHHQFXHQWUDGHQWURGHODOFDQFHJHRJUiFRGHDSOLFDFLyQGHO&RQYHQLR
Marco, el rgano encargado de las contrataciones, estar obligado a contratarlos
GH ORV SURYHHGRUHV DGMXGLFDWDULRV SUHYLD YHULFDFLyQ GH OD GLVSRQLELOLGDG GH
recursos de acuerdo a lo sealado en la Directiva de Convenio Marco.
Como excepcin, y previa aprobacin por escrito del OSCE, las Entidades
que no tengan acceso a Internet en su localidad no se encuentran obligadas
a contratar a travs de Convenio Marco, debiendo emplear el mecanismo de
contratacin que corresponda.
La contratacin a travs del Catlogo Electrnico de Convenios Marco puede
realizarse de acuerdo a los requerimientos peridicos de cada Entidad, sin que
dichas operaciones sean consideradas como fraccionamiento.
49
Artculo 101.- Responsabilidad del pago
Las Entidades que contraten a travs de la modalidad de seleccin de Convenio
Marco son responsables del pago al proveedor adjudicatario, el mismo que se
debe hacer efectivo en el plazo mximo de veinte (20) das calendario de otorgada
la conformidad de las prestaciones, no existiendo responsabilidad de la Central
de Compras Pblicas - PER COMPRAS.
480RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
133
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Un proveedor adjudicatario podr rechazar la orden de compra o de servicio,
cuando la Entidad tenga retraso en el pago de deudas derivadas de cualquier
tipo de obligacin con dicho proveedor o retraso en el pago de las obligaciones
asumidas frente a otro proveedor adjudicatario en el catlogo del Convenio Marco
en el que se emite la orden de compra o servicio.
El incumplimiento en el pago acarrea responsabilidad de acuerdo con lo
sealado en la Directiva de Convenio Marco.
En las contrataciones derivadas de la utilizacin del Catlogo Electrnico de
Convenio Marco, no es posible disponer la entrega de adelantos.
50
Artculo 102.- Vigencia y renovacin del Convenio Marco
(OSOD]RGHYLJHQFLDGHFDGD&RQYHQLR0DUFRVHUiHVSHFLFDGRHQODV%DVHV
del proceso, y podr ser renovado sucesivamente, previo informe del rgano
tcnico competente en el que se sustente la conveniencia tcnica y econmica
de la renovacin, de acuerdo con lo sealado en la Directiva de Convenio Marco.
En caso se decida renovar la vigencia de un Convenio Marco, se deber
implementar un procedimiento de incorporacin de nuevos proveedores al
Catlogo Electrnico vigente, siendo que dicha incorporacin debe hacerse
efectiva antes de la entrada en vigencia de la renovacin.
Sin embargo, la Central de Compras Pblicas - PER COMPRAS podr revisar
ORVWpUPLQRVGHXQGHWHUPLQDGR&RQYHQLRFRQODQDOLGDGGHREWHQHUFRQGLFLRQHV
PiVFRQYHQLHQWHVSXGLHQGRGDUORSRUQDOL]DGRDQWLFLSDGDPHQWHHQFDVRODV
FRQGLFLRQHVRIHUWDGDVQRVHDQODVPiVEHQHFLRVDV
La facultad de disponer la renovacin o la revisin del Convenio corresponde
a la Central de Compras Pblicas PER COMPRAS, de acuerdo a lo que
establezca la Directiva de Convenio Marco que apruebe el OSCE.
51
$UWtFXOR &DXVDOHV GH H[FOXVLyQ GH ODV FKDV R GHO 3URYHHGRU GHO
Catlogo Electrnico de Convenios Marco
/DVFKDVGH&RQYHQLR0DUFRVHUiQH[FOXLGDVGHO&DWiORJR(OHFWUyQLFRGH
Convenios Marco en los siguientes casos:
1. Vencimiento del plazo de vigencia del Acuerdo de Convenio Marco.
6ROLFLWXGMXVWLFDGDGHOSURYHHGRUDGMXGLFDWDULRDSUREDGDSRUOD&HQWUDO
de Compras Pblicas - PERU COMPRAS.
3. Efecto de la revisin del Convenio Marco.
,QFXPSOLPLHQWRLQMXVWLFDGRGHOSURYHHGRUDGMXGLFDWDULRGHVXVREOLJD-
ciones contractuales derivadas de rdenes de compra o de servicios,
segn corresponda, que d lugar a la resolucin del contrato de manera
FRQVHQWLGDRDUELWUDOPHQWHUPH
Un proveedor ser excluido del Catlogo Electrnico de Convenios Marco en
los siguientes casos:
50, 51 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
134
1. Est impedido para contratar con el Estado, de acuerdo con lo dispuesto
en el artculo 10 de la Ley;
(VWpLQKDELOLWDGRWHPSRUDORGHQLWLYDPHQWHSDUDFRQWUDWDUFRQHO(VWDGR
o;
3. No cuente con inscripcin vigente en el RNP.
(QHVWRVFDVRVODH[FOXVLyQVHUHHUHDWRGRVORV&RQYHQLRV0DUFRYLJHQWHV
con el proveedor adjudicatario.
52
CAPTULO XII
SOLUCION DE CONTROVERSIAS DURANTE EL PROCESO DE SELECCIN
Artculo 104.- Recurso de apelacin
Mediante recurso de apelacin se impugnan los actos dictados durante el
desarrollo del proceso de seleccin, desde la convocatoria hasta aquellos emitidos
antes de la celebracin del contrato.
En los procesos de seleccin de Adjudicacin Directa Selectiva y Adjudicacin
de Menor Cuanta, el recurso de apelacin se presenta ante la Entidad que
convoc el proceso de seleccin que se impugna, y ser conocido y resuelto
por el Titular de la Entidad. En los procesos de Licitaciones Pblica, Concurso
Pblico, Adjudicacin Directa Pblica y Adjudicacin de Menor Cuanta Derivada
de los procesos antes mencionados, el recurso de apelacin se presenta ante y
es resuelto por el Tribunal. En los procesos de seleccin segn relacin de tems,
el proceso principal del cual forma parte el tem que se impugna determinar ante
quin se presentar el recurso de apelacin.
Con independencia del tipo de proceso de seleccin, los actos emitidos por
HO7LWXODUGHOD(QWLGDGTXHGHFODUHQODQXOLGDGGHRFLRRFDQFHOHQHOSURFHVR
podrn impugnarse ante el Tribunal.
53
Concordancia: LCE: Artculo 53 y Dcimo Tercera Disposicin
Complementaria Final.

Artculo 105.- Actos impugnables
Son impugnables:
1. Los actos dictados por el Comit Especial o el rgano encargado de las
contrataciones, segn corresponda, durante el desarrollo del proceso
de seleccin.
2. Los actos expedidos luego de haberse otorgado la Buena Pro y hasta
antes de la celebracin del contrato.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
53 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
135
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
3. Los actos emitidos por el Titular de la Entidad que afecten la continuacin
del proceso de seleccin, distintos de aquellos que resuelven recursos
GHDSHODFLyQWDOHVFRPRQXOLGDGGHRFLRFDQFHODFLyQXRWURV
Artculo 106.- Actos no impugnables
No son impugnables:
1. Las actuaciones materiales relativas a la programacin de los procesos
de seleccin en el SEACE.
2. Las actuaciones y actos preparatorios de la Entidad convocante,
destinadas a organizar la realizacin de procesos de seleccin.
3. Las Bases del proceso de seleccin y/o su integracin.
4. Las actuaciones materiales referidas al registro de participantes.
5. Los actos que aprueban la exoneracin del proceso de seleccin, as
como los que se generen para la suscripcin del respectivo contrato.
54
Artculo 107.- Plazos de la interposicin del recurso de apelacin
La apelacin contra el otorgamiento de la Buena Pro o contra los actos dictados
con anterioridad a ella debe interponerse dentro de los ocho (8) das hbiles
siguientes de haberse otorgado la Buena Pro. En el caso de Adjudicaciones
Directas y Adjudicaciones de Menor Cuanta, el plazo ser de cinco (5) das hbiles.
La apelacin contra los actos distintos a los indicados en el prrafo anterior debe
interponerse dentro de los ocho (8) das hbiles siguientes de haberse tomado
conocimiento del acto que se desea impugnar. En el caso de Adjudicaciones
Directas y Adjudicaciones de Menor Cuanta, el plazo ser de cinco (5) das hbiles.
Los plazos indicados resultan aplicables a todo recurso de apelacin, sea que
se interponga ante la Entidad o ante el Tribunal, segn corresponda.
Artculo 108.- Efectos de la interposicin del recurso de apelacin
La interposicin del recurso de apelacin suspende el proceso de seleccin.
Si el proceso de seleccin fue convocado por tems, etapas, lotes, paquetes o
tramos, la suspensin afectar nicamente al tem, etapa, lote, paquete o tramo
impugnado.
Son nulos los actos expedidos con infraccin de lo establecido en el prrafo
precedente.
Tanto la Entidad como el Tribunal, segn corresponda, deben informar en la
FKDGHOSURFHVRGHVHOHFFLyQREUDQWHHQHO6($&(ODLQWHUSRVLFLyQGHOUHFXUVR
de apelacin, el mismo da de su interposicin.
Concordancia: LCE: Artculo 54.
Artculo 109.- Requisitos de admisibilidad del recurso de apelacin
El recurso de apelacin, sea presentado ante la Entidad o ante el Tribunal,
54 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
136
deber cumplir con los siguientes requisitos:
1. Ser presentado ante la Unidad de Trmite Documentario de la Entidad o
0HVDGH3DUWHVGHO7ULEXQDOFRQIRUPHDORLQGLFDGRHQHODUWtFXOR
En el caso de las Entidades domiciliadas fuera de Lima, el recurso de
DSHODFLyQ GLULJLGR DO7ULEXQDO SRGUi VHU SUHVHQWDGR DQWH ODV RFLQDV
desconcentradas del OSCE, el que lo derivar a la Mesa de Partes del
Tribunal al da siguiente de su recepcin.
2. Identificacin del impugnante, debiendo consignar su nombre y
Q~PHURGHGRFXPHQWRRFLDOGHLGHQWLGDGRVXGHQRPLQDFLyQRUD]yQ
social. En caso de actuacin mediante representante, se acompaar
la documentacin que acredite tal representacin. Tratndose de
consorcios, el representante comn debe interponer el recurso de
apelacin a nombre de todos los consorciados, acreditando sus
facultades de representacin mediante la presentacin de copia simple
de la promesa formal de consorcio.
3. Sealar como domicilio procesal una direccin electrnica propia.
4. El petitorio, que comprende la determinacin clara y concreta de lo que
se solicita.
5. Los fundamentos de hecho y derecho que sustentan su petitorio.
6. Las pruebas instrumentales pertinentes.
/DJDUDQWtDFRQIRUPHDORVHxDODGRHQHODUWtFXOR
55
/DUPDGHOLPSXJQDQWHRGHVXUHSUHVHQWDQWH(QHOFDVRGHFRQVRUFLRV
EDVWDUi OD UPD GHO UHSUHVHQWDQWH FRP~Q VHxDODGR FRPR WDO HQ OD
promesa formal de consorcio.
9. Copias simples del escrito y sus recaudos para la otra parte, si la hubiera,
y
10. Autorizacin de abogado, slo en los casos de Licitaciones Pblicas,
Concursos Pblicos y Adjudicaciones Directas Pblicas, y siempre que
la defensa sea cautiva.
Artculo 110.- Trmite de admisibilidad del recurso de apelacin
Independientemente que sea interpuesto ante la Entidad o ante el Tribunal, el
trmite de admisibilidad del recurso de apelacin es el siguiente:
1. El anlisis referido a la conformidad de los requisitos de admisibilidad
se realiza en un solo acto, al momento de la presentacin del recurso
de apelacin, por la Unidad de Trmite Documentario de la Entidad, por
OD0HVDGH3DUWHVGHO7ULEXQDORODV2FLQDV=RQDOHVGHO26&(VHJ~Q
corresponda.
2. El recurso de apelacin contra el otorgamiento de la Buena Pro o contra
los actos dictados con anterioridad a ella que sea presentado antes de
haberse efectuado el otorgamiento de la Buena Pro, ser rechazado de
55 Segn Fe de Erratas publicada el 15 de enero de 2009.
137
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
plano, sin mayor trmite, por la Unidad de Trmite Documentario de la
(QWLGDGSRUOD0HVDGH3DUWHVGHO7ULEXQDORODV2FLQDV=RQDOHVGHO
26&(VHJ~QFRUUHVSRQGDFRQODVLPSOHYHULFDFLyQHQHO6($&(GH
la fecha programada para el otorgamiento de la Buena Pro.
3. El requisito de admisibilidad indicado en el inciso 8) del artculo
precedente debe ser consignado obligatoriamente en el primer escrito
que se presente; de lo contrario, el recurso ser rechazado de plano,
sin mayor trmite, por la Unidad de Trmite Documentario de la Entidad,
SRUOD0HVDGH3DUWHVGHO7ULEXQDORODV2FLQDV=RQDOHVGHO26&(
segn corresponda.
4. La omisin de los requisitos sealados en los incisos 2), 3), 4), 5), 6), 7),
9) y 10) del artculo precedente deber ser subsanada por el apelante
dentro del plazo mximo de dos (2) das hbiles contado desde el da
siguiente de la presentacin del recurso de apelacin. El plazo otorgado
para la subsanacin suspende todos los plazos del procedimiento de
impugnacin.
5. Transcurrido el plazo a que se contrae el inciso anterior sin que
se hubiese subsanado la omisin, el recurso de apelacin se
considerar automticamente como no presentado, sin necesidad de
pronunciamiento alguno, y los recaudos se pondrn a disposicin del
apelante para que los recabe en la Unidad de Trmite Documentario de
OD(QWLGDGHQOD0HVDGH3DUWHVGHO7ULEXQDORHQODV2FLQDV=RQDOHV
del OSCE, segn corresponda.
6. Si la Entidad advirtiera, dentro de los tres (3) das hbiles de admitido
el recurso de apelacin, que el impugnante omiti alguno de los
requisitos de admisibilidad detallados en el inciso 4) del presente
artculo, y ello no fue advertido por su Unidad de Trmite Documentario,
GHEHUiHPSOD]DUORLQPHGLDWDPHQWHDQGHTXHUHDOLFHODVXEVDQDFLyQ
correspondiente, otorgndole un plazo mximo de dos (2) das hbiles,
sin que el mismo suspenda el plazo para la resolucin del recurso.
Transcurrido el plazo sealado sin que se realice la subsanacin, el
recurso se tendr por no presentado.
56
Artculo 111.- Improcedencia del recurso de apelacin
El recurso de apelacin presentado ante la Entidad o ante el Tribunal ser
declarado improcedente cuando:
1. La Entidad o el Tribunal, segn corresponda, carezca de competencia
para resolverlo.
2. Sea interpuesto contra alguno de los actos que no son impugnables,
FRQIRUPHDORVHxDODGRHQHODUWtFXOR
6HDLQWHUSXHVWRIXHUDGHOSOD]RLQGLFDGRHQHODUWtFXOR
4. El que suscriba el recurso no sea el impugnante o su representante.
56 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
138
5. El impugnante se encuentre impedido para participar en los procesos de
VHOHFFLyQ\RFRQWUDWDUFRQHO(VWDGRFRQIRUPHDODUWtFXORGHOD/H\
6. El impugnante se encuentre incapacitado legalmente para ejercer
actos civiles.
7. El impugnante carezca de legitimidad procesal para impugnar el acto
objeto de cuestionamiento.
8. Sea interpuesto por el postor ganador de la Buena Pro.
9. No exista conexin lgica entre los hechos expuestos en el recurso y
el petitorio del mismo.

Artculo 112.- Garanta por interposicin de recurso de apelacin
La garanta que respalda la interposicin del recurso de apelacin, de
FRQIRUPLGDGFRQHODUWtFXORGHOD/H\GHEHUiRWRUJDUVHDIDYRUGHOD(QWLGDG
o del OSCE, segn corresponda, por una suma equivalente al tres por ciento
(3%) del valor referencial del proceso de seleccin impugnado. En los procesos
de seleccin segn relacin de tems, etapas, tramos, lotes y paquetes el monto
de la garanta ser equivalente al tres por ciento (3%) del valor referencial del
respectivo tem, etapa, tramo, lote o paquete.
En ningn caso, la garanta ser menor al cincuenta por ciento (50%) de la
Unidad Impositiva Tributaria (UIT) vigente.
La garanta deber ser incondicional, solidaria, irrevocable y de realizacin
automtica en el pas al solo requerimiento de la Entidad o del OSCE, segn
corresponda, bajo responsabilidad de las empresas que las emiten, las mismas
que debern estar dentro del mbito de supervisin de la Superintendencia de
Banca, Seguros y Administradoras Privadas de Fondos de Pensiones y contar
con autorizacin para emitir garantas; o estar consideradas en la ltima lista de
bancos extranjeros de primera categora que peridicamente publica el Banco
Central de Reserva del Per.
As tambin, la garanta podr consistir en un depsito en la cuenta bancaria
de la Entidad o del OSCE, segn corresponda, y recibir el mismo tratamiento,
GHDFXHUGRDORHVWDEOHFLGRHQHODUWtFXORGHOSUHVHQWH5HJODPHQWR
En caso el recurso de apelacin se presente ante la Entidad, la garanta deber
tener un plazo mnimo de vigencia de veinte das (20) calendario; de presentarse
ante el Tribunal, la garanta deber tener un plazo mnimo de vigencia de treinta
(30) das calendario; debiendo ser renovada, en cualquiera de los casos, hasta el
momento en que se agote la va administrativa, siendo obligacin del impugnante
realizar dichas renovaciones en forma oportuna. En el supuesto que la garanta
no fuese renovada hasta la fecha consignada como vencimiento de la misma,
ser ejecutada para constituir un depsito en la cuenta bancaria de la Entidad o
del OSCE, segn corresponda, el cual se mantendr hasta el agotamiento de la
va administrativa.
57
57 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
139
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 113.- Recurso de apelacin ante la Entidad
El Titular de la Entidad podr delegar, mediante resolucin, la facultad de
resolver los recursos de apelacin, sin que en ningn caso dicha delegacin
pueda recaer en los miembros del Comit Especial o en el rgano encargado de
las contrataciones de la Entidad, segn corresponda.
La tramitacin del recurso de apelacin presentado ante la Entidad se sujetar
al siguiente procedimiento:
1. La presentacin de los recursos de apelacin deber registrarse en el
SEACE el mismo da de haber sido interpuestos.
2. De haberse interpuesto dos (2) o ms recursos de apelacin respecto
GHXQPLVPRSURFHVRRtWHPOD(QWLGDGSRGUiDFXPXODUORVDQGH
resolverlos de manera conjunta, siempre que los mismos guarden
conexin. El plazo de resolucin de dichos recursos acumulados ser
el plazo del ltimo recurso interpuesto o subsanado.
3. La Entidad correr traslado de la apelacin a los postores que pudiesen
resultar afectados con la resolucin del recurso, dentro del plazo de dos
(2) das hbiles contados desde la presentacin del recurso o desde la
subsanacin de las omisiones advertidas en la presentacin del mismo,
segn corresponda.
4. El postor o postores emplazados podrn absolver el traslado del recurso
interpuesto en un plazo no mayor a tres (3) das hbiles. La Entidad
deber resolver con la absolucin del traslado o sin ella.
Al interponer el recurso o al absolverlo, el impugnante o los postores
podrn solicitar el uso de la palabra, lo cual deber efectuarse dentro
de los tres (3) das hbiles siguientes de culminado el plazo para la
absolucin del traslado del recurso de apelacin.
/D(QWLGDGUHVROYHUiODDSHODFLyQ\QRWLFDUiVXGHFLVLyQDWUDYpVGHO
SEACE, en un plazo no mayor de doce (12) das hbiles, contados
desde la presentacin del recurso o desde la subsanacin de las
omisiones y/o defectos advertidos en la presentacin del mismo.
A efectos de resolver el recurso de apelacin, el Titular de la Entidad,
o en quien se haya delegado dicha facultad, deber contar con un
informe tcnico legal sobre la impugnacin, emitido por las reas
correspondientes de la Entidad. Dicho informe no podr ser emitido por
el Comit Especial o el rgano encargado de las contrataciones de la
Entidad, segn sea el caso.
6. El impugnante deber asumir que su recurso de apelacin ha sido
GHVHVWLPDGR RSHUDQGR OD GHQHJDWRULD FWD FXDQGR OD (QWLGDG QR
UHVXHOYD\QRWLTXHVXUHVROXFLyQGHQWURGHOSOD]RGHGRFHGtDV
hbiles siguientes a la presentacin o subsanacin del recurso de
apelacin, a efectos de la interposicin de la demanda contencioso
administrativa.
7. Es procedente el desistimiento del recurso de apelacin mediante
HVFULWRFRQUPDOHJDOL]DGDDQWHHOIHGDWDULRGHOD(QWLGDG1RWDULRR
-XH]GH3D]VHJ~QVHDHOFDVR(OGHVLVWLPLHQWRHVDFHSWDGRPHGLDQWH
UHVROXFLyQ \ SRQH Q DO SURFHGLPLHQWR DGPLQLVWUDWLYR VDOYR FXDQGR
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
140
comprometa el inters pblico.
En caso de desistimiento, se ejecutar el cien por ciento (100%) de la
garanta, de conformidad con el literal c) del numeral 51.2 del artculo
GHOD/H\
Concordancia: LCE: Artculo 53.
Artculo 114.- Contenido de la resolucin de la Entidad
El acto expedido por la Entidad que resuelve el recurso de apelacin deber
consignar como mnimo lo siguiente:
1. Los antecedentes del proceso en que se desarrolla la impugnacin.
/D GHWHUPLQDFLyQ GH ORV SXQWRV FRQWURYHUWLGRV GHQLGRV VHJ~Q ORV
hechos alegados por el impugnante mediante su recurso y por los dems
intervinientes en el procedimiento al absolver el traslado del recurso de
apelacin.
3. El anlisis respecto de cada uno de los puntos controvertidos propuestos.
4. La decisin respecto de los extremos del petitorio del recurso de
apelacin y de la absolucin de los dems intervinientes en el
procedimiento, conforme a los puntos controvertidos.
Al ejercer su potestad resolutiva, la Entidad deber resolver de una de las
siguientes formas:
1. De considerar que el acto impugnado se ajusta a la Ley, al presente
Reglamento, a las Bases y dems normas conexas o complementarias,
declarar infundado el recurso de apelacin.
2. Cuando en el acto impugnado se advierta la aplicacin indebida o
interpretacin errnea de la Ley, del presente Reglamento, de las Bases
o dems normas conexas o complementarias, declarar fundado el
recurso de apelacin y revocar el acto objeto de impugnacin.
Si el acto o actos impugnados estn directamente vinculados a la
evaluacin de las propuestas y/o otorgamiento de la Buena Pro, deber,
GHFRQWDUFRQODLQIRUPDFLyQVXFLHQWHHIHFWXDUHODQiOLVLVSHUWLQHQWH
sobre el fondo del asunto y otorgar la Buena Pro a quien corresponda.
&XDQGR HQ YLUWXG GHO UHFXUVR LQWHUSXHVWR VH YHULTXH OD H[LVWHQFLD
de actos dictados por rganos incompetentes, que contravengan
normas legales, que contengan un imposible jurdico o prescindan de
las normas esenciales del procedimiento o de la forma prescrita por
OD QRUPDWLYLGDG DSOLFDEOH HO7LWXODU GH OD (QWLGDG GHFODUDUi GH RFLR
la nulidad de los mismos, debiendo precisar la etapa hasta la que se
retrotraer el proceso de seleccin, en cuyo caso podr declarar que
resulta irrelevante pronunciarse sobre el petitorio del recurso.
4. Cuando el recurso de apelacin incurra en alguna de las causales
HVWDEOHFLGDVHQHODUWtFXOROD(QWLGDGORGHFODUDUiLPSURFHGHQWH
58
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
141
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 115.- Agotamiento de la va administrativa
La resolucin de la Entidad que resuelve el recurso de apelacin o la
GHQHJDWRULDFWDGHQRHPLWLU\QRWLFDUVXGHFLVLyQGHQWURGHOSOD]RUHVSHFWLYR
agotan la va administrativa.
/DRPLVLyQGHUHVROYHU\QRWLFDUHOUHFXUVRGHDSHODFLyQGHQWURGHOSOD]R
establecido genera la responsabilidad funcional del Titular de la Entidad y del
funcionario a quien se hubiese delegado la funcin de resolver.
Concordancia: LCE: Artculo 55.
Artculo 116.- Recurso de apelacin ante el Tribunal
El Tribunal tramita el recurso de apelacin conforme a las siguientes reglas:
1. De haberse interpuesto dos (2) o ms recursos de apelacin respecto
de un mismo proceso o tem, independientemente del acto impugnado,
HO7ULEXQDO SURFHGHUi D DFXPXODUORV D Q GH UHVROYHUORV GH PDQHUD
conjunta, salvo que por razones debidamente fundamentadas decida
lo contrario.
2. Admitido el recurso el Tribunal correr traslado, en el plazo no mayor
de tres (3) das hbiles, a la Entidad que emiti el acto que se impugna,
requirindole la remisin del Expediente de Contratacin completo. La
(QWLGDGGHEHUiQRWLFDUFRQHOGHFUHWRTXHDGPLWHDWUiPLWHHOUHFXUVR
de apelacin al postor y/o postores distintos al impugnante que pudieran
verse afectados con la resolucin del Tribunal.
'HQWURGHOSOD]RGHWUHVGtDVKiELOHVGHQRWLFDGDOD(QWLGDGHVWi
REOLJDGDDUHPLWLUDO7ULEXQDODGHPiVGHORVUHTXLVLWRVMDGRVHQHO783$
del OSCE, el Expediente de Contratacin completo correspondiente al
proceso de seleccin, que deber incluir las propuestas de todos los
postores, incluyendo, adems, como recaudo del mismo, un informe
tcnico legal sobre la impugnacin, en el cual se indique expresamente
la posicin de la Entidad respecto de los fundamentos del recurso
interpuesto. Simultneamente, la Entidad deber remitir al Tribunal
ODGRFXPHQWDFLyQTXHDFUHGLWHODQRWLFDFLyQGHOGHFUHWRTXHDGPLWH
a trmite el recurso de apelacin al postor y/o postores distintos
al impugnante que pudieran verse afectados con la resolucin del
Tribunal.
El incumplimiento de dichas obligaciones por parte de la Entidad
ser comunicada al rgano de Control Institucional de sta y/o a
la Contralora General de la Repblica y generar responsabilidad
funcional en el Titular de la Entidad.
El postor o postores emplazados deben absolver el traslado del recurso
en un plazo no mayor a cinco (5) das hbiles, contados a partir del da
VLJXLHQWH GH KDEHU VLGR QRWLFDGRV FRQ HO UHFXUVR GH DSHODFLyQ SRU
parte de la Entidad. La absolucin del traslado ser presentado a la
0HVDGH3DUWHVGHO7ULEXQDORHQODV2FLQDV=RQDOHVGHO26&(VHJ~Q
corresponda.
4. Dentro del plazo mximo de dos (2) das hbiles siguientes de recibida
la informacin que se indica en el numeral 3 precedente, o vencido el
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
142
plazo y sin ella en caso de incumplimiento por parte de la Entidad, el
expediente ser remitido a la Sala correspondiente del Tribunal.
5. Recibido el expediente en la Sala correspondiente del Tribunal, con o sin
la absolucin del postor o postores que resulten afectados, sta tiene un
plazo de cinco (5) das hbiles para evaluar la documentacin obrante
en el expediente y, de ser el caso, para declarar mediante decreto que
est listo para resolver.
6. La Sala correspondiente del Tribunal, de considerarlo pertinente
puede, por nica vez, y en una sola oportunidad solicitar informacin
DGLFLRQDODOD(QWLGDGDOLPSXJQDQWH\DWHUFHURVDQGHUHFDXGDUOD
documentacin necesaria para mejor resolver, quedando prorrogado
el plazo total de evaluacin al que se alude en el prrafo precedente
por el trmino necesario, el que no podr exceder de quince (15) das
hbiles contados desde que el expediente es recibido en Sala.
La Sala del Tribunal podr formular requerimiento de informacin a todas
las Entidades y las personas naturales o jurdicas, bajo responsabilidad.
La oposicin, omisin o demora en el cumplimiento del mandato
requerido supondr, sin excepcin alguna, una infraccin al deber de
colaboracin con la Administracin que, en el caso de las Entidades,
se pondr en conocimiento de su rgano de Control Institucional para
la adopcin de las medidas a que hubiere lugar. Tratndose de las
dems personas naturales o jurdicas, o del postor adjudicatario de la
Buena Pro, el incumplimiento del mandato ser apreciado por el Tribunal
al momento de resolver, valorndose conjuntamente con los dems
actuados que obren en el expediente.
(QFRQFRUGDQFLDFRQORHVWLSXODGRHQHO$UWtFXORGHO5HJODPHQWR
HQFDVRGHKDEHUVHFRQFHGLGRGHRFLRRDSHGLGRGHSDUWHHOXVRGH
la palabra en audiencia pblica para los informes orales, stos debern
realizarse dentro del perodo mencionado en el numeral 6 anterior. El
pedido de parte deber hacerse con la interposicin del recurso o con
la absolucin.
8. El requerimiento de informacin adicional podr efectuarse luego de
realizada la respectiva audiencia pblica siempre que la evaluacin
total no exceda del perodo mencionado en el numeral 6 del presente
artculo.
9. Al da siguiente de recibida la informacin adicional y/o realizada la
audiencia pblica, se declarar el expediente listo para resolver a travs
del decreto correspondiente.
(O7ULEXQDOUHVROYHUi\QRWLFDUiVXUHVROXFLyQDWUDYpVGHO6($&(GHQWUR
del plazo de cinco (5) das hbiles, contados desde la fecha de emisin
del decreto que declare que el expediente est listo para resolver.
11. Todos los actos que emita el Tribunal en el trmite del recurso de
DSHODFLyQVHUiQQRWLFDGRVDODVSDUWHVWUDYpVGHO6($&(
59
Concordancia: LCE: Artculo 53.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
143
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 117.- Uso de la palabra
El Tribunal podr conceder a las partes el uso de la palabra a efectos de
sustentar su derecho, cuando sea solicitada por ellas, slo hasta antes que el
Tribunal declare que el expediente est listo para resolver, sin perjuicio que sea
UHTXHULGRGHRFLRDFRQVLGHUDFLyQGHO7ULEXQDO3DUDWDOHIHFWRHO7ULEXQDOVHxDODUi
da y hora para la realizacin de la respectiva audiencia pblica. En este caso,
el plazo de evaluacin del expediente queda prorrogado hasta el da en que se
realice la correspondiente audiencia pblica.
Artculo 118.- Contenido de la resolucin del Tribunal
La resolucin expedida por el Tribunal que se pronuncia sobre el recurso de
apelacin deber consignar como mnimo lo siguiente:
1. Los antecedentes del proceso en que se desarrolla la impugnacin.
/D GHWHUPLQDFLyQ GH ORV SXQWRV FRQWURYHUWLGRV GHQLGRV VHJ~Q ORV
hechos alegados por el impugnante mediante su recurso y por los dems
intervinientes en el procedimiento de impugnacin al absolver el traslado
del recurso de apelacin.
3. El anlisis respecto de cada uno de los puntos controvertidos propuestos.
4. El pronunciamiento respecto de los extremos del petitorio del recurso
de apelacin y de la absolucin de los dems intervinientes en el
procedimiento, conforme a los puntos controvertidos.
60
Artculo 119.- Alcances de la resolucin
Al ejercer su potestad resolutiva, el Tribunal deber resolver de una de las
siguientes formas:
1. En caso el Tribunal considere que el acto impugnado se ajusta a la Ley,
al presente Reglamento, a las Bases del proceso de seleccin y dems
normas conexas o complementarias, declarar infundado el recurso de
DSHODFLyQ\FRQUPDUiHODFWRREMHWRGHOPLVPR
2. Cuando en el acto impugnado se advierta la aplicacin indebida o
interpretacin errnea de la Ley, del presente Reglamento, de las Bases
del proceso de seleccin o dems normas conexas o complementarias,
el Tribunal declarar fundado el recurso de apelacin y revocar el acto
impugnado.
3. Si el impugnante ha cuestionado actos directamente vinculados a la
evaluacin de las propuestas y/o otorgamiento de la Buena Pro, el
7ULEXQDO DGHPiV HYDOXDUi VL FXHQWD FRQ OD LQIRUPDFLyQ VXFLHQWH
para efectuar el anlisis sobre el fondo del asunto. De contar con dicha
informacin, el Tribunal otorgar la Buena Pro a quien corresponda,
siendo improcedente cualquier impugnacin administrativa contra dicha
decisin.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
144
&XDQGR HQ YLUWXG GHO UHFXUVR LQWHUSXHVWR R GH RFLR VH YHULTXH
la existencia de actos dictados por rganos incompetentes, que
contravengan normas legales, que contengan un imposible jurdico
o prescindan de las normas esenciales del procedimiento o de la
forma prescrita por la normatividad aplicable, declarar la nulidad de
los mismos, debiendo precisar la etapa hasta la que se retrotraer el
proceso de seleccin, en cuyo caso podr declarar que resulta irrelevante
pronunciarse sobre el petitorio del recurso.
5. Cuando el recurso de apelacin incurra en alguna de las causales
HVWDEOHFLGDVHQHODUWtFXORHO7ULEXQDOORGHFODUDUiLPSURFHGHQWH
61
Artculo 120.- Desistimiento
El apelante podr desistirse del recurso de apelacin mediante escrito con
UPDOHJDOL]DGDDQWH1RWDULRRDQWHOD6HFUHWDUtDGHO7ULEXQDOVLHPSUH\FXDQGR
la respectiva solicitud de desistimiento haya sido formulada hasta antes de
haberse declarado que el expediente est listo para resolver y no comprometa
el inters pblico.
(OGHVLVWLPLHQWRHVDFHSWDGRPHGLDQWHUHVROXFLyQ\SRQHQDOSURFHGLPLHQWR
administrativo.
En caso de desistimiento, se ejecutar el cien por ciento (100%) de la garanta,
GHFRQIRUPLGDGFRQHOOLWHUDOFGHOQXPHUDOGHODUWtFXORGHOD/H\
Artculo 121.- Denegatoria ficta
9HQFLGRHOSOD]RSDUDTXHHO7ULEXQDOUHVXHOYD\QRWLTXHODUHVROXFLyQTXHVH
pronuncia sobre el recurso de apelacin, el impugnante deber asumir que aqul
IXHGHVHVWLPDGRRSHUDQGRODGHQHJDWRULDFWDDHIHFWRVGHODLQWHUSRVLFLyQGH
la demanda contencioso administrativa.
Concordancia: LCE: Artculo 55.
Artculo 122.- Agotamiento de la va administrativa
La resolucin del Tribunal que resuelve el recurso de apelacin o la denegatoria
FWDGHQRHPLWLU\QRWLFDUVXGHFLVLyQGHQWURGHOSOD]RUHVSHFWLYRDJRWDQOD
va administrativa, por lo que no cabe interponer recurso administrativo alguno.
/DRPLVLyQGHUHVROYHU\QRWLFDUHOUHFXUVRGHDSHODFLyQGHQWURGHOSOD]R
establecido genera la responsabilidad funcional de la Sala del Tribunal.
62
Concordancia: LCE: Artculo 55.
Artculo 123.- Cumplimiento de las resoluciones del Tribunal
La resolucin dictada por el Tribunal debe ser cumplida por las partes sin
FDOLFDUOD\EDMRVXVWpUPLQRV
61 Segn Fe de Erratas publicada el 15 de enero de 2009.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
145
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Cuando la Entidad no cumpla con lo dispuesto en una resolucin del Tribunal,
ste dictar las medidas pertinentes para su debida ejecucin, comunicando tal
hecho al rgano de Control Institucional de aquella y/o a la Contralora General
de la Repblica, sin perjuicio del requerimiento al Titular de la Entidad para que
VHLPSRQJDDORDORVUHVSRQVDEOHVODVVDQFLRQHVSUHYLVWDVHQHODUWtFXORGH
OD/H\'HVHUHOFDVRVHGHQXQFLDUiDORVLQIUDFWRUHVVHJ~QORWLSLFDGRHQHO
Cdigo Penal.
Artculo 124.- Precedentes de Observancia Obligatoria
Mediante acuerdos adoptados en sesin de Sala Plena, el Tribunal interpreta
de modo expreso y con alcance general las normas establecidas en la Ley y
el presente Reglamento, los cuales constituyen precedentes de observancia
REOLJDWRULD'LFKRVDFXHUGRVGHEHUiQVHUSXEOLFDGRVHQHO'LDULR2FLDO(O3HUXDQR
y en el portal institucional del OSCE. Los precedentes de observancia obligatoria
FRQVHUYDUiQVXYLJHQFLDPLHQWUDVQRVHDQPRGLFDGRVSRUSRVWHULRUHVDFXHUGRV
de Sala Plena del Tribunal o por norma legal.
Dichos acuerdos deben ser observados por las Salas del Tribunal y las
Entidades, incluso al resolver las apelaciones que conozcan.
63
Artculo 125.- Ejecucin de la garanta
Independientemente que se haya presentado el recurso de apelacin
ante la Entidad o ante el Tribunal, segn corresponda, cuando el recurso sea
declarado fundado en todo o en parte, o se declare la nulidad sin haberse emitido
SURQXQFLDPLHQWRVREUHHOIRQGRGHODVXQWRXRSHUHODGHQHJDWRULDFWDSRUQR
UHVROYHU\QRWLFDUODUHVROXFLyQGHQWURGHOSOD]ROHJDOVHSURFHGHUiDGHYROYHU
la garanta al impugnante, en un plazo de quince (15) das hbiles de solicitado.
Cuando el recurso de apelacin sea declarado infundado o improcedente o
el impugnante se desista, se proceder a ejecutar la garanta.

Artculo 126.- Accin contencioso administrativa
La interposicin de la accin contencioso administrativa cabe nicamente
FRQWUD OD UHVROXFLyQ R GHQHJDWRULD FWD TXH DJRWDQ OD YtD DGPLQLVWUDWLYD \ QR
suspende lo resuelto por la Entidad o por el Tribunal, segn corresponda. Dicha
accin se interpondr dentro del plazo previsto en la ley de la materia, contado
D SDUWLU GHO GtD VLJXLHQWH GH OD QRWLFDFLyQ GH OD UHVROXFLyQ UHVSHFWLYD R GHO
vencimiento del plazo para resolver el recurso de apelacin, segn corresponda.
Concordancia: LCE: Artculo 55.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
146
CAPTULO XIII
EXONERACIN DEL PROCESO DE SELECCIN
Artculo 127.- Contratacin entre Entidades
Esta exoneracin no resultar aplicable a las contrataciones en las que acte
como proveedor una empresa del Estado organizada bajo la forma que establezca
la legislacin vigente, ya sea de propiedad del Gobierno Central, Regional o Local,
o Entidades del Estado que realizan actividades empresariales de manera habitual
en el rubro de la contratacin.
Concordancia: LCE: Artculo 20 inciso a).
Artculo 128.- Situacin de Emergencia
(QYLUWXGGHDFRQWHFLPLHQWRVFDWDVWUyFRVRGHVLWXDFLRQHVTXHDIHFWHQOD
defensa o seguridad nacional, o de situaciones que supongan el grave peligro
de que alguno de los supuestos anteriores ocurra, la Entidad deber contratar en
forma inmediata lo estrictamente necesario para prevenir los efectos del evento
prximo a producirse, as como para atender los requerimientos generados como
consecuencia directa del evento producido.
/RV DFRQWHFLPLHQWRV FDWDVWUyFRV VRQ DTXHOORV GH FDUiFWHU H[WUDRUGLQDULR
ocasionados por la naturaleza o por la accin u omisin del obrar humano, que
generan daos afectando a una determinada comunidad.
Las situaciones que afectan la defensa o seguridad nacional estn dirigidas a
enfrentar agresiones de orden interno o externo que menoscabe la consecucin
GHORVQHVGHO(VWDGR
Las situaciones que supongan grave peligro son aquellas en las que exista la
posibilidad debidamente comprobada de que cualquiera de los acontecimientos
o situaciones anteriores ocurra de manera inminente.
Una vez realizada la contratacin por situacin de emergencia, la Entidad deber
convocar los respectivos procesos de seleccin para atender las necesidades que
no estn directamente relacionados con la situacin que sustent la exoneracin.
Cuando no corresponda realizar un proceso de seleccin posterior, las razones
TXHPRWLYDQODFRQWUDWDFLyQGHQLWLYDGHEHQHQFRQWUDUVHIXQGDPHQWDGDVHQHO
LQIRUPHDOTXHVHUHHUHHODUWtFXORGHOSUHVHQWH5HJODPHQWR
Toda contratacin realizada para enfrentar una situacin de emergencia
deber regularizarse dentro de los diez (10) das hbiles siguientes de efectuada
la entrega del bien o la primera entrega en el caso de suministros, o del inicio de
la prestacin del servicio o del inicio de la ejecucin de la obra. Para tal efecto,
la Entidad debe incluir el proceso en su Plan Anual de Contrataciones, as como
elaborar y publicar en el SEACE la resolucin o acuerdo correspondiente y el
LQIRUPH D TXH VH UHHUH HO PHQFLRQDGR DUWtFXOR $GLFLRQDOPHQWH GHEH
cumplir con formalizar las actuaciones de la fase de actos preparatorios y del
perfeccionamiento del contrato que resulten aplicables.
64
Concordancia: LCE: Artculos 20 y 23 inciso b).
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
147
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 129.- Situacin de desabastecimiento
/DVLWXDFLyQGHGHVDEDVWHFLPLHQWRVHFRQJXUDDQWHODDXVHQFLDLQPLQHQWHGH
determinado bien o servicio, debido a la ocurrencia de una situacin extraordinaria
e imprevisible, que compromete la continuidad de las funciones, servicios,
actividades u operaciones que la Entidad tiene a su cargo.
La necesidad de los bienes o servicios debe ser actual e imprescindible para
atender los requerimientos inmediatos.
No puede invocarse la existencia de una situacin de desabastecimiento en
las siguientes contrataciones:
a) En contrataciones bajo la cobertura de un tratado o compromiso
internacional que incluya disposiciones sobre contrataciones pblicas,
cuando el desabastecimiento se hubiese originado por negligencia, dolo
o culpa inexcusable del funcionario o servidor de la Entidad.
b) Por perodos consecutivos que excedan el lapso del tiempo requerido
para paliar la situacin, salvo que ocurra una situacin diferente a la que
motiv la exoneracin original, en cuyo caso la Entidad es responsable
GHVXYHULFDFLyQ\VXVWHQWRFRQIRUPHORHVWDEOHFLGRHQORVDUWtFXORV
\GHOD/H\\HQHOSUHVHQWH5HJODPHQWR
c) Para satisfacer necesidades anteriores a la fecha de aprobacin de la
exoneracin al proceso de seleccin, y
d) Por cantidades que excedan lo necesario para atender el desabas-
tecimiento.
e) En va de regularizacin.
Cuando del sustento de la exoneracin se desprenda que la conducta
de los funcionarios o servidores de la Entidad hubiese originado la presencia
o configuracin de la causal, en la resolucin o acuerdo que aprueba la
exoneracin debe disponerse el inicio de las medidas conducentes al deslinde
de las responsabilidades administrativas, civiles y/o penales de los funcionarios
o servidores pblicos involucrados. Esta exigencia no es aplicable al supuesto
previsto en el literal a) del presente artculo.
65
Concordancia: LCE: Artculos 20 y 22 inciso c).
Artculo 130.- Carcter de secreto, secreto militar o de orden interno
Las contrataciones con carcter de secreto, de secreto militar o de orden interno
que deban realizar los organismos que conforman el Sistema de Inteligencia
Nacional, las Fuerzas Armadas y la Polica Nacional del Per, estn exoneradas
del proceso de seleccin respectivo, siempre que su objeto est incluido en la
lista que, mediante Decreto Supremo, haya aprobado el Consejo de Ministros.
La opinin favorable de la Contralora General de la Repblica deber
sustentarse en la comprobacin de la inclusin del objeto de la contratacin en
ODOLVWDDTXHVHUHHUHHOSiUUDIRDQWHULRU\GHEHUiHPLWLUVHGHQWURGHOSOD]RGH
65 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
148
quince (15) das hbiles a partir de presentada la solicitud.
Los bienes, servicios o ejecucin de obras de carcter administrativo y
RSHUDWLYRDTXHVHUHHUHOD~OWLPDSDUWHGHOLQFLVRGGHODUWtFXORGHOD/H\VRQ
aquellos necesarios para el normal funcionamiento de las unidades del Sistema de
Inteligencia Nacional, de las Fuerzas Armadas y de la Polica Nacional del Per.
Concordancia: LCE: Artculo 20 inciso d).
Artculo 131.- Proveedor nico de bienes o servicios que no admiten sustitutos
En los casos en que no existan bienes o servicios sustitutos a los requeridos por
el rea usuaria, y siempre que exista un solo proveedor en el mercado nacional,
la Entidad podr contratar directamente.
Tambin se considerar que existe proveedor nico en los casos que por
razones tcnicas o relacionadas con la proteccin de derechos de propiedad
intelectual se haya establecido la exclusividad del proveedor.
Adicionalmente, se encuentran incluidos en esta causal los servicios de
publicidad que prestan al Estado los medios de comunicacin televisiva, radial,
escrita o cualquier otro medio de comunicacin.
66
Concordancia: LCE: Artculo 20 inciso e).
Artculo 132.- Servicios Personalsimos
Cuando exista un requerimiento de contratar servicios especializados
SURIHVLRQDOHVDUWtVWLFRVFLHQWtFRVRWHFQROyJLFRVSURFHGHODH[RQHUDFLyQSRU
servicios personalsimos para contratar con personas naturales, siempre que se
sustente objetivamente lo siguiente:
1. Especialidad del proveedor, relacionada con sus conocimientos
profesionales, artsticos, cientficos o tecnolgicos que permitan
sustentar de modo razonable e indiscutible su adecuacin para
satisfacer la complejidad del objeto contractual.
2. Experiencia reconocida en la prestacin objeto de la contratacin.
3. Comparacin favorable frente a otros potenciales proveedores que
estn en la capacidad de brindar el servicio.
Las prestaciones que se deriven de los contratos celebrados al amparo del
presente artculo no sern materia de subcontratacin ni de cesin de posicin
contractual.
67
Concordancia: LCE: Artculo 20 inciso f).
Artculo 133.- Informes previos en caso de exoneraciones
La resolucin o acuerdo que apruebe la exoneracin del proceso de seleccin
requiere obligatoriamente del respectivo sustento tcnico y legal, en el informe o
LQIRUPHVSUHYLRVTXHFRQWHQJDQODMXVWLFDFLyQGHODQHFHVLGDG\SURFHGHQFLD
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
149
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
de la exoneracin. En el caso de las empresas pblicas, la aprobacin de las
exoneraciones le corresponde al Directorio.
68
Concordancia: LCE: Artculo 21.
Artculo 134.- Publicacin de las resoluciones o acuerdos que aprueban las
Exoneraciones
Las resoluciones o acuerdos que aprueben las exoneraciones y los informes
TXHORVVXVWHQWDQVDOYRODFDXVDOSUHYLVWDHQHOLQFLVRGGHODUWtFXORGHOD
Ley, sern publicadas a travs del SEACE dentro de los diez (10) das hbiles
siguientes a su emisin o adopcin, segn corresponda.
69
Concordancia: LCE: Artculo 21.
Artculo 135.- Procedimiento para las contrataciones exoneradas
La Entidad efectuar las contrataciones en forma directa mediante acciones
inmediatas, requirindose invitar a un solo proveedor, cuya propuesta cumpla con
las caractersticas y condiciones establecidas en las Bases, las cuales slo deben
FRQWHQHUORLQGLFDGRHQORVOLWHUDOHVEFHKHLGHODUWtFXORGHOD/H\/D
propuesta podr ser obtenida, por cualquier medio de comunicacin, incluyendo
el facsmil y el correo electrnico.
La exoneracin se circunscribe a la omisin del proceso de seleccin; por lo
que los actos preparatorios y contratos que se celebren como consecuencia de
aquella, deben cumplir con los respectivos requisitos, condiciones, formalidades,
exigencias y garantas que se aplicaran de haberse llevado a cabo el proceso
de seleccin correspondiente.
La contratacin del bien, servicio u obra objeto de la exoneracin, ser realizada
por el rgano encargado de las contrataciones de la Entidad o el rgano designado
para el efecto.
El cumplimiento de los requisitos previstos para las exoneraciones, en la Ley
y el presente Reglamento, es responsabilidad del Titular del la Entidad y de los
funcionarios que intervengan en la decisin y ejecucin.
Concordancia: LCE: Artculo 26.
Artculo 136.- Limitaciones a las contrataciones exoneradas
En el caso de las contrataciones exoneradas por causales de situacin
de desabastecimiento y situacin de emergencia no sern aplicables las
contrataciones complementarias. Asimismo, bajo dichos supuestos, de ser
necesario prestaciones adicionales se requerir previamente la emisin de un
nuevo acuerdo o resolucin de exoneracin.
70
Concordancia: RLCE: Artculo 182.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
150
TITULO III
EJECUCIN CONTRACTUAL
CAPTULO I
DEL CONTRATO
Artculo 137.- Obligacin de contratar
8QDYH]TXHOD%XHQD3URKDTXHGDGRFRQVHQWLGDRDGPLQLVWUDWLYDPHQWHUPH
tanto la Entidad como el o los postores ganadores, estn obligados a suscribir el
o los contratos respectivos.
La Entidad no puede negarse a suscribir el contrato, salvo por razones de
recorte presupuestal correspondiente al objeto materia del proceso de seleccin,
por norma expresa o porque desaparezca la necesidad, debidamente acreditada.
La negativa a hacerlo basada en otros motivos, genera responsabilidad funcional
en el Titular de la Entidad, en el responsable de Administracin o de Logstica o
el que haga sus veces, segn corresponda.
En caso que el o los postores ganadores de la Buena Pro se nieguen a
suscribir el contrato, sern pasibles de sancin, salvo imposibilidad fsica o jurdica
sobrevenida al otorgamiento de la Buena Pro que no le es atribuible, declarada
por el Tribunal.
Artculo 138.- Perfeccionamiento del Contrato
El contrato se perfecciona con la suscripcin del documento que lo contiene.
Tratndose de procesos de Adjudicaciones de Menor Cuanta, distintas a
las convocadas para la ejecucin y consultora de obras, el contrato se podr
perfeccionar con la recepcin de la orden de compra o de servicio.
La contratacin a travs de la modalidad de Convenio Marco se formaliza a
travs de la recepcin de la orden de compra o de servicio, independientemente
del monto involucrado, por lo que no son aplicables los plazos y procedimiento
sealados en el artculo 148 y los requisitos del artculo 141.
En el caso de procesos de seleccin por relacin de tems, se podr
perfeccionar el contrato con la suscripcin del documento que lo contiene o con
la recepcin de una orden de compra o de servicio segn el monto del valor
referencial de cada tem. En caso que un mismo proveedor resulte ganador en
ms de un tem, podr suscribirse un contrato por cada tem o un solo contrato
por todos ellos. La Entidad deber informar al SEACE de cada tem contratado.
En las rdenes de compra o de servicios que se remitan a los postores
JDQDGRUHVGHOD%XHQD3URJXUDUiFRPRFRQGLFLyQTXHHOFRQWUDWLVWDVHREOLJDD
cumplir las obligaciones que le corresponden, bajo sancin de quedar inhabilitado
para contratar con el Estado en caso de incumplimiento.
Los contratos y, en su caso, las rdenes de compra o de servicio, as como
la informacin referida a su ejecucin, debern ser registrados en el SEACE en
un plazo no mayor de diez (10) das hbiles siguientes a su perfeccionamiento,
ocurrencia o aprobacin, segn corresponda.
71
Concordancia: LCE: Artculo 35.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHMXOLRGH
151
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 139.- Suscripcin del Contrato
El contrato ser suscrito por la Entidad, a travs del funcionario competente o
debidamente autorizado, y por el contratista, ya sea directamente o por medio de
su apoderado, tratndose de persona natural, y tratndose de persona jurdica,
a travs de su representante legal.
Artculo 140.- Sujetos de la relacin contractual
Son sujetos de la relacin contractual la Entidad y el contratista.
En aquellos casos en los que se haya distribuido o prorrateado la Buena Pro
entre dos (2) o ms postores se formalizar un contrato con cada postor.
Artculo 141.- Requisitos para suscribir el Contrato
Para suscribir el contrato, el postor ganador de la Buena Pro deber presentar,
adems de los documentos previstos en las Bases, los siguientes:
1. Constancia vigente de no estar inhabilitado para contratar con el Estado,
salvo en los contratos derivados de procesos de Adjudicacin de Menor
Cuanta y de procesos de seleccin segn relacin de tems, en los que el
monto del valor referencial del tem o sumatoria de los valores referenciales
de los tems adjudicados a un mismo postor no superen lo establecido en
la normativa vigente para convocar a una Adjudicacin de Menor Cuanta,
HQORVTXHOD(QWLGDGGHEHUiHIHFWXDUODYHULFDFLyQFRUUHVSRQGLHQWHHQ
el portal del RNP.
2. Garantas, salvo casos de excepcin.
&RQWUDWRGHFRQVRUFLRFRQUPDVOHJDOL]DGDVGHORVFRQVRUFLDGRVGHVHU
el caso.
4. Cdigo de cuenta interbancaria (CCI).
7UDGXFFLyQRFLDOHIHFWXDGDSRUWUDGXFWRUS~EOLFRMXUDPHQWDGRGHWRGRV
los documentos de la propuesta presentados en idioma extranjero que
IXHURQDFRPSDxDGRVGHWUDGXFFLyQFHUWLFDGD
Estos requisitos no sern exigibles cuando el contratista sea otra Entidad,
cualquiera sea el proceso de seleccin, con excepcin de las Empresas del
Estado que debern cumplirlos.
Luego de la suscripcin del contrato y, en el mismo acto, la Entidad entregar
un ejemplar del mismo al contratista.
72
Concordancia: LCE: Artculo 39.

Artculo 142.- Contenido del Contrato
El contrato est conformado por el documento que lo contiene, las Bases
Integradas y la oferta ganadora, as como los documentos derivados del proceso
de seleccin que establezcan obligaciones para las partes y que hayan sido
expresamente sealados en el contrato.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
152
El contrato es obligatorio para las partes y se regula por las normas de este
Ttulo. Los contratos de obras se regulan, adems, por el Captulo III de este
Ttulo. En lo no previsto en la Ley y el presente Reglamento, son de aplicacin
supletoria las normas de derecho pblico y, slo en ausencia de stas, las de
derecho privado.
Artculo 143.- Modificacin en el Contrato
Durante la ejecucin del contrato, en caso el contratista ofrezca bienes y/o
servicios con iguales o mejores caractersticas tcnicas, de calidad y de precios,
OD(QWLGDGSUHYLDHYDOXDFLyQSRGUiPRGLFDUHOFRQWUDWRVLHPSUHTXHWDOHVELHQHV
\RVHUYLFLRVVDWLVIDJDQVXQHFHVLGDG7DOHVPRGLFDFLRQHVQRGHEHUiQYDULDUHQ
forma alguna las condiciones originales que motivaron la seleccin del contratista.
Artculo 144.- Nulidad del Contrato
6RQFDXVDOHVGHGHFODUDFLyQGHQXOLGDGGHRFLRGHOFRQWUDWRODVSUHYLVWDV
SRU HO DUWtFXOR GH OD /H\ SDUD OR FXDO OD (QWLGDG FXUVDUi FDUWD QRWDULDO DO
contratista adjuntando copia fedateada del documento que declara la nulidad del
contrato. Dentro de los quince (15) das hbiles siguientes el contratista que no
est de acuerdo con esta decisin, podr someter la controversia a conciliacin
y/o arbitraje.
Concordancia: LCE: Artculo 56.
Artculo 145.- Consorcio
(OFRQWUDWRGHFRQVRUFLRVHIRUPDOL]DPHGLDQWHGRFXPHQWRSULYDGRFRQUPDV
legalizadas ante Notario por cada uno de los integrantes, de sus apoderados
o de sus representantes legales, segn corresponda, designndose en dicho
GRFXPHQWR DO UHSUHVHQWDQWH R DSRGHUDGR FRP~Q 1R WHQGUi HFDFLD OHJDO
frente a la Entidad los actos realizados por personas distintas al representante o
apoderado comn.
Al suscribirse el contrato de consorcio se mantendr la informacin referida al
porcentaje de obligaciones de cada uno de sus integrantes, conforme a lo indicado
en la promesa formal del consorcio.
Los integrantes de un consorcio responden solidariamente respecto de la no
suscripcin del contrato y del incumplimiento del mismo, estando facultada la
Entidad, en dichos casos, para demandar a cualquiera de ellos por los daos y
perjuicios causados.
El incumplimiento del contrato generar la imposicin de sanciones
administrativas que se aplicarn a todos los integrantes del consorcio, aun
cuando se hayan individualizado las obligaciones y precisado la participacin de
cada uno.
73
Concordancia: LCE: Artculo 36.
Artculo 146.- Subcontratacin
El contratista podr acordar con terceros la subcontratacin de parte de las
prestaciones a su cargo, cuando lo autoricen las Bases, siempre que:
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
153
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
1. La Entidad lo apruebe por escrito y de manera previa, por intermedio del
IXQFLRQDULRTXHFXHQWHFRQIDFXOWDGHVVXFLHQWHV\GHQWURGHORVFLQFR
(5) das hbiles de formulado el pedido. Si transcurrido dicho plazo la
Entidad no comunica su respuesta, se considera que el pedido ha sido
aprobado.
2. Las prestaciones a subcontratarse con terceros no excedan del cuarenta
por ciento (40%) del monto del contrato original.
3. El subcontratista se encuentre inscrito en el RNP y no est suspendido
o inhabilitado para contratar con el Estado.
4. En el caso de contratistas extranjeros, stos se comprometan a brindar
capacitacin y transferencia de tecnologa a los nacionales.
Aun cuando el contratista haya subcontratado, conforme a lo indicado
precedentemente, es el nico responsable de la ejecucin total del contrato frente
a la Entidad. Las obligaciones y responsabilidades derivadas de la subcontratacin
son ajenas a la Entidad.
Las subcontrataciones se efectuarn de preferencia con las microempresas
y pequeas empresas.
Concordancia: LCE: Artculo 37.
Artculo 147.- Cesin de Derechos y de Posicin Contractual
Salvo disposicin legal o reglamentaria en contrario, el contratista puede ceder
sus derechos a favor de terceros, caso en el cual la Entidad abonar a stos la
prestacin a su cargo dentro de los lmites establecidos en la cesin.
En el mbito de las normas sobre contrataciones del Estado no procede la
cesin de posicin contractual del contratista, salvo en los casos de transferencia
de propiedad de bienes que se encuentren arrendados a las Entidades, cuando
se produzcan fusiones o escisiones o que exista norma legal que lo permita
expresamente.
Artculo 148.- Plazos y procedimiento para suscribir el Contrato
8QDYH]TXHTXHGHFRQVHQWLGRRDGPLQLVWUDWLYDPHQWHUPHHORWRUJDPLHQWR
de la Buena Pro, los plazos y el procedimiento para suscribir el contrato son los
siguientes:
1. Dentro de los siete (7) das hbiles siguientes al consentimiento de la
Buena Pro, sin mediar citacin alguna, el postor ganador deber presentar
a la Entidad la documentacin para la suscripcin del contrato prevista
en las Bases. Asimismo, dentro de los tres (3) das hbiles siguientes a la
presentacin de dicha documentacin, deber concurrir ante la Entidad
para suscribir el contrato.
2. En los casos que el contrato se perfeccione mediante orden de compra
o de servicios, el postor deber presentar la documentacin para la
suscripcin del contrato prevista en las Bases, dentro de los tres (3) das
hbiles siguientes al consentimiento de la Buena Pro, sin mediar citacin
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
154
DOJXQD$VLPLVPROD(QWLGDGGHEHUiQRWLFDUOHODRUGHQGHFRPSUDRGH
servicios en un plazo no mayor de cuatro (4) das hbiles siguientes a la
presentacin de dicha documentacin.
3. Cuando el postor ganador no presente la documentacin y/o no
concurra a suscribir el contrato, segn corresponda, en los plazos antes
indicados, perder automticamente la Buena Pro, sin perjuicio de la
sancin administrativa aplicable. En tal caso, el rgano encargado de las
contrataciones citar al postor que ocup el segundo lugar en el orden
GHSUHODFLyQDQTXHSUHVHQWHODGRFXPHQWDFLyQSDUDODVXVFULSFLyQGHO
contrato en el plazo previsto en el numeral 1, y posteriormente, concurra
a suscribir el contrato en el plazo previsto en dicho numeral. En el caso
TXHHOFRQWUDWRVHSHUIHFFLRQHFRQODQRWLFDFLyQGHODRUGHQGHFRPSUD
o de servicios, la Entidad citar al postor que ocup el segundo lugar
HQHORUGHQGHSUHODFLyQDQTXHSUHVHQWHODGRFXPHQWDFLyQSDUDOD
suscripcin del contrato en el plazo previsto en el numeral 2, debiendo
QRWLFDUOHGLFKDRUGHQHQHOSOD]RSUHYLVWRHQHOPLVPRQXPHUDO6LHVWH
postor no suscribe el contrato, dicho rgano declarar desierto el proceso
de seleccin, sin perjuicio de la sancin administrativa aplicable.
4. Cuando la Entidad no cumpla con suscribir el contrato dentro del plazo
establecido en el numeral 1, el postor ganador de la Buena Pro podr
requerirla para su suscripcin, dentro de los dos (2) das hbiles siguientes
de vencido el plazo para suscribir el contrato, dndole un plazo de entre
cinco (5) a diez (10) das hbiles. Vencido el plazo otorgado, sin que la
Entidad haya suscrito el contrato, dentro de los cinco (5) das hbiles
siguientes, tiene la facultad de dejar sin efecto el otorgamiento de la
Buena Pro.
&XDQGR OD (QWLGDG QR FXPSOD FRQ QRWLFDU OD RUGHQ GH FRPSUD R GH
servicios al contratista en el plazo establecido en el numeral 2, dentro de
los dos (2) das hbiles siguientes de vencido dicho plazo, el contratista
SRGUiUHTXHULUODSDUDTXHFXPSODFRQHIHFWXDUODQRWLFDFLyQHQHOSOD]R
de tres (3) das hbiles; vencido este plazo, el contratista podr solicitar
a la Entidad que deje sin efecto el otorgamiento de la Buena Pro.
74
Artculo 149.- Vigencia del Contrato
El contrato tiene vigencia desde el da siguiente de la suscripcin del documento
que lo contiene o, en su caso, desde la recepcin de la orden de compra o de servicio.
Tratndose de la adquisicin de bienes y servicios, el contrato rige hasta que
el funcionario competente d la conformidad de la recepcin de la prestacin a
cargo del contratista y se efecte el pago.
En el caso de ejecucin y consultora de obras, el contrato rige hasta el
consentimiento de la liquidacin y se efecte el pago correspondiente.
Concordancia: LCE: Artculo 42.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
155
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 150.- Casos especiales de vigencia contractual
1. Las Bases pueden establecer que el plazo del contrato sea por ms de
un ejercicio presupuestal, hasta un mximo de tres (3), salvo que por
leyes especiales o por la naturaleza de la prestacin se requieran plazos
mayores, siempre y cuando se adopten las previsiones presupuestarias
necesarias para garantizar el pago de las obligaciones.
2. En el caso de la ejecucin y consultora de obras, el plazo contractual
corresponder al previsto para su culminacin.
3. Tratndose de servicios de asesora legal, como el patrocinio judicial,
arbitral u otros similares, el plazo podr vincularse con la duracin del
encargo a contratarse.
4. Cuando se trate del arrendamiento de bienes inmuebles, el plazo
podr ser hasta por un mximo de tres (3) aos prorrogables en forma
sucesiva por igual o menor plazo; reservndose la Entidad el derecho
de resolver unilateralmente el contrato antes del vencimiento previsto,
sin reconocimiento de lucro cesante ni dao emergente, sujetndose los
reajustes que pudieran acordarse al ndice de Precios al Consumidor que
establece el Instituto Nacional de Estadstica e Informtica - INEI.
Artculo 151.- Cmputo de los plazos
Durante la vigencia del contrato, los plazos se computarn en das calendario,
excepto en los casos en los que el Reglamento indique lo contrario.
El plazo de ejecucin contractual se computa en das calendario desde el
da siguiente de la suscripcin del contrato o desde el da siguiente de cumplirse
las condiciones establecidas en las Bases. En el caso de contrataciones
perfeccionadas mediante orden de compra o de servicio, el plazo de ejecucin
se computa desde el da siguiente de recibida.
En ambos casos se aplicar supletoriamente lo dispuesto por los artculos
\GHO&yGLJR&LYLO
Artculo 152.- Fallas o defectos percibidos por el contratista luego del
perfeccionamiento del contrato.
El contratista debe comunicar a la Entidad las fallas o defectos que advierta en
ODVHVSHFLFDFLRQHVWpFQLFDVRWpUPLQRVGHUHIHUHQFLDGHORVELHQHVRVHUYLFLRV
a ser adquiridos o contratados, a ms tardar a los siete (7) das siguientes
del perfeccionamiento del contrato. Esta disposicin es slo aplicable a las
contrataciones cuyo monto correspondan a la Adjudicacin de Menor Cuanta
y en ningn caso ser aplicable a la Adjudicacin de Menor Cuanta Derivada.
La Entidad evaluar las observaciones formuladas por el contratista y se
pronunciar en el plazo de siete (7) das hbiles.
Si acoge las observaciones, la Entidad deber entregar las correcciones o
efectuar los cambios correspondientes, y si, adems, las fallas o defectos afectan
el plazo de ejecucin del contrato, ste empezar a correr nuevamente a partir
de dicha entrega o del momento en que se efecten los cambios.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
156
En caso de que las observaciones no fuesen admitidas, la Entidad har la
correspondiente comunicacin para que el contratista contine la prestacin
objeto del contrato, bajo responsabilidad de aquella respecto a las mencionadas
observaciones.
75
Artculo 153.- Responsabilidad de la Entidad
/D (QWLGDG HV UHVSRQVDEOH IUHQWH DO FRQWUDWLVWD GH ODV PRGLFDFLRQHV TXH
ordene y apruebe en los proyectos, estudios, informes o similares o de aqullos
cambios que se generen debido a la necesidad de la ejecucin de los mismos, sin
perjuicio de la responsabilidad que le corresponde a los autores de los proyectos,
estudios, informes o similares.
La Entidad es responsable de la obtencin de las licencias, autorizaciones,
permisos, servidumbre y similares para la ejecucin y consultora de obras,
salvo que en las Bases se estipule que la tramitacin de stas correr a cargo
del contratista.
76
Artculo 154.- Tributos, gravmenes y otros
Los tributos y gravmenes que correspondan al contratista, as como las
responsabilidades de carcter laboral y por el pago de las aportaciones sociales
de su personal, se regularn por las normas sobre la materia.
Asimismo, corresponde al contratista la contratacin de todos los seguros
necesarios para resguardar la integridad de los bienes, los recursos que se utilizan y
los terceros eventualmente afectados, de acuerdo con lo que establezcan las Bases.
CAPTULO II
GARANTAS
Artculo 155.- Garantas
Las bases del proceso de seleccin establecern el tipo de garanta que le
otorgar el postor y/o contratista, segn corresponda.
En los casos que resulte aplicable la retencin del diez por ciento (10%) del
PRQWRGHOFRQWUDWRRULJLQDOFRPRJDUDQWtDGHHOFXPSOLPLHQWRGLFKDUHWHQFLyQ
se efectuar durante la primera mitad del nmero total de pagos a realizarse, de
IRUPDSURUUDWHDGDFRQFDUJRDVHUGHYXHOWRDODQDOL]DFLyQGHOPLVPR
Las Entidades estn obligadas a aceptar las garantas que se hubieren emitido
conforme a lo dispuesto en los prrafos precedentes, bajo responsabilidad.
Aquellas empresas que no cumplan con honrar la garanta otorgada en el plazo
HVWDEOHFLGRHQHODUWtFXORGHOD/H\VHUiQVDQFLRQDGDVSRUOD6XSHULQWHQGHQFLD
de Banca, Seguros y Administradoras Privadas de Fondos de Pensiones.
Las garantas slo se harn efectivas por el motivo garantizado.
77
Concordancia: LCE: Artculo 39.
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
157
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 156.- Clases de garantas
En aquellos casos y en las oportunidades previstas en el Reglamento, el postor
o el contratista, segn corresponda, est obligado a presentar las siguientes
garantas:
*DUDQWtDGHHOFXPSOLPLHQWR
2. Garanta por el monto diferencial de la propuesta.
3. Garanta por adelantos.
78
Concordancia: LCE: Artculo 39.
Artculo 157.- (*)
'HURJDGRSRUHODUWtFXORGHO'HFUHWR6XSUHPR1()SXEOLFDGR
el 7 de agosto de 2012.
Artculo 158.- Garanta de fiel cumplimiento
Como requisito indispensable para suscribir el contrato, el postor ganador
GHEHHQWUHJDUDOD(QWLGDGODJDUDQWtDGHHOFXPSOLPLHQWRGHOPLVPR(VWD
deber ser emitida por una suma equivalente al diez por ciento (10%) del
monto del contrato original y tener vigencia hasta la conformidad de la
recepcin de la prestacin a cargo del contratista, en el caso de bienes y
VHUYLFLRV R KDVWD HO FRQVHQWLPLHQWR GH OD OLTXLGDFLyQ QDO HQ HO FDVR GH
ejecucin y consultora de obras.
De manera excepcional, respecto de aquellos contratos que tengan una
vigencia superior a un (1) ao, previamente a la suscripcin del contrato, las
Entidades podrn aceptar que el ganador de la Buena Pro presente la garanta
GHHOFXPSOLPLHQWR\GHVHUHOFDVRODJDUDQWtDSRUHOPRQWRGLIHUHQFLDOGH
la propuesta, con una vigencia de un (1) ao, con el compromiso de renovar
su vigencia hasta la conformidad de la recepcin de la prestacin o exista el
consentimiento de la liquidacin del contrato.
Concordancia: LCE: Artculo 39.
Artculo 159.- Garantas de fiel cumplimiento por prestaciones
accesorias
En las contrataciones de bienes, servicios o de obras que conllevan la
ejecucin de prestaciones accesorias, tales como mantenimiento, reparacin o
DFWLYLGDGHVDQHVVHRWRUJDUiXQDJDUDQWtDDGLFLRQDOSRUHVWHFRQFHSWRODPLVPD
que se renovar peridicamente hasta el cumplimiento total de las obligaciones
garantizadas, no pudiendo eximirse su presentacin en ningn caso. El OSCE
mediante Directiva establecer las disposiciones complementarias para la
aplicacin de esta garanta.
Concordancia: Directiva N 009-2009-OSCE/CD
78 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
158
Artculo 160.- Garanta por el monto diferencial de propuesta
Cuando la propuesta econmica fuese inferior al valor referencial en ms del
diez por ciento (10%) de ste en el proceso de seleccin para la contratacin de
servicios, o en ms del veinte por ciento (20%) de aqul en el proceso de seleccin
para la adquisicin o suministro de bienes, para la suscripcin del contrato el postor
ganador deber presentar una garanta adicional por un monto equivalente al
veinticinco por ciento (25%) de la diferencia entre el valor referencial y la propuesta
econmica. Dicha garanta deber tener vigencia hasta la conformidad de la
recepcin de la prestacin a cargo del contratista, en el caso de bienes y servicios.
Concordancia: LCE: Artculo 39.
Artculo 161.- Excepciones
1RVHFRQVWLWXLUiJDUDQWtDGHHOFXPSOLPLHQWR\JDUDQWtDGHHOFXPSOLPLHQWR
por prestaciones accesorias en los siguientes casos:
1. Contratos derivados de procesos de Adjudicacin de Menor Cuanta para
bienes y servicios, siempre que no provengan de procesos declarados
desiertos.
Dicha excepcin tambin ser aplicable en los contratos derivados
de procesos de seleccin segn relacin de tems, cuando el valor
referencial del tem o la sumatoria de los valores referenciales de los
tems adjudicados a un mismo postor no supere el monto establecido
para convocar a una Adjudicacin de Menor Cuanta.
2. Contratos de servicios derivados de procesos de Adjudicacin Directa
Selectiva o de procesos de seleccin segn relacin de tems cuando el
valor referencial del tem o la sumatoria de los valores referenciales de
los tems adjudicados a un mismo postor no supere el monto establecido
para convocar a una Adjudicacin Directa Selectiva.
3. Adquisicin de bienes inmuebles.
4. Contratacin ocasional de servicios de transporte cuando la Entidad recibe
los boletos respectivos contra el pago de los pasajes.
5. Contratos de arrendamiento de bienes muebles e inmuebles.
6. Las contrataciones complementarias celebradas bajo los alcances del
DUWtFXORFX\RVPRQWRVVHHQFXHQWUHQHQORVVXSXHVWRVSUHYLVWRV
en los numerales 1 y 2 del presente artculo.
La garanta por el monto diferencial de la propuesta no se presentar en
los casos previstos en los numerales 1, 3, 4, 5 y para la celebracin de las
FRQWUDWDFLRQHVFRPSOHPHQWDULDVEDMRORVDOFDQFHVGHODUWtFXOR
79
Artculo 162.- Garanta por adelantos
La Entidad slo puede entregar los adelantos previstos en las Bases y
solicitados por el contratista, contra la presentacin de una garanta emitida
por idntico monto y un plazo mnimo de vigencia de tres (3) meses, renovable
79 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
159
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
trimestralmente por el monto pendiente de amortizar, hasta la amortizacin total
del adelanto otorgado. La presentacin de esta garanta no puede ser exceptuada
en ningn caso.
Cuando el plazo de ejecucin contractual sea menor a tres (3) meses, las
garantas podrn ser emitidas con una vigencia menor, siempre que cubra la
fecha prevista para la amortizacin total del adelanto otorgado.
Tratndose de los adelantos de materiales, la garanta se mantendr vigente
hasta la utilizacin de los materiales o insumos a satisfaccin de la Entidad,
pudiendo reducirse de manera proporcional de acuerdo con el desarrollo respectivo.
Concordancia: LCE: Artculos 38 y 39.
Artculo 163.- Garantas a cargo de la Entidad
En los contratos de arrendamiento de bienes muebles e inmuebles, la garanta
ser entregada por la Entidad al arrendador en los trminos previstos en el contrato.
Dicha garanta cubrir las obligaciones derivadas del contrato, con excepcin de
la indemnizacin por lucro cesante y dao emergente.
Artculo 164.- Ejecucin de garantas
Las garantas se ejecutarn a simple requerimiento de la Entidad en los
siguientes supuestos:
1. Cuando el contratista no la hubiere renovado antes de la fecha de su
vencimiento. Contra esta ejecucin, el contratista no tiene derecho a
interponer reclamo alguno.
Una vez culminado el contrato, y siempre que no existan deudas a cargo
del contratista, el monto ejecutado le ser devuelto a ste sin dar lugar
al pago de intereses. Tratndose de las garantas por adelantos, no
corresponde devolucin alguna por entenderse amortizado el adelanto
otorgado.
/D JDUDQWtD GH HO FXPSOLPLHQWR \ OD JDUDQWtD DGLFLRQDO SRU HO PRQWR
diferencial de propuesta se ejecutarn, en su totalidad, slo cuando la
resolucin por la cual la Entidad resuelve el contrato por causa imputable
al contratista, haya quedado consentida o cuando por laudo arbitral
consentido y ejecutoriado se declare procedente la decisin de resolver
el contrato. El monto de las garantas corresponder ntegramente a la
(QWLGDGLQGHSHQGLHQWHPHQWHGHODFXDQWLFDFLyQGHOGDxRHIHFWLYDPHQWH
irrogado.
,JXDOPHQWHODJDUDQWtDGHHOFXPSOLPLHQWR\GHVHUQHFHVDULRODJDUDQWtD
por el monto diferencial de propuesta, se ejecutarn cuando transcurridos
tres (3) das de haber sido requerido por la Entidad, el contratista no
hubiera cumplido con pagar el saldo a su cargo establecido en el acta
de conformidad de la recepcin de la prestacin a cargo del contratista,
HQHOFDVRGHELHQHV\VHUYLFLRVRHQODOLTXLGDFLyQQDOGHOFRQWUDWR
debidamente consentida o ejecutoriada, en el caso de ejecucin de obras.
Esta ejecucin ser solicitada por un monto equivalente al citado saldo
a cargo del contratista.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
160
CAPTULO III
INCUMPLIMIENTO DEL CONTRATO
Artculo 165.- Penalidad por mora en la ejecucin de la prestacin
(QFDVRGHUHWUDVRLQMXVWLFDGRHQODHMHFXFLyQGHODVSUHVWDFLRQHVREMHWRGHO
contrato, la Entidad le aplicar al contratista una penalidad por cada da de atraso,
hasta por un monto mximo equivalente al diez por ciento (10%) del monto del
contrato vigente o, de ser el caso, del tem que debi ejecutarse. Esta penalidad
VHUiGHGXFLGDGHORVSDJRVDFXHQWDGHOSDJRQDORHQODOLTXLGDFLyQQDORVL
fuese necesario se cobrar del monto resultante de la ejecucin de las garantas
GHHOFXPSOLPLHQWRRSRUHOPRQWRGLIHUHQFLDOGHSURSXHVWD
En todos los casos, la penalidad se aplicar automticamente y se calcular
de acuerdo con la siguiente frmula:
Penalidad diaria = 0.10 x Monto
F x Plazo en das
Donde F tendr los siguientes valores:
a) Para plazos menores o iguales a sesenta (60) das, para bienes, servi-
cios y ejecucin de obras: F = 0.40.
b) Para plazos mayores a sesenta (60) das:
b.1) Para bienes y servicios: F = 0.25.
b.2) Para obras: F = 0.15.
7DQWRHOPRQWRFRPRHOSOD]RVHUHHUHQVHJ~QFRUUHVSRQGDDOFRQWUDWRRtWHP
que debi ejecutarse o, en caso que estos involucraran obligaciones de ejecucin
peridica, a la prestacin parcial que fuera materia de retraso.
Cuando se llegue a cubrir el monto mximo de la penalidad, la Entidad podr
resolver el contrato por incumplimiento.
Para efectos del clculo de la penalidad diaria se considerar el monto del
contrato vigente.
Concordancia: LCE: Artculo 48.
Artculo 166.- Otras penalidades
En las Bases se podrn establecer penalidades distintas a la mencionada en
el artculo precedente, siempre y cuando sean objetivas, razonables y congruentes
con el objeto de la convocatoria, hasta por un monto mximo equivalente al diez
por ciento (10%) del monto del contrato vigente o, de ser el caso, del tem que
debi ejecutarse. Estas penalidades se calcularn de forma independiente a la
penalidad por mora.
Concordancia: LCE: Artculo 48.
161
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 167.- Resolucin de Contrato
&XDOTXLHUDGHODVSDUWHVSXHGHSRQHUQDOFRQWUDWRSRUXQKHFKRVREUHYLQLHQWH
a la suscripcin del mismo, siempre que se encuentre previsto expresamente en
el contrato con sujecin a la Ley.
Por igual motivo, se puede resolver el contrato en forma parcial, dependiendo
de los alcances del incumplimiento, de la naturaleza de las prestaciones, o de
algn otro factor relevante, siempre y cuando sea posible sin afectar el contrato
en su conjunto.
Concordancia: LCE: Artculos 40 inciso c), 44.
Artculo 168.- Causales de resolucin por incumplimiento
La Entidad podr resolver el contrato, de conformidad con el inciso c) del
DUWtFXORGHOD/H\HQORVFDVRVHQTXHHOFRQWUDWLVWD
,QFXPSOD LQMXVWLFDGDPHQWH REOLJDFLRQHV FRQWUDFWXDOHV OHJDOHV R
reglamentarias a su cargo, pese a haber sido requerido para ello.
2. Haya llegado a acumular el monto mximo de la penalidad por mora o el
monto mximo para otras penalidades, en la ejecucin de la prestacin
a su cargo; o
3DUDOLFHRUHGX]FDLQMXVWLFDGDPHQWHODHMHFXFLyQGHODSUHVWDFLyQSHVH
a haber sido requerido para corregir tal situacin.
El contratista podr solicitar la resolucin del contrato, de conformidad con
HOLQFLVRFGHODUWtFXORGHOD/H\HQORVFDVRVHQTXHOD(QWLGDGLQFXPSOD
LQMXVWLFDGDPHQWHVXVREOLJDFLRQHVHVHQFLDOHVODVPLVPDVTXHVHFRQWHPSODQHQ
las Bases o en el contrato, pese a haber sido requerido conforme al procedimiento
HVWDEOHFLGRHQHODUWtFXOR
Concordancia: LCE: Artculo 40 inciso c).
Artculo 169.- Procedimiento de resolucin de Contrato
Si alguna de las partes falta al cumplimiento de sus obligaciones, la parte
perjudicada deber requerirla mediante carta notarial para que las satisfaga en
un plazo no mayor a cinco (5) das, bajo apercibimiento de resolver el contrato.
Dependiendo del monto contractual y de la complejidad, envergadura o
VRVWLFDFLyQ GH OD FRQWUDWDFLyQ OD (QWLGDG SXHGH HVWDEOHFHU SOD]RV PD\RUHV
pero en ningn caso mayor a quince (15) das, plazo este ltimo que se otorgar
necesariamente en el caso de obras. Si vencido dicho plazo el incumplimiento
contina, la parte perjudicada podr resolver el contrato en forma total o parcial,
comunicando mediante carta notarial la decisin de resolver el contrato.
No ser necesario efectuar un requerimiento previo cuando la resolucin del
contrato se deba a la acumulacin del monto mximo de penalidad por mora,
o por otras penalidades, o cuando la situacin de incumplimiento no pueda ser
revertida. En este caso, bastar comunicar al contratista mediante carta notarial
la decisin de resolver el contrato.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
162
En el caso de las contrataciones efectuadas a travs de la modalidad de
Convenio Marco, las comunicaciones antes indicadas se debern realizar a
travs del SEACE.
La resolucin parcial slo involucrar a aquella parte del contrato afectada
por el incumplimiento y siempre que dicha parte sea separable e independiente
del resto de las obligaciones contractuales, y que la resolucin total del contrato
pudiera afectar los intereses de la Entidad. En tal sentido, el requerimiento que
se efecte deber precisar con claridad qu parte del contrato quedara resuelta
si persistiera el incumplimiento.
De no hacerse tal precisin, se entender que la resolucin ser total en caso
de persistir el incumplimiento.
80
Concordancia: LCE: Artculo 40 inciso c).
Artculo 170.- Efectos de la resolucin
Si la parte perjudicada es la Entidad, sta ejecutar las garantas que el
contratista hubiera otorgado, sin perjuicio de la indemnizacin por los mayores
daos y perjuicios irrogados.
Si la parte perjudicada es el contratista, la Entidad deber reconocerle la
respectiva indemnizacin por los daos y perjuicios irrogados, bajo responsabilidad
del Titular de la Entidad.
Cualquier controversia relacionada con la resolucin del contrato podr ser
sometida por la parte interesada a conciliacin y/o arbitraje dentro de los quince
(15) das hbiles siguientes de comunicada la resolucin. Vencido este plazo
sin que se haya iniciado ninguno de estos procedimientos, se entender que la
resolucin del contrato ha quedado consentida.
CAPTULO IV
ADELANTOS, ADICIONALES, REDUCCIONES Y AMPLIACIONES
Artculo 171.- Clases de Adelantos
Las Bases podrn establecer adelantos directos al contratista, los que en
ningn caso excedern en conjunto del treinta por ciento (30%) del monto del
contrato original.
Concordancia: LCE: Artculo 38.
Artculo 172.- Entrega de Adelantos
La Entidad debe establecer en las Bases el plazo en el cual el contratista
solicitar el adelanto, vencido dicho plazo no proceder la solicitud.
La entrega del adelanto se har en la oportunidad y plazo establecidos en
las Bases.
En el supuesto que no se entregue el adelanto en dicho plazo, el contratista
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
163
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
tiene derecho a solicitar la ampliacin del plazo de ejecucin de la prestacin
SRUHOQ~PHURGHGtDVHTXLYDOHQWHDODGHPRUDFRQIRUPHDODUWtFXORGHO
Reglamento.
81
Artculo 173.- Amortizacin de los Adelantos
La amortizacin de los adelantos se har mediante descuentos proporcionales
en cada uno de los pagos parciales que se efecten al contratista por la ejecucin
de la o las prestaciones a su cargo.
Cualquier diferencia que se produzca respecto de la amortizacin parcial de
los adelantos se tomar en cuenta al momento de efectuar el siguiente pago que
le corresponda al contratista o al momento de la conformidad de la recepcin de
la prestacin.
Artculo 174.- Adicionales y Reducciones
3DUDDOFDQ]DUODQDOLGDGGHOFRQWUDWR\PHGLDQWHUHVROXFLyQSUHYLDHO7LWXODU
de la Entidad podr disponer la ejecucin de prestaciones adicionales hasta por
el lmite del veinticinco por ciento (25%) del monto del contrato original, para lo
cual deber contar con la asignacin presupuestal necesaria. El costo de los
DGLFLRQDOHVVHGHWHUPLQDUiVREUHODEDVHGHODVHVSHFLFDFLRQHVWpFQLFDVGHO
bien o trminos de referencia del servicio y de las condiciones y precios pactados
en el contrato; en defecto de estos se determinar por acuerdo entre las partes.
Igualmente, podr disponerse la reduccin de las prestaciones hasta el lmite
del veinticinco por ciento (25%) del monto del contrato original.
En caso de adicionales o reducciones, el contratista aumentar o reducir de
forma proporcional las garantas que hubiere otorgado, respectivamente.
Los adicionales o reducciones que se dispongan durante la ejecucin de
proyectos de inversin pblica debern ser comunicados por la Entidad a la
autoridad competente del Sistema Nacional de Inversin Pblica.
82
Concordancia: LCE: Artculo 41.
Artculo 175.- Ampliacin del plazo contractual
Procede la ampliacin del plazo en los siguientes casos:
1. Cuando se aprueba el adicional, siempre y cuando afecte el plazo.
En este caso, el contratista ampliar el plazo de las garantas que hubiere
otorgado.
2. Por atrasos o paralizaciones no imputables al contratista.
3. Por atrasos o paralizaciones en el cumplimiento de la prestacin del
contratista por culpa de la Entidad; y,
4. Por caso fortuito o fuerza mayor.
El contratista deber solicitar la ampliacin dentro de los siete (7) das hbiles
VLJXLHQWHVDODQRWLFDFLyQGHODDSUREDFLyQGHODGLFLRQDORGHQDOL]DGRHOKHFKR
generador del atraso o paralizacin.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
164
/D (QWLGDG GHEH UHVROYHU VREUH GLFKD VROLFLWXG \ QRWLFDU VX GHFLVLyQ DO
contratista en el plazo de diez (10) das hbiles, computado desde el da siguiente
de su presentacin. De no existir pronunciamiento expreso, se tendr por aprobada
la solicitud del contratista, bajo responsabilidad del Titular de la Entidad.
En virtud de la ampliacin otorgada, la Entidad ampliar el plazo de los
contratos directamente vinculados al contrato principal.
Las ampliaciones de plazo en contratos de bienes o para la prestacin de
servicios darn lugar al pago de los gastos generales debidamente acreditados.
En el caso de la consultora de obras, debe pagarse al contratista, adems del
gasto general variable, el costo directo.
Cualquier controversia relacionada con la ampliacin del plazo por parte de la
Entidad podr ser sometida a conciliacin y/o arbitraje dentro de los quince (15)
das hbiles posteriores a la comunicacin de esta decisin.
83
CAPITULO V
CULMINACIN DE LA EJECUCIN CONTRACTUAL
Artculo 176.- Recepcin y conformidad
La recepcin y conformidad es responsabilidad del rgano de administracin
o, en su caso, del rgano establecido en las Bases, sin perjuicio de lo que se
disponga en las normas de organizacin interna de la Entidad.
La conformidad requiere del informe del funcionario responsable del rea
XVXDULDTXLHQGHEHUiYHULFDUGHSHQGLHQGRGHODQDWXUDOH]DGHODSUHVWDFLyQ
la calidad, cantidad y cumplimiento de las condiciones contractuales, debiendo
realizar las pruebas que fueran necesarias.
Tratndose de rdenes de compra o de servicio, derivadas de Adjudicaciones
de Menor Cuanta distintas a las de consultora y ejecucin de obras, la
conformidad puede consignarse en dicho documento.
De existir observaciones se consignaran en el acta respectiva, indicndose
claramente el sentido de estas, dndose al contratista un plazo prudencial para
su subsanacin, en funcin a la complejidad del bien o servicio. Dicho plazo no
podr ser menor de dos (2) ni mayor de diez (10) das calendario. Si pese al
plazo otorgado, el contratista no cumpliese a cabalidad con la subsanacin, la
Entidad podr resolver el contrato, sin perjuicio de aplicar las penalidades que
correspondan.
Este procedimiento no ser aplicable cuando los bienes y/o servicios
PDQLHVWDPHQWHQRFXPSODQFRQODVFDUDFWHUtVWLFDV\FRQGLFLRQHVRIUHFLGDVHQ
cuyo caso la Entidad no efectuar la recepcin, debiendo considerarse como no
ejecutada la prestacin, aplicndose las penalidades que correspondan.
Las discrepancias en relacin a la recepcin y/o conformidad, as como la
negativa de la Entidad de efectuarlas podrn ser sometidas a conciliacin y/o
arbitraje dentro del plazo de quince (15 ) das hbiles de ocurrida la recepcin, la
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
165
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
negativa o de vencido el plazo para otorgar la conformidad, segn corresponda.
La recepcin conforme de la Entidad no enerva su derecho a reclamar
posteriormente por defectos o vicios ocultos.
84
Artculo 177.- Efectos de la conformidad
Luego de haberse dado la conformidad a la prestacin se genera el derecho al
pago del contratista. Efectuado el pago culmina el contrato y se cierra el expediente
de contratacin respectivo.
Las discrepancias referidas a defectos o vicios ocultos deber ser sometidas
a conciliacin y/o arbitraje. En dicho caso el plazo de caducidad se computar a
partir de la conformidad otorgada por la Entidad hasta quince (15) das hbiles
posteriores al vencimiento del plazo de responsabilidad del contratista previsto
en el contrato.
85
Concordancia: LCE: Artculo 42.
Artculo 178.- Constancia de prestacin
Otorgada la conformidad de la prestacin, el rgano de administracin o
el funcionario designado expresamente por la Entidad es el nico autorizado
SDUD RWRUJDU DO FRQWUDWLVWD GH RFLR R D SHGLGR GH SDUWH XQD FRQVWDQFLD TXH
GHEHUiSUHFLVDUFRPRPtQLPRODLGHQWLFDFLyQGHOREMHWRGHOFRQWUDWRHOPRQWR
correspondiente y las penalidades en que hubiera incurrido el contratista.
Slo se podr diferir la entrega de la constancia en los casos en que hubieran
penalidades, hasta que stas sean canceladas.
Artculo 179.- Liquidacin del Contrato de Consultora de Obra
1. El contratista presentar a la Entidad la liquidacin del contrato de
consultora de obra dentro de los quince (15) das siguientes de haberse
otorgado la conformidad de la ltima prestacin. La Entidad deber
SURQXQFLDUVHUHVSHFWRGHGLFKDOLTXLGDFLyQ\QRWLFDUVXSURQXQFLDPLHQWR
dentro de los quince (15) das siguientes de recibida; de no hacerlo, se
tendr por aprobada la liquidacin presentada por el contratista.
Si la Entidad observa la liquidacin presentada por el contratista, ste
GHEHUiSURQXQFLDUVH\QRWLFDUVXSURQXQFLDPLHQWRHQHOSOD]RGHFLQFR
(5) das de haber recibido la observacin; de no hacerlo, se tendr por
aprobada la liquidacin con las observaciones formuladas por la Entidad.
En el caso que el contratista no acoja las observaciones formuladas por
la Entidad, deber manifestarlo por escrito dentro del plazo previsto en el
prrafo anterior. En tal supuesto, dentro de los quince (15) das hbiles
siguientes, cualquiera de las partes deber solicitar el sometimiento de
esta controversia a conciliacin y/o arbitraje, segn corresponda, en la
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
166
IRUPDHVWDEOHFLGDHQORVDUWtFXORV\R
2. Cuando el contratista no presente la liquidacin en el plazo indicado,
OD(QWLGDGGHEHUiHIHFWXDUOD\QRWLFDUODGHQWURGHORVTXLQFHGtDV
siguientes, a costo del contratista; si ste no se pronuncia dentro de los
FLQFRGtDVGHQRWLFDGRGLFKDOLTXLGDFLyQTXHGDUiFRQVHQWLGD
Si el contratista observa la liquidacin practicada por la Entidad, sta
GHEHUiSURQXQFLDUVH\QRWLFDUVXSURQXQFLDPLHQWRGHQWURGHORVFLQFR
(5) das siguientes; de no hacerlo, se tendr por aprobada la liquidacin
con las observaciones formuladas por el contratista.
En el caso de que la Entidad no acoja las observaciones formuladas por
el contratista, deber manifestarlo por escrito dentro del plazo previsto en
el prrafo anterior. En tal supuesto, dentro de los quince (15) das hbiles
siguientes, cualquiera de las partes deber solicitar el sometimiento de
esta controversia a conciliacin y/o arbitraje, segn corresponda, en la
IRUPDHVWDEOHFLGDHQORVDUWtFXORV\R
3. Toda discrepancia respecto de la liquidacin, incluso las controversias
relativas a su consentimiento o al incumplimiento de los pagos que
resulten de la misma, se resuelve mediante conciliacin y/o arbitraje,
sin perjuicio del cobro de la parte no controvertida.
Las controversias en relacin a los pagos que la Entidad debe efectuar
al contratista podrn ser sometidas a conciliacin y/o arbitraje dentro del
plazo de quince (15) das hbiles siguientes de vencido el plazo para
hacer efectivo el pago de acuerdo a lo previsto en el contrato.
Una vez que la liquidacin haya quedado consentida, no procede
ninguna impugnacin, salvo las referidas a defectos o vicios ocultos, las
que sern resueltas mediante conciliacin y arbitraje, de acuerdo con el
SOD]RVHxDODGRHQHODUWtFXORGHO5HJODPHQWR
86
CAPTULO VI
EL PAGO
Artculo 180.- Oportunidad del pago
Todos los pagos que la Entidad deba realizar a favor del contratista por
concepto de los bienes o servicios objeto del contrato, se efectuarn despus de
ejecutada la respectiva prestacin; salvo que, por razones de mercado, el pago
del precio sea condicin para la entrega de los bienes o la realizacin del servicio.
La Entidad podr realizar pagos peridicos al contratista por el valor de los
bienes y servicios contratados en cumplimiento del objeto del contrato, siempre
TXHHVWpQMDGRVHQODV%DVHV\TXHHOFRQWUDWLVWDORVVROLFLWHSUHVHQWDQGROD
GRFXPHQWDFLyQ TXH MXVWLTXH HO SDJR \ DFUHGLWH OD H[LVWHQFLD GH ORV ELHQHV R
OD SUHVWDFLyQ GH ORV VHUYLFLRV /DV %DVHV SRGUiQ HVSHFLFDU RWUDV IRUPDV GH
acreditacin de la obligacin. Los montos entregados tendrn el carcter de
pagos a cuenta.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
167
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En el caso que se haya suscrito contrato con un consorcio, el pago se realizar
de acuerdo a lo que se indique en el contrato de consorcio.
Concordancia: LCE: Artculo 42.
Artculo 181.- Plazos para los pagos
La Entidad deber pagar las contraprestaciones pactadas a favor del contratista
en la oportunidad establecida en las Bases o en el contrato. Para tal efecto, el
responsable de otorgar la conformidad de recepcin de los bienes o servicios,
deber hacerlo en un plazo que no exceder de los diez (10) das calendario de ser
pVWRVUHFLELGRVDQTXHOD(QWLGDGFXPSODFRQODREOLJDFLyQGHHIHFWXDUHOSDJR
GHQWURGHORVTXLQFHGtDVFDOHQGDULRVLJXLHQWHVVLHPSUHTXHVHYHULTXHQ
las dems condiciones establecidas en el contrato.
En caso de retraso en el pago, el contratista tendr derecho al pago de
LQWHUHVHVFRQIRUPHDORHVWDEOHFLGRHQHODUWtFXORGHOD/H\FRQWDGRGHVGHOD
oportunidad en que el pago debi efectuarse.
Las controversias en relacin a los pagos que la Entidad debe efectuar al
contratista podrn ser sometidas a conciliacin y/o arbitraje dentro del plazo de
quince (15) das hbiles siguientes de vencido el plazo para hacer efectivo el
pago.
87
Concordancia: LCE: Artculo 48.
Artculo 182.- Contrataciones Complementarias
Dentro de los tres (3) meses posteriores a la culminacin del contrato, la
Entidad podr contratar complementariamente bienes y servicios con el mismo
contratista, por nica vez y en tanto culmine el proceso de seleccin convocado,
hasta por un mximo del treinta por ciento (30%) del monto del contrato original,
siempre que se trate del mismo bien o servicio y que el contratista preserve las
condiciones que dieron lugar a la adquisicin o contratacin.
No ser condicin de la contratacin complementaria la convocatoria del
proceso de seleccin, en aquellos casos en los que con dicha contratacin
complementaria se agote la necesidad de la Entidad, lo que debe ser sustentado
por el rea usuaria al formular su requerimiento.
No caben contrataciones complementarias a los contratos de consultora de
obra.
88
Concordancia: RLCE: Artculo 136.
CAPTULO VII
OBRAS
Artculo 183.- Requisitos adicionales para la suscripcin del Contrato de Obra
Para la suscripcin del contrato de ejecucin de obra, adicionalmente a lo
SUHYLVWR HQ HO DUWtFXOR HO SRVWRU JDQDGRU GHEHUi FXPSOLU ORV VLJXLHQWHV
requisitos:
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
168
1. Presentar la constancia de Capacidad Libre de Contratacin expedida
por el RNP.
2. Designar al residente de la obra, cuando no haya formado parte de la
propuesta tcnica.
3. Entregar el calendario de avance de obra valorizado sustentado en el
Programa de Ejecucin de Obra (PERT-CPM).
4. Entregar el calendario de adquisicin de materiales o insumos
necesarios para la ejecucin de obra, en concordancia con el calendario
de avance de obra valorizado. Este calendario se actualizar con cada
ampliacin de plazo otorgada, en concordancia con el calendario de
avance de obra valorizado vigente.
5. Entregar el desagregado por partidas que dio origen a su propuesta,
en el caso de obras sujeto al sistema de suma alzada.
89
Artculo 184.- Inicio del plazo de ejecucin de obra
El inicio del plazo de ejecucin de obra comienza a regir desde el da siguiente
de que se cumplan las siguientes condiciones:
1. Que se designe al inspector o al supervisor, segn corresponda;
2. Que la Entidad haya hecho entrega del expediente tcnico de obra
completo;
3. Que la Entidad haya hecho entrega del terreno o lugar donde se
ejecutar la obra;
4. Que la Entidad provea el calendario de entrega de los materiales
e insumos que, de acuerdo con las Bases, hubiera asumido como
obligacin;
5. Que se haya entregado el adelanto directo al contratista, en las
FRQGLFLRQHV\RSRUWXQLGDGHVWDEOHFLGDVHQHODUWtFXOR
/DVFRQGLFLRQHVDTXHVHUHHUHQORVQXPHUDOHVSUHFHGHQWHVGHEHUiQVHU
cumplidas dentro de los quince (15) das contados a partir del da siguiente de la
suscripcin del contrato.
En caso no se haya solicitado la entrega del adelanto directo, el plazo se inicia
con el cumplimiento de las dems condiciones.
Si la Entidad no cumple con lo dispuesto en los numerales precedentes por
causas imputables a sta, el contratista podr iniciar el procedimiento de resolucin
del contrato dentro del plazo de quince (15) das de vencido el plazo previsto en
HOSiUUDIRDQWHULRUGHDFXHUGRDORVHxDODGRHQHODUWtFXOR$VLPLVPRHQ
el mismo plazo tendr derecho a solicitar resarcimiento de daos y perjuicios
debidamente acreditados, hasta por un monto equivalente al cinco por diez mil
(5/10000) del monto del contrato por da y hasta por un tope de setenta y cinco por
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
169
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
diez mil (75/10000). La Entidad debe pronunciarse sobre dicha solicitud en el plazo
de diez (10) das hbiles de presentada. Respecto al derecho de resarcimiento,
el contratista podr iniciar un procedimiento de conciliacin y/o arbitraje dentro
de los quince (15) das hbiles de vencido el plazo con el que cuenta la Entidad
para pronunciarse sobre la solicitud.
Si cumplidas las condiciones antes indicadas, la estacionalidad climtica
no permitiera el inicio de la ejecucin de la obra, la Entidad podr acordar con
el contratista la fecha para el inicio de la ejecucin. Dicha decisin deber
ser sustentada en un informe tcnico que formar parte del expediente de
contratacin.
90
Artculo 185.- Residente de Obra
En toda obra se contar de modo permanente y directo con un profesional
colegiado, habilitado y especializado designado por el contratista, previa
conformidad de la Entidad, como residente de la obra, el cual podr ser ingeniero
o arquitecto, segn corresponda a la naturaleza de los trabajos, con no menos
de dos (2) aos de experiencia en la especialidad.
/DV%DVHVSXHGHQHVWDEOHFHUFDOLFDFLRQHV\H[SHULHQFLDVDGLFLRQDOHVTXH
deber cumplir el residente, en funcin de la naturaleza, envergadura y complejidad
de la obra.
Por su sola designacin, el residente representa al contratista para los efectos
RUGLQDULRVGHODREUDQRHVWDQGRIDFXOWDGRDSDFWDUPRGLFDFLRQHVDOFRQWUDWR
La sustitucin del residente slo proceder previa autorizacin escrita del
IXQFLRQDULRGHOD(QWLGDGTXHFXHQWHFRQIDFXOWDGHVVXFLHQWHVSDUDHOORGHQWUR
de los ocho (8) das hbiles siguientes de presentada la solicitud a la Entidad.
Transcurrido dicho plazo sin que la Entidad emita pronunciamiento se considerar
DSUREDGDODVXVWLWXFLyQ(OUHHPSOD]DQWHGHEHUiUHXQLUFDOLFDFLRQHVSURIHVLRQDOHV
iguales o superiores a las del profesional reemplazado.
91
Concordancia: LCE: Artculo 43.
Artculo 186.- Clases de Adelantos en Obras
Las Bases podrn establecer los siguientes adelantos:
1. Directos al contratista, los que en ningn caso excedern en conjunto
del veinte por ciento (20%) del monto del contrato original.
2. Para materiales o insumos a utilizarse en el objeto del contrato, los que
en conjunto no debern superar el cuarenta por ciento (40%) del monto
del contrato original.
Concordancia: LCE: Artculo 38.
Artculo 187.- Entrega del Adelanto Directo
En el caso que en las Bases se haya establecido el otorgamiento de este
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
170
adelanto, el contratista dentro de los ocho (8) das siguientes a la suscripcin del
contrato, podr solicitar formalmente la entrega del adelanto, adjuntando a su
solicitud la garanta y el comprobante de pago correspondiente, vencido dicho
plazo no proceder la solicitud.
La Entidad debe entregar el monto solicitado dentro de los siete (7) das
contados a partir del da siguiente de recibida la mencionada documentacin.
En el caso que las Bases hubieran previsto entregas parciales del adelanto
directo, se considerar que la condicin establecida en el inciso 5) del artculo
VHGDUiSRUFXPSOLGDFRQODHQWUHJDGHOSULPHUGHVHPEROVR
92
Artculo 188.- Entrega del Adelanto para Materiales e Insumos
La Entidad debe establecer en las Bases el plazo en el cual el contratista
solicitar el adelanto, as como el plazo en el cual entregar el adelanto, con
ODQDOLGDGTXHHOFRQWUDWLVWDSXHGDGLVSRQHUGHORVPDWHULDOHVRLQVXPRVHQOD
oportunidad prevista en el calendario de adquisicin de materiales o insumos.
Las solicitudes de otorgamiento de adelantos para materiales o insumos
debern ser realizadas una vez iniciada la ejecucin contractual, teniendo en
consideracin el calendario de adquisicin de materiales o insumos presentado
por el contratista y los plazos establecidos en las Bases para solicitar y entregar
dichos adelantos.
No proceder el otorgamiento del adelanto de materiales o insumos en los
casos en que las solicitudes correspondientes sean realizadas con posterioridad
a las fechas sealadas en el calendario de adquisicin de materiales e insumos.
Para el otorgamiento del adelanto para materiales o insumos se deber tener
HQFXHQWDORGLVSXHVWRHQHO'HFUHWR6XSUHPR19&\VXVPRGLFDWRULDV
ampliatorias y complementarias.
93
Artculo 189.- Amortizacin de Adelantos
La amortizacin del adelanto directo se har mediante descuentos
proporcionales en cada una de las valorizaciones de obra.
La amortizacin del adelanto para materiales e insumos se realizar de acuerdo
FRQ OR GLVSXHVWR HQ HO 'HFUHWR 6XSUHPR 1 9& \ VXV PRGLFDWRULDV
ampliatorias y complementarias.
Cualquier diferencia que se produzca respecto de la amortizacin de los
adelantos se tomar en cuenta al momento de efectuar el pago siguiente que le
corresponda al contratista y/o en la liquidacin.
Artculo 190.- Inspector o Supervisor de Obras
Toda obra contar de modo permanente y directo con un inspector o con
un supervisor, quedando prohibida la existencia de ambos en una misma
obra.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
171
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
El inspector ser un profesional, funcionario o servidor de la Entidad,
expresamente designado por sta, mientras que el supervisor ser una persona
QDWXUDO R MXUtGLFD HVSHFLDOPHQWH FRQWUDWDGD SDUD GLFKR Q (Q HO FDVR GH VHU
una persona jurdica, sta designar a una persona natural como supervisor
permanente en la obra.
El inspector o supervisor, segn corresponda, debe cumplir por lo menos con
ODVPLVPDVFDOLFDFLRQHVSURIHVLRQDOHVHVWDEOHFLGDVSDUDHOUHVLGHQWHGHREUD
Ser obligatorio contratar un supervisor cuando el valor de la obra a ejecutarse
sea igual o mayor al monto establecido en la Ley de Presupuesto del Sector
3~EOLFRSDUDHODxRVFDOUHVSHFWLYR
Concordancia: LCE: Artculo 47.
Artculo 191.- Costo de la supervisin o inspeccin
El costo de la supervisin no exceder del diez por ciento (10%) del valor
referencial de la obra o del monto vigente del contrato de obra, el que resulte
mayor, con excepcin de los casos sealados en los prrafos siguientes. Los
gastos que genere la inspeccin no deben superar el cinco por ciento (5%)
del valor referencial de la obra o del monto vigente del contrato de obra, el
que resulte mayor.
Cuando en los casos distintos a los de adicionales de obra, se produzcan
variaciones en el plazo de la obra o variaciones en el ritmo de trabajo de
la obra, autorizadas por la Entidad, y siempre que impliquen mayores
prestaciones en la supervisin que resulten indispensables para el adecuado
control de la obra, el Titular de la Entidad puede autorizarlas, bajo las mismas
condiciones del contrato original y hasta por un mximo del quince por ciento
(15%) del monto del contrato original de supervisin, considerando para el
clculo todas las prestaciones adicionales previamente autorizadas por este
mismo supuesto, as como aquella que se requiere aprobar.
Cuando dichas prestaciones superen el quince por ciento (15%), se
requiere aprobacin previa al pago de la Contralora General de la Repblica,
la que deber pronunciarse en un plazo no mayor de quince (15) das hbiles,
el mismo que se computar desde que la Entidad presenta la documentacin
sustentatoria correspondiente, transcurrido el cual sin haberse emitido
pronunciamiento, las prestaciones adicionales se considerarn aprobadas,
sin perjuicio del control posterior.
En los casos en que se generen prestaciones adicionales en la ejecucin
GHODREUDVHDSOLFDUiSDUDODVXSHUYLVLyQORGLVSXHVWRHQORVDUWtFXORV
\VHJ~QFRUUHVSRQGD
A estos supuestos no les ser aplicable el lmite establecido en el numeral
GHODUWtFXORGHOD/H\
94
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
172
Artculo 192.- Obligaciones del contratista de obra en caso de atraso en la
QDOL]DFLyQGHODREUD
En caso de atrasos en la ejecucin de la obra por causas imputables al
contratista, con respecto a la fecha consignada en el calendario de avance de
obra vigente, y considerando que dicho atraso producir una extensin de los
servicios de inspeccin o supervisin, lo que genera un mayor costo, el contratista
de la ejecucin de obra asumir el pago del monto equivalente al de los servicios
indicados, lo que se har efectivo deduciendo dicho monto de la liquidacin del
contrato de ejecucin de obra. Durante la ejecucin de la obra dicho costo ser
asumido por la Entidad.
Artculo 193.- Funciones del Inspector o Supervisor
La Entidad controlar los trabajos efectuados por el contratista a travs del
inspector o supervisor, segn corresponda, quien ser el responsable de velar
directa y permanentemente por la correcta ejecucin de la obra y del cumplimiento
del contrato.
El inspector o el supervisor, segn corresponda, tiene como funcin controlar
la ejecucin de la obra y absolver las consultas que le formule el contratista
segn lo previsto en el artculo siguiente. Est facultado para ordenar el retiro de
cualquier subcontratista o trabajador por incapacidad o incorrecciones que, a su
juicio, perjudiquen la buena marcha de la obra; para rechazar y ordenar el retiro de
PDWHULDOHVRHTXLSRVSRUPDODFDOLGDGRSRUHOLQFXPSOLPLHQWRGHODVHVSHFLFDFLRQHV
tcnicas; y para disponer cualquier medida generada por una emergencia.
No obstante lo sealado en el prrafo precedente, su actuacin debe ajustarse
DOFRQWUDWRQRWHQLHQGRDXWRULGDGSDUDPRGLFDUOR
El contratista deber brindar al inspector o supervisor las facilidades necesarias
para el cumplimiento de su funcin, las cuales estarn estrictamente relacionadas
con sta.
Artculo 194.- Cuaderno de Obra
En la fecha de entrega del terreno, se abrir el cuaderno de obra, el mismo
TXH VHUi UPDGR HQ WRGDV VXV SiJLQDV SRU HO LQVSHFWRU R VXSHUYLVRU VHJ~Q
FRUUHVSRQGD\SRUHOUHVLGHQWHDQGHHYLWDUVXDGXOWHUDFLyQ'LFKRVSURIHVLRQDOHV
son los nicos autorizados para hacer anotaciones en el cuaderno de obra.
El cuaderno de obra debe constar de una hoja original con tres (3) copias
desglosables, correspondiendo una de stas a la Entidad, otra al contratista y la
tercera al inspector o supervisor. El original de dicho cuaderno debe permanecer
en la obra, bajo custodia del residente, no pudiendo impedirse el acceso al mismo.
Si el contratista no permite el acceso al cuaderno de obra al inspector o
supervisor, impidindole anotar las ocurrencias, ser causal de aplicacin de
multa del cinco por mil (5/1000) del monto de la valorizacin por cada da de
dicho impedimento.
Concluida la ejecucin de la obra, el original quedar en poder de la Entidad.
Concordancia: LCE: Artculo 43.
173
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 195.- Anotacin de ocurrencias
En el cuaderno de obra se anotarn los hechos relevantes que ocurran
GXUDQWHODHMHFXFLyQGHHVWDUPDQGRDOSLHGHFDGDDQRWDFLyQHOLQVSHFWRUR
supervisor o el residente, segn sea el que efectu la anotacin. Las solicitudes
que se realicen como consecuencia de las ocurrencias anotadas en el cuaderno
de obra, se harn directamente a la Entidad por el contratista o su representante,
por medio de comunicacin escrita.
El cuaderno de obra ser cerrado por el inspector o supervisor cuando la obra
KD\DVLGRUHFLELGDGHQLWLYDPHQWHSRUOD(QWLGDG
Artculo 196.- Consultas sobre ocurrencias en la obra
Las consultas se formulan en el cuaderno de obra y se dirigen al inspector o
supervisor, segn corresponda.
Las consultas cuando por su naturaleza, en opinin del inspector o supervisor,
no requieran de la opinin del proyectista, sern absueltas por stos dentro del
plazo mximo de cinco (5) das siguientes de anotadas las mismas. Vencido
el plazo anterior y de no ser absueltas, el contratista dentro de los dos (2) das
siguientes acudir a la Entidad, la cual deber resolverlas en un plazo mximo de
cinco (5) das, contados desde el da siguiente de la recepcin de la comunicacin
del contratista.
Las consultas cuando por su naturaleza, en opinin del inspector o supervisor,
requieran de la opinin del proyectista sern elevadas por stos a la Entidad dentro
del plazo mximo de cuatro (4) das siguientes de anotadas, correspondiendo
a sta en coordinacin con el proyectista absolver la consulta dentro del plazo
mximo de quince (15) das siguientes de la comunicacin del inspector o
supervisor.
Para este efecto, los proyectistas establecern en sus respectivas propuestas
para los contratos de diseo de la obra original, el compromiso de atender
consultas en el plazo que establezcan las Bases.
(QFDVRQRKXELHVHUHVSXHVWDGHOSUR\HFWLVWDHQHOSOD]RPi[LPRMDGRHQ
el prrafo anterior, la Entidad deber dar instrucciones al contratista a travs del
inspector o supervisor, sin perjuicio de las acciones que se adopten contra el
proyectista, por la falta de absolucin de la misma.
Si, en ambos casos, vencidos los plazos, no se absuelve la consulta, el
contratista tendr derecho a solicitar ampliacin de plazo contractual por el tiempo
correspondiente a la demora. Esta demora se computar slo a partir de la fecha
en que la no ejecucin de los trabajos materia de la consulta empiece a afectar
la ruta crtica del programa de ejecucin de la obra.
Artculo 197.- Valorizaciones y Metrados
Las valorizaciones tienen el carcter de pagos a cuenta y sern elaboradas
el ltimo da de cada perodo previsto en las Bases, por el inspector o supervisor
y el contratista.
En el caso de las obras contratadas bajo el sistema de precios unitarios, las
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
174
valorizaciones se formularn en funcin de los metrados ejecutados con los precios
unitarios ofertados, agregando separadamente los montos proporcionales de
gastos generales y utilidad ofertados por el contratista; a este monto se agregar,
de ser el caso, el porcentaje correspondiente al Impuesto General a las Ventas.
En el caso de las obras contratadas bajo el sistema a suma alzada, durante la
ejecucin de la obra, las valorizaciones se formularn en funcin de los metrados
ejecutados contratados con los precios unitarios del valor referencial, agregando
separadamente los montos proporcionales de gastos generales y utilidad del
valor referencial. El subtotal as obtenido se multiplicar por el factor de relacin,
calculado hasta la quinta cifra decimal; a este monto se agregar, de ser el caso,
el porcentaje correspondiente al Impuesto General a las Ventas.
En las obras contratadas bajo el sistema a precios unitarios se valorizar hasta
el total de los metrados realmente ejecutados, mientras que en el caso de las
obras bajo el sistema de suma alzada se valorizar hasta el total de los metrados
del presupuesto de obra.
Los metrados de obra ejecutados sern formulados y valorizados
conjuntamente por el contratista y el inspector o supervisor, y presentados a la
Entidad dentro de los plazos que establezca el contrato. Si el inspector o supervisor
no se presenta para la valorizacin conjunta con el contratista, ste la efectuar.
El inspector o supervisor deber revisar los metrados durante el perodo de
aprobacin de la valorizacin.
El plazo mximo de aprobacin por el inspector o el supervisor de las
valorizaciones y su remisin a la Entidad para perodos mensuales es de cinco (5)
das, contados a partir del primer da hbil del mes siguiente al de la valorizacin
respectiva, y ser cancelada por la Entidad en fecha no posterior al ltimo da de
WDOPHV&XDQGRODVYDORUL]DFLRQHVVHUHHUDQDSHUtRGRVGLVWLQWRVDORVSUHYLVWRV
en este prrafo, las Bases establecern el tratamiento correspondiente de acuerdo
con lo dispuesto en el presente artculo.
A partir del vencimiento del plazo establecido para el pago de estas
valorizaciones, por razones imputables a la Entidad, el contratista tendr derecho
DOUHFRQRFLPLHQWRGHORVLQWHUHVHVOHJDOHVGHFRQIRUPLGDGFRQORVDUWtFXORV
\GHO&yGLJR&LYLO3DUDHOSDJRGHORVLQWHUHVHVVHIRUPXODUiXQD
Valorizacin de Intereses y se efectuar en las valorizaciones siguientes.
Artculo 198.- Reajustes
(Q HO FDVR GH REUDV GDGR TXH ORV QGLFHV 8QLFDGRV GH 3UHFLRV GH OD
Construccin son publicados por el Instituto Nacional de Estadstica e Informtica
,1(,FRQXQPHVGHDWUDVRORVUHDMXVWHVVHFDOFXODUiQHQEDVHDOFRHFLHQWH
GHUHDMXVWH.FRQRFLGRDHVHPRPHQWR3RVWHULRUPHQWHFXDQGRVHFRQR]FDQ
ORVQGLFHV8QLFDGRVGH3UHFLRVTXHVHGHEHQDSOLFDUVHFDOFXODUiHOPRQWR
GHQLWLYRGHORVUHDMXVWHVTXHOHFRUUHVSRQGHQ\VHSDJDUiQFRQODYDORUL]DFLyQ
PiVFHUFDQDSRVWHULRURHQODOLTXLGDFLyQQDOVLQUHFRQRFLPLHQWRGHLQWHUHVHV
95
Concordancia: RLCE: Artculo 49.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
175
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 199.- Discrepancias respecto de valorizaciones o metrados
Si surgieran discrepancias respecto de la formulacin, aprobacin o valorizacin
de los metrados entre el contratista y el inspector o supervisor o la Entidad, segn
sea el caso, se resolvern en la liquidacin del contrato, sin perjuicio del cobro de
la parte no controvertida.
Si la valorizacin de la parte en discusin representa un monto igual o superior
al cinco por ciento (5%) del contrato actualizado, la parte interesada podr someter
dicha controversia a conciliacin y/o arbitraje dentro de los quince (15) das hbiles
despus de presentada.
La iniciacin de este procedimiento no implica la suspensin del contrato ni el
incumplimiento de las obligaciones de las partes.
96
Artculo 200.- Causales de ampliacin de plazo
'HFRQIRUPLGDGFRQHODUWtFXORGHOD/H\HOFRQWUDWLVWDSRGUiVROLFLWDUOD
ampliacin de plazo pactado por cualquiera de las siguientes causales ajenas a
ODYROXQWDGGHOFRQWUDWLVWDVLHPSUHTXHPRGLTXHQODUXWDFUtWLFDGHOSURJUDPDGH
ejecucin de obra vigente al momento de la solicitud de ampliacin:
1. Atrasos y/o paralizaciones por causas no atribuibles al contratista.
2. Atrasos y/o paralizaciones en el cumplimiento de sus prestaciones por
causas atribuibles a la Entidad.
3. Caso fortuito o fuerza mayor debidamente comprobado.
4. Cuando se aprueba la prestacin adicional de obra. En este caso, el
contratista ampliar el plazo de las garantas que hubiere otorgado.
97
Concordancia: LCE: Artculo 41.
Artculo 201.- Procedimiento de ampliacin de plazo
Para que proceda una ampliacin de plazo de conformidad con lo establecido
en el artculo precedente, desde el inicio y durante la ocurrencia de la causal, el
contratista, por intermedio de su residente, deber anotar en el cuaderno de obra
las circunstancias que a su criterio ameriten ampliacin de plazo. Dentro de los
quince (15) das siguientes de concluido el hecho invocado, el contratista o su
UHSUHVHQWDQWHOHJDOVROLFLWDUiFXDQWLFDUi\VXVWHQWDUiVXVROLFLWXGGHDPSOLDFLyQ
de plazo ante el inspector o supervisor, segn corresponda, siempre que la demora
afecte la ruta crtica del programa de ejecucin de obra vigente y el plazo adicional
resulte necesario para la culminacin de la obra. En caso que el hecho invocado
pudiera superar el plazo vigente de ejecucin contractual, la solicitud se efectuar
antes del vencimiento del mismo.
El inspector o supervisor emitir un informe expresando opinin sobre la
solicitud de ampliacin de plazo y lo remitir a la Entidad, en un plazo no mayor
de siete (7) das, contados desde el da siguiente de presentada la solicitud. La
(QWLGDGUHVROYHUiVREUHGLFKDDPSOLDFLyQ\QRWLFDUiVXGHFLVLyQDOFRQWUDWLVWD
en un plazo mximo de catorce (14) das, contados desde el da siguiente de la
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
176
recepcin del indicado informe. De no emitirse pronunciamiento alguno dentro
del plazo sealado, se considerar ampliado el plazo, bajo responsabilidad de
la Entidad.
Toda solicitud de ampliacin de plazo debe efectuarse dentro del plazo vigente
de ejecucin de obra, fuera del cual no se admitir las solicitudes de ampliaciones
de plazo.
Cuando las ampliaciones se sustenten en causales diferentes o de distintas
fechas, cada solicitud de ampliacin de plazo deber tramitarse y ser resuelta
independientemente, siempre que las causales diferentes no correspondan a un
mismo periodo de tiempo sea este parcial o total.
En tanto se trate de causales que no tengan fecha prevista de conclusin,
hecho que deber ser debidamente acreditado y sustentado por el contratista de
REUDOD(QWLGDGSRGUiRWRUJDUDPSOLDFLRQHVGHSOD]RSDUFLDOHVDQGHSHUPLWLU
que los contratistas valoricen los gastos generales por dicha ampliacin parcial,
para cuyo efecto se seguir el procedimiento antes sealado.
La ampliacin de plazo obligar al contratista a presentar al inspector
o supervisor un calendario de avance de obra valorizado actualizado y la
programacin PERTCPM correspondiente, considerando para ello slo las partidas
que se han visto afectadas y en armona con la ampliacin de plazo concedida, en
un plazo que no exceder de diez (10) das contados a partir del da siguiente de
ODIHFKDGHQRWLFDFLyQDOFRQWUDWLVWDGHOD5HVROXFLyQTXHDSUXHEDODDPSOLDFLyQ
de plazo. El inspector o supervisor deber elevarlos a la Entidad, con los reajustes
concordados con el residente, en un plazo mximo de siete (7) das, contados a
partir de la recepcin del nuevo calendario presentado por el contratista. En un
plazo no mayor de siete (7) das, contados a partir del da siguiente de la recepcin
del informe del inspector o supervisor, la Entidad deber pronunciarse sobre dicho
calendario, el mismo que, una vez aprobado, reemplazar en todos sus efectos
al anterior. De no pronunciarse la Entidad en el plazo sealado, se tendr por
aprobado el calendario elevado por el inspector o supervisor.
Cualquier controversia relacionada con el pronunciamiento de la Entidad
respecto a las solicitudes de ampliacin de plazos podr ser sometida a conciliacin
y/o arbitraje dentro de los quince (15) das hbiles posteriores a la comunicacin
de esta decisin.
98
Artculo 202.- Efectos de la modificacin del plazo contractual
Las ampliaciones de plazo en los contratos de obra darn lugar al pago de
mayores gastos generales variables iguales al nmero de das correspondientes a
la ampliacin multiplicados por el gasto general variable diario, salvo en los casos
de prestaciones adicionales de obra.
Slo cuando la ampliacin de plazo sea generada por la paralizacin total
de la obra por causas ajenas a la voluntad del contratista, dar lugar al pago
de mayores gastos generales variables debidamente acreditados, de aquellos
98 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
177
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
conceptos que forman parte de la estructura de gastos generales variables de la
oferta econmica del contratista o del valor referencial, segn el caso.
En el supuesto que las reducciones de prestaciones afecten el plazo
contractual, los menores gastos generales variables se calcularn siguiendo el
procedimiento establecido en el prrafo precedente.
En virtud de la ampliacin otorgada, la Entidad ampliar el plazo de los otros
contratos celebrados por sta y vinculados directamente al contrato principal.
99
Artculo 203.- Clculo del Gasto General Diario
En los contratos de obra a precios unitarios, el gasto general diario se calcula
dividiendo los gastos generales variables ofertados entre el nmero de das del
SOD]RFRQWUDFWXDODMXVWDGRSRUHOFRHFLHQWH,S,RHQGRQGH,SHVHOQGLFH
General de Precios al Consumidor (Cdigo 39) aprobado por el Instituto Nacional
de Estadstica e Informtica-INEI correspondiente al mes calendario en que ocurre
ODFDXVDOGHDPSOLDFLyQGHOSOD]RFRQWUDFWXDOH,RHVHOPLVPRtQGLFHGHSUHFLRV
correspondiente al mes del valor referencial.
En los contratos de obra a suma alzada, el gasto general diario se calcula
dividiendo los gastos generales variables del presupuesto que sustenta el
valor referencial entre el nmero de das del plazo contractual, ajustado por el
IDFWRUGHUHODFLyQ\SRUHOFRHFLHQWH,S,RHQGRQGH,SHVHOQGLFH*HQHUDO
de Precios al Consumidor (Cdigo 39) aprobado por el Instituto Nacional de
Estadstica e Informtica - INEI correspondiente al mes calendario en que ocurre
ODFDXVDOGHDPSOLDFLyQGHOSOD]RFRQWUDFWXDOH,RHVHOPLVPRtQGLFHGHSUHFLRV
correspondiente al mes del valor referencial.
En el caso de obras adicionales y prestaciones adicionales de servicios de
supervisin de obras, los gastos generales se determinarn considerando lo
necesario para su ejecucin.

Artculo 204.- Pago de Gastos Generales
Para el pago de los mayores gastos generales se formular una Valorizacin
de Mayores Gastos Generales, la cual deber ser presentada por el residente al
inspector o supervisor; dicho profesional en un plazo mximo de cinco (5) das
contados a partir del da siguiente de recibida la mencionada valorizacin la
elevar a la Entidad con las correcciones a que hubiere lugar para su revisin y
aprobacin. La Entidad deber cancelar dicha valorizacin en un plazo mximo
de treinta (30) das contados a partir del da siguiente de recibida la valorizacin
por parte del inspector o supervisor.
A partir del vencimiento del plazo establecido para el pago de esta valorizacin,
el contratista tendr derecho al reconocimiento de los intereses legales, de
FRQIRUPLGDG FRQ ORV DUWtFXORV \ GHO &yGLJR &LYLO 3DUD HO
pago de intereses se formular una Valorizacin de Intereses y se efectuar en
las valorizaciones siguientes.
99 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
178
Artculo 205.- Demoras injustificadas en la ejecucin de la Obra
Durante la ejecucin de la obra, el contratista est obligado a cumplir los
avances parciales establecidos en el calendario de avance de obra vigente.
(QFDVRGHUHWUDVRLQMXVWLFDGRFXDQGRHOPRQWRGHODYDORUL]DFLyQDFXPXODGD
ejecutada a una fecha determinada sea menor al ochenta por ciento (80%) del
monto de la valorizacin acumulada programada a dicha fecha, el inspector
o supervisor ordenar al contratista que presente, dentro de los siete (7) das
siguientes, un nuevo calendario que contemple la aceleracin de los trabajos,
de modo que se garantice el cumplimiento de la obra dentro del plazo previsto,
anotando tal hecho en el cuaderno de obra.
La falta de presentacin de este calendario dentro del plazo sealado en el
prrafo precedente podr ser causal para que opere la intervencin econmica
de la obra o la resolucin del contrato. El nuevo calendario no exime al contratista
GHODUHVSRQVDELOLGDGSRUGHPRUDVLQMXVWLFDGDVQLHVDSOLFDEOHSDUDHOFiOFXOR
y control de reajustes.
Cuando el monto de la valorizacin acumulada ejecutada sea menor al ochenta
por ciento (80%) del monto acumulado programado del nuevo calendario, el
inspector o el supervisor anotar el hecho en el cuaderno de obra e informar
a la Entidad. Dicho retraso podr ser considerado como causal de resolucin
del contrato o de intervencin econmica de la obra, no siendo necesario
apercibimiento alguno al contratista de obra.
100
Artculo 206.- Intervencin Econmica de la Obra
/D(QWLGDGSRGUiGHRFLRRDVROLFLWXGGHSDUWHLQWHUYHQLUHFRQyPLFDPHQWH
la obra en caso fortuito, fuerza mayor o por incumplimiento de las estipulaciones
contractuales que a su juicio no permitan la terminacin de los trabajos. La
intervencin econmica de la obra es una medida que se adopta por consideraciones
GHRUGHQWpFQLFR\HFRQyPLFRFRQODQDOLGDGGHFXOPLQDUODHMHFXFLyQGHORV
trabajos, sin llegar al extremo de resolver el contrato. La intervencin econmica
no deja al contratista al margen de su participacin contractual, y sus obligaciones
correspondientes, perdiendo el derecho al reconocimiento de mayores gastos
generales, indemnizacin o cualquier otro reclamo, cuando la intervencin sea
consecuencia del incumplimiento del contratista.
Si el contratista rechaza la intervencin econmica, el contrato ser resuelto
por incumplimiento.
Para la aplicacin de lo establecido en el presente artculo deber tenerse
en cuenta lo dispuesto en la Directiva y dems disposiciones que dicte el OSCE
sobre la materia.
Artculo 207.- Prestaciones adicionales de obras menores al quince por
ciento (15%)
Slo proceder la ejecucin de prestaciones adicionales de obra cuando
previamente se cuente con la certificacin de crdito presupuestario y la
100 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
179
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
resolucin del Titular de la Entidad y en los casos en que sus montos, restndole
los presupuestos deductivos vinculados, sean iguales o no superen el quince por
ciento (15%) del monto del contrato original.
Excepcionalmente, en el caso de prestaciones adicionales de obra que por
su carcter de emergencia, cuya no ejecucin pueda afectar el ambiente o poner
en peligro a la poblacin, los trabajadores o a la integridad de la misma obra,
la autorizacin previa de la Entidad podr realizarse mediante comunicacin
HVFULWD D Q GH TXH HO LQVSHFWRU R VXSHUYLVRU SXHGD DXWRUL]DU OD HMHFXFLyQ GH
WDOHV SUHVWDFLRQHV DGLFLRQDOHV VLQ SHUMXLFLR GH OD YHULFDFLyQ TXH UHDOL]DUi OD
Entidad previo a la emisin de la resolucin correspondiente, sin la cual no podr
efectuarse pago alguno.
En los contratos de obra a precios unitarios, los presupuestos adicionales de
obra sern formulados con los precios del contrato y/o precios pactados y los
JDVWRVJHQHUDOHVMRV\YDULDEOHVSURSLRVGHODSUHVWDFLyQDGLFLRQDOSDUDORFXDO
deber realizarse el anlisis correspondiente teniendo como base o referencia los
anlisis de los gastos generales del presupuesto original contratado. Asimismo,
debe incluirse la utilidad del presupuesto ofertado y el Impuesto General a las
Ventas correspondiente.
En los contratos de obra a suma alzada, los presupuestos adicionales de
obra sern formulados con los precios del presupuesto referencial ajustados
SRUHOIDFWRUGHUHODFLyQ\RORVSUHFLRVSDFWDGRVFRQORVJDVWRVJHQHUDOHVMRV
y variables propios de la prestacin adicional para lo cual deber realizarse el
anlisis correspondiente teniendo como base o referencia los montos asignados en
el valor referencial multiplicado por el factor de relacin. Asimismo, debe incluirse
la utilidad del valor referencial multiplicado por el factor de relacin y el Impuesto
General a las Ventas correspondiente.
La necesidad de tramitar la autorizacin de la ejecucin de prestaciones
adicionales de obra debe ser anotada en el cuaderno de obra, ya sea por el
inspector o supervisor o por el contratista. El inspector o supervisor debe comunicar
a la Entidad sobre la necesidad de elaborar el expediente tcnico de la prestacin
adicional de obra.
/D(QWLGDGGHEHGHQLUVLODHODERUDFLyQGHOH[SHGLHQWHWpFQLFRGHODSUHVWDFLyQ
adicional de obra estar a su cargo, a cargo de un consultor externo o a cargo
del contratista ejecutor de la obra principal, en calidad de prestacin adicional
GH REUD DSUREDGD FRQIRUPH DO SURFHGLPLHQWR SUHYLVWR HQ HO DUWtFXOR GHO
5HJODPHQWR3DUDGLFKDGHQLFLyQOD(QWLGDGGHEHWHQHUHQFRQVLGHUDFLyQOD
naturaleza, magnitud, complejidad, entre otros aspectos relevantes de la obra
principal, as como la capacidad tcnica y/o especializacin del contratista que la
ejecuta, cuando considere encargarle a ste la elaboracin del expediente tcnico.
Cuando el expediente tcnico es elaborado por la Entidad o por un consultor
H[WHUQRVHUiQHFHVDULRYHULFDUFRQHOFRQWUDWLVWDHMHFXWRUGHODREUDSULQFLSDO
que la solucin tcnica de diseo se ajusta a la prestacin principal; asimismo,
independientemente de quin elabore el expediente tcnico, deber tenerse en
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
180
consideracin lo sealado en los prrafos tercero y cuarto de este artculo.
Concluida la elaboracin del expediente tcnico, el inspector o supervisor
cuenta con un plazo de catorce (14) das para remitir a la Entidad el informe
pronuncindose sobre la procedencia de la ejecucin de la prestacin adicional.
Recibido dicho informe, la Entidad cuenta con catorce (14) das para emitir
\ QRWLFDU DO FRQWUDWLVWD OD UHVROXFLyQ PHGLDQWH OD TXH VH SURQXQFLD VREUH OD
procedencia de la ejecucin de la prestacin adicional de obra. La demora de
OD(QWLGDGHQHPLWLU\QRWLFDUHVWDUHVROXFLyQSRGUiVHUFDXVDOGHDPSOLDFLyQ
de plazo.
Cuando la Entidad decida autorizar la ejecucin de la prestacin adicional de
REUDDOPRPHQWRGHQRWLFDUODUHVSHFWLYDUHVROXFLyQDOFRQWUDWLVWDWDPELpQGHEH
entregarle el expediente tcnico de dicha prestacin, debidamente aprobado.
El pago de los presupuestos adicionales aprobados se realiza mediante
valorizaciones adicionales.
Cuando se apruebe la prestacin adicional de obra, el contratista estar
REOLJDGR D DPSOLDU HO PRQWR GH OD JDUDQWtD GH HO FXPSOLPLHQWR ,JXDOPHQWH
cuando se apruebe la reduccin de prestaciones, el contratista podr reducir el
monto de dicha garanta.
Los adicionales o reducciones que se dispongan durante la ejecucin de
proyectos de inversin pblica debern ser comunicados por la Entidad a la
autoridad competente del Sistema Nacional de Inversin Pblica.
101
Concordancia: LCE: Artculo 41.
Artculo 208.- Prestaciones adicionales de obras mayores al quince por
ciento (15%)
Las prestaciones adicionales de obras cuyos montos, restndole los
presupuestos deductivos vinculados, superen el quince por ciento (15%) del
monto del contrato original, luego de ser aprobadas por el Titular de la Entidad,
requieren previamente, para su ejecucin y pago, la autorizacin expresa de la
Contralora General de la Repblica.
En el caso de adicionales con carcter de emergencia la autorizacin de la
Contralora General de la Repblica se emitir previa al pago.
La Contralora General de la Repblica contar con un plazo mximo de
quince (15) das hbiles, bajo responsabilidad, para emitir su pronunciamiento,
el cual deber ser motivado en todos los casos. El referido plazo se computar
a partir del da siguiente que la Entidad presenta la documentacin sustentatoria
correspondiente. Transcurrido este plazo, sin que medie pronunciamiento de la
Contralora General de la Repblica, la Entidad est autorizada para disponer
la ejecucin y/o pago de prestaciones adicionales de obra por los montos que
hubiere solicitado, sin perjuicio del control posterior.
De requerirse informacin complementaria, la Contralora General de la
Repblica har conocer a la Entidad este requerimiento, en una sola oportunidad,
101 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
181
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
a ms tardar al quinto da hbil contado desde que se inici el plazo a que se
UHHUHHOSiUUDIRSUHFHGHQWHPiVHOWpUPLQRGHODGLVWDQFLD
La Entidad cuenta con cinco (5) das hbiles para cumplir con el requerimiento.
En estos casos el plazo se interrumpe y se reinicia al da siguiente de la fecha
de presentacin de la documentacin complementaria por parte de la Entidad a
la Contralora General de la Repblica.
El pago de los presupuestos adicionales aprobados se realiza mediante
valorizaciones adicionales.
Cuando se apruebe la prestacin adicional de obras, el contratista estar
REOLJDGRDDPSOLDUHOPRQWRGHODJDUDQWtDGHHOFXPSOLPLHQWR
Las prestaciones adicionales de obra no podrn superar el cincuenta por ciento
(50%) del monto del contrato original. En caso que superen este lmite se proceder
DODUHVROXFLyQGHOFRQWUDWRQRVLHQGRDSOLFDEOHHO~OWLPRSiUUDIRGHODUWtFXOR
debindose convocar a un nuevo proceso por el saldo de obra por ejecutar, sin
perjuicio de las responsabilidades que pudieran corresponder al proyectista.
Los adicionales o reducciones que se dispongan durante la ejecucin de
proyectos de inversin pblica debern ser comunicados por la Entidad a la
autoridad competente del Sistema Nacional de Inversin Pblica.
102
Concordancia: LCE: Artculo 41.
Artculo 209.- Resolucin del Contrato de Obras
La resolucin del contrato de obra determina la inmediata paralizacin de
la misma, salvo los casos en que, estrictamente por razones de seguridad o
disposiciones reglamentarias de construccin, no sea posible.
La parte que resuelve deber indicar en su carta de resolucin, la fecha y hora
para efectuar la constatacin fsica e inventario en el lugar de la obra, con una
anticipacin no menor de dos (2) das. En esta fecha, las partes se reunirn en
SUHVHQFLDGH1RWDULRR-XH]GH3D]GHFRQIRUPLGDGFRQORGLVSXHVWRHQHOWHUFHU
\FXDUWRSiUUDIRGHODUWtFXORGHO5HJODPHQWR\VHOHYDQWDUiXQDFWD6LDOJXQD
de ellas no se presenta, la otra levantar el acta, documento que tendr pleno
efecto legal, debindose realizar el inventario respectivo en los almacenes de la
REUDHQSUHVHQFLDGHO1RWDULRR-XH]GH3D]GHMiQGRVHFRQVWDQFLDGHOKHFKR
en el acta correspondiente, debiendo la Entidad disponer el reinicio de la obras
VHJ~QODVDOWHUQDWLYDVSUHYLVWDVHQHODUWtFXORGHOD/H\
Culminado este acto, la obra queda bajo responsabilidad de la Entidad y se
SURFHGHDODOLTXLGDFLyQFRQIRUPHDORHVWDEOHFLGRHQHODUWtFXOR
En caso que la resolucin sea por incumplimiento del contratista, en la
liquidacin se consignarn las penalidades que correspondan, las que se harn
HIHFWLYDVFRQIRUPHDORGLVSXHVWRHQORVDUWtFXORV\GHO5HJODPHQWR
En caso que la resolucin sea por causa atribuible a la Entidad, sta reconocer
al contratista, en la liquidacin que se practique, el cincuenta por ciento (50%)
102 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
182
de la utilidad prevista, calculada sobre el saldo de obra que se deja de ejecutar,
actualizado mediante las frmulas de reajustes hasta la fecha en que se efectu
la resolucin del contrato.
Los gastos incurridos en la tramitacin de la resolucin del contrato, como los
notariales, de inventario y otros, son de cargo de la parte que incurri en la causal
de resolucin, salvo disposicin distinta del laudo arbitral.
En caso de que surgiese alguna controversia sobre la resolucin del contrato,
cualquiera de las partes podr recurrir a los mecanismos de solucin establecidos
en la Ley, el Reglamento o en el contrato, dentro del plazo de quince (15) das
KiELOHVVLJXLHQWHVGHODQRWLFDFLyQGHODUHVROXFLyQYHQFLGRHOFXDOODUHVROXFLyQ
del contrato habr quedado consentida.
(QFDVRTXHFRQIRUPHFRQORHVWDEOHFLGRHQHOWHUFHUSiUUDIRGHODUWtFXORGH
la Ley, la Entidad opte por invitar a los postores que participaron en el proceso de
seleccin que dio origen a la ejecucin de la obra, teniendo en cuenta el orden de
prelacin, se considerar los precios de la oferta de aquel que acepte la invitacin,
incorporndose todos los costos necesarios para su terminacin, debidamente
sustentados, siempre que se cuente con la disponibilidad presupuestal.
103
Concordancia: LCE: Artculo 44.
Artculo 210.- Recepcin de la Obra y plazos
1. En la fecha de la culminacin de la obra, el residente anotar tal hecho en
el cuaderno de obras y solicitar la recepcin de la misma. El inspector
o supervisor, en un plazo no mayor de cinco (5) das posteriores a la
DQRWDFLyQVHxDODGDORLQIRUPDUiDOD(QWLGDGUDWLFDQGRRQRORLQGLFDGR
por el residente.
(QFDVRTXHHOLQVSHFWRURVXSHUYLVRUYHULTXHODFXOPLQDFLyQGHODREUD
la Entidad proceder a designar un comit de recepcin dentro de los
siete (7) das siguientes a la recepcin de la comunicacin del inspector
o supervisor. Dicho comit estar integrado, cuando menos, por un
representante de la Entidad, necesariamente ingeniero o arquitecto,
segn corresponda a la naturaleza de los trabajos, y por el inspector o
supervisor.
En un plazo no mayor de veinte (20) das siguientes de realizada
su designacin, el Comit de Recepcin, junto con el contratista,
SURFHGHUiDYHULFDUHOHOFXPSOLPLHQWRGHORHVWDEOHFLGRHQORVSODQRV
\HVSHFLFDFLRQHVWpFQLFDV\HIHFWXDUiODVSUXHEDVTXHVHDQQHFHVDULDV
para comprobar el funcionamiento de las instalaciones y equipos.
&XOPLQDGDODYHULFDFLyQ\GHQRH[LVWLUREVHUYDFLRQHVVHSURFHGHUiD
la recepcin de la obra, tenindose por concluida la misma, en la fecha
indicada por el contratista. El Acta de Recepcin deber ser suscrita
por los miembros del comit y el contratista.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
183
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
2. De existir observaciones, stas se consignarn en un Acta o Pliego
de Observaciones y no se recibir la obra. A partir del da siguiente, el
contratista dispondr de un dcimo (1/10) del plazo de ejecucin vigente
de la obra para subsanar las observaciones, plazo que se computar
a partir del quinto da de suscrito el Acta o Pliego. Las obras que se
ejecuten como consecuencia de observaciones no darn derecho al
pago de ningn concepto a favor del contratista ni a la aplicacin de
penalidad alguna.
Subsanadas las observaciones, el contratista solicitar nuevamente la
UHFHSFLyQGHODREUDHQHOFXDGHUQRGHREUDVORFXDOVHUiYHULFDGRSRU
el inspector o supervisor e informado a la Entidad, segn corresponda,
en el plazo de tres (3) das siguientes de la anotacin. El comit de
recepcin junto con el contratista se constituirn en la obra dentro de los
siete (7) das siguientes de recibido el informe del inspector o supervisor.
/DFRPSUREDFLyQTXHUHDOL]DUiVHVXMHWDUiDYHULFDUODVXEVDQDFLyQGH
las observaciones formuladas en el Acta o Pliego, no pudiendo formular
nuevas observaciones.
De haberse subsanado las observaciones a conformidad del comit de
recepcin, se suscribir el Acta de Recepcin de Obra.
3. En caso que el contratista o el comit de recepcin no estuviese conforme
con las observaciones o la subsanacin, segn corresponda, anotar
la discrepancia en el acta respectiva. El comit de recepcin elevar al
Titular de la Entidad, segn corresponda, todo lo actuado con un informe
sustentado de sus observaciones en un plazo mximo de cinco (5) das.
La Entidad deber pronunciarse sobre dichas observaciones en igual
plazo. De persistir la discrepancia, sta se someter a conciliacin y/o
arbitraje, dentro de los quince (15) das siguientes al pronunciamiento
de la Entidad.
4. Si vencido el cincuenta por ciento (50%) del plazo establecido para
la subsanacin, la Entidad comprueba que no se ha dado inicio
a los trabajos correspondientes, salvo circunstancias justificadas
debidamente acreditadas por el contratista, dar por vencido dicho
plazo, sta intervendr y subsanar las observaciones con cargo a
las valorizaciones pendientes de pago o de acuerdo al procedimiento
establecido en la directiva que se apruebe conforme a lo establecido
HQHOWHUFHUSiUUDIRGHODUWtFXOR
5. Todo retraso en la subsanacin de las observaciones que exceda
del plazo otorgado, se considerar como demora para efectos de las
penalidades que correspondan y podr dar lugar a que la Entidad
UHVXHOYDHOFRQWUDWRSRULQFXPSOLPLHQWR/DVSHQDOLGDGHVDTXHVHUHHUH
el presente artculo podrn ser aplicadas hasta el tope sealado en la
Ley, el Reglamento o el contrato, segn corresponda.
6. Est permitida la recepcin parcial de secciones terminadas de las
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
184
obras, cuando ello se hubiera previsto expresamente en las Bases,
en el contrato o las partes expresamente lo convengan. La recepcin
parcial no exime al contratista del cumplimiento del plazo de ejecucin;
en caso contrario, se le aplicarn las penalidades correspondientes.
7. Si por causas ajenas al contratista la recepcin de la obra se retardara,
superando los plazos establecidos en el presente artculo para tal acto, el
lapso de la demora se adicionar al plazo de ejecucin de la misma y se
reconocer al contratista los gastos generales debidamente acreditados,
en que se hubiese incurrido durante la demora.
6LHQHOSURFHVRGHYHULFDFLyQGHODVXEVDQDFLyQGHODVREVHUYDFLRQHV
el comit de recepcin constata la existencia de vicios o defectos
distintas a las observaciones antes formuladas, sin perjuicio de suscribir
el Acta de Recepcin de Obra, informar a la Entidad para que sta
solicite por escrito al contratista las subsanaciones del caso, siempre
que constituyan vicios ocultos.
Artculo 211.- Liquidacin del Contrato de Obra
El contratista presentar la liquidacin debidamente sustentada con la
documentacin y clculos detallados, dentro de un plazo de sesenta (60) das o
el equivalente a un dcimo (1/10) del plazo vigente de ejecucin de la obra, el que
resulte mayor, contado desde el da siguiente de la recepcin de la obra. Dentro del
plazo mximo de sesenta (60) das de recibida, la Entidad deber pronunciarse,
ya sea observando la liquidacin presentada por el contratista o, de considerarlo
SHUWLQHQWHHODERUDQGRRWUD\QRWLFDUiDOFRQWUDWLVWDSDUDTXHpVWHVHSURQXQFLH
dentro de los quince (15) das siguientes.
Si el contratista no presenta la liquidacin en el plazo previsto, su elaboracin
ser responsabilidad exclusiva de la Entidad en idntico plazo, siendo los gastos
GHFDUJRGHOFRQWUDWLVWD/D(QWLGDGQRWLFDUiODOLTXLGDFLyQDOFRQWUDWLVWDSDUDTXH
ste se pronuncie dentro de los quince (15) das siguientes.
La liquidacin quedar consentida cuando, practicada por una de las partes,
no sea observada por la otra dentro del plazo establecido.
Cuando una de las partes observe la liquidacin presentada por la otra,
sta deber pronunciarse dentro de los quince (15) das de haber recibido
la observacin; de no hacerlo, se tendr por aprobada la liquidacin con las
observaciones formuladas.
En el caso de que una de las partes no acoja las observaciones formuladas
por la otra, aqulla deber manifestarlo por escrito dentro del plazo previsto en el
prrafo anterior. En tal supuesto, dentro de los quince (15) das hbiles siguientes,
cualquiera de las partes deber solicitar el sometimiento de esta controversia a
conciliacin y/o arbitraje.
Toda discrepancia respecto a la liquidacin se resuelve segn las disposiciones
previstas para la solucin de controversias establecidas en la Ley y en el presente
Reglamento, sin perjuicio del cobro de la parte no controvertida.
En el caso de obras contratadas bajo el sistema de precios unitarios, la
185
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
OLTXLGDFLyQQDOVHSUDFWLFDUiFRQORVSUHFLRVXQLWDULRVJDVWRVJHQHUDOHV\XWLOLGDG
ofertados; mientras que en las obras contratadas bajo el sistema a suma alzada
la liquidacin se practicar con los precios, gastos generales y utilidad del valor
referencial, afectados por el factor de relacin.
No se proceder a la liquidacin mientras existan controversias pendientes
de resolver.
Artculo 212.- Efectos de la liquidacin
Luego de haber quedado consentida la liquidacin y efectuado el pago
TXHFRUUHVSRQGDFXOPLQDGHQLWLYDPHQWHHOFRQWUDWR\VHFLHUUDHOH[SHGLHQWH
respectivo.
Las discrepancias en relacin a defectos o vicios ocultos, debern ser
sometidas a conciliacin y/o arbitraje. En dicho caso el plazo de caducidad se
computar a partir de la recepcin de la obra por la Entidad hasta quince (15)
das hbiles posteriores al vencimiento del plazo de responsabilidad del contratista
previsto en el contrato.
Las controversias en relacin a los pagos que la Entidad debe efectuar al
contratista podrn ser sometidas a conciliacin y/o arbitraje dentro del plazo de
quince (15) das hbiles siguiente de vencido el plazo para hacer efectivo el pago
de acuerdo a lo previsto en el contrato.
104
Concordancia: LCE: Artculo 7.
Artculo 213.- Declaratoria de fbrica o memoria descriptiva valorizada
Con la liquidacin, el contratista entregar a la Entidad los planos post
construccin y la minuta de declaratoria de fbrica o la memoria descriptiva
valorizada, segn sea el caso, obligacin cuyo cumplimiento ser condicin para
el pago del monto de la liquidacin a favor del contratista.
La Declaratoria de Fbrica se otorgar conforme a lo dispuesto en la Ley
de la materia. La presentacin de la Declaratoria de Fbrica mediante escritura
pblica, es opcional.
CAPTULO VIII
CONCILIACIN Y ARBITRAJE
Artculo 214.- Conciliacin
Cualquiera de las partes tiene el derecho a solicitar una conciliacin dentro del
SOD]RGHFDGXFLGDGSUHYLVWRHQORVDUWtFXORV
\HQFRQFRUGDQFLDFRQORGLVSXHVWR
HQHOQXPHUDOGHODUWtFXORGHOD/H\GHELHQGRLQLFLDUVHHVWHSURFHGLPLHQWR
DQWHXQ&HQWURGH&RQFLOLDFLyQ3~EOLFRRDFUHGLWDGRSRUHO0LQLVWHULRGH-XVWLFLD
1040RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
186
Las actas de conciliacin debern ser remitidas al OSCE para su registro y
publicacin, dentro del plazo de diez (10) das hbiles de suscritas.
105
Concordancia: LCE: Artculos 40 inciso b) y 52.
Artculo 215.- Inicio del Arbitraje
Cualquiera de las partes tiene el derecho a iniciar el arbitraje administrativo
GHQWURGHOSOD]RGHFDGXFLGDGSUHYLVWRHQORVDUWtFXORV
\HQFRQFRUGDQFLDFRQ
ORGLVSXHVWRHQHOQXPHUDOGHODUWtFXORGHOD/H\
De haberse pactado en el convenio arbitral la realizacin de un arbitraje
institucional, la parte interesada debe recurrir a la institucin arbitral en aplicacin
del respectivo reglamento arbitral institucional. De haberse pactado arbitraje ad
hoc, la parte interesada proceder a remitir a la otra la solicitud de arbitraje a que
VHUHHUHHVWH5HJODPHQWR
Si las partes optaron por el procedimiento de conciliacin de manera previa
al arbitraje, ste deber iniciarse dentro de un plazo de caducidad de quince (15)
das hbiles siguientes de emitida el Acta de no Acuerdo Total o Parcial.
/DV FRQWURYHUVLDV UHODWLYDV DO FRQVHQWLPLHQWR GH OD OLTXLGDFLyQ QDO GH ORV
contratos de consultora y ejecucin de obras o respecto de la conformidad de la
recepcin en el caso de bienes y servicios, as como las referidas al incumplimiento
de los pagos que resulten de las mismas, tambin sern resueltas mediante
arbitraje.
El arbitraje se desarrollar de conformidad con la normativa de contrataciones
del Estado, pudiendo el OSCE brindar servicios de organizacin y administracin
en los arbitrajes administrativos que se encuentren bajo el rgimen de contratacin
pblica y de acuerdo a las Directivas que apruebe el OSCE para tal efecto.
'HFRQIRUPLGDGFRQORGLVSXHVWRSRUHOQXPHUDOGHODUWtFXORGHOD
Ley, la parte que solicita la conciliacin y/o el arbitraje debe poner su solicitud en
conocimiento del OSCE dentro del plazo de quince (15) das hbiles de formulada,
salvo cuando se trate de un arbitraje administrado por dicho organismo o cuando
ste designe a los rbitros.
106
Concordancia: LCE: Artculo 52.
Artculo 216.- Convenio Arbitral
En el convenio arbitral las partes pueden encomendar la organizacin
y administracin del arbitraje a una institucin arbitral, a cuyo efecto el
correspondiente convenio arbitral tipo puede ser incorporado al contrato. El
OSCE publicar en su portal institucional una relacin de convenios arbitrales
tipo aprobados peridicamente.
Si en el convenio arbitral incluido en el contrato, no se precisa que el arbitraje
es institucional, la controversia se resolver mediante un arbitraje ad hoc. El
arbitraje ad hoc ser regulado por las Directivas sobre la materia que para el
efecto emita el OSCE.
105, 106 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
187
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En el caso que el convenio arbitral establezca que el arbitraje es institucional,
y no se haga referencia a una institucin arbitral determinada, se aplicar lo
GLVSXHVWRHQHOQXPHUDOGHODUWtFXORGHOD/H\
Si el contrato no incorpora un convenio arbitral, se considerar incorporado de
pleno derecho el siguiente texto, que remite a un arbitraje institucional del Sistema
Nacional de Arbitraje - OSCE, cuya clusula tipo es:
7RGRVORVFRQLFWRVTXHGHULYHQGHODHMHFXFLyQHLQWHUSUHWDFLyQGHOSUHVHQWH
FRQWUDWRLQFOXLGRVORVTXHVHUHHUDQDVXQXOLGDGHLQYDOLGH]VHUiQUHVXHOWRVGH
PDQHUDGHQLWLYDHLQDSHODEOHPHGLDQWHDUELWUDMHGHGHUHFKRGHFRQIRUPLGDGFRQ
lo establecido en la normativa de contrataciones del Estado, bajo la organizacin
y administracin de los rganos del Sistema Nacional de Arbitraje del OSCE y de
DFXHUGRFRQVX5HJODPHQWR
Cuando el convenio arbitral disponga que la organizacin y administracin
del arbitraje se encontrar a cargo del SNA-OSCE, se entender que las partes
han aceptado sujetarse a las disposiciones de su Reglamento y a las decisiones
de sus rganos.
Asimismo, en caso el convenio arbitral seale que la organizacin y
administracin del arbitraje estar a cargo de cualquiera de los rganos funcionales
del OSCE, se entender que dicho encargo le corresponde al SNA-OSCE.
107
Artculo 217.- Estipulaciones adicionals al Convenio Arbitral
/DV SDUWHV SRGUiQ HVWDEOHFHU HVWLSXODFLRQHV DGLFLRQDOHV R PRGLFDWRULDV
del convenio arbitral, en la medida que no contravengan las disposiciones de la
normativa de contrataciones, las disposiciones de la Ley General de Arbitraje que
resulten aplicables, ni las normas y Directivas complementarias dictadas por el
OSCE de conformidad con sus atribuciones.
Artculo 218.- Solicitud de Arbitraje
En caso las partes no se hayan sometido a un arbitraje institucional o no hayan
pactado al respecto, el arbitraje se inicia con la solicitud de arbitraje dirigida a la otra
parte por escrito, con indicacin del convenio arbitral, incluyendo la designacin
del rbitro, cuando corresponda. La solicitud tambin deber incluir de manera
UHIHUHQFLDO\FRQQHVLQIRUPDWLYRVXQUHVXPHQGHODRODVFRQWURYHUVLDVDVHU
sometidas a arbitraje y su cuanta.
Artculo 219.- Respuesta de Arbitraje
La parte que reciba una solicitud de arbitraje de conformidad con el articulo
precedente, deber responderla por escrito dentro del plazo de diez (10) das
hbiles, contados a partir del da siguiente de la recepcin de la respectiva solicitud,
con indicacin de la designacin del rbitro, cuando corresponda, y su posicin
107 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
188
o resumen referencial respecto de la controversia y su cuanta. De ser el caso,
la respuesta podr contener una ampliacin o rplica respecto de la materia
controvertida detallada en la solicitud.
La falta de respuesta o toda oposicin formulada en contra del arbitraje, no
interrumpir el desarrollo del mismo ni de los respectivos procedimientos para que
se lleve a cabo la conformacin del tribunal arbitral y la tramitacin del arbitraje.
Artculo 220.- rbitros
El arbitraje ser resuelto por rbitro nico o por un tribunal arbitral conformado
por tres (3) rbitros, segn el acuerdo de las partes. A falta de acuerdo entre las
partes, o en caso de duda, ser resuelto por rbitro nico.
El rbitro nico y el presidente del tribunal arbitral deben ser necesariamente
abogados y contar con especializacin acreditada en derecho administrativo,
arbitraje y contrataciones con el Estado.
108
Artculo 221.- Impedimentos
Se encuentran impedidos para actuar como rbitros
1. El Presidente y los Vicepresidentes de la Repblica, los Congresistas,
los Ministros de Estado, los titulares miembros del rgano colegiado de
los organismos constitucionalmente autnomos.
/RV0DJLVWUDGRVFRQH[FHSFLyQGHORV-XHFHVGH3D]
3. Los Fiscales, los Procuradores Pblicos y los Ejecutores Coactivos.
4. El Contralor General de la Repblica.
5. Los titulares de instituciones o de organismos pblicos descentralizados,
los alcaldes y los directores de las empresas del Estado.
6. El personal militar y policial en situacin de actividad.
7. Los funcionarios y servidores pblicos en los casos que tengan relacin
directa con la Entidad en que laboren y dentro de los mrgenes
establecidos por las normas de incompatibilidad vigentes.
8. Los funcionarios y servidores del OSCE hasta seis (6) meses despus
de haber dejado la institucin.
9. Los declarados en insolvencia.
10. Los sancionados o inhabilitados por los respectivos colegios
profesionales o entes administrativos, en tanto estn vigentes dichas
sanciones.
(QORVFDVRVDTXHVHUHHUHQORVLQFLVRV\HOLPSHGLPHQWRVHUHVWULQJH
al mbito sectorial al que pertenecen esas personas.

Artculo 222.- Designacin
En caso las partes no hayan pactado respecto de la forma en que se designar
a los rbitros o no se hayan sometido a arbitraje institucional y administrado por
108 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
189
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
una institucin arbitral, el procedimiento para la designacin ser el siguiente:
1. Para el caso de rbitro nico, una vez respondida la solicitud de arbitraje
o vencido el plazo para su respuesta, sin que se hubiese llegado a un
acuerdo entre las partes, cualquiera de stas podr solicitar al OSCE
en el plazo mximo de diez (10) das hbiles, la designacin de dicho
rbitro.
2. Para el caso de tres (3) rbitros, cada parte designar a un rbitro
en su solicitud y respuesta, respectivamente, y estos dos (2) rbitros
designarn al tercero, quien presidir el tribunal arbitral. Vencido el plazo
para la respuesta a la solicitud de arbitraje sin que se hubiera designado
al rbitro correspondiente, la parte interesada solicitar al OSCE, dentro
del plazo de diez (10) das hbiles, la respectiva designacin.
3. Si una vez designados los dos (2) rbitros conforme al procedimiento
antes referido, stos no consiguen ponerse de acuerdo sobre la
designacin del tercero dentro del plazo de diez (10) das hbiles de
recibida la aceptacin del ltimo rbitro, cualquiera de las partes podr
solicitar al OSCE la designacin del tercer arbitro dentro del plazo de
diez (10) das hbiles.
/DUHVROXFLyQGHGHVLJQDFLyQVHQRWLFDUiDODVSDUWHVDWUDYpVGHVXSXEOLFDFLyQ
en el SEACE y ser comunicada, de manera personal, al rbitro designado.
Las designaciones efectuadas en estos supuestos por el OSCE se realizarn
GHVX5HJLVWURGHUELWURV\VRQGHQLWLYDVHLQLPSXJQDEOHV
109
Artculo 223.- Aceptacin de los rbitros
En caso las partes no se hayan sometido a arbitraje institucional o cuando
no hayan pactado respecto de la aceptacin de los rbitros en un arbitraje ad
hoc, cada rbitro, dentro de los cinco (5) das hbiles siguientes de haber sido
comunicado con su designacin, deber dar a conocer su aceptacin por escrito
a la parte que lo design, la misma que deber de poner en conocimiento de la
contraria la correspondiente aceptacin del rbitro.
Si en el plazo establecido, el rbitro no comunica su aceptacin, se presume
que no acepta ejercer el cargo, con lo que queda expedito el derecho de la
parte que lo design para designar un nuevo rbitro dentro de los diez (10) das
hbiles siguientes. Si el nuevo rbitro no acepta o no comunica su aceptacin en
el plazo de cinco (5) das hbiles, la otra parte podr solicitar la designacin del
rbitro ante el OSCE, sustentando su pedido sobre la base de la documentacin
correspondiente.
Los rbitros estn sujetos a las reglas de tica que apruebe el OSCE as como
a las normas sobre responsabilidad civil y penal establecidas en la legislacin
sobre la materia.
109 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
190
Artculo 224.- Independencia, imparcialidad y deber de informacin
Los rbitros deben ser y permanecer durante el desarrollo del arbitraje
independientes e imparciales, sin mantener con las partes relaciones personales
profesionales o comerciales.
Todo rbitro, al momento de aceptar el cargo, debe informar sobre cualquier
circunstancia acaecida dentro de los cinco (5) aos anteriores a su nombramiento,
que pudiera afectar su imparcialidad e independencia. Este deber de informacin
comprende adems la obligacin de dar a conocer a las partes la ocurrencia de
cualquier circunstancia sobrevenida a su aceptacin durante el desarrollo de todo
el arbitraje y que pudiera afectar su imparcialidad e independencia.
Asimismo, el rbitro designado debe incluir una declaracin expresa sobre
su idoneidad para ejercer el cargo, su capacidad profesional en lo que concierne
D FRQWDU FRQ FRQRFLPLHQWRV VXFLHQWHV SDUD OD DSOLFDFLyQ GH OD QRUPDWLYD GH
FRQWUDWDFLRQHVGHO(VWDGRDVtFRPRODGLVSRQLELOLGDGGHWLHPSRVXFLHQWHSDUD
llevar a cabo el arbitraje en forma satisfactoria.
El OSCE aprobar un Cdigo de tica que establezca los principios y reglas
que deben ser cumplidos por todos los rbitros que ejerzan funcin arbitral en
materia de contrataciones del Estado, as como las infracciones a dichos principios
y reglas, y sus correspondientes sanciones. Los Cdigos de tica que aprueben
las instituciones arbitrales establecern las infracciones sobre las cuales se
impondrn las respectivas sanciones.
El Cdigo de tica aprobado por el OSCE es de aplicacin a los arbitrajes
administrados por el SNA OSCE y los arbitrajes ad hoc, y de aplicacin supletoria
a los procesos arbitrales administrados por una institucin arbitral que no tenga
aprobado un Cdigo de tica o que tenindola no establezca la infraccin cometida
por el rbitro o no establezca la sancin aplicable.
110
Artculo 225.- Causales de Recusacin
Los rbitros podrn ser recusados por las siguientes causas:
&XDQGR VH HQFXHQWUHQ LPSHGLGRV FRQIRUPH HO DUWtFXOR R QR
FXPSODQFRQORGLVSXHVWRSRUHODUWtFXOR
2. Cuando no cumplan con las exigencias y condiciones establecidas por
las partes en el convenio arbitral, con sujecin a la Ley, el Reglamento
y normas complementarias.
&XDQGRH[LVWDQFLUFXQVWDQFLDVTXHJHQHUHQGXGDVMXVWLFDGDVUHVSHFWR
de su imparcialidad o independencia y cuando dichas circunstancias no
hayan sido excusadas por las partes en forma oportuna y expresa.
Artculo 226.- Procedimiento de Recusacin
En el caso que las partes no se hayan sometido a un arbitraje institucional o
cuando no hayan pactado sobre el particular, el trmite de recusacin se llevar
110 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
191
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
a cabo conforme las siguientes reglas:
1. La recusacin debe formularse ante el OSCE dentro de los cinco (5)
das hbiles siguientes de comunicada la aceptacin del cargo por
el rbitro recusado a las partes o desde que la parte recusante tom
conocimiento de la causal sobreviniente.
2. El OSCE pondr en conocimiento de la otra parte y del rbitro o rbitros
recusados la recusacin, para que, en el plazo de cinco (5) das hbiles,
PDQLHVWHQORFRQYHQLHQWHDVXGHUHFKR
3. Si la otra parte est de acuerdo con la recusacin o el rbitro o rbitros
renuncian, se proceder a la designacin del rbitro o rbitros sustitutos
en la misma forma en que se design al rbitro o rbitros recusados.
4. Si la otra parte no est de acuerdo con la recusacin o el rbitro o rbitros
no renuncian o no absuelven el traslado en el plazo indicado, el OSCE
lo resolver en un plazo de diez (10) das hbiles.
/DUHVROXFLyQTXHUHVXHOYHODUHFXVDFLyQVHUiQRWLFDGDDWUDYpVGHVX
publicacin en el SEACE.
/DUHVROXFLyQGHODUHFXVDFLyQSRUHO26&(GHEHVHUPRWLYDGDHVGHQLWLYD
e inimpugnable y ser publicada en el portal institucional del OSCE.
Cuando la recusacin sea declarada fundada, el OSCE proceder a la
designacin del rbitro sustituto.
El trmite de recusacin no suspende el arbitraje, salvo cuando se trate de
rbitro nico o hayan sido recusados dos (2) o tres (3) rbitros o, en su caso,
cuando lo disponga el tribunal arbitral.
111
Artculo 227.- Instalacin
Salvo que las partes se hayan sometido a un arbitraje institucional, una vez que
los rbitros hayan aceptado sus cargos, cualquiera de las partes deber solicitar
al OSCE, la instalacin del rbitro nico o del tribunal arbitral, dentro de los cinco
(5) das siguientes a la aceptacin de estos, segn corresponda.
Realizada la instalacin del rbitro nico o tribunal arbitral, se trate o no de
arbitraje institucional, las Entidades debern registrar en el SEACE los nombres
y apellidos completos del rbitro nico o de los rbitros que conforman el tribunal
arbitral, as como de aquellos que eventualmente sustituyan a estos.
La instalacin del rbitro nico o del tribunal arbitral suspende el procedimiento
administrativo sancionador que se haya iniciado por la materia controvertida.
Dicha suspensin continuar durante el desarrollo del proceso arbitral y
nicamente podr ser levantada cuando dicho proceso concluya con el laudo
debidamente consentido o sea declarado archivado por el rbitro o tribunal arbitral,
segn corresponda.
112
1110RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
192
Artculo 228.- Regulacin del Arbitraje
En cualquier etapa del proceso arbitral, los jueces y las autoridades
DGPLQLVWUDWLYDV VH DEVWHQGUiQ GH RFLR R D SHWLFLyQ GH SDUWH GH FRQRFHU ODV
controversias derivadas de la validez, invalidez, rescisin, resolucin, nulidad,
ejecucin o interpretacin de los contratos y, en general, cualquier controversia
que surja desde la celebracin de los mismos, sometidos al arbitraje conforme al
presente Reglamento, debiendo declarar nulo todo lo actuado y el archivamiento
GHQLWLYR GHO SURFHVR MXGLFLDO R DGPLQLVWUDWLYR TXH VH KXELHUH JHQHUDGR en el
estado en que ste se encuentre.
Durante el desarrollo del arbitraje, los rbitros debern tratar a las partes con
igualdad y darle a cada una de ellas plena oportunidad para ejercer su derecho
de defensa.
Artculo 229.- Acumulacin
Cuando exista un arbitraje en curso y surja una nueva controversia relativa al
mismo contrato, tratndose de arbitraje ad hoc, cualquiera de las partes puede
pedir a los rbitros la acumulacin de las pretensiones a dicho arbitraje dentro
del plazo de caducidad previsto en la Ley, siempre que no se haya procedido a
declarar la conclusin de la etapa probatoria.
Cuando no se establezca expresamente en el convenio arbitral que slo
proceder la acumulacin de pretensiones cuando ambas estn de acuerdo,
una vez iniciada la actuacin de pruebas, los rbitros podrn decidir sobre la
acumulacin tomando en cuenta la naturaleza de las nuevas pretensiones, el
estado de avance en que se encuentre el arbitraje y las dems circunstancias
que sean pertinentes.
Artculo 230.- Gastos Arbitrales
Los rbitros pueden exigir a las partes los anticipos de honorarios y gastos
que estimen necesarios para el desarrollo del arbitraje.
El OSCE aprobar mediante directiva una tabla de gastos arbitrales, la que ser
de aplicacin a los arbitrajes que el SNA-OSCE organice y administre conforme
a su Reglamento.
En los casos de arbitraje ad hoc, los gastos arbitrales no podrn exceder lo
HVWDEOHFLGRHQODWDEODDTXHVHUHHUHHOSiUUDIRSUHFHGHQWHQRSXGLpQGRVH
pactar en contrario. En estos casos, la parte que se encuentre en desacuerdo
con la liquidacin o reliquidacin de gastos arbitrales aprobada por el respectivo
rbitro nico o Tribunal Arbitral, por considerar que se excede de lo establecido
por la tabla de gastos arbitrales SNA- OSCE, podr solicitar al OSCE emitir un
SURQXQFLDPLHQWRQDODOUHVSHFWR(OWUiPLWHGHGLFKDVROLFLWXGQRVXVSHQGHUi
el respectivo proceso arbitral. La decisin que emita el OSCE al respecto ser
GHQLWLYDHLQLPSXJQDEOH
En el caso de renuncia o de recusacin de rbitro declarada fundada y cuando
no se trate de un arbitraje institucional, cualquier discrepancia que surja entre las
partes y los rbitros, respecto de la devolucin de honorarios, ser resuelta a
193
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
pedido de parte por el OSCE, de conformidad con la directiva que ste apruebe
SDUD WDOHV HIHFWRV /D GHFLVLyQ TXH WRPH HO 26&( DO UHVSHFWR HV GHQLWLYD H
inimpugnable.
113
Artculo 231.- Laudo
(O ODXGR HV GHQLWLYR H LQDSHODEOH WLHQH HO YDORU GH FRVD MX]JDGD \ VH
ejecuta como una sentencia. El laudo, as como sus integraciones, exclusiones,
LQWHUSUHWDFLRQHV\UHFWLFDFLRQHVGHEHUiQVHUQRWLFDGRVDWUDYpVGHO6($&(
DGHPiV GH OD QRWLFDFLyQ SHUVRQDO D ODV SDUWHV FRQIRUPH D OR SUHYLVWR HQ HO
QXPHUDOGHODUWtFXORGHOD/H\
Es responsabilidad del rbitro nico o del presidente del tribunal arbitral registrar
correctamente el laudo en el SEACE as como sus integraciones, exclusiones,
LQWHUSUHWDFLRQHV \ UHFWLFDFLRQHV FRQIRUPH D OR GLVSXHVWR HQ HO DUWtFXOR
del Reglamento, as como la remisin que se requiera efectuar a la respectiva
VHFUHWDUtDDUELWUDOSDUDHIHFWRVGHVXQRWLFDFLyQSHUVRQDO'LFKDUHVSRQVDELOLGDG
tambin alcanza a la informacin que el rbitro nico o el presidente del tribunal
arbitral deba ingresar en el SEACE a efectos de registrar el laudo respectivo.
Como requisito para interponer recurso de anulacin contra el laudo, podr
establecerse en el convenio arbitral que la parte impugnante deber acreditar la
FRQVWLWXFLyQGHFDUWDDQ]DDIDYRUGHODSDUWHYHQFHGRUD\SRUODFDQWLGDGTXH
el laudo determine pagar a la parte vencida.
Cuando se interponga recurso de anulacin contra el laudo, la parte impugnante
deber cumplir con comunicar y acreditar ante el rbitro nico o el tribunal arbitral
la interposicin de este recurso dentro de los cinco (5) das hbiles siguientes de
vencido el plazo correspondiente; en caso contrario se entender que el laudo
ha quedado consentido en sede arbitral.
$VLPLVPR ODV VHQWHQFLDV TXH UHVXHOYDQ GH PDQHUD GHQLWLYD HO UHFXUVR
de anulacin, debern ser remitidas al OSCE por la parte interesada en el
SOD]R GH GLH] GtDV KiELOHV GH QRWLFDGDV SDUD VX UHJLVWUR \ SXEOLFDFLyQ
Los representantes de las partes debern cumplir con dicha obligacin bajo
responsabilidad.
114
Artculo 232.- Registro de rbitros
El OSCE llevar un Registro de rbitros para efectos de las designaciones
que deba realizar. Asimismo, aprobara la Directiva correspondiente para esta-
blecer el procedimiento y requisitos para la inscripcin de los interesados en
dicho Registro.
Artculo 233.- Organizacin y Administracin de Arbitrajes
1. El OSCE podr organizar y administrar arbitrajes, de conformidad con el
1130RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
194
Reglamento del Sistema Nacional de Arbitraje del OSCE (SNA-OSCE)
que se apruebe para tal efecto.
2. El OSCE podr proporcionar apoyo administrativo constante o servicios
de organizacin y administracin de arbitrajes y dems medios de
prevencin, gestin y solucin de controversias. En estos casos, el
OSCE podr llevar a cabo los cobros correspondientes, de conformidad
con las formas de pago que se apruebe para tales efectos.
3. El OSCE podr conformar uno o ms tribunales arbitrales especiales
para atender las controversias derivadas de contratos u rdenes de
compras o de servicios originados en Adjudicaciones de Menor Cuanta
y cuyo monto no supere las quince Unidades Impositivas Tributarias (15
UIT). Los arbitrajes a cargo de estos tribunales sern regulados por el
OSCE mediante la directiva que apruebe para tal efecto.
115
Articulo 234.- (*)
'HURJDGRSRUHODUWtFXORGHO'HFUHWR6XSUHPR1()SXEOLFDGR
el 7 de agosto de 2012.
TITULO IV
SANCIONES
Artculo 235.- Potestad sancionadora del Tribunal
La facultad de imponer sancin administrativa de inhabilitacin, temporal o
GHQLWLYDVDQFLyQHFRQyPLFDVXVSHQVLyQWHPSRUDORLQKDELOLWDFLyQSHUPDQHQWH
DTXHVHFRQWUDHQORVDUWtFXORV\GHOD/H\DSURYHHGRUHVSDUWLFLSDQWHV
postores, contratistas, expertos independientes y rbitros, segn corresponda, por
infraccin de las disposiciones contenidas en la Ley y el presente Reglamento,
reside en exclusividad en el Tribunal.
116
Concordancia: LCE: Artculos 51 y 52.
Artculo 236.- Causal de imposicin de sancin a los expertos
independientes
Cuando la Entidad considere que existe responsabilidad por parte de los
expertos independientes que formaron parte de un Comit Especial, remitir
al Tribunal todos los actuados, incluyendo un informe en el cual se indique la
supuesta responsabilidad en que habran incurrido los expertos independientes,
adjuntando la evidencia correspondiente, en un plazo que no exceder de diez
(10) das hbiles contados a partir de la deteccin del hecho correspondiente.
El Tribunal evaluar los actuados y, de concluir que asiste responsabilidad,
impondr una sancin administrativa de inhabilitacin temporal a los expertos
independientes, sean estas personas naturales o jurdicas, por las irregularidades
115, 116 0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
195
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
cometidas como miembros de un Comit Especial, que le sean imputables por
dolo, negligencia y/o culpa inexcusable. Esta inhabilitacin para participar en
procesos de seleccin y para contratar con el Estado podr ser por un periodo
no menor de seis (6) meses ni mayor a doce (12) meses.
Artculo 237.- Impedimentos
Adicionalmente a los impedimentos establecidos en el artculo 10 de la Ley,
se encuentran impedidos de ser participantes, postores y/o contratistas aquellas
personas naturales o jurdicas a travs de las cuales una autoridad, funcionario
S~EOLFR HPSOHDGR GH FRQDQ]D VHUYLGRU S~EOLFR R SURYHHGRU SUHWHQGD HOXGLU
su condicin de impedido valindose de cualquier modalidad de reorganizacin
societaria y/o la utilizacin de testaferros para participar en un proceso de seleccin.
117
Artculo 238.- Causal de imposicin de sancin a rbitros en materia de
contratacin pblica
El Tribunal impondr sancin de suspensin temporal o inhabilitacin
permanente a los rbitros, sea que hayan actuado como rbitro nico o tribunal
DUELWUDOFXDQGRLQFXUUDQHQODVLQIUDFFLRQHVWLSLFDGDVHQHOQXPHUDOGHO
DUWtFXORGHOD/H\
La infraccin referida al incumplimiento de la obligacin de informar
oportunamente si existe alguna circunstancia que le impida al rbitro ejercer el
FDUJRFRQLQGHSHQGHQFLDLPSDUFLDOLGDG\DXWRQRPtDVHFRQJXUDUiFXDQGRVH
haya declarado fundada la recusacin interpuesta contra el rbitro dentro del
SOD]RFRUUHVSRQGLHQWH$VLPLVPRHO7ULEXQDOGHEHGHWHUPLQDUODFRQJXUDFLyQ
de la infraccin antes sealada aun cuando no exista pronunciamiento sobre el
fondo de la recusacin por renuncia del rbitro recusado o no se haya presentado
recusacin en el plazo correspondiente.
Asimismo, la infraccin referida al incumplimiento de actuar con transparencia
VHFRQJXUDUiFXDQGRHOiUELWURRHOWULEXQDODUELWUDOQRFXPSODFRQUHJLVWUDUHQ
el SEACE el laudo emitido dentro de los plazos previstos en la Ley y el presente
Reglamento, o no cumpla con informar al OSCE sobre el estado del proceso
arbitral en la oportunidad en que se le requiera.
El Tribunal evaluar los actuados y, de ser el caso, sancionar a los rbitros,
con suspensin temporal no menor de seis (6) meses ni mayor de dos (2) aos
para ejercer el cargo de rbitro en las controversias que se produzcan dentro
del marco de la Ley y el presente Reglamento, con la consecuente suspensin
en el Registro de rbitros del OSCE, cuando formen parte de dicho Registro. La
graduacin de la sancin se sujetar a los criterios establecidos en el artculo
HQORTXHFRUUHVSRQGD
Cuando durante el procedimiento sancionador seguido contra un rbitro, el
Tribunal constate, adems de la responsabilidad del infractor, que ste ha sido
sancionado en oportunidades anteriores con suspensin temporal cuyo tiempo
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHPDU]RGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
196
sumado sea mayor a veinticuatro (24) meses dentro de un lapso de tres (3) aos,
le impondr la sancin de inhabilitacin permanente, con la consecuente exclusin
del Registro de rbitros del OSCE, cuando forme parte de dicho Registro.
118
Concordancia: LCE: Artculos 52
Artculo 239.- Sanciones a Consorcios
Las infracciones cometidas por los postores que presentaron promesa de
consorcio durante su participacin en el proceso de seleccin se imputarn
exclusivamente a la parte que las haya cometido, aplicndose slo a sta la
sancin a que hubiera lugar, siempre que de la promesa formal de consorcio
pueda individualizarse al infractor.
Las infracciones cometidas por un consorcio durante la ejecucin del contrato,
se imputarn a todos los integrantes del mismo, aplicndose a cada uno de ellos
la sancin que le corresponda, sin excepcin alguna.
119
Artculo 240.- Sanciones econmicas a las Entidades cuando acten como
proveedores
El Tribunal impondr a las Entidades que acten como proveedores sancin
econmica no menores de cinco (5) Unidades Impositivas Tributarias ni mayor
diez (10) Unidades Impositivas Tributarias cuando incurran en las infracciones
WLSLFDGDVHQORVOLWHUDOHVDFJKL\NGHOQXPHUDOGHODUWtFXORGH
la Ley. La sancin ser no menor de diez (10) Unidades Impositivas Tributarias
ni mayor de veinte (20) Unidades Impositivas Tributarias cuando incurran en las
LQIUDFFLRQHVWLSLFDGDVHQORVOLWHUDOHVEM\OGHODLQGLFDGD/H\
120
Artculo 241.- Obligacin de informar sobre supuestas infracciones
El Tribunal podr tomar conocimiento de hechos que puedan dar lugar a la
LPSRVLFLyQGHVDQFLyQ\DVHDGHRFLRSRUSHWLFLyQPRWLYDGDGHRWURVyUJDQRV
o Entidades, o por denuncia; siendo que en todos los casos, la decisin de iniciar
el correspondiente procedimiento administrativo sancionador corresponde al
Tribunal.
1. Obligacin de las entidades de informar sobre supuestas infracciones:
Inmediatamente advertida la existencia de indicios de la comisin de
una infraccin, las Entidades estn obligadas a poner en conocimiento
del Tribunal tales hechos, adjuntando los antecedentes y un informe
tcnico legal de la Entidad, que contenga la opinin sobre la procedencia
y responsabilidad respecto a la infraccin que se imputa.
Esta obligacin ser cumplida por la Entidad sin perjuicio de la
responsabilidad que le corresponde para declarar la nulidad del proceso
o, de ser el caso, del contrato, cuando se incurra en alguna de las
FDXVDOHVSUHYLVWDVHQHODUWtFXORGHOD/H\
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
197
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
2. Denuncia de terceros:
Los terceros podrn formular denuncias respecto a proveedores,
participantes, postores, contratistas o rbitros, que puedan dar lugar a
ODLPSRVLFLyQGHODVVDQFLRQHVDODVTXHVHUHHUHOD/H\\HOSUHVHQWH
Reglamento, para lo cual debern acompaar el sustento de las
imputaciones que formulan. En este caso, a requerimiento del Tribunal,
las Entidades deben remitir la informacin correspondiente.
121
Artculo 242.- Debido Procedimiento
El Tribunal tramita los procedimientos sancionadores bajo las siguientes reglas:
1. Para efectuar las indagaciones previas al inicio del procedimiento
sancionador, el Tribunal tendr un plazo no mayor de treinta (30) das
hbiles contados desde la fecha de presentacin de la denuncia o
de la subsanacin correspondiente o de emitido el decreto por el que
previamente se le solicita al denunciante o la entidad la documentacin
sustentatoria. En este ltimo supuesto, el Tribunal tiene un plazo mximo
de cinco (05) das hbiles siguientes de admitida la denuncia para
requerir la documentacin sustentatoria.
Vencido el indicado plazo para las indagaciones previas, deber remitirse
el expediente a la Sala correspondiente, dentro de un plazo no mayor
de los quince (15) das hbiles siguientes.
2. Las Entidades estn obligadas a remitir la informacin adicional que se
indica en el numeral precedente en un plazo no mayor de diez (10) das
KiELOHVGHQRWLFDGD(QHOFDVRTXHFRPRFRQVHFXHQFLDGHODRPLVLyQ
de la Entidad en remitir la informacin solicitada, no sea posible iniciar
el procedimiento sancionador, se proceder al archivo del expediente,
bajo responsabilidad del Titular de la Entidad y se har de conocimiento
al rgano de Control Institucional o, en su defecto, a la Contralora
General de la Repblica.
3. El Tribunal dispondr el inicio del procedimiento sancionador slo si
GHWHUPLQDTXHFXHQWDFRQHOHPHQWRVVXFLHQWHVSDUDWDOHIHFWR
En caso se deba emitir acuerdo respecto del inicio de un procedimiento
sancionador, este debe adoptarse dentro de los quince (15) das hbiles
siguientes de haber sido remitido el expediente a la Sala correspondiente
del Tribunal. Cuando se requiera informacin adicional, este plazo
no ser mayor de treinta (30) das hbiles de haber sido remitido el
expediente a la Sala correspondiente.
4. Iniciado el correspondiente procedimiento sancionador, el Tribunal
notificar al respectivo proveedor, postor, contratista, experto
independiente o rbitro para que ejerza su derecho de defensa
GHQWURGHORVGLH]GtDVKiELOHVVLJXLHQWHVGHODQRWLFDFLyQEDMR
121 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
198
apercibimiento de resolverse con la documentacin obrante en autos.
5. Vencido el indicado plazo, y con el respectivo descargo o sin l, el
expediente ser remitido a la Sala correspondiente del Tribunal, la cual
SRGUiUHDOL]DUGHRFLRWRGDVODVDFWXDFLRQHVQHFHVDULDVSDUDHOH[DPHQ
de los hechos, recabando la informacin y datos necesarios y relevantes
para determinar, de ser el caso, la existencia de responsabilidad
susceptible de sancin.
6. La Sala deber emitir su resolucin, determinando la existencia o no de
responsabilidad administrativa, dentro de los tres (3) meses de remitido
el expediente a la Sala correspondiente del Tribunal.
7. De no emitirse el acuerdo o la resolucin correspondiente dentro de
los plazos establecidos en los incisos 3) y 6), respectivamente, la Sala
mantiene la obligacin de emitir el respectivo pronunciamiento, sin
perjuicio de las responsabilidades que le corresponda, de ser el caso.
122
Artculo 243.- Prescripcin
Las infracciones establecidas en la Ley para efectos de las sanciones a las
TXHVHUHHUHHOSUHVHQWH7tWXORSUHVFULEHQDORVWUHVDxRVGHFRPHWLGDV
3DUDHOFDVRGHODVLQIUDFFLRQHVSUHYLVWDVHQORVOLWHUDOHVF\OGHODUWtFXOR
de la Ley, el plazo de prescripcin se computa, en el primer caso, a partir de la
QRWLFDFLyQGHOODXGRDUELWUDO\HQHOVHJXQGRFDVRDSDUWLUGHTXHHO7LWXODUGH
la Entidad toma conocimiento del incumplimiento.
En el caso de la infraccin prevista en el literal j) del numeral 51.1 del artculo
GHOD/H\ODVDQFLyQSUHVFULEHDORVFLQFRDxRVGHFRPHWLGD
3DUDHOFDVRGHODVLQIUDFFLRQHVSUHYLVWDVHQHOQXPHUDOGHODUWtFXORGH
la Ley, el plazo de prescripcin ser de dos (2) aos y se computa segn causal
de la siguiente manera:
1. Respecto de la obligacin de informar oportunamente si existe
alguna circunstancia que impida ejercer el cargo con independencia,
LPSDUFLDOLGDG\DXWRQRPtDGHVGHODQRWLFDFLyQGHODUHVROXFLyQTXH
declara fundada la recusacin, que admite la renuncia del rbitro
recusado o del vencimiento del plazo para presentar recusacin contra
el rbitro, segn corresponda;
2. Respecto de la obligacin de actuar con transparencia, desde el
vencimiento del plazo para registrar el laudo en el SEACE o del
vencimiento del plazo otorgado por OSCE para informar sobre el estado
del proceso arbitral, segn corresponda; y,
3. Respecto de la obligacin de sustentar el apartarse del orden de
SUHODFLyQSUHYLVWRHQHOQXPHUDOGHODUWtFXORGHOD/H\DSDUWLU
de la publicacin del laudo en el SEACE.
La prescripcin se declarar a solicitud.
123
122, 123 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
199
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 244.- Suspensin del plazo de prescripcin
El plazo de prescripcin se suspende en los siguientes casos:
1. Por el periodo de tres (3) meses luego de iniciado el procedimiento
administrativo sancionador en caso el Tribunal se pronuncie dentro de
dicho plazo. Si el Tribunal no se pronuncia dentro del plazo indicado, la
prescripcin reanuda su curso, adicionndose el periodo transcurrido
con anterioridad a la suspensin e, inclusive, los tres (3) meses de
suspensin.
2. Por la tramitacin de proceso judicial o arbitral que sea necesario para
la determinacin de la responsabilidad del proveedor, postor, contratista,
experto independiente o rbitros, en el respectivo procedimiento
administrativo sancionador. En el caso de procesos arbitrales, se
entender iniciada la tramitacin a partir de la instalacin del rbitro o
tribunal arbitral.
En tales supuestos, la suspensin del plazo surtir efectos a partir del acuerdo
del Tribunal que as lo determine y en tanto dicho rgano no sea comunicado de
la sentencia judicial o laudo que d trmino al proceso.
124
Artculo 245.- Determinacin gradual de la sancin
Para graduar la sancin de inhabilitacin temporal a imponerse, conforme a las
disposiciones del presente Ttulo, el Tribunal considerar los siguientes criterios:
1. Naturaleza de la infraccin.
2. Intencionalidad del infractor.
3. Dao causado.
4. Reiterancia.
5. El reconocimiento de la infraccin cometida antes de que sea detectada.
6. Circunstancias de tiempo, lugar y modo.
7. Condiciones del infractor.
8. Conducta procesal del infractor.
En caso de incurrir en ms de una infraccin en un proceso de seleccin o en
la ejecucin de un contrato, se aplicar la que resulte mayor.
Artculo 246.- Inhabilitacin Definitiva
Cuando durante la sustanciacin de un procedimiento administrativo
sancionador contra un proveedor, participante, postor, contratista o experto
independiente, el Tribunal constate, adems de la responsabilidad del infractor, que
ste ha sido sancionado en oportunidades anteriores con inhabilitacin temporal
cuyo tiempo sumado sea mayor a treinta y seis (36) meses dentro de un lapso
GHFXDWURDxRVOHLPSRQGUiODVDQFLyQGHLQKDELOLWDFLyQGHQLWLYD
124 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
200
Artculo 247.- Notificacin y vigencia de las sanciones
/DQRWLFDFLyQGHOGHFUHWRTXHGDLQLFLRDOSURFHGLPLHQWRVDQFLRQDGRU\TXH
otorga plazo para formular los descargos se efecta en forma personal.
Los actos que emita el Tribunal durante el procedimiento sancionador, incluidas
las resoluciones que determinan la imposicin de sanciones y las que resuelven los
UHFXUVRVGHUHFRQVLGHUDFLyQVHQRWLFDUiQDWUDYpVGHO7RPD5D]yQHOHFWUyQLFR
implementado en el portal institucional del OSCE, siendo responsabilidad del
infractor el permanente seguimiento del procedimiento sancionador a travs de
dicho medio electrnico, de conformidad con lo dispuesto en la Quinta Disposicin
&RPSOHPHQWDULD)LQDOGHOD/H\/DQRWLFDFLyQVHHQWLHQGHHIHFWXDGDHOGtDGH
la publicacin en el Toma Razn electrnico.
/DVDQFLyQVHUiHIHFWLYDGHVGHHOVH[WRGtDKiELOVLJXLHQWHGHODQRWLFDFLyQ(Q
caso no se conozca domicilio cierto del infractor, la sancin ser efectiva desde el
VH[WRGtDKiELOVLJXLHQWHGHVXSXEOLFDFLyQHQHO'LDULR2FLDO(O3HUXDQR
En caso que, adems de las infracciones administrativas, las conductas se
adecen a un ilcito penal, el Tribunal comunicar al Ministerio Pblico para que
interponga la accin penal correspondiente, indicando las piezas procesales que
se remitirn para tal efecto.
125
Artculo 248.- Suspensin de las sanciones.
La vigencia de las sanciones se suspende por medida cautelar dictada en
un proceso judicial. Cancelada o extinta bajo cualquier otra forma dicha medida
cautelar, la sancin continuar su curso por el periodo restante al momento de
la suspensin, siempre que la resolucin del Tribunal que dispuso la sancin no
KD\DVLGRUHYRFDGDSRUPDQGDWRMXGLFLDOUPH
La vigencia de las sanciones tambin se suspende por la interposicin del
recurso de reconsideracin, de conformidad con lo dispuesto en el presente
Reglamento, y mientras ste no sea resuelto por el Tribunal.
Lo indicado en los prrafos anteriores resulta aplicable a las sanciones
econmicas impuestas por el Tribunal, en cuanto sea aplicable.
Artculo 249.- Recurso de reconsideracin
Contra lo resuelto por el Tribunal en un procedimiento sancionador podr
interponerse recurso de reconsideracin dentro de los cinco (5) das hbiles de
QRWLFDGDRSXEOLFDGDODUHVSHFWLYDUHVROXFLyQ
Como requisito de admisibilidad del recurso de reconsideracin deber
acompaarse una garanta equivalente a una Unidad Impositiva Tributaria (1
UIT) vigente, que deber cumplir con las caractersticas indicadas en el artculo
GHOD/H\\WHQHUXQDYLJHQFLDPtQLPDGHWUHLQWDGtDVFDOHQGDULRODFXDO
podr consistir en un depsito en cuenta bancaria del OSCE. De no presentarse
HVWH UHTXLVLWR GH DGPLVLELOLGDG OD 0HVD GH 3DUWHV GHO 7ULEXQDO R ODV RFLQDV
125 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
201
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
desconcentradas del OSCE otorgarn al impugnante el plazo mximo de dos (2)
das hbiles para su subsanacin. Transcurrido dicho plazo sin que se produzca
dicha subsanacin, el recurso de reconsideracin se considerar automticamente
como no presentado, sin necesidad de pronunciamiento alguno, y los recaudos se
pondrn a disposicin del impugnante para que los recabe en la Mesa de Partes
GHO7ULEXQDORODVRFLQDVGHVFRQFHQWUDGDVGHO26&(
Cuando se declare fundado, en todo o en parte, el recurso de reconsideracin
o se declare nulo el procedimiento administrativo sancionador, se devolver la
garanta presentada. De declararse infundado o improcedente el recurso, se
ejecutar la garanta.
El Tribunal resolver dentro del plazo de quince (15) das hbiles improrrogables
de presentado sin observaciones o subsanado el recurso de reconsideracin.
Artculo 250.- Accin Contencioso Administrativo
3URFHGH OD DFFLyQ FRQWHQFLRVR DGPLQLVWUDWLYD DQWH HO 3RGHU -XGLFLDO GH
conformidad con la Ley de la materia, contra:
a) La resolucin que impone una sancin; o
b) La resolucin que se pronuncia respecto de la reconsideracin
interpuesta contra una resolucin sancionatoria.
TITULO V
REGISTROS
CAPTULO I
REGISTRO NACIONAL DE PROVEEDORES
Artculo 251.- Conformacin
El Registro Nacional de Proveedores-RNP, cuyo desarrollo, administracin y
operacin est a cargo del OSCE, est conformado por los siguientes registros:
1. Registro de Proveedores de Bienes, a quienes se acredita con
informacin suficiente acerca de la naturaleza y objeto de sus
actividades, habilitndolos para ser participantes, postores y/o
contratistas en los procesos de contratacin de bienes.
2. Registro de Proveedores de Servicios, a quienes se acredita con
informacin suficiente acerca de la naturaleza y objeto de sus
actividades, habilitndolos para ser participantes, postores y/o
contratistas en los procesos de contratacin de servicios en general y
servicios de consultora distintos de obras.
3. Registro de Consultores de Obras, a quienes se acredita con informacin
suficiente acerca de la naturaleza y objeto de sus actividades,
asignndoles especialidades, que los habilita para ser participantes,
postores y/o contratistas en los procesos de contratacin de consultora
de obras.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
202
4. Registro de Ejecutores de Obras, a quienes se acredita con informacin
suficiente acerca de su naturaleza y objeto de sus actividades,
asignndoles una capacidad mxima de contratacin, que los habilita
para ser participantes, postores y/o contratistas en los procesos de
contratacin de ejecucin de obras.
5. Registro de Inhabilitados para Contratar con el Estado, que comprende
a los proveedores, participantes, postores o contratistas sancionados
administrativamente por el Tribunal con inhabilitacin temporal o
definitiva para participar en procesos de seleccin o contratar con el
Estado.
Concordancia: LCE: Artculo 9.
Artculo 252.- Inscripcin en los Registros del RNP y vigencia de la inscripcin
Los proveedores accedern a los Registros de Bienes, de Servicios, de
Consultores de Obras y de Ejecucin de Obras, de acuerdo a lo establecido en
el presente Reglamento y cumpliendo con los requisitos, tasas, criterios y escalas
establecidos en el TUPA del OSCE.
'H DFXHUGR FRQ HO QXPHUDO GHO DUWtFXOR GH OD /H\ OD DSOLFDFLyQ GHO
Principio de Reciprocidad no implicar en ningn caso omitir el procedimiento de
inscripcin en el RNP.
6LQSHUMXLFLRGHORGLVSXHVWRHQHOQXPHUDOGHODUWtFXORGHOD/H\HQ
DSOLFDFLyQGHORHVWDEOHFLGRHQHODUWtFXORGHOD&RQVWLWXFLyQ3ROtWLFDGHO3HU~
las empresas nacionales y extranjeras cumplirn los mismos requisitos para la
inscripcin y/o renovacin ante el RNP.
De observarse algn trato discriminatorio a las empresas peruanas en
determinado pas relacionado a la inscripcin en un registro equivalente al RNP,
cualquier proveedor, de manera sustentada, podr comunicar tal situacin ante
HO26&(SDUDTXHHVWHDVXYH]YHULTXHWDOKHFKRHQXQSOD]RGHVHVHQWD
das hbiles. Las Entidades competentes brindarn el apoyo correspondiente al
26&(SDUDTXHpVWHUHDOLFHWDOYHULFDFLyQ
'HVHUSRVLWLYDWDOYHULFDFLyQHO26&(H[LJLUiORVPLVPRVUHTXLVLWRVDODV
empresas originarias del pas donde se cometi el trato discriminatorio a las
empresas peruanas. Si stas ltimas ya estuvieran inscritas, debern cumplir
las nuevas exigencias al momento de su renovacin y/o nueva inscripcin, de
FRQIRUPLGDGFRQORGLVSXHVWRSRUODSDUWHQDOGHOSULPHUSiUUDIRGHODUWtFXOR
de la Constitucin Poltica del Per.
La inscripcin en los Registros tendr validez de un (1) ao a partir del da
siguiente de su aprobacin, pudiendo el interesado iniciar el procedimiento de
renovacin dentro de los sesenta (60) das calendarios anteriores a su vencimiento.
El proveedor deber acceder electrnicamente a su respectiva constancia a travs
del portal institucional del OSCE.
Los proveedores sern responsables de que su inscripcin en el Registro
correspondiente del RNP se encuentre vigente al registrarse como participante, en
la presentacin de propuestas, en el otorgamiento de la buena pro y la suscripcin
203
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
GHOFRQWUDWR/DV(QWLGDGHVGHEHUiQYHULFDUODYLJHQFLDGHODLQVFULSFLyQHQHO
RNP en el portal institucional de OSCE.
Mediante directivas el OSCE establecer disposiciones al presente captulo.
Lo dispuesto en el presente Captulo ser de aplicacin en los trmites de
renovacin de inscripcin, aumento de capacidad mxima de contratacin y
ampliacin de especialidad, en lo que corresponda.
126

Artculo 253.- Calificacin de subcontratos de ejecucin de obras pblicas
En los procedimientos tramitados ante el RNP, los subcontratos de ejecucin
GHREUDVS~EOLFDVVHUiQFRQVLGHUDGRVSDUDODFDOLFDFLyQGHOVXEFRQWUDWLVWD\QR
para la del contratista principal, siempre que posean la misma naturaleza y objeto
del contrato original. En este caso los subcontratos deben haber sido autorizados
por las Entidades contratantes, de conformidad con lo establecido en el presente
5HJODPHQWR3DUDTXHGLFKRVVXEFRQWUDWRVVHDQFDOLFDGRVFRPRH[SHULHQFLD
para la asignacin de la capacidad mxima de contratacin, stos deben estar
inscritos en el RNP, segn el procedimiento establecido en el TUPA del OSCE.
127
Concordancia: LCE: Artculo 37.
Artculo 254.- Fiscalizacin posterior a los procedimientos tramitados ante
el RNP
(O26&(VRPHWHUiDVFDOL]DFLyQSRVWHULRUODGRFXPHQWDFLyQLQIRUPDFLyQ
declaraciones y traducciones, presentadas por los proveedores, de acuerdo a lo
dispuesto por la normativa aplicable y a sus normas de organizacin interna.
128
Artculo 255.- Proveedores extranjeros
Para las personas jurdicas constituidas en el extranjero, los requisitos
establecidos en el TUPA del OSCE sern los equivalentes a los solicitados para
las personas jurdicas nacionales, cuando corresponda, expedidos por autoridad
competente en su lugar de origen.
En los procedimientos seguidos ante los registros de ejecutores y consultores
de obras, al da siguiente de recibida la solicitud con la documentacin que
acredite los indicados requisitos, el proveedor acceder en forma electrnica a su
constancia de inscripcin en el RNP, la que tendr una vigencia de treinta (30) das
hbiles, periodo en el que podr participar y ser postor en los distintos procesos
de seleccin que se convoquen, pero no podr suscribir contratos.
La vigencia de la constancia para ser participante y postor se extender por
diez (10) das hbiles, cuando el trmite de inscripcin sea observado y este sea
subsanado en los ltimos cinco (5) das hbiles del procedimiento, durante dicho
periodo el proveedor no podr presentar mayor documentacin y la ampliacin
del plazo de la constancia estar supeditada al resultado de la evaluacin de la
subsanacin presentada.
La documentacin proveniente del extranjero que tenga por objeto acreditar
126, 127, 128 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
204
los requisitos previstos en el TUPA del OSCE deber contar con la legalizacin
respectiva del Consulado Peruano correspondiente al lugar de origen del
documento, refrendado por el Ministerio de Relaciones Exteriores en el Per o
con la Apostilla de la Haya y, de ser el caso, con su traduccin simple indicando
el nombre del traductor. La legalizacin deber constar en el documento original
y no en la traduccin.
En el caso de procedimientos iniciados con la presentacin de documentacin
conforme al prrafo precedente, el proveedor dentro de los treinta (30) das hbiles
computados a partir del da siguiente de presentada la solicitud, deber presentar
dicha documentacin con la legalizacin del Consulado Peruano correspondiente,
en su lugar de origen, refrendado por el Ministerio de Relaciones Exteriores en el
Per y, de ser el caso, con su traduccin simple indicando el nombre del traductor.
Si la documentacin presentada por el proveedor es conforme, el RNP
proceder a aprobar el procedimiento iniciado. Al da siguiente de la aprobacin,
el proveedor acceder electrnicamente a la constancia de inscripcin en el RNP
con una vigencia de un (1) ao. Con dicha constancia podr ser participante,
postor y suscribir contratos. En caso de no presentar la documentacin con las
formalidades previstas en el cuarto prrafo y dentro del plazo indicado, se dar
por no aprobado el procedimiento iniciado.
Las personas jurdicas extranjeras no domiciliadas con representante legal
en el pas debern adjuntar, para acreditar al mismo, copia simple del poder
YLJHQWHRWRUJDGRFRQIDFXOWDGHVVXFLHQWHVSDUDUHSUHVHQWDUDODHPSUHVDHQ
procedimientos administrativos, debidamente inscrito en los Registros Pblicos
del Per.
Para las personas jurdicas extranjeras no domiciliadas y sin representante legal
en el pas, podrn iniciar su inscripcin en el RNP conforme a los procedimientos
aprobados para tal efecto, el OSCE emitir la directiva para su inscripcin en el
RNP.
129
Artculo 256.- Excepciones
No requieren inscribirse como proveedores en el RNP:
/DV(QWLGDGHVGHO(VWDGRFRPSUHQGLGDVHQHOLQFLVRGHODUWtFXOR
de la Ley.
2. Las sociedades conyugales y las sucesiones indivisas para celebrar
contratos sobre bienes y servicios.
130
Concordancia: LCE: Artculo 3
Artculo 257.- Categoras y Especialidades
El RNP otorgar categoras a los ejecutores de obras, asignndoles una
capacidad mxima de contratacin, y especialidades a los consultores de obras.

129, 130 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
205
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 258.- Comunicacin de ocurrencias
Para mantener actualizados los datos del RNP, quienes se encuentren
registrados en l, estn obligados a comunicar las ocurrencias establecidas
en el presente Reglamento dentro de los plazos previstos, sujetndose a las
consecuencias que se deriven de su incumplimiento.
Artculo 259.- Impedimentos
No podrn inscribirse ni renovar su inscripcin, aumentar su capacidad mxima
de contratacin, ni ampliar su especialidad como proveedores en el RNP:
1. Las personas naturales o jurdicas que se encuentren con sancin vigente
de inhabilitacin.
2. Los proveedores cuya inscripcin haya sido declarada nula por haber
presentado documentacin falsa o informacin inexacta al RNP, conforme
DORGLVSXHVWRHQHODUWtFXORGHOD/H\
131
Artculo 260.- Socios Comunes
Cuando dos o ms proveedores tengan socios comunes en los que sus
acciones, participaciones o aportes sean superiores al cinco por ciento (5%) del
capital o patrimonio social en cada uno de ellos, con la solicitud de inscripcin,
renovacin, ampliacin de especialidad, aumento de capacidad mxima de
contratacin, segn corresponda, que formulen ante el RNP, debern declarar que
cuando participen en un mismo proceso de seleccin, slo lo harn en consorcio
y no independientemente.
Si se detectara el incumplimiento del presente artculo deber comunicarse
al Tribunal de Contrataciones del Estado para la aplicacin de la sancin
correspondiente, establecida en la Ley.
132
Artculo 261.- Inscripcin en el Registro de Proveedores de Bienes
En el Registro de Proveedores de Bienes debern inscribirse todas las
personas naturales o jurdicas, nacionales o extranjeras, que deseen participar
en procesos de seleccin y/o contratar con el Estado la provisin de bienes, sea
que se presenten de manera individual, en consorcio, o tengan la condicin de
subcontratistas, para lo cual debern estar legalmente capacitadas para contratar:
1. Las personas naturales deben encontrarse en pleno ejercicio de sus
derechos civiles.
2. Las personas jurdicas nacionales deben haber sido constituidas
conforme a ley. Las personas jurdicas extranjeras deben haber sido
constituidas de conformidad con la ley de su lugar de origen, y cumplir
con los requisitos establecidos en el TUPA de OSCE. El objeto social
establecido en la escritura pblica de las personas jurdicas, inscrito
en Registros Pblicos o en la institucin u autoridad competente en el
131, 132, 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
206
lugar de origen para las extranjeras, cuando corresponda, deber estar
referido a las actividades consideradas en este registro.
133
Artculo 262.- Obligaciones de los proveedores de bienes
Los proveedores de bienes estn obligados a comunicar al RNP, dentro de los
diez (10) das hbiles siguientes al trmino de cada mes, las siguientes ocurrencias:
variacin de domicilio, cambio de razn o denominacin social, transformacin
societaria, cambio de representante legal, socios, accionistas, participacionistas
o titular, rganos de administracin, cambio en la distribucin de acciones,
participaciones, aportes y otras variaciones que el OSCE establezca mediante
directiva. Si el proveedor no declar la variacin dentro del plazo establecido,
deber regularizarla mediante la comunicacin de ocurrencias extempornea.
134
Artculo 263.- Inscripcin en el Registro de Proveedores de Servicios
En el Registro de Proveedores de Servicios debern inscribirse todas las
personas naturales o jurdicas, nacionales o extranjeras, que deseen participar
en procesos de seleccin y/o contratar con el Estado la contratacin de servicios
en general y las consultoras distintas a las de obras, sea que se presenten de
manera individual, en consorcio, o tengan la condicin de subcontratistas, para
lo cual debern estar legalmente capacitadas para contratar:
1. Las personas naturales deben encontrarse en pleno ejercicio de sus
derechos civiles.
2. Las personas jurdicas nacionales deben haber sido constituidas
conforme a ley. Las personas jurdicas extranjeras deben haber sido
constituidas de conformidad con la ley de su lugar de origen, y cumplir
con los requisitos establecidos en el TUPA de OSCE. El objeto social
establecido en la escritura pblica de las personas jurdicas, inscrito
en Registros Pblicos o en la institucin u autoridad competente en el
lugar de origen para las extranjeras, cuando corresponda, deber estar
referido a las actividades consideradas en este registro.
135
Artculo 264.- Obligaciones de los proveedores de servicios
Los proveedores de servicios estn obligados a comunicar al RNP, dentro de los
diez (10) das hbiles siguientes al trmino de cada mes, las siguientes ocurrencias:
variacin de domicilio, cambio de razn o denominacin social, transformacin
societaria, cambio de representante legal, socios, accionistas, participacionistas
o titular, rganos de administracin, cambio en la distribucin de las acciones,
participaciones, aportes y otras variaciones que el OSCE establezca mediante
directiva. Si el proveedor no declar la variacin dentro del plazo establecido,
deber regularizarla mediante la comunicacin de ocurrencias extemporneas.
136
133, 134,135,136 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
207
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 265.- Inscripcin en el Registro de Consultores de Obras
En el Registro de Consultores de Obras debern inscribirse todas las personas
naturales o jurdicas, nacionales o extranjeras, que deseen participar en procesos
de seleccin y/o contratar con el Estado en la consultora de obras pblicas, sea
que se presenten de manera individual, en consorcio o tengan la condicin de
subcontratistas, para lo cual debern:
1. Estar legalmente capacitadas para contratar:
a) Las personas naturales deben encontrarse en pleno ejercicio de
sus derechos civiles.
b) Las personas jurdicas nacionales deben haber sido constituidas
como sociedades al amparo de la Ley General de Sociedades
y normas complementarias, o como empresas individuales de
responsabilidad limitada.
El objeto social establecido en la escritura pblica inscrita
en Registros Pblicos debe corresponder a la supervisin de
obras y/o elaboracin de expedientes tcnicos de obras. Las
personas jurdicas extranjeras deben haber sido constituidas de
conformidad con la ley de la misma materia que las nacionales,
pero de su lugar de origen, y de acuerdo con los requisitos
establecidos en el TUPA del OSCE. Los requisitos referidos al
objeto social sern los equivalentes a los solicitados para las
personas jurdicas nacionales.
2. Tener capacidad tcnica:
La capacidad tcnica ser acreditada considerando la experiencia
realizada como consultor de obras, asignndoles las especialidades que
corresponda de acuerdo a lo establecido en el presente Reglamento y
en el TUPA del OSCE.
No ser considerada como experiencia aquellos contratos suscritos
contraviniendo la Ley y el Reglamento.
3. Tener solvencia econmica:
Para determinar la solvencia econmica se evaluar la informacin
QDQFLHUD\FRQWDEOHVROLFLWDGDHQHO783$GHO26&(DSOLFDQGRORVUDWLRV
de medicin de solvencia, aprobados para tal efecto. Adicionalmente,
cuando corresponda, se tomar en cuenta la calificacin de la
Superintendencia de Banca, Seguros y Administradoras de Fondos de
Pensiones.
Las personas naturales o jurdicas, nacionales o extranjeras, que deseen
inscribirse en el registro de consultores de obras debern presentar ante
el RNP la respectiva solicitud adjuntando la documentacin que acredite
los requisitos que establezca el TUPA del OSCE.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
208
Al da siguiente de recibida la solicitud con la documentacin que acredite
los requisitos indicados en el TUPA del OSCE, el proveedor acceder
en forma electrnica a su constancia de inscripcin en el RNP, la que
tendr una vigencia de treinta (30) das hbiles, periodo en el que podr
participar y ser postor en los distintos procesos de seleccin que se
convoquen, pero no podr suscribir contratos.
La constancia para ser participante y postor se extender por diez
(10) das hbiles, cuando el trmite de inscripcin sea observado
y este sea subsanado en los ltimos cinco (5) das hbiles del
procedimiento, durante dicho periodo el proveedor no podr presentar
mayor documentacin y la ampliacin del plazo de la constancia estar
supeditada al resultado de la evaluacin de la subsanacin presentada.
Solo podrn suscribir contratos cuando se haya aprobado el
procedimiento iniciado, caso en el cual acceder electrnicamente a
la constancia de inscripcin en el RNP con una vigencia de un (1) ao,
contado a partir del da siguiente de su aprobacin. Con dicha constancia
podr ser participante, postor y suscribir contratos.
137
Artculo 266.- Profesin de las personas naturales
Podrn inscribirse como personas naturales en el Registro de Consultores
de Obras los arquitectos y los ingenieros civiles, sanitarios, agrcolas,
electromecnicos, mecnicos, mecnicos elctricos, mecnico de fluidos,
elctricos, electrnicos, mineros, petroleros, ambientales y de energa.
138
Artculo 267.- Asignacin de Especialidades de los Consultores de obras
El RNP asignar a los consultores de obras una (1) o varias especialidades,
habilitndolos para participar en procesos de seleccin y contratar con el Estado
la consultora de obras pblicas.
A los consultores de obras que no acrediten experiencia se les otorgar la
especialidad de consultoras en obras menores.
Slo se considerar la experiencia obtenida directamente, sea como persona
natural o persona jurdica, en la realizacin de elaboracin de expedientes tcnicos
y/o supervisin de obras, no considerndose como tales aquellas actividades
ejecutadas como dependientes o bajo la direccin de otro consultor de obras.
La experiencia en la especialidad para los consultores de obras, nacionales
o extranjeros, se acreditar con un servicio de consultora de obras culminado
dentro de los ltimos cinco (5) aos, considerados hasta la fecha de presentacin
de la respectiva solicitud de inscripcin.
139
Artculo 268.- Especialidades de los Consultores de obras
La (s) especialidad (es) de los consultores de obras se determinar por:
1370RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
209
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
a) El objeto sealado en la escritura pblica de constitucin, inscrita en
Registros Pblicos o en la institucin u autoridad competente en el
lugar de origen para las extranjeras, slo para el caso de las personas
jurdicas; y
b) La experiencia previa determinada por el tipo de proyectos y obras en
que haya prestado servicios de consultora de obras, en las siguientes
especialidades:
b.1) Consultora en obras urbanas, edificaciones y afines
Construccin, ampliacin o remodelacin de edificios, viviendas,
centros comerciales, conjuntos habitacionales, habilitaciones
urbanas, reservorios de agua potable (elevados o apoyados),
muros de contencin, pavimentaciones de calles, fbricas y afines.
b.2) Consultora en obras viales, puertos y afines
Carreteras con pavimento asfltico o concreto, caminos rurales,
puentes, tneles, lneas ferroviarias, explotaciones mineras,
puertos y aeropuertos, pavimentacin de pistas de aterrizaje y
afines.
b.3) Consultora en obras de saneamiento y afines
Plantas de tratamiento de agua potable, redes de conduccin
de agua potable, redes de conduccin de desages, conjuntos
habitacionales, habilitaciones urbanas, emisores de desages,
lneas de impulsin, lneas de aduccin, lneas de conduccin,
cmaras de bombeo, reservorios elevados o apoyados, lagunas
de oxidacin, conexiones domiciliarias de agua y desage, plantas
de tratamiento.
Redes de conduccin de lquidos, combustibles, gases y afines.
b.4) Consultora en obras electromecnicas y afines
Redes de conduccin de corriente elctrica en alta y baja tensin,
subestaciones de transformacin, centrales trmicas, centrales
hidroelctricas y afines.
b.5) Consultora en obras energticas y afines
Plantas de generacin elctrica, lneas de transmisin, redes
primarias, redes secundarias con conexiones domiciliarias,
centrales hidroelctricas, conjuntos habitacionales, habilitaciones
urbanas y afines.
b.6) Consultora en obras de represas, irrigaciones y afines
Represas de concreto, represas de tierra y otras, canales de
conduccin de aguas, encauzamiento y defensas de ros, tomas
de derivacin, presas, tneles para conduccin de aguas.
b.7) Consultora en obras menores
La especialidad de consultora en obras menores, que comprende
a cualquiera de las especialidades antes mencionadas, solo
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
210
autoriza a participar, presentar propuestas y suscribir contrato,
de manera individual o en consorcio, en las Adjudicaciones
Directas Selectivas, las Adjudicaciones de Menor Cuanta, y en
las exoneraciones cuyo monto corresponda a los mencionados
procesos, exceptundose a aquellos procesos de Adjudicacin
de Menor Cuanta Derivadas de Concurso Pblico o Adjudicacin
Directa Pblica.
140
Artculo 269.- Ampliacin de la Especialidad
Para la aprobacin de la solicitud de ampliacin de la especialidad, el consultor
de obras deber cumplir con lo siguiente:
1. Tener vigente su inscripcin en el RNP.
2. Cumplir con los dems requisitos establecidos en el TUPA del OSCE.
141
Artculo 270.- Obligaciones de los Consultores de Obras
Los consultores de obras estn obligados a comunicar al RNP, dentro de los
primeros diez (10) das hbiles siguientes al trmino de cada mes de producido
el hecho, las siguientes ocurrencias:
1. Contratos suscritos con Entidades.
2. Variacin de domicilio, representante legal, cambio de socios,
accionistas, participacionistas o titular, razn o denominacin social,
transformacin societaria, cambio de rganos de administracin,
distribucin de las acciones, participaciones, aportes y otras variaciones
que el OSCE establezca mediante directiva.
En el caso del inciso 1, se declarar a travs del rcord de consultora de obras.
En el caso del inciso 2, se comunicar a travs del trmite de comunicacin
de ocurrencias, de conformidad con lo establecido en el TUPA del OSCE.
142
Artculo 271.- Rcord de Consultora de Obras
Es la declaracin efectuada por el consultor de obras al RNP de la informacin
detallada de los contratos suscritos con las Entidades comprendidas en el inciso
GHODUWtFXORGHOD/H\H[RQHUiQGRVHGHWDOREOLJDFLyQDORVFRQVXOWRUHVGH
obras que no hubieran suscrito contrato alguno.
El proveedor se encuentra obligado a efectuar esta declaracin electrnicamente
en la seccin del RNP del OSCE.
La declaracin extempornea del rcord de consultora de obras podr
regularizarse, siempre que no haya contratado por especialidades distintas a las
otorgadas por el RNP, situacin que ser comunicada al Tribunal de Contrataciones
del Estado para la aplicacin de la sancin correspondiente, establecida en la
Ley.
143
140, 141, 142,143 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
211
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 272.- Inscripcin en el Registro de Ejecutores de Obras
En el Registro de Ejecutores de Obras debern inscribirse todas las personas
naturales o jurdicas, nacionales o extranjeras, que deseen participar en procesos
de seleccin y/o contratar con el Estado en la ejecucin de obras pblicas, ya
sea que se presenten de manera individual, en consorcio o tengan la condicin
de subcontratistas, para lo cual debern:
1. Estar legalmente capacitadas para contratar:
a) Las personas naturales deben encontrarse en pleno ejercicio de
sus derechos civiles.
b) En el caso de personas jurdicas nacionales deben haberse
constituido como sociedades al amparo de la Ley General de
Sociedades y normas complementarias, o como empresas
individuales de responsabilidad limitada. El objeto social
establecido en la escritura pblica inscrita en Registros Pblicos
deber corresponder a la ejecucin de obras.
Las personas jurdicas extranjeras debern haber sido constituidas
de conformidad con la ley de la misma materia que las nacionales,
pero de su lugar de origen, y de acuerdo a los requisitos
establecidos en el TUPA del OSCE. Los requisitos referidos al
objeto social sern los equivalentes a los solicitados para las
personas jurdicas nacionales.
2. Tener capacidad tcnica:
La que ser acreditada considerando la experiencia realizada como
ejecutor de obras, otorgndoles la capacidad mxima de contratacin
que corresponda y de acuerdo a lo establecido en el presente
Reglamento y en el TUPA del OSCE.
No ser considerada como experiencia aquellos contratos suscritos
contraviniendo la Ley y el Reglamento.
3. Tener solvencia econmica:
Para determinar la solvencia econmica se evaluar la informacin
financiera y contable solicitada en el TUPA del OSCE, aplicando los ratios
de medicin de solvencia, aprobados para tal efecto. Adicionalmente,
cuando corresponda, se tomar en cuenta la calificacin de la
Superintendencia de Banca, Seguros y Administradoras de Fondos de
Pensiones.
Las personas naturales o jurdicas, nacionales o extranjeras, que deseen
inscribirse en el registro de ejecutores de obras debern presentar ante
el RNP la respectiva solicitud adjuntando la documentacin que acredite
los requisitos que establezca el TUPA del OSCE.
Al da siguiente de recibida la solicitud con la documentacin que acredite
los requisitos indicados en el TUPA del OSCE, el proveedor acceder
en forma electrnica a su constancia de inscripcin en el RNP, la que
tendr una vigencia de treinta (30) das hbiles, periodo en el que podr
participar y ser postor en los distintos procesos de seleccin que se
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
212
convoquen, pero no podr suscribir contratos.
La constancia para ser participante y postor se extender por diez
(10) das hbiles, cuando el trmite de inscripcin sea observado
y este sea subsanado en los ltimos cinco (5) das hbiles del
procedimiento, durante dicho periodo el proveedor no podr presentar
mayor documentacin y la ampliacin del plazo de la constancia estar
supeditada al resultado de la evaluacin de la subsanacin presentada.
Solo podrn suscribir contratos cuando se haya aprobado el
procedimiento iniciado, caso en el cual acceder electrnicamente a
la constancia de inscripcin en el RNP con una vigencia de un (1) ao,
contado a partir del da siguiente de su aprobacin. Con dicha constancia
podr ser participante, postor y suscribir contratos.
144
Artculo 273.- Profesin de las personas naturales
Podrn inscribirse como personas naturales en el Registro de Ejecutores
de Obras los arquitectos y los ingenieros civiles, sanitarios, agrcolas,
electromecnicos, mecnicos, mecnicos elctricos, mecnico de fluidos,
elctricos, electrnicos, mineros, petroleros y de energa.
145
Artculo 274.- Asignacin de la capacidad de mxima contratacin para los
ejecutores de obras
El RNP asignar a los ejecutores de obras, nacionales y extranjeros, una
capacidad mxima de contratacin, habilitndolos para participar en los procesos
de seleccin y/o contratar la ejecucin de obras.
En el caso de ejecutores que no acrediten experiencia, se les otorgar una
capacidad mxima de contratacin hasta por un total equivalente al monto
establecido para la Adjudicacin Directa Selectiva.
Cuando el ejecutor de obras solicite la renovacin de inscripcin despus
de haber transcurrido cinco (5) aos de vencida la vigencia de su inscripcin y/o
muestre una reduccin de capital que afecte su capacidad mxima de contratacin,
sta se recalcular, debiendo ser el tope mximo la que tuvo anteriormente,
SXGLHQGRHQHVWHFDVRDFUHGLWDUQXHYDVREUDVSDUDGLFKRQ
La experiencia para los ejecutores de obras, nacionales o extranjeros, se
acreditar con la ejecucin de obras culminadas dentro de los ltimos cinco (5)
aos, consideradas hasta la fecha de presentacin de la respectiva solicitud de
inscripcin.
146
Artculo 275.- Capacidad mxima de contratacin
La capacidad mxima de contratacin es el monto hasta por el cual un
ejecutor de obras est autorizado a contratar la ejecucin de obras pblicas
simultneamente, y est determinada por la ponderacin del capital y las obras
ejecutadas de la siguiente manera:
1440RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
213
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
a) Para personas naturales nacionales y extranjeras, personas jurdicas
nacionales inscritas en el Registro Nacional de la Micro y Pequea Empresa
(REMYPE) y personas jurdicas extranjeras domiciliadas (sucursal) y no
domiciliadas (matriz) que provengan de pases con los cuales el Per tenga vigente
un tratado o compromiso internacional que incluya disposiciones en materia de
contrataciones pblicas:
CMC = 15 (C) + 2 (S Obras)
Donde :
CMC : Capacidad mxima de contratacin.
C : Capital
S Obras : Sumatoria de los montos de las obras culminadas dentro de
los ltimos cinco (5) aos, considerados hasta la fecha de
presentacin de la respectiva solicitud.
Para las personas naturales, el capital estar representado por su capital
contable declarado en el libro de inventarios y balances y/o en el balance del ltimo
ejercicio presentado a la Superintendencia Nacional de Administracin Tributaria
- SUNAT, o documentos equivalentes expedidos por autoridad competente del
domicilio de la persona natural extranjera solicitante.
Para las personas jurdicas nacionales y las personas jurdicas extranjeras
domiciliadas (sucursal), el capital estar representado por su capital social, pagado
e inscrito en Registros Pblicos.
Para las personas jurdicas extranjeras no domiciliadas (matriz), la inscripcin
HQORV5HJLVWURV3~EOLFRVVHUHHUHDODLQVFULSFLyQUHDOL]DGDDQWHODLQVWLWXFLyQR
autoridad competente, conforme a las formalidades exigidas en su pas de origen.
b) Para personas jurdicas nacionales y extranjeras domiciliadas (sucursal) y
no domiciliadas (matriz) no incluidas en el literal a) del presente artculo:
CMC = 15 (C) + 2 (S Obras)
Donde:
CMC : Capacidad Mxima de Contratacin.
C : Capital o Depsito, el cual no podr ser inferior al 5% de su
capacidad mxima de contratacin
S Obras : Sumatoria de los montos de las obras culminadas dentro de
los ltimos cinco (5) aos, considerados hasta la fecha de
presentacin de la respectiva solicitud.
Para las personas jurdicas nacionales, el capital estar representado por su
capital social suscrito, pagado e inscrito en Registros Pblicos.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
214
Para las personas jurdicas extranjeras domiciliadas (sucursal) el capital estar
representado por el asignado a sta, el cual debe estar inscrito en Registros
Pblicos.
Para las personas jurdicas extranjeras no domiciliadas (matriz) el capital estar
representado por el depsito dinerario en una cuenta abierta por el representante
OHJDOHQHOVLVWHPDQDQFLHURQDFLRQDO3DUDWDOHIHFWRGLFKRGHSyVLWRGHEHUiKDEHU
VLGRSUHYLDPHQWHDSUREDGRSRUOD-XQWD*HQHUDOGH$FFLRQLVWDVXyUJDQRDQiORJR
de la sociedad. Asimismo, debe acreditarse ste con el reporte de estado de
FXHQWDH[WUDFWREDQFDULRYRXFKHUGHGHSyVLWRRFRQVWDQFLDGHHQWLGDGQDQFLHUD
(OGHSyVLWRGLQHUDULRHQHOVLVWHPDQDQFLHURQDFLRQDODTXHVHUHHUHHOSiUUDIR
precedente se mantendr durante la vigencia de la inscripcin del proveedor en el
RNP o, en su defecto, podr ser utilizado por las personas jurdicas extranjeras no
GRPLFLOLDGDVPDWUL]SDUDQDQFLDUVXVRSHUDFLRQHVHQWHUULWRULRQDFLRQDOVLHQGR
GLFKDGHFLVLyQGHH[FOXVLYDUHVSRQVDELOLGDGGHOD-XQWD*HQHUDOGH$FFLRQLVWDVX
rgano anlogo de la sociedad.
Tratndose de capitales, depsitos o contratos de obras celebrados en moneda
extranjera, se determinar su equivalente en la moneda de curso legal vigente
en el pas, utilizando el factor de conversin del promedio ponderado venta de la
Superintendencia de Banca, Seguros y Administradoras Privadas de Fondos de
3HQVLRQHVXRWURVPHGLRVHQHOFXDOVHLQIRUPHHOWLSRGHFRQYHUVLyQRFLDODOD
fecha de la presentacin de la solicitud.
147
Artculo 276.- Aumento de capacidad mxima de contratacin
Para la aprobacin de la solicitud de aumento de la capacidad mxima de
contratacin, el ejecutor de obras deber cumplir con lo siguiente:
1. Tener vigente su inscripcin en el RNP.
2. Cumplir con los dems requisitos establecidos en el TUPA del OSCE.
Para otorgarle la nueva capacidad mxima de contratacin se aplicar lo
HVWDEOHFLGRHQHODUWtFXORGHO5HJODPHQWR
148
Artculo 277.- Capacidad Libre de Contratacin
La capacidad libre de contratacin es el monto no comprometido de la
capacidad mxima de contratacin y se obtiene deduciendo de sta las obras
pblicas adjudicadas que cuenten con constancia de capacidad libre de
contratacin expedida por el Registro Nacional de Proveedores.
La capacidad mxima de contratacin es comprometida al momento de la
expedicin de la constancia de capacidad libre de contratacin, y se va restituyendo
de acuerdo a la declaracin de lo valorizado por los avances de las obras pblicas
contratadas, efectuadas a travs del mdulo del rcord de obras habilitado en el
portal institucional del OSCE.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH\UHFWLIL-
cado mediante Fe de Erratas publicada en el Diario Oficial El Peruano el 18 de agosto de 2012.
148 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
215
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En el caso de consorcios, estos solicitarn la correspondiente constancia
de capacidad libre de contratacin para cada integrante, donde la suma de las
capacidades libres de contratacin deber ser igual o superior al monto de la
propuesta econmica que presenten. La capacidad libre de contratacin de cada
integrante del consorcio debe ser superior o igual al monto del porcentaje de la
obligacin asumida en cada proceso.
149
Artculo 278.- Obligaciones de los ejecutores de obras
Los ejecutores de obras estn obligados a comunicar al RNP dentro de los
primeros diez (10) das hbiles siguientes al trmino de cada mes de ocurrido el
hecho, las siguientes ocurrencias:
1. Contratos suscritos con Entidades.
2. Valorizaciones acumuladas de cada una de las obras hasta su
culminacin fsica.
3. Variacin de domicilio, representante legal, cambio de socios,
accionistas, participacionistas o titular, razn o denominacin social,
transformacin societaria, rganos de administracin, distribucin de
las acciones, participaciones, aportes y otras variaciones que el OSCE
establezca mediante directiva.
En el caso de los incisos 1 y 2, se declarar a travs del mdulo de rcord
GHREUDVVLODRPLVLyQOREHQHFLyLQGHELGDPHQWHQRSRGUiUHJXODUL]DUOR6LVH
detectara dicha situacin deber comunicarse al Tribunal de Contrataciones del
Estado para la aplicacin de la sancin correspondiente, establecida en la Ley.
En el caso del inciso 3, se comunicar a travs del trmite de comunicacin
de ocurrencias, de conformidad con lo establecido en el TUPA del OSCE.
150
Artculo 279.- Rcord de Obras
Es la declaracin efectuada por el ejecutor de obras ante el RNP, de la
informacin detallada de los contratos suscritos con las Entidades comprendidas
en el inciso 3.1 del artculo 3 de la Ley, as como las respectivas valorizaciones
acumuladas hasta la culminacin fsica de la obra, exonerndose de tal obligacin
a los ejecutores de obra que no hubieran suscrito contrato alguno.
El proveedor se encuentra obligado a efectuar esta declaracin electrnicamente
en la seccin del RNP del portal del OSCE.
La declaracin extempornea del rcord de obras podr regularizarse siempre
TXH OD RPLVLyQ QR KD\D EHQHFLDGR DO HMHFXWRU HQ VX SDUWLFLSDFLyQ HQ RWURV
procesos de seleccin.
Si se detectara dicha situacin deber comunicarse al Tribunal de
Contrataciones del Estado para la aplicacin de la sancin correspondiente,
establecida en la Ley.
151
149, 150 ,151 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
216
Artculo 280.- Registro de Inhabilitados para contratar con el Estado
La inclusin de un proveedor, participante, postor y/o contratista en el Registro
de Inhabilitados para Contratar con el Estado se produce previa resolucin del
7ULEXQDOTXHDVtORRUGHQHRSRUFXPSOLPLHQWRGHVHQWHQFLDMXGLFLDOUPH
(O26&(H[FOXLUiGHRFLRGHO5HJLVWURGH,QKDELOLWDGRVSDUD&RQWUDWDUFRQHO
Estado al proveedor, participante, postor y/o contratista que haya cumplido con la
VDQFLyQLPSXHVWDRVLODPLVPDKDTXHGDGRVLQHIHFWRSRUUHVROXFLyQMXGLFLDOUPH
Artculo 281.- Publicacin del Registro de Inhabilitados
La relacin de los proveedores, participantes, postores y/o contratistas que
KD\DQVLGRVDQFLRQDGRVFRQLQKDELOLWDFLyQWHPSRUDORGHQLWLYDSDUDFRQWUDWDUFRQ
el Estado, ser publicada mensualmente en el portal institucional del OSCE, dentro
de los quince (15) das hbiles siguientes al trmino de cada mes, de conformidad
FRQORHVWDEOHFLGRHQHODUWtFXORGHOD/H\
La publicacin de los proveedores sancionados incluir la informacin de los
socios, accionistas, participacionistas o titulares con ms del cinco por ciento (5%)
de participacin en el capital o patrimonio social, as como de los integrantes de
sus rganos de administracin, a la fecha de la comisin de la infraccin.
3DUD HIHFWRV GH OD SXEOLFDFLyQ D OD TXH VH UHHUH HO SiUUDIR DQWHULRU VH
considerar como rganos de administracin al gerente, directorio, consejo
directivo, administradores, junta directiva, junta de administracin, consejo de
administracin, consejo universitario o consejo directivo, o el rgano equivalente
inscrito ante autoridad competente en el pas de origen, en el caso de empresas
extranjeras.
/DLQIRUPDFLyQDODTXHVHUHHUHHOSiUUDIRDQWHULRUVHSXEOLFDUiGHDFXHUGR
a los datos existentes en el sistema informtico del RNP, conforme a lo declarado
por los proveedores bajo su responsabilidad, por lo que los reclamos que se
presenten respecto de la informacin publicada no son imputables al RNP.
152
Artculo 282.- Constancia de no estar Inhabilitado para contratar con el Estado
y de capacidad de libre contratacion.
La constancia de no estar inhabilitado para contratar con el Estado es el
documento expedido por el OSCE que acredita que un proveedor no se encuentra
incluido en el Registro de Inhabilitados para contratar con el Estado.
La constancia de capacidad libre de contratacin es el documento expedido
por el OSCE que acredita el monto no comprometido de la capacidad mxima de
contratacin hasta por el cual puede contratar un ejecutor de obras.
La solicitud de expedicin de las constancias de no estar inhabilitado para
contratar con el Estado y de capacidad libre de contratacin se tramitar dentro
de los quince (15) das hbiles siguientes de haber quedado consentida la Buena
Pro o de haberse agotado la va administrativa conforme a lo previsto en los
DUWtFXORV\(O26&(QRH[SHGLUiODVFRQVWDQFLDVTXHVHDQVROLFLWDGDV
fuera del plazo establecido.
1520RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
217
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
En caso de detectarse el incumplimiento del plazo para la suscripcin del
contrato por parte de la Entidad, el OSCE, en ejercicio de su funcin de velar por
el cumplimiento de la normativa, adoptar las medidas correspondientes.
La solicitud de expedicin de las constancias de no estar inhabilitado para
contratar con el Estado y de capacidad de libre contratacin deber tramitarse
en el plazo sealado, independientemente del cumplimiento del procedimiento y
plazos que realice la Entidad para la suscripcin del contrato respectivo, previstos
HQHODUWtFXOR
En aquellos casos en los cuales el OSCE tome conocimiento sobre el
incumplimiento de la normativa, en ejercicio de la funcin sealada en el literal
PGHODUWtFXORGHOD/H\GHQHJDUiODH[SHGLFLyQGHODFRQVWDQFLDGHQRHVWDU
inhabilitado para contratar con el Estado y/o de capacidad libre de contratacin.
153
CAPTULO II
REGISTRO DE ENTIDADES CONTRATANTES
Artculo 283.- Registro de las Entidades Contratantes
Para efectos de la realizacin de los procesos de contrataciones del Estado, el
Registro de Entidades Contratantes (REC) inscribe a las Entidades comprendidas
en el numeral 3.1 del artculo 3 de la Ley, que realicen procesos de contratacin
pblica.
Artculo 284.- Registro de la informacin en el Registro de Entidades
Contratantes
Para su registro en el REC, las Entidades debern proporcionar la informacin
que se solicite en el enlace correspondiente del SEACE.
/DVPRGLFDFLRQHVDODLQIRUPDFLyQSURSRUFLRQDGDHQHO5(&GHEHUiQVHU
actualizadas en el SEACE en un plazo no mayor de diez (10) das hbiles de
producida.
TTULO VI
SISTEMA ELECTRNICO DE CONTRATACIONES DEL
ESTADO - SEACE
CAPTULO I
GENERALIDADES
Artculo 285.- Objeto
El presente Captulo tiene como objeto regular el procedimiento para el registro
de la informacin de las contrataciones de bienes, servicios y obras en el Sistema
Electrnico de Contrataciones del Estado - SEACE.
Concordancia: LCE: Artculos 67 al 70.
153 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
218
Artculo 286.- Acceso al SEACE
Para interactuar con el SEACE, tanto las Entidades, proveedores, rbitros u
RWURVXVXDULRVDXWRUL]DGRVGHEHUiQXWLOL]DUHO&HUWLFDGR6($&(HPLWLGRSRUHO
OSCE.
Es responsabilidad de la Entidad solicitar ante el OSCE la desactivacin del
&HUWLFDGR6($&(GHDTXHOORVIXQFLRQDULRVXVXDULRVTXH\DQRVHHQFXHQWUHQ
autorizados para registrar informacin en el SEACE. Asimismo, corresponde al
iUELWURVROLFLWDUDO26&(ODGHVDFWLYDFLyQGHVX&HUWLFDGR6($&(FXDQGRKD\D
determinado que no efectuar uso del mismo.
154
Artculo 287.- Obligatoriedad
7RGDVODVHQWLGDGHVUHIHULGDVHQHOQXPHUDOGHODUWtFXORGHOD/H\HVWiQ
obligadas a registrar informacin sobre su Plan Anual de Contrataciones, los
procesos de seleccin, los contratos y su ejecucin, y todos los actos que requieran
ser publicados, conforme se establece en la Ley, el presente Reglamento y en la
Directiva que emita el OSCE.
La Entidad deber registrar en el SEACE dentro de los diez (10) primeros das
hbiles de cada mes, las contrataciones por montos de una (1) a tres (3) Unidades
Impositivas Tributarias realizadas en el mes anterior.
El OSCE mediante Directiva establecer los lineamientos para el registro
en el SEACE de las contrataciones con sujecin a regmenes especiales de
FRQWUDWDFLyQDVtFRPRGHODVFRQWUDWDFLRQHVDTXHVHUHHUHHOSiUUDIRSUHFHGHQWH
Concordancia: LCE: Artculos 45, 66 y 70.
Artculo 288.- Registro de la informacin
La informacin que se registra en el SEACE debe ser idntica a la informacin
TXH VH WLHQH FRPR GRFXPHQWR QDO SDUD OD UHDOL]DFLyQ GH FXDOTXLHU DFWR HQ
el proceso de contratacin, bajo responsabilidad del funcionario que hubiese
VROLFLWDGRODDFWLYDFLyQGHO&HUWLFDGR6($&(\GHDTXpOTXHKXELHUDUHJLVWUDGR
la informacin.
Asimismo, la informacin del laudo arbitral y otras resoluciones arbitrales
que se registran en el SEACE, en cumplimiento de la obligacin prevista en el
DUWtFXORGHEHUiVHULGpQWLFDDODGHORULJLQDOVXVFULWRSRUHORORVUHVSHFWLYRV
rbitros, bajo responsabilidad del rbitro nico o del presidente del tribunal arbitral
encargado de su registro.
155
Artculo 289.- Condiciones de continuidad del sistema
El OSCE acreditar la suspensin de la continuidad del funcionamiento total
o parcial de la plataforma del SEACE, en cuyo caso las Entidades debern
FRPXQLFDUVHFRQHO26&(DQGHVROLFLWDUWDODFUHGLWDFLyQODFXDOOHSHUPLWLUi
reprogramar las etapas de los procesos de seleccin.
1540RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
219
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
Artculo 290.- Rgimen de notificaciones
Todos los actos realizados a travs del SEACE, incluidos los efectuados por
HO26&(HQHOHMHUFLFLRGHVXVIXQFLRQHVVHHQWLHQGHQQRWLFDGRVHOPLVPRGtD
de su publicacin.
156
Concordancia: LCE: Artculo 70.
CAPTULO II
PROCESOS ELECTRONICOS
Artculo 291.- Alcances
El presente Captulo establece las reglas que deben aplicarse a los procesos
de seleccin electrnicos.

Artculo 292.- Procesos electrnicos
El desarrollo de las etapas correspondientes de los procesos de seleccin
electrnicos se llevar a cabo y difundir, ntegramente, a travs del SEACE,
siendo sus principales etapas las siguientes:
1. Convocatoria, que contendr obligatoriamente las Bases bajo sancin
de nulidad.
2. Registro de participantes, en la que una vez registrado el participante
se presume la aceptacin de las condiciones de uso del SEACE.
3. Consultas y observaciones.
4. Presentacin de propuestas tcnica y econmica, que se inicia
conjuntamente con la etapa de registro de participantes. Estas
propuestas sern enviadas nicamente a travs del SEACE.
5. Calificacin y evaluacin de propuestas, la misma que se efecta luego
de la apertura electrnica de las propuestas presentadas.
6. Otorgamiento de la Buena Pro.
Asimismo, se registrarn en el SEACE todos los dems actos que correspondan
al proceso de seleccin electrnico.
157
Artculo 293.- Nomenclatura de un proceso electrnico
Al tipo de proceso de seleccin que corresponda convocar, dentro de los
mrgenes establecidos por la Ley Anual de Presupuesto del Sector Pblico,
GHEHUiDJUHJDUVHODIUDVH3URFHVR(OHFWUyQLFR7DOSUHFLVLyQQRVHUiQHFHVDULD
hacerla en el Plan Anual de Contrataciones.
Artculo 294.- Propuestas electrnicas
Los participantes registrarn sus propuestas a travs del SEACE de acuerdo
con las caractersticas, formatos y dems condiciones establecidas en las Bases.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
220
Para ello, debern ingresar al SEACE su propuesta tcnica y econmica, ambas
FRQVXFHUWLFDGR6($&(DVHJXUiQGRVHGHKDEHUUHDOL]DGRHOHQYtR\ODFDUJD
de las mismas en el sistema.
Las propuestas electrnicas de todos los participantes sern almacenadas en
una bveda segura del SEACE hasta la fecha establecida en el calendario del
proceso para el acto de apertura electrnica de propuestas.
Una vez enviadas las propuestas, no cabe subsanacin alguna.
158
Artculo 295.- Contenido de las propuestas electrnicas
La propuesta tcnica deber contener todos los documentos solicitados en las
Bases, as como aquellos que sirvan para acreditar los factores de evaluacin.
La propuesta econmica deber presentarse en funcin al valor referencial total
del tem y, en caso de procesos convocados bajo el sistema de precios unitarios,
deber adjuntarse adicionalmente el precio unitario.
159
Artculo 296.- Apertura electrnica de las propuestas tcnicas
En la fecha y hora establecidas en el calendario del proceso y en presencia del
Comit Especial o el rgano encargado de las contrataciones, segn corresponda,
HOIXQFLRQDULRDXWRUL]DGRGHOD(QWLGDGLQJUHVDUiDO6($&(XWLOL]DQGRVXFHUWLFDGR
6($&(DQGHSURFHGHUDODDSHUWXUDHOHFWUyQLFDGHODVSURSXHVWDVWpFQLFDV
El SEACE habilitar la opcin de descarga de propuestas tcnicas electrnicas
de la bveda segura y no permitir la inclusin de ninguna propuesta adicional.
Luego, el funcionario autorizado de la Entidad imprimir y entregar todas las
propuestas tcnicas al Comit especial o a quien haga sus veces.
Si se trata de un proceso de seleccin con otorgamiento de la buena pro en
DFWR S~EOLFR HO 1RWDULR UPDUi ODV SURSXHVWDV WpFQLFDV TXH VHDQ GHFODUDGDV
vlidas por el Comit Especial o quien haga sus veces.
160
Artculo 297.- Evaluacin de la propuesta tcnica
El Comit Especial evala las propuestas tcnicas y emite un acta incluyendo
el cuadro de la evaluacin tcnica, dicha acta contendr la relacin de todas las
SURSXHVWDVODVTXHFXPSODQFRQORVUHTXHULPLHQWRVPtQLPRV\ODVGHVFDOLFDGDV
El acta debe ser publicada en el SEACE antes de la apertura de las propuestas
econmicas, bajo responsabilidad del Comit Especial o de quin haga sus veces.
Artculo 298.- Evaluacin y Buena Pro
El funcionario autorizado por la Entidad descargar del SEACE las propuestas
econmicas electrnicas de los postores que alcanzaron el puntaje mnimo en la
evaluacin tcnica, en presencia del Comit Especial o de quin haga sus veces
y del Notario, cuando la evaluacin se lleve a cabo en acto pblico.
El Comit Especial o quien haga sus veces recibe y evala las propuestas
HFRQyPLFDV\HPLWHHOFXDGURQDOGHFDOLFDFLRQHVRWRUJDQGROD%XHQD3URDO
158, 159, 1600RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
221
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
postor que ocupe el primer puesto por haber alcanzado el ms alto puntaje.
El Comit Especial entrega a los postores que lo soliciten: el Acta del Resultado
GHO3URFHVRFRQHOFXDGURGHFDOLFDFLyQ\ORVFXDGURVGHHYDOXDFLyQWpFQLFD\
econmica detallados. El funcionario autorizado por la Entidad los publica en el
SEACE.
El Comit Especial o quien haga sus veces elaborar el Acta de Buena Pro
con el resultado de la evaluacin y el sustento debido en los casos en que los
SRVWRUHVVHUiQGHVFDOLFDGRV
El Acta de Otorgamiento de Buena Pro deber ser publicada en el SEACE el
mismo da de la Buena Pro.
DISPOSICIONES COMPLEMENTARIAS FINALES
Primera.- Las normas complementarias del presente Reglamento se
ajustarn a lo indispensable y sern aprobadas mediante Directivas emitidas
por el OSCE.
Segunda.- 6HJ~QORGLVSXHVWRHQHOLQFLVRD\HGHODUWtFXORGHOD/H\
el OSCE deber adoptar las medidas necesarias para supervisar el debido
cumplimiento de la Ley, el presente Reglamento y normas complementarias,
emitiendo para el efecto resoluciones, pronunciamientos, entre otros; pudiendo
requerir a travs del SEACE u otro medio, informacin y la participacin de
todas las Entidades para la implementacin de las medidas correctivas que
disponga.
Asimismo, conforme a lo dispuesto en el literal j) del referido artculo, el
OSCE absuelve las consultas sobre el sentido y alcance de la normativa
de contrataciones del Estado, formuladas por las Entidades, as como
por el sector privado y la sociedad civil. La formulacin de consultas debe
efectuarse conforme a los requisitos establecidos en el Texto nico de
Procedimientos Administrativos (TUPA) del OSCE. Las consultas que no se
ajusten a lo establecido en el prrafo precedente sern observadas, siendo
responsabilidad del solicitante su subsanacin; de no cumplir con subsanarlas
se las tendr por no presentadas. Las opiniones que se emitan absolviendo las
consultas formuladas sern publicadas en el portal institucional del OSCE.
161
Concordancia: LCE: Artculo 58.
Tercera.- Las opiniones mediante las que el OSCE absuelve consultas
sobre la normativa de contrataciones del Estado tienen carcter vinculante
desde su publicacin en el portal institucional del OSCE. El criterio establecido
HQODRSLQLyQFRQVHUYDUiVXFDUiFWHUYLQFXODQWHPLHQWUDVQRVHDPRGLFDGR
mediante otra opinin posterior, debidamente sustentada o por norma legal.
Los pronunciamientos emitidos por el OSCE en el marco de sus
161 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
222
competencias, constituyen precedente administrativo cuando aquellos as
lo establezcan. El criterio interpretativo establecido en el pronunciamiento
conservar su vigencia mientras no sea modificado mediante otro
pronunciamiento posterior, debidamente sustentado o por norma legal.
162
Cuarta.- Si durante la fase de actos preparatorios, las Entidades advierten
TXH HV SRVLEOH OD SDUWLFLSDFLyQ GH SURYHHGRUHV TXH JR]DQ GHO EHQHFLR GH OD
H[RQHUDFLyQGHO,*9SUHYLVWDHQOD/H\1GHEHUiWHQHUVHHQFXHQWDOR
siguiente:
1. El valor referencial del proceso de seleccin es nico y deber incluir
todos los conceptos que incidan sobre el costo del bien, servicio u
obra a contratar, incluido el Impuesto General a las Ventas (IGV),
determinado en los correspondientes estudios de posibilidades que
ofrece el mercado que realiz la Entidad.
2. Las Bases del respectivo proceso de seleccin debern establecer
adems del valor referencial, los lmites de ste, con y sin IGV.
(OSRVWRUTXHJR]DGHODH[RQHUDFLyQSUHYLVWDHQOD/H\1
Ley de Promocin de la Inversin en la Amazona, formular su
propuesta econmica teniendo en cuenta exclusivamente el total
de los conceptos que conforman el valor referencial, excluido el
Impuesto General a las Ventas (IGV).
(O SRVWRU TXH QR JR]D GH OD H[RQHUDFLyQ SUHYLVWD HQ OD /H\ 1
27037, Ley de Promocin de la Inversin en la Amazona, formular
su propuesta econmica teniendo en cuenta el valor referencial
incluido el Impuesto General a las ventas (IGV)
5. La admisin de la propuesta econmica que presenten los postores
depender de si aquella se encuentra dentro los lmites establecidos
HQ HO DUWtFXOR GH OD /H\ GH &RQWUDWDFLRQHV GHO (VWDGR \ HO
DUWtFXORGHVX5HJODPHQWRVHJ~QFRUUHVSRQGDDOREMHWRGHOD
contratacin. La propuesta econmica que no incluya el IGV debe
ser contrastada con los lmites del valor referencial sin IGV.
La inclusin en las Bases de las disposiciones referidas a
la aplicacin del beneficio de la exoneracin del IGV se da
independientemente del lugar en que se convoque el proceso de
seleccin o se suscriba el respectivo contrato.
163
Quinta.- Lo dispuesto en el artculo 242 del Reglamento, respecto del
procedimiento que debe seguir el Tribunal para tramitar los procedimientos
sancionadores, ser de aplicacin para los expedientes de imposicin de
sancin que se generen a partir de la entrada en vigencia de la Ley.
162, 163 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
223
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
DISPOSICIONES COMPLEMENTARIAS TRANSITORIAS
Primera.- Se encuentran obligadas a convocar procesos de seleccin
electrnicos de Adjudicacin de Menor Cuanta para la contratacin de
servicios, las Entidades comprendidas en el listado publicado por el OSCE en
el portal del SEACE, el mismo que podr ser actualizado para la incorporacin
gradual de otras Entidades.
Las Entidades que no se encuentren incluidas en dicho listado podrn
realizar procesos electrnicos de Adjudicacin de Menor Cuanta para la
contratacin de servicios.
El OSCE mediante directiva sealar la oportunidad, forma y criterios en
que se aplicar a las Entidades la obligatoriedad de realizar procesos de
seleccin electrnicos de Adjudicacin de Menor Cuanta para la contratacin
de bienes y obras, as como la aplicacin progresiva y obligatoria de la
contratacin electrnica en otros tipos de procesos de seleccin.
164
Concordancia: LCE: Artculo 18.
RLCE: Artculo 78.
Segunda.- La implementacin de lo dispuesto en el artculo 5, referido a la
capacitacin de los funcionarios y servidores de los rganos de contrataciones de
las Entidades se realizar en los nueve (9) meses contados a partir de la entrada
en vigencia del presente Reglamento.
Concordancia: LCE: Artculo 6.
RLCE: Artculo 5.
Tercera.- Para efectos de lo dispuesto en el artculo 10 de la Ley, se reputan
como organismos constitucionales autnomos los sealados en los artculos 18,
82, 84, 87, 150, 158, 161, 177 y 201 de la Constitucin Poltica del Per.
$VLPLVPRODUHVWULFFLyQDTXHVHUHHUHHOLQFLVRJGHODUWtFXORGHOD/H\
es de aplicacin sin perjuicio a lo dispuesto por el artculo 92 de la Constitucin.
Cuarta.- El OSCE mediante Directivas aprobar Bases Estandarizadas, las
mismas que sern utilizadas obligatoriamente por las Entidades. En tanto el
OSCE las apruebe y publique, las Entidades podrn continuar elaborando las
Bases de sus procesos de seleccin, sujetndose a lo establecido en el presente
Reglamento.
)RUPDSDUWHLQWHJUDQWHGHOSUHVHQWH5HJODPHQWRODVGHQLFLRQHVTXHFRQVWDQ
en el Anexo nico.
Concordancia: LCE: Artculo 26.
RLCE: Artculo 38.
Quinta.- En las contrataciones bajo el mbito del inciso t) del artculo 3.3
164 0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
224
GHOD/H\HQFDVRGHYDFtRRGHFLHQFLDHQODUHJXODFLyQGHORVSURFHVRVGH
seleccin convocados, sern de aplicacin supletoria las disposiciones de la
Ley y el presente Reglamento. En uno u otro supuesto corresponder al OSCE
supervisar el cumplimiento de los principios que rigen los procesos de seleccin
contemplados en el artculo 3 de la Ley.
6LHOYDFtRRGHFLHQFLDDTXHVHUHHUHHOSiUUDIRDQWHULRUHVWiQUHIHULGRVDO
procedimiento o a las reglas para la determinacin de la competencia en la solucin
de controversias e impugnaciones, corresponder al OSCE resolver la controversia
y/o impugnacin suscitada en calidad de ltima instancia administrativa.
Concordancia: LCE: Artculo 3.
Sexta.- Las Entidades que no tengan acceso a Internet registrarn en el
SEACE, previa autorizacin del OSCE, la informacin de los procesos de
seleccin, contratos y su ejecucin dentro de los quince (15) das siguientes al
cierre de cada trimestre.
3DUDHIHFWRVGHODFRQYRFDWRULD\QRWLFDFLRQHVTXHWHQJDQTXHUHDOL]DUGXUDQWH
el proceso de seleccin, las Entidades autorizadas conforme a lo previsto en el
prrafo precedente, se sujetarn a las siguientes reglas:
1. La convocatoria en el caso de Licitaciones Pblicas, Concursos Pblicos
y Adjudicaciones Pblicas y Adjudicaciones de Menor Cuanta Derivadas
se realizar mediante la publicacin de un aviso en un diario de circulacin
nacional o local.
En el caso de Adjudicaciones Directas Selectivas y Adjudicaciones de
Menor Cuanta la convocatoria se efectuar mediante invitacin.
2. La notificacin de los dems actos debern efectuarse mediante
comunicacin escrita, salvo el otorgamiento de la Buena Pro realizado
en acto pblico, cuando corresponda.
165
Concordancia: RLCE: Artculo 51.
Stima.- De conformidad con el artculo 64 de la Ley, el Presidente del Tribunal
ser elegido por el Consejo Directivo del OSCE.
La designacin de los vocales que resulten elegidos por concurso pblico se
efectuar mediante la emisin de una Resolucin Suprema.
Octava.- A la primera renovacin de inscripcin de las personas jurdicas
ejecutoras de obras que se encuentren dentro de los alcances del numeral 9.3
GHODUWtFXORGHOD/H\\TXHVHUHDOLFHDSDUWLUGHODHQWUDGDHQYLJHQFLDGHO
SUHVHQWH5HJODPHQWRVHOHDSOLFDUiORSUHYLVWRSRUHODUWtFXORGHO5HJODPHQWR
3DUDODDSOLFDFLyQGHOOLWHUDODGHODUWtFXORGHEHFRQVLGHUDUVHTXHVH
encuentran bajo tal supuesto, las personas jurdicas extranjeras domiciliadas
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
225
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
(sucursal) y no domiciliadas (matriz) que provengan de pases con los cuales
el Per ha suscrito un Tratado u otro compromiso internacional en materia
de contratacin pblica con anterioridad a la entrada en vigor del presente
Reglamento.
166
Concordancia: LCE: Artculo 9.
RLCE: Artculo 275.
Novena.- EL OSCE desarrollar la funcionalidad para el registro de
participantes electrnico a travs del SEACE y, pondr en conocimiento de los
usuarios, a travs de comunicado, el momento a partir del cual su utilizacin ser
obligatoria.
Con excepcin de los procesos de seleccin electrnicos, durante el periodo
previo a la publicacin del comunicado, el registro de participantes se efectuar
desde el da siguiente de la convocatoria y hasta un (1) da hbil despus de haber
quedado integrada las Bases. En el caso de Adjudicaciones de Menor Cuanta
para bienes y servicios, el registro de participantes se lleva a cabo desde el da
siguiente de la convocatoria hasta antes del inicio de la presentacin de propuestas.
La Entidad tendr la obligacin de entregar al participante, por cualquier medio y
en el mismo da de su registro, la respectiva constancia o comprobante de registro.
Si en el acto pblico de presentacin de propuestas, algn participante es
omitido, podr acreditarse con la presentacin de la constancia de su registro
como participante.
167
Dcima.-/DLPSOHPHQWDFLyQGHORGLVSXHVWRHQORVDUWtFXORV\
GHO5HJODPHQWRUHIHULGRVDODSXEOLFDFLyQHQHO6($&(VHUHDOL]DUiHQIRUPD
progresiva, siendo obligatorio el registro en el SEACE a partir del comunicado
que publique el OSCE en su portal institucional. Antes de la implementacin, la
QRWLFDFLyQGHORVDFWRVDTXHVHUHHUHQORVDUWtFXORVVHxDODGRVHQHOSiUUDIR
precedente se efectuar en forma personal.
168
Dcimo Primera.-/RGLVSXHVWRSRUHODUWtFXORGHOSUHVHQWH5HJODPHQWR
ser de aplicacin incluso a los catlogos electrnicos de Convenio Marco vigentes
y aquellos procesos de seleccin sujetos a la modalidad de Convenio Marco que
haya sido convocados y se encuentren en trmite a la fecha de la entrada de
vigencia de la presente disposicin.
169
Dcimo Segunda.- Adicionalmente a lo dispuesto por la Segunda Disposicin
Complementaria Final, las opiniones mediante las cuales el OSCE absuelve
consultas sobre la normativa de contrataciones del Estado se pondrn a
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
'LVSRVLFLyQ&RPSOHPHQWDULDLQFRUSRUDGDSRUHODUWtFXORGHO'HFUHWR6XSUHPR1
138-2012-EF publicado el 7 de agosto de 2012.
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
226
disposicin de los usuarios a travs del sistema de bsqueda rpida que
implemente el OSCE en su portal institucional. La utilizacin de dicho sistema
se pondr en conocimiento de los usuarios a travs comunicado que el OSCE
emita para tal efecto.
170
170 'LVSRVLFLyQ&RPSOHPHQWDULDLQFRUSRUDGDSRUHODUWtFXORGHO'HFUHWR6XSUHPR1()
publicado el 7 de agosto de 2012.
227
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
ANEXO NICO
ANEXO DE DEFINICIONES
1. Bases:
Es el documento que contiene el conjunto de reglas formuladas por la Entidad
FRQYRFDQWHGRQGHVHHVSHFLFDHOREMHWRGHOSURFHVRODVFRQGLFLRQHVDVHJXLU
en la preparacin y ejecucin del contrato y los derechos y obligaciones de los
participantes, postores y del futuro contratista, en el marco de la Ley y el presente
Reglamento.
2. Bases integradas:
6RQ ODV UHJODV GHQLWLYDV GHO SURFHVR GH VHOHFFLyQ FX\R WH[WR FRQWHPSOD
todas las aclaraciones y/o precisiones producto de la absolucin de consultas,
DVtFRPRWRGDVODVPRGLFDFLRQHV\RFRUUHFFLRQHVGHULYDGDVGHODDEVROXFLyQ
de observaciones y/o del pronunciamiento del Titular de la Entidad o del OSCE;
o, cuyo texto coincide con el de las bases originales en caso de no haberse
presentado consultas y/u observaciones.
3. Bienes:
Son objetos que requiere una Entidad para el desarrollo de sus actividades
\FXPSOLPLHQWRGHVXVQHV
4. Calendario del Proceso de Seleccin:
(OGRFXPHQWRTXHIRUPDSDUWHGHODV%DVHVHQHOTXHVHMDQORVSOD]RVGH
cada una de las etapas del proceso de seleccin.
5. Calendario de avance de obra valorizado:
El documento en el que consta la programacin valorizada de la ejecucin de
la obra, por perodos determinados en las Bases o en el contrato.
6. Certificado SEACE:
(VHOPHFDQLVPRGHLGHQWLFDFLyQ\VHJXULGDGTXHGHEHQXWLOL]DUWRGRVORV
usuarios del sistema para interactuar en l.
7. Compras Corporativas:
Mecanismo de contratacin que pueden utilizar las Entidades para que, a
travs de un proceso de seleccin nico, puedan adquirir bienes o contratar
servicios en forma conjunta, en las mejores y ms ventajosas condiciones para
el Estado, aprovechando las economas de escala.
8. Consorcio:
El contrato asociativo por el cual dos (2) o ms personas se asocian, con el
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
228
criterio de complementariedad de recursos, capacidades y aptitudes, para participar
en un proceso de seleccin y, eventualmente, contratar con el Estado.
9. Consulta sobre las Bases:
La solicitud de aclaracin o pedido formulada por los participantes en un
proceso, referido al alcance y/o contenido de cualquier aspecto de las Bases.
10. Consultor:
La persona natural o jurdica que presta servicios profesionales altamente
FDOLFDGRVHQODHODERUDFLyQGHHVWXGLRV\SUR\HFWRVHQODLQVSHFFLyQGHIiEULFD
peritajes de equipos, bienes y maquinarias; en investigaciones, auditorias,
asesoras, estudios de prefactibilidad y de factibilidad tcnica, econmica
\ QDQFLHUD HVWXGLRV EiVLFRV SUHOLPLQDUHV \ GHQLWLYRV DVHVRUDPLHQWR HQ
la ejecucin de proyectos y en la elaboracin de trminos de referencia,
HVSHFLFDFLRQHVWpFQLFDV\%DVHVGHGLVWLQWRVSURFHVRVGHVHOHFFLyQHQWUHRWURV
11. Consultor de Obra:
La persona natural o jurdica con no menos de un (1) ao de experiencia
especializada, que presta servicios profesionales altamente calificados
consistentes en la elaboracin del expediente tcnico de obras. Tambin se
considera consultor de obra a la persona natural o jurdica con no menos de dos
DxRVGHH[SHULHQFLDHVSHFLDOL]DGDTXHSUHVWDVHUYLFLRVDOWDPHQWHFDOLFDGRV
consistentes en la supervisin de obras.
1
12. Contratacin:
Es la accin que deben realizar las Entidades para proveerse de bienes,
servicios u obras, asumiendo el pago del precio o de la retribucin correspondiente
con fondos pblicos, y dems obligaciones derivadas de la condicin del
contratante.
13. Contrato:
(VHODFXHUGRSDUDFUHDUUHJXODUPRGLFDURH[WLQJXLUXQDUHODFLyQMXUtGLFD
dentro de los alcances de la Ley y del Reglamento.
14. Contrato original:
Es el contrato suscrito como consecuencia del otorgamiento de la Buena Pro
en las condiciones establecidas en las Bases y la oferta ganadora.
15. Contrato actualizado o vigente:
El contrato original afectado por las variaciones realizadas por los reajustes,
0RGLFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
- Segn Fe de Erratas publicada en el Diario Oficial El Peruano el 18 de agosto de 2012.
229
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
prestaciones adicionales, reduccin de prestaciones, o por ampliacin o reduccin
del plazo.
16. Contratista:
El proveedor que celebre un contrato con una Entidad, de conformidad con
las disposiciones de la Ley y del presente Reglamento.
17. Convenio Marco:
El Convenio Marco es la modalidad por la cual se selecciona a aquellos
proveedores con los que las Entidades debern contratar los bienes y servicios que
requieran y que son ofertados a travs del Catlogo Electrnico de Convenios Marco.
18. Cuaderno de Obra:
El documento que, debidamente foliado, se abre al inicio de toda obra y en
el que el inspector o supervisor y el residente anotan las ocurrencias, rdenes,
consultas y las respuestas a las consultas.
19. Criterios de Evaluacin:
Las reglas consignadas en las Bases respecto a la forma en que el Comit
Especial, asignar los puntajes a las distintas propuestas en cada uno de los
factores de evaluacin.
20. Error subsanable:
Aqul que incide sobre aspectos accidentales, accesorios o formales, siendo
VXVFHSWLEOHGHUHFWLFDUVHDSDUWLUGHVXFRQVWDWDFLyQGHQWURGHOSOD]RTXHRWRUJXH
el Comit Especial.
21. Especificaciones Tcnicas:
Descripciones elaboradas por la Entidad de las caractersticas fundamentales
de los bienes, suministros u obras a contratar.
22. Estandarizacin:
El proceso de racionalizacin consistente en ajustar a un determinado tipo
o modelo los bienes o servicios a contratar, en atencin a los equipamientos
preexistentes.
23. Expediente de Contratacin:
Conjunto de documentos en el que aparecen todas las actuaciones referidas
a una determinada contratacin, desde la decisin de adquirir o contratar hasta
la culminacin del contrato, incluyendo la informacin previa referida a las
caractersticas tcnicas, valor referencial, la disponibilidad presupuestal y su
IXHQWHGHQDQFLDPLHQWR
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
230
24. Expediente Tcnico de Obra:
El conjunto de documentos que comprende: memoria descriptiva,
HVSHFLFDFLRQHVWpFQLFDVSODQRVGHHMHFXFLyQGHREUDPHWUDGRVSUHVXSXHVWRGH
obra, fecha de determinacin del presupuesto de obra, Valor Referencial, anlisis
de precios, calendario de avance de obra valorizado, frmulas polinmicas y, si
el caso lo requiere, estudio de suelos, estudio geolgico, de impacto ambiental
u otros complementarios.
25. Factores de evaluacin:
Son los aspectos consignados en las Bases que sern materia de evaluacin
y que deben estar vinculados con el objeto del contrato.
26. Factor de relacin:
El cociente resultante de dividir el monto del contrato de la obra entre el monto
del Valor Referencial.
27. Gastos Generales:
Son aquellos costos indirectos que el contratista debe efectuar para la
ejecucin de la prestacin a su cargo, derivados de su propia actividad empresarial,
por lo que no pueden ser incluidos dentro de las partidas de las obras o de los
costos directos del servicio.
28. Gastos Generales Fijos:
Son aquellos que no estn relacionados con el tiempo de ejecucin de la
prestacin a cargo del contratista.
29. Gastos Generales Variables:
Son aquellos que estn directamente relacionados con el tiempo de ejecucin
de la obra y por lo tanto pueden incurrirse a lo largo del todo el plazo de ejecucin
de la prestacin a cargo del contratista.
30. Lote:
Conjunto de bienes del mismo tipo.
31. Metrado:
(VHOFiOFXORRODFXDQWLFDFLyQSRUSDUWLGDVGHODFDQWLGDGGHREUDDHMHFXWDU
32. Mora:
El retraso parcial o total, continuado y acumulativo en el cumplimiento de
prestaciones consistentes en la entrega de bienes, servicios o ejecucin de obras
sujetos a cronograma y calendarios contenidos en las Bases y/o contratos.
231
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
33. Obra:
Construccin, reconstruccin, remodelacin, mejoramiento, demolicin,
renovacin, ampliacin y habilitacin de bienes inmuebles, tales como
HGLFDFLRQHV HVWUXFWXUDV H[FDYDFLRQHV SHUIRUDFLRQHV FDUUHWHUDV SXHQWHV
entre otros, que requieren direccin tcnica, expediente tcnico, mano de obra,
materiales y/o equipos.
2
34. Obra similar:
Obra de naturaleza semejante a la que se desea contratar.
35. Paquete:
Conjunto de bienes o servicios de una misma o distinta clase.
36. Participante:
El proveedor que puede intervenir en el proceso de seleccin, por haberse
registrado conforme a las reglas establecidas en las Bases.
37. Partida:
Cada una de las partes o actividades que conforman el presupuesto de una
obra.
38. Postor:
La persona natural o jurdica legalmente capacitada que participa en un
proceso de seleccin desde el momento en que presenta su propuesta o su sobre
SDUDODFDOLFDFLyQSUHYLDVHJ~QFRUUHVSRQGD
39. Prestacin:
La ejecucin de la obra, la realizacin de la consultora, la prestacin del
servicio o la entrega del bien cuya contratacin se regula en la Ley y en el presente
Reglamento.
40. Prestacin adicional de obra:
Aquella no considerada en el expediente tcnico, ni en el contrato original,
cuya realizacin resulta indispensable y/o necesaria para dar cumplimiento a
la meta prevista de la obra principal y que da lugar a un presupuesto adicional.
3
41. Presupuesto adicional de obra:
Es la valoracin econmica de la prestacin adicional de una obra que debe
ser aprobado por la Contralora General de la Repblica cuando el monto supere
al que puede ser autorizado directamente por la Entidad.
0RGLILFDGRPHGLDQWH'HFUHWR6XSUHPR1()SXEOLFDGRHOGHDJRVWRGH
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
232
42. Proceso de seleccin:
Es un procedimiento administrativo especial conformado por un conjunto de
actos administrativos, de administracin o hechos administrativos, que tiene por
objeto la seleccin de la persona natural o jurdica con la cual las Entidades del
Estado van a celebrar un contrato para la contratacin de bienes, servicios o la
ejecucin de una obra.
43. Proforma de contrato:
El proyecto del contrato a suscribirse entre la Entidad y el postor ganador de
la buena pro y que forma parte de las Bases.
44. Proveedor:
La persona natural o jurdica que vende o arrienda bienes, presta servicios
generales o de consultora o ejecuta obras.
45. Proyectista:
El consultor que ha elaborado los estudios o la informacin tcnica del objeto
del proceso de seleccin.
46. Requerimiento Tcnico Mnimo:
Son los requisitos indispensables que debe reunir una propuesta tcnica
para ser admitida.
47. Ruta Crtica del Programa de Ejecucin de Obra:
Es la secuencia programada de las actividades constructivas de una obra
cuya variacin afecta el plazo total de ejecucin de la obra.
48. Servicio en general:
La actividad o labor que realiza una persona natural o jurdica para atender
una necesidad de la entidad, pudiendo estar sujeta a resultados para considerar
terminadas sus prestaciones.
49. Suministro:
La entrega peridica de bienes requeridos por una Entidad para el desarrollo
de sus actividades.
50. Trminos de referencia:
Descripcin, elaborada por la Entidad, de las caractersticas tcnicas y de
las condiciones en que se ejecutar la prestacin de servicios y de consultora.
51. Trabajo similar:
Trabajo o servicio de naturaleza semejante a la que se desea contratar,
independientemente de su magnitud y fecha de ejecucin, aplicable en los casos
de servicios en general y de consultora.
233
REGLAMENTO DE LA LEY DE
CONTRATACIONES DEL ESTADO
52. Tramo:
Parte de una obra que tiene utilidad por s misma.
53. Valorizacin de una obra:
(VODFXDQWLFDFLyQHFRQyPLFDGHXQDYDQFHItVLFRHQODHMHFXFLyQGHODREUD
realizada en un perodo determinado.
54. Obra principal:
Obra materia del proceso de seleccin que convoca la Entidad.
4
55. Prestacin nueva de obra:
La no considerada en el expediente tcnico, ni en el contrato original, cuya
realizacin no es indispensable y/o necesaria para dar cumplimiento a la meta
prevista y que se ejecutar mediante un nuevo contrato.
5
1XPHUDOLQFRUSRUDGRSRUHODUWtFXORGHO'HFUHWR6XSUHPR1()SXEOLFDGRHOGH
agosto de 2012.
ANEXOS
ANEXO I Abreviaturas de las Concordancias
ANEXO II Directivas emitidas por el OSCE
- Directiva N 006-2012-OSCE/CD 242
Elevacin de observaciones a las Bases y
emisin de pronunciamiento.

- Directiva N 007-2012-OSCE/CD 247
Disposiciones aplicables al registro de informacin en
el Sistema Electrnico de Contrataciones del Estado
(SEACE).
- Directiva N 010-2012-OSCE/CD 269
Disposiciones referidas al trmite de asignacin,
actualizacin y desactivacin del certificado SEACE
otorgado a los usuarios del Sistema Electrnico de
Contrataciones del Estado (SEACE).

- Directiva N 011-2012-OSCE/CD 293
Procedimiento y plazos para la inscripcin, renovacin
de inscripcin, aumento de capacidad mxima de
contratacin, ampliacin de especialidad e inscripcin
de subcontratos de ejecutores y consultores de obras
en el Registro Nacional de Proveedores (RNP).

- Directiva N 012-2012-OSCE/CD 326
Procedimientos y plazos para la inscripcin y
renovacin de inscripcin de proveedores bienes
y/o servicios en el Registro Nacional de Proveedores
(RNP).
- Directiva N 013-2012-OSCE/CD 348
Procedimiento de declaracin del rcord de ejecucin
y consultora de obras en el Registro Nacional de
Proveedores (RNP).
- Directiva N 014-2012-OSCE/CD 354
Disposiciones aplicables a los procedimientos de
comunicacin de ocurrencias y modificacin de datos
de la relacin de sancionados publicada en el portal
institucional del OSCE.

- Directiva N 006-2009-OSCE/CD 362
Lineamientos para la aplicacin de la modalidad
especial de seleccin por Subasta Inversa .
- Directiva N 015-2012-OSCE/CD 375
Aplicacin de la modalidad especial de seleccin
por Subasta Inversa.

- Directiva N 016-2012-OSCE/CD 391
Participacin de proveedores en consorcio en las
contrataciones del Estado.
- Directiva N 017-2012-OSCE/CD 400
Directiva de Convenio Marco.
- Directiva N 018-2012-OSCE/CD 423
Disposiciones sobre el contenido de las Bases
Estandarizadas que las entidades del Estado
deben utilizar en los procesos de seleccin que
convoquen.
- Directiva N 020-2012-OSCE/CD 427
Disposiciones sobre el contenido de las Bases
Estandarizadas que las entidades del Estado deben
utilizar en los procesos de seleccin que convoquen
al amparo de la Ley N 29792 y de los Decretos de
Urgencia N 054-2011, N 007-2012 y N 016-2012.
- Directiva N 005-2009-OSCE/CD 431
Plan Anual de Contrataciones.
- Directiva N 007-2009-OSCE/CD 443
Tabla de gastos arbitrales del SNA - OSCE y
supuestos de devolucin de honorarios arbitrales
para procesos Ad Hoc.

- Directiva N 009-2009-OSCE/CD 449
Lineamientos para la aplicacin de la garanta de fiel
cumplimiento por prestaciones accesorias.
- Directiva N 010-2009-OSCE/CD 452
Lineamientos para la contratacin en la que se hace
referencia a determinada marca o tipo particular.
239
ANEXOS
ANEXO I
ABREVIATURAS DE LAS CONCORDANCIAS
ANEXOS
240
ANEXO I
ABREVIATURAS DE LAS CONCORDANCIAS
LCE : Ley de Contrataciones del Estado.
RLCE : Reglamento de la Ley de Contrataciones del Estado.
241
ANEXOS
ANEXO II
DIRECTIVAS EMITIDAS POR EL OSCE
ANEXOS
242
DIRECTIVA N 006-2012-OSCE/CD
ELEVACIN DE OBSERVACIONES A LAS BASES Y EMISIN DE
PRONUNCIAMIENTO
I. FINALIDAD
Precisar las disposiciones que debe observarse cuando los participantes en
los procesos de seleccin convocados soliciten la elevacin de observaciones
ante el Organismo Supervisor de las Contrataciones (OSCE) y la emisin del
pronunciamiento respectivo.
II. OBJETO
Establecer el procedimiento de elevacin de observaciones a las Bases ante
el Organismo Supervisor de las Contrataciones del Estado (OSCE), y las
disposiciones que deber observarse para la emisin del pronunciamiento
respectivo.
III. ALCANCE
La presente directiva es de cumplimiento obligatorio para todas las Entidades que
se encuentran bajo el mbito de aplicacin de la normativa de contrataciones del
Estado, conforme al artculo 3 de la Ley de Contrataciones del Estado, aprobada
mediante Decreto Legislativo N 1017, as como para los participantes en los
procesos de seleccin que dichas Entidades convoquen.
IV. BASE LEGAL
/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGDPHGLDQWH'HFUHWR/HJLVODWLYR
N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
'HFUHWR6XSUHPR1()
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado (OSCE), aprobado mediante Resolucin
Ministerial N 789-2011-EF/10.
/H\1/H\GHO3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
7H[WRQLFRGH3URFHGLPLHQWRV$GPLQLVWUDWLYRVGHO2UJDQLVPR6XSHUYLVRU
de las Contrataciones del Estado OSCE, aprobado por el Decreto
Supremo N 292-2009-EF.
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso
V. REFERENCIAS
En la presente directiva se utilizar las siguientes referencias:
243
ANEXOS
Ley: Ley de Contrataciones del Estado.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
Directiva: La presente directiva.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
SEACE: Sistema Electrnico de Contrataciones del Estado.
Entidad: Entidad bajo el alcance de la presente directiva y que ha
convocado el proceso de seleccin cuyas bases han sido materia de
elevacin.
VI. DISPOSICIONES GENERALES
6.1. De conformidad con lo dispuesto en el artculo 28 de la Ley y el artculo
56 del Reglamento, los participantes pueden formular observaciones a
las Bases, a travs de las cuales se cuestiona el contenido de stas,
debido al incumplimiento de:
a) Las condiciones mnimas a que se refiere el artculo 26 de la Ley;
b) Cualquier disposicin en materia de contrataciones del Estado;
c) Cualquier otra norma complementaria o conexa que tenga relacin
con el proceso de seleccin.
6.2. Las observaciones debern ser formuladas mediante un escrito
debidamente fundamentado siendo responsabilidad del Comit
Especial absolver tales observaciones tambin de manera
fundamentada y sustentada, sea que las acoja, las acoja parcialmente
o no las acoja.
6.3. La absolucin de las observaciones formuladas debe notificarse a la
totalidad de los participantes mediante un pliego que se publicar en
el SEACE en la fecha prevista para ello en el cronograma del proceso,
y que contendr:
a) La identificacin de cada observante,
b) Las observaciones presentadas,
c) La respuesta del Comit Especial a cada observacin presentada;
y
d) El requerimiento de pago de la tasa por concepto de elevacin
de observaciones al OSCE.
VII. DISPOSICIONES ESPECFICAS
Supuestos habilitantes para emitir pronunciamiento
7.1. Los participantes de un proceso de seleccin pueden solicitar la elevacin
de las observaciones para la emisin de pronunciamiento, respecto de
la absolucin de observaciones, siempre que se verifique alguno de los
supuestos que se detallan en el numeral siguiente. En tal sentido, no se
emitir pronunciamiento cuando un participante solicite la elevacin de
FRQVXOWDVDXQTXHKD\DQVLGRGHQRPLQDGDVREVHUYDFLRQHV
ANEXOS
244
7.2. En virtud de lo establecido en el artculo 28 de la Ley y el artculo 58
del Reglamento, los participantes pueden solicitar al Comit Especial la
elevacin de las observaciones a las Bases ante el OSCE para la emisin
de pronunciamiento, siempre que se configure alguno de los siguientes
supuestos:
a) Cuando las observaciones presentadas por el participante no
fueron acogidas o fueron acogidas parcialmente;
b) Cuando a pesar de ser acogidas sus observaciones, el participante
considere que tal acogimiento contina siendo contrario a lo
dispuesto por el artculo 26 de la Ley, cualquier otra disposicin
de la normativa sobre contrataciones del Estado u otras normas
complementarias o conexas que tengan relacin con el proceso
de seleccin; y
c) Cuando un participante considere que el acogimiento de una
observacin formulada por otro participante resulta contrario a lo
dispuesto por el artculo 26 de la Ley, cualquier otra disposicin
de la normativa sobre contrataciones del Estado u otras normas
complementarias o conexas que tengan relacin con el proceso
de seleccin.
Para que se configure este ltimo supuesto, el participante debe
de haberse registrado como tal hasta el vencimiento del plazo
para formular observaciones.
Procedimiento de elevacin de observaciones a las Bases.
7.3. Los participantes tienen un plazo de tres (3) das hbiles, computados
desde el da siguiente de la notificacin del pliego de absolucin de
observaciones a travs del SEACE, para solicitar la elevacin. Para tal
efecto, a la solicitud que se presente ante la Entidad debern adjuntar
copia del pago de la tasa correspondiente.
7.4. El importe de la tasa por concepto de elevacin de observaciones a las
Bases se encuentra establecido en el TUPA del OSCE.
La tasa debe ser cancelada en su totalidad, mediante el depsito
respectivo en la cuenta o cuentas que el OSCE habilite para tal fin.
7.5. En caso que el participante no pague la tasa o no la pague en su totalidad;
no cumpla con presentar a la Entidad la copia del pago de la tasa dentro
del plazo indicado en el numeral 7.3; no efecte el depsito respectivo en
la cuenta o cuentas habilitadas por el OSCE para tal fin; o presente copia
del pago de la tasa emitido a nombre de otra persona; no proceder su
solicitud de elevacin.
7.6. Segn lo dispuesto en el numeral 123.3 de la Ley N 27444, Ley del
Procedimiento Administrativo General, el participante puede remitir
a la Entidad su solicitud de elevacin de observaciones a las Bases
245
ANEXOS
acompaada del pago de la tasa respectiva a travs de medios de
transmisin de datos a distancia, como el correo electrnico o facsmil.
En este supuesto, como mximo, en el tercer da hbil debe presentar
formalmente (en fsico) la solicitud de elevacin, con lo cual se la
tendr como presentada en la fecha de su envo a travs del medio de
transmisin de datos utilizado.
7.7. El Comit Especial, bajo responsabilidad, deber remitir la totalidad de
la documentacin requerida para tal fin por el TUPA del OSCE, a ms
tardar al da siguiente de vencido el plazo para que los participantes
soliciten la elevacin de observaciones.
Mientras no se remita el ntegro de la documentacin prevista en el TUPA
del OSCE o no se subsane las omisiones detectadas, el expediente de
elevacin no se considerar recibido.
Emisin de pronunciamiento
7.8. Una vez elevadas las observaciones, el OSCE las absolver mediante
un pronunciamiento debidamente motivado, objetivo y claro.
7.9. Adicionalmente a la absolucin de las observaciones formuladas a
solicitud de parte, el pronunciamiento incluir, cuando corresponda,
las observaciones de oficio que el OSCE formule atendiendo a su
funcin de velar por el cumplimiento de la normativa en materia de
contrataciones pblicas.
7.10. La emisin y publicacin del pronunciamiento en el SEACE, debe
efectuarse dentro de los diez (10) das hbiles siguientes de recibido
el expediente completo por el OSCE.
De no emitirse el pronunciamiento dentro del plazo establecido, deber
devolverse el importe de la tasa al participante, mantenindose la
obligacin de emitirlo.
7.11. Los pronunciamientos emitidos por el OSCE constituyen precedente
administrativo de observancia obligatoria cuando ellos as lo
establezcan.
A fin de establecer que determinado pronunciamiento constituye
precedente administrativo, deber considerarse la relevancia o
reiteracin de la materia del cuestionamiento y el alcance del criterio
interpretativo que se establezca.
Actuaciones posteriores a la emisin del pronunciamiento
7.12. El Comit Especial deber integrar y publicar las Bases del proceso
de seleccin dentro de los dos (2) das hbiles siguiente de notificado
el pronunciamiento.
ANEXOS
246
Para integrar las Bases del proceso, el Comit Especial no solo
incorporar al texto original de las Bases todas las correcciones,
precisiones y/o modificaciones dispuestas en el pronunciamiento, sino
tambin las realizadas en los pliegos de absolucin de consultas y/u
observaciones, y, cuando corresponda, lo dispuesto por el OSCE a
travs de las acciones de supervisin efectuadas al proceso.
Cuando el pronunciamiento disponga la precisin y/o modificacin de
las caractersticas tcnicas, el Comit Especial deber coordinarlas
con el rea usuaria, la que deber aprobar tales precisiones o
modificaciones.
Cuando el pronunciamiento disponga la reevaluacin del valor
referencial del proceso, el expediente de contratacin deber ser
remitido al rgano encargado de las contrataciones para el anlisis
correspondiente y, de ser el caso, la determinacin del nuevo valor
referencial.
En caso que la precisin y/o modificacin de las caractersticas tcnicas,
la reevaluacin del valor referencial u otro extremo del pronunciamiento,
originen la modificacin del expediente de contratacin, ste deber
ser nuevamente aprobado.
Concluidas las acciones sealadas en los prrafos precedentes, el
Comit Especial deber integrar las Bases en el plazo de dos (2) das
hbiles.
7.13. Cuando las Bases de un proceso de seleccin no sean integradas
adecuadamente, conforme a lo indicado en el numeral precedente,
cualquier participante podr comunicar tal hecho al OSCE, a efectos
que ste adopte las medidas pertinentes.
7.14. Ante el incumplimiento del plazo para elevar las observaciones a
las Bases, sealado en el numeral 7.7; o del plazo para integrar las
Bases, indicado en el numeral 7.12, que origine una exoneracin bajo
la causal de desabastecimiento inminente, el Titular de la Entidad
deber dar inicio a las medidas conducentes al establecimiento de
las responsabilidades administrativas, civiles y/o penales de los
funcionarios o servidores involucrados, de ser el caso.
VIII. DISPOSICIONES FINALES
1. La presente directiva regir a partir de la entrada en vigencia de la Ley N
29873, que modifica la Ley de Contrataciones del Estado y el Decreto
Supremo N 138-2012-EF, que modifica el Reglamento de la Ley de
Contrataciones del Estado.
2. A partir de la vigencia de la presente directiva djese sin efecto la Directiva
N 004-2009-OSCE/CD.
-HV~V0DUtDVHWLHPEUH
247
ANEXOS
DIRECTIVA N 007-2012-OSCE/CD
DISPOSICIONES APLICABLES AL REGISTRO DE INFORMACIN EN EL
SISTEMA ELECTRNICO DE CONTRATACIONES DEL ESTADO (SEACE)
I. FINALIDAD
Precisar las disposiciones que deben observar las Entidades para el registro y
publicacin de la informacin de sus contrataciones en el Sistema Electrnico de
Contrataciones del Estado (SEACE).
II. OBJETO
Establecer las disposiciones que debern observar las Entidades para el
registro y publicacin en el Sistema Electrnico de Contrataciones del Estado
(SEACE) de la informacin de sus contrataciones realizadas en el marco de: i)
La Ley de Contrataciones del Estado y su Reglamento, ii) Regmenes legales
de contratacin, iii) Supuestos de inaplicacin previstos en los literales i), o), s),
t) y v) del numeral 3.3 del artculo 3 de la Ley de Contrataciones del Estado, as
como de aquellos actos en los que sea obligatorio su registro en el mencionado
sistema por dispositivo legal.
III. ALCANCE
La presente directiva es de cumplimiento obligatorio para todas las Entidades
contratantes que se encuentran bajo el mbito de aplicacin de la normativa de
contrataciones del Estado, conforme al numeral 3.1 del artculo 3 de la Ley de
Contrataciones del Estado, aprobada mediante Decreto Legislativo N 1017, as
como para los rbitros, y otros usuarios autorizados a registrar informacin en el
Sistema Electrnico de Contrataciones del Estado (SEACE).
IV. BASE LEGAL
/H\ GH &RQWUDWDFLRQHV GHO (VWDGR DSUREDGD PHGLDQWH 'HFUHWR
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
Decreto Supremo N 184-2008-EF.
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado, aprobado por Resolucin Ministerial N
789-2011-EF/10.
/H\1/H\GH3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
ANEXOS
248
V. REFERENCIAS
Ley: Ley de Contrataciones del Estado.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
Directiva: La presente directiva.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
PAC: Plan Anual de Contrataciones.
SEACE: Sistema Electrnico de Contrataciones del Estado.
CUBSO: Catlogo nico de Bienes, Servicios y Obras.
RNP: Registro Nacional de Proveedores.
OEC: rgano encargado de las contrataciones de la Entidad.
Entidad: Entidad bajo el alcance del mbito de aplicacin del numeral 3.1.
del artculo 3 de la Ley, que tiene la obligacin de registrar la informacin
de sus contrataciones en el SEACE.
VI. DEFINICIONES
Certificado SEACE: Mecanismo de identificacin y seguridad que
debern utilizar las Entidades contratantes, los proveedores del Estado,
rbitros y los dems usuarios autorizados para acceder e interactuar en
el SEACE. Dicho Certificado se encuentra compuesto por un cdigo de
usuario y una contrasea.
&RQWUDWDFLyQGHXQDDWUHV8,7 Es el acuerdo entre una Entidad
y un proveedor que se perfecciona a travs de la notificacin de la orden
de compra u orden de servicio, segn corresponda, que emite la Entidad
a nombre de un proveedor por el monto de una (1) a tres (3) UIT, en
mrito de la cual ste ltimo, a partir de su recepcin, se obliga a proveer
lo requerido asumiendo la Entidad el pago de la retribucin econmica,
con cargo a fondos pblicos.
&RQWUDWDFLyQ VXMHWD D UpJLPHQ OHJDO GH FRQWUDWDFLyQ Es la
contratacin realizada por una Entidad para proveerse de bienes,
servicios y/u obras, bajo disposiciones de un rgimen legal de excepcin
que establece un procedimiento especfico de contratacin para tal
efecto.
&RQWUDWDFLRQHV EDMR HO iPELWR GH OD /H\ Son las que realizan
las Entidades sealadas en el numeral 3.1 del artculo 3 de la Ley,
para proveerse de los bienes, servicios y obras necesarios para el
cumplimiento de sus funciones, asumiendo el pago del precio o de la
retribucin correspondiente con fondos pblicos, y dems obligaciones
derivadas de la calidad de contratante.
6($&( Es el sistema electrnico desarrollado y administrado por el
OSCE que permite el intercambio de informacin y difusin sobre las
contrataciones del Estado, as como la realizacin de transacciones
electrnicas.
249
ANEXOS
6XSXHVWRVGHLQDSOLFDFLyQSon aquellos que, no obstante tratarse de
contrataciones de bienes, servicios u obras que realizan las Entidades
indicadas en el numeral 3.1 del artculo 3 de la Ley con cargo a fondos
pblicos, se encuentran expresamente excluidos de su aplicacin, de
acuerdo al listado del numeral 3.3 del referido artculo.
VII. DISPOSICIONES GENERALES
7.1. Las Entidades estn obligadas a registrar en el SEACE la informacin
sobre su Plan Anual de Contrataciones, los procesos de seleccin,
los contratos y su ejecucin as como todos los actos que requieren
ser publicados conforme a lo que establece la Ley, el Reglamento y la
Directiva.
7.2. La obligacin de brindar publicidad a las contrataciones por montos de
una (1) a tres (3) UIT, as como a las realizadas bajo regmenes legales
de contratacin y los supuestos de inaplicacin previstos los literales o)
s), t) y v) del numeral 3.3 del artculo 3 de la Ley, a travs de su registro
en el SEACE, incluye a las contrataciones que realicen las Entidades
cualquiera fuese la fuente de financiamiento a que se encuentra sujeta
la contratacin.
7.3. El registro de la informacin en el SEACE debe ser efectuada nicamente
por los usuarios funcionarios, rbitros y otros usuarios autorizados
empleando el Certificado SEACE, debiendo observar los lineamientos
de los manuales de usuario que publica el OSCE en el referido sistema.
El registro de la informacin de las contrataciones por montos de una (1)
a tres (3) UIT, las realizadas bajo regmenes legales de contratacin, as
como las previstas en los literales o), s), t) y v) del numeral 3.3 del artculo
3 de la Ley, debe realizarse en los mdulos del SEACE habilitados para
tal fin.
7.4. La informacin que se registra en el SEACE debe ser idntica a aquella
que se tiene como documento final para la realizacin de cualquier
acto relacionado con la contratacin a registrar, ya sea en el proceso
de seleccin, contrato o su ejecucin, segn corresponda; bajo
responsabilidad del funcionario que hubiese solicitado la activacin del
Certificado SEACE y de aqul que hubiera registrado la informacin.
La informacin del laudo arbitral, as como sus integraciones, exclusiones,
interpretaciones y rectificaciones que se registren en el SEACE, debe
ser idntica a la del original suscrito por el o los respectivos rbitros, bajo
responsabilidad del rbitro nico o del presidente del tribunal arbitral
encargado de su registro.
ANEXOS
250
7.5. La informacin que las Entidades registren en el SEACE, se encontrar
a disposicin de todos los interesados en el Portal Web www.seace.
gob.pe
7.6. Todos los actos realizados a travs del SEACE en el marco de lo
dispuesto por la Ley y su Reglamento se entendern notificados el mismo
da de su publicacin.
VIII. DISPOSICIONES ESPECFICAS
8.1. Una vez efectuado el registro y publicacin en el SEACE de la informacin
a que se refiere la Directiva no ser necesaria su remisin al OSCE por
medio escrito, salvo que la normativa vigente as lo exija o el OSCE la
solicite en ejercicio de sus funciones.
8.2. El registro en el SEACE de la informacin de contrataciones realizadas
en mrito a regmenes legales de contratacin o de actos cuyo registro
sea obligatorio por dispositivo legal, se efectuar observando los
plazos sealados en el dispositivo legal de que se trate, as como las
indicaciones que muestre el sistema.
8.3. Excepcionalmente, las Entidades que no tengan acceso a internet podrn
solicitar autorizacin al OSCE para efectuar procesos y contrataciones
de acuerdo a la Sexta Disposicin Complementaria Transitoria del
Reglamento, as como para su posterior registro en el SEACE dentro
del plazo establecido en dicha Disposicin Complementaria Transitoria
del Reglamento.
8.4. El SEACE cuando corresponda incluir en la convocatoria de los
procesos de seleccin la indicacin de los instrumentos internacionales
bajo cuyos alcances se encuentran cubiertos los procesos de seleccin
publicados por las Entidades, tomando para ello la informacin de los
umbrales fijados en los instrumentos internacionales proporcionada por
el Ministerio de Comercio Exterior y Turismo (MINCETUR) al OSCE, as
como la informacin registrada por la Entidad.
8.5. El OSCE a travs de la Direccin del SEACE, as como las Sub
Direcciones que la integran, efectuar las revisiones que correspondan
a la funcionalidad del SEACE y, de ser el caso, atender las incidencias
que los usuarios del SEACE reporten sobre registro de informacin en
el sistema, adoptando las medidas que resulten convenientes, segn
sea el caso.
251
ANEXOS
8.6. DEL REGISTRO EN EL SEACE DE LA INFORMACIN DE
PROCESOS DE SELECCIN Y CONTRATACIONES EN EL MARCO
DE LA LEY Y SU REGLAMENTO
8.6.1. De la convocatoria de procesos de seleccin
La convocatoria de los procesos de seleccin en el marco de la
Ley y su Reglamento deber efectuarse a travs del SEACE,
bajo sancin de nulidad.
A. Para publicar la convocatoria de un proceso de seleccin
deber consignarse en el SEACE, entre otros, la siguiente
informacin:
a) Datos del documento que aprueba el expediente de
contratacin.
b) Enlace al PAC, previa indicacin del tipo de compra
o seleccin (Por la Entidad, Compra Corporativa
Facultativa u Obligatoria o por Encargo).
c) Datos Generales del proceso de seleccin como
son: el tipo de proceso, modalidad de seleccin,
ao, nmero de proceso, nmero de convocatoria,
modalidad de ejecucin contractual, sistema de
contratacin, forma de presentacin de propuestas,
acto de buena pro, descripcin del objeto del proceso,
catlogo y fuente de financiamiento.
d) Cdigo Presupuestal
e) Valor Referencial
f) Bases.
g) Resumen ejecutivo del estudio de las posibilidades
que ofrece el mercado, cuando corresponda.
h) Registro de participantes en el que se indica el horario
y lugar en el que se efectuar el registro, as como el
costo de reproduccin de las bases.
i) Cronograma o calendario del proceso
j) Relacin de tems, de ser el caso.
B. Cuando corresponda y en aquellos procesos que se
encuentren dentro de los umbrales de los Tratados de
Libre Comercio y/u otros instrumentos internacionales
suscritos por el Per, la Entidad deber sealar si el proceso
a convocar se encuentra comprendido en alguna de las
excepciones previstas en tales documentos, para lo cual
deber seguir las indicaciones u opciones que el SEACE
muestre en el mdulo de registro.
ANEXOS
252
C. Slo ser factible la modificacin de informacin registrada
y archivos adjuntos en el SEACE cuando stos se hallen
guardados en borrador, una vez publicados en dicho sistema
no cabe modificacin alguna, salvo las opciones previstas en
el SEACE conforme a los manuales de usuario publicados
por el OSCE en el mencionado sistema.
D. Los procesos de seleccin deben ser vinculados al Plan
Anual de Contrataciones del ao fiscal que corresponde a
la convocatoria, salvo que se trate de una Adjudicacin de
Menor Cuanta no programable.
E. Para efectuar el registro en el SEACE se debe utilizar la
descripcin del Catlogo nico de Bienes, Servicios y Obras
CUBSO que tenga mayor relacin con el objeto del proceso
de seleccin. Lo mismo debe verificarse al momento de
registrar los tems del proceso. La Entidad es responsable
de la seleccin de los elementos del CUBSO para el proceso
y el tem.
F. Los procesos de seleccin deben ser convocados a travs del
SEACE el mismo da previsto en el cronograma o calendario
de las Bases aprobadas, debiendo adjuntar el archivo que
contiene las Bases en las extensiones permitidas por el
sistema.
G. Para la convocatoria de las Licitaciones Pblicas, Concursos
Pblicos y Adjudicaciones Directas se publicar en el
SEACE el archivo del Resumen Ejecutivo del estudio de
las posibilidades que ofrece el mercado, en las extensiones
permitidas por el sistema.
Dicha exigencia se mantiene para las Adjudicaciones de
Menor Cuanta Derivadas que devienen de la declaratoria
de desierto de los procesos de Licitacin Pblica, Concurso
Pblico o Adjudicacin Directa.
Para el caso de los procesos que por su monto correspondan
a una Adjudicacin de Menor Cuanta, el registro del
Resumen Ejecutivo del Estudio de las posibilidades que
ofrece el mercado es facultativo.
H. Las fechas de inicio y fin de las etapas previstas en el
cronograma o calendario registrado en el SEACE, as como
las que figuran en las Bases aprobadas, deben observar
los plazos mnimos y mximos previstos en la Ley y el
Reglamento para cada tipo y modalidad de proceso de
seleccin. La misma disposicin debe observarse en los
253
ANEXOS
casos de postergacin de las etapas del calendario.
I. De acuerdo al artculo 32 de la Ley, cuando un proceso de
seleccin haya sido declarado desierto se convocar a una
Adjudicacin de Menor Cuanta Derivada. En el supuesto
que el expediente de contratacin haya sufrido alguna
modificacin y de acuerdo a lo establecido en el ltimo
prrafo del artculo 10 del Reglamento se haya aprobado un
nuevo expediente de contratacin, deber registrarse en el
SEACE los datos y el archivo del documento que aprueba
el nuevo expediente de contratacin.
- (IHFWXDGD OD SXEOLFDFLyQ GH OD FRQYRFDWRULD \ GXUDQWH HO
trmite del proceso de seleccin se deber registrar en el
SEACE la informacin detallada en el numeral 8.6.5 de la
presente Directiva.
8.6.2. Del registro del Comit Especial
En las Licitaciones Pblicas, Concursos Pblicos, Adjudicaciones
Directas y Adjudicaciones de Menor Cuanta Derivadas se
registrarn los datos del funcionario que design al Comit
Especial y los miembros que lo integran. Adems, se indicar
VLVHWUDWDGHXQ&RPLWp(VSHFLDO$G+RFR3HUPDQHQWH
En los casos de las Adjudicaciones de Menor Cuanta en los que
no se haya designado un Comit Especial, se consignar los
datos del OEC y, de ser el caso, los nombres de las personas a
quienes se les asign la conduccin del proceso de seleccin.
De haberse designado Comit Especial deber procederse
conforme al prrafo precedente.
8.6.3. Del Registro de Participantes
A. Antes del inicio de la etapa de presentacin de propuestas
la Entidad deber registrar en el SEACE la informacin de
los participantes inscritos, debiendo asegurarse de haber
completado el registro de todos los participantes para iniciar
el registro de las propuestas.
B. El SEACE restringir el registro de un participante que
no cuente con inscripcin vigente en Registro del RNP
correspondiente al objeto del proceso y/o se encuentre
inhabilitado para contratar con el Estado.
C. En los procesos de Adjudicacin de Menor Cuanta de
ANEXOS
254
bienes y servicios, la fecha de inicio de la etapa de registro
de participantes deber estar comprendida dentro del horario
de atencin de la Entidad y extenderse hasta un minuto antes
del inicio de la presentacin de propuestas.
D. Considerando que la atencin a los usuarios debe ser
continuada, los proveedores podrn registrarse como
participantes en cualquier momento dentro de las fechas
previstas para esa etapa en el horario de atencin a los
usuarios que haya establecido la Entidad, el cual en ningn
caso podr ser inferior a ocho horas diarias consecutivas
de acuerdo con lo dispuesto en el artculo 138 de la Ley N
27444, Ley del Procedimiento Administrativo General.
8.6.4. De la presentacin de propuestas
A. De acuerdo al artculo 64 del Reglamento, los actos de
presentacin de propuestas se llevan a cabo en la fecha
y hora sealadas en la convocatoria, salvo que stos se
posterguen. En ese sentido, la Entidad deber indicar en las
Bases y registrar en el cronograma o calendario del SEACE,
entre otros, la fecha y hora en que se efectuar el acto de
presentacin de propuestas.
B. En caso que la presentacin de propuestas sea en acto
pblico, la Entidad debe registrar en el cronograma o
calendario del SEACE, adems del lugar y fecha en que
se realizar, la hora de inicio de dicho acto, a fin de que los
postores tengan conocimiento oportuno de la fecha y hora
en la que deben apersonarse a presentar sus propuestas.
La hora de culminacin de dicho acto est condicionada a
la cantidad de propuestas presentadas y al tiempo que se
utilice para la acreditacin de representantes y evaluacin
de la documentacin presentada, segn lo dispuesto en el
artculo 66 del Reglamento. La hora de inicio del acto de
presentacin de propuesta debe contemplar lo establecido
en el ltimo prrafo del literal C del numeral 8.6.3 de la
Directiva.
C. En caso que la presentacin de propuestas sea en acto
privado, a fin de incentivar la mayor concurrencia, pluralidad y
participacin de potenciales postores, en estricta observancia
del Principio de Libre Concurrencia y Competencia
contemplado en el literal c) del artculo 4 de la Ley, la Entidad
deber registrar en el cronograma o calendario del SEACE,
255
ANEXOS
adems de la fecha prevista, la hora en que iniciar y
culminar el Acto de Presentacin de Propuestas, debiendo
mediar entre la hora de inicio y hora fin no menos de ocho (8)
horas en el caso de Adjudicaciones Directas Selectivas y no
menos de cuatro (4) horas en el caso de las Adjudicaciones
de Menor Cuanta. La hora de inicio del acto de presentacin
de propuesta debe contemplar lo establecido en el ltimo
prrafo del literal C del numeral 8.6.3 de la Directiva.
D. El registro en el SEACE de las propuestas presentadas se
efectuar con la indicacin de la fecha y el nombre o razn
social del postor. En caso que el postor sea una persona
jurdica debern indicarse los datos del representante legal.

E. En caso que el postor sea un consorcio al momento del
registro de su propuesta en el SEACE se deber consignar
los datos de cada una de las personas naturales y/o jurdicas
que lo integran, los datos del representante comn y el
porcentaje de obligaciones de cada uno de los integrantes
del consorcio previsto en la promesa formal de consorcio.
F. El SEACE restringir el registro de la propuesta de aquel
postor que no cuente con inscripcin vigente en el RNP y/o
que se encuentre inhabilitado para contratar con el Estado.
Dicha restriccin tambin ser aplicada en el caso que los
integrantes de un consorcio no cuenten con inscripcin
vigente en el RNP y/o se encuentren inhabilitados para
contratar con el Estado.
8.6.5. Del registro de las acciones durante el trmite del proceso
A. Durante el trmite del proceso de seleccin y cuando
corresponda se deber publicar en el SEACE, las siguientes
acciones realizadas:
a) Pliego de Absolucin de consultas y/u
observaciones a las Bases, cuando corresponda.
b) Elevacin de observaciones a las Bases al OSCE:
Se registrar los datos de los participantes que
solicitaron la elevacin de las Bases, de ser el caso.
c) Pronunciamiento emitido por el OSCE, en los casos
que se haya solicitado elevacin de Bases.
d) Bases Integradas: En todos los procesos de seleccin
ANEXOS
256
que cuentan con la etapa de integracin de bases,
aun cuando no se hayan presentado consultas y/u
observaciones.
En este ltimo supuesto podr registrarse nuevamente
las Bases originales o el acta en que se acuerde la
integracin de las Bases segn su texto original por
no haberse presentado consultas y/u observaciones.
e) Registro en caso de empate: Se registrar el acta y
el cuadro comparativo en los que consta el empate;
en ellos debe apreciarse los nombres o razn social
de los postores que empataron.
f) La Buena Pro otorgada hasta por un monto no
mayor al 100% del valor referencial: En el caso de
procesos convocados para la adquisicin de bienes,
la contratacin de servicios en general, consultora en
general y consultora de obras, se registrar la Buena
Pro otorgada hasta un monto no mayor al 100% del
valor referencial, adjuntando el cuadro comparativo
de propuestas y el Acta de Otorgamiento de la Buena
Pro.
La Buena Pro deber registrarse en el SEACE el
mismo da de su realizacin, sea que se trate de un
acto pblico o privado.
g) La Buena Pro otorgada hasta el lmite del 110%
del valor referencial: En los procesos convocados
para la ejecucin de obras, se registrar la Buena
Pro otorgada hasta el lmite del 110% del valor
referencial adjuntando al sistema, adems del cuadro
comparativo de propuestas y el Acta de Otorgamiento
de la Buena Pro, el documento a travs del cual el
Titular de la Entidad aprob el otorgamiento de la
Buena Pro hasta el lmite antes indicado.
h) Registro de la declaratoria de desierto del proceso
de seleccin o un tem de ste: Se registrar hasta
el da siguiente de producido, debiendo sealar la
fecha del acta a travs del cual el Comit Especial
o el OEC, segn corresponda, declar desierto el
proceso o tem y adjuntar el archivo correspondiente
en las extensiones que muestra el sistema.
i) El recurso de apelacin presentado ante la
Entidad: En procesos cuya apelacin corresponda ser
presentada ante la Entidad, se registrar el nombre o
257
ANEXOS
razn social del postor que present la apelacin, el
nmero y fecha del documento presentado y la fecha
de recepcin del recurso en la Entidad, y el tem o
tems impugnados.
j) El recurso de apelacin interpuesto ante el Tribunal
de Contrataciones del Estado: En procesos cuya
apelacin corresponda ser presentada ante el Tribunal
de Contrataciones del Estado, se registrar indicando
el nombre o razn social del postor impugnante.
Los datos de la apelacin presentada podrn ser
consultados en el Toma Razn Electrnico al cual
se puede acceder desde la ficha del proceso de
seleccin.
k) Registro de la resolucin que resolvi el recurso
de apelacin: A travs de esta accin se informar
sobre la publicacin de la resolucin que resolvi el
recurso de apelacin presentado ante la Entidad o
ante el Tribunal de Contrataciones del Estado.
l) Registro del agotamiento de la va administrativa,
cuando corresponda: A travs de esta accin
se informar a travs del SEACE si la resolucin
que resolvi el recurso de apelacin agot la va
administrativa.
m) Registro del consentimiento de la Buena Pro:
Se debe efectuar como mximo al da siguiente de
producido, observando los plazos establecidos en
la Ley y su Reglamento segn el tipo de proceso de
seleccin y modalidad.
n) Registro de la nulidad del proceso de seleccin o
de alguno de los tems que lo integran: Los actos
emitidos por el Titular de la Entidad o el Tribunal de
Contrataciones del Estado al amparo de lo establecido
en el artculo 56 de la Ley sern registrados con la
indicacin de los datos del Titular de la Entidad o la
Sala del Tribunal que emiti dicha decisin, la causal
de la nulidad, la etapa a la que se retrotraer el proceso
y el tem cuya nulidad se declar.
En el caso que en un proceso de seleccin declarado
nulo se haya dispuesto retrotraer el proceso a la etapa
de convocatoria, previa reformulacin de las Bases
ANEXOS
258
o algn aspecto del expediente de contratacin, la
Entidad deber registrar la aprobacin del expediente
de contratacin modificado, las bases modificadas
debidamente aprobadas y el resumen ejecutivo del
estudio de las posibilidades que ofrece el mercado,
segn corresponda.
Cuando uno o ms tems de un proceso de seleccin
hayan sido declarados nulos y se haya ordenado
retrotraer esos tems a la etapa de convocatoria, el
tipo de proceso de seleccin que se convoque ser
aqul que corresponda a la sumatoria de los valores
referenciales de los tems declarados nulos.
o) Registro de la cancelacin total del proceso o
de alguno de los tems que lo integran: Deber
efectuarse al da siguiente de la comunicacin al
Comit Especial o el OEC de la decisin de cancelar el
proceso, debiendo adjuntar el archivo de la resolucin
o acuerdo cancelatorio, segn corresponda.
p) La no suscripcin del contrato por el postor: El
registro de dicho evento se efectuar con la indicacin
del nombre o razn social del postor que no suscribi
el contrato, ya sea el postor que ocup el primer lugar
o el segundo lugar, segn corresponda.
q) La no suscripcin del contrato por decisin de la
Entidad: Deber registrarse las razones de la decisin
de la Entidad: (i) recorte presupuestal correspondiente
al objeto del proceso de seleccin; (ii) por norma
expresa; o, (ii) porque ha desaparecido la necesidad.
r) La modificacin de algunos datos errneos
publicados en la Ficha de la Convocatoria: Datos
tales como la descripcin bsica del objeto, costo
de reproduccin de las bases, cdigo presupuestal,
etc. que fueron registrados errneamente podrn
ser modificados a travs de la opcin fe de erratas,
siempre y cuando la informacin que obra en el
expediente de contratacin o en las Bases aprobadas
demuestren que los datos publicados en el SEACE
son errneos y requieren ser corregidos. A travs de
esta opcin no podr modificarse el contenido de los
documentos registrados, tal es el caso de las Bases,
Resumen Ejecutivo, entre otros.
259
ANEXOS
s) La postergacin de las etapas del proceso de
seleccin: A travs de esta opcin se podr registrar
la postergacin de la realizacin de una etapa del
proceso o la prrroga para la finalizacin de la
misma, correspondiendo su utilizacin en el caso
de la suspensin de actos del proceso. El registro
podr efectuarse hasta el mismo da sealado en
el cronograma o calendario del proceso, siempre
y cuando la fecha prevista no haya transcurrido, y
deber ser comunicada a los participantes o postores,
segn sea el caso, a travs del SEACE, sealando el
motivo de la postergacin o prrroga.
B. Los datos y documentos publicados en el SEACE se
almacenarn en dicho sistema no siendo factible su
eliminacin, salvo norma que disponga lo contrario.
8.6.6. Del registro del procedimiento de exoneracin
La publicacin en el SEACE de informacin del procedimiento
de exoneracin por las causales previstas en el artculo 20 de
la Ley, salvo aquella sealada en el literal d) del mencionado
artculo, deber efectuarse dentro del plazo de diez (10) das
hbiles siguientes a la emisin o adopcin de las resoluciones o
acuerdos que aprueben las exoneraciones y los informes que los
sustentan. Para ello, deber registrarse en el SEACE la siguiente
informacin:
a) Datos de documento que aprueba el expediente de
contratacin.
b) Enlace al PAC.
c) Datos Generales de la exoneracin como son: causal de
exoneracin, ao, nmero de la exoneracin, modalidad de
ejecucin contractual, sistema de contratacin, descripcin
del objeto, catlogo y fuente de financiamiento.
d) Cdigo presupuestal.
e) Monto autorizado.
f) Dejar sin efecto la exoneracin: Se registrar el documento
que deja sin efecto la exoneracin aprobada, el cual deber
ser emitido por el mismo rgano que la aprob.
g) Archivo del instrumento de aprobacin de la exoneracin en
las extensiones que se indican en el sistema.
h) Archivo de los documentos que contiene el sustento tcnico
legal en las extensiones que se indican en el sistema.
i) Bases.
ANEXOS
260
j) Registro del rgano encargado de las contrataciones u
rgano designado para el efecto.
k) Registro del postor invitado.
l) Registro de la adjudicacin: se deber adjuntar el acta de
adjudicacin y registrar los datos del postor adjudicado.
Asimismo, se efectuar el enlace al PAC del ao fiscal que
corresponda a la fecha de aprobacin de la exoneracin.
El SEACE verificar que el monto adjudicado no sea superior al
monto autorizado en el instrumento de la exoneracin.
8.6.7. Del registro de informacin de procesos de seleccin por
encargo
A. En el caso de procesos por encargo a una Entidad Pblica,
la Entidad encargante deber verificar que dicho proceso se
encuentre incluido en su PAC con la indicacin de la Entidad
encargada de la conduccin del proceso. Por su parte la
Entidad encargada realizar el registro en el SEACE de la
informacin del proceso que le fue encargado. El registro
de la informacin del contrato suscrito y su ejecucin ser
realizado por la Entidad encargante.
B. En el caso de encargos a organismos internacionales
aprobados bajo los alcances del artculo 89 del Reglamento,
la Entidad encargante deber incluir las contrataciones en su
PAC y de acuerdo a los trminos del convenio deber registrar
en el SEACE, sea directamente o a travs del organismo
internacional, la informacin que se indica en los campos
habilitados en el SEACE, los mismos que comprenden, entre
otros, la convocatoria de los procedimientos de contratacin
que realice el organismo internacional encargado, el
resultado de los mismos, proveedores adjudicados, los
montos y contratos suscritos.
En este supuesto, la convocatoria y los dems actos se
registrarn en el SEACE a ms tardar al da hbil siguiente
de efectuados.
8.6.8. Del registro de contratos
El registro de los contratos y su ejecucin en el SEACE, deber
ser efectuado completando, entre otros, la siguiente informacin:
a) Datos del contrato.
261
ANEXOS
b) Datos del contratista.
c) Datos de garantas presentadas.
d) Adicionales.
e) Reducciones.
f) Resolucin del contrato, cuando corresponda.
g) Nulidad del contrato, cuando corresponda.
h) Penalidades.
i) Reajustes.
j) Ampliaciones de plazo.
k) Intervencin econmica, cuando corresponda.
l) Prrrogas, en caso de arrendamiento de inmuebles.
m) Conformidad.
n) Liquidacin.
o) Contratos complementarios, cuando corresponda.
El registro del contrato y su ejecucin en el SEACE culmina con
el registro de la conformidad o liquidacin consentida, segn
corresponda.
El OEC es responsable de verificar que se efecte el registro
en el SEACE de los contratos y, en su caso, las rdenes
de compra o de servicio, as como la informacin referida a
su ejecucin en el plazo no mayor de diez (10) das hbiles
siguientes a su perfeccionamiento, ocurrencia o aprobacin,
segn corresponda, resultando aplicable las responsabilidades
y sanciones establecidas en el artculo 46 de la Ley en caso de
incumplimiento.
Es responsabilidad de la autoridad de la Entidad de que se
trate, verificar que los actos que emita o suscriba luego de la
suscripcin del contrato y que supongan una modificacin del
monto o los trminos del contrato se sujeten a la normativa de
contrataciones del Estado.
Los usuarios - funcionarios que registren informacin en el
SEACE, referida a los contratos y, en su caso, a las rdenes de
compra o de servicio, que difieran de los documentos aprobados
y suscritos asumirn la responsabilidad administrativa y/o penal
que les asiste, de acuerdo a la normativa aplicable.
8.6.9. Del registro de laudos
El Presidente del Tribunal Arbitral o Arbitro nico es responsable
de efectuar el registro y publicacin del laudo, as como sus
integraciones, exclusiones, interpretaciones y rectificaciones
en el SEACE, observando el plazo establecido en la Ley y el
ANEXOS
262
Reglamento, as como los lineamientos de los manuales de
usuario publicados por el OSCE.
Para efectuar el registro deber solicitar al OSCE el Certificado
SEACE, as como verificar que la Entidad haya registrado la
existencia de la controversia en la ficha del contrato de que se
trate.
Asimismo, deber verificar bajo responsabilidad que la
informacin que publica en el SEACE sea idntica al documento
original suscrito por el Tribunal Arbitral o Arbitro nico que ser
notificada personalmente a las partes de la controversia.
8.6.10. Del Procedimiento de autorizacin para Entidades que no
tienen acceso a internet
Las Entidades que no tengan acceso a internet podrn solicitar
al OSCE, la autorizacin para efectuar procesos y contrataciones
de acuerdo a la Sexta Disposicin Complementaria Transitoria
del Reglamento, as como para su posterior registro en el SEACE
en el plazo de quince (15) das siguientes al cierre de cada
trimestre.
Para ello, la Entidad solicitante deber remitir a la Direccin
del SEACE un oficio u otro documento en el que seale, bajo
responsabilidad, que no cuenta con internet, indicando su
domicilio y un nmero de fax a los que se les podr notificar la
decisin adoptada por la citada Direccin.
El OSCE evaluar en cada caso la procedencia de la solicitud
y notificar al domicilio consignado en el pedido, la decisin de
autorizar o no a la Entidad solicitante.
El SEACE habilitar las opciones que permitan a las Entidades
autorizadas por OSCE informar en el plazo establecido en la
Sexta Disposicin Complementaria Transitoria del Reglamento,
aquellos procesos de seleccin y las contrataciones realizadas
bajo las reglas de la mencionada Disposicin Complementaria
Transitoria.
En ningn caso, la autorizacin otorgada por OSCE convalida
los actos que las Entidades durante el procedimiento de
contratacin efecten en contravencin de la normativa aplicable,
por corresponder a las autoridades de cada Entidad supervisar
en forma previa, concurrente y posterior la legalidad de stos,
como parte del proceso de control interno.
263
ANEXOS
8.7. DEL REGISTRO DE INFORMACIN DE LAS CONTRATACIONES
SUJETAS A SUPUESTOS DE INAPLICACIN DE LOS LITERALES
I, O, S, T y V DEL ARTCULO 3.3. DE LA LEY
8.7.1. Contrataciones por montos de 1 a 3 UIT
A. De acuerdo a lo establecido en el artculo 68 de la Ley, la
Entidad registrar y publicar en el SEACE la informacin
de sus contrataciones por montos de una (1) a tres (3) UIT
que hubieran realizado durante el mes, contando para ello
con un plazo mximo de (10) das hbiles del mes siguiente.
B. La informacin que se registra en el SEACE debe ser
idntica a aquella que se tiene en la orden de compra (O/C)
u orden de servicio (O/S) que fue notificada al contratista,
debiendo informar cuando corresponda el estado de dicha
contratacin.
C. Las rdenes de compra u rdenes de servicio que se deriven
de contratos suscritos bajo el mbito de aplicacin de la Ley
y el Reglamento, regmenes legales de contratacin, o los
supuestos de inaplicacin recogidos en el numeral 3.3. del
artculo 3 de la Ley, continuarn siendo registrados en los
mdulos del SEACE habilitados para ello. El registro de la
informacin en el SEACE se efectuar en el Mdulo del
SEACE habilitado para tal efecto, completando, entre otros,
la siguiente informacin:
a) Datos de la Entidad.
b) Datos de la Orden de Servicio u Orden de Compra.
c) Datos de contratacin.
d) Datos presupuestales.
e) Datos del contratista.
f) Detalle de tems.
8.7.2. Contrataciones sujetas a los supuestos de inaplicacin de
los literales o, s, t y v del artculo 3.3 de la Ley
A. Las Entidades debern registrar en el SEACE la informacin
de las contrataciones previstas en los literales o, s, t y v) del
numeral 3.3. del artculo 3 de la Ley en un plazo mximo de
diez (10) das hbiles de haberse realizado la contratacin
o suscrito el convenio, segn corresponda.
'HOUHJLVWURGHODVFRQWUDWDFLRQHVSUHYLVWDVHQHOOLWHUDOR
del artculo 3.3 de la Ley
ANEXOS
264
B. El registro en el SEACE de las contrataciones realizadas
con proveedores no domiciliados en el pas cuyo mayor
valor estimado de las prestaciones se realice en territorio
extranjero deber realizarse completando los campos del
Mdulo del SEACE habilitado para tal fin, debiendo incluir,
entre otros, la siguiente informacin:
a) Enlace con el PAC.
b) Informe que acredite los requisitos para la configuracin
de una contratacin en el extranjero.
c) Cronograma o calendario de la contratacin, de ser
el caso.
d) Monto estimado o referencial, de ser el caso.
e) Documento que contenga las condiciones de la
contratacin (plazo, lugar de entrega, transferencia de
conocimientos, prestaciones accesorias, entre otros).
f) Archivo del contrato suscrito.
g) Informacin del proveedor contratado: nombre,
denominacin o razn social y pas de procedencia.
Del registro de las contrataciones previstas en el literal s
del artculo 3.3 de la Ley
C. El registro en el SEACE de los convenios de cooperacin,
gestin u otros de naturaleza anloga, suscritos entre
Entidades, o entre stas y organismos internacionales,
siempre que se brinden los bienes, servicios u obras propios
de la funcin que por ley les corresponde, y adems no
se persigan fines de lucro, deber realizarse completando
los campos del Mdulo del SEACE habilitado para tal fin,
debiendo incluir, entre otros, la siguiente informacin:
a) Archivo del convenio.
b) Informacin de la contraparte: Denominacin de
la Entidad u Organismo con la que se suscribe el
convenio.
c) Estructura de costos, en los casos en que el convenio
involucre algn tipo de desembolso dinerario.
Del registro de las contrataciones previstas en el literal t
del artculo 3.3 de la Ley
D. El registro en el SEACE de la contratacin de servicios
pblicos, siempre que no exista la posibilidad de contratar
con ms de un proveedor, deber realizarse completando
los campos del Mdulo del SEACE habilitado para tal fin,
debiendo incluir, entre otros, la siguiente informacin:
a) Empresa con la que se contrat el servicio.
b) Monto contratado.
265
ANEXOS
Del registro de las contrataciones previstas en el literal v
del artculo 3.3 de la Ley
E. El registro en el SEACE de las contrataciones realizadas de
acuerdo con las exigencias y procedimientos especficos
de organismos internacionales, Estado o entidades
cooperantes que se deriven de donaciones efectuadas
por stos, siempre que dichas donaciones representen
por lo menos el 25% del monto total de las contrataciones
involucradas en el Convenio suscrito para tal efecto, deber
realizarse completando los campos del Mdulo del SEACE
habilitado para tal fin, debiendo incluir, entre otros, la siguiente
informacin:
a) Enlace con el PAC.
b) Convenio o documento que contenga las condiciones
de la donacin y en el cual se aprecie las obligaciones
de las partes.
c) Informacin de la contraparte: Denominacin del
Organismo, Estado o Entidad Cooperante, monto que
se compromete a donar
d) Datos del procedimiento de contratacin, tales
como: Bases o documento anlogo, cronograma o
calendario del procedimiento, de corresponder, acta
de adjudicacin o documento anlogo, contrato,
denominacin o razn social del proveedor contratado.
De acuerdo a lo establecido en el artculo 58 de la Ley, el
OSCE supervisar, entre otros, las contrataciones previstas
en los literales i, o, s, t y v del numeral 3.3. del artculo
3 de la Ley y las Entidades estn obligadas a remitir la
informacin solicitada por el OSCE en el marco de las
acciones de supervisin, en el plazo establecido en la
notificacin electrnica o en el oficio, segn corresponda,
bajo responsabilidad del Titular de la Entidad.
8.8. DEL REGISTRO DE INFORMACIN DE CONTRATACIONES
SUJETAS A REGMENES LEGALES DE CONTRATACIN
8.8.1. La informacin de las contrataciones con sujecin a los regmenes
legales de contratacin que establezcan la obligatoriedad de su
registro en el SEACE debe efectuarse en el Mdulo del sistema
habilitado para tal fin, observando los plazos establecidos en la
norma que lo regule, as como las indicaciones que muestra el
sistema.
8.8.2. El registro y publicacin se efectuar completando los campos
que muestre el SEACE referidos, entre otras, a las siguientes
acciones:
ANEXOS
266
a) Tipo de rgimen legal: Se indicar el dispositivo legal
que corresponda a la contratacin materia de registro,
seleccionando la opcin del listado que muestre el SEACE.
b) Documento que aprueba el expediente de contratacin:
En aquellos casos que el procedimiento previsto en el
rgimen legal de contratacin no contemple la aprobacin de
un expediente de contratacin, la Entidad registrar los datos
del documento a travs del cual el funcionario competente
autoriz la contratacin o algn otro documento del cual se
desprenda dicha autorizacin.
c) Bases de la contratacin: En caso que el procedimiento
previsto en el rgimen legal de contratacin no contemple
la elaboracin de Bases, la Entidad registrar el documento
anlogo que contenga las reglas de la contratacin o, en
su defecto, las especificaciones tcnicas o trminos de
referencia de la contratacin.
d) Enlace al PAC.
e) Datos Generales del procedimiento: Se completarn en
esta seccin los datos del procedimiento, como es el nmero,
sigla, objeto y descripcin de la contratacin.
f) Valor o monto referencial del procedimiento: En caso que
el procedimiento previsto en el rgimen legal de contratacin
no prevea la determinacin de un valor referencial se
registrara el valor estimado para la contratacin.
g) Cronograma o calendario: En esta seccin se registrar
la fecha de convocatoria o invitacin a los proveedores para
participar en el procedimiento, segn corresponda; la fecha
prevista para que los proveedores realicen sus ofertas o
presenten sus ofertas y/o propuestas, segn corresponda; y
la fecha prevista para la comunicacin de los resultados del
procedimiento al proveedor seleccionado o a los proveedores
que participaron, segn corresponda.
h) Las fechas referidas a la presentacin de propuestas
as como el otorgamiento de la buena pro debe ser
registrada en todos los casos, con independencia de la
denominacin que reciban dichas actividades en el marco
de sus procedimientos legales de contratacin.
i) Relacin de tems, cuando corresponda.
267
ANEXOS
j) Registro de participantes: En caso que el procedimiento
previsto en el rgimen legal de contratacin no prevea
la inscripcin de participantes previa a la presentacin
de ofertas o propuestas, la Entidad deber registrar la
informacin correspondiente a los proveedores que
presentaron sus propuestas y/o ofertas al procedimiento,
segn corresponda.
k) Absolucin de consultas y/u observaciones: Esta seccin
ser completada nicamente si es que el procedimiento
previsto en el rgimen legal de contratacin lo prev.
l) Registro de Propuesta: Con independencia de la
denominacin que reciba esta etapa en el marco del
procedimiento especial que se registra, la entidad registrar en
este rubro la informacin correspondiente a los proveedores
que presentaron sus propuestas al procedimiento, segn
corresponda.
m) Cuadro comparativo de propuestas y/u ofertas
presentadas y Acta de Buena Pro y/o resultados del
procedimiento: En aquellos casos que el procedimiento
de seleccin no contemple la elaboracin de un cuadro
comparativo y/o un acta de buena pro, la Entidad deber
registrar en ambos campos el documento en el cual se
comunica el resultado del procedimiento al proveedor
seleccionado o a los proveedores que participaron, segn
corresponda.
n) Datos y documento de contrato.
o) Datos del contratista.
p) Declaracin de desierto, cuando corresponda.
q) Fe de erratas, cuando corresponda.
r) Postergacin, cuando corresponda.
8.8.3. Las Entidades sujetas a regmenes legales de contratacin de
bienes, servicios y obras que se creen con posterioridad a la
entrada en vigencia de la presente Directiva, y que por disposicin
legal estn obligadas a registrar informacin en el SEACE sobre
las contrataciones que realicen, debern observar adems de lo
indicado en el numeral precedente, lo siguiente:
ANEXOS
268
A. Efectuar las coordinaciones necesarias con el OSCE, a fin
que se habilite en el sistema las opciones y funcionalidades
necesarias para el registro de dicha informacin en el
SEACE.
B. Acudir a las reuniones de coordinacin que el OSCE
convoque as como proporcionar la informacin solicitada
durante el procedimiento de anlisis e implementacin de
funcionalidades en el SEACE.
IX. DISPOSICIN TRANSITORIA
El registro en el SEACE de las contrataciones por montos de una (1) a tres (3)
UIT, as como las que se realicen bajos los supuestos de inaplicacin previstos
en los literales o), s), t) y v) del numeral 3.3 del artculo 3 de la Ley, se realizar
de manera obligatoria a partir de la publicacin del comunicado que emita OSCE
para tal efecto.
X. DISPOSICIN FINAL
1. La presente Directiva regir a partir de la entrada en vigencia de la Ley
N 29873, que modifica la Ley de Contrataciones del Estado y el Decreto
Supremo N 138-2012-EF, que modifica el Reglamento de la Ley de
Contrataciones del Estado.
2. A partir de la vigencia de la presente directiva djese sin efecto la Directiva
N 008-2010-OSCE/CD.
-HV~V0DUtDVHWLHPEUHGH

269
ANEXOS
DIRECTIVA N 010-2012-OSCE/CD
DISPOSICIONES REFERIDAS AL TRMITE DE ASIGNACIN,
ACTUALIZACIN Y DESACTIVACIN DEL CERTIFICADO SEACE
OTORGADO A LOS USUARIOS DEL SISTEMA ELECTRNICO DE
CONTRATACIONES DEL ESTADO (SEACE)
I. FINALIDAD
Precisar el procedimiento y disposiciones que las Entidades Pblicas Contratantes,
rganos que ejercen control y fiscalizacin, proveedores del Estado, rbitros u otros
usuarios autorizados, deben tener en cuenta para el trmite, ante el Organismo
Supervisor de las Contrataciones del Estado, en adelante OSCE, para la emisin
del Certificado SEACE, as como para la actualizacin y desactivacin del mismo.
II. OBJETO
Establecer el procedimiento que deben seguir las Entidades Pblicas Contratantes,
rganos que ejercen control y fiscalizacin, proveedores del Estado, rbitros u
otros usuarios autorizados, para obtener, actualizar y desactivar sus Certificados
SEACE, as como precisar las responsabilidades que genera su uso.
III. ALCANCE
La presente directiva es de cumplimiento obligatorio para las Entidades que se
encuentran bajo el mbito de aplicacin de la normativa de contrataciones del
Estado, conforme al artculo 3 de la Ley, aprobada mediante Decreto Legislativo
N 1017; los rganos que ejercen control y fiscalizacin; los proveedores inscritos
en el Registro Nacional de Proveedores (RNP); los proveedores exceptuados de
inscripcin en el citado Registro conforme a lo establecido en el artculo 256 del
Reglamento; los rbitros; as como para otros usuarios autorizados a contar con
Certificado SEACE, segn los perfiles y atributos sealados en el Anexo N 1.
IV. BASE LEGAL
Ley de Contrataciones del Estado, aprobada mediante Decreto
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
Decreto Supremo N 184-2008-EF.
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado, aprobado mediante Resolucin Ministerial
N 789-2011-EF/10.
/H\1/H\GHO3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
ANEXOS
270
V. REFERENCIAS
En la presente directiva se utilizarn las siguientes referencias:
/H\ Ley de Contrataciones del Estado.
5HJODPHQWR Reglamento de la Ley de Contrataciones del Estado.
'LUHFWLYDLa presente directiva.
26&(Organismo Supervisor de las Contrataciones del Estado.
6($&( Sistema Electrnico de Contrataciones del Estado (SEACE).
513Registro Nacional de Proveedores.
'1, Documento Nacional de Identidad.
58& Registro nico de Contribuyente.
5(&Registro de Entidades Contratantes.
VI. DEFINICIONES
&HUWLILFDGR 6($&( Mecanismo de identificacin y seguridad que
debern utilizar las Entidades Pblicas Contratantes, los proveedores
del Estado, rbitros y los dems usuarios sealados en Anexo N 1,
para acceder e interactuar en el SEACE. Dicho Certificado se encuentra
compuesto por un cdigo de usuario y una contrasea.
3HUILO Constituye el tipo de usuario con que se interacta en el SEACE
segn accesos otorgados.
$WULEXWRV Accesos autorizados en el SEACE que los usuarios poseen
segn el tipo de perfil al que se encuentran asociados.
)XQFLRQDULRVXVXDULRV GH ODV (QWLGDGHV 3~EOLFDV &RQWUDWDQWHV
Funcionarios-usuarios de las Entidades comprendidas en el numeral 3.1
del artculo 3 de la Ley, que realizan procesos de contratacin pblica.
)XQFLRQDULRVXVXDULRV GH ORV UJDQRV TXH HMHUFHQ FRQWURO \
fiscalizacin: Comprende a los funcionarios-usuarios de la Contralora
General de la Repblica, del Congreso de la Repblica y de otras
Entidades del Estado facultadas a realizar las funciones de control y
fiscalizacin. Tambin, incluye a los funcionarios-usuarios del rgano
de Control Institucional de la Entidad.
)XQFLRQDULRVXVXDULRV GHO 26&( Comprende a los funcionarios-
usuarios del OSCE que realizan funciones de administracin de datos,
revisin, fiscalizacin y supervisin de los procesos de contratacin
pblica, como parte de sus labores.
VII. DISPOSICIONES GENERALES
7.1. El OSCE es el encargado de emitir el Certificado SEACE a travs de
271
ANEXOS
la Sub Direccin de Plataforma de la Direccin del SEACE y de la Sub
Direccin de Operaciones Registrales de la Direccin del RNP, segn
corresponda.
7.2. El acceso y uso del Certificado SEACE se encuentra sujeto a lo previsto
en la Ley, su Reglamento, las normas complementarias y los Trminos
y Condiciones de Uso del sistema, los cuales se entendern aceptados
por las Entidades Pblicas Contratantes, los proveedores del Estado,
rbitros y otros usuarios autorizados por el slo hecho de utilizar los
diferentes mdulos del SEACE.
VIII. DISPOSICIONES ESPECFICAS
8.1. DE LA ESTRUCTURA DEL CERTIFICADO SEACE
8.1.1. Para las Entidades Pblicas Contratantes:
El Certificado SEACE que les otorga el OSCE consta de dos
(02) elementos:
a) Cdigo del usuario: Compuesto por:
&yGLJRGHOD(QWLGDG1~PHURTXHOHDVLJQDHO6($&(
a cada Entidad Pblica Contratante; y
'1,GHOIXQFLRQDULRXVXDULR
b) Contrasea: Cadena de caracteres alfanumricos
autogenerada por el SEACE.
8.1.2. Para los rganos que ejercen control y fiscalizacin
(Incluye a los funcionarios-usuarios del rgano de Control
Institucional de la Entidad):
El Certificado SEACE que les otorga el OSCE consta de dos
(02) elementos:
a) Cdigo del usuario: Compuesto por:
&yGLJRGHOyUJDQRTXHHMHUFHFRQWURO\ILVFDOL]DFLyQ
Nmero que le asigna el SEACE a cada rgano que
ejerce control y fiscalizacin; y
'1,GHOIXQFLRQDULRXVXDULR
b) Contrasea: Cadena de caracteres alfanumricos
autogenerada por el SEACE.
8.1.3. Para el OSCE:
El Certificado SEACE que les otorga el OSCE consta de dos
(02) elementos:
ANEXOS
272
a) Cdigo del usuario: Compuesto por:
&yGLJRGHOD(QWLGDG1~PHURTXHOHDVLJQDHO6($&(
al OSCE; y
'1,GHOIXQFLRQDULRXVXDULR
b) Contrasea: Cadena de caracteres alfanumricos
autogenerada por el SEACE.
8.1.4. Para los proveedores del Estado:
El Certificado SEACE que les otorga el OSCE consta de dos
(02) elementos:
a) Cdigo del usuario: Segn el tipo de proveedor:
3HUVRQDVQDWXUDOHVRMXUtGLFDVQDFLRQDOHVLQVFULWDVHQ
el RNP: Nmero de RUC.
3HUVRQDVQDWXUDOHVRMXUtGLFDVH[WUDQMHUDVLQVFULWDVHQ
el RNP: Nmero asignado por el OSCE al momento
de su inscripcin.
3URYHHGRUHVH[FHSWXDGRVGHLQVFULELUVHHQHO513
Nmero de RUC.

b) Contrasea: Cadena de caracteres alfanumricos
autogenerada por el RNP.
8.1.5. Para los rbitros:
El Certificado SEACE de los rbitros consta de dos (02)
elementos:
a) Cdigo del usuario:
1~PHURGH58&
b) Contrasea: Cadena de caracteres alfanumricos
autogenerada por el SEACE.
8.2. PERFILES Y ATRIBUTOS QUE SE PUEDEN ASIGNAR A LOS
USUARIOS DEL SEACE
En la solicitud remitida al OSCE para la creacin y asignacin del
Certificado SEACE, debe indicarse el o los perfiles que contendr el
Certificado SEACE a ser asignado al funcionario-usuario autorizado por
el solicitante.
Los perfiles que se pueden asignar a los usuarios del SEACE y sus
correspondientes atributos, son los establecidos en el Anexo N 1 de la
GLUHFWLYDGHQRPLQDGR/LVWDGHSHUILOHV\VXVFRUUHVSRQGLHQWHVDWULEXWRV
273
ANEXOS
8.3. DEL PROCEDIMIENTO PARA OBTENER, ACTUALIZAR Y
DESACTIVAR EL CERTIFICADO SEACE
8.3.1. Del procedimiento para obtener el Certificado SEACE:
a) Entidades Pblicas Contratantes:
(OWLWXODUGHOD(QWLGDGRHOIXQFLRQDULRS~EOLFRIDFXOWDGR
para tal efecto, es el responsable de solicitar a la
Sub Direccin de Plataforma de la Direccin del
SEACE la emisin del Certificado SEACE de aquellos
funcionarios-usuarios que se encuentran autorizados
para registrar informacin en el SEACE.
Para este efecto, se debe utilizar el formulario
adjunto en el Anexo N 2 de la directiva que se
encuentra publicado en los portales web del OSCE
y del SEACE, www.osce.gob.pe y www.seace.gob.
pe, respectivamente, en el cual debern consignar
la totalidad de datos requeridos en forma legible e
indicar el/los perfiles a asignarse al funcionario-usuario
autorizado, segn lo detallado en el Anexo N 1 de la
directiva.
Dicha solicitud debe presentarse ante la Unidad de
Atencin al Usuario de la Sede Central del OSCE
o en sus Oficinas Zonales, pudiendo enviarse va
correo electrnico o facsmil. En caso la solicitud sea
remitida va correo electrnico o facsmil, la Entidad
debe presentar la solicitud formalmente (en fsico)
dentro del tercer da hbil de remitida, con lo cual se
la tendr como presentada en la fecha de envo a
travs del medio de transmisin de datos utilizado.
Este procedimiento resulta tambin aplicable a los
rganos que ejercen funcin de control y fiscalizacin,
conforme a la definicin sealada en el numeral VI)
de la presente directiva.
5HFLELGD OD VROLFLWXG SUHVHQWDGD DQWH HO 26&( HO
SEACE crear y enviar al correo electrnico del
funcionario-usuario autorizado su Certificado SEACE,
informndole los perfiles asignados. La recepcin del
Certificado SEACE habilita al funcionario-usuario para
interactuar en el sistema, sin necesidad de algn tipo
de confirmacin o validacin adicional.
ANEXOS
274
b) Proveedores del Estado
/DV SHUVRQDV QDWXUDOHV R MXUtGLFDV QDFLRQDOHV R
extranjeras a quienes les corresponda inscribirse en
el RNP obtendrn su Certificado SEACE al realizar el
trmite de su inscripcin.
La recepcin del Certificado SEACE habilita a los
proveedores para interactuar en el sistema, sin
necesidad de algn tipo de confirmacin o validacin
adicional.
/DV(QWLGDGHV3~EOLFDVUHJLVWUDGDVHQHO5(&TXH
deseen participar como proveedores en procesos de
seleccin convocados por otras Entidades Pblicas,
debern solicitar a la Sub Direccin de Plataforma de
la Direccin del SEACE la emisin de su Certificado
SEACE (Creacin de usuario como proveedor para
Entidad Pblica registrada en el REC).
Para tal efecto, el Titular de la Entidad Pblica o
el funcionario pblico facultado, debe presentar
la solicitud respectiva ante la Unidad de Atencin
al Usuario de la Sede Central del OSCE o en sus
Oficinas Zonales, indicando su inters de participar
como proveedor del Estado, asimismo, debe
consignar el nombre completo, el nmero de D.N.I
y el correo electrnico del funcionario-usuario que
ser responsable del usuario y contrasea para la
participacin de su Entidad en procesos de seleccin.
La recepcin del Certificado SEACE habilita al
funcionario-usuario para interactuar en el sistema, sin
necesidad de algn tipo de confirmacin o validacin
adicional.
Dicha solicitud tambin podr enviarse va correo
electrnico o facsmil. En caso la solicitud sea remitida
va correo electrnico o facsmil, la Entidad debe
presentar la solicitud formalmente (en fsico) dentro
del tercer da hbil de remitida, con lo cual se la tendr
como presentada en la fecha de envo a travs del
medio de transmisin de datos utilizado.
/RV SURYHHGRUHV H[FHSWXDGRV GH LQVFULELUVH HQ HO
RNP comprendidos en el artculo 256 del Reglamento
debern tramitar ante la Sub Direccin de Operaciones
Registrales de la Direccin del Registro Nacional de
275
ANEXOS
Proveedores la emisin de sus Certificados SEACE
(Creacin de usuario para proveedor exceptuado).
Para este efecto, se debe utilizar el formulario que se
encuentra publicado en el portal web del RNP www.
rnp.gob.pe, consignar la informacin solicitada y
presentarlo ante la Unidad de Atencin al Usuario de
la Sede Central del OSCE o en sus Oficinas Zonales.
La recepcin del Certificado SEACE habilita a los
proveedores para interactuar en el sistema, sin
necesidad de algn tipo de confirmacin o validacin
adicional.
El perfil asignado a los proveedores y sus
correspondientes atributos se encuentran detallados
en el Anexo N 1 de la presente directiva.
c) rbitros
Los rbitros que hayan sido designados como presidente del
tribunal arbitral o rbitro nico en procedimientos arbitrales en
el marco de la normativa de contrataciones del Estado, podrn
solicitar ante el OSCE la creacin del Certificado SEACE, a fin
de acceder al sistema para registrar los laudos, as como sus
integraciones, exclusiones, interpretaciones y rectificaciones, y
otras resoluciones arbitrales.
Para tal efecto, la Entidad contratante debe registrar previamente
en el SEACE la existencia de la controversia sometida a arbitraje
e indicar los nombres y apellidos completos del rbitro nico o
de los rbitros que conforman el tribunal arbitral, as como de
aquellos que eventualmente sustituyan a estos.
Para la solicitud que formulen los rbitros, se debe utilizar el
formulario adjunto en Anexo N 3 de la directiva que se encuentra
publicado en los portales web del OSCE y del SEACE, www.
osce.gob.pe y www.seace.gob.pe, respectivamente.
Dicha solicitud debe presentarse ante la Unidad de Atencin al
Usuario de la Sede Central del OSCE o en sus Oficinas Zonales,
pudiendo enviarse va correo electrnico o facsmil. En caso la
solicitud sea remitida va correo electrnico o facsmil, el rbitro
que haya sido designado como presidente del tribunal arbitral o
rbitro nico debe presentar la solicitud formalmente (en fsico)
dentro del tercer da hbil de remitida, con lo cual se la tendr
como presentada en la fecha de envo a travs del medio de
transmisin de datos utilizado.
ANEXOS
276
8.3.2. Del procedimiento para actualizar datos y solicitar la
asignacin y/o retiro de Perfiles al Certificado SEACE
otorgado.
/D DFWXDOL]DFLyQ GH GDWRV GHO &HUWLILFDGR 6($&( GH
los funcionarios-usuarios de las Entidades Pblicas
Contratantes, de los rganos que ejercen funcin de control
y fiscalizacin, del OSCE y rbitros se debe realizar a
WUDYpVGHODILFKD$FWXDOL]DU'DWRVXELFDGDHQHOVXEPHQ~
0RGLILFDFLyQGH'DWRVGHO0yGXORGH8VXDULRVGHO6($&(
al cual se accede ingresando con su cdigo de usuario y
contrasea del SEACE. En la ficha mostrada por el sistema
el funcionario-usuario deber actualizar cuando corresponda
la siguiente informacin: Cargo, correo electrnico, telfono,
nombre del rgano desconcentrado o unidad operativa,
direccin del rgano desconcentrado o unidad operativa,
ubicacin geogrfica del rgano desconcentrado o unidad
operativa.
En aquellos casos en que por restricciones de acceso al
sistema, los funcionarios-usuarios de las Entidades Pblicas
Contratantes y de los rganos que ejercen funcin de control
y fiscalizacin, no puedan modificar sus datos directamente
en el SEACE, podrn solicitar la actualizacin de sus datos,
utilizando el formulario adjunto en el Anexo N 2 de la
directiva que se encuentra publicado en los portales web
del OSCE y del SEACE, www.osce.gob.pe y www.seace.
gob.pe, respectivamente, en el cual debern consignar la
totalidad de datos requeridos en forma legible. Para el caso
de los rbitros debern utilizar el formulario adjunto en el
Anexo N 3.
/D DVLJQDFLyQ \R UHWLUR GH SHUILOHV DO &HUWLILFDGR 6($&(
otorgado a los funcionarios-usuarios de las Entidades
Pblicas Contratantes y de los rganos que ejercen funcin
de control y fiscalizacin, se realizar a travs de la solicitud
que presente el Titular de la Entidad o el funcionario pblico
facultado para tal efecto, a la Sub Direccin de Plataforma
de la Direccin del SEACE.
277
ANEXOS
Para este efecto, debern utilizar el formulario del Anexo N
2 de la directiva en el que debern consignar la totalidad de
datos requeridos e indicar el/los perfiles que se asignarn
o retirarn al funcionario-usuario, segn lo detallado en
el Anexo N 1 de la presente directiva. El formulario se
encuentra publicado en los portales web del OSCE y
del SEACE, www.osce.gob.pe y www.seace.gob.pe,
respectivamente.
(QDPERVFDVRVODVVROLFLWXGHVGHEHQSUHVHQWDUVHDQWHOD
Unidad de Atencin al Usuario de la Sede Central del OSCE
o en sus Oficinas Zonales, pudiendo enviarse va correo
electrnico o facsmil. En caso la solicitud sea remitida va
correo electrnico o facsmil, la Entidad debe presentar la
solicitud formalmente (en fsico) dentro del tercer da hbil
de remitida, con lo cual se la tendr como presentada en la
fecha de envo a travs del medio de transmisin de datos
utilizado.
8.3.3. Del procedimiento para desactivar el Certificado SEACE.
(O7LWXODUGHOD(QWLGDGRHOIXQFLRQDULRS~EOLFRIDFXOWDGRHV
el responsable de solicitar a la Sub Direccin de Plataforma
de la Direccin del SEACE la desactivacin del Certificado
SEACE de aquellos funcionarios-usuarios de las Entidades
Pblicas Contratantes y de los rganos que ejercen
funcin de control y fiscalizacin que ya no se encuentran
autorizados a registrar informacin en el SEACE. Para
este efecto, debe utilizar el formulario del Anexo N 2 de la
directiva, consignando la totalidad de datos requeridos en
forma legible.
(QHOFDVRGHORViUELWURVFRUUHVSRQGHDORViUELWURVTXH
hayan sido designados como presidente del tribunal arbitral o
rbitro nico, solicitar a la Sub Direccin de Plataforma de la
Direccin del SEACE la desactivacin del Certificado SEACE
cuando haya determinado que no efectuar uso del mismo.
Para este efecto, debe utilizar el formulario del Anexo N 3
de la directiva, consignando la totalidad de datos requeridos
en forma legible.
/RVPHQFLRQDGRVIRUPXODULRVVHHQFXHQWUDQSXEOLFDGRVHQ
los portales web del OSCE y del SEACE, www.osce.gob.pe
y www.seace.gob.pe, respectivamente.
Las solicitudes de desactivacin del Certificado SEACE
ANEXOS
278
deben presentarse ante la Unidad de Atencin al Usuario
de la Sede Central del OSCE o en sus Oficinas Zonales,
pudiendo enviarse va correo electrnico o facsmil. En caso
la solicitud sea remitida va correo electrnico o facsmil, la
Entidad o el rbitro, debe presentarla formalmente (en fsico)
dentro del tercer da hbil de remitida, con lo cual se la tendr
como presentada en la fecha de envo a travs del medio
de transmisin de datos utilizado.
8.4. DE LA RESPONSABILIDAD DEL USO DEL CERTIFICADO SEACE
a) El Certificado SEACE es de carcter personal e intransferible.

b) Los funcionarios-usuarios y otros usuarios autorizados son
responsables de verificar que la informacin que registran
en el SEACE es idntica a la informacin que se tiene como
documento final aprobado para la realizacin de cualquier
acto en el proceso de contratacin, bajo responsabilidad del
funcionario que hubiese solicitado la activacin del Certificado
SEACE y de aqul que hubiera registrado la informacin.
En el caso de los rbitros que hayan sido designados como
presidente del tribunal arbitral o rbitro nico, son responsables
de verificar que la informacin del laudo arbitral, as como sus
integraciones, exclusiones, interpretaciones y rectificaciones, y
otras resoluciones arbitrales que se registran en el SEACE sea
idntica a la del original suscrito por el o los respectivos rbitros,
bajo responsabilidad del rbitro nico o del presidente del tribunal
arbitral encargado de su registro.
c) La informacin registrada por los funcionarios-usuarios y otros
usuarios autorizados tiene carcter de declaracin jurada y est
sujeta a las responsabilidades legales correspondientes.
d) El registro de informacin en el SEACE no implica la convalidacin
o conformidad de los actos y datos reportados que no se cian
a lo dispuesto en la normativa vigente sobre contrataciones del
Estado.
e) En caso se detecten defectos, omisiones y/o fraude en la
informacin reportada o el uso indebido del sistema por parte de
los funcionarios-usuarios, el Titular de la Entidad o el funcionario
pblico facultado que solicit la emisin del Certificado SEACE
y el funcionario-usuario autorizado asumirn la responsabilidad
que les asiste, conforme a la normativa vigente, sin perjuicio de
poner el caso en conocimiento de la Contralora General de la
Repblica.
279
ANEXOS
f) En caso se detecten defectos, omisiones y/o fraude en la
informacin reportada o el uso indebido del sistema por parte de
un proveedor del Estado, de un rbitro u otro usuario autorizado,
ste asumir la responsabilidad que le asiste, conforme a la
normativa vigente, sin perjuicio de poner el caso en conocimiento
del Tribunal de Contrataciones del Estado o de la Procuradura
Pblica del OSCE, segn corresponda.
8.5. POLTICA DE SEGURIDAD
Todo funcionario-usuario de las Entidades Pblicas Contratantes,
rganos que ejercen funcin de control y fiscalizacin, rbitros y otros
usuarios autorizados debern efectuar el cambio de la contrasea de su
Certificado SEACE cada cuatro (4) meses, para lo cual podrn utilizar una
combinacin de smbolos, nmeros y letras. Tratndose de proveedores
debern efectuar el cambio de su contrasea de su Certificado SEACE
(Clave RNP) cada seis (6) meses, para lo cual tambin podrn utilizar
una combinacin de smbolos, nmeros y letras. En ambos casos, de no
realizar el cambio dentro de los plazos sealados, no podrn acceder
al sistema.
Los proveedores que se encuentran inhabilitados para contratar con el
Estado no podrn interactuar en el Mdulo de Transacciones Electrnicas
al cual acceden con su Certificado SEACE, el cual contiene los mdulos
de Procesos Electrnicos y Convenio Marco. Similar restriccin opera
para los proveedores que no cuentan con inscripcin vigente en el RNP.
IX. DISPOSICION TRANSITORIA
A fin de mejorar el servicio de obtencin, actualizacin y desactivacin del
Certificado SEACE y mantener actualizada la informacin de la Entidad incluida
en el REC, OSCE solicitar a las entidades incluidas en el REC la designacin
GHXQDSHUVRQDDTXLHQVHOHDVLJQDUiHOUROGH$GPLQLVWUDGRUGHOD(QWLGDGDO
cual se le asignar permisos especiales para la auto gestin del servicio antes
sealado.
El OSCE comunicar la implementacin de la presente disposicin transitoria,
mediante el aviso correspondiente en los portales web del OSCE y del SEACE,
www.osce.gob.pe y www.seace.gob.pe, respectivamente.
X. DISPOSICION FINAL
1. La presente directiva se actualizar, de acuerdo a las modificaciones y/o
adiciones que realice la Sub Direccin de Plataforma de la Direccin del
SEACE, a los perfiles y atributos correspondientes consignados en el Anexo
ANEXOS
280
N 1, as como a los datos requeridos en el Anexo N 2 y Anexo N 3. El
OSCE pondr en conocimiento de los usuarios, a travs del comunicado
que se emita y publique para tal efecto en los portales web del OSCE y del
SEACE, www.osce.gob.pe y www.seace.gob.pe, respectivamente.
2. La presente directiva regir a partir de la entrada en vigencia de la Ley
N 29873, que modifica la Ley de Contrataciones del Estado y el Decreto
Supremo N 138-2012-EF, que modifica el Reglamento de la Ley de
Contrataciones del Estado.
-HV~V0DUtDVHWLHPEUHGH

281
ANEXOS
ANEXO N 1
LISTA DE PERFILES Y SUS CORRESPONDIENTES ATRIBUTOS
LISTA DE PERFILES:
A) Perfiles de las Entidades Pblicas Contratantes
1. Administrador REC de la Entidad.
2. Operador del PAC.
3. Operador de Procesos de Seleccin.
4. Operador de Procedimientos Especiales.
5. Operador de Contrataciones de 1 a 3 UIT.
6. Operador de Compras por Catlogo.
7. Operador de Notificaciones de Entidad.
8. Operador de Contratos.
B) Perfil de los rganos que ejercen control y fiscalizacin
1. Funcionario-Usuario de Control y Fiscalizacin.
2. Funcionario-Usuario OCI de la Entidad.
C) Perfil de rbitros
1. Operador de registro de Laudos y otras resoluciones arbitrales.

D) Perfiles de los funcionarios-usuarios del OSCE
1. Acceso al Mdulo del Plan Anual.
2. Acceso al Mdulo de Procesos de Seleccin.
3. Acceso al Mdulo de Procedimientos Especiales.
4. Acceso al Mdulo de Contratos
5. Acceso al Mdulo de Convenio Marco
6. Acceso al Mdulo de Gestin de Fichas Tcnicas de Subasta.
7. Acceso al Modulo de Contrataciones de 1 a 3 UIT.
8. Operador de Pronunciamientos del OSCE.
9. Operador de Resoluciones /Acuerdos del Tribunal.
10. Operador de Notificaciones del SEACE.
11. Operador de Traduccin de Fichas de Convocatorias
12. Administrador de REC.
13. Administrador de Usuarios del SEACE.
14. Administrador de Proveedores Exceptuados del RNP.
15. Administrador de CUBSO.
ANEXOS
282
16. Administrador Gestin de Fichas Tcnicas para Subasta.
17. Administrador de Catlogo Electrnico de Convenio Marco.
18. Administrador de Procesos de Convenio Marco.
19. Operador de suspensin de procesos y no emisin de constancias.
20. Usuario observador del SEACE.
E) Perfil de los proveedores del Estado
1. Operador Participacin en Transacciones Electrnicas
PERFILES Y SUS CORRESPONDIENTES ATRIBUTOS:
A) Perfiles de las Entidades Pblicas Contratantes
Los atributos de acuerdo al perfil que pueden asumir los funcionarios-usuarios
de una Entidad Pblica Contratante son los siguientes:
1. Administrador REC de la Entidad
Registrar y visualizar los Datos de la Entidad;
5HJLVWUDU\YLVXDOL]DUHOQ~PHURWRWDOGHSHUVRQDOTXHODERUDHQHO
rgano Encargado de las Contrataciones (OEC);
5HJLVWUDU\YLVXDOL]DUODUHODFLyQGHOSHUVRQDOTXHODERUDHQHOUJDQR
Encargado de las Contrataciones (OEC); y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo REC del SEACE.
2. Operador de PAC
5HJLVWUDU\YLVXDOL]DUHO3UHVXSXHVWR,QLFLDOGH$SHUWXUD3,$
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHDSUREDFLyQ
del PAC;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHDSUREDFLyQ
de las modificaciones al PAC;
9LVXDOL]DUORVSURFHVRVSURJUDPDGRVDVtFRPRHOKLVWRULDOGHOWRWDO
de procesos, de las modificaciones y de las versiones; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo del Plan Anual del SEACE.
3. Operador de Procesos de Seleccin
5HJLVWUDU\YLVXDOL]DUODFRQYRFDWRULDGHSURFHVRVGHVHOHFFLyQ
5HJLVWUDU \ YLVXDOL]DU OD FRQIRUPDFLyQ GHO &RPLWp (VSHFLDO R HO
rgano Encargado de las Contrataciones de la Entidad, segn
corresponda;
5HJLVWUDU\YLVXDOL]DUDORVSDUWLFLSDQWHV
283
ANEXOS
5HJLVWUDU \ YLVXDOL]DU ORV GRFXPHQWRV DVRFLDGRV DO SURFHVR GH
seleccin;
5HJLVWUDU\YLVXDOL]DUODVSURSXHVWDVSUHVHQWDGDV
$EULU\YLVXDOL]DUSURSXHVWDVRVREUHVGHKDELOLWDFLyQSUHVHQWDGDV
electrnicamente;
9LVXDOL]DUODPHMRUDGHSUHFLRV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVGHUHVXOWDGRV
de procesos de seleccin;
5HJLVWUDU\YLVXDOL]DU3URQXQFLDPLHQWRV\5HVROXFLRQHVGH$SHODFLyQ
de la Entidad;
5HJLVWUDU\YLVXDOL]DUHOFRQVHQWLPLHQWRGHOD%XHQD3UR
5HJLVWUDU\YLVXDOL]DUODVSRVWHUJDFLRQHVGHOSURFHVR
5HJLVWUDU\YLVXDOL]DUODVDFFLRQHVFRQODFRQYRFDWRULD\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Procesos del SEACE.
4. Operador de Procedimientos Especiales
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRV
a Exoneraciones;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRV
a contrataciones en mrito a convenios y contratos de prstamos y
donaciones;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRV
a Contratos Internacionales;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRVD
contrataciones en mrito a Regmenes Especiales cualquiera fuese
su rgimen legal o su fuente de financiamiento al que se sujeta; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Procedimientos Especiales del SEACE.
5. Operador de Contratos de 1 a 3 UIT
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRV
a contratos de 1 a 3 UIT; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Contratos de 1 a 3 UIT.
6. Operador de Compras por Catlogo
6HOHFFLRQDUtWHPVSDUDHOFDUULWRGHFRPSUD
5HVSHFWRDODVVROLFLWXGHVGH&RWL]DFLyQ&UHDUPRGLILFDUYLVXDOL]DU
enviar al proveedor, anular y recuperar solicitudes de cotizacin;
5HVSHFWR D ODV UGHQHV GH &RPSUD \R GH 6HUYLFLR &UHDU
modificar, visualizar, anular, asociar / desasociar al Plan Anual de
Contrataciones (PAC), notificar al proveedor, registrar la fecha de
ANEXOS
284
recepcin, registrar contratos u rdenes de compras o de servicios;
y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Compras por Catlogo del SEACE.
7. Operador de Notificaciones de Entidad
'DUSRUUHFLELGDVODVQRWLILFDFLRQHVUHPLWLGDVDWUDYpVGHO6($&(
por la Direccin de Supervisin, Fiscalizacin y Estudios del OSCE;
'DUUHVSXHVWDDODVQRWLILFDFLRQHVUHPLWLGDVDWUDYpVGHO6($&(SRU
la Direccin de Supervisin, Fiscalizacin y Estudios del OSCE; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en los Mdulos del SEACE en donde se publican notificaciones.
8. Operador de Contratos
5HJLVWUDU \ YLVXDOL]DU OD LQIRUPDFLyQ \ HO GRFXPHQWR GH OD RUGHQ
de compra o servicio recepcionada o el contrato suscrito,
correspondiente a cualquier rgimen legal o su fuente de
financiamiento al que se sujet la contratacin;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODVJDUDQWtDV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODQXOLGDG
del contrato; y
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODUHVROXFLyQ
del contrato;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHORVDGHODQWRV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHORVDGLFLRQDOHV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHODVUHGXFFLRQHV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHODDPSOLDFLyQGHOSOD]R
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHODVSUyUURJDV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODLQWHUYHQFLyQ
econmica;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHODVSHQDOLGDGHV
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODFRQIRUPLGDG
o liquidacin del contrato;
5HJLVWUDU\YLVXDOL]DUODLQIRUPDFLyQGHORVFRQWUDWRVFRPSOHPHQWDULRV
y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Contratos del SEACE.
B) Perfil de los rganos que ejercen Control y Fiscalizacin
Los atributos de acuerdo al perfil que pueden asumir los funcionarios-usuarios
de un rgano que ejerce funcin de control y fiscalizacin son los siguientes:
285
ANEXOS
1. Funcionario-Usuario de Control y Fiscalizacin
9LVXDOL]DUODLQIRUPDFLyQ\GRFXPHQWRVUHJLVWUDGRVHQORV0yGXORV
de Plan Anual, Procesos de Seleccin, Procedimientos Especiales,
Contratos y Convenio Marco de todas las Entidades Pblicas
Contratantes, as como la relacin de usuarios de la Entidad
seleccionada.
2. Funcionario-Usuario OCI de la Entidad
9LVXDOL]DUODLQIRUPDFLyQ\GRFXPHQWRVUHJLVWUDGRVHQORV0yGXORV
de Plan Anual, Procesos de Seleccin, Procedimientos Especiales,
Contratos y Convenio Marco de su Entidad Pblica Contratante, as
como la relacin de usuarios de la Entidad.
C) Perfil de rbitros
1. Operador de registro de Laudos y otras resoluciones arbitrales
9LVXDOL]DUODILFKDGHDTXHOORVFRQWUDWRVFX\DFRQWURYHUVLDHVWpD
su cargo en su condicin de presidente del tribunal arbitral o rbitro
nico, segn corresponda;
5HJLVWUDU/DXGRV\RWUDVUHVROXFLRQHVHQODFRQWURYHUVLDTXHHVWpD
su cargo en su condicin de presidente del tribunal arbitral o rbitro
nico, segn corresponda; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
HQHOVXEPHQ~/DXGRVGHO0yGXORGH&RQWUDWRVGHO6($&(
D) Perfiles de los funcionarios-usuarios del OSCE
Los atributos de acuerdo al perfil que pueden asumir los funcionarios-usuarios
del OSCE son los siguientes:
1. Acceso al Mdulo del Plan Anual
9LVXDOL]DUHOUHJLVWURGHO3UHVXSXHVWR,QLFLDOGH$SHUWXUD3,$GH
todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHDSUREDFLyQGHO3$&GH
todas las Entidades;
9LVXDOL]DU OD LQIRUPDFLyQ \ HO GRFXPHQWR GH DSUREDFLyQ GH ODV
modificaciones al PAC de todas las Entidades;
9LVXDOL]DUORVSURFHVRVSURJUDPDGRVDVtFRPRHOKLVWRULDOGHOWRWDO
de procesos, de las modificaciones y de las versiones de todas las
Entidades; y,
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
ANEXOS
286
en el Mdulo del Plan Anual del SEACE relacionadas a los perfiles
del OSCE.
2. Acceso al Mdulo de Procesos de Seleccin
9LVXDOL]DUODLQIRUPDFLyQ\GRFXPHQWRVGHORVSURFHVRVGHVHOHFFLyQ
de todas las Entidades; y,
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Procesos de Seleccin del SEACE relacionadas a
los perfiles del OSCE.
3. Acceso al Mdulo de Procedimientos Especiales
9LVXDOL]DU OD LQIRUPDFLyQ \ ORV GRFXPHQWRV UHODFLRQDGRV D
exoneraciones de todas las Entidades;
9LVXDOL]DU OD LQIRUPDFLyQ \ ORV GRFXPHQWRV UHODFLRQDGRV D
contrataciones en mrito a convenios y contratos de prstamos y
donaciones de todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQ\ORVGRFXPHQWRVUHODFLRQDGRVDFRQWUDWRV
internacionales de todas las Entidades;
9LVXDOL]DU OD LQIRUPDFLyQ \ ORV GRFXPHQWRV UHODFLRQDGRV D
contrataciones bajo Regmenes Especiales cualquiera fuese su
rgimen legal o su fuente de financiamiento de todas las Entidades;
y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Procedimientos Especiales del SEACE relacionadas
a los perfiles del OSCE.
4. Acceso al Mdulo de Contratos
9LVXDOL]DU OD LQIRUPDFLyQ \ HO GRFXPHQWR GH OD RUGHQ GH FRPSUD
o servicio recepcionada o el contrato suscrito correspondiente a
cualquier rgimen legal o su fuente de financiamiento de todas las
Entidades;
9LVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODVJDUDQWtDVGHWRGDV
las Entidades;
9LVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODQXOLGDGGHOFRQWUDWR
de todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQ\HOGRFXPHQWRGHODUHVROXFLyQGHOFRQWUDWR
de todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQGHORVDGHODQWRVGHWRGDVODV(QWLGDGHV
9LVXDOL]DUODLQIRUPDFLyQGHORVDGLFLRQDOHVGHWRGDVODV(QWLGDGHV
9LVXDOL]DUODLQIRUPDFLyQGHODVUHGXFFLRQHVGHWRGDVODV(QWLGDGHV
9LVXDOL]DU OD LQIRUPDFLyQ GH OD DPSOLDFLyQ GHO SOD]R GH WRGDV ODV
Entidades;
9LVXDOL]DUODLQIRUPDFLyQGHODVSUyUURJDVGHWRGDVODV(QWLGDGHV
287
ANEXOS
9LVXDOL]DU OD LQIRUPDFLyQ \ HO GRFXPHQWR GH OD LQWHUYHQFLyQ
econmica de todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQGHODVSHQDOLGDGHVGHWRGDVODV(QWLGDGHV
9LVXDOL]DU OD LQIRUPDFLyQ \ HO GRFXPHQWR GH OD FRQIRUPLGDG R
liquidacin del contrato de todas las Entidades;
9LVXDOL]DUODLQIRUPDFLyQGHORVFRQWUDWRVFRPSOHPHQWDULRVGHWRGDV
las Entidades; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Contratos del SEACE relacionadas a los perfiles
del OSCE.
5. Acceso al Mdulo de Convenio Marco
3HUPLWD YLVXDOL]DU UHSRUWHV GH FRPSUDV GH &RQYHQLR 0DUFR GH
diversas Entidades Pblicas con la siguiente informacin: RUC del
Proveedor, Proveedor, RUC Entidad, Entidad, Documento, Estado
del Documento, Fecha del Documento, Fecha del Ultimo Estado,
Plazo de Entrega, Destino Sub Total (S/.), Descuento (S/.), Flete (S/.),
Monto IGV (S/.), Monto Total (S/.) y Orden de Compra (documento
fsico); y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Convenio Marco del SEACE relacionadas a los
perfiles del OSCE.
6. Acceso al Mdulo de Gestin de Fichas Tcnicas de Subasta
9LVXDOL]DUODLQIRUPDFLyQGHO/LVWDGRGH%LHQHV&RPXQHV\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Gestin de Fichas Tcnicas de Subasta del SEACE
relacionadas a los perfiles del OSCE.
7. Acceso al Mdulo de Contratacin de 1 a 3 UIT
9LVXDOL]DU OD LQIRUPDFLyQ \ ORV GRFXPHQWRV UHODFLRQDGRV D
contrataciones de 1 a 3 UIT de todas las Entidades; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Contratos de 1 a 3 UIT.
8. Operador de Pronunciamientos del OSCE
5HJLVWUDUORV3URQXQFLDPLHQWRVHPLWLGRVSRUHO26&(
5HJLVWUDUORVRILFLRVHPLWLGRVSRUHO26&(HQUHODFLyQDODVROLFLWXG
de elevacin de observaciones a la Bases; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el SEACE relacionadas con la elevacin de observaciones a las
Bases al OSCE.
ANEXOS
288
9. Operador de Resoluciones / Acuerdo del Tribunal
5HJLVWUDUODV5HVROXFLRQHVHPLWLGDVSRUHO7ULEXQDOGH&RQWUDWDFLRQHV
del Estado que resuelven los recursos de apelacin;
5HJLVWUDUORV$FXHUGRVHPLWLGRVSRUHO7ULEXQDOGH&RQWUDWDFLRQHV
del Estado; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
relacionadas con las funciones asignadas al Tribunal de
Contrataciones del Estado.
10. Operador de Notificaciones del OSCE
(PLWLU\HQYLDUQRWLILFDFLRQHVHOHFWUyQLFDV\PDQXDOHVDWUDYpVGHO
SEACE;
'DUSRUDWHQGLGDVGHPDQHUDSDUFLDORWRWDOODVUHVSXHVWDVGHODV
Entidades a las notificaciones enviadas a travs del SEACE;
'HMDUVLQHIHFWRODVQRWLILFDFLRQHVUHPLWLGDV\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Notificaciones del OSCE.
11. Operador de Traduccin de Fichas de Convocatorias

9LVXDOL]DUODLQIRUPDFLyQGHSURFHVRVGHVHOHFFLyQTXHVHHQFXHQWUHQ
bajo algn acuerdo comercial;
5HDOL]DUODWUDGXFFLyQGHODGHVFULSFLyQJHQHUDOGHOSURFHVR\GHORV
tems; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Acuerdos Comerciales.
12. Administrador del REC
5HJLVWUDU XQD (QWLGDG 3~EOLFD &RQWUDWDQWH HQ HO 5HJLVWUR GH
Entidades Contratantes (REC);
'HVDFWLYDU XQD (QWLGDG 3~EOLFD &RQWUDWDQWH HQ HO 5HJLVWUR GH
Entidades Contratantes (REC);
$FWXDOL]DU ORV GDWRV GH XQD (QWLGDG 3~EOLFD &RQWUDWDQWH HQ HO
Registro de Entidades Contratantes (REC);
9LVXDOL]DU\*HQHUDUUHSRUWHVGHSHUVRQDOGHO2(&\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo REC del SEACE.
13. Administrador de Usuario SEACE
5HJLVWUDU D ORV )XQFLRQDULRV8VXDULRV GH ODV (QWLGDGHV 3~EOLFDV
Contratantes;
5HJLVWUDUDORV)XQFLRQDULRV8VXDULRVGHODV(QWLGDGHVTXHHMHUFHQ
289
ANEXOS
funcin de control y fiscalizacin;
5HJLVWUDUDORV)XQFLRQDULR8VXDULRVGHO26&(
5HJLVWUDUDORVXVXDULRVUELWURVTXHRSHUDUDQORV/DXGRV\RWUDV
resoluciones arbitrales;
'HVDFWLYDUIXQFLRQDULRVXVXDULRV\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Usuarios del SEACE.
14. Administrador de Proveedores Exceptuados del RNP
5HJLVWUDU3URYHHGRUHV([FHSWXDGRVGHO513\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Proveedores Exceptuados del RNP.
15. Administrador del CUBSO
5HJLVWUDU \ DFWXDOL]DU HOHPHQWRV DO &DWiORJR QLFR GH %LHQHV
Servicios y Obras (CUBSO);
,QDFWLYDUHOHPHQWRVGHO&DWiORJRQLFRGH%LHQHV6HUYLFLRV\2EUDV
(CUBSO);
5HDOL]DUDFWXDOL]DFLRQHVGHQXHYDVYHUVLRQHVGHO&DWiORJRQLFR
de Bienes, Servicios y Obras; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en Mdulo CUBSO del SEACE.
16. Administrador Gestin de Fichas Tcnicas para Subasta Inversa
5HJLVWUDUSUR\HFWRVGHILFKDVWpFQLFDV
3XEOLFDUSUR\HFWRVGHILFKDVWpFQLFDVSDUDVXJHUHQFLDV
*HVWLRQDUVXJHUHQFLDVUHFLELGDV
5HJLVWUDU \ PRGLILFDU LQIRUPDFLyQ WpFQLFD GH SUR\HFWRV GH ILFKDV
tcnicas;
3XEOLFDUILFKDVWpFQLFDVDSUREDGDVHQHO/LVWDGRGHELHQHV\VHUYLFLRV
comunes;
$FWXDOL]DU\H[FOXLUILFKDVWpFQLFDVDSUREDGDV\
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo Administrador Gestin de fichas tcnicas para Subasta
Inversa.
17. Administrador de Catlogo Electrnico de Convenio Marco
$FFHVRDO&DWiORJR(OHFWUyQLFRGH&RQYHQLR0DUFR
5HDOL]DUODDFWXDOL]DFLyQ\PRGLILFDFLyQGHO&DWiORJR(OHFWUyQLFRGH
Convenio Marco; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Convenio Marco del SEACE.
ANEXOS
290
18. Administrador de Procesos de Convenio Marco
$FFHVRDODLQIRUPDFLyQGHORVSURYHHGRUHV\FDWiORJRVHQJHQHUDO
y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Convenio Marco del SEACE.
19. Operador de suspensin de procesos y no emisin de constancias
5HJLVWUDUODVXVSHQVLyQGHSURFHVRVGHVHOHFFLyQ
5HJLVWUDUODQRHPLVLyQWHPSRUDORGHILQLWLYDGH&RQVWDQFLDV
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Accin de Supervisin del SEACE.
20. Usuario observador del SEACE
9LVXDOL]DUODLQIRUPDFLyQ\GRFXPHQWRVUHJLVWUDGRVHQORV0yGXORV
de Plan Anual, Procesos de Seleccin, Procedimientos Especiales
y Contratos de todas las Entidades Pblicas Contratantes, as como
la relacin de usuarios de la Entidad seleccionada.
E) Perfil de los proveedores del Estado
Los atributos de acuerdo al perfil que pueden asumir los proveedores del
Estado al acceder al Mdulo de Transacciones Electrnicas son los siguientes:
1. Operador Participacin en Transacciones Electrnicas
%XVFDUSURFHVRVGHVHOHFFLyQHOHFWUyQLFRV
5HJLVWUDUVHHOHFWUyQLFDPHQWHFRPRSDUWLFLSDQWHHQHOSURFHVRGH
seleccin electrnico o clsico, cuando corresponda;
5HJLVWUDU\SUHVHQWDUSURSXHVWDVHOHFWUyQLFDPHQWHHQHOSURFHVR
de seleccin electrnico;
3DUWLFLSDU HQ OD PHMRUD GH SUHFLRV HQ SURFHVRV GH VHOHFFLyQ SRU
Subasta Inversa Electrnica;
5HDOL]DU PHMRUD GH FRQGLFLRQHV FRPHUFLDOHV GHO &DWiORJR GH
Electrnico de Convenio Marco;
*HVWLRQDUVROLFLWXGHVGHFRWL]DFLyQyUGHQHVHOHFWUyQLFDV\yUGHQHV
de compra o servicios en el marco del Catlogo Electrnico de
Convenio Marco; y
7RGDVODVGHPiVRSHUDFLRQHVLPSOHPHQWDGDVRSRULPSOHPHQWDUVH
en el Mdulo de Transacciones Electrnicas del SEACE.


291
ANEXOS

Prohibido modificar y/o adicionar campos al formulario.


1.
1
2
1
2
4
5
6
7
* De no contener sello y firma del solicitante podra carecer de veracidad.
_______________, de de
9
10
Operador de Proceso de Seleccin (Incluye registro de Pronunciamientos
y Resoluciones de Apelacin de la Entidad)
Funcionario-Usuario OCI de la Entidad (Slo para el personal de la
Oficina de Control Institucional de la Entidad)
8 Operador de Contratos
Debe ser llenado con letra imprenta
SOLICITUD DE ASIGNACIN, ACTUALIZACIN Y DESACTIVACIN DEL CERTIFICADO SEACE(*)
* (USUARIO Y CONTRASEA)
Operador de Contratos iguales o menor a 3 UIT
(***) Informacin de carcter obligatorio.
CARGO O FUNCIN QUE DESEMPEA
Operador de Compras por Catlogo
Operador de Notificaciones de Entidad
Operador de Procedimientos Especiales
5.- SOLICITO DESACTIVACIN DE USUARIO - DATOS DEL FUNCIONARIO USUARIO
Declaro bajo juramento que toda la informacin proporcionada es veraz, en caso contrario, me someto al procedimiento y a las sanciones previstas en la Ley N 27444 - Ley del Procedimiento Administrativo General.
NOMBRES Y APELLIDOS (COMPLETOS)
Administrador REC de la Entidad (Incluye actualizacin de Datos de la
Entidad as como informacin del personal)
USUARIO ADESACTIVAR
ANEXO N 2
CORREO ELECTRNICO
NOMBRES Y APELLIDOS (COMPLETOS)
(**) El usuario y la contrasea sern enviados va correo electrnico, por lo tanto se requiere que dicho dato sea legible y vlido.
D.N.I.
PERFIL (ES) DEL FUNCIONARIO-USUARIO
(indicar nmero (s) segn cuadro 1 2)
1.- DATOS DE LA ENTIDAD
R.U.C. SIGLAS (si corresponde)
2.- DATOS DEL SOLICITANTE (TITULAR DE LA ENTIDAD O FUNCIONARIO PBLICO COMPETENTE)
TELFONO
3.- SOLICITO CREACIN DE USUARIO - DATOS DEL FUNCIONARIO USUARIO
CORREO ELECTRNICO (**)
TELFONO/ANEXO:
DOMICILIO LEGAL
DIRECCIN DEL SEACE - SUBDIRECCIN DE PLATAFORMA
NOMBRE DE LA ENTIDAD
CARGO QUE DESEMPEAEN LAENTIDAD
FAX:
Urbanizacin: Distrito:
Mza: Lote:
Indicar el nmero de los
perfiles a retirar
NOMBRES Y APELLIDOS (COMPLETOS)
Int.:
D.N.I
Lote:
Distrito:
Av./Jr./Calle/Psje. :
Provincia: Departamento:
D.N.I
Provincia: Departamento:
CUADRO 1. PERFILES DE FUNCIONARIO-USUARIO
NOMBRES Y APELLIDOS (COMPLETOS) USUARIO ADESACTIVAR
TELFONO
NOMBRES Y APELLIDOS (COMPLETOS)
DSEACE-SDP-FOR-0001
(***) DIRECCIN DEL RGANO DESCONCENTRADO O UNIDAD OPERATIVAAL CUAL PERTENECE (si corresponde)
BASELEGAL: En conformidad con el Decreto Legislativo N 1017 - Ley de Contrataciones del Estado y el Decreto Supremo N 184-2008-EF- Reglamento de la Ley de Contrataciones del Estado.
Int.: Mza:
Operador de PAC
Pgina 1/1
CUADRO 2. PERFIL DE LOS RGANOS QUE EJERCEN CONTROL Y
FISCALIZACIN
Funcionario-Usuario de Control y Fiscalizacin (Slo para la Contralora
General de la Repblica y otras Entidades del Estado facultadas de realizar
esta funcin)
(***) NOMBRE DEL RGANO DESCONCENTRADO O UNIDAD OPERATIVAAL CUAL PERTENECE (si corresponde)
TELFONO
4.- SOLICITO ACTUALIZACION DE DATOS, ASIGNACIN Y/O RETIRO DE PERFILES DE ACCESO - DATOS DEL FUNCIONARIO USUARIO
PERFIL (ES) DEL FUNCIONARIO-USUARIO
(indicar nmero (s) segn cuadro 1 2 )
Sello y Firma del Titular de la Entidad o Funcionario Pblico competente
Nro.:
3
Av./Jr./Calle/Psje. : Nro.: Of.:
Of.:
Urbanizacin:
(**) El usuario y la contrasea sern enviados va correo electrnico, por lo tanto se requiere que dicho dato sea legible y vlido.
USUARIOOTORGADOPOR EL SEACE (Consignar el
usuario asignado para accesar a la vista privada del SEACE)
CORREOELECTRNICO(**)
Indicar el nmero de los
nuevos perfiles
ANEXOS
292

(Debe ser llenado con letra imprenta)


(*) Prohibido modificar y/o adicionar campos al formulario.
1.
Verificar los requisitos establecidos en el TUPAdel OSCE para esta solicitud.
1
2
* De no contener sello y firma del solicitante podra carecer de veracidad.
_______________, de de
NOMBRES Y APELLIDOS (COMPLETOS)
TELFONO (***) CORREO ELECTRNICO
LLENAR LAS SECCIONES 3 Y 4 SI USTED ELIGI EL PERFIL DEL USUARIO 2 (VER CUADRO 1. PERFIL DEL USUARIO).
2.- SOLICITO ACTUALIZACIN DE DATOS DEL PRESIDENTE ARBITRAL O RBITRO NICO
CUADRO 1. PERFIL DEL USUARIO
OTRO USUARIO AUTORIZADO A ACCEDER AL SEACE - NO APLICABLE PARA ENTIDAD PUBLICA (Solo
si existe Dispositivo Legal que faculte tener acceso al SEACE).
PRESIDENTE ARBITRAL O RBITRO NICO (Operador de registro de Laudos y otras resoluciones
arbitrales).
Urbanizacin: Distrito:
Av./Jr./Calle/Psje. :
NMERO DE
COLEGIATURA
Declaro bajo juramento que toda la informacin proporcionada es veraz, en caso contrario, me someto al procedimiento y a las sanciones previstas en la Ley N 27444 - Ley del
Procedimiento Administrativo General.
2.
TELFONO/ANEXO FAX: (***) CORREO ELECTRNICO
Lote:
COLEGIO DE
ABOGADOS
(**) D.N.I
(**) Informacin de carcter obligatorio.
Provincia: Departamento:
TELFONO (***) CORREO ELECTRNICO (**) R.U.C.
ANEXO N 3
SEALAR CON ASPA (X) EL PERFIL AL QUE USTED REPRESENTA.
LLENAR EL SIGUIENTE CUADRO SI USTED ELIGI EL PERFIL DEL USUARIO 1 (VER CUADRO 1. PERFIL DEL USUARIO)
DIRECCIN DEL SEACE - SUBDIRECCIN DE PLATAFORMA
SOLICITUD DE CREACIN Y/O DESACTIVACIN DE OTROS USUARIOS AUTORIZADOS A ACCEDER AL SEACE
4.- DATOS DEL USUARIO AUTORIZADO A ACCEDER AL SEACE
Departamento:
DOMICILIO LEGAL
NOMBRES Y APELLIDOS (COMPLETOS)
3.- DATOS DE LA ENTIDAD PRIVADA, NACIONAL O INTERNACIONAL RESPONSABLE DE LA SOLICITUD (NO
APLICABLE PARA ENTIDAD PUBLICA)
SIGLAS (si corresponde) R.U.C.
NOMBRES Y APELLIDOS (COMPLETOS)
Int.: Mza: Lote:
Urbanizacin: Distrito: Provincia:
TELFONO
DSEACE-SDP-FOR-0003
BASELEGAL: En conformidad con el Decreto Legislativo N 1017 - Ley de Contrataciones del Estado y el Decreto Supremo N 184-2008-EF- Reglamento de la Ley de Contrataciones del Estado.
Int.: Mza:
Av./Jr./Calle/Psje. : Nro.: Of.:
Sello y Firma del Solicitante
Pgina 1/1
(***) El usuario y la contrasea sern enviados va correo electrnico, por lo tanto se requiere que dicho dato sea legible y vlido.
1.- DATOS DEL PRESIDENTE ARBITRAL O RBITRO NICO
DOMICILIO LEGAL
NOMBRES Y APELLIDOS (COMPLETOS) D.N.I
Nro.: Of.: Lote:
USUARIOADESACTIVAR
USUARIOADESACTIVAR
5.- SOLICITO DESACTIVACIN DE USUARIO
NOMBRES Y APELLIDOS (COMPLETOS)
NOMBRES Y APELLIDOS (COMPLETOS)
293
ANEXOS
DIRECTIVA N 011-2012-OSCE/CD
PROCEDIMIENTO Y PLAZOS PARA LA INSCRIPCIN, RENOVACIN DE
INSCRIPCIN, AUMENTO DE CAPACIDAD MXIMA DE CONTRATACIN,
AMPLIACIN DE ESPECIALIDAD E INSCRIPCIN DE SUBCONTRATOS
DE EJECUTORES Y CONSULTORES DE OBRAS EN EL REGISTRO
NACIONAL DE PROVEEDORES (RNP)
I. FINALIDAD
Desarrollar los procedimientos y plazos para la inscripcin, renovacin de
inscripcin, aumento de capacidad mxima de contratacin, ampliacin de
especialidad e inscripcin de subcontratos de ejecutores y consultores de obras
en el Registro Nacional de Proveedores.
II. OBJETO
Regular los procedimientos realizados por los ejecutores y consultores de obras
sealados en los artculos 265 al 278 del Ttulo V del Reglamento de la Ley de
&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRSRU'HFUHWR6XSUHPR1()
III. ALCANCE
La presente Directiva es de aplicacin obligatoria para ejecutores y consultores
de obras nacionales, extranjeros domiciliados y extranjeros no domiciliados
con apoderado o representante legal, interesados en contratar con el Estado la
ejecucin y consultora de obras pblicas.
IV. BASE LEGAL
/H\ GH &RQWUDWDFLRQHV GHO (VWDGR DSUREDGD PHGLDQWH 'HFUHWR
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
Decreto Supremo N 184-2008-EF.
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado (OSCE), aprobado mediante Resolucin
Ministerial N 789-2011-EF/10.
/H\1/H\GHO3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
7H[WRQLFRGH3URFHGLPLHQWRV$GPLQLVWUDWLYRVGHO2UJDQLVPR6XSHUYLVRU
de las Contrataciones del Estado OSCE, aprobado por el Decreto
Supremo N 292-2009-EF.
'HFUHWR/HJLVODWLYR1/H\0DUFRSDUDHO&UHFLPLHQWRGHOD,QYHUVLyQ
Privada.
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
ANEXOS
294
V. REFERENCIAS
Ley: Ley de Contrataciones del Estado.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
Pgina web del RNP: www.rnp.gob.pe.
Proveedor: Ejecutor y/o consultor de obras.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
RENIEC: Registro Nacional de Identificacin y Estado Civil.
RNP: Registro Nacional de Proveedores.
SUNARP: Superintendencia Nacional de Registros Pblicos.
SUNAT: Superintendencia Nacional de Aduanas y de Administracin
Tributaria.
TUPA: Texto nico de Procedimientos Administrativos del OSCE.
VI. DISPOSICIONES GENERALES
6.1. CONSIDERACIONES PREVIAS
a) El proveedor, de acuerdo a las actividades que realiza, podr
inscribirse en el Registro de Ejecutores de Obras o en el Registro
de Consultores de Obras, segn corresponda.
b) Los procedimientos de inscripcin, renovacin, aumento de
capacidad mxima de contratacin, ampliacin de especialidad
e inscripcin de subcontratos en el Registro de Ejecutores de
Obras y en el Registro de Consultores de Obras, se califican
como procedimientos de evaluacin previa.
c) El proveedor podr efectuar el pago de la tasa correspondiente
en cualquiera de las entidades bancarias autorizadas, cuya
relacin se encuentra publicada en la pgina web del RNP.
d) Los proveedores no domiciliados con apoderado o representante
legal, debern efectuar el pago de la tasa nicamente en la Sede
Central del OSCE.
e) Los requisitos para los procedimientos de inscripcin, renovacin,
aumento de capacidad mxima de contratacin, ampliacin de
especialidad e inscripcin de subcontrato, estn establecidos
en el TUPA del OSCE, debiendo ser presentados en la Sede
Central o en cualquiera de las Oficinas Zonales del OSCE, en
forma personal o mediante correo postal.
f) El domicilio del proveedor nacional o extranjero domiciliado
es el que declar en la SUNAT y del proveedor extranjero no
domiciliado es aquel que declar en el formulario electrnico del
RNP.
6.2. NOTIFICACIONES
6.2.1. Las notificaciones de los procedimientos se remitirn a la bandeja
de mensajes del proveedor, para ello deber ingresar a la opcin
EDQGHMDGHPHQVDMHVGHODSiJLQDZHEGHO513FRQIRUPHD
lo siguiente:
3DUD DFFHGHU SRU SULPHUD YH] D VX EDQGHMD GH PHQVDMHV HO
proveedor nacional o extranjero domiciliado, deber ingresar
295
ANEXOS
su nmero de RUC y el nmero de voucher o constancia de
pago del Banco. Posteriormente, para acceder a su bandeja de
mensajes, deber ingresar con su nmero de RUC y la Clave
GHO513TXHOHVHUiQRWLILFDGDDGLFKDEDQGHMD
(O SURYHHGRU H[WUDQMHUR QR GRPLFLOLDGR GHEHUi LQJUHVDU D
su bandeja de mensajes con el Cdigo de extranjero no
GRPLFLOLDGR\OD&ODYHGHO513TXHOHDVLJQDUiHO513\TXH
ser entregada con el kit de usuario.
6.2.2. Las comunicaciones realizadas a travs de la bandeja de
mensajes del proveedor se entendern notificadas el mismo
da de su lectura, siendo obligacin de ste el permanente
seguimiento del trmite de su procedimiento.
6.2.3. Cuando en la presente Directiva se haga referencia al Usuario
1~PHURGH58&\ODFODYHGHO513HQORVWUiPLWHVVHJXLGRV
por proveedores nacionales y extranjeros domiciliados, debe
HQWHQGHUVH D HVWH GHWDOOH FRPR HO &HUWLILFDGR 6($&( HQ
aplicacin de lo dispuesto en el artculo 286 del Reglamento.
Asimismo, para los proveedores extranjeros no domiciliados el
&HUWLILFDGR6($&(HVWDUiFRQVWLWXLGRSRUHOXVXDULR&yGLJR
GHH[WUDQMHURQRGRPLFLOLDGR\ODFODYHGHO513
6.3. PLAZOS MXIMOS DEL PROCEDIMIENTO
6.3.1. El proveedor cuenta con los siguientes plazos mximos en
los procedimientos de inscripcin, renovacin, aumento de
capacidad mxima de contratacin, ampliacin de especialidad
e inscripcin de subcontratos:
(QHOFDVRGHLQVFULSFLyQ\UHQRYDFLyQSDUDHODFFHVRDO
formulario electrnico e ingreso de datos: un (1) ao contado
a partir del da siguiente de realizado el pago de la tasa.
3DUDODSUHVHQWDFLyQGHGRFXPHQWRV\RUHTXLVLWRVH[LJLGRV
por el TUPA del OSCE: un (1) ao contado a partir del da
siguiente de realizado el pago de la tasa.
3DUD OD VXEVDQDFLyQ GH ODV REVHUYDFLRQHV 'HEHUi
efectuarse dentro de los treinta (30) das hbiles siguientes
de haberse presentado la solicitud.
6.3.2. El RNP tiene como plazo mximo para la resolucin del trmite
de los procedimientos de inscripcin, renovacin, aumento de
capacidad mxima de contratacin, ampliacin de especialidad
e inscripcin de subcontratos, treinta (30) das hbiles contados
a partir del da hbil siguiente de presentados los documentos
y/o requisitos exigidos por el TUPA del OSCE. Cuando el
trmite sea subsanado en los ltimos cinco (5) das hbiles del
procedimiento, el plazo de resolucin del trmite se extender
por diez (10) das hbiles adicionales.
6.4. CONSTANCIA DE INSCRIPCIN EN EL RNP PARA SER
PARTICIPANTE Y POSTOR
Al da siguiente de presentada la solicitud con la documentacin que
ANEXOS
296
acredite los requisitos indicados en el TUPA del OSCE para los trmites
de inscripcin o renovacin de inscripcin, el proveedor podr acceder en
forma electrnica, a travs de la pgina web del RNP, a su Constancia
GHLQVFULSFLyQHQHO513SDUDVHUSDUWLFLSDQWH\SRVWRUODPLVPDTXH
tendr una vigencia de treinta (30) das hbiles.
Tratndose de solicitudes de renovacin iniciadas antes del vencimiento
de la vigencia de la inscripcin en el RNP (renovacin anticipada), la
&RQVWDQFLD GH LQVFULSFLyQ HQ HO 513 SDUD VHU SDUWLFLSDQWH \ SRVWRU
tendr vigencia a partir del vencimiento de la vigencia de la inscripcin
y por el trmino del plazo que resta de los treinta (30) das hbiles para
resolver el trmite de renovacin; salvo que se resuelva aprobndose el
trmite antes de los treinta (30) das hbiles, en cuyo caso, la vigencia
de la mencionada constancia culminar cuando entre en vigencia la
Constancia de inscripcin en el RNP para ser participante, postor y
FRQWUDWLVWD
/D&RQVWDQFLDGHLQVFULSFLyQHQHO513SDUDVHUSDUWLFLSDQWH\SRVWRU
mostrar el registro relativo al trmite de inscripcin o renovacin que
el proveedor est realizando, su domicilio, el plazo de vigencia y la
indicacin expresa que se trata de una constancia que slo le permitir
ser participante y/o postor.
Para los trmites de inscripcin o renovacin de inscripcin, la vigencia
GHOD&RQVWDQFLDGHLQVFULSFLyQHQHO513SDUDVHUSDUWLFLSDQWH\SRVWRU
se extender por diez (10) das hbiles adicionales cuando el trmite de
inscripcin sea observado y ste sea subsanado en los ltimos cinco
(5) das hbiles del procedimiento; durante dicho periodo el proveedor
no podr presentar mayor documentacin, y la ampliacin del plazo
de la constancia estar supeditada al resultado de la evaluacin de la
subsanacin presentada.
/D&RQVWDQFLDGHLQVFULSFLyQHQHO513SDUDVHUSDUWLFLSDQWH\SRVWRUQR
faculta al proveedor a suscribir contratos; bajo sancin de ser inhabilitado
para contratar con el Estado, conforme a lo dispuesto por la Ley y el
Reglamento.
6.5. CONSTANCIA DE INSCRIPCIN EN EL RNP PARA SER
PARTICIPANTE, POSTOR Y CONTRATISTA
Al da siguiente de aprobado el trmite de inscripcin o renovacin, el
proveedor podr acceder de forma electrnica a travs de la opcin
,PSULPLU&RQVWDQFLDGHODSiJLQDZHEGHO513DVX&RQVWDQFLDGH
LQVFULSFLyQHQHO513SDUDVHUSDUWLFLSDQWHSRVWRU\FRQWUDWLVWDODPLVPD
que tendr una vigencia de un (1) ao contado a partir del da siguiente
de la aprobacin del trmite; esta aprobacin ser comunicada en la
bandeja de mensajes del proveedor.
En esta constancia se mostrar la informacin de los registros vigentes
con los que cuenta el proveedor en el RNP, el plazo de vigencia de la
inscripcin, su domicilio y la indicacin expresa que se trata de una
constancia que permitir al proveedor ser participante, postor y contratista
del Estado.
297
ANEXOS
6.6. ESTADO DE LOS TRMITES
El RNP, en los trmites de inscripcin o renovacin de inscripcin
considera, entre otros, los siguientes estados:
a. Trmite pendiente de envo de datos:
Cuando el proveedor ha efectuado el pago de la tasa y tiene
habilitado el formulario electrnico para su llenado y envo va web.
b. Formulario recibido:
Cuando el proveedor registr sus datos completos en el formulario
electrnico y lo envo va web.
c. Inscripcin/renovacin iniciada:
Cuando la solicitud y los requisitos exigidos en el TUPA del OSCE,
son recibidos en la Sede Central o en cualquiera de las Oficinas
Zonales del OSCE.
d. Trmite observado:
Cuando el RNP ha efectuado la evaluacin de la documentacin
presentada y advierte que los requisitos e informacin presentados
por el proveedor se encuentran incompletos o con informacin
errada o inconsistente.
e. Trmite aprobado:
Cuando la evaluacin de los aspectos legales, contables, tcnicos
y, cuando corresponda, legalizaciones, se encuentran conformes.
f. Trmite no aprobado:
Cuando el proveedor no subsana las observaciones advertidas a
su trmite dentro del plazo de treinta (30) das hbiles contados a
partir del da hbil siguiente de presentados los documentos y/o
requisitos exigidos por el TUPA del OSCE
g. Trmite con pago de tasa caduco:
Cuando el proveedor que ha pagado la tasa, no cumple con
presentar los requisitos exigidos en el TUPA del OSCE en el plazo
de un (1) ao contado a partir del da siguiente de realizado el pago
de la tasa.
6.7. IMPEDIMENTOS E IMPROCEDENCIA DE LA INSCRIPCIN O
RENOVACIN DE INSCRIPCIN ANTE EL RNP
6.7.1. Los supuestos en los cuales el proveedor se encuentra impedido
para inscribirse o renovar su inscripcin en el RNP, son:
(OSURYHHGRUFRQLQKDELOLWDFLyQYLJHQWHSDUDFRQWUDWDUFRQ
el Estado. Este supuesto es verificado durante todo el
procedimiento de evaluacin.
(O SURYHHGRU FX\D LQVFULSFLyQ KD VLGR GHFODUDGD QXOD SRU
haber presentado documentacin falsa o informacin
inexacta al RNP, encontrndose impedido hasta que
transcurra el plazo de dos (2) aos de haber sido declarada
nula su inscripcin anterior como consecuencia de la accin
de fiscalizacin posterior. Este plazo se contabilizan a partir
de la fecha en que qued administrativamente firme la
resolucin que declar la nulidad.
ANEXOS
298
6.7.2. Los supuestos en los cuales no es procedente el inicio del
procedimiento de inscripcin o renovacin en el RNP, son:
&XDQGRDOPRPHQWRGHOSDJRGHODWDVDHOHVWDGRGHO58&
del proveedor nacional o extranjero domiciliado no existe o
VHHQFXHQWUDHQVLWXDFLyQGHQRKDELGRRQRDFWLYRDQWH
SUNAT. Esta situacin ser hasta que regularice su estado,
oportunidad en la que el proveedor deber iniciar un nuevo
trmite; podr solicitar la devolucin del primer pago.
&XDQGRXQDSHUVRQDMXUtGLFDSDJDODWDVDGHXQDSHUVRQD
natural.
&XDQGRHO58&FRQHOTXHVHHIHFWXyHOSDJRFRUUHVSRQGH
a una Entidad.
&XDQGRVHSURGXFHXQDGXSOLFLGDGGHSDJR
&XDQGRHOSURYHHGRUVHHQFXHQWUDFRQPXOWDLPSDJDLPSXHVWD
por el OSCE o moroso en el pago del fraccionamiento
correspondiente.
6.8. TIPOS DE EVALUACIN EN LOS PROCEDIMIENTOS DE
INSCRIPCIN, RENOVACIN DE INSCRIPCIN, AUMENTO DE
CAPACIDAD Y AMPLIACIN DE ESPECIALIDAD
Los proveedores en los procedimientos de inscripcin, renovacin de
inscripcin, aumento de capacidad y ampliacin de especialidad en los
Registros de Ejecutores y Consultores de Obras, cuando corresponda,
sern evaluados en los siguientes aspectos:
6.8.1. Evaluacin Legal
Consiste en la evaluacin de la capacidad legal del proveedor
para contratar con el Estado. Para tal efecto, se verificar
la informacin declarada en el formulario respecto de su
conformacin jurdica, teniendo en cuenta lo siguiente:
6.8.1.1. El RNP har uso de la informacin en lnea del
RENIEC, de la SUNARP, as como de la informacin
proporcionada en los portales web institucionales de
los Colegios Profesionales, cuando corresponda.
Para efectos de la evaluacin ser necesario que
el proveedor, persona jurdica nacional o extranjero
domiciliado, cuente con informacin actualizada de
la partida registral correspondiente ante la SUNARP,
respecto de los socios, participacionistas o titular,
capital social suscrito y pagado, nmero de acciones
o participaciones, objeto social, directorio u rgano de
administracin y representante legal.
En caso de no encontrarse la informacin declarada
por el proveedor en las bases de datos de las
mencionadas instituciones, el RNP podr requerir
la presentacin de las copias literales de Registros
Pblicos o la copia de las constancias de afiliacin
pertinentes. Asimismo, podr requerir la presentacin
299
ANEXOS
del acta emitida por el rgano competente, segn sus
estatutos, que acredite la fecha de designacin de
los miembros que integran actualmente sus rganos
de administracin y/o de las actas de transferencia
de acciones que acrediten la fecha de ingreso de los
participacionistas o titulares de la persona jurdica,
cuando dicha fecha no figure en la base de datos de
la SUNARP.
Tratndose de Sociedades Annimas (S.A),
Sociedades Annimas Abiertas (S.A.A.) y Cerradas
(S.A.C.), cuando de la documentacin presentada
por el proveedor no pueda verificarse la distribucin
accionaria y/o la fecha de incorporacin de los
accionistas, el RNP podr requerir la presentacin
del libro de matrcula de acciones donde figure dicha
informacin, segn corresponda al tipo societario.
6.8.1.2. El proveedor extranjero domiciliado (persona
jurdica) deber acreditar la informacin declarada
en el formulario electrnico, con copia de la escritura
pblica inscrita en Registros Pblicos o ante autoridad
competente en su pas de origen, o documento
oficial emitido por la autoridad registral. En caso que
en dichos documentos no figure la distribucin de
acciones y/o la fecha de ingreso del accionista, deber
presentar documento similar al libro de matrcula de
DFFLRQHVRWHVWLPRQLRRDFWDGHOD-XQWD*HQHUDOGH
Accionistas donde figure dicha informacin, segn
corresponda. Excepcionalmente, cuando el pas de
origen no expida los instrumentos antes mencionados,
podr presentar documento emitido por el rgano de
administracin que cuente con facultades para brindar
dicha informacin.
6.8.1.3. La acreditacin del apoderado o representante legal
del proveedor extranjero no domiciliado se efectuar
mediante copia simple del poder vigente inscrito en los
Registros Pblicos, con una antigedad no mayor a
sesenta (60) das calendario a la fecha de presentacin
del expediente.
Entre las facultades otorgadas al representante
legal o apoderado en el Per deber encontrarse
la de representar al poderdante en procedimientos
administrativos ante entidades pblicas.
6.8.1.4. Para el caso del proveedor extranjero (persona
jurdica) cuyas acciones son cotizadas en bolsa, a
efectos de acreditar a sus socios, podr presentar el
certificado que emite el organismo pertinente en su
ANEXOS
300
pas de origen o documento expedido y suscrito por el
directorio, consejo de administracin u rgano similar
de la empresa con facultades para realizar dichas
declaraciones, debiendo cumplir la documentacin
presentada con las formalidades establecidas en la
primera disposicin complementaria de la presente
Directiva.
6.8.1.5. La acreditacin de la especialidad para el caso del
proveedor extranjero (persona natural), se realizar
conforme lo establecido en el TUPA del OSCE. Sin
perjuicio de ello, el proveedor colegiado en el Per
acreditar su especialidad con el documento oficial
expedido por el Colegio de Ingenieros o Arquitectos
del Per; asimismo, debern cumplir con las
especialidades y/o profesiones establecidas en los
artculos 266 y 273 del Reglamento.
La informacin sobre los profesionales extranjeros que
se encuentren inscritos en los colegios profesionales
antes mencionados, podr ser validada por el RNP a
travs de los portales web respectivos.
6.8.1.6. Las legalizaciones consulares (legalizacin del
Consulado Peruano en el lugar de origen del
documento, refrendado por el Ministerio de Relaciones
Exteriores en el Per) o apostillas, deben constar en
los documentos provenientes del extranjero en el
idioma original.
6.8.1.7. Las legalizaciones consulares o apostillas no sern
necesarias en los documentos que contengan el texto
de alguna norma emitida en el extranjero o cuando las
traducciones que se haya presentado sean realizadas
en el extranjero.
6.8.1.8. El proveedor nacional (persona jurdica) que desee
acreditar su condicin de Micro o Pequea Empresa
(MYPE) para efectos del clculo de su capacidad
mxima de contratacin, deber presentar copia de
la Constancia de Inscripcin en el Registro de Micro
y Pequeas Empresas (REMYPE).
6.8.1.9. El proveedor extranjero que sea persona jurdica
(matriz o sucursal) que provenga de un pas con el
cual Per no cuente con un Tratado o Compromiso
Internacional vigente o suscrito con anterioridad al 20
de septiembre de 2012, que incluya disposiciones en
materia de contrataciones pblicas, para su inscripcin
como ejecutor de obras deber presentar copia de la
escritura pblica, testimonio, acta o similar, donde la
-XQWD*HQHUDOGH$FFLRQLVWDVXyUJDQRDQiORJRGHOD
301
ANEXOS
sociedad, de acuerdo a sus estatutos o leyes del pas
en el cual se constituy la matriz, acuerde el monto
que ser depositado en el Per como capital asignado
en caso de sucursal o como depsito a nombre del
representante legal en caso de la matriz.
Adicionalmente, en los trmites de inscripcin
como ejecutor de obras, el proveedor extranjero no
domiciliado (matriz) deber presentar copia del reporte
de estado de cuenta, extracto bancario, voucher de
depsito o constancia de entidad financiera en el que
acredite el depsito de dicho monto, en alguna de las
empresas del sistema financiero nacional en cuenta
abierta a nombre de su representante legal en el Per.
Dicho requerimiento tambin resulta aplicable en el
primer trmite de renovacin de inscripcin o aumento
de capacidad mxima de contratacin que realice el
proveedor a partir del 20 de setiembre de 2012.
6.8.1.10. El depsito dinerario antes mencionado deber
mantenerse en el sistema financiero nacional durante
la vigencia de la inscripcin del proveedor extranjero
no domiciliado (matriz) en el RNP o, en su defecto,
podr ser utilizado para financiar sus operaciones en
territorio nacional.
6.8.1.11. Cuando el mencionado proveedor obtenga una
capacidad mxima de contratacin en funcin de
su capital representado por dicho depsito, deber
presentar en los posteriores trmites de renovacin
de inscripcin o aumento de capacidad mxima de
contratacin como ejecutor de obras, una declaracin
jurada firmada por el representante legal en donde
manifieste que durante la vigencia de la inscripcin,
el depsito dinerario acreditado en la inscripcin se
mantuvo en la cuenta abierta en el sistema financiero
nacional.
Por otro lado, cuando el proveedor hubiera optado por
utilizar total o parcialmente el monto acreditado como
depsito para financiar sus operaciones en territorio
nacional, deber sealar dicha situacin con el formato
correspondiente consignado en el TUPA del OSCE,
debidamente firmado por su representante legal y un
contador pblico colegiado; teniendo en cuenta que
la sumatoria del saldo del depsito que permanece
en el sistema financiero nacional y el monto declarado
como inversin en el territorio nacional debe coincidir
con el monto acreditado como depsito para obtener
su capacidad mxima de contratacin anterior. De
ANEXOS
302
advertirse incongruencias en la informacin declarada
se proceder de la siguiente manera:
i) En caso el monto sea menor al originalmente
acreditado, se proceder con el reclculo de la
capacidad mxima de contratacin; o,
ii) En caso el monto consignado en el formato sea
mayor al originalmente acreditado, el proveedor
GHEHUiSUHVHQWDUHODFXHUGRGHOD-XQWD*HQHUDO
de Accionistas u rgano anlogo de la sociedad,
de acuerdo a sus estatutos o leyes del pas
en el cual se constituy la matriz, donde se
autorice el uso del depsito excedente realizado
a nombre del representante legal para financiar
las operaciones del proveedor extranjero no
domiciliado (matriz) en el pas.
En cualquiera de los dos supuestos sealados en
los prrafos anteriores, el proveedor extranjero no
domiciliado (matriz) que requiera acreditar un mayor
capital para efectos del clculo de la capacidad
mxima de contratacin solicitada, deber presentar
la documentacin sealada en numeral 6.8.1.9 del
presente acpite a efectos de acreditar el monto del
capital adicional que constituye como depsito.
6.8.1.12. Para la determinacin de la capacidad mxima
de contratacin se considerar el capital suscrito
y pagado, el capital asignado o el depsito, segn
sea el caso, acreditado durante los treinta (30) das
hbiles que dura el procedimiento de inscripcin y/o
renovacin de inscripcin y/o aumento de capacidad
mxima de contratacin.
6.8.2. Evaluacin Contable
6.8.2.1. Generalidades
Consiste en la evaluacin de la solvencia econmica
del ejecutor de obras (persona natural o jurdica,
nacional o extranjera) y consultor de obras (persona
jurdica, nacional o extranjera), haciendo uso del
aplicativo de evaluacin de los Ratios de Medicin
de Solvencia y la calificacin de la Central de
Riesgos de la Superintendencia de Banca, Seguros
y AFP, segn el Reporte de Posicin del Cliente de
la Superintendencia de Banca, Seguros y AFP, para
los casos que corresponda (nacionales), as como
complementariamente con la informacin contenida
en la pgina web de la SUNAT. Para tal efecto, se
tiene en consideracin lo siguiente:
303
ANEXOS
a) Evaluacin segn los Ratios de Medicin de
Solvencia
Para determinar los ratios de medicin se
utilizarn los siguientes indicadores:
RATIO DE ENDEUDAMIENTO:
R2 = Patrimonio / (Pasivo Corriente + Pasivo
No Corriente)
RATIO DE LIQUIDEZ:
R3 = Activo Corriente / Pasivo Corriente
RATIO DE SOLVENCIA:
R8 = Patrimonio / Capital Social
RATIO DE MARGEN BRUTO:
R9 = Utilidad Operativa / (Patrimonio + Pasivo
No Corriente)
Se considera solvente al ejecutor de obras
(persona natural o jurdica, nacional o extranjera)
y consultor de obras (persona jurdica, nacional
o extranjera) que, producto de la aplicacin
de los ratios antes mencionados a travs del
aplicativo informtico correspondiente, obtuviera
el estado de solvente, considerndose ste
cuando posee determinada cantidad de activos
o patrimonio con los que pueda cumplir y
garantizar sus obligaciones.
b) Calificacin de la Central de Riesgos de la
Superintendencia de Banca, Seguros y AFP
El Reglamento para la evaluacin y clasificacin
del deudor y la exigencia de provisiones,
aprobado mediante Resolucin S.B.S. N 808-
2003 y sus modificatorias, establece que los
criterios de evaluacin de las empresas del
sistema financiero para el otorgamiento de un
crdito est determinado por la capacidad de
pago del solicitante que, a su vez, est definida
por su flujo de caja y grado de cumplimiento de
sus obligaciones.
Asimismo, califica al deudor de la cartera de
crditos de acuerdo a las siguientes categoras:
1RUPDO
&RQ3UREOHPDV3RWHQFLDOHV
'HILFLHQWH
ANEXOS
304
'XGRVR
3pUGLGD
En tal sentido, se considera Estado Solvente
cuando el ejecutor de obras (persona natural o
jurdica, nacional) o consultor de obras (persona
jurdica nacional) se encuentra en la calificacin
Normal (0). Dicha calificacin se evidencia en
el reporte de posicin del cliente de la Central
de Riesgo de la Superintendencia de Banca,
Seguros y AFP.
En todos los casos, los dos lineamientos antes
mencionados sern aplicados simultneamente
para medir la solvencia econmica, salvo
cuando el ejecutor de obras (persona natural o
jurdica, nacional) o consultor de obras (persona
jurdica nacional) no tuvieran informacin
reportada en la Central de Riesgos de la
Superintendencia de Banca, Seguros y AFP o,
se trate de ejecutor o consultor extranjero de
obras, en cuyo caso se les aplicar nicamente
los Ratios de Medicin de Solvencia.
6.8.2.2. Procedimiento de evaluacin de la solvencia
econmica en la inscripcin y renovacin
Para la inscripcin y renovacin del ejecutor de obras
(persona natural o jurdica, nacional) y consultores
de obras (persona jurdica nacional), se efectuar la
evaluacin de la ltima Declaracin Pago Anual del
Impuesto a la Renta Tercera Categora - PDT (estados
financieros) declarada a la SUNAT y su respectiva
constancia de presentacin; o segn sea presentado,
se efectuar la evaluacin de los estados financieros
auditados del ltimo ejercicio econmico. En el caso
que no se cuente con el PDT del ltimo ejercicio
econmico, por estar en el primer trimestre del ao
y no haber vencido an el plazo de presentacin de
dicha declaracin a SUNAT, se presentar el PDT
correspondiente al ejercicio anterior.
Para el caso del proveedor extranjero, que solicite la
inscripcin y renovacin de su inscripcin como ejecutor
de obras (persona natural o jurdica) y/o consultor de
obras (persona jurdica), se efectuar la evaluacin de
los estados financieros auditados del ltimo ejercicio
econmico. Los estados financieros auditados, en
todos los casos, deben incluir como informacin
mnima, el dictamen de auditor independiente, balance
general, estado de ganancias y prdidas y las notas a
los estados financieros.
305
ANEXOS
6.8.2.3. Casos en los que procede la presentacin de los
estados financieros situacionales
Si despus de aplicar los Ratios de Medicin de
Solvencia RNP, el ejecutor de obras (persona natural
o jurdica, nacional) y consultores de obras (persona
jurdica nacional) resultara insolvente, por no lograr
acreditar el ratio de endeudamiento y/o el ratio de
liquidez, tendr la opcin de presentar estados
financieros situacionales (balance general y estado
de ganancias y prdidas en el formulario establecido
para dicho fin).
En caso no se logre alcanzar los indicadores de los
Ratios de Medicin de Solvencia y/o de la calificacin
de la Superintendencia de Banca y Seguros y AFP, el
proveedor podr presentar informacin adicional, tales
como: libros y registros contables, declaraciones y/o
reportes de SUNAT, actas, testimonios, cronogramas
de pagos, manifiestos, entre otros, necesarios segn
el caso, para respaldar la evaluacin contable.
Si los estados financieros situacionales continan sin
mostrar mejora en los indicadores observados, el RNP
considerar superada la observacin, siempre que el
SURYHHGRUVHHQFXHQWUHFRQODFDOLILFDFLyQQRUPDO
(0) en una fecha ms actualizada, en el reporte de
posicin del cliente de la Central de Riesgos de la
Superintendencia de Banca y Seguros y AFP; salvo
que del anlisis de la informacin de los estados
financieros situacionales presentados se muestre
una situacin que origine ser declarado insolvente
de acuerdo a lo establecido en la Ley N 26887, Ley
General de Sociedades o en el Decreto Ley N 21621,
Ley de Empresas Individuales de Responsabilidad
Limitada. En este caso, el proveedor deber capitalizar
prdidas o realizar aportes de capital en cuanta que
compense el desmedro y acreditar nuevo capital
suscrito, pagado e inscrito en Registros Pblicos, as
como presentar estados financieros situacionales
(balance general y estado de ganancias y prdidas
presentados en el formulario establecido para dicho
fin), y de ser el caso, informacin y/o documentos
adicionales que respalden la evaluacin contable.
En aquellos casos en los cuales el ejecutor de obras
(persona natural o jurdica, nacional) o consultor de
obras (persona jurdica nacional) no tenga informacin
reportada en la Central de Riesgos de la SBS y
producto de la aplicacin de los indicadores de los
ANEXOS
306
Ratios de Medicin de Solvencia no lograra acreditar
el ratio de endeudamiento y/o el ratio de liquidez,
tendr la opcin de presentar estados financieros
situacionales (balance general y estado de ganancias
y prdidas presentados en el formulario establecido
para dicho fin) y, de ser el caso, informacin y/o
documentos adicionales que respalden la evaluacin
contable.
Cuando, producto de la aplicacin de los Ratios de
Medicin de Solvencia RNP, el ejecutor de obras
(persona natural o jurdica, nacional) o consultor de
obras (persona jurdica nacional) obtuviera el resultado
de Estado solvente, pero el reporte de posicin del
cliente de la Central de Riesgos de la Superintendencia
de Banca, Seguros y AFP, muestre una calificacin
FRQ SUREOHPDV SRWHQFLDOHV GHILFLHQWH
GXGRVR\RSpUGLGDHOSURYHHGRUWHQGUiOD
opcin de presentar estados financieros situacionales
(balance general y estado de ganancias y prdidas
presentados en el formulario establecido para dicho
fin) y de ser el caso, informacin y/o documentos
adicionales que respalden la evaluacin contable.
Para el caso del proveedor extranjero que solicite
inscribirse o renovar su inscripcin como ejecutor de
obras (persona natural o jurdica) y/o consultor de
obras (persona jurdica), que como resultado de la
aplicacin de los Ratios de Medicin de Solvencia no
lograra acreditar el ratio de endeudamiento y/o el ratio
de liquidez, podr adjuntar un cronograma mensual o
manifiesto de las amortizaciones del pasivo corriente
durante el ejercicio siguiente y saldo por amortizar,
en caso no se haya cumplido an con cancelar la
totalidad del pasivo corriente. Dicho cronograma,
deber detallar las cuentas que conforman el pasivo
corriente del Balance General materia de evaluacin,
las sumatorias de los importes consignados y deber
encontrarse firmado por el directorio, consejo de
administracin, rgano similar o por el funcionario
o representante que cuente con las facultades para
emitir este tipo de declaraciones. Esta informacin
deber cumplir con las formalidades establecidas
en la primera disposicin complementaria de la
presente Directiva. En caso de insolvencia patrimonial,
se deber proceder de acuerdo a la normativa
aplicable en su pas de origen, a fin de restablecer su
solvencia econmica, para lo cual deber presentar
la documentacin que lo acredite.
307
ANEXOS
6.8.2.4. Situaciones previstas en la evaluacin contable
a) Cuando se haya validado la declaracin anual a
SUNAT y existan diferencias entre los importes
consignados en la Declaracin jurada de
VROYHQFLDHFRQyPLFDGHOIRUPXODULRHOHFWUyQLFR
(solicitud de inscripcin/ renovacin para
proveedor de ejecucin /consultor de obras),
podr realizarse la modificacin de oficio en el
formulario electrnico, teniendo como evidencia
la Declaracin de Pago Anual del Impuesto a la
Renta (PDT) presentado, con la excepcin de
las casillas del activo y pasivo. Esta modificacin
excepcional slo ser posible durante el
procedimiento de resolucin del recurso de
reconsideracin y siempre que no subsista
alguna observacin contable constatada en el
trmite inicial.
b) Cuando se hayan validado los Estados
Financieros Auditados y existan diferencias con
los importes consignados en la Declaracin
MXUDGDGHVROYHQFLDHFRQyPLFDGHOIRUPXODULR
electrnico (solicitud de inscripcin/renovacin
para proveedor de ejecucin/consultor de
obras), se podr realizar la modificacin de
oficio, teniendo como evidencia los estados
financieros auditados, salvo que no se cuente
con alguno de los importes requeridos. Esta
modificacin excepcional slo ser posible
durante el procedimiento de resolucin del
recurso de reconsideracin y siempre que
no subsista alguna observacin contable
constatada en el trmite inicial.
c) En caso que se consigne capital adicional y slo
para efectos de la evaluacin contable, podr
acreditarse ste con la presentacin de la copia
simple del libro de acta de junta de accionistas
o del titular (en caso de una E.I.R.L.), con el
acuerdo o decisin de elevar el capital adicional
a escritura pblica e inscribirlo en Registros
Pblicos, salvo en los casos sealados en el
literal f) del presente numeral.
d) En caso que se consigne excedente de
revaluacin, deber acreditarse ste con la
presentacin de la copia simple del documento
que sustenta el ajuste de la reevaluacin, slo
si su inclusin permitiera alcanzar el indicador
ANEXOS
308
de solvencia patrimonial requerida.
e) Cuando los resultados acumulados que se
consignen en el balance situacional sea un
importe mayor al derivado del balance del
ltimo ejercicio econmico declarado a la
SUNAT, deber acreditar la diferencia mediante
documento adicional.
f) Cuando los estados financieros muestren
prdidas acumuladas que superen el 50% del
capital social en dos ejercicios consecutivos, las
personas jurdicas debern proceder conforme
a lo dispuesto en la Ley N 26887, Ley General
de Sociedades y la Ley N 21621, Ley de
la Empresa Individual de Responsabilidad
Limitada; presentando posteriormente estados
financieros situacionales en el formulario
establecido, en el cual se consigne el nuevo
capital social suscrito y pagado, debidamente
inscrito en Registros Pblicos, que le permita
restablecer su solvencia econmica.
Las personas naturales debern presentar
estados financieros situacionales en el
formulario establecido para tal efecto, mostrando
solvencia econmica y, de ser el caso, presentar
documentos adicionales que permitan acreditar
la informacin.
g) En los casos de inscripcin de ejecutores de
obras (personas naturales) que no cuenten con
la Declaracin Pago Anual del Impuesto a la
Renta de Tercera Categora, debern consignar
HQHOIRUPXODULRHOHFWUyQLFR'HFODUDFLyQ-XUDGD
de Solvencia Econmica) la informacin
financiera registrada en el balance de apertura
presentado, consignando la fecha de dicho
balance.
h) En los casos de renovacin de inscripcin de
ejecutores de obra (persona natural o jurdica)
o consultores de obras (persona jurdica), en los
cuales logren acreditar que no se encontraron
obligados a presentar la Declaracin Pago Anual
del Impuesto a la Renta de Tercera Categora
del ltimo ejercicio econmico, debern
presentar estados financieros situacionales en
el formulario establecido para dicho fin en el
TUPA del OSCE.
309
ANEXOS
6.8.2.5. Acreditacin de la presentacin de estados
financieros - PDT ante la SUNAT
Segn el inciso b) del artculo 118 del Texto nico
Ordenado de la Ley del Impuesto a la Renta, las
personas naturales o jurdicas que realicen actividades
calificadas como contratos de construccin, as como
actividades de arquitectura e ingeniera y actividades
conexas de asesoramiento tcnico, no pueden
acogerse al Rgimen Especial del Impuesto a la Renta
RER. La misma regulacin se encuentra establecida
en el Decreto Legislativo N 1086, Texto nico
Ordenado de la Ley MYPE. Por lo tanto, ejecutores de
obra (persona natural o jurdica) o consultores de obras
(persona jurdica) estn obligados a tributar bajo las
normas del Rgimen General del Impuesto a la Renta,
debiendo presentar anualmente la Declaracin de
Pago Anual del Impuesto a la Renta Tercera Categora
- PDT a la SUNAT.
La presentacin de los estados financieros PDT
(Declaracin Pago Anual del Impuesto a la Renta
Tercera Categora) ante SUNAT se acreditar con la
respectiva constancia de presentacin, la cual deber
mostrar la ruta web de SUNAT o el sello legible del
banco receptor de la declaracin, a fin de validar la
presentacin de la declaracin.
En caso el proveedor presente el reporte del
formulario PDT- Declaracin Anual emitido por la
SUNAT (consultas preliminares y/o todos los rubros),
tambin deber adjuntar la constancia de presentacin
respectiva, en este caso sin necesidad de la ruta web
de SUNAT.
6.8.2.6. Procedimiento de evaluacin de la solvencia
econmica en el aumento de capacidad mxima
de contratacin
Para el trmite de aumento de capacidad mxima
de contratacin se aplicar la evaluacin contable
conforme a lo previsto en los literales precedentes,
considerndose adems que si posteriormente al
cierre del ltimo ejercicio econmico se produce un
aumento del capital, se deber presentar estados
financieros situacionales en el formulario establecido,
mostrando el nuevo capital suscrito y pagado
debidamente inscrito en los Registros Pblicos. En
el caso de las personas naturales, deber presentar
estados financieros situacionales en el formulario
ANEXOS
310
establecido y, de ser el caso, acreditar el nuevo capital
consignado con la informacin adicional respectiva.
6.8.3. Evaluacin Tcnica
Consiste en la evaluacin de la capacidad tcnica del proveedor,
para lo cual se tendr en cuenta lo previsto por la Ley, su
Reglamento y el TUPA del OSCE. En tal sentido, la evaluacin
implica la revisin y cumplimiento de lo establecido en la
normativa para la acreditacin de la experiencia, la asignacin
de la capacidad mxima de contratacin y de especialidades,
considerndose lo siguiente:
6.8.3.1. Capacidad Mxima de Contratacin
La capacidad mxima de contratacin se asignar
al ejecutor de obras conforme a lo sealado en los
artculos 274 y 275 del Reglamento, debindose
considerar lo siguiente:
a) En el caso de las personas jurdicas nacionales
se verificar si cuenta con inscripcin en el
Registro Nacional de la Micro y Pequea
Empresa (REMYPE), con la presentacin de
la respectiva constancia. En el caso de las
personas jurdicas extranjeras domiciliadas
(sucursal) o extranjeras no domiciliadas
(matriz), se verificar si provienen de pases
con los cuales el Per tiene vigente un tratado
o compromiso internacional que incluya
disposiciones en materia de contrataciones
pblicas. Como consecuencia de ello, en
todos los trmites de inscripcin, renovacin o
aumento de capacidad mxima de contratacin,
se determinar la capacidad mxima de
contratacin de acuerdo con lo dispuesto en los
literales a) o b) del artculo 275 del Reglamento,
segn corresponda.
b) En virtud a lo establecido en la octava disposicin
complementaria transitoria del Reglamento,
para la determinacin de la capacidad mxima
de contratacin establecida en el literal a) del
artculo 275 del Reglamento se considerar
tambin a las personas jurdicas extranjeras
domiciliadas (sucursal) y no domiciliadas
(matriz) que provengan de pases con los cuales
el Per ha suscrito un tratado u otro compromiso
internacional en materia de contratacin pblica,
con anterioridad al 20 de setiembre de 2012.
c) Si el proveedor no logra acreditar experiencia
en su inscripcin como ejecutor de obras,
311
ANEXOS
se le otorgar una capacidad mxima de
contratacin hasta por un total equivalente al
monto establecido para el proceso de seleccin
Adjudicacin Directa Selectiva, siempre que
su capital o depsito, de ser el caso, le permita
acceder a dicha capacidad conforme a la
frmula aplicable al caso en concreto.
d) En el caso de los trmites de inscripcin como
ejecutor de obras (que acrediten experiencia)
y de aumento de capacidad mxima de
contratacin para los proveedores que se
encuentren dentro lo establecido en el literal a)
del artculo 275 del Reglamento, la capacidad se
determinar por la ponderacin del capital y de
la experiencia en obras acreditadas, de acuerdo
con la documentacin exigida en el TUPA del
OSCE.
e) Para la determinacin de la capacidad mxima
de contratacin de proveedores extranjeros
domiciliados (sucursal), incluidos en el literal a)
del artculo 275 del Reglamento, se considerar
el capital social, pagado e inscrito en los
Registros Pblicos del pas de origen o autoridad
competente, conforme a las formalidades
exigidas en su pas.
f) Para personas jurdicas nacionales que no se
encuentren inscritas en el Registro Nacional
de la Micro y Pequea Empresa (REMYPE)
y personas jurdicas extranjeras domiciliadas
(sucursal) y no domiciliadas (matriz) que
provengan de pases con los cuales el Per
no tenga vigente un tratado o compromiso
internacional que incluya disposiciones en
materia de contrataciones, se aplicar lo
dispuesto en el literal b) del artculo 275 del
Reglamento, segn el siguiente detalle:
&0&&REUDV
Donde:
C: Capital o Depsito, el cual no podr ser
inferior al 5% de su capacidad mxima de
contratacin
Entonces:
&&0&
ANEXOS
312
&&0&
&&0&
Por tanto, la capacidad mxima de contratacin
no podr exceder, en ningn caso, a veinte (20)
veces el capital o depsito acreditado.
g) En los trmites de inscripcin como ejecutor de
obras (que acredite experiencia) y de aumento
de capacidad mxima de contratacin, de los
proveedores mencionados en el literal anterior,
la capacidad se determinar por la ponderacin
del capital o depsito, de ser el caso, y la
experiencia en obras acreditadas; de acuerdo
con la documentacin exigida en el TUPA del
OSCE, pudindose otorgar hasta veinte (20)
veces el capital o depsito sealado en el literal
b) del artculo 275 del Reglamento.
h) En los trmites de renovacin de inscripcin,
cuando se verifique que su capital o depsito
sea inferior al capital o depsito acreditado
para la obtencin de su capacidad mxima
de contratacin anterior, el RNP proceder a
recalcularla conforme a lo establecido en los
artculos 274 y 275 del Reglamento. En el caso
de las personas jurdicas bajo los alcances del
literal b) del artculo 275 del Reglamento, el RNP
reajustar su capacidad mxima de contratacin
siempre que el capital o depsito acreditado sea
menor al cinco por ciento (5%) de su capacidad
mxima de contratacin anterior, otorgndole
como capacidad el monto equivalente a veinte
(20) veces el capital o depsito acreditado.
i) Cuando el ejecutor de obras solicite la
renovacin de inscripcin despus de haber
transcurrido cinco (5) aos de vencida la
vigencia de su inscripcin, la capacidad mxima
de contratacin ser recalculada considerando
lo establecido en los artculos 274 y 275
del Reglamento. En consecuencia, podr
presentar toda la documentacin exigida en el
TUPA del OSCE, considerando para tal efecto
lo establecido en el trmite de aumento de
capacidad mxima de contratacin.
j) Para el caso de trmites de renovacin
realizados dentro de los cinco (5) aos de
vencida la vigencia de su inscripcin, se
313
ANEXOS
otorgar al ejecutor de obras automticamente
la capacidad mxima de contratacin obtenida
anteriormente, siempre que el capital o depsito,
de ser el caso, no haya disminuido con respecto
al trmite anterior o que esta disminucin no
afecte la capacidad mxima de contratacin
otorgada anteriormente.
La capacidad mxima de contratacin del
ejecutor de obras se ver afectada cuando
el monto del nuevo capital o depsito, de
ser el caso, al ser multiplicado por el factor
de ponderacin de la frmula establecida
en el artculo 275 del Reglamento, resulte
inferior a la otorgada en su ltima vigencia,
debiendo recalcular su capacidad mxima de
contratacin, siguiendo lo previsto en el literal
i) del presente numeral.
6.8.3.2. Especialidades
Al consultor de obras se le otorgar especialidades
conforme a lo previsto por los artculos 267 y 268
del Reglamento, para lo cual deber presentar los
requisitos establecidos en el TUPA del OSCE.
Tratndose de renovacin de inscripcin, se le otorgar
la(s) especialidad(es) obtenida(s) en su trmite
anterior.
6.8.3.3. Situaciones previstas en la evaluacin de la
experiencia de los ejecutores de obras
a) Para la acreditacin de la experiencia ante el
RNP, el acta de recepcin en obras pblicas,
documento exigido dentro de los trmites
establecidos en el TUPA del OSCE, ser
considerado siempre que cumpla con las
formalidades establecidas en el artculo 210 del
Reglamento.
b) Cuando se trate de obras bajo las modalidades
de concurso oferta y llave en mano, slo se
considerar como experiencia para efectos
de determinar la capacidad mxima de
contratacin, el monto de obra ejecutado,
independientemente de la elaboracin del
expediente tcnico y del costo del terreno. As,
nicamente se considerar el equipamiento,
siempre que se refiera a componentes
mecnicos y electromecnicos necesarios
para el funcionamiento de la edificacin y no el
mobiliario.
ANEXOS
314
c) En el caso de obras contratadas por encargo
con Organismos Internacionales, el proveedor
deber presentar copia simple del contrato,
del acta de recepcin de obras y las facturas
emitidas por el ejecutor.
d) En el caso de contratos marco privados
culminados, el proveedor deber presentar
adicionalmente al contrato, el acta de
conformidad del contrato, las rdenes de
servicio giradas por la Entidad contratante y
las facturas de pago por la ejecucin de las
obras. Todos estos documentos debern estar
relacionados con el contrato marco.
e) En el caso de obras ejecutadas bajo la normativa
de los Programas de Vivienda del Estado que
no cuenten con el monto final de obra en el
certificado de finalizacin de obra municipal ni
con la declaratoria de fbrica, podrn presentar
adicionalmente al contrato y al certificado de
finalizacin de obra municipal, un documento
emitido por la Entidad autorizada que acredite
el desembolso total efectuado por las obras que
el proveedor presente en su trmite.
f) Para acreditar experiencia en ejecucin de
obras privadas mediante la autoconstruccin, el
proveedor deber presentar un documento que
acredite la propiedad del inmueble, as como los
dems documentos exigidos en el TUPA que le
resulten aplicables; estos documentos debern
demostrar fehacientemente su condicin como
ejecutor de la obra, caso contrario, no ser
considerada.
g) Para las obras privadas ejecutadas para otras
personas naturales o jurdicas dedicadas
al rubro de la construccin, stas podrn
ser consideradas siempre que no se traten
de servicios, para lo cual presentarn la
documentacin que corresponda de acuerdo
a la naturaleza de la obra, conforme a lo
establecido en el TUPA del OSCE, y siempre
que se demuestre fehacientemente quin
ejecut la obra.
h) Para que el subcontrato de ejecucin de obra
pblica sea considerado para la determinacin
de la capacidad mxima de contratacin, deber
encontrarse inscrito en el RNP, de acuerdo con
315
ANEXOS
el procedimiento establecido en el TUPA del
OSCE.
6.8.3.4. Situaciones previstas en la evaluacin de
experiencia de los consultores de obras
a) Para la acreditacin de la experiencia en
consorcio, en los contratos suscritos bajo
la modalidad de concurso oferta, slo se
considerar aquella obtenida por el consultor de
obras que haya tenido a su cargo la elaboracin
del expediente tcnico de obra.
b) Para acreditar experiencia en consultoras de
obras, la documentacin presentada deber
demostrar fehacientemente que se trata de
la elaboracin de un expediente tcnico para
ejecucin de obras o una supervisin de obra.
Caso contrario, el proveedor podr presentar
documentacin adicional a la exigida en el
TUPA, emitida por entidad y/o la contratante,
para acreditarla como tal.
6.8.3.5. Situaciones que se presentan en la evaluacin
tcnica
a) La experiencia obtenida por el proveedor como
persona natural ser considerada, a partir de
la fecha de incorporacin al colegio profesional
correspondiente; y para las personas jurdicas
desde la fecha de inscripcin de la constitucin
en Registros Pblicos, verificndose que
su objeto social corresponda a la ejecucin
de obras y/o consultora de obras, segn
corresponda.
De acuerdo a lo previsto en el TUPA del
OSCE, el cuadro demostrativo de ejecucin
y consultora de obras es parte integrante
del formulario electrnico en los trmites
de inscripcin y renovacin de inscripcin;
asimismo, es parte integrante del formulario
de solicitud en los trmites de ampliacin de
especialidad y aumento de capacidad mxima
de contratacin. En dicho cuadro el proveedor
detallar la informacin de los ejecutores de
obras o consultores de obras que el proveedor
desee acreditar como experiencia.
La informacin contenida en el cuadro
demostrativo es descriptiva y referencial, dado
que sta ser corroborada con la documentacin
presentada y exigida en el TUPA del OSCE.
ANEXOS
316
Asimismo, ser verificada con la base de datos
contenida en el mdulo de rcord de ejecucin
y consultora de obras, y con el mdulo de
reporte de constancias de capacidad de libre
contratacin y de no estar inhabilitado para
contratar con el Estado, segn corresponda.
b) Para los trmites de renovacin de inscripcin
en los registros de ejecutores y consultores
de obras, aumento de capacidad mxima
de contratacin, ampliacin de especialidad
e inscripcin de los subcontratos de obras
pblicas el proveedor deber encontrarse al
da en la declaracin mensual de su rcord de
ejecucin de obras y/o rcord de consultora
de obras, segn corresponda, como lo indica el
TUPA del OSCE y el Reglamento, para lo cual
deber tener en cuenta lo siguiente:
(QORVWUiPLWHVGHUHQRYDFLyQGHHMHFXWRUHV
y consultores de obras y de inscripcin de
subcontratos de obras pblicas se verificar
la informacin declarada por el proveedor
en los rcords, teniendo en cuenta para
ello los reportes de las constancias de
capacidad libre de contratacin y de no estar
inhabilitado para contratar con el Estado
emitidas, segn corresponda.
6H HYDOXDUi OD GHFODUDFLyQ GH ORV UpFRUGV
de ejecutores y consultores de obras con
tres (3) meses de anterioridad al inicio de
su ltima vigencia, verificando la correcta
declaracin de la informacin de las obras
y consultoras de obras, conforme a lo
establecido en los artculos 270, 271, 278 y
279 del Reglamento.
(Q ORV WUiPLWHV GH DXPHQWR GH FDSDFLGDG
mxima de contratacin y ampliacin de
especialidad, se aplicar lo previsto en el
prrafo anterior, para lo cual se tomar en
cuenta la declaracin de los rcords de
los ltimos cinco (5) aos de vigencia del
ejecutor y consultor de obras.
c) Para efectos de acreditar la experiencia ante
el RNP, no se considerarn los siguientes
supuestos:
/RV FRQWUDWRV R VXEFRQWUDWRV TXH VH
constituyan con infraccin a la Ley y/o su
317
ANEXOS
Reglamento.
/RV VXEFRQWUDWRV SDUD OD HMHFXFLyQ GH
obras pblicas en el extranjero que no se
encuentren debidamente autorizados por la
Entidad pblica competente.
/RVVXEFRQWUDWRVGHREUDVSULYDGDVDQLYHO
nacional o extranjero.
/RV FRQWUDWRV PDUFR SULYDGRV TXH VH
encuentren en ejecucin.
/RVFRQWUDWRVVXVFULWRVFX\RREMHWRVyORHV
la ejecucin de partidas, ya que ste trabajo
ser considerado como servicio.
VII. DISPOSICIONES ESPECFICAS
7.1. PROCEDIMIENTOS PARA LOS EJECUTORES Y CONSULTORES
DE OBRAS NACIONALES Y EXTRANJEROS DOMICILIADOS
(SUCURSAL)
7.1.1. Trmite de inscripcin
7.1.1.1. El proveedor deber realizar el pago de la tasa cuyo
monto se encuentra establecido en el TUPA del OSCE.
Al momento de realizar el pago en la entidad bancaria
autorizada, el proveedor deber indicar el nmero de
RUC y el registro en el cual desea inscribirse:
5HJLVWURGH(MHFXWRUHVGH2EUDVR
5HJLVWURGH&RQVXOWRUHVGH2EUDV
Estos datos estarn consignados en la constancia
de pago o voucher que la entidad bancaria genere.
Es responsabilidad del proveedor verificar que en
la constancia de pago o voucher est consignado
correctamente el nmero de RUC y el registro elegido
para inscribirse, antes de dar su conformidad a la
operacin.
7.1.1.2. Transcurridos dos (2) das hbiles de realizado el pago
de la tasa, el proveedor podr ingresar a la Bandeja de
0HQVDMHVTXHVHHQFXHQWUDHQODRSFLyQ2SHUDFLyQ
HQ/tQHD&RQFODYH513GHODSiJLQDZHEGHO513
a la que deber acceder por nica vez digitando su
RUC y nmero de voucher o constancia de pago.
Una vez validados los datos registrados, recibir en
VXEDQGHMDGHPHQVDMHVOD&ODYHGHO513ODTXH
le permitir participar en los procesos de seleccin
electrnicos.
(OSURYHHGRUGHEHUiLQJUHVDUD7UiPLWHVHQ/tQHD
ubicado en la opcin Operacin en Lnea Con clave
513GHODSiJLQDZHEGHO513GLJLWDQGRVXQ~PHUR
de RUC y su clave del RNP con la finalidad de acceder
ANEXOS
318
al formulario electrnico de Solicitud de Inscripcin/
5HQRYDFLyQSDUD(MHFXWRUR&RQVXOWRUGH2EUDVHQ
el cual deber completar los datos solicitados y grabar
la informacin registrada; luego deber imprimir el
formulario electrnico y el rtulo de envo.
A partir del da siguiente de grabar en el sistema los
datos del formulario electrnico, podr presentarlo
adjuntando los requisitos segn el TUPA del OSCE,
de forma presencial o mediante correo postal en la
Sede Central o en las Oficinas Zonales del OSCE.
7.1.1.4. Al da siguiente de ingresada la documentacin en el
OSCE se inicia el trmite de inscripcin, generndose
adems la Constancia de Inscripcin en el RNP para
VHUSDUWLFLSDQWH\SRVWRUODFXDOSXHGHVHUREWHQLGD
por el proveedor digitando su nmero de RUC en la
RSFLyQ ,PSULPLU &RQVWDQFLD GH OD SiJLQD ZHE GHO
RNP. La vigencia de esta constancia es de treinta
(30) das hbiles, pudindose extender por diez (10)
das hbiles ms cuando el trmite observado sea
subsanado en los ltimos cinco (5) das hbiles del
procedimiento.
7.1.1.5. Dentro del plazo de resolucin del trmite, se enviar
al proveedor una notificacin electrnica a su bandeja
de mensajes informndole sobre el resultado de
la evaluacin. Si el resultado de la evaluacin es
aprobado, finaliza el procedimiento.
Al da siguiente de la aprobacin se genera la
Constancia de inscripcin para ser participante, postor
\FRQWUDWLVWDFRQXQDYLJHQFLDGHXQDxR'LFKD
constancia puede ser obtenida digitando el nmero de
58&HQODRSFLyQ,PSULPLU&RQVWDQFLDGHODSiJLQD
web del RNP.
7.1.1.6. Si producto de la evaluacin se advierte que la
informacin presentada est incompleta o errada, el
trmite de inscripcin pasar al estado de observado,
pudiendo el proveedor subsanar dentro del plazo
mximo de treinta (30) das hbiles siguientes de
presentada la solicitud. Esta situacin ser comunicada
mediante una notificacin electrnica a la bandeja de
mensajes del proveedor, para que proceda conforme
lo establecido en el numeral 7.3. Subsanacin de
2EVHUYDFLRQHVGHODV'LVSRVLFLRQHV(VSHFtILFDVGH
la presente Directiva.
7.1.1.7. Si el proveedor no cumple con presentar la totalidad
de la documentacin exigida en el TUPA del
OSCE o efectuar las correcciones en los plazos
319
ANEXOS
antes sealados, no se considerar conforme el
cumplimiento de los requisitos y, por consiguiente, su
trmite se declarar no aprobado. El proveedor podr
presentar el recurso impugnativo correspondiente.
7.1.2. Trmite de renovacin de inscripcin
7.1.2.1. El proveedor nacional y extranjero domiciliado inscrito
en el RNP, podr iniciar su trmite de renovacin de
inscripcin abonando la tasa correspondiente en los
bancos autorizados, desde los sesenta (60) ltimos
das antes del vencimiento de la vigencia de su
inscripcin. De efectuarse el pago sin encontrarse en
el plazo sealado, el sistema del RNP considerar
HO SDJR FRPR GXSOLFLGDG HQ HO UHJLVWUR HQ TXH VH
encuentre inscrito, no siendo viable el inicio del trmite
de renovacin; en este caso, el proveedor podr
solicitar la devolucin de la tasa respectiva.
7.1.2.2. Transcurridos dos (2) das hbiles de realizado el
pago de la tasa correspondiente, el proveedor podr
LQJUHVDUD%DQGHMDGH0HQVDMHVRSFLyQ2SHUDFLyQ
HQ/tQHD&RQFODYH513GHODSiJLQDZHEGHO513
y seguir el procedimiento indicado para el trmite de
inscripcin indicado en el numeral 7.1.1 del presente
acpite.
En caso que el trmite de renovacin de inscripcin se
apruebe cuando an se encuentre vigente el trmite
anterior, la vigencia de la renovacin se iniciar al da
siguiente de haber vencido la vigencia del primero de
ellos.
7.1.3. Trmites de aumento de capacidad mxima de contratacin,
ampliacin de especialidad e inscripcin de subcontratos
7.1.3.1. El proveedor deber efectuar el pago de la tasa en
cualquiera de las entidades bancarias habilitadas para
tal efecto.
7.1.3.2. El proveedor deber descargar el formulario
Solicitud para Aumento de Capacidad/Ampliacin
GH (VSHFLDOLGDG (MHFXWRU R &RQVXOWRU GH 2EUDV
el cual se encuentra publicado en la pgina web
GHO 513 2ULHQWDFLyQ DO XVXDULR VHOHFFLRQDQGR OD
RSFLyQ)RUPXODULRV5137UDWiQGRVHGHOWUiPLWHGH
inscripcin de subcontratos, descargar el formulario
6ROLFLWXGSDUDLQVFULSFLyQGHVXEFRQWUDWR
7.1.3.3. El proveedor deber consignar toda la informacin
solicitada en los formularios antes indicados, segn
corresponda. Luego presentar, en la Sede Central
u Oficinas Zonales del OSCE, todos los requisitos
ANEXOS
320
exigidos en el TUPA del OSCE, inicindose el trmite
al da siguiente de su presentacin.
7.1.3.4. Dentro del plazo de resolucin del trmite, se
comunicar al proveedor sobre el resultado de la
evaluacin a travs de su bandeja de mensajes;
asimismo, se podr verificar el resultado desde la
pgina web del RNP Consultas en Lnea Sin clave
513 RSFLyQ (VWDGR GH 7UiPLWH (MHFXWRUHV \
&RQVXOWRUHV
Si el trmite es aprobado se finaliza el procedimiento
y se modificar la Constancia de Inscripcin para
VHUSDUWLFLSDQWHSRVWRU\FRQWUDWLVWDFRQVLJQiQGRVH
la nueva capacidad de contratacin o nuevas
especialidades, segn corresponda, y a la cual podr
acceder el proveedor a travs de la pgina web del
513HQODRSFLyQ,PSULPLU&RQVWDQFLD
En el caso de inscripcin de subcontrato, la constancia
es expedida de forma fsica, realizndose su entrega
de forma personal en la Sede Central u Oficinas
Zonales del OSCE.
7.1.3.5. Si luego de la evaluacin realizada se advierte que la
informacin presentada est incompleta o errada, el
trmite pasar al estado de observado, pudiendo el
proveedor subsanar la observacin dentro del plazo
de treinta (30) das hbiles siguientes de presentada
la solicitud. Esta situacin ser comunicada mediante
una notificacin electrnica a la bandeja de mensajes
proveedor, as como a travs de la pgina web del RNP
&RQVXOWDVHQ/tQHD6LQFODYH513GHQWURGHOD
RSFLyQ(VWDGRGH7UiPLWH(MHFXWRUHV\&RQVXOWRUHV
para que proceda conforme lo establecido en el
DFiSLWH6XEVDQDFLyQGH2EVHUYDFLRQHVGHODV
Disposiciones Especficas de la presente Directiva.
7.1.3.6. Si el proveedor no cumple con presentar la totalidad
de la documentacin exigida en el TUPA del
OSCE o efectuar las correcciones en los plazos
antes sealados, no se considerar conforme el
cumplimiento de los requisitos y, por consiguiente, su
trmite se declarar no aprobado. El proveedor podr
presentar el recurso impugnativo correspondiente.
7.2. PROCEDIMIENTO DE INSCRIPCIN Y RENOVACIN DE
EJECUTORES Y CONSULTORES DE OBRAS EXTRANJEROS NO
DOMICILIADOS
7.2.1. Trmite de inscripcin
7.2.1.1. El trmite puede ser realizado por un apoderado o
321
ANEXOS
representante legal, segn sea el caso. Para tal efecto,
deber contar con poder vigente (con facultades
suficientes para representarlo en procedimientos
administrativos) debidamente inscrito en los Registros
Pblicos del Per.
La copia simple del citado poder deber contar con una
antigedad no mayor a sesenta (60) das calendario
a la fecha de presentacin de la solicitud.
7.2.1.2. El apoderado o representante legal deber efectuar el
trmite de manera presencial, acercndose a la Sede
Central del OSCE, donde ser atendido por personal
del RNP, quien luego de verificar el contenido del poder
vigente dar su conformidad para que se realice el
pago de la tasa correspondiente en la caja de la Sede
Central del OSCE.
7.2.1.3. Transcurridos dos (2) das hbiles, el apoderado
o representante se acercar a la Sede Central del
OSCE, siendo que personal del RNP le entregar el
&yGLJRGHH[WUDQMHURQRGRPLFLOLDGR\OD&ODYHGHO
513
7.2.1.4. El apoderado o representante legal deber ingresar
DODRSFLyQ7UiPLWHVHQ/tQHDXELFDGRHQODSiJLQD
ZHEGHO5132SHUDFLyQHQ/tQHD&RQFODYH513
GLJLWDQGR VX &yGLJR GH H[WUDQMHUR QR GRPLFLOLDGR
y su clave del RNP con la finalidad de acceder al
formulario electrnico, en el cual deber completar los
datos solicitados y grabar la informacin registrada;
imprimiendo el formulario electrnico y el rtulo de
envo.
7.2.1.5. A partir del da siguiente de registrado el formulario
electrnico, deber ser presentado en la Sede Central
o en las Oficinas Zonales del OSCE, debidamente
firmado por el apoderado o representante legal, junto
con los dems requisitos sealados en el TUPA del
OSCE; la presentacin podr ser personal o mediante
correo postal.
7.2.1.6. Al da siguiente de ingresada la documentacin en el
OSCE se inicia el trmite de inscripcin, generndose
adems la Constancia de Inscripcin en el RNP para
VHUSDUWLFLSDQWH\SRVWRUODFXDOSXHGHVHUREWHQLGD
por el proveedor digitando su Cdigo de extranjero no
GRPLFLOLDGRHQODRSFLyQ,PSULPLU&RQVWDQFLDGHOD
pgina web del RNP. La vigencia de esta constancia es
de treinta (30) das hbiles, pudindose extender por
diez (10) das hbiles ms cuando el trmite observado
sea subsanado en los ltimos cinco (5) das hbiles
ANEXOS
322
del procedimiento.
7.2.1.7. Luego, el procedimiento de inscripcin ser
exactamente igual al procedimiento de inscripcin
de ejecutores y consultores de obras nacionales y
extranjeros domiciliados (sucursal) establecido en el
numeral 7.1.1. del presente acpite.
7.2.2. Trmite de renovacin
7.2.2.1. El proveedor inscrito en el RNP podr iniciar su trmite
de renovacin abonando la tasa correspondiente
en los bancos autorizados, desde los sesenta (60)
ltimos das antes del vencimiento de la vigencia de
su inscripcin. De efectuarse el pago sin encontrarse
en el plazo sealado, el sistema del RNP considerar
HO SDJR FRPR GXSOLFLGDG HQ HO UHJLVWUR HQ TXH VH
encuentre inscrito, no siendo viable el inicio del trmite
de renovacin; en este caso, el proveedor podr
solicitar la devolucin de la tasa respectiva.
7.2.2.2. Transcurridos dos (2) das hbiles de realizado el
pago de la tasa, el proveedor podr ingresar a la
pgina web del RNP Operacin en Lnea Con
FODYH 513 RSFLyQ %DQGHMD GH 0HQVDMHV \
seguir el procedimiento indicado para el trmite de
inscripcin de proveedores extranjeros no domiciliados
establecido en el numeral 7.2.1. del presente acpite.
En caso que el trmite de renovacin se apruebe
cuando an se encuentre vigente el trmite anterior,
la vigencia de la renovacin se iniciar al da siguiente
de haber vencido la vigencia del trmite anterior
(inscripcin o renovacin).
7.2.3. Trmites de aumento de capacidad mxima de contratacin,
ampliacin de especialidad e inscripcin de subcontratos
Se proceder conforme lo sealado en numeral 7.1.3. del
presente acpite.
7.3. SUBSANACIN DE OBSERVACIONES
Si el trmite de inscripcin, renovacin de inscripcin, aumento de
capacidad de contratacin, ampliacin de especialidad e inscripcin
de subcontratos es observado por la falta de un requisito o por la
incongruencia detectada en la informacin presentada, deber tenerse
en cuenta lo siguiente:
7.3.1. Cuando la observacin sea sobre el contenido del formulario
electrnico:
El proveedor deber subsanar las observaciones formuladas al
trmite correspondiente, corrigiendo la informacin contenida
en el formulario electrnico que se encuentra publicado en la
SiJLQDZHEGHO513RSFLyQ7UiPLWHVHQ/tQHDLPSULPLUOR\
presentarlo en sobre cerrado, en forma presencial o mediante
323
ANEXOS
correo postal en la Sede Central u Oficinas Zonales del OSCE.
Tratndose del aumento de capacidad mxima de contratacin,
ampliacin de especialidad e inscripcin de subcontratos, debe
descargarse el formulario que corresponda al trmite para
proceder a subsanar las observaciones formuladas, imprimirlo
y presentarlo con las correcciones solicitadas en sobre cerrado,
en forma presencial o mediante correo postal, en la Sede Central
u Oficinas Zonales del OSCE.
7.3.2. Cuando la observacin se encuentre referida a otros
requisitos establecidos en el TUPA del OSCE:
El proveedor deber presentar los requisitos que fueron
observados, ya sea en forma presencial o mediante correo postal
en la Sede Central u Oficinas Zonales del OSCE.
El proveedor podr subsanar las observaciones dentro de un
plazo que no exceder de los treinta (30) das hbiles siguientes
de presentada la solicitud. De no cumplir con subsanar las
observaciones formuladas dentro del plazo antes indicado,
no se considerar conforme el cumplimiento de los requisitos
exigidos en el TUPA del OSCE y como consecuencia el trmite se
declarar no aprobado, notificndose tal situacin a su bandeja
de mensajes, pudiendo interponer recurso de impugnacin.
VIII. DISPOSICIONES COMPLEMENTARIAS
8.1. Los documentos provenientes del extranjero debern contar con la
legalizacin respectiva del Consulado Peruano correspondiente al pas
de origen del documento, refrendado por el Ministerio de Relaciones
Exteriores en el Per o, en su defecto, con la Apostilla de la Haya.
Dichas formalidades debern constar en el documento proveniente del
extranjero y tener una antigedad no mayor de ciento cincuenta (150)
das calendario al momento de la presentacin del formulario fsico en
el RNP, contados a partir de la fecha de la legalizacin realizada por el
Ministerio de Relaciones Exteriores o, cuando corresponda, de la fecha
de legalizacin de la Apostilla. De ser el caso, debern contar con su
respectiva traduccin simple con indicacin del nombre y apellidos del
traductor. La legalizacin deber constar en el documento original.
8.2. Slo se podrn inscribir en el RNP aquellos subcontratos que cumplan
con lo establecido en el artculo 146 del Reglamento, debiendo el
subcontratista contar con inscripcin vigente en el RNP.
IX. DISPOSICIONES TRANSITORIAS
9.1. A las empresas inscritas en el RNP con anterioridad al 20 de setiembre
de 2012 y que inicien su trmite de aumento de capacidad mxima de
contratacin a partir de dicha fecha, se les aplicar lo previsto por el
ANEXOS
324
artculo 275 del Reglamento.
9.2. A partir del 20 de septiembre de 2012 las empresas que se encuentren
inscritas en el RNP con anterioridad a esta fecha, no estn obligadas
a comunicar la renuncia y/o la variacin del plantel tcnico, cuando la
renuncia se produzca luego del da sealado.
9.3. Con relacin a la acreditacin del plantel tcnico de aquellos proveedores
que se registraron con anterioridad al 20 de setiembre de 2012, el
RNP proceder a la cancelacin de la inscripcin o disminucin de la
capacidad mxima de contratacin, segn corresponda, si la renuncia
del plantel tcnico se produjo antes del 20 de setiembre de 2012 y
el proveedor no cumple con realizar el trmite de comunicacin de
renuncia y/o variacin del plantel tcnico, independientemente si el RNP
tom conocimiento de la renuncia con anterioridad o posterioridad a la
mencionada fecha. En ese sentido, si la renuncia del plantel tcnico
se produce a partir de la vigencia del Reglamento, no proceder la
cancelacin de su inscripcin o disminucin de su capacidad mxima
de contratacin.
9.4. Las notificaciones de los procedimientos de aumento de capacidad
mxima de contratacin, ampliacin de especialidad, inscripcin de
subcontrato y resoluciones de los recursos de reconsideracin que se
interpongan, ser realizada de manera electrnica en la bandeja de
mensajes, en la medida que esta sea implementada en el sistema del
RNP de manera progresiva. En tanto no se culmine la implementacin
antes mencionada, la notificacin de dichos procedimientos ser
realizada al domicilio del proveedor, de su apoderado o de su
representante legal fijado en el formulario correspondiente.
9.5. Los procedimientos seguidos ante el RNP con anterioridad al 20 de
setiembre de 2012 que se encuentren en evaluacin, debern cumplir
con lo dispuesto en la normativa vigente al momento de la presentacin
de su solicitud.
9.6. El reclculo de la capacidad mxima de contratacin al que se hace
referencia en el artculo 274 del Reglamento, cuando el proveedor
solicite la renovacin de su inscripcin despus de cinco (5) aos,
tambin ser aplicable a aquellos proveedores inscritos con anterioridad
al 20 de setiembre de 2012.
X. DISPOSICIONES FINALES
1. El trmite para los ejecutores y consultores de obras nacionales,
extranjeros domiciliados (sucursal) y extranjeros no domiciliados (matriz)
iniciar al da siguiente de recibida la documentacin en fsico en la Sede
Central del OSCE o en cualquiera de sus Oficinas Zonales.
2. Las validaciones diarias en el sistema del RNP despus del inicio del
trmite son las siguientes:
a) No estar inhabilitado para contratar con el Estado.
b) No estar anulado por fiscalizacin.
325
ANEXOS
Si el RNP identifica que el trmite se encuentra en alguno de los
supuestos antes indicados, notificar automticamente al proveedor a
travs de la bandeja de mensajes lo siguiente: trmite no aprobado por
LQKDELOLWDFLyQ\RLPSHGLPHQWR
3. El formulario electrnico presentado va web tiene el carcter de
declaracin jurada, por lo que el proveedor solicitante al hacer uso de
la clave del RNP que le fue asignada, es responsable de la informacin
que se consigne en dicho formulario, bajo sancin de ser inhabilitado
para contratar con el Estado, conforme a lo prescrito por la Ley y su
Reglamento.
4. Tratndose de capitales, depsitos o contratos de obras celebrados en
moneda extranjera, se determinar su equivalente en Nuevos Soles
utilizando el factor de conversin del promedio ponderado de venta de
la Superintendencia de Banca y Seguros y AFP publicado en su portal
web institucional, a la fecha del llenado del formulario electrnico (datos
completos). Para el clculo del financiamiento de operaciones en el
territorio nacional, el tipo de cambio a ser utilizado es el de la fecha de
suscripcin del formato correspondiente consignado en el TUPA del
OSCE.
5. La presente Directiva regir a partir de la entrada en vigencia de la Ley
N 29873, que modifica la Ley de Contrataciones del Estado, y el Decreto
Supremo N 138-2012-EF, que modifica el Reglamento de la Ley de
Contrataciones del Estado.
-HV~V0DUtDVHWLHPEUHGH

ANEXOS
326
DIRECTIVA N 012-2012-OSCE/CD
PROCEDIMIENTO Y PLAZOS PARA LA INSCRIPCIN Y RENOVACIN
DE INSCRIPCIN DE PROVEEDORES DE BIENES Y/O SERVICIOS EN EL
REGISTRO NACIONAL DE PROVEEDORES (RNP)
I. FINALIDAD
Establecer los lineamientos respecto al procedimiento y plazos aplicables en los
trmites de inscripcin y renovacin de los proveedores de bienes y/o servicios
en el Registro Nacional de Proveedores, en adelante RNP.
II. OBJETO
Implementar los mecanismos administrativos necesarios para la aplicacin de
los procedimientos establecidos en los artculos 261 y 263 del Reglamento de
la Ley de Contrataciones del Estado, aprobado mediante Decreto Supremo N
184-2008-EF.
III. ALCANCE
La presente directiva es de aplicacin obligatoria para:
/RV SURYHHGRUHV GH ELHQHV \R VHUYLFLRV QDFLRQDOHV \ H[WUDQMHURV
domiciliados.
/RVSURYHHGRUHVGHELHQHV\RVHUYLFLRVH[WUDQMHURVQRGRPLFLOLDGRVFRQ
apoderado o representante legal en el Per.
/RVSURYHHGRUHVGHELHQHV\RVHUYLFLRVH[WUDQMHURVQRGRPLFLOLDGRVVLQ
apoderado o representante legal en el Per.
/RV SURYHHGRUHV IDEULFDQWHV H[WUDQMHURV GH ELHQHV VRILVWLFDGRV QR
domiciliados sin apoderado o representante legal en el Per.
IV. BASE LEGAL
/H\ GH &RQWUDWDFLRQHV GHO (VWDGR DSUREDGD PHGLDQWH 'HFUHWR
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGDPHGLDQWH
'HFUHWR6XSUHPR1()
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado (OSCE), aprobado mediante Resolucin
Ministerial N 789-2011-EF/10.
/H\1/H\GHO3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
7H[WRQLFRGH3URFHGLPLHQWRV$GPLQLVWUDWLYRVGHO2UJDQLVPR6XSHUYLVRU
de las Contrataciones del Estado OSCE, aprobado por el Decreto
Supremo N 292-2009-EF.
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
327
ANEXOS
V. REFERENCIAS
Ley: Ley de Contrataciones del Estado.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
Pgina web del RNP: www.rnp.gob.pe.
Proveedor: Proveedor de bienes o proveedor de servicios.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
RNP: Registro Nacional de Proveedores.
RUC: Registro nico de Contribuyente.
TUPA: Texto nico de Procedimientos Administrativos.
VI. DISPOSICIONES GENERALES
6.1. CONSIDERACIONES PREVIAS
a) El proveedor, persona natural o jurdica, de acuerdo a las
actividades que realiza, podr inscribirse en el Registro de
Proveedores de Bienes o en el Registro de Proveedores de
Servicios, segn corresponda.
En el caso de personas jurdicas, el objeto social establecido en la
escritura pblica, inscrito en Registros Pblicos o en la institucin o
autoridad competente en el lugar de origen, cuando corresponda,
deber estar referido a las actividades consideradas en el registro
que desee solicitar su inscripcin o renovacin.
b) Los procedimientos de inscripcin y renovacin de inscripcin en
los Registros de Bienes y Servicios son de aprobacin automtica.
c) Los requisitos para los procedimientos de inscripcin y renovacin
de inscripcin en el RNP se encuentran establecidos en el TUPA
del OSCE.
d) El proveedor podr efectuar el pago de la tasa correspondiente
en cualquiera de las entidades bancarias autorizadas, cuya
relacin se encuentra publicada en la pgina web del RNP. Los
proveedores no domiciliados debern realizar el pago de la tasa
en la Sede Central del OSCE.
e) El domicilio del proveedor nacional o extranjero domiciliado es el
que declar en la SUNAT y del proveedor extranjero no domiciliado
es aquel que declar en el formulario electrnico del RNP.
6.2. NOTIFICACIONES AL PROVEEDOR
6.2.1. Las notificaciones al proveedor se realizarn a su bandeja
de mensajes, para ello deber ingresar a la pgina web del
513RSFLyQ%DQGHMDGHPHQVDMHVODFXDOSXHGHXELFDUODHQ
2SHUDFLRQHVHQ/tQHDFRQFODYH513
3DUDDFFHGHUSRUSULPHUDYH]DVXEDQGHMDGHPHQVDMHV
el proveedor nacional o extranjero domiciliado, deber
ingresar su nmero de RUC y el nmero de voucher o
constancia de pago del banco. En lo sucesivo, deber
LQJUHVDUFRQOD&ODYHGHO513TXHOHVHUiQRWLILFDGDHQ
esta bandeja.
(OSURYHHGRUH[WUDQMHURQRGRPLFLOLDGRGHEHUiLQJUHVDUD
ANEXOS
328
su bandeja de mensajes con el Cdigo de Extranjero No
'RPLFLOLDGRTXHOHDVLJQDUiHO513\VX&ODYHGHO513
6.2.2. Cuando en la presente directiva se haga referencia al usuario
1~PHURGH58&\ODFODYHGHO513HQORVWUiPLWHVVHJXLGRV
por proveedores nacionales y extranjeros domiciliados, debe
HQWHQGHUVHDHVWHGHWDOOHFRPRHO&HUWLILFDGR6($&(HQYLUWXG
de lo dispuesto en el artculo 286 del Reglamento. Asimismo,
para los proveedores extranjeros no domiciliados el Certificado
6($&(HVWDUiFRQVWLWXLGRSRUHOXVXDULRFyGLJRGHH[WUDQMHUR
QRGRPLFLOLDGR\ODFODYHGHO513
6.3. ESTADO DE LOS TRMITES
El RNP considera los siguientes estados:
a) Aprobacin Automtica:
Cuando el RNP recibe va web o de manera fsica el formulario
electrnico del proveedor nacional o extranjero domiciliado o no
domiciliado, segn corresponda.
b) Control de requisitos conforme:
Cuando el RNP verific que el proveedor cumpli con presentar
los requisitos establecidos en el TUPA del OSCE y estos se
encuentran conformes.
c) Formulario recibido:
Cuando el proveedor nacional o extranjero domiciliado registra
sus datos completos en el formulario electrnico y cumple con
enviarlo va web.
d) Levantamiento de suspensin recibida:
Cuando el proveedor, cuyo trmite de inscripcin se encuentra
en estado de suspendido, cumple con levantar las observaciones
formuladas por el RNP y enva el formulario electrnico va web o
de manera fsica, dependiendo del caso.
e) Levantamiento de suspensin en evaluacin:
Cuando el RNP recibe va web o de manera fsica, de ser el caso,
el formulario electrnico mediante el cual el proveedor levanta las
observaciones formuladas.
f) Pago caduco:
Cuando el proveedor que ha pagado la tasa, no cumple con
registrar y enviar el formulario electrnico va web o de manera
fsica, dependiendo del caso, antes del vencimiento del plazo de
un (1) ao contado desde el da siguiente de la fecha de pago.
g) Subsanacin recibida:
Cuando el proveedor subsana las observaciones y cumple
con enviar el formulario electrnico de manera virtual o fsica,
dependiendo del caso.
h) Subsanacin en evaluacin:
Cuando el RNP recibe va web o de manera fsica, dependiendo
del caso, el formulario electrnico del proveedor mediante el cual
subsana las observaciones formuladas. Si el trmite es subsanado
329
ANEXOS
en los ltimos cinco (5) das hbiles del procedimiento, el plazo
de resolucin del mismo se extender por un plazo adicional de
diez (10) das hbiles.
i) Subsanacin evaluada no conforme:
Cuando el RNP durante el plazo de resolucin del trmite realiza
el control de los requisitos y verifica que estos se encuentran
incompletos o con informacin errada. De no existir ms plazo
de subsanacin el trmite pasar al estado de suspendido.
j) Trmite pendiente de envo de datos:
Cuando el proveedor nacional o extranjero domiciliado tiene
habilitado el formulario para su llenado y envo va web; o
tratndose del proveedor extranjero no domiciliado, cuando se
encuentre habilitado para la presentacin de la documentacin
en la Sede Central o en las Oficinas Zonales del OSCE.
k) Trmite observado:
Cuando el proveedor present los requisitos de inscripcin o
renovacin de manera incompleta o con informacin errada.
l) Trmite sin vigencia:
Cuando culmina la vigencia de un (1) ao.
m) Trmite suspendido:
Cuando el proveedor no cumpli con subsanar las observaciones
formuladas a su trmite de inscripcin o renovacin, dentro del
plazo de los treinta (30) das hbiles de iniciado. Mientras dure
esta suspensin, el proveedor no podr ser participante, postor
y/o contratista.
6.4. PLAZOS DE LOS PROCEDIMIENTOS
Los plazos de los procedimientos de inscripcin y renovacin de
inscripcin en el RNP son los siguientes:
6.4.1. Para la presentacin de requisitos:
(O SURYHHGRU QDFLRQDO R H[WUDQMHUR GRPLFLOLDGR SDUD
acceder al formulario electrnico cuenta con el plazo de un
(1) ao, despus del da siguiente de realizado el pago de
la tasa, plazo durante el cual podrn completar sus datos
y enviar el formulario va web.
(O SURYHHGRU H[WUDQMHUR QR GRPLFLOLDGR SDUD DFFHGHU DO
formulario electrnico cuenta con el plazo de un (1) ao,
despus del da siguiente de realizado el pago de la tasa
en caja del OSCE, plazo durante el cual podr completar
sus datos y presentar los requisitos en la Sede Central o
en las Oficinas Zonales del OSCE.
6.4.2. Para el control de requisitos:
(O SURYHHGRU QDFLRQDO R H[WUDQMHUR GRPLFLOLDGR LQLFLD VX
trmite al da siguiente del envo del formulario electrnico
va web. El plazo mximo para el control de requisitos es
de treinta (30) das hbiles, contados a partir del inicio del
trmite.
ANEXOS
330
(OSURYHHGRUH[WUDQMHURQRGRPLFLOLDGRLQLFLDVXWUiPLWHDO
da siguiente de la presentacin de los requisitos completos
en la Sede Central o en las Oficinas Zonales del OSCE. El
plazo para el control de requisitos del trmite es de treinta
(30) das hbiles, contados a partir del inicio del trmite.
(QFDVRTXHHOSURYHHGRUVXEVDQHODVREVHUYDFLRQHVHQORV
ltimos cinco (5) das hbiles del procedimiento, el plazo de
resolucin del trmite se extender por un plazo adicional
de diez (10) das hbiles.
6.4.3. Para la subsanacin de observaciones:
El proveedor cuyo trmite ha sido observado, podr subsanarlo
dentro de los treinta (30) das hbiles contados a partir del inicio
del trmite.
6.4.4. Para el levantamiento de la suspensin:
El proveedor podr levantar la suspensin dentro del plazo de un
(1) ao calendario, contado a partir del da del inicio del trmite.
6.4.5. Plazo de vigencia:
La vigencia de la inscripcin y/o renovacin de inscripcin en el
RNP es de un (1) ao. Dicha vigencia inicia al da siguiente del
envo del formulario electrnico va web o la presentacin fsica
de los requisitos completos en la Sede Central o en las Oficinas
Zonales del OSCE, segn corresponda.
6.5. CONTROL DE REQUISITOS EN LOS PROCEDIMIENTOS DE
INSCRIPCIN O RENOVACIN
Durante el control de requisitos en los procedimientos de inscripcin o
renovacin, el RNP verificar que el proveedor cumpla con presentar
los requisitos exigidos en el TUPA, lo cual incluir verificar que el
proveedor haya llenado el formulario electrnico en todos los campos
que correspondan a la naturaleza de la persona natural o jurdica.
Asimismo, durante la verificacin que efecte el RNP al formulario
electrnico har uso de la informacin en lnea del Registro Nacional
de Identificacin y Estado Civil (RENIEC), de la Superintendencia
Nacional de Registros Pblicos (SUNARP), as como de la informacin
proporcionada en la Superintendencia Nacional de Administracin
Tributaria (SUNAT), entre otros, que resulten necesarios, para efectos
de determinar que los proveedores se encuentren en pleno ejercicio de
sus derechos civiles (personas naturales) o constituidos conforme a Ley
(personas jurdicas).
El formulario electrnico presentado va web tiene el carcter de
declaracin jurada, sujetndose la informacin all consignada al principio
de presuncin de veracidad. En ese sentido, el proveedor, su apoderado
o representante legal, y/o la Entidad solicitante al utilizar el usuario y clave
del RNP asignados, son responsables de la informacin y el contenido
que se consigne en dicho formulario.
331
ANEXOS
6.6. CONSTANCIA DE INSCRIPCIN EN EL RNP PARA SER
PARTICIPANTE, POSTOR Y CONTRATISTA
Es el documento que acredita la inscripcin del proveedor en el RNP; es
obtenido de forma virtual al inicio del trmite de inscripcin o renovacin.
Para ello el proveedor deber ingresar a la pgina web del RNP, opcin
,PSULPLUFRQVWDQFLDODFXDOSXHGHXELFDUODHQ&RQVXOWDVHQ/tQHDVLQ
FODYH513GLJLWDQGRVXQ~PHURGH58&RHO&yGLJRGH([WUDQMHURQR
'RPLFLOLDGRVHJ~QVHDHOFDVR
Esta constancia mostrar la informacin de los registros vigentes del
proveedor en el RNP, su domicilio y el plazo de vigencia de la inscripcin.
En caso que el proveedor se encuentre inhabilitado para contratar con
el Estado, no podr obtener esta constancia.
6.7. IMPEDIMENTO E IMPROCEDENCIA DE LA INSCRIPCIN O
RENOVACIN DE INSCRIPCIN ANTE EL RNP
6.7.1. Los supuestos en los cuales el proveedor se encuentra impedido
para inscribirse o renovar su inscripcin en el RNP, son:
(OSURYHHGRUFRQLQKDELOLWDFLyQYLJHQWHSDUDFRQWUDWDUFRQ
el Estado. Este supuesto es verificado durante todo el
procedimiento de evaluacin.
(O SURYHHGRU FX\D LQVFULSFLyQ KD\D VLGR GHFODUDGD QXOD
por haber presentado documentacin falsa o informacin
inexacta al RNP, encontrndose impedido hasta que
transcurra el plazo de dos (2) aos de haber sido declarada
nula su inscripcin anterior como consecuencia de la accin
de fiscalizacin posterior. Los dos (2) aos se contabilizan
a partir de la fecha en que qued administrativamente firme
la resolucin que declar la nulidad.
6.7.2. Los supuestos en los cuales no resulta procedente el inicio del
procedimiento de inscripcin o renovacin en el RNP, son:
&XDQGR DO PRPHQWR GHO SDJR HO HVWDGR GHO 58& GHO
proveedor nacional o extranjero domiciliado no existe, o se
HQFXHQWUDHQVLWXDFLyQGHQRKDELGRRQRDFWLYRDQWHOD
SUNAT. Esta situacin se mantendr hasta que regularice
su estado, oportunidad en la que el proveedor debe iniciar
un nuevo trmite.
&XDQGRXQDSHUVRQDMXUtGLFDSDJDODWDVDGHXQDSHUVRQD
natural.
&XDQGRHOSDJRHIHFWXDGRQRFRLQFLGHFRQHOYROXPHQGH
ingresos y/o ventas brutas al ao anterior declarados en el
formulario electrnico.
&XDQGRHO58&FRQHOFXDOVHHIHFWXyHOSDJRFRUUHVSRQGD
a una Entidad del Estado.
&XDQGRVHSURGXFHXQDGXSOLFLGDGHQHOSDJR
&XDQGRHOSURYHHGRUWHQJDXQDPXOWDLPSDJDLPSXHVWD
por el OSCE o sea moroso en el pago del fraccionamiento
correspondiente.
ANEXOS
332
1R SURFHGHUi HO WUiPLWH GH UHQRYDFLyQ GH LQVFULSFLyQ
cuando el proveedor tenga un pago pendiente por reintegro.
6.8. IMPEDIMENTOS PARA SER PARTICIPANTE, POSTOR Y/O
CONTRATISTA
Debe precisarse que todo proveedor que desee ser participante, postor
y/o contratista, no deber encontrarse inmerso en los supuestos de
impedimentos establecidos en el artculo 10 de la Ley.
6.9. FISCALIZACIN POSTERIOR
Toda la documentacin o informacin presentada por el proveedor para
efectos de su inscripcin o renovacin de inscripcin tendr carcter
de declaracin jurada y podr ser sometida a un procedimiento de
fiscalizacin posterior, segn lo establecido en el artculo 32 de la Ley N
27444, Ley del Procedimiento Administrativo General, y en la directiva
aprobada por el OSCE sobre la materia.
El proveedor que presente documentos falsos o declaraciones juradas
con informacin inexacta, ser pasible, segn corresponda, de la nulidad
del trmite o inscripcin, de la inhabilitacin para contratar con el Estado
y del inicio de las acciones legales correspondientes, segn lo previsto
en la Ley N 27444 antes citada y dems normativa aplicable.
Asimismo, de advertirse que la informacin proporcionada por la Entidad
es falsa o inexacta, se declarar la nulidad del trmite y la cancelacin
de la inscripcin del proveedor extranjero no domiciliado sin apoderado
o representante legal, segn lo previsto en la Ley N 27444; sin perjuicio
de poner este hecho en conocimiento del Sistema Nacional de Control
para el deslinde de las responsabilidades que corresponda.
VII. DISPOSICIONES ESPECFICAS
7.1. PROCEDIMIENTO DE INSCRIPCIN Y RENOVACIN DE
INSCRIPCIN DE PROVEEDORES NACIONALES Y EXTRANJEROS
DOMICILIADOS
7.1.1. Procedimiento de inscripcin
7.1.1.1. El proveedor deber realizar el pago de la tasa, cuyo
monto se encuentra establecido en el TUPA del OSCE.
Al realizar el pago en la entidad bancaria autorizada,
el proveedor deber indicar el nmero de RUC y el
registro en el cual desea inscribirse:
5HJLVWURGH3URYHHGRUHVGH%LHQHV
5HJLVWURGH3URYHHGRUHVGH6HUYLFLRV
Estos datos estarn consignados en la constancia
de pago o voucher que la entidad bancaria genere.
Es responsabilidad del proveedor verificar que en
la constancia de pago o voucher est consignado
correctamente el nmero de RUC y el registro elegido
para inscribirse, antes de dar su conformidad a la
operacin.
7.1.1.2. Transcurridos dos (2) das hbiles de realizado el pago
333
ANEXOS
de la tasa correspondiente en la entidad bancaria
autorizada, el proveedor podr ingresar a la pgina
ZHEGHO513RSFLyQ%DQGHMDGH0HQVDMHVODFXDO
puede ubicarla en Operaciones en Lnea con clave
513 GLJLWDQGR VX Q~PHUR GH 58& \ Q~PHUR GH
voucher o constancia de pago. Una vez validados los
datos ingresados, recibir en su bandeja de mensajes
VX&ODYHGHO513
7.1.1.3. A continuacin, deber ingresar a la opcin Trmites
HQ/tQHDODFXDOSXHGHXELFDUODHQODSiJLQDZHE
GHO5132SHUDFLRQHVHQ/tQHDFRQFODYH513
digitando su nmero de RUC y su clave del RNP con la
finalidad de acceder al formulario electrnico Solicitud
de Inscripcin/Renovacin de Proveedores de Bienes
\R6HUYLFLRVHQHOFXDOGHEHUiFRPSOHWDUORVGDWRV
requeridos y grabar la informacin registrada.
7.1.1.4. Al da siguiente del envo del formulario electrnico va
web, se inicia el trmite y se genera la Constancia de
,QVFULSFLyQSDUDVHU3DUWLFLSDQWH3RVWRU\&RQWUDWLVWD
Esta constancia puede ser obtenida a partir del da
siguiente del envo del formulario a travs de la pgina
ZHE GHO 513 RSFLyQ ,PSULPLU FRQVWDQFLD OD FXDO
puede ubicarla en Consultas en Lnea sin clave
513SDUDHOORVyORVHUiQHFHVDULRGLJLWDUVXQ~PHUR
de RUC.
El plazo mximo para el control de requisitos del trmite
es de treinta (30) das hbiles contados a partir del
inicio del mismo.
7.1.1.5. Dentro del plazo para el control de requisitos, el RNP
enviar al proveedor una notificacin electrnica a su
bandeja de mensajes informndole sobre el resultado
de dicho control.
7.1.1.6. Si el resultado del control de requisitos es conforme,
finaliza el procedimiento de inscripcin.
7.1.1.7. Si en la evaluacin se advierte que la informacin
declarada est incompleta o errada, el trmite
pasar al estado de observado. Esta situacin ser
comunicada a la bandeja de mensajes asignada al
proveedor para que proceda conforme al numeral
6XEVDQDFLyQGHREVHUYDFLRQHVGHOSUHVHQWH
acpite.
7.1.1.8. Si el proveedor no cumpliera con efectuar las
correcciones en los plazos sealados para la
subsanacin de observaciones, no se considerar
conforme el cumplimiento de los requisitos, por lo que
se suspender la vigencia de su inscripcin. En ese
ANEXOS
334
sentido, no podr obtener la constancia de inscripcin
hasta que cumpla con subsanar las observaciones.
Esta situacin le ser comunicada a su bandeja de
mensajes, para que proceda conforme al numeral
6XEVDQDFLyQ GH VXVSHQGLGR GH SUHVHQWH
acpite.
7.1.1.9. Con la inscripcin suspendida, el proveedor no podr
ser participante, postor y/o contratista; bajo sancin
de ser inhabilitado conforme a lo prescrito en la Ley y
su Reglamento.
7.1.2. Procedimiento de renovacin
7.1.2.1. El proveedor inscrito en el RNP podr iniciar su trmite
de renovacin de inscripcin realizando el pago de la
tasa en los bancos autorizados, dentro de los ltimos
sesenta (60) das calendario previos al vencimiento de
la vigencia de su inscripcin. De efectuarse el pago,
con anterioridad a dicho plazo, el sistema del RNP no
generar la renovacin; en este caso, el proveedor
podr solicitar la devolucin de la tasa respectiva.
7.1.2.2. Transcurridos dos (2) das hbiles de realizado el pago
de la tasa, el proveedor podr ingresar a la Bandeja
GH 0HQVDMHV OD FXDO SXHGH XELFDUOD HQ OD SiJLQD
web del RNP, opcin Operaciones en Lnea con
&ODYH 513 D OD TXH GHEHUi DFFHGHU GLJLWDQGR VX
RUC y su Clave del RNP. Una vez validados los datos
ingresados, recibir en su bandeja de mensajes la
notificacin para dar inicio al trmite de renovacin.
7.1.2.3. Vencido el plazo sealado en el numeral anterior, el
procedimiento se sujeta a lo previsto para la inscripcin
de proveedores nacionales y extranjeros domiciliados
descrito en el numeral 7.1.1 del presente acpite.
7.1.2.4. En caso que el trmite de renovacin de inscripcin se
apruebe cuando an se encuentre vigente el trmite
anterior, la vigencia de la renovacin se iniciar al da
siguiente de haber vencido la vigencia del primero de
ellos.
7.1.2.5. El proveedor que se encuentre con su trmite
suspendido no podr renovar su inscripcin
anticipadamente.
7.1.3. Subsanacin de observaciones
7.1.3.1. Si el proveedor, durante el trmite de inscripcin o
renovacin, recibe en su bandeja de mensajes una
notificacin electrnica de que su trmite ha sido
observado, deber seguir los siguientes pasos:
(QODSiJLQDZHEGHO513HOSURYHHGRUHOHJLUi
OD RSFLyQ 7UiPLWHV HQ /tQHD OD FXDO SXHGH
335
ANEXOS
ubicarla en la pgina web del RNP, opcin
2SHUDFLRQHVHQ/tQHDFRQFODYH513GRQGH
podr acceder digitando su nmero de RUC y la
Clave del RNP. Seguidamente podr acceder al
formulario electrnico a efectos de subsanar las
observaciones notificadas.
3DUDTXHODVXEVDQDFLyQSURFHGDHOSURYHHGRU
deber realizar el envo del formulario electrnico
a travs del sistema.
7.1.3.2. El proveedor podr realizar la respectiva subsanacin
dentro del plazo notificado a su bandeja de mensajes,
el cual no exceder de los treinta (30) das hbiles
contados a partir del da de iniciado el trmite.
De no cumplir con presentar la subsanacin a
las observaciones, dentro del plazo indicado, no
se considerar conforme el cumplimiento de los
requisitos, por lo que el trmite pasar al estado de
suspendido, notificndose dicha situacin a su bandeja
de mensajes.
7.1.4. Subsanacin de suspendido
7.1.4.1. Si el proveedor, durante el trmite de inscripcin o
renovacin de inscripcin, recibe en su bandeja de
mensajes una notificacin electrnica sobre el estado
suspendido de su trmite, deber seguir los siguientes
pasos:
'HQWURGHODSiJLQDZHEGHO513HOSURYHHGRU
HOHJLUi OD RSFLyQ 7UiPLWHV HQ /tQHD OD FXDO
puede ubicarla en la pgina web del RNP, opcin
2SHUDFLRQHVHQ/tQHDFRQFODYH513GRQGH
podr acceder digitando su nmero de RUC y la
Clave del RNP. Seguidamente podr acceder al
formulario electrnico para proceder a subsanar
las observaciones notificadas.
3DUDTXHODVXEVDQDFLyQSURFHGDHOSURYHHGRU
deber realizar el envo del formulario electrnico
a travs del sistema.
7.1.4.2. El proveedor podr subsanar el estado de suspendido
dentro del plazo de un (1) ao calendario, contado
a partir del da de inicio del trmite. Si el proveedor
levanta la suspensin correctamente se activar su
vigencia el da calendario siguiente de la conformidad
de los requisitos. En la constancia de inscripcin se
visualizar los siguientes rangos de fechas:
a) Desde el inicio de la vigencia hasta la suspensin;
y,
b) Desde el da calendario siguiente de la conformidad
ANEXOS
336
del levantamiento de suspensin hasta el tiempo
que resta de su vigencia.
7.2. PROCEDIMIENTO DE INSCRIPCIN Y RENOVACIN DE
INSCRIPCIN DE PROVEEDORES EXTRANJEROS NO
DOMICILIADOS CON APODERADO O REPRESENTANTE LEGAL
7.2.1. Procedimiento de inscripcin
7.2.1.1. El apoderado o representante, segn sea el caso,
deber contar con poder vigente inscrito en los
Registros Pblicos del Per. Entre las facultades
otorgadas al apoderado o representante legal
deber encontrarse aquella referida a representar al
poderdante en procedimientos administrativos ante
Entidades Pblicas; as tambin presentar la escritura
pblica inscrita en la institucin o autoridad competente
en el lugar de origen, donde se consigne que el objeto
social se encuentra relacionado a las actividades
consideradas en el registro que desea inscribirse.
Luego de verificada la documentacin presentada, el
apoderado o representante legal proceder a realizar
el pago en efectivo de la tasa en la Caja de la Sede
Central del OSCE.
En caso se advierta que el proveedor ya se encuentra
inscrito en el registro solicitado o impedido para
inscribirse o renovar su inscripcin en el RNP, conforme
a lo establecido en el artculo 259 del Reglamento, no
proceder su inscripcin ni renovacin, informndose
al proveedor de dicha situacin.
7.2.1.2. Transcurridos dos (2) das hbiles de realizado el
pago, el representante o apoderado legal concurrir
a la Sede Central del OSCE donde personal del RNP
OHHQWUHJDUiHO&yGLJRGH([WUDQMHUR1R'RPLFLOLDGR
\OD&ODYHGHO513NLWGHXVXDULR
7.2.1.3. El apoderado o representante legal deber ingresar
DODSiJLQDZHEGHO513RSFLyQ7UiPLWHVHQ/tQHD
la cual puede ubicarla en Operaciones en Lnea
con clave RNP, digitando su Cdigo de extranjero
QRGRPLFLOLDGR\VXFODYHGHO513FRQODILQDOLGDG
de acceder al formulario electrnico Solicitud de
Inscripcin/Renovacin en el RNP Proveedor de
Bienes y/o Servicios Extranjero No Domiciliado con
$SRGHUDGRR5HSUHVHQWDQWH/HJDOHQHO3HU~HQHO
cual deber completar los datos solicitados y grabar
la informacin registrada.
7.2.1.4. A continuacin, deber imprimir el formulario
electrnico y el rtulo de envo. A partir del da siguiente
de completados los datos en el formulario electrnico,
337
ANEXOS
podr presentarlo, adjuntando los dems requisitos
segn el TUPA del OSCE, de manera personal o
mediante correo postal en la Sede Central o a las
Oficinas Zonales del OSCE. El formulario electrnico
deber estar suscrito por el apoderado o representante
legal que fue debidamente acreditado para el trmite.
7.2.1.5. El trmite de inscripcin se inicia al da siguiente de
ingresada la documentacin a la Sede Central o a
las Oficinas Zonales del OSCE. Al da siguiente de
la presentacin de la documentacin, se genera la
Constancia de Inscripcin para ser Participante,
3RVWRU \ &RQWUDWLVWD 'LFKD FRQVWDQFLD SXHGH VHU
obtenida a travs de la pgina web del RNP, opcin
,PSULPLU FRQVWDQFLD OD FXDO SXHGH XELFDUOD HQ
&RQVXOWDVHQ/tQHDVLQFODYH513GLJLWDQGRVX
&yGLJRGH([WUDQMHUR1R'RPLFLOLDGR
7.2.1.6. Dentro del plazo para el control de requisitos, se
enviar al proveedor una notificacin electrnica a su
bandeja de mensajes informndole sobre el resultado
de dicho control.
7.2.1.7. Si el resultado del control de requisitos es aprobado,
finaliza el procedimiento.
7.2.1.8. Si se advierte que la informacin presentada est
incompleta o errada, el trmite pasar al estado de
observado, esta situacin ser comunicada a la
bandeja de mensajes y el proveedor deber subsanar
las observaciones indicadas en la notificacin
electrnica, conforme al numeral 7.2.3 Subsanacin
GHREVHUYDFLRQHVGHOSUHVHQWHDFiSLWH
7.2.1.9. Si el proveedor no cumpliera con presentar la
totalidad de la documentacin exigida en el TUPA
del OSCE o efectuar las correcciones en los plazos
antes sealados, no se considerar conforme el
cumplimiento de los requisitos; por lo tanto, su trmite
pasar al estado de suspendido, lo que generar la
suspensin de la vigencia de su inscripcin y de la
Constancia de inscripcin para ser participante, postor
\FRQWUDWLVWDTXHREWXYRHOHFWUyQLFDPHQWHKDVWDTXH
cumpla con realizar dichos actos. Esta situacin ser
comunicada a su bandeja de mensajes para que
proceda conforme al numeral 7.2.4 Subsanacin de
VXVSHQGLGRGHSUHVHQWHDFiSLWH
7.2.1.10. Con la inscripcin suspendida, el proveedor no podr
ser participante, postor y/o contratista; bajo sancin
de ser inhabilitado conforme a lo prescrito en la Ley y
su Reglamento.
ANEXOS
338
7.2.2. Procedimiento de renovacin de inscripcin en el RNP
7.2.2.1. El proveedor inscrito en el RNP podr iniciar su trmite
de renovacin de inscripcin realizando el pago de la
tasa en los bancos autorizados, dentro de los ltimos
sesenta (60) das calendario previos al vencimiento de
la vigencia de su inscripcin. De efectuarse el pago,
con anterioridad a dicho plazo, el sistema del RNP
no generar la renovacin; en este caso, el proveedor
podr solicitar la devolucin de la tasa respectiva.
7.2.2.2. El trmite del procedimiento de renovacin se sujeta
al procedimiento de inscripcin de proveedores
extranjeros no domiciliados con apoderado o
representante legal descrito en el numeral 7.2.1 del
presente acpite. La Clave del RNP es la misma del
trmite de inscripcin; en caso el proveedor no contara
con dicha clave, deber realizar el trmite respectivo
para la obtencin de sta.
7.2.2.3. En el supuesto que el trmite de renovacin de
inscripcin se apruebe cuando an se encuentre
vigente el trmite anterior, la vigencia de la renovacin
se iniciar al da siguiente de haber vencido la vigencia
del primero de ellos.
7.2.2.4. El proveedor que se encuentre con su trmite
suspendido no podr renovar su inscripcin
anticipadamente.
7.2.2.5. Si al momento de realizar el trmite de renovacin, el
proveedor extranjero no domiciliado ya no cuenta con
apoderado o representante legal en el Per, y alguna
Entidad requiere contratar directamente con dicho
proveedor, podr realizarlo siguiendo lo establecido
en el acpite 7.3. de las Disposiciones Especficas de
la presente directiva.
7.2.3. Subsanacin de observaciones
7.2.3.1. Si el proveedor extranjero no domiciliado con
apoderado o representante legal recibe en su
bandeja de mensajes, una notificacin electrnica
comunicndole que su trmite de inscripcin o
renovacin ha sido observado, deber seguir los
siguientes pasos:
'HQWURGHODSiJLQDZHEGHO513HOSURYHHGRU
HOHJLUiODRSFLyQ7UiPLWHVHQ/tQHDODFXDOSXHGH
ubicarla en Operaciones en Lnea con Clave
513GRQGHSRGUiDFFHGHUGLJLWDQGRVX&yGLJR
GHH[WUDQMHURQRGRPLFLOLDGR\OD&ODYHGHO513
Seguidamente, podr acceder al formulario
electrnico Solicitud de Inscripcin/Renovacin
339
ANEXOS
para Proveedor de Bienes y/o Servicios Extranjero
No Domiciliado con Apoderado o Representante
/HJDOHQHO3HU~SDUDVXEVDQDUODVREVHUYDFLRQHV
notificadas.
$ FRQWLQXDFLyQ GHEHUi FRPSOHWDU ORV GDWRV
solicitados e imprimir el mencionado formulario.
A partir del da siguiente de completado este
formulario, el proveedor podr presentarlo, en
sobre cerrado y rotulado, de manera personal o
mediante correo postal a la Sede Central o a las
Oficinas Zonales del OSCE.
7.2.3.2. El proveedor podr subsanar las observaciones dentro
del plazo notificado a su bandeja de mensajes, el cual
no exceder de los treinta (30) das hbiles contado
a partir del da de inicio del trmite. De no cumplir
con presentar la subsanacin a las observaciones,
dentro del plazo antes indicado, no se considerar
conforme el cumplimiento de los requisitos y, como
consecuencia, el trmite de inscripcin pasar al
estado de suspendido, notificndose dicha situacin
a su bandeja de mensajes.
7.2.4. Subsanacin de suspendido
7.2.4.1. Si el proveedor extranjero no domiciliado con
apoderado o representante legal en el Per, durante
el trmite de inscripcin o renovacin, recibe en su
bandeja de mensajes una notificacin electrnica
comunicndole que su trmite ha sido suspendido,
deber seguir los siguientes pasos:
(QODSiJLQDZHEGHO513HOSURYHHGRUHOHJLUi
OD RSFLyQ 7UiPLWHV HQ /tQHD OD FXDO SXHGH
ubicarla en Operaciones en Lnea con clave
513GRQGHDFFHGHUiGLJLWDQGRVX&yGLJRGH
H[WUDQMHUR QR GRPLFLOLDGR \ OD &ODYH GHO 513
Seguidamente podr acceder al formulario
electrnico para proceder a subsanar las
observaciones notificadas.
$ FRQWLQXDFLyQ GHEHUi FRPSOHWDU ORV GDWRV
solicitados e imprimir el mencionado formulario. A
partir del da siguiente de completado el formulario,
podr presentarlo, en sobre cerrado y rotulado, de
manera personal o mediante correo postal a la
Sede Central o a las Oficinas Zonales del OSCE.
El formulario electrnico deber estar suscrito
por el apoderado o representante legal que fue
debidamente acreditado para el trmite.
7.2.4.2. El proveedor podr subsanar el estado de suspendido
ANEXOS
340
dentro del plazo que le resta de la vigencia de su
inscripcin. Si el proveedor levanta la suspensin
correctamente se activar su vigencia al da calendario
siguiente de la conformidad de los requisitos. En la
constancia de inscripcin se visualizar los siguientes
rangos de fechas:
a) Desde el inicio de la vigencia hasta la suspensin;
y,
b) Desde el da calendario siguiente de la conformidad
del levantamiento de suspensin hasta el tiempo
que resta de la vigencia.
7.3. PROCEDIMIENTO DE INSCRIPCIN Y RENOVACIN DE INCRIPCIN
DE PROVEEDORES EXTRANJEROS NO DOMICILIADOS SIN
APODERADO O REPRESENTANTE LEGAL EN EL PER
El presente procedimiento es de aplicacin para las Entidades que
requieran contratar directamente con proveedores extranjeros no
domiciliados que no cuentan con apoderado o representante legal en el
Per, la adquisicin de bienes sofisticados o la contratacin de servicios
especializados, que conlleve a la exoneracin del proceso de seleccin.
7.3.1. Procedimiento de inscripcin
7.3.1.1. La Entidad interesada en la inscripcin en el RNP de un
proveedor extranjero no domiciliado que no cuenta con
apoderado o representante legal en el Per, deber
realizarla de manera directa en la Sede Central del
OSCE.
A tal efecto, deber presentarse una carta poder
simple firmada por el Titular de la Entidad en la que
se identifique al funcionario pblico responsable del
trmite y copia de la resolucin o acuerdo que aprueba
la exoneracin. As tambin se presentar copia del
documento o cdula de identidad del proveedor o de
la escritura pblica inscrita en la institucin o autoridad
competente en el lugar de origen del proveedor; en
este ltimo caso se verificar que el objeto social se
encuentra relacionado a las actividades consideradas
en el registro que desea inscribirse.
Luego de verificada la documentacin presentada, la
Entidad proceder a efectuar el pago de la tasa en la
Caja de la Sede Central del OSCE, de acuerdo a lo
sealado en el TUPA del OSCE.
En caso se advierta que el proveedor ya se encuentra
inscrito en el registro solicitado o impedido para
inscribirse o renovar su inscripcin en el RNP,
conforme a lo establecido en el artculo 259 del
Reglamento, no proceder su inscripcin ante el RNP,
informndose de dicha situacin a la Entidad.
341
ANEXOS
7.3.1.2. Transcurridos dos (2) das hbiles del pago, la Entidad
concurrir a la Sede Central del OSCE donde el
personal del RNP le entregar el Cdigo de extranjero
QRGRPLFLOLDGR\OD&ODYHGHO513NLGGHXVXDULR
del proveedor interesado en inscribir en el RNP.
7.3.1.3. La Entidad deber ingresar a la opcin Trmites
HQ/tQHDODFXDOSXHGHXELFDUODHQODSiJLQDZHE
GHO5132SHUDFLRQHVHQ/tQHDFRQ&ODYH513
GLJLWDQGR HO &yGLJR GH H[WUDQMHUR QR GRPLFLOLDGR
y la Clave del RNP del proveedor con la finalidad
de acceder al formulario electrnico Solicitud de
Inscripcin/Renovacin en el RNP para Proveedor
de Bienes y/o Servicios Extranjero No Domiciliado sin
$SRGHUDGRR5HSUHVHQWDQWH/HJDOHQHO3HU~HQHO
cual deber completarse los datos solicitados y grabar
la informacin registrada.
7.3.1.4. A continuacin, deber imprimir el formulario
electrnico y el rtulo de envo. A partir del da siguiente
de completados los datos en el formulario electrnico,
podr presentarlo, adjuntando los dems requisitos
segn el TUPA del OSCE, de manera personal o
mediante correo postal en la Sede Central o a las
Oficinas Zonales del OSCE.
7.3.1.5. El trmite de inscripcin se inicia al da siguiente de
ingresada la documentacin a la Sede Central o a
las Oficinas Zonales del OSCE. Al da siguiente de
la presentacin de la documentacin, se genera la
Constancia de Inscripcin para ser Participante,
3RVWRU \ &RQWUDWLVWD 'LFKD FRQVWDQFLD SXHGH VHU
obtenida a travs de la pgina web del RNP, opcin
,PSULPLU FRQVWDQFLD OD FXDO SXHGH XELFDUOD HQ
&RQVXOWDV HQ /tQHD VLQ FODYH 513 GLJLWDQGR HO
&yGLJRGH([WUDQMHUR1R'RPLFLOLDGR
7.3.1.6. Dentro del plazo para el control de requisitos, se
enviar una notificacin electrnica a la bandeja
de mensajes del proveedor informndole sobre el
resultado de dicho control.
7.3.1.7. Si el resultado del control de requisitos es aprobado,
finaliza el procedimiento.
7.3.1.8. Si se advierte que la informacin presentada est
incompleta o errada, el trmite pasar al estado
de observado, esta situacin ser comunicada a
la bandeja de mensajes del proveedor y la Entidad
deber subsanar las observaciones indicadas en la
notificacin electrnica, conforme al numeral 7.3.3
6XEVDQDFLyQGHREVHUYDFLRQHVGHOSUHVHQWHDFiSLWH
ANEXOS
342
7.3.1.9. Si la Entidad no cumpliera con presentar la totalidad
de la documentacin exigida en el TUPA del
OSCE o efectuar las correcciones en los plazos
antes sealados, no se considerar conforme el
cumplimiento de los requisitos, por lo que el trmite
pasar al estado de suspendido, lo que generar
la suspensin de la vigencia de su inscripcin y de
la Constancia de Inscripcin para ser Participante,
3RVWRU\&RQWUDWLVWDREWHQLGDHOHFWUyQLFDPHQWHKDVWD
que cumpla con dichos actos. Esta situacin ser
comunicada a la bandeja de mensajes del proveedor
para que se proceda conforme al numeral 7.3.4
6XEVDQDFLyQGHVXVSHQGLGRGHOSUHVHQWHDFiSLWH
Con la inscripcin suspendida el proveedor no podr
ser participante, postor y/o contratista; bajo sancin
de ser inhabilitado conforme a lo prescrito en la Ley y
su Reglamento.
7.3.2. Procedimiento de renovacin
7.3.2.1. La Entidad podr iniciar el trmite de renovacin de
inscripcin del proveedor inscrito en el RNP dentro
de los ltimos sesenta (60) das calendario previos
al vencimiento de la vigencia de su inscripcin. De
efectuarse el pago con anterioridad a dicho plazo,
el sistema del RNP no generar la renovacin; en
este caso, se podr solicitar la devolucin de la tasa
respectiva.
7.3.2.2. El trmite del procedimiento de renovacin se sujeta
a lo dispuesto para el procedimiento de inscripcin
de proveedores extranjeros no domiciliados que no
cuentan con apoderado o representante legal en
el Per descrito en el numeral 7.3.1 del presente
acpite. La Clave del RNP es la misma del trmite de
inscripcin; en caso la Entidad no contara con dicha
clave, deber realizar el trmite respectivo para su
obtencin.
7.3.2.3. En el supuesto que el trmite de renovacin de
inscripcin se apruebe cuando an se encuentre
vigente el trmite anterior, la vigencia de la renovacin
se iniciar al da siguiente de haber vencido la vigencia
del primero de ellos.
7.3.2.4. No podr renovarse la inscripcin anticipadamente del
proveedor cuyo trmite se encuentre suspendido.
7.3.2.5. Si al momento de realizar el trmite de renovacin el
proveedor extranjero no domiciliado ya cuenta con
apoderado o representante legal en el Per, dicho
proveedor deber realizar el trmite segn el acpite
343
ANEXOS
7.2 de las Disposiciones Especficas de la presente
directiva.
7.3.3. Subsanacin de observaciones
7.3.3.1. Si la Entidad recibe en la bandeja de mensajes del
proveedor una notificacin electrnica comunicndole
que el trmite de inscripcin o renovacin ha sido
observado, deber seguir los siguientes pasos:
'HQWURGHOVLWLR:HEGHO513HOHJLUiODRSFLyQ
7UiPLWHVHQ/tQHDODFXDOSXHGHXELFDUODHQOD
pgina web del RNP Operaciones en Lnea con
FODYH 513 GRQGH SRGUi DFFHGHU GLJLWDQGR HO
&yGLJRGHH[WUDQMHURQRGRPLFLOLDGR\OD&ODYH
del RNP del proveedor. Seguidamente podr
acceder al formulario electrnico, para subsanar
las observaciones notificadas.
$ FRQWLQXDFLyQ GHEHUi FRPSOHWDU ORV GDWRV
solicitados e imprimir el mencionado formulario.
A partir del da siguiente de completado este
formulario, la Entidad podr presentarlo en sobre
cerrado y rotulado, directamente o mediante
correo postal a la Sede Central o a las Oficinas
Zonales del OSCE.
7.3.3.2. La Entidad podr subsanar las observaciones dentro
del plazo notificado a la bandeja de mensajes, el cual
no exceder de los treinta (30) das hbiles contado
a partir del da de inicio del trmite. De no cumplir
con presentar la subsanacin a las observaciones
dentro del plazo antes indicado, no se considerar
conforme el cumplimiento de los requisitos y, como
consecuencia, el trmite de inscripcin pasar al
estado de suspendido, notificndose dicha situacin
a la bandeja de mensajes.
7.3.4. Subsanacin de suspendido
7.3.4.1. Si la Entidad, durante el trmite de inscripcin o
renovacin del proveedor, recibe en la bandeja de
mensajes una notificacin electrnica comunicndole
que el trmite ha sido suspendido, deber seguir los
siguientes pasos:
(Q OD SiJLQD ZHE GHO 513 HOHJLUi OD RSFLyQ
7UiPLWHV HQ /tQHD OD FXDO SXHGH XELFDUOD HQ
la pgina web del RNP Operaciones en Lnea
FRQ &ODYH 513 GRQGH DFFHGHUi GLJLWDQGR
HO &yGLJR GH ([WUDQMHUR 1R 'RPLFLOLDGR \ OD
Clave del RNP. Seguidamente podr acceder al
formulario electrnico para proceder a subsanar
las observaciones notificadas.
ANEXOS
344
$ FRQWLQXDFLyQ GHEHUi FRPSOHWDU ORV GDWRV
solicitados e imprimir el mencionado formulario. A
partir del da siguiente de completado el formulario
podr presentarlo, en sobre cerrado y rotulado, de
manera directa o mediante correo postal a la Sede
Central o a las Oficinas Zonales del OSCE.
7.3.4.2. La Entidad podr subsanar el estado de suspendido
dentro del plazo que le resta de vigencia al proveedor.
Si se levanta la suspensin correctamente, se activar
la vigencia de inscripcin al da calendario siguiente
de la conformidad de los requisitos. En la constancia
de inscripcin se visualizar los siguientes rangos de
fechas:
a) Desde el inicio de la vigencia hasta la suspensin;
y,
b) Desde el da calendario siguiente de la conformidad
del levantamiento de suspensin hasta el tiempo
que resta de su vigencia.
7.4. PROCEDIMIENTO DE INSCRIPCIN Y RENOVACIN DE
INSCRIPCIN DE PROVEEDORES FABRICANTES EXTRANJEROS
DE BIENES SOFISTICADOS NO DOMICILIADOS SIN APODERADO
O REPRESENTANTE LEGAL EN EL PER
El presente procedimiento es de aplicacin para las Entidades que
requieran la participacin en los procesos de seleccin que lleven a
cabo, de proveedores extranjeros que fabriquen bienes sofisticados
y que brinden el servicio especializado de instalacin, ensamblaje,
mantenimiento, entre otros, segn sea necesario de acuerdo al tipo de
bien, y que no cuentan con apoderado o representante legal en el Per.
7.4.1. Procedimiento de inscripcin
7.4.1.1. La Entidad interesada en la inscripcin en el RNP de un
proveedor fabricante extranjero de bienes sofisticados
no domiciliado que no cuenta con apoderado o
representante legal en el Per, deber realizarla de
manera directa en la Sede Central del OSCE.
A tal efecto, deber presentarse una carta poder
simple firmada por el Titular de la Entidad en la que
se identifique al funcionario pblico responsable del
trmite y se consigne la descripcin y/o caractersticas
del bien sofisticado y, cuando sea necesario, del
servicio especializado. Asimismo, se debe adjuntar
copia del documento o cdula de identidad del
proveedor o de la escritura pblica inscrita en la
institucin o autoridad competente en el lugar de
origen del proveedor; en este ltimo caso se verificar
que el objeto social se encuentra relacionado a las
345
ANEXOS
actividades consideradas en el registro que desea
inscribirse.
Luego de verificada la documentacin presentada, la
Entidad proceder a efectuar el pago de la tasa en la
Caja de la Sede Central del OSCE, de acuerdo a lo
sealado en el TUPA del OSCE.
En caso se advierta que el proveedor ya se encuentra
inscrito en el registro solicitado o impedido para
inscribirse o renovar su inscripcin en el RNP,
conforme a lo establecido en el artculo 259 del
Reglamento, no proceder su inscripcin ante el RNP,
informndose de dicha situacin a la Entidad.
7.4.1.2. Transcurridos dos (2) das hbiles del pago, la Entidad
concurrir a la Sede Central del OSCE donde el
personal del RNP le entregar el Cdigo de Extranjero
1R'RPLFLOLDGR\OD&ODYHGHO513NLGGHXVXDULR
del proveedor interesado en inscribirse en el RNP.
7.4.1.3. La Entidad deber ingresar a la opcin Trmites
HQ/tQHDODFXDOSXHGHXELFDUODHQODSiJLQDZHE
GHO5132SHUDFLRQHVHQ/tQHDFRQ&ODYH513
GLJLWDQGR HO &yGLJR GH H[WUDQMHUR QR GRPLFLOLDGR
y la Clave del RNP del proveedor con la finalidad
de acceder al formulario electrnico Solicitud de
Inscripcin/Renovacin en el RNP para Proveedor
de Bienes y/o Servicios Extranjero No Domiciliado
Fabricante de Bienes Sofisticados sin Apoderado
R 5HSUHVHQWDQWH /HJDO HQ HO 3HU~ HQ HO FXDO
deber completarse los datos solicitados y grabar la
informacin registrada.
7.4.1.4. El procedimiento del trmite de inscripcin se sujeta
al procedimiento de inscripcin de proveedores
extranjeros no domiciliados sin apoderado
representante legal en el Per descrito en el numeral
7.3.1 del acpite 7.3 de las Disposiciones Especficas
de la presente directiva.
7.4.2. Procedimiento de renovacin
7.4.2.1. La Entidad podr iniciar el trmite de renovacin
de inscripcin del proveedor dentro de los ltimos
sesenta (60) das calendario previos al vencimiento
de la vigencia de su inscripcin. De efectuarse el pago
con anterioridad a dicho plazo, el sistema del RNP no
generar la renovacin; en este caso, se podr solicitar
la devolucin de la tasa respectiva.
7.4.2.2. El trmite del procedimiento de renovacin se sujeta
al procedimiento de inscripcin de proveedores
extranjeros no domiciliados que no cuentan con
ANEXOS
346
apoderado o representante legal en el Per descrito en
el numeral 7.3.2. del acpite 7.3. de las Disposiciones
Especficas de la presente directiva. La Clave del
RNP es la misma del trmite de inscripcin; en caso
la Entidad no contara con dicha clave, deber realizar
el trmite respectivo para su obtencin.
7.4.2.3. Si el trmite de renovacin de inscripcin se apruebe
cuando an se encuentre vigente el trmite anterior,
la vigencia de la renovacin se iniciar al da siguiente
de haber vencido la vigencia del primero de ellos.
7.4.2.4. No podr renovarse la inscripcin anticipadamente del
proveedor cuyo trmite se encuentre suspendido.
7.4.2.5. Si al momento de realizar el trmite de renovacin
el proveedor cuenta con apoderado o representante
legal en el Per, dicho proveedor deber realizar el
trmite siguiendo lo previsto en el acpite 7.2 de las
Disposiciones Especficas de la presente directiva.
7.4.3. Subsanacin de observaciones
La subsanacin de observaciones en el procedimiento de
inscripcin en el RNP del proveedor fabricante extranjero de
bienes sofisticados no domiciliado que no cuenta con apoderado
o representante legal en el Per se sujeta a lo dispuesto en el
numeral 7.3.3 del acpite 7.3 de las Disposiciones Especficas
de la presente directiva.
7.4.4. Subsanacin de suspendido
La subsanacin de suspendido en el procedimiento de inscripcin
en el RNP del proveedor fabricante extranjero de bienes
sofisticados no domiciliado que no cuenta con apoderado o
representante legal en el Per se sujeta a lo dispuesto en el
numeral 7.3.4 del acpite 7.3 de las Disposiciones Especficas
de la presente directiva.
VIII. DISPOSICIONES FINALES
1. Para iniciar el procedimiento de renovacin de inscripcin en los Registros
de Bienes y/o Servicios, los proveedores, de ser el caso, debern realizar
los pagos de reintegro existentes de trmites anteriores a ste. En la
medida que dichos trmites hayan culminado en el estado de suspendido,
caso contrario, no se generar el trmite de renovacin de inscripcin
en el registro o registros solicitados.
El trmite de renovacin no generado no ser habilitado cuando el
proveedor realice el pago por reintegro, puesto que ste deber realizar
un nuevo pago de la tasa para iniciar su trmite de renovacin de
inscripcin.
Respecto del pago realizado por el trmite no generado, el proveedor
podr solicitar la devolucin de la tasa ante la Oficina de Administracin
del OSCE.
347
ANEXOS
2. La evaluacin en los procedimientos de inscripcin y renovacin para
proveedores de bienes y/o servicios se realiza sobre la base del Principio
de Presuncin de Veracidad, establecido en el artculo IV, numeral 1.7
de la Ley N 27444, Ley del Procedimiento Administrativo General.
3. Los proveedores exceptuados de inscribirse en el RNP comprendidos en
el artculo 256 del Reglamento de la Ley de Contrataciones del Estado,
para poder interactuar con el SEACE, debern iniciar el trmite de
&UHDFLyQGH8VXDULR3URYHHGRU([FHSWXDGRFRQIRUPHDORVUHTXLVLWRV
fijados en el TUPA del OSCE.
4. A partir de la vigencia de la presente directiva, derguese las Directivas
N 005-2007-CONSUCODE/PRE y 007-2007-CONSUCODE/PRE.
5. La presente directiva regir a partir de la entrada en vigencia de la Ley N
29873, que modifica la Ley de Contrataciones del Estado, y el Decreto
Supremo N 138-2012-EF, que modifica el Reglamento de la Ley de
Contrataciones del Estado.
-HV~V0DUtDVHWLHPEUHGH
ANEXOS
348
DIRECTIVA N 013-2012-OSCE/CD
PROCEDIMIENTO DE DECLARACIN DEL RCORD DE EJECUCIN
Y CONSULTORA DE OBRAS EN EL REGISTRO NACIONAL DE
PROVEEDORES (RNP)
I. FINALIDAD
Desarrollar el procedimiento de declaracin del rcord de ejecucin y consultora
de obras en el Registro Nacional de Proveedores, en adelante RNP.
II. OBJETO
Regular la obligacin tanto del ejecutor como del consultor de obras de declarar
la informacin detallada de los contratos suscritos con las entidades del sector
pblico, y para el ejecutor de obras de declarar las respectivas valorizaciones
acumuladas hasta la culminacin de la obra, mediante el formulario oficial del
rcord de ejecucin o consultora de obras ante el RNP.
III. ALCANCE
La presente directiva es de aplicacin obligatoria para los ejecutores y consultores
de obras del RNP, independientemente del estado de la vigencia de su registro.
IV. BASE LEGAL
/H\ GH &RQWUDWDFLRQHV GHO (VWDGR DSUREDGD PHGLDQWH 'HFUHWR
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
'HFUHWR6XSUHPR1()
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado (OSCE), aprobado mediante Resolucin
Ministerial N 789-2011-EF/10.
/H\1/H\GHO3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
7H[WRQLFRGH3URFHGLPLHQWRV$GPLQLVWUDWLYRVGHO2UJDQLVPR6XSHUYLVRU
de las Contrataciones del Estado OSCE, aprobado por el Decreto
Supremo N 292-2009-EF.
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
V. REFERENCIAS
Ley: Ley de Contrataciones del Estado.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
Directiva: La presente directiva.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
RNP: Registro Nacional de Proveedores.
349
ANEXOS
VI. DEFINICIONES
Rcord de ejecucin de obras o de consultora de obras: Es la
declaracin efectuada por el ejecutor o consultor de obras, respecto de
los contratos que haya suscrito con las Entidades durante la vigencia de
su inscripcin en el RNP, dentro del marco de la Ley y el Reglamento.
En el caso del ejecutor de obra, incluye las respectivas valorizaciones
acumuladas, adicionales o deductivos si los hubiera, de cada contrato de
obra en ejecucin, desde la suscripcin del contrato hasta la culminacin
fsica de la obra.
Rectificacin de la declaracin del rcord: Es presentada por el
ejecutor o consultor de obras con la finalidad de corregir los datos de
una declaracin presentada con anterioridad.
Regularizacin de la declaracin del rcord: Es presentada por el
ejecutor o consultor de obras con la finalidad de subsanar la omisin de
no haber presentado su declaracin dentro del plazo de diez (10) das
hbiles siguientes del mes correspondiente.
VII. DISPOSICIONES GENERALES
7.1. Se encuentran obligados a realizar las declaraciones del rcord, todos
los ejecutores y consultores de obras con inscripcin en el RNP, sea
que esta se encuentre o no vigente.
7.2. La declaracin del rcord de ejecucin y consultora de obras se
realiza va web; y, excepcionalmente, de forma presencial, en los casos
sealados en el numeral 8.2 de la presente directiva.
7.3. La rectificacin o regularizacin de la declaracin del rcord de
consultora de obras podr realizarse, siempre que el consultor no haya
contratado por especialidades distintas a las otorgadas por el RNP.
En el caso que haya contratado por especialidades distintas, dicha
situacin debe ser comunicada al Tribunal de Contrataciones del Estado.
7.4. La rectificacin o regularizacin de la declaracin del rcord de
ejecucin de obras podr realizarse, siempre que la informacin a
rectificar o la omisin en la presentacin de la declaracin del rcord,
segn corresponda, no haya beneficiado al ejecutor en la suscripcin
de contratos por montos superiores a su capacidad mxima de
contratacin.
En el caso que haya contratado por montos superiores a su capacidad
mxima de contratacin, dicha situacin debe ser comunicada al
Tribunal de Contrataciones del Estado.
7.5. Slo es posible cancelar la declaracin de una obra que no ha terminado
de valorizarse, por motivos debidamente justificados.
VIII. DISPOSICIONES ESPECFICAS
8.1. DECLARACIN VA WEB DEL RCORD DE EJECUCIN Y
CONSULTORA DE OBRAS
8.1.1. Obligatoriedad
ANEXOS
350
El ejecutor y consultor de obras se encuentra obligado a efectuar
la declaracin electrnica a travs de la pgina web del RNP:
www.rnp.gob.pe.
La declaracin del rcord utilizando este medio se efecta de
manera gratuita.
8.1.2. Casos de declaracin va web
La declaracin del rcord de ejecucin y consultora de obras
va web se presenta en los siguientes casos:
a) Declaracin del rcord de ejecucin de obras
El ejecutor de obras debe efectuar la declaracin del rcord
dentro de los primeros diez (10) das hbiles siguientes al
trmino del mes en que se suscribieron los contratos, se
aprobaron obras adicionales y/o deductivos, y se efectuaron
las valorizaciones acumuladas del contrato de obra, segn
corresponda.
Si dentro del plazo establecido el ejecutor de obras no
hubiese efectuado ninguna declaracin, al dcimo primer
(11) da hbil el sistema del RNP automticamente realizar
la declaracin sin obras (declaracin en blanco). En ese
caso, y slo si el ejecutor de obras tuviera obras que
declarar, deber realizar la regularizacin del rcord de
ejecucin de obras.
b) Declaracin del rcord de consultora de obras
El consultor de obras debe efectuar la declaracin del rcord
dentro de los primeros diez (10) das hbiles siguientes al
trmino del mes en que se suscribieron los contratos de
consultora de obras.
Si dentro del plazo establecido el consultor de obras no
hubiese efectuado ninguna declaracin, al dcimo primer
(11) da hbil, el sistema del RNP automticamente realizar
la declaracin sin consultora de obras (declaracin en
blanco). En ese caso, y slo si el consultor de obras tuviera
contratos que declarar, deber realizar la regularizacin del
rcord de consultora de obras.
c) Rectificacin va web del rcord de ejecucin o
consultora de obras
El ejecutor o consultor de obras podr modificar por primera
vez la informacin registrada en el rcord, dentro del plazo
sealado en los literales a) y b) del presente numeral.
Para el caso del ejecutor de obra, esta rectificacin podr
realizarse siempre que no se haya emitido la Constancia
de Capacidad Libre de Contratacin.
8.1.3. Procedimiento
a) Para efectos de realizar la declaracin del rcord, el ejecutor
o consultor de obras debe ingresar a la pgina web del
RNP: www.rnp.gob.pe, seleccionar el enlace Operaciones
351
ANEXOS
HQ/tQHD&RQ&ODYH513\ODRSFLyQWUiPLWHVHQOtQHD
donde deber consignar su nmero de RUC y clave RNP.
b) Seguidamente, debe seleccionar la opcin rcord de
REUDV(VWDRSFLyQOHGDUiDFFHVRDODSDQWDOODGHLQLFLRGHO
mdulo de declaracin del rcord de ejecucin y consultora
de obras, en la cual se podr visualizar la seleccin
automtica que realiza el sistema del RNP, segn se trate
de ejecutor y/o consultor de obras. En caso el proveedor
se encontrase inscrito en ambos registros, la declaracin
debe efectuarse por separado.
c) El mdulo de declaracin de rcord de ejecucin y
consultora de obras presentar las siguientes opciones:
5HJLVWURGH5pFRUG
Esta opcin permite realizar la declaracin mensual
del rcord de ejecucin y consultora de obras y, de
ser el caso, la primera rectificacin dentro del plazo
para efectuar la declaracin del rcord. Incluye las
siguientes acciones:
i) Presentacin regular: La que se efecta dentro
de los primeros diez (10) das hbiles siguientes
al trmino de cada mes.
ii) Falta declarar rcord de obras: Detalla los meses
en los que no se ha cumplido con la declaracin
del rcord de obras y la fecha en que se requiere
efectuar la declaracin de la valorizacin del mes
actual. Adems, permite determinar los perodos
a regularizar, conforme a lo dispuesto en el
numeral 8.2, a efectos que se pueda declarar el
rcord en el mes correspondiente.
iii) Rectificacin de rcord: La primera rectificacin
que se realiza dentro del plazo para presentar
la declaracin del rcord. La nica que puede
realizarse va web.
5HSRUWHGH5pFRUG
Esta opcin permite visualizar todos los rcords
declarados va web y en forma presencial, ya sea
que el ejecutor o consultor de obra haya tenido o no
inscripcin vigente en el RNP.
8.2. DECLARACIN PRESENCIAL DEL RCORD DE EJECUCIN Y
CONSULTORA DE OBRAS
La Declaracin presencial del rcord de ejecucin y consultora de obras
se presenta en los casos de regularizacin del rcord y de rectificacin
del rcord.
a) Regularizacin del rcord de ejecucin de obras
El ejecutor de obras presenta la declaracin del rcord en forma
ANEXOS
352
extempornea, es decir, fuera del plazo de diez (10) das hbiles
sealado en el literal a) del numeral 8.1.2 de la presente directiva,
con el objeto de declarar los contratos de obra, as como las
valorizaciones acumuladas, adicionales y deductivos derivados
del contrato de obra. Para tal efecto, debe realizar el pago de la
tasa fijada en el TUPA del OSCE.
b) Regularizacin del rcord de consultora de obras
El consultor de obras presenta su declaracin del rcord en
forma extempornea, es decir, fuera del plazo de diez (10) das
hbiles sealado en el literal b) del numeral 8.1.2 de la presente
directiva, con el fin de declarar contratos de consultora de obra.
Para tal efecto, realiza el pago de la tasa fijada en el TUPA del
OSCE.
c) Rectificacin presencial del rcord de ejecucin o
consultora de obras, sujeto o no a pago de tasa establecido
en el TUPA del OSCE
Se realiza si dentro del plazo para presentar la declaracin
del rcord, el ejecutor o consultor de obras requiere modificar
por segunda vez o ms su declaracin del rcord. Asimismo,
cuando modifica su declaracin del rcord presentada en forma
extempornea.
El ejecutor o consultor de obras debe efectuar la rectificacin
realizando o no el pago de la tasa, de acuerdo a lo previsto en
el TUPA del OSCE.
c.1.) Rectificacin sujeta al pago de tasa
Si la rectificacin del rcord de ejecucin o consultora
de obras comprende la inclusin de nuevas obras o
consultoras de obras, segn sea el caso, o la modificacin
de los montos contratados y/o montos valorizados, segn
corresponda, que fueron comunicados errneamente
o que no fueron comunicados en el rcord de obras
mensual y/o en la regularizacin.
c.2.) Rectificacin no sujeta al pago de tasa
Si la rectificacin del rcord comprende la modificacin
de datos referidos al tipo y nmero de proceso,
fecha del contrato y el nombre de la Entidad, que
fueron comunicados errneamente o que no fueron
comunicados en el rcord de obras mensual y/o en la
regularizacin.
8.2.1. Procedimiento
a) La declaracin del rcord se realizar mediante el
formulario oficial Informacin sobre Rcord de Ejecutor
GH2EUDVR,QIRUPDFLyQVREUH5pFRUGGH&RQVXOWRUGH
2EUDVGLULJLGRDOD6XEGLUHFFLyQGH,QIRUPDFLyQ5HJLVWUDO
de la Direccin del Registro Nacional de Proveedores del
OSCE, documento que el ejecutor o consultor de obra
353
ANEXOS
debe descargar de la pgina web del RNP: www.rnp.gob.
pe, segn corresponda.
b) De ser el caso, realizar el pago de la tasa en cualquiera
de los bancos autorizados.
c) Se acercar a la Unidad de Trmite Documentario
de la Sede Central o las Oficinas Zonales del OSCE
para presentar el formulario debidamente llenado y
acompaado, de ser el caso, del voucher original o copia
del pago de la tasa correspondiente.
IX. DISPOSICIONES COMPLEMENTARIAS
En el caso de consorcios, la declaracin del rcord de ejecucin de obras y/o de
consultora de obras se realizar por cada consorciado, de acuerdo al porcentaje
de obligaciones que le corresponde respecto al monto total del contrato.
En el caso de contratos de ejecucin de obras, los consorciados debern declarar
todas las valorizaciones acumuladas, adicionales y/o deductivos afectadas por su
porcentaje de obligaciones, el cual deber concordar con la promesa formal del
consorcio presentada en su propuesta tcnica, en base a la cual se le otorg la
buena pro, y con la constancia de capacidad libre de contratacin.
En el caso de contratos de consultora de obras, los consorciados debern
declarar la suscripcin del contrato, considerando su porcentaje de obligaciones
correspondiente.
X. DISPOSICIN FINAL
La presente Directiva regir a partir de la entrada en vigencia de la Ley 29873,
que modifica la Ley de Contrataciones del Estado y el Decreto Supremo N 138-
2012-EF, que modifica el Reglamento de la Ley de Contrataciones del Estado.
-HV~V0DUtDVHWLHPEUH

ANEXOS
354
DIRECTIVA N 014-2012-OSCE/CD
DISPOSICIONES APLICABLES A LOS PROCEDIMIENTOS DE
COMUNICACIN DE OCURRENCIAS Y MODIFICACIN DE DATOS
DE LA RELACIN DE SANCIONADOS PUBLICADA EN EL PORTAL
INSTITUCIONAL DEL OSCE
I. FINALIDAD
Precisar las disposiciones aplicables al procedimiento de comunicacin de
ocurrencias, as como al procedimiento de modificacin de datos de las personas
naturales y jurdicas que figuran en la relacin de sancionados publicada en el
portal institucional del OSCE.
II. OBJETO
Establecer las disposiciones que las personas naturales o jurdicas deben
cumplir para comunicar las ocurrencias previstas en el Reglamento de la Ley
de Contrataciones del Estado, as como, para solicitar la modificacin de datos
declarados ante el Registro Nacional de Proveedores que permita actualizar la
relacin de sancionados publicada en el portal institucional del OSCE, de ser el
caso.
III. ALCANCE
La presente directiva es de cumplimiento obligatorio para los proveedores de
bienes, servicios, consultores y ejecutores de obras, nacionales y extranjeros,
inscritos en el Registro Nacional de Proveedores, as como para los socios,
accionistas, participacionistas, titular y rganos de administracin, que soliciten
la modificacin de datos de la relacin de sancionados publicada en el portal
institucional del OSCE.
IV. BASE LEGAL
/H\ GH &RQWUDWDFLRQHV GHO (VWDGR DSUREDGD PHGLDQWH 'HFUHWR
Legislativo N 1017.
5HJODPHQWRGHOD/H\GH&RQWUDWDFLRQHVGHO(VWDGRDSUREDGRPHGLDQWH
Decreto Supremo N 184-2008-EF.
5HJODPHQWRGH2UJDQL]DFLyQ\)XQFLRQHVGHO2UJDQLVPR6XSHUYLVRUGH
las Contrataciones del Estado (OSCE), aprobado mediante Resolucin
Ministerial N 789-2011-EF/10.
/H\1/H\GH3URFHGLPLHQWR$GPLQLVWUDWLYR*HQHUDO
/H\1/H\*HQHUDOGH6RFLHGDGHV
7H[WRQLFRGH3URFHGLPLHQWRV$GPLQLVWUDWLYRVGHO2UJDQLVPR6XSHUYLVRU
de las Contrataciones del Estado OSCE, aprobado por el Decreto
Supremo N 292-2009-EF.
Las referidas normas incluyen sus respectivas disposiciones ampliatorias,
modificatorias y conexas, de ser el caso.
355
ANEXOS
V. REFERENCIAS
En la presente directiva se utilizarn las siguientes referencias:
Ley: Ley de Contrataciones del Estado.
Reglamento: Reglamento de la Ley de Contrataciones del Estado.
TUPA: Texto nico de Procedimientos Administrativos del OSCE.
Ley N 27444: Ley de Procedimiento Administrativo General.
LGS: Ley General de Sociedades.
OSCE: Organismo Supervisor de las Contrataciones del Estado.
Tribunal: Tribunal de Contrataciones del Estado.
RNP: Registro Nacional de Proveedores.
SUNARP: Superintendencia Nacional de los Registros Pblicos.
SUNAT: Superintendencia Nacional de Aduanas y de Administracin
Tributaria.
RUC: Registro nico de Contribuyentes.
Directiva: La presente directiva.
Proveedores: Proveedores de bienes, servicios, consultores y ejecutores
de obras, nacionales y extranjeros inscritos en el RNP.
VI. DEFINICIONES
&RPXQLFDFLyQGHRFXUUHQFLDVEs la declaracin que deben efectuar
los proveedores cuando se produzca una o varias modificaciones en la
informacin que figura en sus Registros como Proveedores de Bienes,
Servicios, Consultores y Ejecutores de Obra del RNP.
0RGLILFDFLyQGHODUHODFLyQGHVDQFLRQDGRV Es la solicitud que pueden
presentar los socios, accionistas, participacionistas o titulares, as como
las personas que integran los rganos de administracin, que figuran en
la relacin de sancionados publicada en el portal institucional del OSCE,
a fin de excluirlos de dicha publicacin.
VII. DISPOSICIONES GENERALES
PROCEDIMIENTO DE COMUNICACIN DE OCURRENCIAS
7.1. Los proveedores estn obligados a efectuar el procedimiento de
comunicacin de ocurrencias, referido a la modificacin del domicilio,
de la razn o denominacin social o nombre de la persona natural,
transformacin societaria, cambio o inclusin de las personas que
integran los rganos de administracin, representante legal, apoderado,
socios, accionistas, participacionistas o titular, as como la variacin que
se produzca en la distribucin de acciones, participaciones o aportes,
segn las disposiciones de las normas legales vigentes, y las que se
establezcan mediante directiva del OSCE.
La informacin modificada debe coincidir con aquella que figura en
la SUNARP, SUNAT, en la institucin competente del pas de origen
(extranjeros), o en alguno de los documentos solicitados en el TUPA
para acreditar la informacin, segn corresponda.
7.2. La comunicacin de ocurrencias debe presentarse en el plazo de diez
(10) das hbiles siguientes al trmino de cada mes de ocurrido el
ANEXOS
356
hecho materia de modificacin, con el objeto de mantener actualizada
la informacin que administra el RNP, de acuerdo al procedimiento
establecido en el TUPA.
Si el proveedor no hubiese realizado la comunicacin de ocurrencias en el
plazo antes indicado, deber efectuar el procedimiento de regularizacin
por comunicacin extempornea, sujetndose al pago de la tasa fijada
en el TUPA.
7.3. Al momento de presentar la solicitud de comunicacin de ocurrencias,
el proveedor debe contar con inscripcin vigente en el Registro
correspondiente del RNP.
En el caso de la vigencia provisional originada como consecuencia
del trmite de inscripcin en el Registro de Consultores y Ejecutores
de Obras, a la que se refieren los artculos 265 y 272 del Reglamento,
la comunicacin de alguna variacin en la informacin del proveedor,
deber ser realizada durante el trmite de inscripcin o renovacin,
segn corresponda.
7.4. La comunicacin de ocurrencias debe presentarse al OSCE (dirigido
a la Direccin del Registro Nacional de Proveedores) a travs del
formulario oficial, en el cual se deber consignar los datos generales
de identificacin del solicitante, la informacin que solicita modificar, as
como la Declaracin jurada de veracidad de documentos, informacin
y declaraciones presentadas por el proveedor de bienes, servicios,
HMHFXWRU\RFRQVXOWRUVXVFULWDHQRULJLQDOSRUHOSURYHHGRUVXDSRGHUDGR
o representante legal, segn corresponda.
Al formulario oficial deber adjuntarse la documentacin requerida en el
TUPA.
7.5. A travs de la comunicacin de ocurrencias, el proveedor puede realizar
varias modificaciones respecto de la informacin que tiene registrada en
el RNP, incluso si figura con inscripcin vigente en ms de un Registro,
las cuales debern ser identificadas expresamente en el formulario oficial.
En estos casos, el proveedor debe realizar nicamente el pago que
corresponda a la tasa de mayor monto de las modificaciones solicitadas,
debiendo cumplir con los requisitos de cada una de ellas, de acuerdo a
lo establecido en el TUPA.
Si la Subdireccin de Informacin Registral de la Direccin del Registro
Nacional de Proveedores del OSCE verifica alguna variacin distinta a
la solicitada, observar el trmite a fin de que el solicitante actualice el
resto de la informacin no comunicada.
7.6. La documentacin proveniente del extranjero, que tenga por objeto
acreditar los requisitos previstos en el TUPA, deber estar legalizada
por el Consulado Peruano, correspondiente al lugar de origen de la
documentacin, refrendado por el Ministerio de Relaciones Exteriores en
el Per y, de ser el caso, con su traduccin simple indicando el nombre
del traductor; o estar fijados con la Apostilla de la Haya. La legalizacin
deber constar en el documento original y no en la traduccin.
Dichas formalidades debern contar con una antigedad no mayor
357
ANEXOS
a ciento cincuenta (150) das calendario, contados desde la fecha
del refrendo efectuado por el Ministerio de Relaciones Exteriores del
Per, o desde la fecha de expedicin de la Apostilla hasta la fecha de
presentacin del formulario oficial en la Unidad de Trmite Documentario
del OSCE.
7.7. El procedimiento de comunicacin de ocurrencias es de evaluacin
previa, por lo que el plazo mximo para resolver es de treinta (30) das
hbiles de presentada la solicitud.
Dentro de los cinco (5) das hbiles de presentada la solicitud, la
Subdireccin de Informacin Registral de la Direccin del Registro
Nacional de Proveedores advertir las observaciones que correspondan,
las que sern comunicadas al correo electrnico consignado por el
proveedor en el formulario oficial, o en su defecto en el que figure
registrado en el RNP.
Las observaciones podrn ser subsanadas dentro del plazo que no
exceder del vigsimo quinto da hbil de presentada la solicitud. De no
subsanarse la observacin dentro del plazo sealado, el trmite no ser
aprobado y su resultado se comunicar mediante oficio en el domicilio
que haya declarado el proveedor en su solicitud o ante el RNP, segn
corresponda.
7.8. El procedimiento de comunicacin de ocurrencias puede ser impugnado a
travs de los recursos de reconsideracin y de apelacin, de conformidad
con los requisitos establecidos en el TUPA. El plazo para interponer
dichos recursos es de quince (15) das hbiles, contados desde que el
administrado fue notificado de la no aprobacin de su solicitud. El plazo
mximo para resolver es de treinta (30) das hbiles.
PROCEDIMIENTO PARA LA MODIFICACIN DE DATOS DE LA RELACIN
DE SANCIONADOS
7.9. Se podr solicitar la modificacin de la relacin de sancionados en el portal
institucional del OSCE, cuando no se haya efectuado la comunicacin de
ocurrencias oportuna y/o correctamente ante el RNP, para el cambio de
uno o varios de los integrantes de los rganos de administracin, socios,
accionistas, participacionistas o titular, siempre que hubiese dado lugar a
la publicacin de dichos datos, bajo responsabilidad de los proveedores.
Los reclamos que se presenten respecto de la informacin publicada no
sern imputables al RNP.
7.10. La solicitud de modificacin debe contener una indicacin clara y expresa
de los hechos que dan lugar al petitorio, as como consignar el correo
electrnico, telfono, el domicilio y la firma en original del administrado.
Si el administrado fuese una persona jurdica, la solicitud deber estar
suscrita con firma original de su representante legal o apoderado que
cuente con facultades suficientes.
7.11. El plazo mximo para resolver las solicitudes de modificacin es de
quince (15) das hbiles, contados a partir del da siguiente de presentada
la solicitud.
Dentro del plazo mximo de cinco (5) das hbiles de presentada la
ANEXOS
358
solicitud, la Subdireccin de Informacin Registral de la Direccin
del Registro Nacional de Proveedores advertir las observaciones
que correspondan, las que sern comunicadas al correo electrnico
consignado por el proveedor en su solicitud.
Las observaciones podrn ser subsanadas dentro del plazo que no
exceder del dcimo segundo da hbil de presentada la solicitud. De no
subsanarse la observacin dentro del plazo sealado, el trmite no ser
aprobado y su resultado se comunicar mediante oficio en el domicilio
que haya declarado el administrado en su solicitud o ante el RNP, segn
corresponda.
7.12. Para la aprobacin de la modificacin de datos, los administrados
deben cumplir los requisitos establecidos para el cambio de los rganos
de administracin, socios, accionistas, participacionistas o titular del
procedimiento de comunicacin de ocurrencias.
7.13. Para que proceda la modificacin de datos de la relacin de sancionados
no se requiere contar con inscripcin vigente en el RNP.
7.14. A este procedimiento le ser aplicable lo establecido en los numerales
7.6 y 7.8