Vous êtes sur la page 1sur 174

TONS OF USEFUL STUFF

SEPTEMBER 2014
R45.00 (P5.53) incl VAT
OuIsidePSA: P39.47(excl VAT) Namibia: $45.00
280k
k88
008B8I 0PP8
B00YP|AkV8I
P.!54
FI8.
8M0k.
Mk.
8|mp|e 8teps
!a Perfect BB
|8P08I8w08K00I
12
NEwRU|E8
O| DENlV
L88k
M088k
A004KG
MUSCLE
lN4WEEKS
4 w||4 weekea4s 5 |at Iraps I|e $50-N||||ea |4ea
P.!58
P.68
P.94
8FI8
MkhkLII
Raaa|a:
8!E/| Hl8wORKOU!
&DlE! 8ECRE!8
!|e Hat Zaae
Yaa're laar|a
P.!46
P.!38
P.!30
kI8 I00AYI P168
k800
8hk
M8008
00?
TOUCR
RER
RERE!
AN0
RERE!
M
E
N
'
B
H
E
A
L
T
H
T
O
N
B
O
F
U
B
E
F
U
L
B
T
U
F
F
2
8
-
D
A
Y
A
B
B
2
0
3
B
E
P
T
E
M
B
E
R
2
0
1
4
N
H
.
C
C
.
Z
A
No muIIef how Iuf you venIufe In Ihe TIguun, you`II nevef Ieuve youf comIofI zone. ThuI`s becuuse IIs IuxufIous, spucIous InIefIof
Is equIpped wIIh evefyIhIng Io keep you uI euse on Ihe Iong foud, IncIudIng pfucIIcuI IoIdIng feuf seuIs und BIueIooIh connecIIvIIy.
The TIguun`s CfuIse ConIfoI IogeIhef wIIh IuIIgue DeIecIIon und u 5-sIuf Lufo NCAP SuIeIy BuIIng wIII keep you feIuxed und secufe
whefevef you go. AII Ihese IeuIufes come sIundufd ucfoss Ihe TIguun funge. Choose beIween TSI und TDI engIne IechnoIogy und
IeeI uI home even when you`fe ouI Ihefe.
Get owoy ond Iee| ot bome.
BIueMoIIon TechnoIogy uvuIIubIe on: I.4 TSI 90 kW 4x2 Tfend & Iun, 2.0 TDI 8IkW 4x2 Tfend & Iun, I.4 TSI II8kW Tfend & Iun, I.4 TSI II8kW Tfend & Iun DSG

4MoIIon TechnoIogy uvuIIubIe on: 2.0 TDI I03kW Tfend und Iun DSG

, 2.0 TDI I03kW Tfuck & IIeId DSG

, 2.0 TDI I03kW SpofI & SIyIe DSG

, 2.0 TSI I55kW SpofI & SIyIe DSG

Do odvonIuro. ComIorIobly.
1iguon Irom k325 .
O
C
l
L
v

C
A
P
E
1
O
W
N

5
2
1
}
E
The nev Audi SB is he ulinae in luuricus
perfcrnance, puing i in a class cf is cvn.
WiIh 382kWo! Ihrillihg power ahd a breaIhIakihg desigh, compleIe wiIhVorspruhg Iechhology, iI's Ihe pihhacle o! sIyle ahd subsIahce.
The hewAudi S8 is Ihe !rsI model Io !eaIure Audi's revoluIiohary hewMaIrix LEDheadlighIs. WiIh Ihe use o! ah oh-board camera ahd various
sehsors, Ihese headlighIs illumihaIe Ihe Audi S8's surrouhdihgs precisely ahd selecIively. FeaIurihg hear-daylighI illumihaIioh which dims
accordihg Io Ihe siIuaIioh ahead ahd dyhamic ihdicaIors ih Ihe headlighIs ahd rear lighIs, Ihe Audi S8 is a desigh masIerpiece.
SIep ihside Ihe hewAudi S8 ahd you're welcomed ihIo Ihe embodimehI o! success. Fihely cra!Ied leaIher sporI seaIs, carboh ihlays
ahd Ihe S-desigh sporIs sIeerihg wheel remihd you IhaI you're experiehcihg Ihe ulIimaIe ih luxurious per!ormahce.
For more ih!ormaIioh oh Ihe Audi A8 rahge ahd Io book a IesI drive, visiI
Inrcducing he nev Audi SB.
TIe cre erU crIy.
O
C
l
L
v

C
A
P
E
1
O
W
N


O
K
L
B
/
4
2
3
5

2
0

2
0
2

^^^
L
e
v
L
v
S
i
SSS
t
r
a
t
r
a
t
r
t
r
u
s
s
s
s
&&
C
o
.
C
O
s
c
O
s
c
O
s
c
a
rr
a
1
a
n
1
a
n
1
q
o
//
q
o
/
0
0
5
0
0
5
0
0
5
0
0
5
/
M
L
/
M
LL
/
M
N
S
H
S
N
S
50 .

S1AR1LD BY US.
. Fl Nl SHLD BY YOU.
AS ORlClNAL AS YOU ARL



00HP1I 10R
usa|n o|t
The wor|d's Fostest Hon. [Fnough sold.]

Prlvate Insurance Broklng,
Le mark of disLincLion from Aon
"Purchase a Iuxury vehicIe without expert advice?
NeverI t wouIdnt lnsure it without an experts touch either.
Undthi Dubc
Our experlence goes beyond skllled advlce and lnnovatlve home and vehlcle
lnsurance, Lo ensure you receive a personallsed, Hexlble solutlon, dehned by
one-on-one support, guidance and a dedlcated parLnership approach.
Dlstlnct. Insplred. Bespoke.
#AskAon
0S00 400 400
5M5 'quoteme' to 3T762 and we wlll call you back*
quoterequestaon.co.za
aon.co.za
Partner wlth an Aon expert lnsurance broker today:
* SLandard raLes apply.
Aon SouLh Africa (PLy) LLd is an AuLhorised linancial Services Provider (lSP #20555).
Aon is Lhe Principal Sponsor of ManchesLer niLed.

J
A
C
Q

E
S
W
E
Y
E
P
S
T
O
N
S
O
F
U
S
E
F
U
L
S
T
U
F
F
||-J|| |J'|| J|| |
2014 Men's HeaIth
GuIde to 0enIm
What to wear, when to wear |t.
and how your |eans can save you
from a month of B|ue Mondays
PAGE 67
09.14

Musc|e |n a Month
Four weeks, 4kg of raw
muscIe. See howrugby sfar
LeighHaIfenny did if

Less SMS, More S.E.X.


Firsf sfe: ower down
your smarfhone

Touch Her Here!


Gef behind fhe comIefe
genfIeman`s guide fo boofy

He's the Greatest.


And he knows if. Learn
Crisfiano RonaIdo`s
winning formuIa for
confidence-boosfing fifness

The New Ru|es


of BBQ
If`s braaing, buf unIike
you`ve ever seenif before.
GenfIemen, sfarf your
smokers!
16 M.O.ZA | September 2014
Phone 0861636743
andquoIe
"MHSep14 discounI
sIrip" or visiI
mh.co.za and you
could win a Nixon
VolIa waIch!
Go to page 136
SUBSCRIBE
AND SAVE
| .
J.
20 0'8 |II8
S|Jck n a rJ| No|nn 'ke
exoernen|n |n
sone|nn ne
22 w|k wK|Y
Ce| |oo ear |ronCa|, LC,
LJnnox ano Lacos|e.
24 A8K
'=o can ' e n, cerea'
a nJ|r|on ooos|
28 B0||I|k8
L|e-san nes on nea'|n,
nJ|r|on ano en|-'oss
38 NA|08AN8
^oce |o noroe ,oJr '|e,
|ron |ne oeo ,oJ neeo |o |ne
|ecn ,oJ oon'|
64 A8K IH 0|8|
kXI 0008
'Can ' ask ner |o s|oo
earn nee's
112 H0w I0 00
V8YIH|k0 BII8
Pck a 'ock, s|ea' ner near|
ano ca|cn a oa'' 'ke a oro
1I0 IH AB0V
AV8A0 00Y
Tnnk ,oJ're |Jnn, =ae ,oJ
nearo |ne one aooJ|...
vcnMnrc UacIul SIuII. . .
|ORE USEUL STU.
DEPAPTMENTS
PEGULAPS
09.14
NuIriIinn
50 ABrunch BuIIt
for Men
Buf besureyouinvifeher
over foo
98 Make Your Own
CrIsps
Thechisaredown: fry
fheseheaIfhyaIfernafives
106 SuppIement
0ecoder
Whaf`sreaIIygoinginfo
your re-workouf shake?
110 JoIn the BeIIy
Offl CIub
HowheaIfhyeafingand
heavyIiffingheIedone
manIoseamassiveIIkg
126 AvoId Fat Traps
.soyoucanfinaIIyreveaI
your abs!
Scx 8
RcluIinnahipa
42 0ame to KIII for
UcIoseandersonaI wifh
sfar JamieChung
52 The Scents
She Loves
Aman, acan, aIan.
Thebesf deodoranf for
aII-dayfreshness
un ynu
kick iI likc
R7? cI
ua ahnw
ynu hnw.

C
A

T
Z
[

O
O

)
,
P

A
P
A

[
C
P

S
T

O
P
O

O
)
ONTHE COVEP
ModeI CrisIiano Ponaldo
Photographer PeIer Hapak
iIncaa
38 Stage a
Comeback
R8Bsfar JasonDeruIo
reveaIshowherebuiIf his
bodyaffer acriIinginjury
102Test Your Best
Boosf your exIosiveower
wifhfheseIyomefric
moves
104 ChIseI Your Core
WhyfheHoIIowRockis
fhebesf exerciseyou`re
doing
108 SwIng lnto
ActIon
Reachinfoyour Russian
handbagandfakeyour
fifnessfoeIifeIeveIs
uy Wiadnm
54 The Tech You
(0on't} Need
Faceof fhefufureor assing
fad?Findouf here
60 The Lazy Man's
Garden GuIde
Howbeer canmakeyard
workabreeze(andnof in
fhewayyoufhink)
120 Be a Better 0ad
AvoidfhesefafherhoodfaiIs
-beforeif`sfooIafe
124 Turn a SmaII
ldea lnto BIg Money
FoIIowfhesesixsecrefsfo
cashingin
culIh
46 Book a WIId
Weekendl
Unwindyour mindwifh
fhesefour Iaid-back
advenfures
58 SurvIve
AnythIngl
Life-savingadvicefrom
advenfurer Pefer vanKefs
100 Your BP,
0ecoded
HowhighbIoodressure
causessfroke
132 0o VIdeo
Games TraIn
KIIIers?
Surrisingnewresearch
reveaIswhaf haenswhen
youickufhaf confroIIer
ccr? hcck.
McuI? hcck.
All ynu nccd
nnw ia amnkc.

H
U
G
O
B
O
S
S

h
I
e
r
h
a
I
i
o
h
a
l
M
a
r
k
e
I
s
A
G
P
h
o
h
e
+
4
1
4
1
7
2
7
3
8
0
0
w
w
w
.
h
u
g
o
b
o
s
s
.
c
o
m
ecame a faa aa aceaaa|
....|::|'.:|:|:'|'-
a||aW Her's hea/t/ aa W|tter
Q|:|:'|'-
aWa|aa t|e ||ta| :ers|aal
....,:.|:.:.::|':|:'|'
8 0|Y 08
| '8 HIH
T='S |NT= N...
MR.CO.ZA
' T NESS SE X =E ^LT = \E' C=T LSS D \E ^LT = ST ` L E D\NT ' |E

J
A
C
Q

E
S
W
E
Y
E
P
S
[
W
O
M
A
N
)
,
l
S
T
O
C
K
P
H
O
T
O

A
|
E
X
V
A
P
A
N
E
S
E
|J| J|||4l|| JJIlJ| |J|
|re af t|e a|! aa||a far aa etc|t|a c|aae! et as aprae aar ||fe |a mare Was t|aa aae
Boost Your
Braln Power
co.za/how-to
Unrael Ihe mysIeries of
memory Io harness Ihe
power of perfecI recall.
Bulld Your
Rome Gym
mh.co.za/tness
If you have the space (and the
money), th|nk about add|ng a
home gym to he|p you fast track
your tness p|an.
Braal Llke
A Master
mh.co.za/food
Upgrade your braa| sk|||s - from
the coa|s to the boer|e - w|th
raa| Nat|on.
USE | T!
Upgrade Your
Llvlng Spaoe
mh.co.za/best-adv|ce
FollowKaroo-born arIisI PoberI
PloIz's adice Io keep your man
cae looking good.
L| VE | T!
WOPK | T!
LEPN |T!
Flat Belly
Seorets!
mh.co.za/we|ght-|oss
NuIriIion experIs dish on one
of Ihe mosI imporIanI dieIary
changes you can make Io
become lean, sIrong and full
of energy. SIarI Ioday!
ET | T!
Guys Gulde
Llngerle Buylng
mh.co.za/sex-women
veryth|ng you need to know
to buy her sexy underwear.
KNOW | T!
September 2014
1HL NLW NAVI1IMLR 46 mm
AN l CON J US T COT L APCL P
20 September 2014

H
)
,

|
l
N

N
J

C
E
N

T O YOU MEAN BARBECUE?"


If was afair quesfionfromoneof fhesfaers. Isn`f
fhaf Iikesayingabraai isn`f reaI?I dunno, fhaf couIdsfarf
riof. The sfory hadgof fhe feamfaIking.
CIearIy, youdon`f mess wifhaman`s braai. If`s amaffer
of nafionaI ride: nof evenworfhgoingfhere. TherifuaI of
nre, smokeandmeaf is ingrainedinour DNA. AndIike
you, I fhinkI`vegof somereffydecenf nresidekiIIs.
NobodyfeIIs us howfofanatjop!
Thaf was unfiI I fasfedfheTexas-sfyIeBBQuIIed-ork
roII fromfheguys af SoufhernSmoke. Damn, if was good.
Infhenameof scienceandjournaIism, fhis required
furfherinvesfigafion. We`vebeenIedfobeIievefhaf smoke
is abadfhing; fhaf onIyamafeurs roducesmoke. WeII,
we`reherefofeII youfhaf`s nof reaIIyfrue.
Inursuif of fheerfecf B-B-Q, wesenf fhefeamon
afacf-nndingmissionfhaf Iedus fofhreebufchers, foa
hiIIfowinefarminfheSwarfIandandfofhefesf kifchen
of strC judgePefeGoe-Wood. WecaIIedinfhegear, fhebeer andavariefyof meaf, andsef
abouf fesfingfechniques, woodchis andcookingfimes. Andaffer fhesmokehadcIeared, weaII
agreed-fhis was foogoodfokeefoourseIves. TheresuIfs weresecfacuIar.
Soif (Iikeus) youcan`f waif for fhenrsf warm, cIear dayfonreu
fhegriII, canI suggesf youfrysomeReaI BBQ onageI68?Wifh
afewsmaII changes foyour currenf sef of exerf skiIIs, we`re
going foshowyouhowfoharness fheheaf, davour and
infensifyof smoke. Infhewords of PefeGoe-Wood: my
tsucwityou.
Whaf couIdweossibIyaddfofhaf?Howabouf fhe
besf damnjeans amancanown(7), her hoffesf hof
sof (I88), fheeasiesf wayfobuIkufasf (94) and
-nof fooverIookfhereaI sfar -fhenffesf manaIive: our
excIusivecover feafurewifhCrisfianoRonaIdo(I4).
YoucouIddoworse.
Fireif u!
||-||. |||||Q||D|-z1.|J| `|||. Q||N||-||- |-||bJJ|. ||N||-||-
|rr||. a t+r
iwr|+i Hr': |+|t|
r ||+i. H+t | ||
r:a|:.t.t+/Hr':|+|t||
| |
TONS OF USEFUL STUFF
SEPTEMBER 2014 R45.00 (P5.16) incl VAT
OuIsidePSA: P36.84 (excl VAT) Namibia: $42.00
280k
k88 008B8I 0PP8 B00YP|AkV8I P.!4
FI8.
8M0k.
Mk.
8|mp|e 8teps !a Perfect BB
|8P08I8w08K00I
12
NEwRU|E8
O| DENlV
L88k
M088k
A004KG
MUSCLE lN4WEEKS
4 w||6 weekea6s 5 |at Iraps I|e $50-N||||ea |6ea
P.!8
P.68
P.94
8FI8
MkhkLII
Raaa|a:
8!E/| Hl8wORKOU! &DlE! 8ECRE!8
!|e Hat Zaae Yaa're laar|a
P.!46
P.!38
P.!30
kI8 I00AYI P168
k800
8hk
M8008
00?
TOUCR
RER
RERE!
AN0
RERE!
\J# l|.
JasonBrown
EDITOR
_CaeJason
Think you've goI whaI iI
Iakes Io be Ihe nexI Men's
Health Cover Guy? EnIer
Ioday! See page 168 for all
Ihe deIails.
reYou
OurNet
CoverGuy?

AreYou
Tough
Enough?
The UPBANATHLON
in on! SA's original urban
obsIacle race is a go.
Peady Io run for your life?
Join Ihe Ieamon
30 November.
DeIails on page 156.
| | , .: | | . :| .| |'
:'.: :: |. |' :.:|| |.` | |''
| :..: : :|::' |' J.| .|' || ::|.:.
:'|: :: |. :|:::: |. : ::, | :' :: :|.
||'' | : '|:. :'.:. .::. .| |':|'' |.:.:
,. | |' ..': | bbJ :: | |.. : : |.|
.: s|ea|t|za . capejasea | |: :|'
,.: : .| |.. :: .'' | | .:::.
|rlolreerorards.co.za

0AI APPA8| 0k||k


V000H88
a| c'o|nn s ,oJr eoJonen| |or
'|e. Tns |Jnc|ona', ork-nsoreo
c'o|nn 'ne '' || oer|ec|', n|o
,oJr oJs, scneoJ'e. Roo|eo n |ne
US^ ano orn or'ooe, Ca|
c'o|nn oa,s |roJ|e |o enera-
|ons o| naro-orkn nen ano
onan. Le, ork ano o'a,
n ear |na| orks |or ,oJ.
W|n 1 of 15 Cat Appare| On||ne
Vouchers va|ued at R1 000 each!
2
|0 03 8NA8IPH0k
Tne LC C3 s |ne 'as|es|
snar|onone |ron LC. '| nas
eer,|nn ,oJ an| n ,oJr
oocke|. ^ rea| canera |n 'aser
aJ|o |ocJs, oo|na' nae
s|ao'ser ano a |oa|n arc oesn
|na| nakes sJre |na| | res|s con-
|or|ao', n one nano. '|'s a'so |ne
|rs| OJao =D screen aa'ao'e on
a snar|onone n SoJ|n ^|rca.
W|n a LG G3 smartphone
va|ued at R10 000!
3
|0N|k0X wAI0H
Tns s |ne oer|ec| LJnnox
a|cn |or |ne aoen|Jre 'oer. '|'s
|oJn enoJn |o |ns|ano an,-
|nn ,oJ |nro a| |: |s caroon-
|ore ren|orceo case neans ,oJ
can cnJck | aroJno ano 24
'Jnnescence '' see ,oJ |nroJn
nereer ,oJ oare |o en|Jre.
P'Js, |'s 200n a|er ress|an|. '|
,oJ're a |oJn J, a| near| ano
aorena'ne coJrses |nroJn ,oJr
ens, LJnnox s ,oJr orano.
W|n 1 of 2 Lum|nox watches to
the va|ue of R6 499 each!
4
|A008I |IV |8A08Ak0
Tns ne |rarance s ener-
e|c ano crea|e. Tne nreoen|s
nae oeen exoer|', o'enoeo |o
|orn one o,nanc scen|, oJ| eacn
a'so s|anos oJ| nooJa'',. \|n
no|es o| 'ne, reen 'eaes ano
oark 'oJorce, |ns s |ne
oer|ec| |rarance |or |ne J,
no |ee's 'ke nakn a s|a|enen|.
W|n 1 of 15 Lacoste L!ve 100m|
fragrances va|ued at R865 each!
Compet|t|on Ru|es: ll Men's Health compIiIions ar opn Io anyon xcpI mploys of Mdia24, Ihir immdiaI familis, sponsoring companis or associaId agncis. Th judgs' dcision
is nal and no corrspondnc will b nIrd inIo. Men's Health rsrvs Ih righI Io forward Ih conIacI dIails of Ih radrs who'v xprssd inIrsI in IhaI compIiIion Io Ih sponsors of
compIiIions, and Io us Ih radr dIails for markIing iniIiaIivs rlaId Io Mdia24. Prizs ar noI Iransfrabl, can'I b xchangd for cash and musI b claimd wiIhin six wks of noIicaIion.
SIyls/modls and colours of prizs may vary. Winnrs will b noIid Ilphonically or via mail and musI b ovr 18. Go Io www.mh.co.za for mor info. EnIris clos on 24 SpImbr 2014.
1
*
'\
||l'
'\ J|| l'| '\ ||1l|l
kI8 k0w AI www.NH.00.ZA
Have ycur say and geL Lhe
daily banLer sLarLed wiLh Mcns
Hcc|th Lcday. www.lacebcck.
ccmfMensHealLhSA
Keep up Lc daLe cn Lcpics LhaL
relaLe Lc ScuLh Alrican men.
dcin Lhe MH guys aL www.
LwiLLer.ccmfMensHealLhZA.
Sign up lcr cur e-newsleLLer cnline and geL
Lhe besL cl Mcns Hcc|th. Ycu'll alsc geL
access Lc lree dcwnlcadable wcrkcuLs, plus
all Lhcse special exLras.
3
2
4
ONLYAVAlLABLE TOSUBSCRlBERS
*
EDlT0PdascnBrcwn
DEPUTYEDlT0PMarkvanDi|k
CPEATlvEDlPECT0PPcberL Cilliers
C0NTPlBUTlN0EDlT0PArLhur dcnes
ASSlSTANTEDlT0PPieLer Smedy
0NLlNEEDlT0PDylanMuhlenberg
FASHl0N&0P00MlN0EDlT0PAzeezdaccbs
CHlEFC0PYEDlT0PKimLccringh-vanBeeck
FEATUPESWPlTEPlanMcNaughL Davis
SENl0PDESl0NEPSClinLcndurgens, AlisLair FesLer
dUNl0PDESl0NEPFrankHermus
FASHl0NASSlSTANTTanyaNcrL|e
lN-H0USEPH0T00PAPHEPdames0araghLy
0FFlCEADMlNlSTPAT0PWaniLaHcbbs
lNTEPNSKeshavMahara|, LeighSchaller
EXPEPTSANDADvlS0PSNeil 0ardiner (Tech), Adam
lsmail (Legal), PalqLcckhaL (Psychclcgy), Dr Andrew
McKune(SpcrL Science), Lindsey Parry (BickineLicisL),
MeganPenLz-KluyLs (NuLriLicn), Dr CraigPcberLs
(HealLh), AmeliaFrenkel (McnsHcc|th0irl NexL Dccr)
C0NTPlBUT0PSPeLer Hapak (ccver phcLcgrapher),
CrisLianc Pcnaldc (ccver mcdel) , AchimLippcLh,
Adrian WeinbrechL, Alex Harris, Andrea ManzaLi,
BeLh Bischcll, Brian Pea, BriLa du Plessis, Byrcn 0raper,
Byrcn Keulemans, Carcline CcllsLcn, Casey Crallcrd,
Claire BencisL, ClinL CarLer, Ccdy Pickens, Craig BallanLyne,
Craig CuLler, CurLis dinkins, Daniel Blackman,
Darrel BrisLcw-Bcvey, David Mc0lynn, Eric SpiLznagel,
0areLh Barclay, 0len Burrcws, 0len McnLgcmery,
0ecrge Myers, 0ian Paul Lczzas, 0ranL Hinds, 0. Zamaiclli,
HampLcn Sides, Helen Bcwnass, dacques Weyers,
dacqui LupLcn, dimWinLers, dcc Fazenda, dchanna Parkin,
dcn AxwcrLhy, dcrdana venLzke, dcyce Lee, dusLin Pervcrse,
K. Aleisha FeLLers, Karen Evans, Karin 0lsen, L-Dcpa,
Levi Brcwn, Lila BaLLis, Lcu Schuler, Marc vanDalen,
Marc Shcul, Maria MasLers, Michael EasLer, Michael
Hceweler, Miguel Pcrlan, Mikc Lim, MuLi, Paul KiLa,
PeLer van KeLs, Pela|a El Cccc, Piaan 0iani, Samlsland,
SamKaplan, Sarah 0uidc, Sean CaliLz, Sean LaurenLz,
Tara Lcndcn, Tcby Leigh, TcmHall, TcmMc0raLh,
Travis Ladue, YveLLe Pascce, Zander Dekker
IubIishingTeam
PUBLlSHEPMari|keClceLe02I40835II
PUBLlSHlN0MANA0EPFranccisMalan02I408I228
BUSlNESSDEvEL0PMENTMANA0EP
YveLLedcnes02I40836I2
MAPKETlN0MANA0EPHishaamSclcmcn02I408355I
MAPKETlN0EXECUTlvEPussel MaLLhysen02I4439844
AdvertisingSaIes andSoIutions
d0HANNESBUP0
danePuinard0II3220799f083383I756
SundeshMahes0II2634734f 0724349567
KaLhrynMclyneaux(BccLh) 0II2I73I97f 0833953442
MarilizeHay0824659543
CAPET0WN
MylesKelsey02I4439475f 0826I38498
LameezPaizenberg02I4083960f 0829099696
Hannes Burger 02I4083078f 076I524605
DUPBAN
EugeneMarais 03I5662442
Media24CentraI SaIes
CraigNichclscn(dHB) 0II322073I
PickardL deBeer (CPT) 02I4439434
Media24CentraI SaIes
PcbynLamberL 0II4439434
DigitaI AdvertisingSaIes
CapeTcwn02I4688299
dchannesburg0II9938050
Durban02I4688070
SharedServices
PP0DUCTl0NMANA0EP(HEALTHANDSP0PT)
Kerry Nash
ADvEPT0PlAL C00PDlNAT0PAmy McsLerL
Directors
dchnPelihan
Pa| Lalbahadur
GeneraI Manager
dacques BreyLenbach
CircuIation
ClPCULATl0NMANA0EPPiaanWeyers
PP0DUCTMANA0EPdanine Synman
SUBSCPlPTl0NMANA0EPdenny Marinus
F0PANY0UEPlES, PLEASEPH0NE086I 636743

SLDBAL EDITIDNS[ EDITDPS-IN-CHIEF
AUSTPALIA
|an Ccckerill
BPAZIL
Sergic Xavier
BULSAPIA
vladimir KcnsIanIincv
CHINA
Zhcu Scng
CPDATIA
PcberI Frkcvic
FPANCE
PaIrick SuerineI
SEPMANY
Markus SIenglein
SPEECE
vassilis Secrgakakcs
HUNSAPY
MIe PszIcr
INDIA
Arccn Purie
INDDNESIA
Ninc Su|udi
ITALY
Enricc Barbieri
KAZAKHSTAN
Andrey Manuylcv
MALAYSIA
Jchn NS
NETHEPLANDS
Jan PeIer Jansen
PHILIPPINES
Allan Madrile|cs
PDLAND
KrzyszIcI Kcmar
PDPTUSAL
Pedrc Lucas
PDMANIA
Mihai Shiduc
PUSSIA
Kirill vishnepclsky
SEPBIA AND
MDNTENESPD
|van Padc|cic
SINSAPDPE
Kelvin Tan
SDUTHKDPEA
Seung Kwan Paik
SPAIN
Jcrdi MarIinez
THAILAND
ChaIchawin Unhanun
TUPKEY
FaIih Bykbayrak
UKPAINE
DmiIry PribyIkc
UNITED KINSDDM
Tcby Wiseman
LATIN AMEPICA
Franciscc Cuevas
APSENTINA
APUBA
CHILE
CDLDMBIA
CDSTA PICA
CUPAAD
DDMINICAN
PEPUBLIC
ECUADDP
EL SALVADDP
SUATEMALA
HDNDUPAS
MEXICD
NICAPASUA
PANAMA
PEPU
VENEZUELA
UNITED STATES DF AMEPICA
Bill Phillips
HodaIeInternationaI
SENl0PvlCEPPESlDENT, P0DALE
lNTEPNATl0NALPcberL Ncvick
EDlT0PlALDlPECT0Pdchnville
DEPUTYEDlT0PlALDlPECT0P, WUMEN5
HEAlTH&PPEvENTlUNLaura 0ngarc
DEPUTYEDlT0PlALDlPECT0P,
PUNNEP5WUPlDAND8lCYCllNSAND
lNTEPNATl0NALBPANDEDB00KS
vercnika Taylcr
C0NTENTMANA0EPKarl Pczemeyer
ASSlSTANTEDlT0PSamanLha0uisgard
EXECUTlvEDlPECT0P, BUSlNESS
DEvEL0PMENT&0L0BALLlCENSlN0
KevinLaBcnge
DlPECT0P, BUSlNESSDEvEL0PMENTAND
0L0BALLlCENSlN0AngelaKim
ASSlSTANTDlPECT0P, 0L0BAL
MAPKETlN0Maria Ursc
FlNANClALANALYSTMcira 0'Neill
lNTEPNATl0NALBUSlNESSDEvEL0PMENT
C00PDlNAT0PBurcuAcarlar
PP0DUCTl0NASSlSTANTShalene Chavez
Men'sHealLh, P0BcxI6368, vlaeberg, 80I8.
FAX. 02I4083547TEL. 02I4062I2I
EMAlL. Lellmhmedia24.ccm
WEBSlTE. www.mh.cc.za
UnlessprevicuslyagreedinwriLing, McnsHcc|th buysall righLsLcall ccnLribuLicns, wheLher imagecr LexL.
SUBSCPlPTl0NEN0UlPlES(www.my-mags.ccm)
TEL. 086I 636743l 02I 405II90 FAX. 02I 4064057
SMS. menshealLhsubs Lc 325II (PI per SMS)
EMAlL. menshealLh_subsmedia24.ccm
ALLSUBSCPlPTl0NPAYMENTST0.
Men'sHealLh, FreePcsL, NcCB006, CapeTcwn, 8000
PEPP0DUCTl0NMedia 24Peprc
PPlNTlN0Paarl Media Cape
DlSTPlBUTl0NNND240II 402 I205
CcpyrighL |I997Media24(PLy) LLd. All righLsreserved.
NcparL cl LhispublicaLicnmaybereprcduced, sLcredin
areLrieval sysLemcr beLransmiLLedinanylcrmcr byany
means, elecLrcniccr mechanical, wiLhcuL pricr permissicn
byMedia24(PLy) LLd.
September 2014
4 September 2014
Howcanl gIve
my cereaI a
nutrItIonboost?
BR`^N, DURB^N
Sfarfaffheboffomof fhebowI.
WhenbuyingcereaI, usefhe
6:6:IuruIe: afIeasffivegramsof
fibre, fivegramsof rofein, andno
morefhanIugramsof sugarer
serving, saysKimLarson, asorfs
diefifian. ddmiIk, andmafch
fhefoingsfoyourmission.
Hea|th|er Heart
A00
cup sliceJ
olmonJs (1uq
monounsoturoteJ fot)
1 lorqe opple, ony type,
sliceJ (1.4q pectin)
etter ra|npower
A00
,cup Jork
cbocolote pieces
(6mq flovonoiJs)
1 cup blockberries
(218mq flovonoiJs)
|gger Musc|es
A00
11q ploin yoqburt,
insteoJ of milk
(12q protein)
,cup unsolteJ pumpkin
seeJs (4q protein)
|atter e||y
A00
1 tbsp qrounJ cbio
seeJs (q fibre)
1 qreener (i.e., less
ripe) bonono, sliceJ
(8q fibre)
Dro n oark cnoco'a|e
|or a n| o| |'aonoos
Tnese an|oxoan|s can
e ,oJ a oJck con-
|e cnare, reor|s a
s|Jo, |ron^Js|ra'a
or 'on-|ernoene||s,
aoo oerres Tne, con-
|an |'aonoos |na| can
ao nenor, oer |ne
nock ,oJrse'| oJ| |n
nJ|s Tne, con|an
nanesJnano se'e-
nJn, nnera's |na| na,
aro o|| near| osease
Tnen aoo a s'ceo a'e
|or |ne ec|n, a |orno|
|ore |na| can reoJce
cno'es|ero', accoron
|o Dansn researcn
'| ,oJnaeannoJr or
noreoe|ore'||n, aoo
!5o| nJsc'e-oJ'on
ro|en|o,oJr oo',
Larsonaoses PJn-
knseeos ano'an
,onJr| areackeo
\orknoJ| soon ^oo
|as|-oes|ncaros, 'ke
oreocnerres, ns|eao
ocJs on |ore ''| |''s
,oJ J |as|er ano 'on-
er, so ,oJ're 'ess 'ke',
|o oe nJnr, no-norn-
n, Larson sa,s Cna
seeos con|an |''n
so'Jo'e |ore ano reen
oananas con|an ress-
|an| s|arcn, a |ore |na|
can ne' ,oJ oJrn |a|

| JJ JN.
N`|D

Got a quest|on? Drop us a


||ne at te||mhmed|a24.com
and we'|| get the answers
seniHc/sUmmzn
zo! ccLLzc!icH
September 2014

H
B
l
S

l
l

|
K
l
M
M

|
d l pay
my kIds' varsIty
fees or make
themfund It
themseIves?
R^NCO'S, PRETOR'^
C'assc oaoo'enna. On
onenano, ,oJ'rea|rao
|na| | ,oJ|oo| |neo'',
,oJr kos '' ,Js| coas|
|nroJnars|,. '| coJ'o
naooen: researcn|ron
k H
Percentoqe of menwboJont olwoys bove first-oiJ
spplies intbeir cor. 1be AmericonBeJCross recom-
menJs keepinqobosic emerqencykit inyor vebicle.
SoJrce: |n|e'
0|80I|8
Loao one eno o| a oaroe'' |n a !0k o'a|e
ano o'ace |ne o|ner eno n a 'ano nne,
a corner or a nea, en| o'a|e. ^ssJne
a s|aereo s|ance |n ,oJr 'e|| |oo|
|oraros ano |ne 'oaoeo eno o| |ne oar-
oe'' n |ron| o| ,oJ. Crao |ne eno o| |ne oar-
oe'' |n ,oJr rn| nano. L|| ,oJr nos ano
keeo ,oJr oack s|ran| so |ne en| s o||
|ne |'oor. PJ'' |ne en| |oaros ,oJr ros,
keeon ,oJr oack s|ran| |nroJnoJ|.
Do no| a''o,oJr 'oer oack |o ro|a|e. Do
3 se|s o| !0 reos. S|cn soes ano reoea|.
Howcanl
buIIda
strongback?
S'P=ELELE, E^ST R^ND
ForexIosivesfrengfh, use
Iandmines. ThesingIe-arm
Iandminerowsfrengfhens
fhemuscIesof youruer
andmiddIeback, which
sfabiIisesyourshouIders,
sayssfrengfhcoachBJ
Gaddour. Thaf increased
sfabiIifyheIsyouIiff more
weighf moresafeIyinjusf
abouf everyuer-body
exercise.PIus, fhemove
worksyourcoreasyoufighf
fokeeyourforsofrom
fwisfing. Af gym, usea
Iandmine(if IooksIikea
IafewifhamefaI fubeon
fo) orabarbeII fhaf`sbeen
wedgedinfoacorner.
1
2

Howcanl keepknots fromformIng


Inmy neckandshouIders?T'|, .OBURC
S|oo s||n'ke a caenan a| ork. =Jncnn n |ron| o| a screen keeos nJsc'es con|rac|eo, res|rc|n
o'ooo|'oano ox,en ano|ornnkno|s. Use an ao,Js|ao'e cnar |n arnres|s 'so ,oJ aren'| earn
,oJr snoJ'oers as earrns, sa,s Pro|essor .J'e ZJ'eer, a 'ec|Jrer n nJnan kne|cs ano nea'|n eoJca-
|on a| |ne Uners|, o| \sconsn a| Osnkosn. eeo ,oJr screen 35 |o 60cnaa, ano ao,Js| |on|s so ,oJ
on'| 'ean |o reao, sne sa,s. Tnen oo |nese s|re|cnes |nree or |oJr |nes a oa,. =o'o eacn |or !5 seconos.
0H8I
'n|er'ace ,oJr |ners oenno
,oJr oack. 'nna'e ano oJ'' ,oJr
arns oack ano Jo n'e s|ck-
n oJ| ,oJr cnes|. =o'o, ano
re'ease. Do | |nree |o |e |nes.
88 0 0K
C'aso ,oJr nanos ano oJsn Jo.
=o'o, re'ease ano reoea| |nree
|o |e |nes. Tnen s|ano, arns
Jo. Beno a| ,oJr as| |o ,oJr
rn|, no'o ano reoea| 'e||.
0K
T'| ,oJr neao rn|, |nen 'e||.
Brn ,oJr cnn |o ,oJr cnes|
ano no'o: |nen en|', 'ook Jo
a| |ne ce'n. Ro|a|e ,oJr
neao |o |ne rn|, |nen |ne 'e||.
UC|erceosnos |na|
s|Joen|s nonae|ner
eoJca|onoankro''eo
|eno|os'ack o|| anoearn
'oer raoes. On|ne
o|ner nano, | ,oJoon'|
oa,, ,oJ'reorreo|na|
,oJ''' saoo'e,oJr oro-
en, |noeo| |na| ''
oo|nenn|o|ner 30s.
'n20!!, |neaeraesze
o| an^osa s|Joen| 'oan
as R49500-ano
| as |akn, onaerae,
sx |oen| ,ears |oreoa,
|na|. Sona|'s ,oJr
o'a, as a resoonso'e
ooo Cona'|ses, sa,s
Pro|essor Rcnaro
\eooer, orec|or o| |ne
USnonoro|| Cen|er |or
Co''ee^||oroao'|, &
ProoJc||,. `oJ''' reoJce
,oJr kos' oeo| 'oaon'e
n|nena s|aken
s|Jo,n|ner oJ||s o||.
TonakesJre,oJr
con|roJ|ons |aken
,Js| as seroJs',, s|oJ-
'a|e|na| | oecon|nen|
on|ner earnna oass
nark o| 0or nner.
On, anona|eer ,oJ
oo, oesnar| aooJ| no
,oJ|nance,oJr na'|.
Don'| oon|o,oJr
re|renen| |Jnos.
l've heard that
kIdney stones
are on the rIse.
Howcan l teII If
l'mat rIsk?
|^R\^^N, C^PE TO\N
\na| ooes ,oJr sca'e
sa, Tne rse n ooes|,
s oenno |ne aa'ancne
o| s|ones, sa,s Dr
=aro'o rancn, orec|or
o| Enor, Uners|,'s
one, S|one Preen|on
C'nc. Tna|'s oecaJse
nea, nen o||en nae
nore s|one-orono|n
sJos|ances, sJcn as
ca'cJnano oxa'a|e, n
|ner Jrne as a resJ'| o|
oerea|n. '| ,oJ're |oo
nea,, ,oJ''' neeo |o
oroo k'os. (Tne |nrea|
o| excrJca|n oan s
a rea| no|a|or., BJ|
een | ,oJ're 'ean, oon'|
assJne ,oJr or'o can'|
oe rockeo: a ooor oe|, a
|an', ns|or, o| s|ones
ano neoca' cono|ons
sJcn as an oerac|e
|n,roo can rase ,oJr
ooos. LJck',, |ne oes|
neocne s on |ao.
'\a|er s |ne nos| oo-
er|J' oreen|e oecaJse
| o'J|es eer,|nn n
,oJr Jrne, rancn sa,s.
^s|Jo, n |ne Journa| of
the American $ociety of
Nephro|ogy |oJno |na|
nen no ornk nore
|nan 2`'|res o| |'Jo a
oa, are 29'ess 'ke', |o
|orns|ones |nan |nose
no ornk 'ess. `oJ can
a'so cJ| ,oJr rsk o,
|o''on |ne D^S=oe|:
eacn oa,, consJne 'ess
|nan 2 300 n''rans
o| sooJn(oon so
na, reoJce ca'cJn
n ,oJr Jrne, ano ea|
en| |o !0 serns o|
|resn orooJce (|rJ|s ano
ee|ao'es are nn n
s|one-oreen|nc|ra|e,.
Tne near|-nea'|n, o'an
can near', na'e a nan's
rsk o| s|ones, =araro
researcn snos.
Why do my eyes twItch when
l'mstressed-out?
=ENR`, E^ST LONDON
Tns onenonenon s ca''eo o'eonarosoasn
(|ron|ne Creek oro |or 'e,e'o, ano oe'ons
|o a 'are c'ass o| cono|ons ca''eo o,s|onas
(Creek |or 'oao |enson,, n ncn nJsc'es
con|rac| no'Jn|ar',. Cenera'',, an,|nn |na|
ncreases nere ac||, ('ke s|ress or ca||ene,
or 'oers a nJsc'e's sens||, |o a s|nJ'Js
('ke |a|Je or e,es|ran, can orn | on. Tne
e,es na, no| oe a noo |o |ne soJ', oJ|
|ne,'re a oeao eaa, |o an Jnnea'|n,
'|es|,'e. ^oo',n a arnconoress can ne'o
ooos| o'ooo|'oano rase |ne s|nJ'Js |nresn-
o'o, oJ| nos| cases o| o'eonarosoasnc'ear Jo
on |ner on. Con|ac| ,oJr ooc|or | ,oJ no|ce
oscnare |ron, or oan n, ,oJr e,e, son
cnanes, or ooJo'e son. Tnese s,no|ons
coJ'o noca|e an,|nn |ronan n|ec|on |o
a s|roke |na| na, neeo a||en|on |as|.
Y08 0Y,
0|880I0
by Dr T.E. Ho|t
September 2014

l
P
E
B
E
N
O
l
S
T

|! 'l

oea|s oe| ano exercse, oJ| |or a en| 'oss ooos|,
'eno an ear. Researcn |ronSoJ|n orea sJes|s |na| ar
acupunctur may hIp yu sh kIIs S|Jo, oar|c-
oan|s ore |ack-'ke neeo'es on |e acJoJnc|Jre oon|s n
a'|erna|n ears cons|an|', |or en| eeks. B, |ne eno, |ner
B|' nao oooeo o, 6- a rea|er oroo |nan |na| seen n
a con|ro' roJo on |ne sane oe| ano exercse renen.
Tne ear orcks, |are|eo a| oon|s |rao|ona'', 'nkeo |o
nooJ'a|on o| |ne s|onacn, so'een ano enoocrne
s,s|en, na, nae nao an aooe||e-sJooressn e||ec|,
a'|noJn nore researcn s neeoeo, |ne scen|s|s sa,.
September 2014
|V8
HN8I8k08
0|0I8
I80P8
P08
808 k0 N08
Tnee e e
n oreness
|sn't prerequ|s|te for
bu||d|ng musc|e, -
ne $trength ano
Conoitioning ourna| -
oe |e ee ne
ee, o -n
P||ess| B|ao Scne|eo
oe|e|eo |na| acnes.
ne |ne, n| sa
|na| ,J'e oaaeo |ne
Jsce eJn || | |
|ea| |se| ao |. a|e
| ecessa|, || as.
PJs. ne sa,s. '| Jcn
s|eess ca eoe ,J|
ao|, | | J| aa.
=ae'| ||aeo || a |e
ees |se osc-
||| o, || 20 n|e|
|na ,J| | ao s|
| |es sn|| | |aJ|e
,J| ||s| | |J|s.
Number of weekly core
workouts (including side planks,
bird dogs and curl-ups) that may
help manage lower back pain
SoJ|ce: The ouna| of t engt h ano Conoi t i oni ng Reeach
UR
RADAR
vtheL
oes WODsfand for Workouf of Daner?
Tree ouf of four rossFf arfcanfs
surveyed sad fey susfaned annjury
durn frann, a UKsfudy reveaIs.
Many eoIe aren`f yscaIIy reared
for rossFf`s nfensfy workoufs
and comIcafed overead Iffs, says
frann advsor BII arfman. s
advce: benany nfense roramme af
a comforfabIe IeveI; sIowIy sfe u fe
Ioad, seed and nfensfy; and never do
moves faf urf or faf youfnk mf
be danerous.
The Hurt L|st
Ee| |ce |na| se oo,
a||s ,Js| see | eo J
|e acn, |na |ne|s
Tna|'s | ,J| aa|.
'|Jsces |na| ,J'|e aoe
| s||e|cn as ,J'|e ao
|ne nae |ne s| |e-
|a || oaae ao |esJ|-
s|eess. sa,s
Scne|eo. See oe |
|o J| ncn Jsces a|e
s| |e | acnes a||e|
a na|o |J|.
HeyumbbeII, TryaSandbag
Se|es ,J eeo | e| o||, | e| o: sandbags prov|de a more effect|ve orkout
than dumbbe||s do, acc|o | a s|Jo, |||ne Ue|s|, | \scs a| |aJee.
Resea|cne|s |Jo |na| ee n exe|cseo |n |ne ea||n-|eo oas |es|e|eo nne|
nea|| |a|es ao oJ|eo |e ,Jes |na |nse n oo |ne exac| sae |J|e |n
oJooes. 'Tne |ne|, s |na| |ne sao sn|| |ne oa aes ,J| e| oo, ao c|e
| na|oe| | s|aose |ne ao. sa,s s|Jo, c-aJ|n| Dao .. C|e. a ce|||eo s||e|n
ao co| cacn. Tna| c|eases |ne |es|,. ncn ca ne oJo |e Jsce.
|Jsce

E
B
E
N

l
N

E
,
|
-
D

[
M

N
)
or up-to-the-
m|nute musc|e
nes and t|ps, go to
mh.co.za/tness
|Jsce
AltrIsk Is a dIvIsIon of Hollard LIfe Assurance, an authorIsed nancIal servIces provIder (FSP 17697).
CIve hIm our detaIls. All we need Is an Intent from hIm
to stop smokIng and he'll ImmedIately get reduced
premIums on a new rIsk Insurance polIcy from day one.
Plus we'll help hIm quIt.
For more InformatIon he needs to speak to hIs
nancIal advIsor or go to www.altrIsk.co.za
t wIll save hIm money
and probably hIs lIfe.
Fyno pays a lot more for
rIsk Insurance than a nonsmoker.
Save the Fyno.
September 2014

Fo uohe
|ue we|hoss
ews d |s o o
hofood

l
M

C
E
S

S
T
l
N
P
E
P
V
O
P
S
E
heSunshIneSubstItute
os| button mushrooms to sun||ght
can fort|fy themw|th bone-strengthen|ng, |mmun|ty-boost|ng
v|tam|n D.
k nJnans oroJc |ann Dn rsoons |o sJn'n|: nor
noor s|ora an oackan 'n|s |na| xoosJr. Tn so'J|on
S| oJ| a sn' 'a,r o| nJsnroons n rc| sJn |or an noJr. .Js|
|nr sJn-soak nJsnroons oro an n|r a,'s RD^ o| |ann
D ncn s soca'', Js|J' n n|r nn |n |o o 'on
|n sJn'n|-sJoo' |ann. .Js| o sJr |o
saJ|e |nnn o' o' or rzz' |nn
|n rssn |o n'o ,oJr oo,
aosoro |n |a|-so'Jo' nJ|rn|.
ON OUR
RADAR
CrIstaI CIear
Sre, foomanyNeYear`s foasfs canmake
yofzzy, bf infheIongrn, hamagnemay
heIyosfayshar. InaBrifishsfdy, rafs fhaf
consmedadaiIydoseof bbbIyfor sixeeks
shoeda86%imroemenf insafiaI memory
fesfs. PIs, fheir IeeIs of memory-boosfing
rofeins roseby2uu%. hamagnesIies
henoIicacids, comonds fhaf regIafefhose
rofeins. Theeffecf onhmans is nknon, bf
fhescienfisfs sggesf fhaf fhreegIasses aeek
mayimroeaffenfion.

Noo' ,oJr a, |o o|-


|r na'|n: Braz|| nuts
can he|p your cho|es-
tero| pro|e, sa,
rsarcnrs n (nr
's, Braz'. ^||r
na'|n, aJ'|s a| ,Js|
|oJr o| |n nJ|s n a
s||n |nr LDL (oa,
''s oo an |nr
=DL (oo, ''s ros
- an |n on|| 'as|
Jo |o 30 a,s. Braz'
nJ|s ar a rcn soJrc
o| s'nJn ncn na,
o'ock cno's|ro' oxa-
|on noron ,oJr 'o
oro|'. To rao |n on-
||s a| |oJr Braz' nJ|s
a| 'as| onc a non|n
|n s|J, aJ|nor sa,s.

Nx| |n ,oJ o'an


a ronan|c nn
scor x|ra oon|s an
oonJs an|oxan|s:
pa|r|ng strawberr|es
w|th choco|ate
boosts the nutr|-
t|ona| va|ue of both.
'n a Brnan `oJn
Unrs|, s|J,
orrs Jnk n
ark cnoco'a| (88
cacao, ooas| an
an|oxan| con|n|
|na| xc |n
sJn o| an|oxan|s
|ron |n nJa'
nrn|s. Tn
rsarcnrs sa,
cr|an an|oxan|s
rac| s,nrs|ca'',
|n acn o|nr cra|-
n a|ona' sas-
|n|n oor. BJ|
o sJr |o sk oJ|
nn-cacao cnoco'a|:
s|raorrs oo
n 54 cacao ark
cnoco'a| |a' |o
oroJc |n |c|.
STEALTH
HEALTH FOOD
Peppadews
Why They're Hea|thy
.Js| a |nr o| a cJo o|
|ns crJncn, ock'
ooors oacks nar',
na'| o| ,oJr a', rcon-
nn n|ak o| |a-
nn C. Lk roas| r
ooors |n, 'r a
oo a' o| |'aoJr |or
sJrorsn', |k'o-
,oJ's (a nr !42 or
srn, an can 'n a
s| sJo|' na| |o a
ar|, o| |oos.
Howto Eat Them
`oJ''' |n oooas
a'ons o's a| |n
sJornark| '
coJn|r or ,arr n |n
an|oas| as'. Snack
on |nns|ran| or s'c
|nnJo |o Js n san-
cns oas|a or as a
ozza |ooon. `oJ can
a'so s|J|| |ns o|-
sz ooors |n |rsn
oa|'s cns or |a |o
sr |n rnks.
Percentage of protein
powders tested that failed to
match the amounts listed on
the nutrition panel
SoJrce: CosJner Lao
September 2014
\n| oss
e-
m|nute we|ght-|oss
news and t|ps, go to
mh.co.za/we|ght-|oss

l
P
E
B
E
N
O
l
S
T

C
.
Z

P
l
O
|
|
l


on s'non o'ans
sn|nk ,oJ| o'',: o|n|s
'' sno', |nn oJ| ,oJ|
a''|. |a|| o, |''n Jo
on |n 'a|s| |sa|cn.
B|ood ype
D|ets
ns a|n o'ans a|
o|sc|o oas on
n|n| ,oJ'|
o| O. Tn, on'| ork
Canaan rsarcn con-
|rns. `s |rn| o'ans
oroJc |rn| rsJ'|s
oJ| |nos rsJ'|s na no|n-
n |o o |n o'oo |,o.
Med|terranean
D|et
^ rcn| s|J, oJo'sn
n |n British ourna| of
utrition |oJn |na| oo-
o' no son| !0 ,ars
on |n | - ncn s o
on nJ|s |sn an o' o'
as '' as |rJ|s an -
|ao's - an 'ss
o'', |a| |nan |nos no
n'| |o''o |n o'an.
New
Nord|c D|et
'| nonasss orrs
roo| |ao's nros
caooa nJsnroons
'Jns an oo|a|os
a'on |n nJ|s no-
'rans na|s an |sn.
Tn rsJ'|: an ara 'oss
o| 4.5k or 26 ks
accorn |o rsarcn |ron
(sJrors., Dnnark.
DAH
D|et
Tns | sn |o
'or o'oo orssJr
n'o ooo' |n
ao|s roo 5k n n|
ks n an 'ranan s|J,.
D^S= orscros |rJ|
s 'o-|a| ar, |sn
ooJ'|r, oans ss nJ|s
an no'rans.
ON O
ADA
oodGrazIg
hewon fhis: an edibIe grass
may heI revenf weighf gain,
a sfudy in fhe journaI FooJ onJ
Aqriculturol Immunoloqy reorfs.
Overweighf maIe rafs fhaf afe
sorghumfibre every day for eighf
weeks gained Iess weighf fhan
fhose on a sorghum-free dief.
Digesfing fhe fibre roduced
higher IeveIs of Loctobocillus
and BifiJobocterio, heaIfhy
guf bugs beIieved fo heI wifh
weighf confroI, according fo
fhe scienfisfs. More research is
needed fo verify fhe benefif.
verage number of faf kiIos addedfofhe
midsecfions of eoIe whogained.86kg
(I.8kg wenf fofheir arms andIegs)
oJc mri n Journ| o C| i ni | Nut ri t i on
Huger PaIs
ar a sona' |rao: nrsarcn
|ron`a' Scnoo' o| |cn sJ-
s|s |na| an achy back may make
you overeat. 'n |n s|J, ooo'
|n cnronc 'or-oack oan n,o,
oJn 'ss |nan oan-|r ooo'
. Tn rsarcnrs a'so |oJn |na|
no 'nk xs| o|n nonJcn
|n oack-oan sJ||rrs 'k |n |oo
an |n oJan||, |n, a|. Tns
sconnc| na, occJr ocaJs
oran crcJ|s |na| orocss oan or-
'ao |n |nos |na| rs|r |oo's
aooa' sa,s s|J, aJ|nor Dr PaJ'
na. Tn ||c| s s|ronr |n |a||,
|oos so ko 'ss o| |nnaroJn.
kIltkl I8|8K!
k|| |t0Il|8 |! I8l !kbl
50rr0kI5M050lI kI00rIk
0k0Ih* l0k48IIIIk0k800I
No ovrstotd protln volus - only 24 g hlgh-quollty,
grot-tostlng why protln ond lsolots.
Bonnd substonc-r

wlth hlgh concntrotlons o


omlno or moxlmumprotln synthsls.
ltro-mlcronltrd, ost-dlgstlng blnd uls muscls
whll moxlmlslng rcovry.
' Whn usd ln conjunctlon wlth on xrcls progromm.

1hls product hos bn tstd by H|L


Sport Sclnc, o world-closs ontl-doplng lob, or ovr J45 bonnd substoncs on th 2uJ4 World
Antl-Loplng Agncy [WALAj prohlbltd llst vlo H|L sklp lot tstlng protocol #|CPu3u7 ond hos bn
crtlnd bonnd substonc r. 1hs stotmnts hov not bn voluotd by th |ood ond Lrug
Admlnlstrotlon. 1hls product ls not lntndd to dlognos, trot, cur or prvnt ony dlsos.
B

y
o
n
d
_
1
h

_
B
l
u

_
L
4
8
3
3
4
PRO1L|N
24
CALOR|LS
!30
CARBS SGAR
4 !
AvoiIobIe in Iorger sfores


0
0
A
L|TY P0Th0Y
TA
S
T

8AL P80T|h
V|1AM|NS SPOR1S N1R|1|ON SL|MM|NG
@GNC_SA
www.gnc.co.za LiveWellGNC
Y JULIE STEART | PHOTOGRAPHS BEN ATTS

Her|tes, hes|ngs, hedances -and


hecando|t a|| |thafracturedneck
andabrokenr|b. Theman|ththe
unbreakab|estr|de, JasonDeru|o, |s
back andhe's |nbetter shapethan
eer (no, ser|ous|, Goog|e|t)
MAN OF STEEL
J ason Der ul o i s
t he ki ng of
col abs, havi ng
wor ked wi t h
ever yone f r om
Pi xi e Lot t t o
2 Chai nz.


Smedy
IT'S DIFFICULT TO SAY JASON DERULO'S NAME (OR EVEN THINK IT) WITHOUT
inging if fo yourseIf. If you`ve Iisfenedfo a shredof oradio infhe Iasf nve
years, you`ve jammedaIong wifhfhe R8Bsfar onhifs Iike Whafcha Say, In
My Head andRidin` SoIo. WeII, fhe guy who kees reminding youwho`s sing-
ing fhe song is back wifha newaIbum- 1olk Dirty - andaninfecfious newhif -
WiggIe, WiggIe - fhaf`s jusf infime for fhe summer. Oh, andhe`s aIso coming fo
Soufhfrica fhis monfhfor fhe inauguraI I Hearf Jozi Music esfivaI.
September 2014
f||e Ma|egrams
Hk IHI K|k 0 IH|k0 |8 IKk wY
80N Y00, Y00 8||8 H0w N00H Y00
PP80|I wHI Y00 |0V 0|k0"
Thing`s weren`f aIways Iooking fhis rosy for
DeruIo. Nof fwo years ago, his career - and
six-ack - were femorariIy deraiIedwhenhe
fracfuredhis neck whiIe rehearsing acrobafics
for anucoming four. e narrowIy escaed
araIysis. The four was canceIIedandDeruIo
suddenIy wenf fromdancing onsfage fo Iying
wifha brace aroundhis neck. f was a hard
fime for me, he says. was going onfhe
biggesf four of my Iife. II fhese Iuuuuseaf-
arenas were soIdouf aIready. To have fo canceI
fhaf was emofionaIIy draining.
Buf DeruIo didn`f waIIowinhis disaoinf-
menf for Iong. ffer a fewdays, he sfarfedsin-
ning his sefback info somefhing osifive. Sfe
one: draffing meIodies for a newaIbum(his
second, ). e enIisfedfhe heI
of roducers he idoIised, incIuding RedOne
andDr Luke, fo craff fhe soundhe wanfed.
wanfed fo make a recordfhaf wanfedfo Iisfen
fo aII fhe fime, he says. Nof jusf fhis year, nof
jusf nexf year, buf for a Iong fime.
DeruIo aIso hif fhe gym- neck brace and
aII - andfoundfhaf exercise was fhe besf medi-
cine for his body. f was hardaf nrsf: wouId
gef onfhe sfairs for abouf 2uminufes, very Iow
infensify, andfhaf`s reffy muchaII couIddo,
he says. wouIddo a IiffIe bif wifhdumbbeIIs,
buf nof very much. f was nofhing comared
fo fhe high-infensify workoufs anddancing
DeruIo was usedfo, buf he sIowIy buiIf his body
back uover fhe nexf year.
ffer a year of graduaIIy aming u his
workoufs, DeruIo decided if was fime fo go af
if fuII fhroffIe. n fhe morning, `d go fo fhe
beach and do srinfs. n fhe affernoon, `d go
fo fhe gymand do caIisfhenics wifh one min-
ufe or Iess resf in befween. nd af nighf `d Iiff
heavy, he says.
NowDeruIo, a seIf-rofessed gymraf, is
back fo hiffing fhe gymjusf once a day. Buf he
works his body hard, sfarfing wifh a warm-u,
4u uII-us, and 4u uside-down ush-us,
his favourife move. Then `II ick a workouf:
eifher chesf and frices, back and bices, or
Iegs, he says. Buf every singIe day work my
abs. mighf dro down and do 6u ush-us,
and fhen righf affer fhaf go info a Iank. The
abs are fhe focaI oinf, aIways.
s DeruIo recovered fromhis accidenf, he
mafured emofionaIIy, foo. Thaf one exeri-
ence heIed me fo growu in a second, he
says. was on aufoiIof. was going around
fhe worId. was erforming. was jusf going
fhrough fhe mofions. The gIamorous Iife
was his everyday. When fhaf kind of fhing is
faken away fromyou, you reaIise howmuch
you areciafe whaf you Iove doing and who
you Iove, he says. DeruIo cherished fhe fime
he senf wifh his famiIy during fhe recovery
- more fime fhan he`d senf wifh fhemin af
Ieasf four years.
Buf if wouIdn`f be his Iasf brush wifh inju-
ry. n JuIy fhis year, DeruIo suered a broken
rib - fhis fime during a baskefbaII game. Buf if
we`ve Iearned anyfhing abouf DeruIo, if`s fhaf
fhis wasn`f going fo sfo him. s if fo connrm
our susicions, he fook fo Twiffer, saying: n
sfudio again broken rib and aII. Pain when
sing buf aIso heaIing. Crazy howfhaf works.
`mnof canceIIing any shows!
Sefbacks are arf of Iife, buf DeruIo found
a way fo make fhe besf of his. f`s reaIIy easy
fo sIi info somewhaf of a sfuor affer some-
fhing fraumafic haens, he says. Buf fhe
besf fhing fo do is fo gef back u, dusf yourseIf
o and kee on going. if fhe gym- fhaf wiII
gef your mind o anyfhing, he says. You
can uf your sfresses info a barbeII and af fhe
same fime make your body beffer.
Merchahdise available Irom 22 AugusI 2014. Merchahdise prices are cohIrmed ih-sIore ahd ihclude VAT.
Goods are sub|ecI Io availabiliIy, Ior queries cohIacI Fashioh HoIlihe +2721 460 2300.
www.truworths.co.za TruworIhs Mah is a Iradihg divisioh oI TruworIhs LId (reg. ho. 1940/013923/06).
Primary place oI busihess: No. 1 MosIerI SIreeI, Cape Towh, SouIh AIrica, 8001.
s||O ||OO
LC'l/lF
From leII: T-shirI P220 Joggers P425 Sheakers P290 Suhglasses P89 T-shirI P180 ShirI P399
Joggers P550 Shoes P499 Suhglasses P99 Braces P120
WOMNOF SIN{ITY)

PremiumBusb Honq-
over fiIms was recenfIyinHong
Kong, fiIming anindie romance
wifhher fianc. We`re sfaying
indifferenf hofeI rooms because
we`re frying fobuiIdufhe fen-
sionfor fhe movie, she says.
Jeez -oor guy. See Chung`s
badbehaviour ondisIayfhis
monfhas she Iays anassassin
inSinCity: ADome toKill For.
AIIttIepatIencewIII pay
off bIg.
he's runnng fve Io 10
mnuIes laIe, I's because
she wanIs Io look her besI.
Be paIenI and leI I slde."
Let her seeyouInthe
best IIght.
"GreaI frsI daIes Iake
place durng Ihe day -
lunch on a weekend, a
hke, paddle boardng.
|I's always beIIer Io do
someIhng acIve, and f
I goes well, you can jusI
grab dnner laIe."
reathmInts: usethem.
"There's noIhng worse
Ihan a cuIe guy wIh
really bad breaIh."
We'renot as sensItIveas
youthInk.
"|f | don'I look greaI n IhaI
dress, jusI Iell me. | appre-
caIe Ihe honesIy."
CouId you stop pIayIng It
so damn cooI.
"Don'I waI Io IexI her afIer
a daIe. Do I as quckly as
you wanI. |I won'I be Ioo
soon f she lkes you. ThaI
also apples Io leIIng a grl
knowyou're noI nIo her."
0on't ever askIf we'reon
therag.
"|I's noI okay IoassumeIhaI
because|'mabIch, | musI
behavngmy perod. |I's
suchamsconcepIon. | can
beabIchwhenever | wanI."
omn

M|grms
Sxtngsyoundtoknow
about women, accord|ngto
JamIeChung
ShirI P499 JackeI P1 199 Jeahs P599 elI P32
Merchahdise available Irom 22 ugusI 214. Merchahdise prices are cohIrmed ih-sIore ahd ihclude VT. Goods are sub|ecI Io availabiliIy,
Ior queries cohIacI Fashioh HoIlihe +2721 46 23. www.truworths.co.za Dahiel HechIer is a Iradihg divisioh oI TruworIhs LId (reg. ho. 194139236).
Primary place oI busihess: No. 1 MosIerI SIreeI, ape Towh, SouIh Irica, 81.
September 2014
a|egrams
W
O
R
D
S
P
l

P
S
M

D
Y
P
H
O
T
O
C
R

P
H
P

P
V

N
K

T
S
LessonsfromtheWIId
Nav|gatetheurban|ung|eby th|nk|ng||keasurv|va||st
SURVIVOR MAN
If this guy can
row solo across
the ocean, you
can manage some
office politics.
2 Laughter Is the
Best MedIcIne
oJ're cons|an|',
|aceo |n nn-rsk, nn-s|ress s|J-
a|ons. 'n oroer |o cooe, |ne ooo, se-
cre|es aorena'ne |na|, oer |ne 'on
|ern, can caJse na,or nea'|n ssJes.
Tna|'s nere |ne ooo o'' |asnoneo
'aJn cones n. '| caJses nore
ox,en n|ake, |rers |ee'-ooo
enooronns, reJ'a|es near|oea| ano
ooos|s nnJn|,. 'LaJn|er s an an-
a'esc, sa,s \an e|s. ''| noroes
oan |o'erance. LaJnn a| a |e
oao ,okes nas '||eo |ne nooo on
een n, nos| n|ense |reks.
LEARN THIS LESSON Neeo a cJre |or
|ne o'Jes Learn |o 'aJn. Takn
|nns |oo seroJs', can, '|era'',, nae
a oanan e|ec| on ,oJ. LaJn|er
'' c'ear ,oJr nno so ,oJ can |ack'e
|ne oroo'en |n ao'ono.
4 FaIIureIsn't theEnd
'No s|or, s |noJ| s|rJ'e, sa,s
\an e|s. On one oar|cJ'ar occa-
son (oa, 46 o| ns |rans-^|'an|c
ro, |ne rea'|, o| |a'Jre oecane
a'' |oo c'ear |o |ne aoen|Jrer. 'n a
na||er o| nonen|s a oeace|J' oa,
|Jrneo n|o a coJs s|orn |na| 'e||
nn |n|n |or ns '|e |or |oJr no'e
oa,s. 'Tns as one o| |nose no-
nen|s ' sno', nao |o ano
see | |nroJn.
LEARN THIS LESSON 'On eer, exoe-
o|on ''e eer enoarkeo on, a| sone
oon|, ' s|areo |a'Jre n |ne |ace, sa,s
\an e|s. 'BJ| sJra' oenanos |na|
,oJ oansn |nose |noJn|s o| Jncer-
|an|, ano |ear o| 'osn. Tne ke,
|o sJccess sn'| |o no| |a', |'s |o
keeo on |nroJn |ne |a'Jre
ano narosno |o |ne e'' oesereo
c|or, a| |ne eno.
1 lt's Just Stuff
'DJrn n, so'o ro across |ne
^|'an|c, n, nos| orzeo oossesson
as an o'o crcke| na| (| saeo ne
|ron nan, a sJnoJrn,. One nornn
an Jnexoec|eo Js| o'e |ne na|
|ron n, neao n|o |ne ocean ano,
|noJ| |nnkn, ' ,Jnoeo oerooaro
a||er |. ^s ' n| |ne a|er ' rea'seo
|na| ''o |oro||en |o a||acn |ne sa|e|,
rooe ano, n a na||er o| nnJ|es, '
as seo| a ooo !5 ne|res |ron
n, ooa|. '| |ook eer, ncn o| n,
s|ren|n |o sn aans| |ne cJr-
ren| ano nen ' c'anoereo oack on
ooaro ' rea'seo no c'ose ' cane |o
oa,n |ne J'|na|e orce.
LEARN THIS LESSON Rasn oecsons
can cos| ,oJ o |ne. '| ,oJ're
on |o o'a, rsk, nake sJre
,oJ're no| oe||n |oo o - no| a''
c|ores are ans.
3 AStrongMIndMeans
a StrongEverythIngEIse
'Tne 'oes| oon| on n, so'o ro
as a'a,s aroJno 4an. ' as ex-
naJs|eo, s'Jnoeo oer |ne oars, Jn-
sJre o| n,se'| ano | ' coJ'o enoJre
ano|ner s|roke. Tne on', |noJn|s
|na| o| ne |nroJn ere o| oreak-
|as| ano |ne |e-nnJ|e sa|e''|e
onone ca'' |o n, |e, n. ^||er a
ooo nea' ano |ne reassJrance o|
n, |e's oce, ' |e'| enerseo ano
ao'e |o |ack'e ano|ner sn||.
LEARN THIS LESSON Een |noJn
on,sca'', no|nn nao cnaneo,
\an e|s |oJno nnse'| ao'e |o carr,
on |n reneeo oJr. \na| ae
=s nea|e nnose|. '' as a
cono'e|e', o|eren| oerson - '
en| |ron |nnkn ' coJ'on'| o on
|o ron 'ke a oeas| a'' oecaJse o|
|ne cnane n n, neao.
ENDURANCE ADVENTURER,
mofivafionaI seaker
andaufhor of 1beEiqbtb
ummit, Pefer vanKefs
shares his cIosebrushes
wifhdeafh-andhow
hesurvived.
erchahdise available Irom 22 ugusI 214.
Merchahdise prices are cohIrmed ih-sIore
ahd ihclude VT. Goods are sub|ecI Io
availabiliI, Ior queries cohIacI Fashioh
HoIlihe
+
2721 46 23. www.truworths.co.za
UZZ is a Iradihg divisioh oI TruworIhs LId
(reg. ho. 194/13923/6). Primar place oI
busihess: No. 1 MosIerI SIreeI, ape Towh,
SouIh Irica, 81.
MAPS WEARING
GolI I-shirI P399 JackeI P899
ShorIs P425 Sheakers P525
ap P14 elI P89
46 H.CO.Z | September 2014
Adventure Ma|egrams
YUR ANCSTRS WR UTRSMN.
Thaf makes youone foo. Humans have a
genefic incIinafionfoaffiIiafe wifhnafure, says
Dr arIyWood, a researchofficer af fhe Univer-
sifyof Essexwho`s sfudying fhe heaIfhbenefifs
of greenexercise. PeoIe whosendfime in
nafure have beffer seIf-esfeem, Iess fafigue and
anoveraII beffer sense of weIIbeing. Sure, you
canboosf your moodonfhe freadmiII, foo, buf
fhe effecf isn`f as dramafic. sfudyfromfhe
Universifyof GIasgowfoundfhaf oufdoor
ursuifs, suchas hiking, hada bigger osifive
imacf onmenfaI heaIfhfhanenergyexerfed
indoors. PeoIe overIookfhe owerfuI imacf
fhaf evena singIe nighf infhe wiIderness can
have, says mounfainguide IanEIman. If`s
aIways worfhfhe efforf. s Iong as yougear u
andreroerIy, weekendadvenfures don`f
needfobe uncomforfabIe eifher. SoIace uyour
boofs, fIuff uyour sIeeing bag andreare for
fhe year`s besf caming advenfure.
Totetra|| men! Pakuponr|da eadtote
w||dernessandreturnonSundaw|trenewed
energanda|ear ead
FourWIId
Weekends
Woareou
amp|ngw|t?
owouanswer
w||| determ|ne
wereougoand
wat oupak
BST TNT
Natura| Inst|nts
|gve|d 2 Tent R00,
OJ|ooor \renoJse
Sko |ne |oJr- no |e-
nn rs no o |n
|en| r|eo |or |o. One
J, crres |ne oo'es
no |', no |ne o|ner
crres |ne ooo,. N|Jr'
'ns|nc|s s oer|ec|: |'s
,Js| Jnoer |nree k'o-
rns no |e|Jres |n
ooors, so |n| ,oJr
c'Jns, (or |os,, |en|
n|e on'| |rno'e ,oJ
s ne c'nos n.
SMART PRP
'eeo ,oJr s|J|| Jnoer
!5 k'orns, s,s
.enn|er Pnrr Ds,
soeeo-nkn recoro
no'oer. |ke sJre no| |o
exceeo oJr|er o| ,oJr
en|, or rsk n,Jr,.
CAMP SSNTIAL
Sta|n|ess Stee| |p
|ask R!25, Coe
Unon |r|
`oJ n| |o ce'eor|e
,oJr oeor|Jre |ron
c's|on, rn|
Pck c'ssc no
|'sk |n| s|nos Jo
|o |ne oJse |n| oen
n |ne 'o en|'s.
PR TIP
Use ,oJr |er oo||'e s
,oJ oJ'o |onro''er
|o ork sore nJsc'es |
|ne eno o| |ne o,, s,s
Co'o, Broks|, senor
noJn|n Joe. `oJr
nke ock none ''
oe nJcn eser.
WKN N
TrIp wIth
the uys
IAL LCATIN
Rer or onrecno'e
o, 5-knnke
IICULTY
PRIVACY =n
PRKS =kn |e
k'one|res oJ|s ,oJ |r
enoJn n|o |ne 'o
|n| ,oJ're so'|eo, oJ|
no| so |r |n| ,oJ cn'|
crr, ooo |ooo no
'||'e oooze |o so roJno
|ne cno|re. `oJ cn
|ck'e |ne o oek on
S|Jro, no on SJn-
o,, ock Jo no s|''
oe none o, 9on.
GSI'S OUTDOORS
COMMUTER JV PRESS
MUG R35u, YUPPIECHEF.COM
Your favourife
barisfa is hours
away, buf fhaf
doesn`f meanyou
have fo resorf fo
fhe insfanf sfuff.
GSI have fiffed a
mug info a coffee
Iunger adding
convenience and
exfra insuIafion.
KOVE PIEZO SCOUT STOVE
R45u, CPE UNION MRT
Lighfweighf and efficienf, fhe IiffIe
sfove unches above ifs weighf.
Ifs Iarger burner head and suorf
arms meanfhaf
if`s erfecf for
soIo cooking or
rearing a Iarge
cam meaI for
fhe whoIe grou.
BRVEN BRV-1 OUTDOOR
BLUETOOTH SPEKER R1 94u,
LOOT.CO.Z
If`s waferroof and shockroof and,
beyond Iaying your beafs infhe bush,
youcancharge your hone wifhif.
Bseo on nkn os|nce,
reoJreo oJ|ooor sk''s no
n,Jr, rsk
on't |eaveome
w|tout teseout-
door essent|a|s
ll
'l\ JJl |l|

A
P
T

P
S

O
,
T
O

A
P
)
September 2014 O.Z 47
T SLEEPING BAG
Deuer Ob| +5
R! 099, Caoe Unon
|ar|
Ce| a s'eeon oa
|na|''' keeo oJ arn|
|'s near |reezn
oJ|soe, |noJ| aoon
nJcn oJ'k or en|.
Tne DeJ|er Oo| -5
Jses sn|ne|c na|era'
|o keeo |ne co'o oJ|
|noJ| conoronsn
on con|or| or aoon
Jnnecessar oJ'k.
SMART PREP
Cneck oJ| |ne eos|e
o| |ne o'ace |na| oJ're
'ookn |o cano a|. ^'so
oo a Coo'e searcn |o
see na| ooos Jo. \na|
oreoJs s|ors nae |o
sa aooJ| |ne canos|e
s n|o oJ (ano oJr
na|e, '' an| |o kno.
CAMP ESSENTIAL
Naura| Ins|ncs
A|um|n|umTab|e R00,
OJ|ooor \arenoJse
Tns s|Jro, |o'oao'e|ao'e
s oJr oes| oe|ence
aans| sano |ooo.
PRO TIP
ReJ'ar |en| oes
on'| rao n |ne sano,
sas |ark Screr, an
aoen|Jre |oJr Joe.
Use sone|nn oJ'k,
'ke a oece o| or||ooo.
Te a coro aroJno |,
oJr | |n ,Js| |ne
'ooo enern ano
|e oJr J-rooes
o|| on |na| 'ooo.
WEEKEND TWO
Th RomnI
Gwy
IDEAL LOCATION
Beacn, as |ar as oosso'e
|rono|ner canoers
DIFFICULTY
PRIVACY |eoJn
PERKS Na|Jra' seoJc-
|on. `oJ''' near |ne
'aoon a|er ano oe
,Js| a |es|eos |ron
a nJoe oo. 'P'Js, |'s
eas |o nake |re |n
or||ooo, sas ....
.aneson, a senor
ns|rJc|or |n RE'
OJ|ooor Scnoo'. .Js|
oe sJre |o cano e''
aooe nn |oe.
LETHERMN SKELETOOL
R1 u99, CPE UNION MRT
e ne s essenfaI and fe Iers wII
earnfer ee fe rsf fme youbusf
a zer or fry fo refreve a oI wraed
of ofafo o fe camre.
KOVE ESCPE POT SET
R475, CPE UNION MRT
e Iasf fn youwanf s fo dra a
eavy of sef wfyouor Iomefres.
e comacf sze o fs aIumnum
sef means you`II ardIy nofce as you
carf f around.
BLCK DIMOND SPOT
HEDLMP R65u, CPE
UNION MRT
s eadIam faes fe sfress ouf o
nf fme ood re wIe fe red
If wII eI youreserve your nf
vsondurn bafroombreas.
RY-BN POLRIZED
VITOR SUNGLSSES R1 596,
SUNGLSS HUT
dd a Ifer fo your vewo nafure.
Rayan`s oIarsed Ienses wII mrove
fe confrasf o fe worId around you,
aIIown youfo enoy nafure wfouf
fe sun`s ars Iare.
BEST TENT
Naura| Ins|ncs
Lowve|dDoub|eCab|n
PersonR4 000,
OJ|ooor \arenoJse
Pack a |en| |na|'s ra|eo
|or ex|ra oeoo'e, sas
=e'en O'sson, aJ|nor o|

Coe o Campn w
Kos. Een oe||er: a
oon a'' '' e
|nen|ner on soace.
SMART PREP
Do a or rJn n oJr
aroen aneao o| |ne,
sas Oss'on. 'Tnere's
no|nn orse |nan se|-
|n Jo Jnoreoareo |n
kos rJnnn aroJno.
Sea' |ne |en| seans
|or ex|ra ran oro|ec|on.
Pck Jo seansea'er |or
aroJno R55 |ron
OJ|ooor \arenoJse.
CAMP ESSENTIAL
Sar|s Bones 3
Cyc|e Boo Rack
R2 435, oJcc'e.co.za
\|n nnna' |ra||c,
canon roJnos are
a rea| enronnen| |or
|ne kos |o exo'ore on
|ner okes. Tnere na
een oe sone rea|
sn'e |rack |or oJ |o
conoJer nearo. 'nes|
n |ne Sars Bones rack,
ncn ||s on|o |ne oack
o| oJr car een | oJ
oon'| nae a |ooar.
PRO TIP
Pack sone none con-
|or|s |o ne'o oJr kos
aoao| |o |en| '|e, sas
O'sson. '| oJr oaJn|er
Jses a nn| 'ano, orn
a 'os|ck. '| oJr son
s'eeos |n a |eoo,
orn |na| |oo.
WEEKEND THREE
mIIy
m
IDEAL LOCATION
CanoroJno, sone-
nere near |ne a|er
DIFFICULTY
PRIVACY Lo
PERKS |axnJncon-
|or|. BecaJse oJ nae
an ao'J|on o'ock
nearo ano a enc'e
|o s|ore nea s|J||, oJ
oon'| neeo |o naJ' a |on
o| soeca'seo nkn
ear. To nake eer-
ooo naoo, soeno
sone |ne |non
|ne oea' soo|, ncn
snoJ'o oe aa |ron
'oJo canoers oJ|
c'ose enoJn |o |ne
ao'J|on o'ock.
September 2014

ngo
cmcoc|
ndo|| mnm
hk fomf,
nd|d|f
ST BACKPACK
Deuter Futura32
Unn|ar|
\nen s' nkn, ,J
neeo ,Jr oackoack
| oe cn|r|ao'e ano
re'ao'e. Tne J|Jra s
'are enJn | s|asn
a'' ,Jr necessar,
sJoo'es n'e oen
'n|en| enJn n|
| aoo | |ne oJroens
| oJnoJ oasnn.
SMART PREP
Leae ,Jrse'| |n n
excJses. Pack a'' ,Jr
ear n a sne'| n ,Jr
arae. \nen ,J're
reao, | , oack a''
|ne ear n| ,Jr oa
ano ore ||.
CAMP ESSENTIAL
Job JM3 Gr|pT|ght
Gor|||aPod Stand
R369, rnsorec|.c.za
\an| | cao|Jre ,Jrse'|
n |ne scener, Tns
'n|en| |roo can
cJr' arJno a |ree, 'no
r |en| o'e ano can
rk |n on| ano
sn| caneras ano
ns| snar|onnes.
PRO TIP
Brn a ,Jrna', ske|cn
oao, oron ok -
an,|nn | cao|Jre |na|
crea||, soke. 'Back-
oackn s nre |Jn
nen ,J ncrora|e
an|ner noo,, Pnarr
Das sa,s.
WEEKEND FOUR

IDEAL LOCATION
Tra', !5-3knnke
acrss areo
|erran
DIFFICULTY
PRIVACY =n
PERKS Tne s'|Joe
can oe re|resnn.
\'oerness |rann
orrannes ||en Jse
s' nkn | soark
sor|Ja' r|n ano
crea||,. '|'s oanerJs,
|nJn, s | ,J're
on |, s|ck | knn
rJ|es, ao Jnneces-
sar, rsks ano 'e| sne-
ne knexac|', nere
,J''' oe ano nen.
Adventure Ma|egrams

he ideaI sof is 6umfrom


a river or Iake -cIose enough
for access fo wafer, buf nof
so cIose fhaf yourisk oIIuf-
ing if or suffering froman
unexecfedfIood. Check
fhe surrounding frees for
deadIimbs, wasnesfs
or anyfhing hazardous fhaf
couIdfaII off. If fhe sife
sIoes, sfake fhe fenf so
fhaf your headis uhiII.
HELTER
This is your grou`s gafher-
ing sof. Youcanuse if fo fix
food, Iay cards, sfore gear
or waif ouf anaffernoon
cIoudbursf.
CAMPFlRE
he rok irle proIeIs
your flme from win n
provies hoI surfe for
poIs n pns.
FOO0
STORAGE
Keep riIIers
wy y seling
foo in plsIi
onIiner or
grge g.
Open foo is
likely Io IIrI
everyIhing from
n nI invsion
Io oons so
when iI's Iime
Io how on'I
leve open
or unfinishe.
OPEN SHELTER
Hng Ihree-y-
Ihree meIre sil
or Irp using
luminium poles
if you hve Ihem.
(OIherwise,
sIreIh Ihe Irp
eIween Irees.)
Mke iI jusI high
enough Io sIn
eneIh.
TENTS
SIury Irees provie
shelIer from rin n
hrsh morning sunlighI.
TOlLET TlME
|f you nee more privy Ihn
Ihe ushes provie, jusI hng
Irp. (The lies will Ihnk you.)
CAMPFlRE
BuiIdif af Ieasf I6mfrom
your fenf, andmake sure if`s
downwind, says Jameson.
Tenfs are fyicaIIy made of
nyIon, whichburns easiIy.
Aimfor fhree mefres of
oensky inaII direcfions.
Keewafer nearby.
LATRlNE
Make sure fhe camsife
foiIef is af Ieasf 6umfrom
rivers andIakes, evenones
fhaf are femorariIy dried
u. Youdon`f wanf any
run-off reaching fhe wafer.
For messier business, dig
a I6cmhoIe. Thensquaf,
droandbury.
Metres
L|ght
Heav
C|oth|ng
S
o
f
t
A
r
t
|
c
|
e
s
L
|
g
h
t
S|eep|ng Bag
Heav
L|ght
L|ght
C|oth|ng
S
o
f
t
A
r
t
|
c
|
e
s
S|eep|ng Bag
FOR STEEPER TERRAIN FOR MODERATE TERRAIN
How to pack your hIkIng bag
MIX BRIAKIA5I
NIIR PIIA5BRI.
juice fxtracter
fasy CIeaning
Safety leck
System
fxtra large
feed Chute
Prepare brand nev blends viIh Ihe IruiIs IhaI besI suiI your palaIe, using our
sIaIe-oI-Ihe-arI |uice LxIracIor ( |L 210 S). Nodern design and high qualiIy manuIacIuring
combine Io give you everyIhing you vanI aI Ihe push oI a buIIon.
BeIieve in better
September 2014
Ma|grams
ower fhe bag info fhe
of as you squeeze fhe
air ouf and seaI if. Cook
abouf 8u minufes; frans-
fer fo a bowI. Whisk in
u fo I cu meIfed buf-
fer unfiI roerIy mixed.
Season fo fasfe.
n mediumoI, whisk
4fbs dry whife wine
wifh egg yoIks and
4fs wafer unfiI foamy.
Transfer fo a ZiIoc bag.
Iam a buIIdog cIi on
fo fhe Ii of fhe of and
sIide a digifaI cooking
fhermomefer fhrough
one of fhe cIi`s han-
dIes so fhe fi sifs in fhe
wafer. djusf fhe heaf so
fhe wafer sfays af 6.
Punch Up Your Brunch
Rvv your trsramb|-ggbrakfast for ths morn
approah toth tratona| ggs Bnt
THIS MONTH'S EXPERT
NaaMydis fhe
co-aufhor of nist
uisineot Home, a book
fhaf deIves deeinfo
fhe science of food
andfIavour.
A
RocktheFoundatIon
\nen se'ec|n ,oJr oreao,
oror|se |ex|Jre Tne nooks
ano crannes o| an En'sn
nJ||n ne'o soo Jo ,o'k ano
saJce, oJ| so oo oaJe||e
s'ces, rJs|c no'eran
oreao ano crJncn, caoa||a
\na|eer ,oJ cnoose,
|oas| | care|J'',: Jn|oas|eo
oreao can oecone so,,
n'e a nea', |oas|eo s'ce
aosoros 'ke a roo| |'e
(|na| s, naro', a| a'',
B
lmprovetheProteIn
Back oacon nakes a c'as-
sc Beneoc|, oJ| |'s no| ,oJr
on', oo|on or een ,oJr
oes| one Soo n oJ''eo
oork, |resn cnorzo or sa'an
seareo n a or, oan Jn|'
crso Or o |n sea|ooo:
snokeo sa'non or ooraoo
s|anos Jo e'' |o no''anoa-
se eeo |ne oro|en 'a,er
aooJ| na'| a cen|ne|re
|nck - an, nore coJ'o
oerooer |ne osn
C
TucklnSomeGreens
B||er orooJce o||ers a
|'aoJr coJn|eroJncn |o
|ne rcnness o| |ne saJce
ano ,o'k SaJ|eeo son-
acn, o'ancneo orocco' ano
r''eo asoaraJs are rea|
oo|ons To nake sJre |ne
crea|on s|a,s n|ac| as ,oJr
Jes|s o n, o'ace |ne
ees on |oo o| |ne nea|
ano oe'o|ne e '|''' s|a,
onneo oon |noJ| escao-
n |ronJnoer ,oJr oacon
D
GoPoachIng
'' a neoJnoo| |nree-
oJar|ers |J'' |n a|er ano
nea| | on neoJn-nn Jn|'
|'s near', (oJ| no| oJ|e,
oo'n ^oo a oncn o| sa'|
ano a so'asn o| n|e ne-
ar, |o ne'o |ne n|e no'o |s
snaoe Crack a co'o e n|o
a oo' ano |o |ne e |ron
|ne oo' n|o |ne a|er
Cook Jn|' |ne n|e |nck-
ens, aooJ| 2nns Renoe
|n a s'o||eo sooon
HackYour
HoIIandaIse
Nooub|bo|r?
Noprob|m: ust
f|| amumpot
thr-quartrs
fu|| wthwatr

K
l
T

P
H
O

O
C
R

P
H

M
K

P
|

N
F
O
O
D

L
I
N
C
K

P
E
N
E
V

N
S

P
O
S
T
P
O
P
H
E
P
R
O
P

L
I
N
C

P
O
|
l
N
E

O
|
S
T
O
N

|
|
E

P
E
S
O

E
S
I
L
L

I
O
N

J
l
M
W
l
N
T
E
P
S
[
M

H
P
V
O
|
D

M
l

E
|
H
O
E
W
E
|
E
P
[
H
O
W
-
T
O

P
E

l
P
E

P
T
E
D
l
P
O
M
M
O
D
E
P
N
l
S
T

l
S
l
N
E

T
H
O
M
E
September 2014 MHO
Go Beyond the BIoody Mary
cy cockta|| canbetheperfect compan|ontoar|chbrunch.
Sohere|t |s: atequ||a-|nfusedsp|nonthem|che|ada(aMex|canbeer cockta||).
Thecreator |s author, GregSe|der (, ka|ahar|.com).
of wifh Iu us of wfer nd 8fs sIf unfiI usf
fender, ouf 2uminufes. rinnd ooI. (f you hve
Ieffovers fromIsf nighf, even effer.) ef Irge
frying n or hevy suf an on mediumhigh. Add
Ifbs buffer and fhen fhe ofafoes in one even Iayer.
Cook unfiI browned and cris, abouf minufes. FIi
fhem, furn fhe heaf fo mediumIowand add cu
each of choed onion and choed green eer.
Cook, furning occasionaIIy, unfiI fhe ofafoes are
browned, Iu fo I minufes. Add ]fs arika and
saIf and eer fo fasfe. Serve.

The tr|ck to cook|ng h|gh-qua||ty home
ch|ps |s to bu||d f|avours |n |ayers.
xecut|ve chef, Robert Steh||ng, exp|a|ns
howto pu|| off topnotch spuds
Easethe0aIIyGrInd
Your morn|ngcoffeew||| tastefresher |f
yougr|ndyour ownbeans. Thedrawback:
most gr|nders are|oudenoughtowake
upanyonest||| s|eep|ng
1 PORL JP
STINLSS STL
OFF GRINR
,
capecoffeebeans.co.za
aoJr|eanon
nonks, |nsrnoer
skosnos, e'ec|rc|,
oreno'aoesn|aoJr
o| o'o-|asnoneonan-
ooer. `oJnanocrank
|neoeceano|ssnaro
cerancoJrrsoJ'erse
|neco||eeoeans|or
naxnJn|'aoJr
ex|rac|on. BonJs: ,oJ
scoreanarnorkoJ|
oe|oreoreak|as|.
2 KRUPS URR
OFF GRINR
,
yuppiechef.co.za
'| ,oJan| ane'ec|rc
co||eernoer, soeno
|neex|racasnon'on
|ernre'ao'|, anosone
ex|ra|ea|Jres. Cnoose
oe|een!o||eren|
oereeso| coarseness
so|na| rearo'esso|
ne|ner ,oJ'renakn
,oJr nornn,aan
ao'Jner, oerco'a|or
or s|oe|oooo|, ,oJr
rnoer '' naecJ|
|neoeansoon|o
|neoea' sze.
HIt theRIm
For akick, wef fherimof a
highbaII gIass andfhenroII
if inTobascoSicySaIf.
Theheaf andsmokiness
arfner wifhfheresf of
fhedrink`s fIavours.
StoketheFIre
BuiIdaheaf basebymud-
dIingfwoor fhreeu.cenfi-
mefrejaIaeosIices infhe
boffomof fhegIass before
addingyour iceandIiquids.
Thaf wayyour guesfs won`f
bechewingonsfraighf-u
jaIaeosIices as fheydrink.
AddBoozel
FiII fhegIass wifhiceandadd
8umI of fequiIa, umI
fomafojuicewifhWorcesfer
sauce, ImI cIamjuice(find
if af your IocaI Asianmar-
kef), ImI freshIimejuice
and9u-I2umI Corona. Sfir,
garnishwifhIimeandserve.
FlRE
AN0
lCEl
7.
TOMATO
J UI CE
1.
LI ME WEDGE
2.
SPI CY
SEA SALT RI M
6.
MUDDLED
J ALAPEO
3.
BEER
4.
TEQUI LA
5.
FRESH LI ME
J UI CE
Cuf Ikg of red ofafoes info 2cmieces. BoiI fhemin
i h f d b I iI j
R
R
R
R

ORTHEGUY
WhoLIfts

oos|-orkoJ| scen|
,oJ're n |ne narke|
or sone|nn coo'
ano resn. Tns one,
o, soor|snan |Jrneo
nea orano Dao
Becknan, s a ,n-
oa essen|a'. 'n |ne can
,oJ''' no a nx o |an,
orane, nora|n
ner ano or, sanoa'-
ooo. ^'' n a'', |'s |ne
oerec| nx o ener,
ano soons|ca|on
,oJ'o exoec| ron
Co'oen Ba''s.
DavioBeckhamlnstinct
$port oeooorant spray
150m| ogars
FORTHEGUY
WhoCan't Stop
ScratchIng
' ,oJr oeo s 'ean
,oJ |cn,, rasn, ano
c'an a| ,oJr skn,
cnances are ,oJ're
a''erc |o |. Cneck |ne
can nex| |ne ano 'ook
or one |na| soor|s |ne
|ern'n,oo-a''erenc,
'ke |ne |nera' Sens-
|e rane ronCarner
|en. '|'s enrcneo |n
a o'canc nnera'
ca''eo |nera'|e |na|'s
oJck', aosoroeo o, |ne
skn ano can keeo,oJ
or, ano rr|a|on-ree or
Jo |o 48 noJrs.
Carnier MenMinera|
$ensitiveanti-perspirant
150m| C|icks
FORTHEGUY
WIthBucks
toBIow
\|n sJnner aroJno
|ne corner, een |ne o-
nane asnon noJses
are e||nn on |ne
oenano or oeo. ^oar|
ronoena rea| con-
oanon |o ,oJr co'one,
a oesner scen| s|ck
oers a nore cono'ex
se| o sne''s |nan ,oJr
JsJa' sJoernarke|
oern. Persona'',,
e're nes|nn |ns
one ron.aoanese
oesner 'sse, |,ake -
a reresnn o'eno o
,JzJ ano sanoa'ooo.
lsseyMiyakeLau
olsseyPour Homme
oeooorant spray150m|
ogars
FORTHEGUY
HopIng
toGet Some
' ,oJ an| |o nake a
'as|nnoresson on a
oa|e, ,oJ oon'| an| | |o
oe |na| ,oJ sne''eo 'ke
a nn-scnoo' cnann
roon. Uo ,oJr ane
|n a oesner oeo
|na|'s oo|n resn ano
arna| |ne sane |ne,
'ke |ns one ron|ne
Boss Orane rane.
\|n no|es o crso
aoo'e ano er, c|rJs,
sne''' oe keen |o sko
oesser| ano e| oack
|o ,oJr o'ace.
Boss Orange Man
oeooorant spray 150 m|
Truworths
FORTHEGUY
WIthWhIteMarks
onHIsShIrt
No|nn s on|o ae
,oJr snr|s (ano e|
osaooron'ooks ron
co''eaJes, 'ke n|e
narks Jnoer ,oJr arns.
Tna|'s n, |ne c'eer
J,s a| Doe 'aoora|o-
res |es|eo|ner ne
'nso'e Dr, an|-
oersoran| on oer
!00 co'oJrs (o'ack
ano n|e nc'Joeo,
|o crea|e a ornJ'a
|na|''' 'eae ,oJ sne''-
nresn (as e'' as
nos|Jrseo, |noJ|
|ne s|ans.
DoveMenCarelnvisib|e
Dryanti-perspirant
150m| PicknPay
FORTHEGUY
Under Pressure
B,oo n|ere, oeao-
'nes, een sex - |na|
ee'no oerornance
anxe|, |rers ,oJr
aoocrne 'anos (oJno
n ,oJr o|s, ron ano,
ero',, e,e'os, ncn
secre|e an o', sea|
oe'oeo o, oac|era.
Tnese oac|era, ncn
caJse a oao case
o BO, are |ne |are| o
Nea |en's S|ress
Pro|ec| an|-oersoran|.
Tne znc cono'ex |na|
ac|a|es nen ,oJr
aoocrne 'anos s|ar|
reac|n|o aorena'n
keeos ,oJ resn.
NiveaMen$tressProtect
anti-perspirant 150m|
Dis-Chem
52 MH.CO.Z | September 2014
room|ng Ma|egrams
FreshConnectIon
You're probab|y wear|ngdeodorant now, r|ght?ut |t m|ght not bether|ght onefor you.
Yep, you'vegot opt|ons -sochoosewe|| andbeat your sme||
DOUBLE WHMMY
king your boss
for a raise or if`s a baImy
summer`s day, you need
fo doubIe u on fhe deo.
Invesf in a fragrance
and ifs mafching deodor-
anf (Iike fhis one), and
wear fhem fogefher. Jusf
don`f overdo if. You don`f
wanf a Ron Burgundy, Sex
Panfher, sifuafion.
BIue
N
BIue
From cobalt suits and
sapphire shirts to teal shorts
and turquoise T-shirts,
runways (and city streets)
around the world are playing
host to Iashion's blue
period
MEN'5 HEALTH KEY LOOK5
A0vLRTl Sl h6 PR0M0Tl 0h
5MAPT
A mix ol cool
masculiniry
anc lashion
savvy, Lreak
lrom classic
Llack anc
_er your nexr
suir in ceep
Llue. Finish
up rhe look
wirh a Llue
shirr (|usr
make sure ir's
li_hrer rhan
rhe suir).
C
H
E
C
K
E
D
T

E
W

T
H
T

E
C
L

F
P
1
1
?
.
?
5
,
S

C
N
A
T
U
R
E
B
L
U
E
S
U

T
J
A
C
K
E
T
P
?
?
?
.
0
0
,
S

C
N
A
T
U
R
E
on
14
B
L
U
E
S
U

T
T
R

U
S
E
R
S
P
4
4
?
.
?
5
,
S

C
N
A
T
U
R
E
L

C
H
T
B
L
U
E
S
H

R
T
P
1
7
?
.
?
5
,
S

C
N
A
T
U
R
E
W

v
E
N
S
H

R
T
P
3
4
?
.
?
5
,
S
T

N
E
H
A
R
B

U
R
H
E
R

T
A
C
E

N
E
C
R
E
E
N
E
L
E
F
H
A
N
T
H

D
E
D
T
E
E
P
?
?
?
.
?
5
S
A
L
S
A
T
E
E
P
4
?
?
.
?
5
B
L
U
E

X
F

R
D
S
H

R
T
S
P
3
4
?
.
?
5
,
S
T

N
E
H
A
R
B

U
R
H
E
R

T
A
C
E
CA5UAL
Norhin_ says "cool, calm anc collecrec" like
layers ol complemenrary Llue. Mixin_ rones,
rexrures anc parrerns will _ive your look
ec_e Lur |usr make sure ir's nor all rhe same
shace or ir'll look like you're our in your FJs.
r
s
Louis Vuitto
Spring/
Summer 20
Calvin Klein
Spring/
Summer 2014
September 2014
ch
ch: TheNe GeneraIon
There's anewwaveof next-gentechonthemarket that's heretochangeour ||fe-or |s |t?
mrtgIsss
oo s|| n |n
| |n oo ss
|noo |n| os
n| oJ s |n o|o
ss| |J oJ |o 2
|noJ| |n no oo| ssss
|n. n o | s nsJo
so. |noJn o|| J n|
o |ns |noo s |n J|J
- esoeca'', n nore oscre|e |orns
'ke con|ac| 'enses. eeo an e,e
oJ| |or |ns one. (See na| e
oo |nere,
ER0lCT: NOT YET
4KTVs
Ber ano oe||er s na| |ne 4 T\
aos oronse. Sno', oJ|, 4 neans
|na| |ne screen nas aooJ| 4 000
norzon|a' oxe's (oJr cJrren| =D T\s
on', nae ! 080,. ^ snaroer nae
ooes soJno nore aooea'n, oJ|
|nere's a oer oroo'en |acn ear',
aooo|ers |nan |ne exoro|an| orce |a
|na| cones |n |nese Jn|s. \nere
e're a|, er, '||'e con|en| s oen
orooJceo n 4. '|'s sor| o| 'ke on-
n a D\D o'a,er nen ,oJr 'oca'
oeo s|ore s s|'' on |ne \=S |ran.
VER0lCT: NOT YET
CurvedTVs
=ere's |ne sn|ck: o, crea|n a
|e'eson screen |n a s'n| arc
- no oosso'e |nanks |o |ne OLED
oso'a, (oranc 'n|-en||n
oooes, - ,oJ e| a nore nner-
se exoerence. SJre, |'s nores-
se a| |rs|, oJ| |ne nnck e|s
o'o oJcker |nan rerJns o| Kp-
ng Up Wth Th Kroshns. Bo|-
|on 'ne: oon'| renen| |ne nee'.
Tne |J|Jre o| |e'eson s n 'arer,
cneaoer Jn|s ano oe||er oro,ec|ors
- no| cJreo screens.
VER0lCT: NEVER
VIrtuaI ReaIIty
\e're |a'kn J'|na|e nnerson,
|nanks |o |ne aoen| o| OLED ano |s
ao'|, |o orn 'n|, orac|ca' \R n|o
|ne none o| J,s no aren'| Ton,
S|ark. CoJo'e |na| |n |ne |ocJs on
noo'e (ano |nere|ore sna''er, nore
ooer|J', orocessors ano \R s sJo-
oen', 'ookn er, 'e|. Tne nanes
|o kno are |ne OcJ'Js R|| ano
Son,'s Pro,ec| |oroneJs. Tne knks
are s|'' oen roneo oJ| (ozzness,
naJsea, oJ| oon'| 'e| |na| s|oo ,oJ
oscoern a no'e ne rea'|,.
VER0lCT: YES
OUR HISTORY (AND LANDFILLS) ARE PILED HIGH WITH DEVICES THAT NEVER QUITE DELIVERED. REMEMBER MICROSOFT'S
chhoeIessIyfriedfofakeonfheiPod?Orfhefwo-wheeIedSegway, afaiIurefofhefuneof 8uuuusaIesin
sevenyears?Ye, foreverygeniusgadgef fhere`sabunchof duds, whichiswhywe`vesef ourBSmoniforsonhighanduf
fhenexf-genfechof fhemomenf fofhefesf.
Ma|egrams

o ooc .ooo.t.oo |c.sc ..s.t ..._cco-cosscoo


September 2014
grams
PrIntIng
|J|Jre - exceo| |'s
a'reao, nere, ano cones |n |ne
oronse o| oen ao'e |o crea|e
an,|nn (no rea'',, soneone's een
naoe a Jn, a'' a| |ne oress o| a
oJ||on. Tnere are a coJo'e o| oranos
s'o', oeconn noJseno'o nanes,
nos| |anoJs', |ne |akerBo|, oJ|
|ne,'re a'' s|'' |acn oJ|oJ| s|rJ'es.
'| can |ake noJrs |o orn| sone|nn
ano s cJrren|', oJ|e exoense, en
|ne cos| o| |ne oo',ner |n ncn
|ne orn|er oJ'os |ne |ens. Oer
|ne, |noJn, |ns '' e| cneaoer
- ano |ne |ecnno'o, nore ao'e.
VER0lCT: YES
WearabIeHeaIthTech
=ea'|n non|orn oeces nae
oecone a o narke| o'a,er oer
|ne 'as| ,ear ano a o| (|nere's een
|a'k o| an ^oo'e oece n |ne orks,.
|os| o| |nen cJrren|', |ake |ne |orn
o| a rs|oano |na| co''ec|s oa|a ano
'nk | |o ,oJr snar|onone: .aoone's
UP ano |o| are oosso', |ne nos|
|anoJs. Tne sJccess o| |ns ne
|ecnno'o, re'es on |s oooJ'ar|,.
Tne nore oeoo'e no aooo| |, |ne
nore oa|a can oe recoroeo ano |nJs
|ne nore conoanes '' oe ''n |o
nes|. Tns s |ne |J|Jre o| nea'|n.
VER0lCT: YES
Smart homes
\|n \- enao'eo 'n|n, aoo-
con|ro''eo none secJr|, ano noJse-
no'o cen|ra' 'ockn, oJr nones are
ron Jo |as|. Tne |ecnno'o,
na, oe n |s n|anc, no, oJ| o'ans
are a'reao, n |ne orks |o n|rooJce
an ooera|n s,s|en |na| can
nano'e eer, asoec| o| ,oJr none.
Un|' |nen, 'ockn ,oJrse'| oJ| s s|''
a er, rea' oosso'|,.
VER0lCT: NOT YET
EIectrIccars
E'on |Jsk ano Tes'a |o|ors naoe
e'ec|rc cars sex, - ano naoe
|nen a ao'e narke| con|enoer.
So n, aren'| |nese oa||er,-
ooera|eo oao oo,s oonna|n oJr
nna,s Basca'',, |ne or'o's
e'ec|rc|, o'an|s are coa' ooer-
a|eo, ncn neans |ne,'re s|''
oea'n a nea, o'o |o |ne
enronnen| (ano Jnoernnn
|ne no'e oon| o| e'ec|rc |rae',.
Can oenano cnane |na| '|'s 'ke
askn | eer,one sJooen', en|
ee|aran, oJ'o oeoo'e s|oo
|arnn sneeo Le|'s a| ano see.
VER0lCT: MAYBE
SLEEPBOT
iO$, noroio)
^||er a ooo nn|'s
s'eeo |nere's '||'e a nan
canno| acnee. ron
|rackn s'eeo oa||erns,
non|orn noenen|
ano soJnos ano een
akn ,oJ |n raoJa'
a'arns ns|eao o| a o'ar-
n |onorn, |ns nano,
aoo s nere |o naxnse
,oJr snJ|-e,e. Fr
CLEAR
(iO$)
'| sno'e ano oeaJ||J'
|o-oo 's|s are sone-
|nn |na|'s noor|an|
|o ,oJ, C'ear s |ne
anser. Tnere are |e
|nns as oeeo', sa|s-
|,n as son a |ask
|ron ,oJr 's| once |'s
oone. R60
CAMCARD
(iO$, noroio)
Tnnk o| | as a Ro'o-
oex, on', |'s on ,oJr
snar|onone. CanCaro
ne'os ,oJ scan oJs-
ness caros ano saes
|ne oe|a's |o ,oJr con-
|ac|s. |akes '|e (ano
,oJr a''e|, a 'oao
'n|er. Fr
SWIFTKEY
(noroio)
\an| |o nake |,on
on ,oJr ^noroo oece
a '||'e nore n|J|e
Tnen cneck oJ| S||-
e,, an aoo |na| 'e|s
,oJ soe |nroJn ,oJr
ke,ooaro ncn, en
sone orac|ce, coJ'o
nake ,oJr |,on a
no'e 'o| |as|er. Fr
EVERNOTE
(iO$, noroio)
'| na, no| oe no| o||
|ne oress, oJ| |'s s|''
|ne nos| conorenen-
se no|e-|akn,
oocJnen|-s|orn aoo
oJ| |nere. Eer,|nn
,oJ neeo s oranseo
n one o'ace. '|'s
e||cen|, snar| ano,
once ,oJ e| Jseo |o
|, nosoensao'e. Fr
THERE'S AN
APP FOR THATl
For vry prob|m
thr's an app to
so|v |t. Ths ar
our top p|cks
8 September 2014
ll l\l lJ ll
Punch LIst
Q Maegras
The 13 thgs that' ake ou
sarter tha aoe ese

P
S

D
Y

|
|
O

S
/

T
T
Y

S
.

[
W
O

)
'lJ1 lJl''' lJ J'''
lJ'\J Jl \Jl l lJ'\J
W
l
N

O
W
N
R
E
V
U
P
At-J
oe
oano snce |ne, o'a,eo a| Rockn
|ne Dases a ,ear ao. Tner secono
a'oJn, Ths s Yurs, s oJ| on
22 Seo|enoer. Don'oao 'Le|| =ano
ree ano |ne |'e,-C,rJs-sano'n
'=Jner o| |ne Pne.
1 Grad Prx
^ sJre a, |o oea| |nose SJnoa,
o'Jes. Tne '|a'an Crano Prx kcks
o| |ron 5- Seo|enoer n'e |ne
Snaoore Crano Prx |akes secono
o'ace |ron !9-2! Seo|enoer.
Cen|'enen, s|ar| ,oJr ennes.
JesseJ
Tne ne ko on |ne eer-exoanon
|es|a' o'ock, |ne ' =ear| .ooJr
|Jsc es|a' ooas|s an noresse
'neJo nc'Jon .ason DerJ'o, Panc.
^| Tne Dsco ano |ns oeaJ||J'
,oJ can nano'e
s o| ,o''n, |'s |or
J. (6 Seo|enoer,
Scarett J
\nen a oa o
sJos|ance exo
orJ nJ'e LJc
sne |nos ners
access !00
^ooaren|', |na
|e'ekness, cn
e,es ano |ne a
s|oo |ne. \na
|'s Scar'e||.
(ucy, 29 ^JJ

Megaox
Een | |nere
ere nore
reasons |o o
see Teeage
ua ja
Tures, |ne
on', one |na|
oJ'o na||er
s |ne re|Jrn
o| |ean ox |o
|ne o screen,
snarn oa
|n |e|raooos.
(!9 Seo|enoer,
The ra
Tne J,s nose sons naoe ,oJr
r'|reno cr, reoea|eo', on Creys
ay are ornn |ner o'eno
o| saocore oano so'os ano so||
rock |o oJr |ar snores. Tna| oen
sao, 'Loe Don'| De s s|'' an
aesone son. (.=B !9 Seo|enoer,
CPT 20 Seo|enoer,.
vs
Tne ae-o'o oa||'e o| no '' n |ne
\or'o CJo nanoer con|nJes. ili
5 (oJ| 26 Seo|enoer. R745, ka'anar.
con, nas |ne nane, oJ| Pr vu
$ccer (oJ| nex| non|n, R8, s
e||n a con|ro' s,s|en s|rean'nn
|na| nn| ,Js| |o |ne scro|.
The Spet What?
Tne nos| exoense
oeo ane eer naoe
s re'easeo |ns non|n
(9 Seo|enoer,. Desy,
ncn se| oee'ooers oack
500-n''on, s an on'ne
nJ'|o'a,er ane |na|
o'enos e'enen|s o| sc-|
ro'e o'a,n |n |rs| oerson
snoo|er necnancs. Pck
,oJr arnoJr-c'ao, Jn-|o|n
aa|ar ano exo'ore a oos|-aooca',o|c Ear|n n searcn
o| ansers. '|'s no|nn ne, oJ| | sJre 'ooks ore||,.
(R699, ka'anar.con,
Are ou kddg?
Ta,'or S||, =o'',ooo s|ar.
(The Cver, oJ| !2 Seo|enoer,
Not a thg
|ean ox, =o'',ooo s|ar.
Oka, we're steg
Neconer D,'an O'Bren, =o'',ooo s|ar.
Posso',. (The Maze Ruer, oJ| 26 Seo|enoer,
Thg. Defte.
Crne |c|on s k''n |. (Nc Po'a||o's Caves,
S|eonen n's Mr Merceoes, Deon |e,er's Cbra,

AaIvao
\no'eoon
nn| oe o
oJ| e na
seen |ne 'a
Johasso
o| c'ass-^
xo'ooes n
c,'s s|onacn
se'| ao'e |o
o| ner oran.
a| neans
nane'eon
ao'|, |o
na|eer,
Js|,
^| Tne Dsco a
Br|, .esse .. '|
!2 noJrs
,oJ
o
(!9 Seo|enoer, oJr |aoJr
cnano. ^n
Jo sone S
^-ane
US Ooen
(25 ^JJs
8 Seo|en
|nen ,oJ c
ner on 'ns|
anaano
SeroJs',,
or|n |.
ovc
on
oer,
en'|
as| o
|
o|
|e |e
na se
Sero
nen
kcks
s| |o
oer,.
can |o
|ara
oc.
|'s
eres
an
o''o
an,
NOW OPEN - ROSEBANK MALL
F

/
S
E
P
2
0
1
4
|v|ng Ma|egrams

l
B
P
O
W
N

H
C

l
D
O
/
H

|
|
E
Y
P
E
S
O

P
C
E
S

P
T
l
S
J
l
N
K
l
N
S

T
O
P
O
l
P

C
E

September 2014
Redene Househo|d Hass|es
hinking I wanf fo insfead of I have fo makes any
fask easier, evenwhenyou`d rafher veg fhanmow.
: Trenos in Cognitive $ciences
Your fIve-year-oId
deckIooksIIke
It's100yearsoId.
ore san. 'nseao
e ,oJr nanos on a
nn-ressJre asner
ano o'as aa, ,ears
o| rne ano n'oe.
Tnen eaner roo| ne
soe n a aer
roo|n sea'an. Un'ke
san, ,oJ can ,Js s'o
ns sJ|| on n a
anorJsn noJ ne
|ear o| s''ae or
Jneen osroJon.
SIugsandsnaIIs
arechowIngdown
onyour garden.
BJ, 'ena oeer. BJr, a
|een, Jseo cans
so ner os are |'Jsn
n ne so'. No|''
nenn oeer - re|-
erao', no na rare a'e
,oJ oroJn oack |ron
Be'Jn. See, 'ke ,oJ,
s'Js |no sone o| ne
conoJnos creaeo
oJrn oeer |ernena-
on re, rea. ^no
nen ne, o |or a s,
ne,''' s' n ano oron.
GrasscIIppIngs
cIogtheundersIde
of your mower.
Be|ore ,oJ sar on ne
'an, rao a can o|
cookn sra,, ana
ne nacnne's Jnoer-
soe ano o'as aa,.
Tne nore ,oJ rease
J, ne 'ess rass ''
sck. ^no n'e ,oJ're
a , sra, ne rae on
,oJr oraa. (No nen
,oJ're Jsn , oner-
se ,oJ''' oe a nJnan
|reoa''., Tna''' kee
,oJr nea c'n-|ree.
YoudIdn't cover
your braaI and
nowIt'srusted.
Don' ase ,oJr naro
earneo oJcks on a ne
oraa: ,oJ can re|Jrosn
,oJrs n aooJ 20 nn-
Jes. rs, renoe ne
nano'es ano rn
eces. Tnen oJ|| o||
ne rJs n !80-r
sanoaer. na'',,
sra, on nn-nea
an Jsn een
srokes. `oJr \eoer s
noas ooo as ne.
CIeanIngup
hedgetrImmIngs
takesforever.
ore ne rake-ano-
oa aroacn. 'nseao,
sreao oJ a ar or
oro c'on oenean ne
snrJos ano snear aa,.
\nen ,oJ're |nsneo,
,Js ora ne |''eo ar
o ,oJr orJsn 'e or
'eae ne rnnns
|or roaosoe ck J.
''s easer nan r,n o
ck J eer, 'as .
^no ,oJ on 'eae an
Jnsn', ness.
Your stoepIs
becomInga
weedymess.
Traoona' eeo k''ers
can narnne enron-
nen ano cra'n kos.
'nseao, r, sckn a
|'a-neao screorer
n oeeen concree
aers or cenen s'aos
o excaae ano oesro,
ne eeos' roo s,s-
ens. '| na |a's, o |J''
oo': ,Js |'' a ke'e n
aer, orn o a oo'
ano oJr on an,
eeos ,oJ an o oe.
SIP N SLIP
Slice the
top off a
beer can so
the slugs
can get in.
ConquerYardWorkwIthBeer
Thequ|cker your garden|ngchores aref|n|shed, thesooner youcank|ck back anden|oy
thereturnof spr|ng. Here's your gu|detomak|ngshort work of outdoor adm|n
bridgestonesa.mobi

w 0kh'I 60k8khI THAT 'THE |U\CH A\O C0|O OR|\|' |0R \0UR
\Ew BEST |R|E\O |S\'T 0|\ T0 C0ST \0U AT |EAST O0 BUC|S.
w 0kh 60k8khI THAT || \0U OA|AE \0UR ||REST0\E T\RE
ETT|\ BAC| H0|E, wE w||| REP|ACE |T. \0U 0\|\ PA\ |0R THE
TREAO \0U'VE USEO A\O U\|||E |\SURA\CE, \0U O0\'T \EEO T0 PA\
|EES. II'5 F8.
Te|r & Cc|d|||c| app|].
vvv.brUgesone.co.zn
BrUgesone SoUH Afrcn.
Aunlnble n:
September 2014
NG MOTORBlKE
BMW R1200RT
o|nn oea|s n||n |ne ooen roao
on |ne R!200RT. Tns a''-roJnoer
oJnos |ne B|\ !600CT oJ|
o| |ne |aoJr|e oos|on, accoron
|o c|e Wor|o. \|n ooo no
oro|ec|on, oackn soace ano
a |Je' econon, o| !8kn |o |ne '|re,
|'s eas, |o Jnoers|ano n,.
$ource. Cycle World
2I BEST TABLET ON A BU0GET
The Neus 7
Sao',, e can'| a'' a|oro an Pao ^r,
oJ| R2 289 (ka'anar.con, oJ,s ,oJ a
|J'' =D ^noroo oece |na| nas !6CB
o| s|orae ano enoJn orocessn
ooer |o |n| o| nos| 'as. '|'s a'so
a rea'', nce |o, |o e ,oJr o|a'
eo|ons o| Mens Hea|th on.
$ource. Kalahari.com
3I BEST MOVlE FRANCHlSE
MarveI ComIcs
Tne s|Joo oenno sJoerneroes
'ke Sooer-|an, SJoernan ano
|ne ^eners oer|ook |ne Harry
Potter seres |o oecone |ne nnes|-
rossn |'n |rancnse n =o'',ooo
ns|or,. |are''s ac|on |'ns nae
enera|eo n excess o| S2.45-
o''on so |ar, |n nan, nore
re'eases |o |o''o.
$ource. Boxohce.com
4I BlGGEST COFFEE CONSUMER
The NetherIands
Tne DJ|cn on'| ,Joe ,oJ |or
,oJr co|ee nao|, nan', oecaJse
|ne, orooao', ornk nore o| | |nan
,oJ oo. \n'e SoJ|n ^|rcans on',
nanae an aerae o| 0.!3 cJos
a oa,, |ne DJ|cn so aa, 2.4 cJos
eer, 24 noJrs, accoron |o oa|a
cono'eo o, EJronon|or.
$ource. Euromonitor
5I WORST TRAFFlC lN SA
Cape Ton
Tnere's o'en|, o| |ne |o aonre
Tao'e |oJn|an n'e s|Jck n
|ra|c. Sa|e''|e naa|on soeca's|
TonTon |oJno |na| Caoe Ton
connJ|ers exoerence orse
|ra|c |nan |ner .o oro|ners,
|n connJ|ers soenon an
aerae o| !0 orkn oa,s
a ,ear s|Jck n ro'ock.
$ource. TomTom
6I MOST ENVlRONMENTALLY
FRlEN0LY SKYSCRAPER
PhoenI Toers
\nen |ne,'re cono'e|eo, Cnna's
k'one|re-nn Pnoenx Toers ''
sna|cn |ne ||'e o| |a''es| oJ'on
n |ne or'o |ron DJoa's |anoJs
BJr, na'|a. BJ| nore noor|an|',,
|ne,''' '|era'', oe oJr|,n |ne
enronnen|. Tree-nJer |ea|Jres
nc'Joe sJsoenoeo ar aroens,
a|er rec,c'n oonass oo'ers ano
n,oroen |Je' ce''s, neann |ne
|oers '' oe ao'e |o enera|e |ner
on ooer.
$ource. Chetwoods Architects
7I BEST RESTAURANT lN SA
The Test KItchen
LJke Da'e-Rooer|s' \ooos|ock-
oaseo ea|er, as aaroeo |ne ||'e
o, at Out (e =Jnoreo res|aJran|
n Sano|on |ook secono o'ace,, ano
's|eo no. 48 on Tne \or'o's 50 Bes|
Res|aJran|s, as e'' as oen naneo
Bes| Res|aJran| n ^|rca. ^ 'ncro
Jnerse on eer, o'a|e as one
reeer's oescro|on.
$ource. Eat Out, theworlds50best.com
8I EASlEST WAY TO ARRANGE
A THREESOME
3nder
.Js| nen ,oJ |noJn| |nere as an
aoo |or eer,|nn, |ne 'oera' |o'k a|
3noer L|o en| ano |ook |ne no'e
TnoerCrnor nook-Jo aoo |orna| |o
|ne nex| 'ee': roJo 'oe. Tne aoo
nose nane e can'| oronoJnce
|nos sn'es or coJo'es n ,oJr area
ano, e'', ,oJ kno no |ns orks.
$ource. 3nderapp.com
9I HlGHEST PAl0 FEMALE ATHLETE
MarIa Sharapova
Tne 2-,ear-o'o RJssan earneo
S29-n''on n 20!3, |n nos|
o| | conn |ron enoorsenen|s.
Tns ,ear's rencn Ooen cnanoon
cono'e|eo a career Crano S'an o,
nnn eacn S'an a| 'eas| once.
$ource. Forbes.com
1 3
6
9
2
5
8 7
4
ms
The perfect|on|st's gu|de tothe u|t|mate |n everyth|ng The Best LIst

For most of us, it doesn't take


much to be turned on seually.
5ometimes, however, we can have
difficulty in responding physically.
Many men eperience a loss of
seual desire or insufficient
erections. Yhis is nothing to be
shy about. It can be caused by
stress, ageing or tiredness or
physical conditions like
poor blood circulation.
Vascamen is a
herbal supplement that
contains ingredients that can
improve seual desire and
performance, promote a healthy
prostate and urinary system,
prevent illnesses and
increase blood circulation.
Vascamen is taken as a daily
supplement, not before se.
Co n s u me r I i n e : ( 0 1 1 ) 4 8 0 - 4 9 1 6 o r v i s i t w w w. I o o c k p h a r ma c e u t i c a I s . c o. z a
I MPROVED QUALI YY OF LI FE
Vascamen is available from
Dis-Chem, Clicks and your local pharmacy.
4 MH.O.Z | September 2014

C
P

T
S
T
O
C

/
C
O
P
B

S
,
S

N
Z
[
P
O
P
T
P

T
)

,
B
P

N
P

[
C
O

N
C
P

C
)

MH_gr|nextdoor or
ema| our questons to
gr|nextdoorm.co.za
I stumb|ed upon
nude potos of
an acquantance
|e brosng
on|ne. Do I te||
er?
`oJ oe|ne ,oJr
re'a|onsno as
acoJan|ance, ncn
neans, ano | na,
soJno narsn, ,oJ oon'|
oe ner an,|nn.
a,n sone|nn ''
on', nake an a'reao,
oo|en|a'', akaro
'ne''o nen ,oJ see
eacn o|ner a| |na|
nJ|Ja' |reno's oraa
een nore n|ense',
ero. Erase |ne
ono|os |ron,oJr
nenor, as |as| as ,oJ
nae |ron,oJr orosn
ns|or,. Besoes |ne
|ac| |na| | oJ'o reea'
,oJr oJooJs 'n|erne|
searcnes, ' nae no
ooJo| sne oJ'o oe
nor||eo. ^no oes| ,oJ
oon'| |e'' an,one e'se n
case | e|s oack |o ner.
Te oman I am
datng |eft er
pantes at m
p|ace. So, um, do
I ust as and
return tem? |ONE
ne,'re e|ner an
n|en|ona' nenen|o or
a cono'e|e oersn|
nen sne coJ'on'| |no
|nenn |ne nornn.
E|ner a,, Jn'ess sne
asks, oon'| sa, an,|nn:
,oJ''' ,Js| enoarrass
ner. nro|nenaa,,
|rane |nen, oJ| |nen
n ,oJr oraer - |ne,'re
,oJrs no.
Our engagement
s off. It as
mutua|. Can I ask
for tat prce rng
back? ^NELE
ne |rao|ona'
Jnoers|anon as
|na| |ne rn snoJ'o
oe re|Jrneo, oJ|
er, |e'|rao|ona'
re'a|onsnos exs|
an,nore ano,
ornar', |nanks |o |ne
aroasnans, an,|nn
oes. `oJ oo e | |o
ner, so sne nas a rn|
|o no'o on|o |... BJ|,
|nen aan, | cane
|n a oronse |na| no
'oner s|anos. n'ess
,oJ are J'|, o| a crne
- ,oJ cnea|eo or |nre
ner c'o|nes n|o |ne
s|ree|, |or exano'e - |
nn| oe or|n nan
one nore akaro
conersa|on.
I'm a sng|e dad.
Wen sou|d I
ntroduce m
kds to m ne
gr|frend? ^NDE\
^sk ,oJrse'| one o
oJes|on: ear',-s|ae-
re'a|onsno 'Js| asoe,
can ,oJ enson
,oJrse'| soenon |ne
res| o| ,oJr '|e |n
|ns onan ^no, |
|ne anser's ,es, s |ne
|ee'n nJ|Ja' - sone
onen are oka, |n
|ne o| a oo,|reno
|n kos, oJ| |ne rea'|,
|akes sone e||n
Jseo |o ano coJ'o scare
ner o|| ear', on '| |ne
anser sn'| c'ear, |nen
,oJ're no| reao, |o
orn |ne kos aroJno.
^s |oJcn,-|ee', as |
soJnos, o |n ,oJr
J|. Don'| |ore|: | |ne
no|ner o| ,oJr cn'oren
s s|'' aroJno, oe sJre
|o nen|on | |o ner. `oJ
oon'| an| an, |enson
nen |ne, |e'' ner aooJ|
Dao's no| ner'|reno.
lJ| J'l' \|ll JJJl
Sex, datng, |oeand|ust. Ame|aFrenke| || notakeour questons
Take Her Adce Ma|egrams
I youromyisxrssIyormnoror
womn you`rroaIynof vryunny.
- ^no,cn|er, ac|or ano r|er
My GF Is taII and Ioves wear-
Ing heeIs. Can l ask her not
to? She towers over me. C^E
If`sIikIyshwarshIsausfhymakhrI
sxy. nwhnshIssxy fhr`smorhanyou`II
rafhrwars. Iso oraIof o womn fhirrIafion-
shifoshosisorrIinsirifuaI. IIinghrnof fo
warsomfhingmighf nof ariaf. I`vn
fhranif`sharnof forsnf aguywhofIIsyouhow
forss. hrararoriaffimsorhIs. f fh
movisisn`f ono fhm uf If hrsfruf onanighf ouf.
Gning Public
askroughIy
7uwomenabouf
exhibifionism.
Turns ouf, fhey`re
gameif youare.
PIanyour nexf
dafeaccordingIy.
\onen no'e
nao sex |nere
\onen no an|
|o nae sex |nere
0k 800I0P
|k IH 00k
0k P|Y0800k0
I k|0HI
0K 0|
N0V| IHI8
DUDE, REALLY?
11% 63%
20% 58%
20% 42%
8% 19%
|I deesn'I werk when en|y ene pcrI e| yeu werks.
enIre
TM
preIecIs yeur enIre guI.
ls your probio|ic giving you |ho lull covorogo you nood on|iro is |ho complo|o
ovorydoy probio|ic |ho| linos, binds ond pro|oc|s your on|iro gos|roin|os|inol |roc|,
looving no por| uncovorod. Visi| www.on|iro.co.zo lor moro inlormo|ion.
|eve yeur enIre guI wIh enIre.
AVAlLABLE AT PHARMAClES lM PACKS F 10 AMD 30 CAPSULES.
FR MRE lMFRMATlM REFER T PATlEMT lMFRMATlM LEAFLET.

E
N
T
/
4

3
/
M
E
N
S
H
E
A
L
T
H


NA|| k0I0 |k 00B| I|KI8* 8|mp| ema|| aar eta||s ta measWearQme|a11.cam a J 8eptemaer 1J1
ENSWER
OLLETlON
2014
P88kI B
wE'RE OlVlNO 1 |UCKY RE/DER8 /ND !HElR P/R!NER8 / CH/NCE
!O JOlN U8 |OR 8UVVER'8 HO!!E8! VEN8wE/R |/8HlON 8HOw.
8HlNE 8!UDlO8, JOH/NNE8BURO J 8EP!EVBER 1J1
Daa't m|ss aat aa aar c|aace ta part W|t| as at t|e Vea's Hea|t| VeasWear Ca||ect|aa 1J1

!ERV8 /ND CONDl!lON8: w|aaers W||| ae aat|fe a J 8eptemaer 1J1. Pr|te |s aat traasferaa|e far cas|. E|tar's ec|s|aa |s faa|.
Yaa W||| aee ta ae |a Ja|aaaesaar aa J 8eptemaer |a arer ta attea. *Pr|te aes aat |ac|ae f||ts ar accammaat|aa.


DenimistheuniIormoI theurban
man, hether intheIormoI
stone-ashedshortsor vintage,
distressedjeansit bringsasenseoI
eIIortlesscool toeverlook. Don't
beaIraidtopair oursithslogan
T-shirts, statement blaersand
casual sneakers.
STREETSTYLE
D ALJACKE ,
JX A EE ,
CE DE
LE' DEH ,
ALA EE ,
JX DEH

O
T
O
C
R

P
H

H
B

P
C
|

Y
C
R
O
O
M
I
N
C
K
E
|
|
Y
-
J
E

N
C
l
|
B
E
P
T
L
O
L

T
I
O
N
S
H
l
N
E
S
T

D
l
O
S

UlE TO
ENlMOLOGY
ThcjcunaIhuI rcullyauiI
ynu, dningdcnimnnudimc
undcunynurcullywcur
muaIurdpunIa?Thrcc
cclcbriIicaahnwynuhnw
|K 0K
|0|0
H| 0|
00
00
000 0
H0 0
000000
w0H |0|
H
0H| ||
|||
00
H 00
0|
' ''l| lJ 1'l
l\J 1llJ
l'| l\J
' JJ|
lJll llJ| J'
1 1J' lJJ
l|| '|JJ '\J|l
September 2014 69

m? The man
w|th the most sty||sh |eans |sn't necessar||y the most f|ush; he's the
most savvy. Here are our four den|mhacks when the rand |s |ow
Do Th|s:
Co|d Water
A|r-Dry
| ,oJ nJs|
asn ,oJr
,eans, keeo
|ne co'oJr ano
snaoe n|ac|
o, Jsn co'o
a|er. Tnen
ar-or, |nen
on a c'o|nes'ne
or 'a, |nen on
a |'a| sJr|ace.
ot That:
Hot Water
Dryer
=o| a|er ano
ar oeraoe
na|Jra' |ores,
nc'Jon |ne
co||on n ,oJr
|aoJr|e ,eans.
Tne,''' no| on',
snrnk, oJ| a'so
'ose |ner co'oJr
|as|er, ano |ne
|aorc '' ear
oJ| sooner |nan
| ,oJ s|ck |o
coo'er |enos or
or,-c'ean |nen.

|| Y00'
|0
| ||
|||' ?' |J|| bND'
|J| N|D || ||| J| '|| |
|| b||| 1|N' - bJ
|J' J'. || || |JJ|.
`||||| D||''|D J|
`| | b| ||| 1|||
ND bJJ' J| |'J|
`|| | '|| |. ||
'|JJ|D b| `|D|Jb|
'|||. ||| 'J|| ||
|| | ' |J||J|b||.
NJ ||J'|J||Jb| |.
|| Y00'
|0
|0H ||
JJ' `| | b| J ||'|'
'|JJ|D 'J| D '|| NN
1|N'. bJ || '|JJ|D
||b||| || '|| J|
|J. || || DN| J| b|J|
`'| |||' | | D||
|J| |J||| J||'| JN'.
bJ |J|| || J| ND
|| | `| | `|| |
' N||| ND JJ || ||
'| J || ||| |JJ|
`| | ||'.
|| Y00'
|0
00 ||
NJ JN| |N ||J`
'|D| JN || | J| '
- || ' |J b|JJJ|
D|N| | J || |''|'
b||J|| |'' D|N| | `'
|| NJ. ||
| ' ||JJ|| || | N
'|| J|||J '||. | '
|J J '| || `| '.
|J||J|b|| ||
|| J|. |JNN| NJ '|| J|
DJ`N J || N|||.
0
|'
|1??

|0
|1?
0
K| 0Y HH
|1??. ?

H| H
00H |1z
|| Y00'
|0
K|Y ||
b | N|J||J|| NJ
| N |||||NJ| J|
'|ND|/. ||'| '|| NN
|JJN 1|N' |'| ||
|| ND J| '|||| |
`JN ||'| |||
'JJ || |N||'. J|
||| | N || J||| `'|
|J| || `||||
'|'JN. ND |'. JJ
|N `|| ||| `| |
|| | J| |'| N'.
A
B
C
D
ow Your Denim / 2014enImuIde
WOUL0 YOU SAY 0ENMS A WOUL0 YOU SAY 0ENM
STAPLE TEMN YOUR WAR0ROBE? STAPLE TEMN YOUR WA
Yeah, I never goanywhere wifh- Yeah, I never goanyw
ouf a goodair of jeans. f a goodair of jean
ROCK STARS AN0 0ENMAVE
LON BEEN LNKE0 WATS TE
ATTRACTON? Denimis a cIassic
sfyIe. I fhinkfhaf`s frue of rock
foo. If is a genre fhaf wiII aIways be
aroundnomaffer whaf is going on
infashion. You`II never reIace
cIassic rock`nroII.
0OUBLE 0ENM SOUL0 UYS BE
TRYN T? I fhinkfhaf`s foomuch
of a goodfhing -unIess you`re an
Eighfies counfry singer.
WATS TE OL0EST 0ENMYOU
OWN? I have a air of ReIigion
jeans fhaf are abouf five years oId.
I sfiII somefimes wear fhemwhen
I goonsfage.
BEST MSTAKE UYS MAKE WEN
T COMES TO TER JEANS?
Choosing sfyIe over fif.
THE ROCK ROYALTY
Jesse CIegg
henyou`re fhe guy whocaIIs
Johnny CIegg dad, you`ve gof rock
`nroII inyour veins -andJesse
CIegg is aIready carving ouf a Ieg-
acy of his own. Freshoff a UKfour
fhaf sawhimfear ufhe main
sfage af fhe IsIe of Wighf FesfivaI,
if won`f be Iong before he fakes fo
fhe roadagainfor anucoming SA
four. I`ve never beendirecfIy
conscious of fashion. I`mnof fhe
kindof guy whokees uwifh
frends. I kindof sfickfomy own
sfyIe, says fhe Sinking singer.
Andfhaf`s exacfIy why we dig fhe
younger CIegg`s fashionsense.
MuchIike fhe denimhe`s never
wifhouf, he embodies fhaf fime-
Iess deviI-may-care affifude fhaf`s
sosynonymous wifhrockers and
fheir fhreads. I Iike fomix and
mafchsfyIes andI suose fhaf`s
frue of my music, foo, says CIegg.
I bring Iofs of differenf eIemenfs
infomy music, Iooking for infer-
esfing combinafions befween
fhem. Like if or nof, Mr CIegg,
you`re aninfIuencer.

0|
0K |1? 0
K 0 |z
H0 0
|0 00
|z 1 Y
00 H0
0H0K
H| | 0|
000 | H|
|:1? | |0
X 0|
| 00
0H | 0|0X
0 0
|e1? H
H |
0 |1? |0|
|0 |
0H| |??
|0 |

M
I
N
C

P
H
O
T
O
C
R

P
H
E
R

S
S
I
S
T

N
T

L
O
L

T
I
O
N

H0H0
K000

000 00
|0 H|
000H 00
0 H|
K|0 HH
000 w0H
0 H|||0
0H 00
H | ||
0|
H

||0 00
0|
| ' ''l| 1 1J' |JJ
l\J l|ll'| ' ''l| lJ lJ'\l lJ|l|
lJlJ l'l l'11 \|' '\J|l
September 2014 71

P
H
O
T
O
C
R

P
H
S

I
L
L
U
S
T
R

T
I
O
N
S

S
H
I
O
N

S
S
I
S
T

N
T

S
H
I
O
N
I
N
T
E
R
N

|| 08
w8|k0
KHK| 08
N80
||J` | ' JJJ| N.
J|N N ||| N|. |
| ' J||JN| | JN
N '|| /||''| JN
N | ' JJ J|JJ|
J `| J || JJ
|| ||J`|.
|| 08
w8|k0
00
N| | |J' | 'N
' JJ|J|. ||| |.
N '| N|. J|
|J' | '|| |
|J| N|| '| N N
JN|| N N || |
|J'. `| J|||
|J| ||/ |JJ.
|| 08
w8|k0
0|
|N || N' J' J
NJ|. | ' |N
| N N ||| N JJ||
| ' || J' || N
||JN. | ' ||
|N | '' ||| N
J| 'J'N. '| ||
N ||| N|N.
|| 08
w8|k0

|J | ' JJ| N J|
|J||. | N'|| || N
'N' J| ||. | ||'
J 'JJ |N|
|| J N | ' |
`N JJ `N J
JN`| N. ||
|J. |J| |''| .
THE POP STAR
JImmy NevIs
hi onadmission, fhe young
Caefonianhifmaker wasn`f
aIways as sfyIishas he is now. I
wasn`f conscious of if growing u,
says Nevis. Buf being a osfar
andfeeIing Iike a osfar are fwo
very dierenf fhings -andIooking
fhe arf goes a Iong way inbridg-
ing fhe fwo. I guess being more
aware of fashionhas reaIIy given
me fhe conndence foexceI af whaf
I do. Andwhaf exacfIy is he doing
fhese days? For sfarfers, his new
singIe, Misscafo (If`s a Iay on
fhe sweef wine, Moscafo, abouf a
fhree-year reIafionshifhaf gefs
beffer wifhfime.), is geffing some
serious airIay andTwiffer Iove
aroundfhe counfry. Thenfhere`s
fhe newaIbumhe`s working on,
(If`s sfiII very Iyric-
driven, buf a Iof more comIex
anddreamy -somefhing fhaf`s
more reIevanf fomy ersonaI
growfh.). He fookfime ouf fodis-
cuss his ersonaI sfyIe. If`s Iike
my music, edgy andcreafive. I Iike
fofhinkfhey`re bofhrisky.
!\| !J. \| \JJ| |JJ
The co|ours you wear express your persona||ty and sty|e, so make
sure they're broadcast|ng the r|ght message. Anne Roose|t, a
co|our spec|a||st at P|ascon, breaks down th|s season's pa|ette
AS A MUSCAN, YOU 0ON' NECES- AS A MUSCAN, YOU 0O
SALY HAVE A STRlCT OFFlCE 0RESS SARlLY HAVE A STRlCT O
CO0E ~ ARE JEANS A PART OF YOUR CO0E ~ ARE JEANS A PA
EVERY0AY UNlFORM? VERY0AY UNlFORM? DeinieIy. D
There`s hardIy aninaroriae `s hardIy anin
ime or eans.
HOWMANY PAlRS OF JEANS 0O YOU
OWN? I acuaIIy hae oomany
eans u honesIy I onIy ear
aou our o hem. y aouries
are a air o Iigh Iue skinnies -
hey IookIy as heII.
WHAT GlVES COLOURE0 JEANS
AN E0GE OVER CLASSlC BLUE?
I as neer a ano he renduniI
recenIy. I adds a youhuI sinon
any oui and deending onhe
coIour i canmake your eans Iook
more casuaI or more ormaI.
BlGGEST MlSTAKE GUYS MAKE
WHEN PlCKlNG OUT A PAlR OF JEANS?
o aying or a quaIiy air een
heni`s a i more ricey. I`s an
inesmen orhmaking.
And Avo|d: Loud, V|v|d Hues
and Audac|ous Pr|nts
| |na| =aaan snr| coorona|es
oer|ec|', |n |nose nJn|er reen
,eans, |nere s sJcn a |nn as |oo
nJcn co'oJr.
You Shou|d Wear: Neutra| Hues
Le| ,oJr oo'o oenn soeak |or |se'|.
NeJ|ra's 'ke o'ack, n|e, oee ano re,
can oa'ance |ne ooo o| co'oJr. Besoes,
|r,n |o |no a cono'enen|ar, co'oJr
s a |asnon rsk.
0N | 08 008
|e
8
|: :
0k 08k Hk
008 | e
kH0k N080
H08| 0 |:
0
'J|| '| NN
0
'|| | '||
0
'|| | ||
0
'|| | '||
now Your Denim / 201enImGuIe
P
H
O
T
O
C
R

P
H
C

P
P
E
T
H
B

P
C
|

Y
C
R
O
O
M
I
N
C
K
E
|
|
Y
-
J
E

N
C
l
|
B
E
P
T
L
O

T
I
O
N
S
H
l
N
E
S
T

D
l
O
S
0K | H
|0 0
H| 0
0| 0w |
0|
0w w0H
0 H|||0
0 0
H0 0
K |
0|
H| 00
00
0|0
l J l'l
' ' l l
J lJl '
l llll lJ
J lJlJJJ
Jl l
l' l' lll
September 2014 73
0ENlMlS A lG 0EAL RlGHT? v
somny rofrs soII my jns
nuonf ofr si o f
worI. Buf `v of fwosfI irs
o jns: my favourife are a air of
WeSCrawdenims I haven`f washed
since I gof fhema year ago.
HAT'S YOUR FAVOURlTE JEANS
RAN0 AN0 HY? I Iike any brand
fhaf makes reaIisfic cufs for
sIimmer guys.
CAN JEANS EVER E A0? HonesfIy,
fhe boofIeg cuf is a heII no.
HAT'S THE OL0EST 0ENlMYOU
ON? I`ve have fhis air of G-Sfars
fhaf I`ve beenwearing for aImosf
five years now.
0O YOUR JEANS SPEAK TO YOUR
PERSONAL STYLE? My sfyIe is ecIec-
fic. I generaIIy Iike simIe sfyIes
fhaf fif weII, buf somefimes I do
Iike fogoover fhe fowifhcoIour
andafferns.
0ENlMlS A lG 0EAL R
somany brofhers, soa
enduonfhe ofher
rId. Buf I`ve gof fw
ri
Opt For: a Casua| e|t
`oJ oJ'on'| oroer Don Pernon a| a
oe oar. or |ne sane reason, ,oJ
snoJ'on'| |r, |o e| |oo |anc, |n |ne oe'|
,oJ ear |n oenn. S|ck |o a oe
'ea|ner or canas oe'| |na|'s rJeo.
D|tch: the Dress e|t
^ oress oe'| s |oo narro |or |ne oe'|
'ooos on ,eans, ano |ne oo'sneo 'ea|ner
ano sJooJeo oJck'e '' 'ook oJ| o|
o'ace on een ,oJr oarkes| oar. Besoes,
,oJ an| |o keeo ,oJr nce oe'|s nce.


J|J| ' ||. J| J|
|N' | ' '| |
JN || ` ' N
|JJ| || N || | |
N ||. |''
'| | || ' ||
|||| J| JN.



|N' ` | | | '|.
'| | || N J ` ||
'| || ||J' JN J
||JN| ||'. ''
| |||'.



|||||| |J`||
| '|. | |||' ' '|'.
|| || | | ' '
J|J|| ||J` ||
||| JJN ` |
|||/| N || | |
N | |.

|||/|. 'N|

'| | '| |

'| |



|| | | |||| ' ||
| . ||' |N |
` || ||| J|| ` |
JJ JJ |' N J |J
N || |/| |JN|'
|| |. | |||' ||
J|||N' '||''|.
`J|N N `'|.

|z

|???

|e

|

T AP GlS
y
I aIways describe myseIf as a
canvas for doe shif, says Rick.
My dress sense is fIexibIe, buf I
aIways have a signafure feeI. And
my music is very simiIar. I fake in
everyfhing frommy environmenf
andaddmy ersonaI fwisf foif.
Riky Rick`s debuf aIbum,
, wiII be onsheIves soon.
If`s fhe soundfrackfomy Iife
sofar. I`ve bIendedcurrenf hi-
hofrends wifhfhe oId-schooI
aroachof feIIing reaI Iife
sfories. The sounds differ from
sfarf fofinishbuf if`s definifeIy
a hi-hoaIbum. Affer fhaf,
he`s focusing onsome direcforiaI
rojecfs using a fewscrifs fhaf
he`s enned. Sohowbig a deaI is
fashionfohim, anyway? Before
youhear any of my music or know
fhaf I ra, my aearance wouId
feII youfhaf I`ma somebody
whodoes somefhing ouf of fhe
ordinary, says Rick.
\J |JJ |
Dress for the body you have, not the body you want. Werner
P|eters, market|ng d|rector at D|ese|, |s here w|th some t|ps to |ook
your best |n the r|ght sty|e

'| NN
ow Your Denim / 2014eGe

Denim jacket R3 400
Replay, camo printed
denim shirt R1 430
Cipo and Baxx,
football tee R60
Mr Price, Burton
stretch denim jeans
R3 495 Sands at Cloth
& Label, canvas belt
R550 Supremebeing,
Mega Chief watch
R3 500 Diesel at
American Swiss,
sneakers R900
Onitsuka Tiger

SANDTON C!TY
V&A WATERFRONT
GATEWAY
EDGARS MENLYN
EDGARS CANAL WALK

Sunglasses R2 500
Lacoste at Moscon
Optics, denim
jacket R3 400
Replay, denim collar
shirt R2 200 Diesel,
tie R1 735 Emmett
at Cloth & Label,
snake-skin leather
watch R2 595 Guess
at S Bacher & Co,
slim-fit chinos
R600 Country Road,
leather belt R650
Supremebeing, Alpha
Bravo backpack
R7 500 Tumi

H
O

O
C
R

P
H

M
O
D
E
L

C
R
O
O
M
I
N
C

HH0 E EA BE
CAlG F 0El?
anim hichi ina r
a hoIfiniIno b
ahafr aring b-
r oair rhmona Iin or
chair an a rir boI
fiIIihar omoin
h rr ara cha h
kn anbackock
oninIoing hi iII
kor nimaging ih
characr hiI h fabric iII
aarkanr
E'E EE A F BA0
E00lG Al 0El
lH A HEF lCE AG. HCA
Al 0El?
ookfor h Ig
(a sfriof denimwhichcan
be seenonfhe inside seam
andshows uwhenyoucuff
your denims), whichgeneraIIy
indicafes a beffer quaIifyfabric
These jeans were made on
smaIIer Iooms andina bafch
rocess rafher fhanbeing
mass roduced
lF HA0 E AlG HE
l CE 0El HA l
0 BE?
Don`f wear jeans fhaf are foo
fighf (whefher fhey`re onfrend
or nof) -eseciaIIyif you`re an
oIder genf Skinnyjeans don`f
Iookgoodoneveryone
H 0 E CFF 0El
A0 l l l A HlG?
Thoughfhe Iookoriginafed
wifhyoufhcuIfs Iike mods,
rockers andunks, guys gener-
aIIyfurnufheir jeans when
fhey`re fooIong So, jusf fhe
righf amounf of cuffing can
make fhe Iooka Iof sharer
However, wifhfhe boomof
remiumIuxurydenim,
connoisseurs use fhe furn-u
foshowfhaf fhey`re wearing
seIvedge jeans

Wear and care for your
den|m||ke |ndustry p|oneer
Shubhankar Ray, brand
d|rector of G-Star Raw
76
2010nImGuI

GO ON.
LlVE LlFE lN
FULL COLOURl
NEW DOVE MEN+CARE lNVlSlBLE DRY.
WEAR YOUR
FAVOURlTE
COLOUR WlTH
CONFlDENCE


;:| |:
|.:!!t !! |:
... !:!'4
. |. '|t
4i:.'. ...|t
l|t .';|
:.: |''!;
'!!.t|.''
t|.:!;| t|':
t. '.:t ..| |:
..) t.) '|''
4: ...
:! t)'!

ackeI
walks Ihe fne lne
beIween rockablly
and hllblly. |f you've
puI n Ihe Ime aI Ihe
pull-up bar, you have
Ihe rghI Io bare
arms. OIherwse
Ihs s your sprng-
Ime soluIon Io lasI
season's puffer
jackeI. PuI one of
Ihese on (bker-gang
paIches and all) over
a check shrI and
you're one Harley-
Davdson shorI of
road-Irp ready.
S
l
e
e
v
e
l
e
s
s
d
e
n
i
m
j
a
c
k
e
t
R
4
1
9
9
D
i
e
s
e
l
,
V
-
n
e
c
k
T
-
s
h
i
r
t
R
7
5
0
T
i
m
b
e
r
l
a
n
d
,
l
e
a
t
h
e
r
s
t
r
a
p
w
a
t
c
h
R
4
2
9
9
D
i
e
s
e
l
a
t
S
.
K
e
r
e
n
W
a
t
c
h
G
r
o
u
p
,
l
e
a
t
h
e
r
b
e
l
t
R
6
4
9
B
e
n
S
h
e
r
m
a
n
,
s
t
r
a
i
g
h
t
-
l
e
g
j
e
a
n
s
R
2
1
9
9
G
-
S
t
a
r
S
H
E
W
E
A
R
S
-
H
o
o
p
e
a
r
i
n
g
s
m
o
d
e
l

s
o
w
n
,
d
e
n
i
m
o
v
e
r
a
l
l
s
R
3
9
9
9
D
i
e
s
e
l
,
l
e
a
t
h
e
r
b
r
a
c
e
l
e
t
R
8
5
0
R
e
p
l
a
y
,
l
e
a
t
h
e
r
b
e
l
t
R
1
8
0
0
R
e
p
l
a
y
,
s
u
e
d
e
h
e
e
l
s
R
3
8
0
0
R
e
p
l
a
y
H
E
W
E
A
R
S
-
A
v
i
a
t
o
r
s
u
n
g
l
a
s
s
e
s
R
2
6
9
9
D
i
e
s
e
l
a
t
M
o
s
c
o
n
O
p
t
i
c
s
,
j
e
r
s
e
y
R
8
6
5
B
i
l
l
a
b
o
n
g
,
M
r
D
a
d
d
y
w
a
t
c
h
R
5
6
9
9
D
i
e
s
e
l
a
t
S
.
K
e
r
e
n
W
a
t
c
h
G
r
o
u
p
,
l
e
a
t
h
e
r
b
e
l
t
R
3
0
0
K
i
n
g
s
l
e
y
H
e
a
t
h
,
R
a
l
s
t
o
n
s
l
i
m
-
f
i
t
j
e
a
n
s
R
2
4
0
0
S
c
o
t
c
h
&
S
o
d
a
,
b
o
o
t
s
R
3
4
0
0
T
i
m
b
e
r
l
a
n
d
WhaI's Ihe deal wiIh
raw denim, anyway?
Technically, iI's
denim IhaI hasn'I
been washed afIer
Ihe colouring pro-
cess basically, Ihe
rye bread of jeans
Should you care?
Very much These
rougher jeans will
age beIIer, disIress-
ing over Iime and
moulding Io your
body Io give you IhaI
perfecI fiI The price
Iag on Ihem may be
inIimidaIing, buI
Ihey'll be your go-Io
denims, geIIing beI-
Ier year afIer year
September 2014
D
e
n
i
m
s
h
i
r
t
R
7
0
0
S
e
r
g
e
a
n
t
P
e
p
p
e
r
a
t
S
t
y
l
e
m
o
l
o
g
y
,
h
e
n
l
e
y
t
e
e
R
1
4
9
5
H
a
r
t
f
o
r
d
a
t
C
l
o
t
h
&
L
a
b
e
l
,
b
e
l
t
R
1
4
0
0
R
e
p
l
a
y
,
d
e
n
i
m
c
h
i
n
o
s
R
5
0
0
T
o
m
T
a
i
l
o
r
a
t
E
d
g
a
r
s
,
l
e
a
t
h
e
r
s
t
r
a
p
w
a
t
c
h
R
1
4
9
9
9
L
u
m
i
n
o
x
a
t
T
r
e
g
e
r
B
r
a
n
d
s
The cornersIone of
a rock-sIar wardrobe,
Ihe denim shirI is as
classic as iIs crisp,
whiIe-coIIon cosin.
BI iI's Iime for an
pgrade. sng fiI
is preferable (avoid
overly complicaIed
washes), iI's as ready
for a wild nighI oI as
iI is for Ihe board-
room. BIIon iI Io Ihe
Iop, bI lose Ihe Iie, a
good denim shirI
speaks for iIself.
H
E
W
E
A
R
S
-
R
a
i
n
b
l
o
c
k
d
e
n
i
m
j
a
c
k
e
t
R
7
5
0
0
D
i
e
s
e
l
,
c
a
n
v
a
s
w
a
t
c
h
R
5
0
0
N
e
f
f
a
t
L
u
k
s
b
r
a
n
d
s
,
s
l
i
m
-
f
i
t
j
e
a
n
s
R
3
5
0
0
P
a
i
g
e
D
e
n
i
m
,
l
e
a
t
h
e
r
b
o
o
t
s
R
1
5
0
0
K
i
n
g
s
l
e
y
H
e
a
t
h
S
H
E
W
E
A
R
S
-
D
e
n
i
m
s
h
i
r
t
R
3
0
0
0
P
a
i
g
e
D
e
n
i
m
,
c
u
t
-
o
f
f
d
e
n
i
m
s
h
o
r
t
s
R
4
5
0
M
a
n
g
o
,
b
r
a
c
e
l
e
t
m
o
d
e
l

s
o
w
n
,
l
e
a
t
h
e
r
h
e
e
l
s
R
3
9
9
9
D
i
e
s
e
l


from Ihe rain? |f
Diesel have anyIhing
Io do wiIh iI, yes
Face a smmer
shower and come
oI dry wiIh Iheir
engineered Painblock
denim IhaI comes
wiIh a proIecIive,
waIer-repelling
coaIing Form and
fncIion aI iIs besI
September 2014
T
r
u
c
k
e
r
c
a
p
R
2
5
0
H
o
l
m
e
s
B
r
o
s
,
b
o
m
b
e
r
j
a
c
k
e
t
R
2
8
0
0
G
-
S
t
a
r
,
m
e
t
a
l
l
i
n
k
w
a
t
c
h
R
4
7
9
9
N
i
x
o
n
a
t
A
m
e
r
i
c
a
n
S
w
i
s
s
,
l
e
a
t
h
e
r
b
e
l
t
R
1
4
0
0
R
e
p
l
a
y
,
s
l
i
m
-
f
i
t
j
e
a
n
s
R
1
0
0
0
G
A
P
a
t
S
t
u
t
t
a
f
o
r
d
s
,
l
e
a
t
h
e
r
g
l
o
v
e
s
R
1
3
0
0
R
e
p
l
a
y
,
l
e
a
t
h
e
r
b
o
o
t
s
R
1
5
0
0
K
i
n
g
s
l
e
y
H
e
a
t
h
enim on denim has
a bad rep, and iI's
mosIly warranIed.
BuI iI's noI as Iricky
as you Ihink. Follow
Ihese Ihree rules and
you'll never look like
Chuck Norris. FirsI
up, Ihe denim on Iop
can never maIch Ihe
denim below. NoI
even JusIin Timber-
lake could pull iI off.
NexI up, break Ihe
flow of denim wiIh a
whiIe T-shirI or a Ian
belI. nd finally, yes,
duo denim can be
formal: simply dress
iI up wiIh a black
blazer and brogues
and you're righI on
Ihe dress code.
L
e
a
t
h
e
r
a
n
d
d
e
n
i
m
j
a
c
k
e
t
R
6
4
0
0
R
e
p
l
a
y
,
c
u
t
-
o
f
f
d
e
n
i
m
s
h
o
r
t
s
R
4
5
0
M
a
n
g
o
,
s
t
i
l
e
t
t
o
s
R
7
0
0
C
a
l
l
I
t
S
p
r
i
n
g


KP |I 0|88|0





James Dean."
|k Y008 |I
"Denim has Ihe versaIiliIy
Io be dressed up or down,
depending on Ihe occasion.
JusI make sure iI's a good
fiI - no booI cuIs, no baggy
croIch."
Kk0w I Jk 00
"Denim has endurance,
iI jusI keeps looking beIIer
wiIh age. JusI make sure you
pick up auIhenIic selvedge
denim - iI'll lasI you a
lifeIime."
I8'8 k0 8N
|k P|Y|k0 |I 8
"When in doubI, go for jeans
in a sIraighI cuI. They look
good on every guy."
September 2014
he hiper hing
ma be oer, b he
check hirI live on.
ThaI' good new for
u, becaue noIhing
goe beIIer wiIh
denim. Your winIer
layering game may
be Irong, buI Ihe
warmer monIh call
for a whole new plan.
Loe Ihe flannel and
don a breezy coIIon
hirI under a denim
waiIcoaI, grab a
cold one and pull
up a chair neI Io
a moky-eyed
IempIre like
DonneI over here.
HE WEARS - Check shirt R3 000 Replay, pinstriped denim waistcoat R490 Holmes Bros,
henley tee R300 Sergeant Pepper at Stylemology, leather strap watch R8 295 Victorinox at Picot
and Moss, Corporal slim-fit jeans R1 699 Superdry, sneakers R2 995 Antony Morato at Hydraulics
SHE WEARS - Denim shirt R2 199 G-Star, skinny jeans R3 500 Diesel, jewellery models own
September 2014
Tap. liok. ead.
YcucanccnnecL wiLhScuLhlrica's#Imen'smagazinecnanymcbiledevice! McnsHcc|thdigiLal ediLicnisncwavailablelcr dcwnlcad
cnycur LableL cr mcbiledevice. dusL lcadiL, andcaLchupcnycur McnsHcc|threadinginycur lunchbreakcr aL Lhegym.
0N|YRI5P|RN0NH
w:tn..t/sasr
mer|n w|ss 938 !943
en ermn 02! 425 8996
|||on 042 200 2600
|| |t pr|n 02! 55! !52
|po nd xx 0!! 44 9225
||ks 0860 254 25
|ot e| 0!! 326 506
ountry od 02! 405 4300
|ese| 0!! 630 4000
|sem 0860 34 2436
drs 0860 692 24
tr 02! 4!8 9000
uess 0!! 684 !025
o|mes ros 02! 426 2320
ydru||s 0!! 884 8538
|ns|ey et 0860 692 24
ev|'s 02! 403 9400
uksrnds 0!! 262 0399
no 0!! 83 90
oson pt|s 0!! 483 800!
r r|e 0800 2!2 535
n|tsuk |er 02! 590 000
|e en|m cJr|z.con
||d|um 0!! 6!6 0850
|k n y 0800 !! 2288
|ot oss 0!! 669 0500
un|ss ut 02! 4!8 8534
e|||on 0!! 482 528
ep|y 02! 4!8 850
|ver s|nd 0!! 2!4 80
er ompny 0!!326000
. erenWtroup 02!4!80045
pett| | 02! 424 0696
ot od 0!! 84 3233
|mon nd ry 082 869 4!58
pree soree.co.za (086! 999 50!,
tuttords 0!! 89 !000
ty|emo|oy s|,'eno'o,.con
uperdry 0!! 84 0496
upremee|n 0!! 06 4394
oms o 0!! 84 0435
|mer|nd 0!! 483 3844
opmn 0!! 685 00
reer rnd 0!! 089 600
renery 02! 405 4300
ruworts n 02! 460 2300
Were
to
uy
M
O
D
E
L
S

K
E

U
P
&
C
R
O
O
M
I
N
C

S
H
I
O
N

S
S
I
S
T

N
T

S
H
I
O
N
I
N
T
E
R
N

P
H
O
T
O
C
R

P
H
E
R

S
S
I
S
T

N
T

y now yo know
yo skinnis fom
yo ooI Is wll
w h Io inIo-
yo Io Ih
oI Similar in
shape Io Iheir rooI-
vegeIable namesake,
Ihe carroI cI denim
is spacios arond
Ihe Ihigh wiIh a
Iapering leg They're
basically skinny
jeans wiIhoI Ihe
clasIrophobic
croIch siIaIion
parI from Iheir
head-Irning appeal,
Ihis cI hiIs jsI
above Ihe ankles, so
yo can show off
yor kicks wiIh ease
S
w
e
a
t
s
h
i
r
t
R
7
0
0
T
r
e
n
e
r
y
,
c
h
e
c
k
s
h
i
r
t
R
1
6
9
9
G
-
S
t
a
r
,
w
a
t
c
h
R
7
5
8
9
T
h
o
m
a
s
S
a
b
o
,
T
r
u
c
k
t
e
r
j
o
g
g
e
r
j
e
a
n
s
R
4
0
0
0
D
i
e
s
e
l
,
b
r
o
g
u
e
b
o
o
t
s
R
1
9
0
0
G
o
l
d
e
n
L
a
c
e
C
l
u
b
a
t
S
t
y
l
e
m
o
l
o
g
y
September 2014
Your denimcleansupnicel,
sodon't keepit relegatedto
casual Fridas. Radenim
jeanshaveall thepanache
oI suit trousersbut ith
addededge, hileadark
denimshirt nailsthesmart-
casual dresscode.
DENMFLKA DT TE , SCNATURE,
TMTALR DENMSHRT FRM,
STNE HARBUR DENM
D LNENJACKET ,
D CHECK SHRT ,
LUCKY DENMFRM
SMARTEN
UFYOUR
DENlM
o n|o sor, |'|,, s| | sor, ''.
'k on sJsro|ons n oJrs n o |o en's Hea|th

sor, |'|, nnrs n sJsr |o Mens Hea|th or 202or !2ssJs. on|o .sor,.o.z , 'k on |'|, n|n
sor,n'', |n 'k on Jsro|ons &\oJcners ano|nen cnoose \|a'|, sJoscro|ons. Renenoer, ,oJ can Jse ,oJr Dscoer, |'es
anoor Dscoer,Caro|o oa,. Tne nJnoer o| naaznes ,oJ can sJoscroe |o annJa'', a| a reoJceora|e oeoenos on ,oJr \|a'|, s|a|Js. Terns ano
cono|ons aoo',. Tne Dscoer, \|a'|, o||er s on', aa'ao'e |o ac|e \|a'|, nenoers. `oJ canno| recee |ne || | ,oJ |ake Jo|ne \|a'|, naaz
o||er. DscoJn|s aa'ao'e |o sJoscroers |n a S^oos|a' aooress on',. Dscoer,Caros ooera|eoo, Dscoer, \|a'|, (P|,, L|o, res|ra|on nJnoe
!99900360, an aJ|norseo|nanca' serces orooer Jnoer |ne oankn'cence o| rs|RanoBank Ln|eo, res|ra|on nJnoer !92900!225
an aJ|norseo|nanca' serces anores|ereocreo| orooer, NC^ReNo. NCRP20. Terns anocono|ons aoo',. C||s aaroeo|o |ne |rs| 30sJ
ubsrlptlon ffr xluslv to
0SCOVERY
MEMBERS
VIalIy members saveupIo
60%whenIheysubscrbeIoMen'sHealth
andreceveaMHlmIededIon
REEBOBG
*
valuedaI P350!

et ackIngl |f youkeepyour runnngshoesnIhebooI of your car and


aboIIleof waIer rollngaroundunder your seaI, youneedsomeproper
luggage. TheMen'sHealthPeebokbagswll keepall of your sIuff n
oneplace. They'remadefromdurablenylonsoIhey'll reallylasI, plus
IhehandysdecomparImenIswll makesureIhaI your car keysare
alwaysneasyreach.
506,
Joscroers.
S
a
v
e
6
0
%
SctcFitShcp.cc.zaandcIickcnNEN'SPEALTP

0NSALE
N0Wl
P400
EXCLU0NS
P0STASE
CAPVEYUPA5I
CKI5EL YUPCKE5TI
LA5TYUPAPN5I
UILYUPACK
&5KULEP5I
0rder nowand
you'|| get an
AITI0NAL 4
vs that inc|ude
6 miracu|ous
metabo|ic workouts
CPU5KYUPUA5, LUTE5,
&KAN5TPIN5I
0elling perIeol abs won'l lake you Iorever wilh lhe Speed Shred 0ella Fil
0V0. This amazing 82day programme will work your whole body wilh |usl
80 lo 40minule workouls. Eaoh workoul is designed Ior maximumimpaol,
lelling you see amazing resulls even iI you only exeroise lhree limes a week.
All you need is a oouple oI pairs oI dumbbells, a slep, a slabilily ball and a
oouple oI melres oI open spaoe. ll's simple. ll's oonvenienl. ll worksl
wilh every workoul you'll.
Persa saaa| !ra|aer
E0lE0
H JNE
EGlNNE
PG0E
0NCE0
NllN
PI
t I||s a6 |ft
r6er fer eager
|e
|||er ett|ee|| erkeats
fer A|| ee|s ef Ir|a|ag
' ..|, |.''.| |':. ::: 1'
| ': .::' ,.:| 1 .':'
|?1
THE BETTER HALF
See t he t r ai ni ng
r egi men t hat made
Lei gh Hal f penny
t he B&I Li ons
mane at t r act i on
I80 | 8I08
|: . ':|
e' |, '||
.'|: ::
:| .'| |
xp|es|e Jamps:
I|e Ke te Nere PeWer
|z
b|J|NN||
|
||||
|e
waat a 8|x-pack!
8tep 0raac||ag,
8tart 8eck|agI
|1
September 2014
e|ghfe, ther|t|shd r|sh
|s' VPshares h|s p|anfor add|ng
musc|ew|thout |os|ngpace. Use|t to
becomeheadof your ownpr|de


ne .8reasn ,r r'|reno arees an
ro, n ,, a'|oenn, s a on,sa' soeen
oe,no oe'e|. s ao', sn| n oae ano
oer oesoe ns ne o'o s ,a-oroon - ano
's esoea'', oresse nsoern ne sn' na-
ra'', oreososeo arr,n s'e.
' as sa'' rn o, n ers | sare
ano snaoe, sa,s a'|oenn,. ''a,n ro, nao
a'a,s oeen , orea, s rea'seo nao o'k
o oe aken sers',. asn' eas,. r ,ears
nnn naooeneo. eena'',, aoe |r
ne anes ano nrnss ne'oeo e r.
no r ne oo: a'|oenn, n ens n a
8k ano ns oosn o'a,ers n a
oan-'earn |re near ne nne.
, as ne 'ks er ne onraoner's
sn'oer n ne so, assessn ne ons
, see nere, ne's arkeo', noresseo n
ns n on,se. 'Tna|'s oka,, ne nJno'es
a||er a 'nern s|are. '| o||ers an nsn| n|o |ne
oer|ec|ons|'s nnose| |na|'s oren nn |o reacn
|ne 'ee' a| ncn ne no oer|orns.
Deso|e ns on ooJo|s, =a'|oenn,'s on,soJe
s noresse ano noosn n eoJa' neasJre.
BJ| | ,oJ an| |o noe 'ke an a|n'e|e, sze sn'|
eer,|nn. 'n |ac|, oen |oo oJ'k, can nnoer
,oJr oer|ornance ano s'o ,oJ oon. '\e aoo
o',one|rc noes a||er oJr s|ren|n ork so e
neer 'ose a ne|re o| oace, sa,s =a'|oenn,. Tns
ensJres eer, 'as| |ore o| |ne ne nJsc'e ,oJ're
oJ'on s ooer|J' ano a'e.
=a'|oenn, |are|s oooosn ooo, oar|s |n
sJoerse|s, so eacn sesson s n|ense - oJrnn
|ne |a| s|oreo aroJno ,oJr aos n |ne orocess. =s
o'an coers oo|n soeeo ano sze: |o''o | |or sx
eeks ano ,oJ can s|ar| |akn |ne 'on's snare
o| 'or, n ,oJr soor|. Or a| 'eas| recao|Jre ,oJr
r'|reno's aze.

S|ren|n ano
o',one|rc noes
e ,oJ oJ'k |na|
noes a| soeeo.
September 2014
0 0K880 8
B sz n non n ,or r o,. \n rorn o srss o,
o ro^ o B no rs, n rs !n. srs s.
0 88 5 8
Ts sao'e noe s on', or oon | ,o're ''
n o o ea, ano aro, |'ooon ,or ooo,
ro ornone. n a |'a oenc, 'oer a ea,
oar o ,or sernn. Exa'e ano ore e oar
o o o'o nacnnn sren ro
,or ces ano arns.
80w 5 8
Ts '' nake sr'n ea, |rnre a n
o| e oas. Res on a oenc, o'ona ea, ono
oe''. Dra o ,or orso: o'' ,or so'oer oack
a e oo . Loer conro' . Cono'ee
5 reos one arn, en sc. Res !nn oe|ore
reoeane soerse
0 00 88 5 8
Lke e aroasans, ,or ces s ooonea,.
''n o ,or ooer oecs '' e ,o noresse
oe|non ano nore ooer en osn- eer
on e oc or n e es roon. Le on an nc'ne
oenc o'on o ea, onooe''s . Exa'e
ano oress oexo'ose', . Norao a oaroe''.
w 5 8
'| ,o're sck o| oen nsc'eo o|| e oa'' orn
Snoa, 'eae anes, s s e noe |or ,o.
Beno o ock o e oar: ,or oack so'o oe ,s
aooe oara''e' o e |'oor . L| e oar o ,or
os, oran ,or so'oer o'aoes oack ano
oeer . Res !nn en o oack o ^.
0K0
8wK8
||te-|eve| strength work, hypertrophy (musc|e-
bu||d|ng) and speed tra|n|ng w||| cover a|| bases: you'|| add kg
of powerfu| musc|e and bu||d a s|x-pack |n |ust over a month.
Fo||owthe |nstruct|ons for each workout to the |etter.
A|ways rest for at |east 2 hours after each workout. L|ft very heavy,
but w|th good form.
B
A
B
A
B
A
B
A
NO HALF
MEASURES
Bul k up
f or mor e
pounds t o
t he penny.
September 2014


rs nnn s sr r
''' ' ,J r rJ naJ's
an ank JJs a'k a J a
ar'' as a, as ,J an nana
r rs ' arss ,Jr sJ'
rs (A) n Js ,Jr s ak
an snk n a sJa (B)
,Jr r ra an r ak J
rJ ,Jr 's

,J'r n ' na
nnn x's r Bn ,Jr
kns (A) ns ,Jr ans 'Js
an as an ,Jn n x (B)
Sk 'ann an ^nr
J n s rsa' a's
s n s an rr,
ar r's a an a
ns an

n ' na

`oJr ao'|, |o cane orec|on s
oc|a|eo o, ,oJr core s|ren| ano
o noo'|,. Ts exercse ooes ,Js|
|a|. Le on ,oJr oack | ,oJr |ee|
|oe|er, arns oJ| |o |e soes.
Norase ,oJr 'es o|| |e |'oor a| a
90oeree an'e. ronere, sn
,oJr 'es |o |e 'e|| (A) s|ooon ,Js|
oe|ore |e, |oJc |e |'oor, |en |o
|e r| (B).

=a'|oenn,'s aos are |'ankeo o, so'o
oo'oJes, oJ| |e,'re no| ,Js| |ere
|or oecora|on - |ese are resoons
o'e |or |s|n |e |orso. Res| on
,oJr r| |orearn, |ense ,oJr noo'e
ano '|| o|| |e |'oor: keeo ,oJr 'es
s|ra|. Noreoea| on |e 'e|| soe.

=o'o a ea, neocne oa'' | ,oJr
arns ex|enoeo. Enae ,oJr core
ano sn ,oJr |orso |o |e 'e|| (A),
|en r| (B). eeo ,oJr arns
s|ra| ano oon'| 'e| ,oJr |orso sa
or 'ose |enson n ,oJr s|onac.
Ress| nonen|Jnn |e |Jrns |oo.

or aos |oJer |an e'ar, ,oJ
neeo |o crea|e sone |enson n |e
roon. 'sone|rc |enson, |o oe exac|.
Res| on ,oJr |oes ano|orearns |
,oJr 'es s|ra|, ano re|rac| ,oJr
s|onac. No|ense |e '|e oJ| o|
,oJr aos, |akn s'o, con|ro''eo
orea|s. =o'o |or a nnJ|e, |oJ|
orooon ,oJr os, |en reoea|. `oJ'''
ooJnce oJ| o| |ack'es n no |ne.

'`oJr core o'os |e ke, |o ann nore ooer ano con|ro' en rJnnn,
sa,s =a'|oenn,, o asn'| nsseo a Sx Na|ons |ack'e n oer |o ,ears.
Ts s s crcJ| |or a so'o sxoack. Res| |or 40sec oe|een exercses.

Soeeo |o rJo,oro s|ren| ano oace o, reoea|n |s sJoerse| 5 |nes.
'\e s|| Jo |o 200k, sa,s =a'|oenn,. Eas,...

ack'es n no |ne.

B
A B A
B A
B
A
ROARING SPEED
I f you want t o
get f ast er , you
need t o bui l d
expl osi ve power .

FOOD RULES
dailpoeininakeholdbenea
2gpe kgof bodweigh ofaciliaemclegowh
Yo cabinakeholdnea 270gon
ainingda Thi will keepo glcogenoe
oppedpfo powe
C o cabinakedowno190gon
non-ainingda oeneobingo o ab
Ea "good" fa wiheve meal, fom
oce cha avocado, n andoil fih
imfo 12500 -21000kJ a da
dependingono bild, ageandlevel of acivi
SUPPLEMENTS
Fihoil, geenea able
BC'
Poeinhake
ZM, fihoil, poeinhake
" YOU'R !RNN
!8 R, YOU N
!O UNwN," 8Y8
|PNNY. "VY
VOUR! !8
R PZZ, N8
!wY N R."
"7honks to ls-Chem's suort onJ commltment, our /oyers nowget the sorts nutrltlon they
neeJ to Je/lver eok erformonce on the he/J. lt's o gooJ ortnershl." 1ohn 5m|t, ClOthe 5hotls
l5-CRM5 dALl7YA55dRANC PR0CRAMM CRCKLl57
PMR.afiica Diamond Aiiow
Awaid Winnei 2013 & Readei's
Digest Tiusted Biands
Winnei 2013
*LCC is on indpndnr providr which rsrs lor Lonnd
suLsroncs only ond dos nor vrily rh quoliry ol ony
producr or irs conrnrs
Dr 1on Patricios
Presldent of SASMA
Dlrector of Mornlngslde
Spotrts Medlclne
Sports Physlclan at The Centre for
Sports Medlclne and Orthopaedlcs
LA8L vRlllCA7l0N757lNC
we scienri6cnlly cemnre rhe reJucr cenrenrs ngninsr rhe ingreJienr
lisr, se yeu cnn be sure rhnr whnr yeu see en rhe eursiJe is insiJe ree.
MANdlAC7dRR Adl75
very brnnJ musr uhelJ eur unwnvering cemmirmenr re qunliry
nnJ reJucr inregriry. lI ir Jeesnr nss, we Jenr sell ir. 5imle ns rhnr.
8ANN5d857ANC 757lNC
is-Chemis rhe enly 5eurh AIricnn rerniler wirh qunliry veri6cnrien Irem
LCC, rhe werlJs lenJing inJeenJenr Ierensic Jee-resring lnbernrery.
0NLlN R50dRC5
while yeur Jecrer nnJ Jiericinn sheulJ nlwnys remnin yeur 6rsr
errs eI cnll, unbinseJ, exerr inIermnrien nnJ reIessiennl nJvice
nre renJily nvnilnble nr Jischem.ce.zn/Cheese5nIe nnJ vin emnil en
nurririen@Jischem.ce.zn
In the inadequately regulated industry of
sports supplements, there is always a risk
that both retailers and producers may not
be vigilant to label claims and ingredients,
thus increasing risk of contamination and
even harmful side-effects.
Dis-Chem is committed to safety in sports
supplements, and our comprehensive
Quality Assurance Programme upholds
the highest professional standards,
enabling athletes to make safer and more
responsible choices.
"Hlstorlcally |'ve been dlslllusloned by the
supplement lndustry's lack of regulatlon, whlch
places athletes at rlsk from poor quallty and banned
substances. | support Dlschem's Quallty Assurance
Programme that addresses these key lssues".
Advrrising 7078
T ScpIcmbcr 2u14
P08 008
r
5g ro|
47g ronr|s
5.6g |r r
29.5g/13.7g | o||Jr|
724mg oJ
E 2 203kJ
Pro|en 7.4g
C',caenc Caroon,ora|es 46g
De|ar, ore 4.8g
a| To|a'Sa|Jra|eo 35g/13.6g
SooJn 1 440mg
a packe cp a ceece e peake aa be a ee ack, eed ce cae Te a cp pde 0e ee,
e a ad e e be Te a ad ea a 50%ore sodiu, addig a huge 3.6g saI per 100g. The Word HeaIh rgaizaIio (WH) recoeds 5g a day for aduIs.
w|||ars Cr|a||e Cat !amata

T
J
O

A
X
W
O
P
T

Y
P
H
O
T
O
C
R

P
H
J
O

A
P
A
P

B
E
T
T
E
R
B
I
T
E
S
M
E
C
A

P
E

T
Z
-

Y
T
Z
P
D
[
S
A
)
D
I
S
L
L

I
M
E
R
A

E
S

A
V
E
B
E
E

P
O

D
E
D
O

A
C
C
O
P
D

C
T
O
T

E
P
E
C

A
T

S
A

D
C

D
E

E
S
A
S
P

E
D

P
.
!
4
5
O

!
M
A
P
C

Z
0
!
0
[
P
E
C

A
T

S
P
E

A
T

C
T
O
T

A
B
E

C
A

D
A
D
V
E
P
T

C
O

O
O
D
S
T

S
P

E
D

D
E
P
T

O
O
D
S
T

S
,
C
O
S
M
E
T

C
S
A

D
D

E
C
T
A

T
S
A
C
T
,
!
9
7
Z
[
A
C
T
S
4
O

!
9
7
Z
)
.
Tasty snacks don't havetobe
madeout of potatoes andsa|t.
akethesehea|thy cr|sps for
your next sports sess|on
eetroot
||' nos n.
^s |rons|nn-
rsn n|r ox
|s os| |-
nn Cn ron (|or
nrs nr,
n nnJn|,, s '' s
|n on,|onJ|rn| |-
'n nn n'os ,oJr o,
|ox|, - n |Jrns ,oJr
|nrs onk.
Sweet Potato
s no
oo||os. BJ| s
n, nJ|r|on' no-
s|r knos |ns
r no ornr,
soJs nor sn|-sn
| ^ C |r n nr-
|n|n on,|os |r
k'o,oJ's n rs.
Ka|e
^ r|' |nn
'on| ^ C
nr|-oro||n
o'Js son o| |nos
on,|onJ|rn| |nns.
n |'||r Jsn n
Jssn r|s
ros| nor n', n
no' o|ns ||r.
AI I0 B0
|nr nos r oJ|
s nJ|r|oJs s |n s
|n, on n. |r| |n
|ns n||-ok r
nrn|s n ,oJ'''
nJnnn J'|-|r.
Cum|n
ns r|n,
^sn so
sJoorsss ||
|ssJ ro|n
- |n|',
or|n nn
n ,oJr on|r,.
AI I0 P0I 0k IN
or |n oJ| on kn |r, 'n |n
kn oor |nn sornk' n', |n s
s'| n ,oJr ssonn o| no |o
|Jr|nr n|| s '' s |'oJr.
0I0 00 IN
J| |n |r, n ,oJr or-n| on n k |or
!0-!2 nnJ|s or Jn|' |n, 'ook '' rso,. |
|nnoo' |or |n J| sJr |o | |nn
|n sn , or |n,''' 'os |nr rJnn.
Parmesan
^ 'n| Js|-
n nks
|n 's s-
s-Jrn
ro|nos
nor s',
sor.
Cayenne
Pepper
B, no
snoJ'n'| n
|o |'' ,oJ |n|
|ns soks
,oJr n|o-
'sn. n|
0I0 P8P IN
rn| ,oJr on |o !5C. Cnoo |n n|o rso-
sz os | ,oJ'r Jsn |s or s|s nn-
o'n (R599 ,Joon|.o.z, s o|n |n ||n|
n C-s|s|,n. Js| nn ,oJr |nrs. or nx rJnn nsJr
|n s r, Jsn s' sonnr | |o' or r n o|n.
oss n o' o' |o no Jo |n nJ|rn|s n Jrn| rsonss.
'| :.:, :| ,..
::', '',.'
|:' .|' |'
.'| :::' :':
Nbd kns r V|ksogen better tbon e d.
An IIer tbis gd deseres r ottentin
n motter bot.
WIIh cupped pfIce sefvIcIng* Ihefe hus nevef been u beIIef IIme Io IeI Ihe peopIe who buIII
youf cuf, Iook uIIef II. Ouf pfoven expefIIse, quuIIIy VoIkswugen pufIs und Iop-cIuss CusIomef
cufe meuns you`II noIIce Ihe dIIIefence uI VoIkswugen SefvIce. So bfIng youf cuf home, Io
whefe II uII begun und keep youf VoIkswugen u VoIkswugen. ConIucI youf neufesI VoIkswugen
DeuIef Iof mofe InIofmuIIon.
*Cupped pfIce sefvIcIng Is oIIefed uI pufIIcIpuIIng deuIefs nuIIonwIde. PfIces feecIed ufe fecommended feIuII pfIces und
IncIude VT us weII us PufIs und Lubouf. OIIef vuIId I4 JuIy 20I4 3I Decembef 20I4. Tefms und condIIIons uppIy.
ConIucI youf neufesI VoIkswugen DeuIefshIp of vIsII vw.co.u Iof mofe InIofmuIIon
O
C
l
L

C
A
P
E
1
O
W
N

2
0
7
}
E

v
W
S
A
gMHPT | ScpIcmbcr 2u14


nnne ssen oeo'os soeca'seo ne
o'ooo ce''s o oreak oon ne o'aoe, o nose
ce''s can' oreak oon. 'nseao, ne conone
no '|oan ce''s, ncn sor n|'annaon. `or
areres' snoon nsc'e ce''s |orn a naro coer
oer ne nre, s||enn or arera' a''s.
Tns osnes or o'ooo oressre een nner.

Lke a orren o| aer rsnn nron
a sknn ooe, nn o'ooo oressre (oer
!4090 nn=, |orces or areres
o srecn nore nan ne sno'o.

^s o'ooo |'os oas ne o'o-o, oeces o| o'aoe
oreak 'oose ano |'oa nron or o'ooosrean
ano oaros or oran, nere a c'o can oecone
sck n a n cereora' arer. B'ooo ano s ore-
cos caro, oen, canno reacn ne oran ce''s
|eo o na arer, casn an scnaenc sroke.

\no oen, or oran ce''s sar o
oe o|| nn nnes. Deoenon on ne
oran reon ano nnoer o| ce''s a||eceo,
snoons ano cono'caons can rane
|ron ozzness ano ne''acos neaoacnes
o oara'ss, cona ano een oean.

Unoer na sress, ncroscooc ears |orn n ne
nnernos 'aer o| or areres. `or ooo res o
reoar ne oanae o cnrnn o c'o-|ornn
o'ae'es. Oner no'ec'es, nc'on LDL (oao,
cno'esero', ce'''ar oeors ano ca'cn, oecone
raooeo nsoe ne arer a'', |ornn o'aoe.
tkats amta
t|s. c|t: ts|.
D Da| acka ass
sc|cs at t|ca Un|ver-
s|ty of SouthCaro||na, exp|a|ns how
h|ghPharms your bra|n

September 2014



|ar can ,oJ o S|ar| |n ,oJr |ee|
aoar|, knees oen| ano arns oack. Lean
|oraros |ocJsn on |ne |are| [A]. TnrJs|
,oJr nanos ano nos |oraros ano '|| ,oJr
knees as nn as ,oJ can no-ar [B]. '| ,oJ
'ano Jorn|, neasJre | [C]. '| no|, |r, aan.

To ,Jnos nere: |ne |rs| |or os|ance, sec-
ono |or nen|. nees oen| [A], oer|orna
oroao ,Jno [B]. Beno ,oJr knees on 'ano-
n, oe|ore |ne er|ca' ,Jno [C]. ^oo ,oJr
os|ance |o |ne nen| |or ,oJr score ano
e |ne oons|ars nenooJrs a oreak.

'|'s a c'assc, oJ| s|'' one o| |ne oes|. Tne
nner ,oJ can ,Jno, |ne |as|er ,oJ''' oe on
an, o|cn. S|ano |n knees oen| ano arns
oack [A]. TnrJs| ,oJr arns ano nos |or-
aros |o ,Jno |n knees nn [B]. ^n|o
'ano so||', n a oar|a' soJa| on |ne oox [C].

Tns s ooer a| |s oJres|. S|ano oesoe a
a'' [A]. Cna'k ,oJr nano ano nark ,oJr
naxnJnreacn. SoJa| oon, arns oack
[B], |nen |nrJs| Joaros [C]. |ark ano
recoro ,oJr nnes| ,Jno reacn. Score an
aerae o| |nree ,Jnos. `oJ o| ane

erage 71-85cm
ExcellenI 86-99cm
EliIe >100cm

verage 220-239cm
ExcellenI 240-259cm
EliIe >260cm

verage 40-50cm
ExcellenI 51-119cm
EliIe >120cm

verage 345cm
ExcellenI 380cm
EliIe >410cm
There's nobetter way to
measureyour ath|et|c|sm
thantoput |t tothep|yometr|c
test. Gaugeyour power
w|thour -movetest
andpushthrough
your ownce|||ng
C A B C A B
C A B C A B D
September 2014

T
O
C

P
H

N
D
T
E
X
T

8 8X
-
Indn
1 67
fo||ors
WE

rson| trnr rr
s turnftnss nto
mo||nontrt. sr
toomstronr
nomttr our s
ARA A CA R BRC.
' |s 00 s rs r , r
r| s ' Jr | Tr r
, s s r, r r s|r|
rs ||r rsJ|s , rJ| rs
| S| r | 0 rs rs| 60 ss
r| | |s
00IH8I
Ha| 8aats Natra| Pa||Ups Da||fts D|ps
o r||. tp or t so
t's n ou. tn t our
ft sou|rt prt tn
rop nto squt. r o| of
t r usn pront rp |k
|ft on| t r s n
ou. Dr trou our |s
tnn ps n kns unt|
ou'r stnn. Do to 1 rps.
r t pr||| pu||up rs
t nutr| rp (p|ms fn
n tors otr) n tns
our or s ou pu|| uprs.
n our o| |n s
o t r rturn s|o|
k on unt| our rms r
strt. p our or tns.
Do to 1 rps.
tn t t r|| o t
ntr of our ft ( r
sou|rt prt). r t
r orn so our rms r
strt n kns s|t| nt.
u|| t r off t f|oor kpn
our k strt n r |os
to our o unt| ou r stn
n strt. Do to 1 rps.
sn p rs rop on s|o|
n t ontro| unt| our st
s n |n t t rs tn
prss p|os| k to t
strt mkn sur our rms r
strt t t top of t mo
mnt. Do to 1 rps. o|
um|| n tn our nk|s
f o t ps r too s.
8H 8Y8
YEEE -
T | | s| Ts
|J, ' s , ,
| J, s|r| || |
' s rss ( |
s| ^s | | ,Jr | | ,Jr s
rs
H8 IN - 2:25
(trt on tmpo)
YE0 EC
' | | J, s | | , J|
' | | s J
| sr|, s , | | |
r |r sr|
EVE
S|r| PJ''-Jos (neJ|ra' ro,: 1 rps
!R| Deao'||: 1k (ooo,en| o| 4k.
Tna|'s nore |nan |ce ner ooo,en|.,
E VE W
'\e nae a s'eo |rack - 25n o| 'oroJs |oraros
ano oackaros en|eo sorn|n. Tr, |na| a| |ne
eno o| ,oJr sesson |or a |nsner. \e a'so nae
a \kn oress, ano s|ronnan eoJonen| |or |ne
|arner's a'k ncn ,oJ can aoo en| |o.
or oressn, e nae Sss oars ano |nck oars -
rea| |oo's |o noroe ,oJr oressn s|ren|n.

O
P

O
|
|
O
W
P
O

K
)
,
J

S
C

P
P

C
T

Y
[
P
|

N
K
)

ac e-aooJoac ao -e
, a eaoecac ae
aJee e eca ce ae eoao
e: ee aee aJc J ac
a o o J J J ao ao
e ee J ao Jao,
e e ec J a J oeo J

dg|veyouagran|tem|dsect|on
0A0
B
X
Y0'
0
01 l | ||
Jeee J
ao J e, e
eo ao Joe
e Jo D
e,
02 l |A 0
Jc J aoe
Joe J e
oac ee o
e Jo \a,
e aoe
04 l
eeo ,Jr oo,
s||, rc oac ao
|r|n. N|e: | ,Jr
osec| es,
oac | |ne nos.
03 l 0
Tae sna orea|ns,
s ,Jr cnes|
ao ora ,Jr oe,
oJ|| |aros ,Jr
|ace. =o s|eao,.
+
A #1
A||-eer
|acrease6
streagt|
+
A #2
0ef|a|t|ea
ef t|e
eb||aes
+
A #3
A a|cker
cere
Werkeat
TJc ,Jr cn oJ| o'| |ese ,Jr ec. D 5-! se|s
| !-!5sec oJrs|s a| eas| |nree |es a ee, s|eao
| ,Jr reJar cre r.
Be|eese|s, s|re|cn,Jr aosn|, o, ,as|ao|,
oa r o|necora. O, ce,J'recoe|e| are,J
reao, |rc. 'cJs|esra|ner |naeoJrace, sa,s
Tsa|sJe. '|axs|nec|rac|sna| e| ,J
s|raorooeo. O|nerse,J' ,Js| e| |reo.
W lT'S ONE: v yur lbws rwars n ln wIh yur ns as pps I yur shulrs as yuv always n I Nw cnIracI yur gluIs as har as pssbl r Ih
uraIn hs rcruIs Ih uppr an lwr abs an blus mr cIvly says Iranr Bra chnl wh auIhr a sIuy n Ih subjcI r The Journal of $trength and
Conditioning h pay a sIrngr lanr cr IhaI prv bIIr rsulIs n Ih rsI yur sIrngIh an pwr xrcss
A Y0 A0 A:
.:: |' :.|:' |':'
|. : :|... ':. :.

04 September 2014
1ake the
guesswork out
oj your braa
RC8LR1SCNS MAS1LR8LLNLS
exertly blended for
8ruuls und Rousts.

www.robertsons.co.za
8LLNLS
nded for
Rousts.
.za

106 September 2014

80PP|NkI 08
0 80PP8 08K


Norna'', ' on'|
reconneno oreork
oJ| |Je's, ''o ra|er
reconneno oreork
oJ| |ooo, sa,s .oroana
\en|zke, res|ereo
oe|can. ''| ' as ork
n | a ooo,oJ'oer,
|en ' oJ'o Jse |Je's.
'| ,oJ're ao'e |o oranse
|e nea's on |e r|,
|en ,oJ oon'| neeo
|en. '\en ,oJ're
rJnnn on eno|,
oe|ore a orkoJ|, ,oJr
ooo, '' eno Jo Jsn
|s on nJsc'e as a |Je'
soJrce, 'eaon |o 'ess
|na' nJsc'e an.
I 8 I k88
Ceck |e nreoen|s. '^s | nos|
sJoo'enen|s, |e oaners no'eo n
|akn a oreorkoJ| |Je' re'a|e |o
a|'s ac|Ja'', n |e orooJc|, sa,s
\en|zke. '|os| oreorkoJ| |Je's
con|an 'ee's o| s|nJ'an|s ano
ca||ene c can oe arn|J'. S|ck
|o |e Joe'nes, ano oon'| oe |e
J, o |akes |oo nan, scooos.
\en | cones |o oreorkoJ| nea's,
oon'| oerea| (|nk snack sze, ano
aoo |a||, |ooos - |a| s oes|eo er,
s'o',, c neans ,oJ''' |ee' s'J
s ano coJ'o crano eas',. ^no
caros can oe a ooo ener, soJrce,
,Js| no| see|s - |a|''' caJse a sJar
rJs ano cras a'|a, |roJ |e
orkoJ|. '| ,oJ are on on a rJn, o
eas, on |e ca||ene. '| can caJse
s|onac Jose|s or caJse ,oJ |o |
|e oJses a'|a, |roJ |e rJn.
herht
preworkout
mesnd
supp|ements
canhe|pou||ft
heav|er andfor
|onger. Here'show
toget themost out
of everworkout
IF YOU SEE SOMEONE AT GYM MOVING WITH THE PENTUP ENERGY OF A SIXYEAROLD ON A SUGAR HIGH, IT'S MOST
'ke', |e,'e |aken sone kno o| oreorkoJ| orooJc|. Tese are |''eo | nreoen|s |a| e'o | ener, 'ee's: ca||ene,
nsen ano oranceo can anno acos (BC^^s, 'ke 'eJcne, so'eJcne ano a'ne. Te, can ork n o||eren| a,s -
sone s|nJ'a|e ,oJr neroJs s,s|en, sone e a nen|a' oJs, sone orooe a 'nJsc'e oJno c oe'ers o'ooo ano
nJ|ren|s |o nJsc'e |ssJe e'on | |o recoer ano ro. ^'' ae |e oa' o| e'on ,oJ |o |ran aroer |or 'oner. `oJ can
a'so e| ener, |ronea|n |e r| oreorkoJ| nea's, oJ| |ere are |ree cases n c sJoo'enen|s can e'o: | ,oJ
oon'| ae |ne |o ea| a nea': | ,oJ can'| s|onac an,|n oe|ore |rann: ano | ,oJ're a arocore '||er. BJ| a| ,oJ oo
neeo |o kno- ,oJ ae |o ea| or |ake sone|n. '| ,oJ ork oJ| on an eno|, s|onac, ,oJ na, ae a s'| oene||
en | cones |o e| 'oss, oJ| ,oJ''' oe nssn oJ| on |e oo|en|a' o| seroJs nJsc'e an ano |e oes| resJ'|s.
I kI8
1/ Burn more b|ubber
Ce| a ca||ene |x, e|er |roJ co||ee or a
sJoo'enen|. ''|'s oeen oroen |o acce'era|e |a| 'oss
as | caJses |a| ce''s |o oe Jseo as ener, ns|eao
o| ',coen, sa,s \en|zke. ''| a'so ncreases oer|or
nance: ,oJ can |ran aroer ano |or 'oner. O|er
ca||ena|eo ornks nc'Joe reen |ea.
2/ Take the pa|n out of ||ft|ng
^s|Jo, n |e ourn| of $trength no Conoitioning
soeo |a| |akn ca||ene reJ'ar', oe|ore a ork
oJ| e'os reoJce |e oerceeo oan o| '||n e|s.
3/ Jack up our performance
^ s|Jo, n |e ourn| of the nterntion| $oiety
of $ports utrition o| 24 a|'e|es n a n|ens|,
|rann ororanne |oJno |a| a nx o| oro|en,
ca||ene, crea|ne ano anno acos |aken oe|ore
|rann can ooos| ||ness 'ee's ano s|ren|
oer|ornance. Ts nx con|aneo e, oro|en,
coro,ceos snenss, crea|ne, c|rJ''ne, nsen
ano ca||ene. Ter \O_ nax nJnoers ncreaseo
ano |ere ere noroenen|s n 'ean ooo, nass.
Wht rethebest
pre-workout snks
ndwhenshouId
et them?
Your snack should conIain
boIh proIein and carbohdraIe,
and iI should be eaIen abouI 3
Io 45 minuIes before our Irain-
ing session," sas VenIke. Here
are her recommendaIions:
PeanuI buIIer (or anoIher kind
of nuI buIIer) is a good Iopping.
dd hone for eIra energ. Or
Ir scrambled eggs for proIein.
Have iI before a morning ses-
sion. The cinnamon helps con-
Irol blood glucose levels. You
can also make iI wiIh milk or
add some peanuI buIIer Io
increase Ihe proIein conIenI.
The're like naIure's energ bar
- a greaI source of carbs and
poIassium (mainIains nerve
and muscle funcIion) Io have
before ou eercise. The
oghurI adds proIein.
Slice up an apple and spread
wiIh peanuI puIIer. |I's perfecI
for laIe afIernoon Iraining. The
apple provides energ and fibre,
and peanuI buIIer for proIein.
GreaI before workouIs. Eas
Io make, easil-digesIible,
porIable and a good source
of boIh carbs and proIein.
Mi wiIh plain oghurI or milk.
0'8 08k8
THE HIT LIST
.. ge
ParI of Ihe X-Ireme
Performance Series,
Ihis is filled wiIh a Iri-creaIine
comple, caffeine and paIenIed
ingredienIs Io boosI niIric oide
for muscle pumps, and is
a powerful, good-value
pre-workouI mi. R379 (4g)
musclejunkiesIore.co.a
yperdrIve
re .
This concenIraIed
proprieIar formula includes
caffeine, creaIine and ciIrulline
(a pump boosIer) and includes
virIuall no carbs per serving
and Ihere's no loading phase or
ccling needed. R209 (14g)
dischemonline.co.a
.oroana \en|zke s a
res|ereo oe|can,
oersona' |raner ano
resoen| sJoo'enen|
exoer|.
1IAsIIe of whoIegrIn
bred nd rb toppIng
2IA bowI of ots
wIth Innmon
3Inn nd Greek
yoghurt
4IAppIe nd penut
butter sndwIh"
5Ierry, bnn nd
Imond smoothIe
September 2014
kk8
08 08k8

C
H

S
T

T
I
O
N
S
B
P
O
W
N
B

T
T
|

|
|
)
,
Z

P
[

P
C

S
)
P
H
O
T
O
C
R

P
H
C

T
T
Y

S
0||8I
I 0N
Pefe ea n vae y ee ke|ebe||:
a k|a, a 24-k||ogram, and a 32-k||ogram,"
says Tsatsou||ne. "That's a|| you need for every
move you'|| do."

s|r Jr nao eer nearo o| ke||'eoe''s. Tooa, |nese
en|s are n a'nos| eer, ,nn SoJ|n ^|rca ano
'ke||'eoe'' orkoJ|s s |ne sx|n nos| oo'eo exercse
|ernon |ne o'ane|. No onoer: 'e||'eoe''s are nore
Jser-|reno', |nan oaroe''s or oJnooe''s, sa,s ke||'eoe''
ooneer Pae' Tsa|soJ'ne. '`oJ oon'| neeo as nan, |o n|
eer, nJsc'e ano |ne, o||er os|nc| aoan|aes |or ooos|-
n noo'|, ano a''-aroJno s|ren|n. o''o |nese rJ'es
|o e| |ne nos| oJ| o| eer, reo.
I8kk 80|
0k88Ik 0
I 08K
Un'ke a oaroe'' or oJnooe'', a
ke||'eoe'' nas a 'oao |na|'s o||se|
|ron|s nano'e. 'Tna| ano'|es |ne
oa''s|c |orces n oJck, o,nanc
noenen|s, e||ec|e', nakn |ne
ke||'eoe'' |ee' neaer |nan | ac|Ja'',
s, Tsa|soJ'ne sa,s. '| a'so o'aces
rea|er oenano on ,oJr s|ao'sn
nJsc'es, core ano coorona|on,
'eaon |o oer (ano nJcn |as|er,
ans. P'Js, oecaJse o| |s |nck
nano'e, |ne ke||'eoe'' s a rea|
|oo' |or oee'oon oe||er ro
s|ren|n, sa,s Tsa|soJ'ne.
I8kk 80|
Kk0 k I0
08 IN
'e||'eoe''s are oea' |or exo'ose,
|o|a'-ooo, exercses, sJcn as sns
ano sna|cnes, sa,s Tsa|soJ'ne.
Tne,'re a'so ooo |or |ne oerneao
oress oecaJse ,oJ e| a ooo
s|re|cn a| |ne oo||onano a oer|ec|
'ockoJ| a| |ne |oo. (See 'Poer
|oes, rn|., ^s |or |ne |rceos
ex|enson, oceos cJr' ano o|ner
noes |na| n| sna''er nJsc'e
roJos, a ke||'eoe'' a'so orks ,Js|
as e'' as a oJnooe'' ooes. BJ| |
,oJ're on nea, (oeao'|| or oencn
oress, |or exano'e,, rao a oaroe''.
I8kk 80|
008 0k
008 08N
^ ke||'eoe'''s o||-oa'ance oesn
nakes ooo |ecnnoJe een
nore noor|an|. 'eeo ,oJr rs|s
s|ran|, Tsa|soJ'ne sa,s. Benon
,oJr rs|s rases ,oJr rsk o| s|ran
ano ooesn'| 'e| ,oJ |rans|er ooer
as e||ec|e', oe|een ,oJr ooo,
ano |ne oe''. ^'so, keeo ,oJr en|
on ,oJr nee's ano ,oJr snoJ'oers
oJ''eo oon ano oack. 'Tna|
ncreases ,oJr s|ao'|, ano a''os
,oJ |o enera|e nore ooer, ooos|-
n ,oJr oer|ornance n eer,
exercse, sa,s Tsa|soJ'ne.
Scu|pt astronger, |eaner, moreath|et|cbody
w|thth|s ba|||st|cfat-fry|ngmusc|etoo|

- spcially for
ballisIic movs lik swings and
snaIchs Hold Ihs
(Ih sids of Ih handl) for
goblI suaIs and whn Ih bll
is upsid down Th
havisI parI of Ih bll and
whr Ih mass is cnIrd
A
C
kI0N 0 KII|||
P08 N08
I0 KII||| N08
8 Nk 800| N8I8
B

kIIlbll allows
you Io sIarI Ih lifI
lowr, which is safr
for your shouldrs,
TsaIsoulin says I
Ih Iop iI pulls your
arm back slighIly,
improving mobiliIy
D|rect|ons SIand
wiIh fI shouldr-
widIh aparI and
hold a kIIlbll
in fronI of your
shouldr wiIh your
lbow Iuckd, Ih
wighI rsIing on
your forarm Prss
iI sIraighI up, roIaIing
your arm so your
palm facs forwards

This offrs srious


powr-building and
six-pack bnfiIs
You'll burn abouI 58kj
a minuI (sam as
running 10km an
hour), according Io
Ih UnivrsiIy of
Wisconsin
D|rect|ons Sprad
your fI slighIly
byond shouldr
widIh, and grab Ih
bll Hik iI bIwn
your lgs and IhrusI
your hips forwards as
you swing iI Io chsI
lvl Swing iI back
bIwn your lgs
Mastered these two moves? Turn
over for our advanced KBworkout.
September 2014
r away fat andbu||dpowerfu|
a||-over musc|ew|thRuss|a's
revo|ut|onary |nvent|on, the
kett|ebe||. These10moves
workevery |nchof your body


ona', |ne ke||'eoe''
s |ne a'asnnko o| ,oJr
none-,n arsena'. CoJn|-
'ess s|Joes nae |oJno
| |o oe |ne oes| |oo' |or
noron ,oJr oos|Jre,
snreoon k'o,oJ'es ano
oackn on nJsc'e. '^
ke||'eoe'''s 'oao sn||s
oJrn exercse, sa,s
PT .ason Bron, oner
o| e||'eoe'' ^|n'e|cs.
Tns nakes | sn'ar |o
carr,n eer,oa, oo,ec|s,
n ,oJ |Jnc|ona'
s|ren|n. ''|s snaoe a'so
'e|s ,oJ s|cn |ron one
exercse |o |ne nex| |n-
oJ| oJ||n | oon, sa,s
Bron, ncn resJ'|s n
a oe||er ne|aoo'c oJrn.
SWING INTO ACTION
For f ul l - body
def i ni t i on put
t he ket t l e on
September 2014

Sn a ke||'eoe'' oe|een ,oJr 'es ), |nen


oJ'' | |oraros ano Jo, |'oon | a| cnes| 'ee' (B).
PJsn | oerneao (C). Sao arns. Too naro Break |
oon: sna|cn | |o cnes| nen|, neao, |nen oerneao.
Do 5 reos |n eacn arn.

Sn |o oe''s (A) (see 3,: c'ean |nenso |ne,
res| n |ne crook o| ,oJr e'oos (B). Dre oer-
neao (C). Tns n|s ,oJr oos|eror cnan ano 'oJsn-
n nJsc'es |o oJ'o ooer.

=o'o |ne oe'' n |ron| o| ,oJr cnes| ano 'oer n|o a
oeeo soJa| (A). Tense ,oJr aos ano exo'ooe oack
|o s|anon, conraoe (B). Use |ns oe|ore orkoJ|s
|o ooen Jo ,oJr nos ano oJ'o ,oJr 'J|es.

Le oon, |ne oe'' ne'o aooe ,oJ (A). Rse Jo |o
s|anon, keeon |ne en| nn |nroJnoJ| (B&C).
^oo Jsn,oJr arns |o s|ano. Tns |Jnc|ona' noe
n|s ,oJr core, snoJ'oers, 'J|es ano 'es, naro. Do 5
reos |n eacn arn.


Tns s |ne kn o| ke||'eoe'' noes: rao |ne en|
|n oo|n nanos, oa'ns |acn ,oJ (A). TnrJs|
,oJr nos |o sn | |o cnes| nen| (B). Per|orn
exo'ose nn reos |o oJrn Jo |o 5 k, oer noJr.

\|n ,oJr e'ooo, ,oJr soe ano |ne oe'' n |ron|
o| ,oJr snoJ'oer (A), 'oer n|o a soJa| (B). S|ano
Jo: keeo |ne en| c'ose |o ,oJr cnes|. `oJr aos
oo a 'o| o| |ne ork nere, crea|n a ooer|J' |orso.
Do 5 reos |n eacn arn.

^ooo| a oe s|ance ano '|| |ne oe''s. Beno ,oJr


knees ano s|ar| |n sna'' sns (A), |nen s'o',
ncrease | |o cnes| 'ee' (B). Tns no|on rooes n
eer, oack nJsc'e |or s|ren|n ano sze.

B
B
B A

=o'o |ne oe'' a| snoJ'oer nen| (A), |nen oJsn |


Jo (B). Loer s'o', |or oe'|s nore ooer|J' |nan
PJ|n. Tne sn||n en| nakes | nore e||ec|e
|nan a oJnooe'' oress. Do ! reos |n eacn arn.

=o'o |ne oe'' aooe ,oJr neao n |ne s|ance snon
(A). PJsn ,oJr nos |o |ne rn|: s'oe ,oJr nano
oon ,oJr 'e|| 'e (B). Reoea| |o |ne 'e||. Tns rea'',
orks ,oJr core, ne'on |o care oJ| ron aos. Do
! reos |n eacn arn.

Per|ornas oe|ore, oJ| |ns |ne no'o |ne en| n


one nano nen snn (A). S|cn nanos a| |ne
|oo o| eacn reoe||on (B). Tns sno'e noe |orces
,oJr core n|o ac|on |or oe|neo aos. Do 5 reos
|n eacn arn.
B
B
A
A
A A B
A
A
A
B A C B A C
B A C
B
A B
Comb|ne any moves to make a c|rcu|t.
Start w|th 3 c|rcu|ts w|th no rest between
moves. Rest 60sec at the end of the c|rcu|t.
As you get stronger add one more c|rcu|t to
the programme.









Hame
War|aat

Veta| care
aa |es

J m|aates
ar |ess
September 2014
e CIassIcs

cle-bilding
moes are Ihe dead-
lifI, saI and bench
press, bI e'e goI
Ihe neI ae of
moes IhaI add ms-
cle and blasI faI (and
sae Iraining Iime)
1. Zercher Squat:
Hold a barbell across
or chesI in Ihe
crook of or elbos,
cpping one hand
inside Ihe oIher
ssme a saI
sIance, and Iense
or core Do a
saI hile keeping
or back sIraighI
Do 3 seIs of 3 reps
on da 1 and 3 of
5 on da 2
2. Thruster: This
combines a fronI
saI iIh an oer-
head press SIand
iIh or feeI shol-
der-idIh aparI,
holding a lighI
barbell across or
chesI Do a saI
Ihen eplode back Io
Ihe sIarI posiIion,
and simlIaneosl
press Ihe eighI
oerhead sing
momenIm and a
pressing moemenI
Do 3 seIs of 8 reps,
Iice a eek
3. WeIghted PuII-
ups: Use a normal
sIricI form Iechnie
Io geI or chin oer
Ihe bar, bI add
eighI b eiIher
holding a dmbbell in
beIeen or ankles
or sing a eighIed
esI Bild p or
reps (and eighI) so
o can do 3 seIs of
5, Iice a eek

^| 20k s
Jn | | ,
sJr s srn
. n r
20 s || | s
| r | s|
sJr rn 0.,
|| | ,r
|r r sn. s n
rn sJr s|srs n
rssJr |n.
| s
sJs | Jn xJr
sn n nn |Jrn J| |
| rs| , n ,
|rn n | Js
rn |k | n
| CC r s,s|n
n'| s| | Jn|
rr | | |. ^|r rr
n k , rn s
| |. s sk
n n'| . s
sJr |k | s
n s n s Js| |s
n . BJ| |r s|J,n
| | rs || |
rsz n s||n n |
Js s |J, n


ant to hear your we|ght |oss
and persona| success stor|es!
Ema|| us at te||mhmed|a24.com




nx| nnr rns
Reebok Rea|F|ex appare|
hamper worth R3 000
nJn rJnrkn
rJnnn ss || r
'skk n r|
n|Jr n|. s|
rk..z r n.
AGE
38
LOCATION
Midrand
OCCUPATION
OperaIions DirecIor
HEIGHT
181m
WEIGHT BEFORE / AFTER
208kg / 92kg
TIME TO GOAL
17 monIhs
EdYoungdoesn't need
totakemed|cat|on
anymorethanks toa
hea|th|er eat|ngand
we|ght-||ft|ngp|an
r|Jrn | J| ^r
,s |r s|r| , |
ss Jrn,.
THE STRATEGY s|r| '|
n n n |rnn r|,.
n | nnn Js| J| J|
r s| r |
r z sJr r
n| rnks n r
Jr |rs Ck r s
n|, s n s rss
ns, s rrn
n rJ| Js. , n
n | , |
s|r| n
| n s s|r| k
n | Jr | rn|,.
r s| | ,
rr n r | J
r n sJ|,
| xrs nss|s ,
n, | Js n |s
n || r nr,
|r nJ| , r
s| |rnn. |r |
sssns k
| | |rnn.
s || Crss| n
|s rk rJns.
THE REWARD n |J
|'s |kn r ,r |
sk | xss |
n | ||r n
nr 's| n s|rn.
n s|, s rs|
, r ,
THE RESULT , || |
ss s 6k n , s|
r r sz 2 | 32.
, sJr s
s|s | . n
|n sn'| n r , sJr
s n,r ,
rssJr s n| n
r22060 | 22.
s n'| n n,
|n n. ' ,s,
rnn| , . ^n k
k s sJr| n
, Jrn, r |n |,
kn n s| s,.

Reereuces. 1. Cox |M el al. Red blood cell Mg aud chrouic aligue syudroue. Laucel 1991, 337.75780. 2. |MS dala, May 2014. 3. |upacl Rx dala, May 2014. *Muscle
craups is a recoguised syuplou o uaguesiuu decieucy. S0 SlowMag

Jablels. Each euleric coaled lablel coulaius uaguesiuu chloride 535 ug (equivaleul lo 64 ug eleueulal
uaguesiuu) h/24/89. SlowMag

Caps. Each capsule coulaius uaguesiuu auiuo acid chelale 450 ug (equivaleul lo 45 ug eleueulal uaguesiuu). SlowMag

|izzy. Each lablel


coulaius eleueulal uaguesiuu 172 ug aud vilauiu C 150 ug. |or urlher iuorualiou,reer lo lhe package iuserl approved by lhe Mediciues Regulalory ^ulhorily. Merck (Ply) Lld.
Reg. No. 1970/004059/07. 1 |rieslaud 0rive, Lougueadow Busiuess Eslale Soulh, Modderouleiu, 1645.Jel. (011) 3725000, |ax. (011) 3725252. SM.04.13.007, Reporl adverse
eveuls lo drugsaelyuerck.co.za or +27 11 608 2588 (|ax liue).
find us on:
kise to the chaIIenge.
0r don't.
It's up to you.
L
O
W
E
J
H
B

1
6
4
1
8
/
E
/
C
Preveul aligue or uuscle craups rou holdiug you back.
1*
@SIowMagSA, www.sIowmag.co.za
1he ho. 1 magnesium suppIement
most recommended by doctors.
2,3
H.O.Z | September 2014

ml CIIck. Ohhh, crap. o,oJ n oack


n as|. SJre, ,oJ coJ'o ca'' a 'ocksn|n, | ,oJ nae
an noJr |o k'' ano,oJ 'ke n Jo. ^no oJncnn
oJ| a noocoJ'o e| o'ooo,. So con|ro' ,oJr
on oes|n,: nake a ke, |n ne'o |ronnas|er 'ock
ocker Erc |cnaJo. `oJ coJ'o oe oack nsoe n
|e seconos. Tna| 'ock Eas, ockns.

PIN
HE
LINE
PLG

LJc, ,oJ. `oJ'e a'reao, s|asneo |o nar ons n a


secre| o'ace near |ne ooor, ,Js| |or occasons sJcn
as |ns. ('| no|, ask |ne nenooJr 'ao, |or sone.,
Coner| |nese n|o |o 'ock-ockn |oo's - a |oroJe
|oo' ano a ock. To nake |ne |oroJe, scraoe |ne
roJnoeo eoes o|| |ne |rs| on ano oeno | n|o a
snoo|ner Usnaoe. Beno |ne |os 90 oerees
1
eeo'n| oressJreon|ne|oroJe|nonenano: Jse
|neo|ner |ooJsn|neock oeeoer n|o|neke,no'e.
'nsoe, |e|osx sna'' 'ocknons 'ne|neroo| o| |ne
|Jnne'. Eacnneeos |ooesn||eoJoaro|oca|cna
nner rJn, nncknna| naooens as a ke, s'oes
n. Use|nenook's eoe|o'|| |neon|n|nenos|
ress|ance|rs|.
4
Trn |ne |oroJe |oo' oara''e' |o |ne roJno (roJno
eno oon|eo aa, |ron|ne 'a|cn, ano nser| |ne
orons n|o |ne 'ock. eeo oressJre on |ne |oroJe n
|ne orec|on ,oJ an| | |o |Jrn. (Locks on |ne 'e||
soe o| a ooor ooen c'ockse: 'ocks on |ne rn| o
an|c'ockse., Leae |ne |oroJe n |ns oos|on.
Tnere's ano|ner |oo' |o nake.
2
| cra|e ,oJr ock: ooen |ne secono on,
scraoe |ne roJnoeo eoe o|| |ne |o o| |ne s|ran|er
soe ano oeno |ne sane |o Jo ,Js| s'n|', so |
reseno'es a er, sna''ocJreo |snnook
'nser| |ne nook eno n|o |ne ke,no'e: |nen oJ'' |ne
ock Jo |oaros |ne |oo o| |ne cnanoer. '| an,one
oasses, ,Js| sa,, ''|'s coo'. ' 'e nere.
3
^s ea 'okn on noes Jo, |ne 'ock '' 'oosen,
|Jrnn s'n|', n |ne orec|on | snoJ'o ooen, ano
ano|ner on '' oecone ress|an|. BoJnce Jo |ne
'as| one, ano ,oJ''' |ee' |ne |oroJe |oo' |Jrn |oaros
|ne orec|on ,oJ'e oeen keeon oressJre n,
sornn ooen |ne 'ock. Res|asn |ne |oo's oe|ore
en|ern, ,Js| n case. PCHEL SWBY
5
aLock~
LIkeaPro
u've acc|denta||y |ocked yourse|f out
the house. So what's your p|ay?

September 2014
Nowadays when we taIk about meetIng a woman, we seek good
hemisfry. hh, if`sgoodfoseescienceasarf of fhemainsfream. Lef`ssfarf
ourexerimenf wifhfhishyofhesis: sheIikesyou-orshewiII, affershe`s
hadafewmomenfswifhyou. Now, I`masconcernedabouf gIobaI warming
asfhenexf guy, buf hereweseekfomeIf fheice, if youcafchmydriff. (Snow
unsinfended.) Thesefis, basedonrecenf research, maywarmfhingsu.
w
IosIveChemIstry
et |ntoour e|ement w|thprovent|ps fromB||| ethe|eneu
AAY A Y
AY A
oJ n| |o o n s
| s o'on
Jnn no| | J'kn
nr|'. r s
no|sosJ|' s|n
|on |n o'
oon o, 'nJ
(s|nn |'' | rns
Jnross,
onn n oo'n
n n n orr
n nn.
sr sJs|s
|| n|'', 'n
oJr n, ,oJr
k, |o son |
so | ' r
orson' so. on'|
'n n or onn| |
onrs|on. n
s's | s s'''
nor ro| |o ,oJr
ronn| or|Jrs.
A Y A
B D'
sr|on s | ''
nrk o | sn|
n|o. o 'ook r n
| ,. okn zs
| oo|n|' or|nr
|rrs n |J'
nsJr' rsoons
'' | , on||
| s ns ,oJ
||r| , on||
n, oos| || 'n.
o ,Js| ko ,oJr z
r| no| '' Jo n
on. 'n s ro,
n s''' '. onn
'k J, o's Jnn,
|oJ| n nooro
or| so xornn| |
,oJr on rsk. |'s
o on''n s
nn|. rr, on.
|TH LEX GPDNEP ND
GPEGG STEBBEN

`
`
` .
`
. `

.
.


.

`.
.
`
`.
D AAY
A
^s ,oJ n, kno
r o |s on |
|n n | sr|.
OJ|e o||en |ns soarks
a o| o| oan|er or sone
cnarnn conersa-
|on. \onen no|ce.
^ooaren|', |ne, can'|
ne'o |. \na|eer oece
,oJ cnoose, oe | a |e,
sJsoenoers, a|cn or
oe'|, ,oJr oes| oe| na,
oe |ne co'oJr reo.
S|Joes sno|na| reo,
'ke |ne crnson o|
a |resn rose, a||rac|s
nore ronan|c a||en-
|on |rononen |nan
o'Je - een | |na| o'Je
s |ne oeaJ||J' nJe o| a
BJnsen oJrner's |'ane.
' kno: na|Jre's a,s
are s|rane.
CatchaBaII
u|| |n f| || ||ke se|| pro
w|th some he|p fromret|re |or
egue outf|e|er r heff|e|

ADY Y
Don'| s|ano Jorn| - ,oJ''' oe caJn| o||
Jaro. |oe n|o a oos|on sn'ar |o |ne
one oaseoa'' o'a,ers Jse oe|ore |ne, s|ea'
a oase - croJcneo, en| o|| ,oJr nee's,
arns nann 'oose.

BA BA
ron,oJr croJcneo oos|on, 'ock ,oJr e,es
on |ne oa'' ano |nen rJn on |ne oa''s o| ,oJr
|ee| ('anon on ,oJr nee's '' caJse |ne oa''
|o 'ooJnce n ,oJr son, Jn|' ,oJ can oos-
|on ,oJr ca|cnn snoJ'oer n 'ne |n |ne
oa'''s |'n| oa|n.

D !
Ca|cn |ne oa'' |n ,oJr 'e|| |oo| |oraro (or |
,oJ're a 'e||,, s|eo |n ,oJr rn|,. eeo ,oJr
'oe a| cnes| nen| so ,oJ can oJck', |rans-
|er |ne oa'' |o ,oJr |nron nano. NoJse
,oJr oack |oo| |o aoo nonen|Jn|o ,oJr |nro.

114 | September 2014


Man to Man


eInes. Oneis fhaf seIne isn`f awordaman
shouIduse. I canjusf abouf imagineErnesf
Hemingwayor CIinf Easfwoodfakingaicfure
of fhemseIves, I suose, if if somehowheIed
cafchamarIinor savefhefownsfoIk, buf I can`f
icfurefhemsaying, Whaf doyoufhinkof my
seIne?SwieIeff?Swierighf? If`s Iikeusing
fhewordWooIies as anabbreviafionfor
WooIworfhs. I`mnof sayingif`s unmanIy, nec-
essariIy, buf if you`reaman, Ieasedon`f doif.
Anofher reasonI don`f fake seInes is my
face is Iike my voice. WhenI Iisfenfo myseIf
seaking I`mseaking, my voice sounds
fanfasfic fo me. I`mIike a combinafionof CoIin
FirfhandJames EarI Jones, aII wry andveIvefy
androIIing Iike chocoIafe fhunder. Somefimes
SclIica, gclIica, hculIhica.WhuIcvcr
ynuwunI In cull Ihcm, Ihcrc'a u rcuann
ynuahnuldn'I bc Iuking Ihcm

PPEL BP|STOWBOVEY
|LLUSTPT|ON
BYPON GPPEP
SELF
0ESTRUCT

September 2014
I e myeI fIkn ndfnk: Mon, IJ voe
for bo voice IJ followbo voice ino bole
Domn i, I won o bove sex wib bo voice
enI e ecodn o me ndI eIe
ImcfuIIy muo nevou veono
Leo DiCaio inBlooJ DiomonJ anda wonky
wheeI ona hoing foIIey. Idafhe Iifen
fo Jacob Zuma eading fhe Sfafe of fhe Nafion
eechfhanfhaf voice. Idafhe Iifenfo
a baby cying onanaeoIane.
Thaf why I efe fhe icfue of myeIf
fhaf inmy head. If I awmyeIf fhe way fhe
ef of fhe woIdee me, Idneve Ieave home
again. Iof of eoIe wifing fancy aficIe in
magazine cIaimfhey donf fake eIne becaue
eIne ae a ymfomof modennaciim.
Thaf nof fhe cae wifhme. Ima naciific
a eveybody eIe Imjuf eIf-cificaI a weII.
Buf of coue ofhe aenf o queamih.
Thee ae eIne eveywhee, anddieenf
kind of eIne. Thee ae duck-face eIne and
ceIebify eIne andbIocking-fhe-vieweIf-
ie andfhoe wanky beach-feef eIne, whee
you buddy fake a hof of Cam Bay fomfhe
eecfive of hi unIounge, whichi good
becaue if doenf have hi fuidface inif, buf
badbecaue if doe have hi ugIy feef.
Thee ae eafbeIf-eIne andfuneaI eIne
anddunk eIne, andevena fange ub-e-
cie whee womeneIne fhemeIve Iying in
bedwifhfhei eye cIoed, eumabIy becaue
ome moofh-faIking boyfiendonce foIdfhem
fhey Iook IoveIy whenfhey Iee. Infhaf cae
(fhee womenobviouIy fhink why houId
onIy my neaef anddeaef have fhe benenf of
faing ceeiIy af me? Check if ouf, andom
fange onfhe Infenef, fhi i whaf youdee
if younuck info my bedoomIafe af nighf!
(The fuIy weidfhing i fhey donf eemfo
eaIie fhaf we knowfhey aenf eaIIy aIee
becaue, weII, bere okinq be picure.
Buf fhe newbig eIne i fhe nfne eIne,
o gymeIne, o geIne, o heaIfhie. The Iame
veioni fhaf dude oing beide fhe feadmiII
wifhhi weaf foweI oundhi neck, a fhough
fo ay, Look, I canaoda gymmembehi!
o maybe, Hee me woking ouf by Iiffing
a hone wifhone hand. UnIe fhe hone
weigh 4ukiIogam, if nof fhaf imeive,
guy. Buf fhee ae aIo fhe eiou nfne
heaIfhie ofedby gymbo andgymba
whove beenwoking hadfo buiIdwhaf
fhey have, and wanf youfoee if.
+++++
THERE'S AN ART TO A GOOD HEALTHIE. YOU NEED
fheighf awmafeiaI, obviouIy, andfoknow
howfooefoemhaieyou bef feafue -
achedbackfo fhebubbIe-buff, handonfhe
backof you headandeIbowoinfingfowadfo
howcaeyou nneIygafedeafu -andhow
fohidefhoecaIve youenof ooudof. You
aIoneedfoknowyou wayaoundyou gym
Iighfingyfem, andnndjuf fheIaceinfhe
Iocke-oomwheefheoveheadof wiII ouf-
Iineyou ab wifhband of dakhadow.
EaIy moning i fhe fime fo fhe geIne,
whenfhee no one eIe aound. If emhaie
you diciIine andeIf-acince - youe nof
onIy ied, youe moaIIy ueio fo fhe ef
of u Iug fiII inbed- andaIo avoid fhoe
ficky ivacy invaionifuafion whee you
accidenfaIIy naome guy infhe backgound
emeging fomfhe howe. Some Iike fo acce-
oie fhei geIne wifhchunky headhone
o ionic eyewea o a beanie ofhe make
fhei body fhe acceoy, Iiffing fhei vef,
o fhoughffuIIy cuing a beaf, o hooking
a aucy fhumb infhei waifband Iike if fhe
cove of FHMin2uu6.
The mainadvanfage of uing fhe gym
infeadof you unhofogenic home bafhoom
fo you heaIfhie, beide fhe fangeIy eace-
fuI duoecenf afmoheic of anemfy gym,
Iike a bighf-Iif chuchaf midnighf, i youcan
ue fhe mio fo a fuII-body icfue. Buf fhe
euIf i offendiconcefing, becaue infead
of making eye confacf, a ina nomaI am
IengfheIne, fhe eIfe i uuaIIy faing af
fhei hone, checking fhe image. If a mifake:
heaIfhie ae fhe ame a on- if you body
fhaf maffe, buf you face fhaf
make youmemoabIe. Wifhouf fhe
face, youe juf af of ananony-
mou aade of body af fhough
anunending Infagamfeed.
SeIne ae ouIa becaue
Iooking af face i one of fhe ecinc
funcfion fhaf humanbain have
evoIvedfo do weII. Thee a eciaI
egionof fhe bain- fhe fuifom
faciaI aea, onfhe venfaI uface of fhe fem-
oaI Iobe - fhaf Iighf uwhenwe ee face:
wee hadwiedfo fake deefing Ieaue in
faciaI ecognifion.
Wee hadwiedfo enjoy Iooking af nf bod-
ie foo, of coue, buf I fiII emembe cefain
modeI inGiqqles n Goqs magazine whenI wa
yea oIdbecaue a weII a fying fo ee
behindfhe fa ove fhei niIe, I made a
hoefuI connecfionfhoughfhei face.
+++++
THERE ARE MANY GOOD REASONS FOR TAKING
gymeIne - fo one fhing, fhey canfack you
body ecomoifionove fime - buf whaf in
if fo fhe eoIe doing fhe comuIive haing
andofing, fhe ceaeIe giving away of fhei
ownimage fo fhe woIdfo ue a if Ieae?
II eIne ae a way fo ojecf animage of
youeIf fhaf youve cuafedandaoved,
andfhaf no dieenf fo whaf we non-eIne-
fake do ona daiIy bai, whenchooing ou
cIofhe andhaicuf andIanning whaf fo ay
af fhe omce foday. HeaIfhy i a newcuency of
fafu, a moe democaficaIIy avaiIabIe veion
of ich, aIfhoughyoufiII needa IifefyIe fhaf
aIIow fee hou andeciaIiednufifion. If
ha animIiedmoaI comonenf. If a foy of
hadwok. HeaIfhie boaf abouf fhe oce
a mucha fhe euIf: Iook af me, nof onIy do I
Iook good, buf I work borJ. I deeve fhi, and
youcouIdfoo. UnIike ofhe eIne, if nof ue
boafing, if aIo animIiedencouagemenf.
Peha fhe dange i infhe femfafionfo
boadcaf you Iife afhe fhanIive if, and fo
bindyou eIf-wofhfo fhe confanf, unfhink-
ing vaIidafionof ofhe. Thaf may be fue, and
if may be a geneaI dange of fhe cuIfue, buf
aguabIy if ha aIway beenfue andeIne juf
make if moe obviou. If aIo aguabIy Ie
fue of heaIfhie fhanof any ofhe fom.
UnIike hofogahing evey meaI andwif-
ing Omnomnom, o invenfing Facebook
udafe abouf fhe hiIaiou fhing you kid
ay, fo fake aneecfive heaIfhie youobviouIy
have fo Iive if. GymeIne-fake ae afaking
of a geneaI cuIfue of naciim, buf af Ieaf
fheyve done omefhing fo eanfhe affenfion.
If nof Thi i me, if Thi i me, and
Iook whaf Ive done. Hee fhe evidence. nd
whiIe nof aII of fhemae fo my fafe - fhee
a whoIe ub-ecie of heaIfhie invoIving
Iycaed-uwomeno fhinif uiing fhaf
fhey evenhowuinfhe mio, anda Iong a
I Iive I hoe I neve ee fhaf difubing combi-
nafionof cameI-foe andfhigh-gaagain- fiII,
fo fhe mof af, if omeone i aying Look af
me!, if a Ieaanf change fhaf fhey acfuaIIy
have omefhing wofhIooking af.
The fufhi fhaf if we ae aII funing info
Kadahian, mof of u ae KhIoe, o if good
fo come aco a Kim.
ndomefime evena Kanye.
l||`\\|1\|J\JJ\J|\\
JJ||||\l|l\\||||
116 September 2014

V|D McGLYNN FIrst Person


M I AN I R IN TH KITHN HN
Iifheredo
his fongue, venomous as a snakebife.
Give me fhe remofe confroI, youass.
Gef inhere, my wife caIIedinfo fhe
Iounge. Now.
Hayden, our nve-year-oIdson, moed
aroundfhe corner, dirfy-bIondanddenanf.
My wife droedfo a knee anduf her
hands onhis shouIders. She was frying hard
nof fo Iaugh. We don`f use fhaf word, she said.
See whaf fhose words do? I said, frying
fo Iay if sfraighf. They make Momcry.
Haydensquinfed. I don`f fhinkshe`s crying.
TeII your brofher you`re sorry, I said.
I`mnof sorry, he said. GaIensucks.
He`s a big, big ass.
My wife uIIedif fogefher. Who faughf
youfhaf word? Her eyes were aimedaf me; if
was more accusafionfhanquesfion.
I'VE LOVED SEAR ORDS SINCE I AS LITTLE.
I can`f say why, excef fhaf fhey`re forbidden.
Thenagain, words have fascinafed me my
enfire Iife. WhenI was a kid, I once marveIIed
over fhe wordshoveI. The more I saidif, fhe
sfranger if feIf. Say fhe shoveI sIowIy andif
sounds Iike a grunf; yeII if andif sounds Iike
aninsuIf - a dig.
Swear words, fhough, are dierenf. They`re
SHlT
Kl0SSY
a ddlnvcdn urac
u wca ana pcd
upc c wnrrcd
wnrda l c
September 2014
: nufrifionaIIy worfhIess and
yef so sweef onfhe Iis.
So maybe my sons Iearnf fo swear fromme.
Buf words don`f sring froma singIe source;
Iike fhe du, fhey`re fransmiffedby doorknobs
andcounferfos. I guessedfhaf anoIder kid
onfhe Iaygroundnrsf assedfhe words fo
GaIen, who infecfedhis IiffIe brofher Hayden,
who sreadfhemaroundhis re-rimary
cIass unfiI fhey reachedhis feacher, who caIIed
us af home.
The nrsf fime Haydenusedfhe f-word,
I friedfo Iaughif o, fhe feacher said.
Buf nowfhe ofher chiIdrenare asking me
fo exIainif.
He usedfhaf wordinschooI? my wife
asked. Her face was furning red. Thanks
for Ieffing us know. We`II fake care of if.
She oinfedaf me. Youfake care of if.
I IedHaydeninfo fhe bafhroomandIiffed
fhe bar of soafromifs fray, bouncing if in
my aImIike a sfone. If youkeesaying nasfy
words, I`mgoing fo have fo washouf your
moufhwifhfhis. Do youfhink if fasfes good?
He sIidhis fhumb info his moufhand
shrugged.
Tasfe if, I said. Give if a Iick, jusf fo see.
Younrsf, he said.
I raised fhe bar fo my nose and gave if a
IiffIe whi. If smeIIedminfy. HowbadcouId
if fasfe? I draggedmy fongue across fhe sIighfIy
riIedarch. If was muchworse fhanI`d
imagined, biffer andobIiferafing. I wraed
my moufharoundfhe faandfurnedfhe
wafer onhigh.
Yucky, I saidfo Hayden, sficking ouf
my fongue. Your furn.
No way, he said. He furned and boIfed
for fhe sfairs. No way, no way, no way!
No more badIanguage! I caIIedaffer him.
AK THE KTHE, Y WFE T WTH
her handacross her forehead. I can`f beIieve
he saidfhaf, she Iamenfed. f schooI.
WeII, I said.
WeII, whaf? she said. nenfire argumenf
fook Iace wifhinfhose fhree words. This
wasn`f fhe nrsf fime a feacher hadcaIIedus.
GaIen`s feachers hadaIso caIIed, andfhey aII
hinfedfhaf his oufbursfs were warning signs
of a behaviouraI disorder - DHD. He was
a young boy, I wouIdcounfer, squirreIIy
andemofionaI.
SfiII, we worried. CaIIing a kidsquirreIIy
was one fhing, buf DHDcarrieda sfigma.
The IabeI, if if sfuck, wouIdmeana Iimif fo
whaf couIdbe execfedof andhoedfor him.
Thaf was fhe reaI robIemwifhfhe
swearing: fhe boys were exosing fhemseIves
fo unfair judgmenf. HowIong unfiI someone
fhey frusfedfoIdfhemfhey were dencienf
or simIy bad? WouIdfhey beIieve if?
A FEW TH AFTE HAYE' TEAHE
caIIed, we were driving fo a wedding ouf of
fown. ffer four hours infhe car, I couIdfeeI
fhe boys becoming resfIess infhe backseaf,
whisering sucks andbaIIs under fheir
breafhs. Insfeadof frying fo sfofhe swearing,
I decidedfo Ief if ouf. See fhaf bridge?
I said. Youcanswear unfiI we`re across.
We cansay anyfhing we wanf?
GaIenasked.
So Iong as we`re onfhe bridge, I said.
If sfos once we`re onfhe ofher side. Gof if?
Infhe rearviewmirror, fhe boys nodded
andgrinned.
Fire af wiII.
GaIenIeanedforwardandshoufed, aImosf
righf inmy ear, Fucking asshoIe!
I swervedhardfowards fhe susension
cabIes, buf managedfo uII fhe car back
fo cenfre. GaIenwas sIaing his knee, his
eyes squeezedfighf.
Does if aIways have fo be fhaf word?
my wife asked.
Shif nufs, Haydensaid.
Buffohmygoddamn, GaIenhowIed.
Sexy, Haydensaid.
Sexy? I said. Our eyes mef infhe mirror.
You`re sexy, Dad. The Iook onhis face said
if wasn`f a comIimenf. This was howfheir
swearing hadbeenaII aIong: comIimenfs
furnedinfo insuIfs, fhe vuIgar sIicedwifhfhe
banaI. Their cursing was anexerimenf infhe
ways Ianguage couIdbe benf andreurosed,
a house fhey were Iearning fo buiId.
I wanfedmy sons fo growinfo menwho
are oIife andkindandwho fhink before fhey
seak, buf who aIso quesfionfhe ruIes fhey`re
execfedfo foIIow. Swear words rise uagainsf
fhe manners fhaf make us comIianf, foo
wiIIing fo accef fhe worIdas if is. Some fhings
inIife are obscene enoughfo warranf rofesf.
ffer aII fhe fime I`dsenf frying fo sfofheir
swearing, I couIdn`f heIfeeIing kindof roud.
WE WEE AT E THE E. U
IiffIe rofanify free-for-aII wouIdendonce
we crossedif, buf I hoedfhe boys wouId
remember fhe momenf as more fhana game.
I wanfedfhemfo knowfhaf fhere was nofhing
fhey couIdn`f say fo me, eseciaIIy as fhey
grewoIder. brokenhearf, a Iosf job, a run-in
wifhfhe cos. No wordor foic wouIdbe
o-Iimifs. I wanfedfo be fhe one fhey faIked
fo, no maffer whaf.
Jusf before we reachedfhe endof fhe
bridge, Haydensqueakedinone more. HoIy
crab cakes! he shoufed. He`ddone his worsf.
The facf fhaf if wasn`f a swear worddidn`f
maffer. I`dgivenhima chance fo seak and
I hadIisfened. fewseconds Iafer we`dreach
fhaf border, a car fuII of oufIaws, moving
forwards fogefher.

J. |!
JJ.
There's a t|me and
p|ace for profan|t.
Here's hen to
fuck|ng go for |t
HIk Pk

U's ee'e Uners|,
|oJno |na| nen oeoo'e
cJrseo, |ne, coJ'o keeo
|ner nanos nnerseo
n er, co'o a|er 'oner
|nan |ne, coJ'o | |ne,
sao sone|nn oenn.
Sn|, |na| nJr|s.
I08kk H8 0k
|os| onen are naoo,
|o |a'k or|, n oeo, sa,s
sex eoJca|or .an,e
\axnan. 'Te'' ner na|
,oJ'reon|ooo|oner,
\axnan sJes|s. BJ|
aoo |orce|J' 'anJae
- ,oJ an| or|,, no|
oaneroJs.
Nk P0kI
'CJrsn accen|Ja|es
eno|on n a,s |na|
soca'', acceo|ao'e
'anJae ooes no|,
sa,s Rooer| SJ||on
o| S|an|oro Uners|,.
'Loaoeo oros |eno
|o carr, nore en|
n soca' s|Ja|ons.
0kk I w08
Searn a| |ne o||ce
se|sann|orna' |one|na|
can ne'o oJ'o co''ea'
raooor| n |ne roJo.
'Tnnk o| cJrse oros
as |ne eroa' eoJa'en|
o| a casJa' a||er-noJrs
oeer, sa,s SJ||on.

k0 w08 08 I0P0 w00
0NI8. wkI I0 IH
0k IHY I I0
118 September 2014
Ife's IttIe essons
YEAROLD, MY BIGGEST CRISIS IN LIFE
a cI da
f e b I a , ade
a WorIdCu-winning kickhadmade
himmy ersonaI saviour. However I became
excessiveIy sfressedfhaf whenI IayedIock
for SoufhAfrica I wouIdn`f gef fhe same
amounf of gIory fhaf, say, a dyhaIf wouId.
ForfunafeIy -for me andfhe resf of Soufh
Africa -if was a robIemfhaf never haened
oufside of my head.
Backfhen, becoming a Sringbokwas
never a maffer of . I fhoughf: Froncois Pien-
oor, AnJre Toubert onJToel Stronsky were oll
once boys wbo ployeJ ruqby. I omoboy wbo
ploys ruqby. 1berefore, its only omotter of time
before I moke it.




BY
|N MNUT V|S
|LLUSTPT|ON
BYPON PPP
SIng
When
You're
LosIng
September 2014
aIe of m non-career ininfernafionaI
rugb is riffenifhindisufabIe numbers.
BackinI996, I hada one inI.4miIIionchance
of making fhe BokXV. Toears Iafer, m
rugb career eaked. I as fhe cafainof m
under-I8BfeamandI hada headsarming
ifhmindIess ofimismdesife aIread Ia-
ing for fhe B-feamaf fhis sfage. Here, af m
afhIefic enifh, I as a I7cmfaII I2-ear-oId.
Toda, I ama I77cmfaII 28-ear-oId. Befeen
fhenandno, everone eIse inIine for fhe
GreenandGoIdhada normaI grofhsurf.
M odds onI gof smaIIer as fhe gof bigger.
Rugb hadaIread beenserving subfIe
hinfs fome over fhe ears, buf onone Safur-
da morning infhe infer of I999, if dishedu
a hearf Iesson. I as subsfifufedb Beong
Ok-Min. Lef me feII ou, fhere`s nofhing quife
as humbIing as fancing ourseIf a fufure
Sringbokandfhengeffing reIacedb fhe
Koreanechange sfudenf. Torubif in, he
scoreda siffer of a fr. If`s nof Iike I ever fried
fousfage himduring his vioIinrecifaIs.

The Iessons didn`f sfofhere, fhough. s a


Sformers suorfer, I reguIarI gef schooIed
onfaIIing shorf of gIor. M feamhasn`f ona
decenf accoIade inSuer Rugb since e on
Weirdesf Jerse inI998.
Suorfing a mediocre feamis a fanfasfic
source of insighf. Life, if furns ouf, isn`f aII
san-dive fries andhaIffime oranges. Some-
fimes if sends ouBeongs of disaoinfmenf
andFIecks of fedium. ndif ouanf fomake
sense of fhis Iife fhing, ouneedfodoas fhe
Romans doandgef cnicaI. Take Seneca, for
eamIe -a RomanhiIosoher hoIivedina
fime heneoIe ere ruIedb oIificians
homade some ver sfuiddecisions. In
ofher ords, he as jusf Iike ouandme.
Seneca saidfhaf one of fhe besf as fobe
sane is fomasfer fhe arf of being essimisfic.
He encouragedeverone fosfarf oeachda
ifha oti, a remedifafion, inhich
ououIdrunfhroughfhe da aheadand
imagine ever singIe disasfer fhaf couIdoccur
-nof because fhe ouIdhaenbuf because
fhe mighf. This is guaranfeedfomake our
coee fasfe beffer, knoing fhaf if couIdhave
scaIdedour Ioins buf chose nof fo. Seneca
aIsosaidfhaf a manmusf saIIoa foadever
morning fobe sure of nof encounfering an-
fhing more disgusfing infhe da ahead, buf I`d
Iike fofhinkfhaf as jusf a mefahor.
These senfimenfs are heIdb severaI hi-
Iosohers, incIuding PIin fhe Younger and
Niefsche fhe MiserabIe BukiII. EvenBud-
dha -for aII his chubb joIIiness -said: Life
is suering. I`dIike fofhinkhe ouIdhave
suorfedfhe Sformers hadhe nof founden-
Iighfenmenf infhe fhcenfur BC, andhe
ouIdhave resignedfofheir minimaIisfic
aroachfoinning andfounda sfrange
sense of encouragemenf inif.

Perhas fhe hiIosohers of esferear ere


more honesf ifhfhemseIves, or mabe back
fhenfhe enfr requiremenf fobecoming a
fhinkerasn`f jusf oningabrain. Noadas
I can`f Iog onfoFacebookifhouf being foIdfo
foIIomdreams andbeIieveinmseIf hiIe
dancing Iike nobod`s afching. Or caring.
The ngurafive foad-gobbIing Seneca saidfhaf
ofimismis fhe source of our anger.
M crisis abouf nof being
aIIoedfokickfor oIes as a
SringbokIock as resoIved
henI discoveredJohnEaIes,
fhe usfraIianIockifha deadI
accurafe boof. Cue mindIess
ofimism. I fhoughf: cii
elveJ; it nl omotte f time
befe I moke it. Buf infrufhas
onI a maffer of fime before I gof
a no-arms shouIder charge
fromcommonsense aIong
ifhsome Korean-imorfed
career counseIIing.
We beIieve e are inconfroI of our desfin,
andifhfhaf beIief comes serious seIf-esfeem
robIems, sas modern-da hiIosoherJrif-
er Iainde Boffon. This is h fhe seIf-heI
secfions inbookshos are geffing faffer fhan
fheir fargef audience. HeII, evenBear GrIIs
rifes seIf-heIbooks no. I knofhis be-
cause I boughf one, fhinking if ouIdbe fuII of
racficaI advice Iike hofosfore urine inraf-
fIesnake carcasses (nafure`s CameIbaks). In-
sfeadif`s incredibI mofivafing. Buf nof ina
gooda. Tooman quofes abouf shoofing for
fhe moonandnof enoughabouf shoofing
eIandifhbIodarfs.
M souI doesn`f needchickensou. If
needs reminders fhaf foda`s forecasf is mun-
dane ifha chance of kakness. Because fhaf
is hoa Iof of Iife canbe. (Jusf askanone ho
has ever beenfoschooI or orkedina cubicIe.)
I didn`f Iearnfhis fhroughquofes onsingIe-
serving sugar sachefs, I Iearnedfhis fhrough
sucking af rugb andsuorfing a feamho
sucks Iess -buf somefimes onI sIighfI -
fhanI did.

M rugb career ma have eakedhenI as


I2, buf fhe sorf confinues foiIIuminafe man
asecfs of Iife for me. Years of being friend-
onedb fhe Suer Rugb froh is a seriaI
seminar onembracing faiIure, accefing
robabiIifies andmasfering fhe arf of
re-orking osf-mafchinferviecIichs.
If`s a reguIar reminder fhaf inan
comefifionfhe odds are againsf everone,
jusf as fhere are sfiII over a miIIionodds
againsf me Iaing for fhe Sringboks.
Our Iifesans aren`f fhe highIighfs onfhe
Suersorf BIif channeI infhe same a fhaf
reIafionshis aren`f aII highnves andheav
effing, andhaving anomce jobisn`f onI
abouf hofocoing bod arfs. Buf ever
noandfhen, fhe sfars aIignandfhe Sform-
ers -m gIorious feamof underachievers -
suddenI sfeamroII a feamifha four-fr
bonus oinf fofhe soundfrackof fhe frenied
sIurring of HughBIaden. Jeande ViIIiers iII
infercef fhe baII andIanf if beneafhfhe
oIes, GioIoniII gIide fhroughfackIers`
grass Iike a scfhe andfhe ros -againsf
aII odds -iII nof knockfhe baII on. ndfhe
greaf Doc CravenIooks donfromfhe Greaf
JanPickardSfandInThe Sk andsmiIes.
These are fhe momenfs fhaf sendme fom
feef, screaming. These are fhe fimes hen
I remember h I Iove fhis game fhaf has
reriffenm ersecfives, skeedm nose
andmade me cr inubIic. ndinfhese
momenfs, fhe aeons fhaf recededfhem
suddenI seemorfhif.
So, raise a (haIf-emf) gIass fofhe oufIi-
ers -fhose eIosions of ecfas fhaf bursf ouf
fromunIikeIihoodandremindouh ou
uf uifheverfhing inbefeen.
Seaking of fhe Sformers, I noficedfhaf
I amfocenfimefres faIIer fhanGioIon.
ndI`mfhree ears ounger fhanhe is. If`s
onI a maffer of fime before I make if.
||||, | J\\ JJ, |\\`
\|| \#\\ J||\ \\J
l\|||1| J\\|\

120 September 2014


therh


6SYWAYS
TOSCREWUP
YOURKl0S
PurcnIingiaumincIicld. vnidIhcacwrnng
mnvcaundynu'rchulIwuyInbcingugrcuI dud

d e ie: d iie hf ef ihf
he de d d fhe ife f def , f if
he id, fhf Pefi, e fd, i
ie fhf Kobayashi Maru fesf in : a no-win
sifuafion fhaf reveaIs your characfer more fhan if
fesfs your infeIIecf or facficaI skiIIs.
YouwiII screwuandyour misfakes wiII aecf your
kids in ways you can`f anficiafe. Buf unIike fhe
simuIafion, which is rigged fo desfroy everyone,
arenfing aIIows do-overs. Nof onIy canyou Iearnfrom
your own misfakes, buf you can aIso Iearn fromfhe
coIIecfive sfu-uery of every dad who`s ever Iived.
September 2014 121

!. . !\ J
\ J J !.J
r|s n kr | |t's
ous on |nt|||gn or
sk|||. Here's the smarter
approach, says Caro| Dweck,
a professor of psycho|ogy at
Stanford Un|vers|ty and the
author of Mndet: The Ne
Pcholog oI Scce


"What can you work on?"
oJr son ooesn'| kno, nae nn
ask |ne coacn. 'None's snon |ne
coacn |na| ne's n|eres|eo n e||n
oe||er, ano ne's recen n|orna|on
aooJ| no|o noroe, sa,s Deck.

.
"You don't have to go to W|ts
or UCT to make a tremendous
contr|but|on."
'Tne oon| o| ner '|e s no| Jners|,,
Deck sa,s. '|'s na| sne ooes 'a|er,
|n |ne kno'eoe ano sk''s sne
ocks Jo n scnoo', a| ork, ano n '|e.


"That's noth|ng. Wa|t'|| you hear
what I messed up today."
Sone kos nae na| Deck ca''s a
|xeo nnose|. 'Tne, |nnk ns|akes
nean |ne,'re no| ooo a| |. Tne,
eno Jo aoon cna''enes. Paren|s
can ne'o |nenJnoers|ano |ne a'Je
o| ns|akes o, snarn |ner on ano
|rann |nenas ke,s |o sJccess.


"N|ce work! What's com|ng up?"
Tne oes| orase |ocJses on orocess,
no| resJ'|s. Sane oes |or |ne ko
no's s|rJ'n. '|'s a'a,s aooJ| |ne
nex| s|eo. ''|'s a a'Je s,s|en,oJ're
connJnca|n, Deck sa,s. 'No|n-
n ,oJ oo no|e''s Js na| ,oJ're
caoao'e o| oon 'a|er, | ,oJ o a| |
|n oasson ano conn|nen|.
CEWU 1
You'reobsessedwIthgettIng
your kIdIntovarsIty.
Peffy crime. Highrafes of anxiefy
andderession. Thaf`s whaf sychoIogy
rofessor Suniya Lufhar execfedfo discover
whenshe sef ouf fo sfudy fhe chiIdrenof
imoverishedfamiIies 2uyears ago. ndshe
foundif. ProbIemwas, she foundevenmore
of if infhe amuenf kids she usedas a confroI
grou. Lufhar has beensfudying fhe high-
achieving osring of high-achieving arenfs
ever since, andeachnewnnding worries her
more fhanfhe Iasf. The kids who have fhe
mosf going for fhemare af fhe highesf risk.
The robIems come whenfhey feeI fhaf fheir
arenfs wiII be disaoinfed, Lufhar says.
Their sense of seIf-worfhgefs fieduinan
inexfricabIe way wifhnof faiIing.
W WAT T T 0 Sure, a fafher shouId
chaIIenge his chiIdrenfo rise fo fheir ofenfiaI.
Buf fhaf`s a smaII sfeaway fromshowing
disarovaI whenfhey don`f exceI. Evena
raisedeyebrowcanconvey if. Somefimes you
don`f evenreaIise you`re doing if, Lufhar says.
Moreover, your disaoinfmenf may be echoed
by feachers, coaches andeers. If a chiIdfeeIs
crificisedandmade fo feeI Iike a faiIure, and
fhis haens ona reguIar basis, fhaf`s a sure
signof danger.
CEWU 2
You'rerudetotheoverworked
pur waItress.
YoucanIecfure aII day abouf manners and
freafing eoIe wifhresecf, buf if your
acfions confradicf your words, your credibiIify
shriveIs. Our kids wafchus andour affifudes,
Lufhar says. I remember one kidsaying,
'Dad`s fone of voice changes whenhe`s faIking
fo somebody af work.` There are many cases
where fhe arenf has a work seIf fhaf`s
dierenf. Kids nofice.
EVE U The kids who say fheir arenfs
vaIue success over decency are fhe ones who
gef infroubIe, Lufhar says. Connecf your
words wifhacfions. Sfofo heIa sfranger.
Showsymafhy for eoIe who are worse off.
ndfreaf eoIe wifhresecf whenyouhave
nofhing fo gain.
CEWU 3
YouthInkyour kId'sthenet essI.
Whenyour sonraninfhaf infercef fry or
scoredfhaf dedecfedgoaI, inyour mindhe
became a rosecf, a fufure ro or af worsf
a rovinciaI-IeveI afhIefe. s arenfs we
become very vuInerabIe whenwe beginfo Iook
af sorfs as some kindof career afhor an
acfivify fhaf has some big ayoaf fhe end,
says Mark Hyman, a Iawyer who`s wriffenfhree
books abouf youfhsorfs. You`re vuInerabIe
fo making some big misfakes. The biggesf
misfake is ushing a chiIdinfo year-round
fraining andcomefifionfor a singIe sorf.
You`re creafing barriers fhaf revenf kids
frombecoming fhe besf afhIefes fhey canbe,
Hymansays. They gef injuredor wanf fo quif
before fhey`re near fheir ofenfiaI.
EGA YU EECTVE Hyman`s fake: foo
offen, sorfs rogrammes exisf fo searafe
arenfs fromfheir money wifhouf concernfor
fhe inferesfs of fhe arficianfs. Remember
fhaf kids Iay fo have fun, fo be wifhfriends
or maybe jusf because fhey Iike fhe kif.
ExcefionaI afhIefes go onfo exceI anyway,
Hymanoinfs ouf. They don`f needfo be
freafedas rofessionaIs fromage seven.
CEWU 4
YouIet your kIdsquIt everythIng.
This is fhe diside of fhe sorfs dad
derangemenf syndrome: ina Finnishsfudy,
kids wifhfhe besf seed, agiIify, anddexferify
didbeffer inmafhs andreading infheir nrsf
fewyears inschooI fhankids who hadn`f
deveIoedfhese skiIIs. Granfed, fhe sfudy
didn`f showcause andeecf. Buf according fo
fhe US Cenfers for Disease ConfroI, schooI-
age kids shouIdexercise af Ieasf anhour a day
doing a variefy of acfivifies. ndfhe merican
cademy of Pediafrics recommends Iimifing
screenfime fo no more fhanfwo hours a day
for kids oIder fhanfwo.
GET A VE Organisedsorfs are sfiII fhe
besf way for kids fo Iay af fuII seed whiIe
deveIoing aII-aroundfifness. Buf kids may
gef fhe message fromarenfs fhaf if fhey`re nof
sfars, fhere`s no reasonfo confinue, Hyman
says. He nofes fhaf fhe eak age for sorfs
arficiafionis II, and7u%of chiIdrenare
finishedby I8. So howdo youencourage fhem
fo sfick wifhif? Go non-comefifive: cycIing
andrunning grous imrove cardiovascuIar
fifness, whiIe marfiaI arfs, yoga anddance
deveIobaIance andcoordinafion. Scoufs sfiII
go hiking andcaming, andyoufhgroucams
are offenoenfo non-members. Or jusf go for
a famiIy waIk or swim.



UP 5
YouIet thempost onlnstagram,
andthenyoustaIkthem.
on`f Iook f soI m s rfI
or o IIn sfIkn nnksInes,
says Professor DanahBoyd, aufhor of Its
omplicoteJ: 1be Sociol Lives of NetworkeJ
1eens. Parenfs don`f reaIise fhaf young eoIe
are using sociaI media as a rimary Iace fo
hang ouf, she says. The kids are frying fo
connecf wifheoIe fhey knowfromschooI,
fromchurch, fromexfra mafhs. True, you
nndcrueIfy youwouIdn`f have seenbefore fhe
Infernef. Buf Iearning fo coe wifhif, Boyd
says, canfeachkids imorfanf skiIIs.
BUlL0 A FOUN0ATlON OF TRUST Howdo you
mainfainfrusf ina wiredhome? Boydrooses
fhe cooI aduIf soIufion. Have anaduIf your
kids are comforfabIe wifh- anaunf, anuncIe,
a coach- connecf wifhfhemonIine. If fhey sIi
oufside boundaries, you`II hear abouf if.
SCREWUP 6
Your marrIagemakestheones
In IookheaIthy.
ondicf af home canhave a Iasfing eecf. In
a Brifishsfudy, brainscans of feens exosed
Fatherhood UpYour Kids
WASTED EFFORT?
Expecting
stardom is
a sure way
to discourage
a childs
efforts.
SctcFitShcp.cc.zaandcIickcn
cooI Women's Heolth gear for your partner and turn up the heat together!
BUlLD5TR0NSERAB5
The perecL Loo| or bu||o|nq ba|ance ano
sLab|||Ly, Lhe Haro Core Ab Whee| |s an abs
ano |ower booy Lra|ner LhaL |eLs you carve
musc|e w|LhouL oo|nq |oaos o
crunches. The easy q||oe whee|
w|Lh aojusLab|e ooL banos |eLs
you work your b|ceps, Lr|ceps,
abs ano back q|v|nq you Lhe
booy you've a|ways wanLeo.
C0REC0NDlTl0NlNS
BoosL your speeo, aq|||Ly ano power w|Lh Lhe sporLsman's
cho|ce. Lhe meo|c|ne ba||. lL a||ows or zero-|mpacL exerc|se,
q|v|nq you a qreaLer ranqe o moL|on. Th|s s|mp|e buL power-
u| Loo| w||| he|p you oene ano cono|L|on your |eqs, chesL,
arms, core ano back wh|ch means beLLer ba|ance, enour-
ance ano cooro|naL|on.

\|
J.J \\\
|\J!| \.

NN anchor and
father of three,
reca||s the |essons
he |earned fromh|s
dad, a former New
York governor



n'e n, |a|ner as
oernor, ' re|ron
a !2-,ear-o'o ko |o a
23-,ear-o'o ao'|. Tne
s'n|es| oance can
'eao |o sccess, ne'o
sa,, so|nere's noreason
|o oe s|ooorn | ,o're
s|ck. no soneone
|n kno'eoe ano
nooe ,o can oene-
|| |ron|. ^no ' co'o
a'a,s |rn |o Poo.



Poo eeo naro ork
as a reorenen|, no|
an ex|ra. Tne on', |ne
,o sno'o oe oon
on ,orse'|, ne'o sa,, s
nen ,o |a' |o o| n
|ne nors |o nake a o|-
|erence. ^no |na| e||or|
sno'o aoo', |o a''
areas o| '|e. `or ork
s ,s| a an|, exercse
| |'s a| |ne cos| o| ,or
|an','s naooness.



o''o,or |, no| a
|ao or a |reno. Tns can
nean oon sone|nn
nooo'ar. Poo nss|eo
|na| nan, s|a|ons nao
no rn| anser - ,o
co'o o e|ner a,, ano
| as o |o ,o. =e'o
's|enano|ee' o| oo|ons
|n ne. B| |ne o-
ance as c'ear: con-
soer a'' cnoces, ano
oo |ne rn| |nn.



Troo'e '' cone, ne'o
sa,. `o '' |a'. `o
'' oe |rea|eo n|ar',.
`o can'| con|ro' |na|,
o| ,o can con|ro'
no,o nano'e |. Poo
o'o oea' |n a se|-
oack, 'oo', or oe|',,
ano |nen ock', se|
aoo| reso'n |ne s|-
a|on. De''n on a
oao oreak ooesn'| ne'o
an,|nn or an,one.

Tns as ns 'esson |or


a '|e|ne: oeoca|e ,or
eneres |o sone|nn
oer |nan ,orse'|.
Poo exo'ans ns re'on
n a sn'e oro: 'oe.
'|one, crea|es oooor-
|n|,, ne sa,s, 'o| a''
|na| na||ers s na| ,o
se | |or. '| ,o nake
'|e aoo| ,or aooe-
||es, ,o '' a'a,s oe
nnr, |or nore.
Iongeddiscordaf young ages showed
reducedgrey maffer infhe cerebeIIum
vermis. This same affernis aIso seenin
afienfs wifhderession, anxiefy, DD,
aufismandevenschizohrenia, says Iead
sfudy aufhor Professor NichoIas WaIsh, a
sychoIogisf af fhe Universify of Easf ngIia.
Thaf doesn`f meanfamiIy furmoiI causes
fhose disorders or fhaf isoIafedsquabbIes
shrink young brains. Buf whena messy
marriage aecfs fhe daiIy dynamics of your
househoId- evenif younever acfuaIIy argue
infronf of fhe kids - if jusf mighf Ieadfo reaI
andIasfing damage.
KEEP HOME A HAVEN Youcan`f shieIdyour kids
fromaII confIicf. nfacf, WaIshsays, kids
who are miIdIy sfressedor chaIIengedwhen
growing uerformbeffer academicaIIy.
Buf whiIe you`re working onyour marriage
robIems, fry fo romofe a famiIy cIimafe
fhaf`s as warmas ossibIe, he says: Kids need
a suorfive, sfimuIafing environmenf in
whichfo deveIofhe heaIfhy habifs andskiIIs
fhey`II needIafer inIife. Whichbrings us
back fo fhis: arenfhoodis sef ufor youfo
faiI. YouwiII, reeafedIy. Buf humanbodies
andbrains are resiIienf. There`s no universaI
arenfing aroachfo anyfhing, says Boyd,
fhe sociaI media exerf. Youhave fo figure
ouf whaf works inyour house. s every
fanknows, jusf because fhe fufure is an
undiscoveredferrifory doesn`f meanif can`f
be beffer fhanfhe one you`re innow.
124 | September 2014
HANGING TOUGH
Since he founded
TRX 10 years ago,
Randy Hetrick has
sold more than
a million of the
training straps.
UU
A
600-
ThcTRXayaIcm'acrcuInrrcvculahnw
hcbuilI umulIi-millinn-Rundcnmpuny
nuI nI... aIrupa. UachiaIipaInIurnynur
nwnbigidcuinInuliIcchungcr
ork

KENS
BY
EP|C SP|TZNGEL
VY SEAL TROOP
der, was deIoyedinsia wifhfhe missiononhoId. The
chaIIenge is mainfaining condifioning whenyouhave noaccess fo
fraining faciIifies, he says. Sohe sfarfedexerimenfing. Digging
fhroughhis backack, he discovereda jujifsubeIf. By fying a knof af
one endandfhrowing if over a door, he couIduse if fodoa variafionof a
singIe-armrow. Buf he wanfedmore versafiIify, sohe foundsome nyIon
webbing usedfor reairing arachufe harnesses andsfifcheda more
eIaborafe fraining sfra. f hada Yshae wifhhandIes fhaf doubIedas
sfirrus. NowefrickcouIddouII-us, curIs, core exercises, Ieg work
-a seemingIy endIess array of moves.
The SEfeamIovedfhe confrafionanddubbedif fhe gizmo.
SfiII, nobody fhoughf fhe gizmo, a frue invenfionof necessify, wouId
be of muchinferesf fociviIians. Now, I7 years Iafer, fhaf gizmois caIIed
TRX(TofaI-Body Resisfance Exercise), andif`s a nfness henomenon.
Buf efrickwasn`f jusf Iucky. is rise fromamafeur invenfor fonfness
enfrereneur roves fhaf a goodidea is onIy haIf fhe baffIe.
2Test andTweak
f af nrsf youdon`f succeed...
weII, you`reIikeeveryoneeIse.
Hefrickfweakedhis design
af Ieasf 6ufimes. His SEL
buddies andsome eIife afh-
Iefes ifchedin. Nomaffer
howsmarf youfhinkyouare,
youneedriver guides foheI
younavigafe fhe raids, he
says. Hefrick`s nrsf 49fries
weren`f misfakes. We fend
fosee success as goodand
faiIure as bad, says sychoI-
ogisf Professor BiII Craw-
ford. Buf faiIure canrovide
goodinformafionabouf whaf
doesn`f work.
10IveIn0eep
ffer Ieaving fhe miIifary
in2uuI, HefrickenroIIedin
businessschooI af CaIifornia`s
SfanfordUniversify. He was
8andmarried, wifha baby
onfhe way. I anchoredfhe
boffomof fhenrsf 2uexams,
he says. Buf he reaIisedfhe
gizmomighf be a means fo
uII himseIf u. He unveiIed
if incIass andbroughf his
rofofye fofhe universify`s
sorfsfrainingcenfre. Preffy
soon, guysaskedfofryif.The
keys: beIieving inhis roducf
andgeffing if infofhe hands
of his fargef user.
5HoneYour Message
Sure, susensionfraining
has beenaroundfor a Iong
fime, says FabioComana,
anexercise hysioIogisf wifh
fhe NafionaI cademyof
Sorfs Medicine. Whaf sef
TRXaarf was ifs sIogan:
Make Your BodyYour
Machine. Hefrickmarkefed
if as agyminyour backack,
as handyfor workoufs as fhe
iPodis for music. PorfabiIify
andconvenience inexercise
is booming, says Comana.
TRXsafisnedfhecusfomers`
needs -erhas evenfheir
unrecognisedneeds.
6KeeplnnovatIng
TodayTRXhasIIuemIoyees
andannuaI revenues of over
Ruu-miIIion. Buf Hefrick
knows TRXneeds fokee
evoIving. Everyfewyears
we`II come ouf wifhanofher
frueinnovafion, hesays. The
Iafesf, fhe TRXRiTrainer,
is a bar joinedfoa resisfance
cordfhaf`s eseciaIIygood
for high-seed, Iow-Ioadrofa-
fionaI frainingandcorework.
If`s fooearIyfosayif fhe new
fooI wiII be a hif, buf Hefrick
nofesfhafif`sonasignincanfIy
fasfer growfhfrackfhanhis
originaI gizmowas.
4CreateaMovement
Soonaffer earning his MB
in2uu8, HefrickIaunched
Fifness nywhere inSan
Francisco. I neffeda grand
or soa monfh, buf if seemed
Iike a forfune. He kef af if,
seIIing fhe TRXnrsf foro
afhIefes andfrainers and
fhenfogyms. EvenfuaIIyhe
branchedouf, bundIing fhe
TRXwifhworkouf DVDs
andcreafing a cerfincafion
for TRXinsfrucfors. The
movemenf gainedmomenfum
as eoIe beganfodesign
andshare fheir ownTRX
exercises andcircuifs.
3FIndShortcuts
Hefrickmade his TRXrofo-
fyes wifha R4uusewing
machine. Bufhegainedground
onhis comefifors, whohad
sIeeker equimenf buf were
Iess versafiIe. Manycreafive
eoIe sendfhousands
onrofofyes, says Bob
DeMaffeis, aufhor of m
Potent toProft. Buf big inno-
vafions don`f aIways haen
inbig Iabs. DeMaffeis heIed
invenf fhe seIf-oening sho-
ingbagwifhaR4uinvesfmenf:
acraffknife, Iywoodandcoaf
hangers. If`s a RI-biIIion
business foday.
.
s |\\JJ
ndy Hetr|ck, an
a|umnus of two of
the wor|d's most
exc|us|ve tra|n|ng
|nst|tut|ons, shares
a few|essons |n ||fe
and |eadersh|p

n ,o'
,o 'n o o ,
onn', ''nn
,o' o
n n n
kn nno ,
o no

o non n
o' B'n
n non
onn ,o o
n 'k ''

, ^'
nn 'o
n Sk'on
n, o'n
n nok o '
nn o ,

, '
on o
'n' n on
o n o
n o 'n
n n

o' ',
non n
n ,o n ,o , o
n, on'nn,
k'' nn
o' n 'o
nn o


nn
o n
'' B
non no no
n n 'n
'n S^ n

blcInrhnwmuchynucuI.
Ncwacicncc: ynurIublcmuIca-rcul nrnnuTVacrccn-pluy
ubigrnlcinwhcIhcrynupuckinnuIricnIanrpucknnkilna

TOGPPHS
JOYCE LEE
BY
MP| MSTEPS
YOU'RE INVITED TO EAT LUNCH IN A ROOM
af ersonhas been
foIdby researchers whaf andhowmuchfo eaf,
buf youdon`f knowfhis. f fhe endof fhe meaI,
you`re askedfhis quesfion: Why didyouchoose
fo eaf as muchas youdid? If your answer is
I afe whaf I wanfedfo or I afe unfiI I feIf fuII,
fhenyou`re nof as infuifive as youfhink youare.
Our sfudy arficianfs assume fhaf fhey eaf
ouf of free wiII, says Professor arah-Jeanne
aIvy, a researchassociafe rofessor af fhe Uni-
versify of oufhernCaIifornia. They don`f reaIise
fhey`re induencedby whaf ofher eoIe eaf.
Ofher sociaI, environmenfaI andsociefaI cues
aIso rodyoufo eaf more. Parf of fhe reason
you`re suscefibIe, exIains aIvy, is fhaf youcan
conformsociaIIy andconvey your seIf-image
fhroughyour eafing habifs. This Iays ouf sub-
consciousIy 24J7 andcaninduence aImosf every
fooddecisionyoumake. Whenyou`reonaufoi-
Iof andeaf mindIessIy, if`s dangerous, says Brian
Wansink, a rofessor af CorneII Universify
who researches weighf Ioss. Here`s how
fo mainfainconfroI af every meaI.
September 2014


ur yu`r yur wnn w
nr n sns usf nf
run yur fs rsr
susfs ff uys nnsu
sf 2ur us
wnfy f wfssx
rns fnwnfy n s
f`s uf wf frs r n
sys vy yur rws fn
s n urrs ns r
yu` f s uys s
fn f ffv vnwf
s Nobody wanfs fo be fhe
sIowone infhe grou, so youfry
fo keeu, says sorfs nufri-
fionisf Professor Chris Mohr.
Before fhe waifer even
aears, menfionfhaf youwanf
fhe griIIedchickensaIad. Some
friends may fease you; ofhers
wiII consider emuIafing you.
Making ubIic your decision
foeaf heaIfhy is fhe nrsf sfefo
changing your behaviour and
erhas fhaf of fhe guys around
you, SaIvy says. Insfeadof eafing
mindIessIy, you`re heIing your
comanions fosfoandfhink
before ordering nve Iafes
of hof chis or a buckefIoad
of meafy izzas.


Resisf fhe rimaI urge foorder
fhe 7uug sfeak. sfudy fromIn-
diana Universify of PennsyIvania
foundfhaf menwhodinedwifh
womenurchasedanaverage of
4774kiIojouIes` worfhof food,
versus 876kiIojouIes whenfhey
afe wifhguys. Menmay be fry-
ing forove fheir mascuIinify
aroundwomenby buying more
kiIojouIes, says sfudyaufhor
Professor Marci D. Coffingham.
Order wifhyour brain,
nof your fesfosferone. f Primi
Piaffi, fhe fuII orfionPanceffa
Pasfa cIocks inaf u98kJ, whiIe
fhe Iife orfionCescoPasfa wifh
InsaIafa di Casa combinedare
onIy 8798kJ. Try sharing a main
course wifhyour dafe andadding
a saIad. There`s somefhing sen-
suaI abouf sharing food, says Dr
DawnJacksonBIafner, aufhor of
e FlexioionDie. ndif never
hurfs fogoromanfic: eoIe who
eaf inresfauranfs fhaf have dim
Iighfs andsoff music consume
fewer kiIojouIes fhanfhose eaf-
ing infhe brighf gIare fyicaI of
many franchises, according foa
sfudy inPycboloqicol Bepo.


Eafing whiIe wafching feIIy can
be evenmore eriIous for your
beIIy fhaneafing af fhe bar wifh
your buds. One sfudy from
UMass mhersf foundfhaf
chowing downinfronf of fhe TV
canbumuyour infake of high-
kiIojouIe fare by as muchas 7I%.
Evenworse: Your brainsubcon-
sciousIy associafes foodwifh
screenfime, soyoufrainyourseIf
focravekiIojouIes whenyousif on
fhe couch, says BIafner. Soon
you`II nndyourseIf scarnng
ouf of habif, nof hunger.
Firsf, furnofhose
disfracfions. Thensavour your
food; fhis imroves safiefy, Mohr
says. ndaIways difchfhe fo-go
confainers infavour of reaI
Iafes. CorneII researchers found
fhaf aer Iafes andIasfic cus
make eoIe feeI as if fhey`re
eafing snacks, sofhey may be
more IikeIy fohave a reaI meaI
Iafer. If youmusf snackinfronf
of a screen, eaf isfachios.
Breaking oenfhe sheIIs sIows
youdownandIeaves a visuaI
reminder of howmuchyou`ve
aIready eafen, Mohr says.

,Js| |o nea's a eek n |ron| o| |ne T\, ano,oJ na, oack on 4.5kn
a ,ear. Tne reason: |ne T\'s oresence can oJ'k Jo,oJr k'o,oJ'e n|ake |oJr|o'o.
Tne e||ec| aoo'es |o o|ner screens |oo, 'ke conoJ|ers, sa,s Dr Dan .ackson
B'a|ner. ''| ,oJ're os|rac|eon'e ea|n, ,oJr as|'ne s a| rsk.
J.



ba|| |nto be||y fat fast
SoJrces: Physio|ogy & Behavior Physio|ogy & Behavior


1z'1

: :'1

z 1cz'1

1 :'1
|| !I
September 2014
UNHAPPY ENDING
Resist the
temptation to
impress your
sweetie pie
with your huge
appetite.

on nor aar o nnor
o oo an rnk con o nak
r a o can ocon nor
'an aoo or oo coc

S'ooon: | ,oJ oo'sn o|| ,oJr oas|a
oJck', (n nne nnJ|es, sa,,, ,oJ''' ea|
nore |nan oeoo'e no are onn a|
a nore re'axeo oace (22 nnJ|es,.

\nen ,oJ ea| oJ| o| a 'arer con|aner,
,oJ're 'ke', |o consJne nore, een |
|ne ac|Ja' anoJn| o| |ooo s |ne sane
n oo|n con|aners.
ano Behavior Journa| of the caoemy of Nutrition ano Dietetics ppetite


D|| '| JN'

: :e?'1

e1c'1

zz D|| '| JN'

: :'1

1c'1


ein hme den eem h
dne: e ckin nd
ein, ein he be nd
in effovers. Buf none of fhaf
heIs if youcaneasiIy reachfor
seconds. CorneII Universify
sfudy foundfhaf menwhouf
serving bowIs ona side counfer
consumedufo86%Iess fhan
fhose whouf fhe foodonfhe
fabIe, wifhineasy reach. The
Iess eorf we exend, fhe Iess
we keefrackof our eafing.
Leave fhe famiIy-sfyIe
asfa andchickenIaffers infhe
kifchen; bringing fhemfofhe
fabIe makes secondandfhird
heIings fooeasy, says BIafner.
Iso, make a acf wifhyourseIf fo
eaf onIy whaf`s onyour ownIafe.
nofher words, keeyour hands
oyour kids` andwife`s Iafes.
FinaIIy, fry foorchesfrafe meaIs
sofhe heaIfhiesf ifems are served
nrsf. Yes, sfarfing wifhsaIadis
aIways smarf. na sfudy fromfhe
Universify of Leeds, EngIand,
diefers whobegana meaI wifh
a saIadconsumedabouf 2u%
fewer kiIojouIes fhanfhose
whobeganwifhgarIic bread.


Youcanseakyour mindaround
your buddies, buf some sifuafions
require more subfIefy. nfacf,
eafing heaIfhy canbe sociaIIy
awkward. na sfudy fromfhe
Universify of Scranfon, arfici-
anfs were askedforafe charac-
ferisfics of eoIe whoafe eifher
a ie or oafs for breakfasf. The ie
eafers were erceivedas more hu-
morous andIess boring. Show-
ing more seIf-confroI fhanofhers
-evenif if`s jusf making heaIfhy
foodchoices -canincrease fhe
chances of a reIafionshicon-
dicf, says Profesor JuIie ExIine,
a sychoIogy researcher af Case
WesfernReserve Universify.
PeoIe Ieasers needfo
be eseciaIIy aware, says ExIine.
Youmay goouf of your way foeaf
more fhanyounormaIIy wouIdin
order fomake ofhers feeI com-
forfabIe. Try fhis baif-and-
swifchfacfic: comIimenf fhe
foodandfaIkabouf howgreaf
everyfhing Iooks whiIenIIing
your Iafe wifhheaIfhy ofions,
Iike roduce androfein. f wiII
seemmore Iike you`re induIging
andnof counfing kiIojouIes.

\nen ,oJ snack |n a oJoo,, ,oJ're
'ke', |o consJne nore oscJ|s ano
crackers |nan ,oJ oJ'o | ,oJ ea|
|n a ronan|c oar|ner.
SoJrces: ppetite


J||'

11 J||'

Who's MakingYouFaI?
P
R
O
P
S
T
Y
L
I
N

P
l
N
O
|
S
E
N
I
L
L
U
S
T
R

T
I
O
N
S
+
l
S
M
N
E
W
Continuous 12hr treatment
Steady ow of pain re|ief a|| day
Stops pain and treats inammation
Ava||ab|e |n 5's and 10's
VoItaren Patch. Each plaster contains diclofenac epolamine equivalent to diclofenac 0,130g.
Reg. no.: 33/3.1/0091. For further information contact Novartis Consumer Health.
AppIicant: Novartis South Africa (Ptyj Ltd, Company Reg. No. 1946/020671/07. 72 Steel Road,
Spartan, Kempton Park. Marketed by: Novartis Consumer Health S.A., a division of Novartis
South Africa (Ptyj Ltd. Customer call centre: 0861 929 929.
07/2014/vOT/089

EVENTS&PROMOT!ONS
Checkout NP.C0.ZAforthelatest event updates
7PAN5F0PN
Y0UP5LF!
Testosteroneisthemost crucial
hormoneinthemalebody-andevery
man'sTlevelsdeclinewithage. The
result?Lossof muscle, sexdriveanda
slowermetabolism. TesIosIerone
TronsformoIionhelpsreversethis
downwardspiral withspecificdiet and
exerciseplanstoget youintoshape!
LoqonIofiIshop.co.zofor more informoIion

C7CL0'INC!
Afavouriteamongst actorsandmodels, the
WhiteGlorangeof teethwhitening
productsisavailableat Clickstohelp
youget that Hollywoodsmile.
Unlikeotherteeth
whiteningsystems,
WhiteGloproducts
formpart of your
everydayoral care
routine, thusprovidinggentlewhiteningwhileremovingplaque.
HO September 2014

pIes


M
LESSTEXT,
MORESEX
DI I yuraurI
IuryuIuuurIr
TaauaI
aIruIa yur
ruIarcuII
M FAE, MEHA, A SE O HEA O EAH OHE ALL HE ME WHE WE WEE



8and84can`fgoongerfhananhorwifhofcheckingfheir
hones. ndinmanycasesfhey`resneakingfhafeekwhiefhey`rewifhofhereoe,
accordingfoa2uI2srveybymobiedevicesecrifycomanyLookof.
MeghanandIwerearfoffherobem.
I`dcheckinfoorfavorifebaronorsqareandseUnfadforafefhebeerIboghf-
a beforesidinginfoaboofhfofakwifhher. Shedidn`fcare. Shewasfoobsyonacebook
orfweefingfoherIuuufoowers.
Ifwenfonikefhisforawhie. Thenonenighf, whiewewereonhoiday, Meghanfried
overasfewhieSMSingandinjredherknee. Ihadforesisffhergefofweefwhaf
haenedbeforeheingher. Thaf`swhenwereaisedwemighfhavearobem.
Sowegaveorsevesachaenge: codwe, asacoe, nfefherorsevesfromor
honesforamonfh?Nocheckingfheminfheresenceofeachofher. Nosingfhemfocom-
mnicafewifheachofherinfhesamebiding. Rbbingherknee, Meghanagreed.
IconfacfedProfessorKafherineHerfein, whoresearchessexaifyandfechnoogyaffhe
September 2014 131

k0
s , J
| s J x s,s.
' ,J s r
,J s || s's ,
|, || s
,J s s,s.
,J | r |
r| r sJ
, r |s
|'s ,Js| ||
r | ||r.
8I08Y080 Y008 I8|P8
'Js | sJss J|Jr
s ||r J| |, |J
r, r| s |s x
s,s. ,J
,Jr x| , r|
|rs| r r
| | s
s J| | ,J' |
| |r. '|' x|
| s|r| ,Jr
|| x s,s.
8kP0HI H8
s r ,
|Jr. |
, |Jr., ,J'r
r| |rs | |x|
sss r sr s|
Js |s s,s
sr rssr ss x
|| rs|,. '^
|, s || ,J'r |
J| r. sr|
s r | x s,s.
\ |JJ !.\
!. \J
ot a|| techno|ogy
d|srupts re|at|on-
sh|ps. Try these
tact|cs to ga|n a
stronger connect|on
B 1
ouarryIt vrywhr
Hswu ouswo
ovswysf
osvfyofus
fofssfy
offx
owqufyfosov
2u2Bfssfuyou The
couIesaIsosaidfhehones
diminishedcIosenessandfrusf.
Onereasonmaybefhaffhese
devicesacfIikemegahonesfo
broaderconversafionaI audiences.
FigurafiveIy, we`reneveraIone.
fhome, MeghanandIchanged
bysfashingourhonesinanadja-
cenfroomandonIyansweringcaIIs.
Overfime, ifhadacuriouseecf: we
madeeyeconfacfmoreoffenand
acfuaIIyIisfened. Conversafions
weredeeer, Iessscaffered. IfreaIIy
wasfhafsimIe. IfyousfruggIe
wifhcomuIsion, uffhehone
oufofsighf,HerfIeinsays.
Obvious, righf?Bufdoyoudoif?
B 2
out oouch
Tryfhisquickfesf: uIIuyourcaII
IogfonndouffheIasffimeyou
honedyourarfner. Thencounf
fheSMSes, BBMsorWhafs
messagesyou`vesenfhersincefhaf
caII. Now, howmanydidyou
misfyeordidshemisread?
Becauseoffheabbreviafed
nafureofSMSes, couIesoffenmis-
inferrefwhafisn`fsenfrafherfhan
whafis,HerfIeinsays. shorffexf
cancomeoascurf. deIayedone
cansefoaworryaIarm. Tryfhis
soIufion: whenyoufwoareindier-
enfIocafionsbufneedforesoIve
somefhing-Iansforfheweekend,
anucomingfri, fhafIiffIesafyou
hadIasfnighf-don`fdoifviaSMS.
Insfead, wrifeheranemaiI. Com-
osinganemaiIrequiresyoufosIow
downandseIf-edif, whichcanheI
eIiminafeconfusion,HerfIeinsays.
IfaIsoencouragesbofhofyoufo
workfowardsasoIufionbecause
fhemediumismorecoIIaborafive
fhanfexfing, shesays. SfiIIjuming
foconcIusions?Thenif`sfimefo
ickufhehoneorscheduIeafaIk.
B 4
ouInIt omfortIng
MeghanoffenIooksfoherhonein
fimesoffrusfrafionorworry. She
susendedourchaIIengejusfonce
-afferrunningamarafhon. Iwanf
fofeII eoIehowIdid. I`minain.
ScrewfheruIes,shesaid. swe
drovehome, shecheckedfhe
weafherduringaforrenfiaI down-
our. Shewanfedfomakesure
weweren`fdrivinginfoaheavy
sform, bufgivenfhafwewere
bareIymoving, ifwouIdn`fhave
mademuchofadierence.
PeoIefhinkfhafbychecking
fheirhonesfheycangainconfroI
overacomromisedsifuafion,
HerfIeinsays. Whaf`sreaIIy
haening, shesays, isanaffemf
fonndsychoIogicaI comforfina
scenariofhaf`shysicaIIydimcuIf
foconfroI. Byfurninginward,
weavoidwhaf`soufside.
Onfhewayfofhemarafhon,
somefhingjusfasharrowingasfhe
B 3
ou'rooonnct
IfoIIowMeghanonTwiffer, and
I`vesomefimeshadfofeign
surrisewhenshefeIIsmefhings
aboufherdayfhafI`veseenonIine.
ThefweefssoiI fhesafisfacfion
IfeeI fromhearingagoodsfory.
ReadingherfweefsorfexfingIove
nofesfoherisnne,bufcommunica-
fionisneverassfrongaswhenifha-
ensface-fo-face,saysHerfIein.I
wasskeficaI,bufafferseIf-imosing
abIockonMeghan`sfweefs,Ifound
B 5
ouosrackof Im
SomefimesIcan`ffeII whefher
Meghanjusffookanaorjusfused
herhone. She`II comenndme,
bIeary-eyed, andask, HasifreaIIy
beenI6minufes?CaII iffhesmarf-
honefimewar: whafsfarfsasa
quickcheckofFacebookfurns
infobigchunksofmissingfime.
Howdoesfhishaen?
Becausesmarfhonefasksare
soquick-aminufeonTwifferhere,
a8u-secondfexffhere-yourbrain
doesn`fregisferfhemasfime
senf,HerfIeinsays. Thesemicro-
accomIishmenfsinfensifyfhe
urgefocheckyoursmarfhone.
ndyouneverknowwhafyou
mighfmiss. DuringourIiffIeexeri-
menf, MeghanandIaffendedawed-
ding. PeoIewereinfriguedbyour
rojecf-unfiIfhebridemenfioned
fhaffheweddinghadahashfag. s
everyonerefurnedfofheirhones,
wesaid, TheheIIwifhif.Wegof
drinksaffhebar, madefacesinfhe
hofoboofh, requesfedsongs. Lafer,
someofourfabIemafesweresfiII
busycomosingudafes. WhiIewe
wereIiving, Ifhoughf, fheywere
Iivinginfheirhones. Ifhadfhe
ringofagoodfweef. Bufinsfeadof
reachingformyhone, Igrabbed
Meghan`shand. Wewereneeded
onfhedancedoor.
sformoccurred: onfhehighway, a
cardewasfmeinfherighfIane
jusfasIwasfryingfomoveinfoif.
Ididn`fseeif, bufMeghandid.
Whoa!shesaid-andInarrowIy
missedhavinganaccidenf. quief
minufeassed. IfI`dbeenIooking
afmyhone,shesaid, wecouId
havebofhbeendead.
myseIfaskingbefferquesfionsand
enjoyingherfaIesevenmore.
Thisfendencyfocheckinonyour
arfnermaysfemfromahighIy
comIeximuIse. Somefimeswe
missourarfnerandjusfwanfa
connecfionwifhoufnecessariIy
communicafingwifhhimorher,
saysProfessorJesseFox, an
assisfanfrofessorafOhioSfafe
Universifywhosfudiesromanfic
affachmenfandsociaImedia. Buf
foIIowingMeghansocIoseIyIeffme
unfuInIIed. Infacf, Ifoundfhafread-
ingherfweefscameaffheexense
ofgreaferinfimacyIaferon. IfI
wanfedfofeeIsafisned, I`dneedfo
waifforfheversionofherdayfhaf
exceededI4ucharacfers.
UniversifyofNevada, LasVegas.
HerfIeinisfheco-aufhorof
ulnmlynly
rmwrk IntmtBelotionsbips
inoDiqitol Aqe, abookfhafheIs
marriagefheraisfsdeaI wifh
fech-reIafedrobIems.
SmarfhonecomuIsionisa
Iearnedbehaviourandfhemore
youreinforcefhafbehaviour, fhe
moreIikeIyifisfobecomean
obsession,HerfIeinsays. The
goodnewsisfhafreversingfhe
comuIsionisaIsoaIearned
behaviour. If`saboufusingfhe
smarfhoneinasmarfway.
Sosfarfbyhanginguonfhese
nvebIunders. Youmighfjusfnnd
yourreIafionshifuIIyrecharged.
.. September 2014

M McGPTH

nn'cmpvicnmincnmccvcn
mncimmcivc icnicinninlly
ncnnnvcil cinn: dncavirIuul
vinlcnccIurnanmcbnyainInrcul killcra?


Smull-acrccnvinlcnccmuyaIill huvcubigcIIccI nnynurbruin.
noone e e ee e 'e on nen eek o o'n ooe
ne o 'ookn 'ke, e'', eek. e oo'en oon no oon on
o nonn n oe n nke o noe ee no 'e enoe
ok, e o'o, ooeo o oo'o e Uners|, o| |s-
soJr. 'n |ac|, |ne eas, accesso'|, o| |nese anes na, caJse |nen|o oe nore
oroo'ena|c |nan |ner o-screen ore|nren. ''| ,oJ nae |ne ane n ,oJr oocke|
ano can o'a, a'' |ne |ne, |nere na, oe no oooor|Jn|, |or |nose e||ec|s |o onn-
sn, sa,s Bar|no'o. =s aoce: 'n| ,oJrse'| |o an noJr a oa,. L|L BTT|S

, as I enfer fhe buiIding fhroughfhe
oendoorway, my body fenses and my eyes
scanfhe roomas quickIy as ossibIe. Is fhere
danger inhere? I move forwards fenfafiveIy,
my senses heighfenedinanficiafion.
SuddenIy I see a ngure infhe shadows. My
nnger moves insfanfIy, fwifching for whaf
seems Iike dozens of fimes as fhe rot-o-tot-tot
exIodes aroundmy ears. I see a body sIum.
If`s fhe one I`ve beenaiming af andI feeI a
surge of safisfacfioninmy chesf.
If`s a Safurday affernoon, andfhough
hysicaIIy I`merchedona chair inmy Iounge
wifha smoofhIasfic Wii confroIIer inmy
handanda chunky I6-year-oIdTVonfhe fabIe
infronf of me, menfaIIy I`minfhe war-forn
sfreefs of whafever unidenfinedcify is fhe
seffing for Co Duty Mrn Vorfore 8.
I`ve beenIaying fhe game for fhe Iasf 46 min-
ufes, andfhoughmy skiII IeveI is reffy Iame -
I seemfo be kiIIedaImosf as offenas I kiII -
inmany ways I feeI Iosf infhis ofher worId.
I Iay for abouf Iumore minufes, bIowing
away a fewmore bad guys, unfiI I`mbIown
away myseIf (again) and decide I`ve had
enough. Because I`maf home andnof ina Iab
somewhere hardwiredfo aII sorfs of monifors,
if`s dimcuIf fo say for sure whaf`s haening
fo me hysioIogicaIIy. Buf if`s a safe bef fhaf my
hearf rafe andbIoodressure are bofheIevafed
andsfress hormones are coursing fhroughmy
body. I feeI a IiffIe onedge. Which, as I waIk
fo fhe kifchen, makes me wonder: wouIdyou
reolly wanf fo be my wife, my kids - evenmy
dog - righf now?

beenengagedina massive andunrecedenfed
sociaI exerimenf: whaf haens whenmiIIions
of eoIe - mosf of fhemboys andyoung men
- are aIIowedfo refend, infhe mosf vividway
ossibIe andoffenfor hours onend, fhaf fhey`re
rofessionaI kiIIers? Does fhe exerience
increase fhe odds fhaf fhey`II someday furn
info kiIIers fhemseIves? Does if shae fheir
ersonaIifies inofher ways? Or is if aII simIy
forgoffeninfhe hours affer fhe game ends?
The anecdofaI evidence isn`f reassuring, af
Ieasf inIighf of fhe infernafionaI headIines of
mass shoofings andfhe number of fhose shoof-
ers who`ve hadsfrong connecfions fo vioIenf
video games. CoIumbine`s Eric Harris and
DyIanKIeboId, for examIe, were serious fans
of fhe scinhorror game Doom. James HoImes,
who oenednre ina movie fheafre inCoIorado,
kiIIingI2eoIeandinjuring68ofhers, aIIegedIy
foIdone ersonfhaf during fhe shoofing he feIf
Iike he was ina video game. ndIafe Iasf year
if was reveaIed, inMaffhewLysiak`s book
Newtown: An Americon 1roqeJy, fhaf dam
Lanza, fhe 2u-year-oIdbehindfhe Sandy Hook
EIemenfary fragedy, hadIoggedmore fhan6uu
hours Iaying fhe nrsf-ersonshoofer game
Combot Arms, during whichhe recorded a sfag-
gering 8849kiIIs (incIuding nearIy 28uuu
headshofs). ndyef scienfinc evidence abouf
fhe eecfs of vioIenf video games is muddIed.
Onone side is a grouof researchers, backed
by dozens of sfudies, who are convincedfhaf
our mass infafuafionwifhsuchfifIes as VorlJ
of Vorcroft andGronJ 1beft Auto is a ubIic
heaIfhfhreaf andfhaf suchgames are making
us moreaggressiveandIess sensifivefovioIence.
Whaf`s more, fhese exerfs cIaim, fhe fhreaf
is arficuIarIy sfrong for men: guys buy fhe
majorify of games, andaccording fo a Harris
Inferacfive survey, young menare abouf 2.6
fimes as IikeIy as young womenare fo describe
fhemseIves as addicfed fo Iaying.
We can`f say whefher fhe games Ieadfo
vioIenf criminaI behaviour. Buf we knowfhey
Ieadfoaggressive behaviour andfhinking, says
BradBushman, a rofessor of communicafion
andsychoIogy af Ohio Sfafe Universify who
has senf fhe asf 26years Iooking af fhe eecfs
of vioIence inmedia. Bushmanco-aufhored
erhas fhe mosf ersuasive aer onfhe foic,
a 2uIumefa-anaIysis fhaf Iookedaf more fhan
Iuurevious sfudies. The aer`s concIusion:
Iaying vioIenf video games ranks aIongside
subsfance use, overfy andabusive arenfs as a
riskfacfor for bofhshorf-fermaggressionandfhe
deveIomenf of aggression-rone individuaIs.
Onfhe oosife side of fhe argumenf is
anofher confingenf of researchers who
essenfiaIIy beIieve fhaf aII of fhe above is
BS. They counfer fhaf muchof fhe research
indicfing videogames is dawedandfhaf fheir
ownsfudies generaIIy showno iII eecfs from
Iaying. Indeed, fhey see fhe hand-wringing
as cIassic moraI anic - eoIe fearing and
3 September 2014
SpecaI Report / WhenKillingis a Game








$98-biIIionworIdwide,
has surassedfhe gIobaI nImindusfry. Given
fhaf four of fhe nve besf-seIIing games of Iasf
year were vioIenf shoofer fifIes, soffware de-
veIoers andevengame-sysfemmanufacfurers
may fake a hif if vioIenf games are foundguiIfy.
More imorfanf, fhe ouIarify of fhese
games may meanfhaf nof onIy are more
damLanzas ouf fhere buf newones are
being frainedevery year.

2uu9, Lanza was a skinny, sociaIIy awkward
I7-year-oIdwho`dbeendiagnosedwifhserger`s
syndrome, a formof aufismdisorder. Or af Ieasf
fhaf`s who he was inreaI Iife. Infhe game, on-
screen, he was abIe fo creafe a dierenf version
of himseIf: a muscIe-boundsoIdier wearing
fafigues, goggIes anda bIack beref andcarrying
amiIifaryassauIf ride. InLanza`s chosenmission
in , Iayers were fo rack ua
cerfainnumber of kiIIs as quickIy as ossibIe -
evenif if meanf furning fhe ride onfhemseIves
andcommiffing suicide - andLanza became
obsessedwifhif. By 2uII, he hadmovedon
from fo ofher vioIenf games,
suchas and MoJern
Vorfore , where againfhe goaI was fo faIIy as
many kiIIs as ossibIe.
HadLanza beenbornjusf a generafionear-
Iier, sucha vioIenf oufIef wouIdhave beenhard
fo come by eveninfhe worIdof video games. In
fhe earIy days, of course, Poc-Mon andDonkey
Konq dominafed, andinrefrosecf fhese games
seemnof jusf benignbuf aImosf sweef. Thaf
beganfo change infhe I99us wifhfhe deveIo-
menf of a newgenre: fhe nrsf-ersonshoofer.
TifIes Iike Volfensein D, Doomand severaI
ofhers aIIowedIayers foseefheworIdnof from
anobjecfive oufside ersecfive buf fromfhe
oinf of viewof fhe ersondoing fhe shoofing.
s fhe fechnoIogy andgrahics imroved
dramaficaIIy infhe foIIowing decade, nrsf-er-
sonshoofers exIodedinouIarify. Ina Iof
of ways, if`s fhe easiesf fhing fo do, says game
wrifer anddesigner WaIf WiIIiams whenasked
why vioIence is af fhe hearf of so many games.
Imosf aII video games oerafe onfhe same
rinciIe: giving Iayers obsfacIes fo overcome,
ixeIs fhaf needfo be cIickedonandmade fo
go away. Creafing fhose obsfacIes infhe form
of eoIe - andmaking fhemdisaear wifh
virfuaI buIIefs - is one of fhe simIesf soIufions
game creafors have.
Buf WiIIiams beIieves fhaf fhe affracfionof
nrsf-ersonshoofer games runs deeer. I fhink
if`s connecfedfo a ower fanfasy, he says.
You`re uf ina sifuafionfhaf reinforces fhe
ower being inyour hands. Thaf`s aeaIing.
So howdoes your body reacf whenfhaf ower
fakes fhe formof shoofing anonscreenrere-
senfafionof a humanbeing who mighf shoof
younrsf if youdon`f acf quickIy enough?
Numerous sfudies have shownanufick
inaII fhe measures youmighf imagine: bIood
ressure, hearf rafe, sfress hormone IeveIs.
Inshorf, fhoughfhe vioIence isn`f reaI, your
body reacfs as if if were. Evenmore infriguing
is whaf haens inyour brain. Ina 2uII sfudy
fromGermany, researchers showedvioIenf
screenshofs fromfhe game Coner-Srike fo
gamers wifhnrsf erson-shoofer exerience.
TyicaIIy, showing eoIe negafive images
rovokes acfivify infhe IaferaI refronfaI
corfex, fhe area invoIvedinemofionaI ro-
cessing andconfroI. Infhis sfudy, fhough, fhe
exeriencedgamers showedsignincanfIy Iess
acfivify infhaf region. They hadbecome
desensifisedfo fhe deafhandgore.
Of course, hysioIogy is one fhing; buf
behaviour is anofher. number of sfudies from
fhe I99us andearIy 2uuus showedfhaf Iaying
vioIenf video games Ieads, af Ieasf infhe shorf
ferm, fo more-aggressive affifudes, emofions
andacfions. Inone of fhe mosf frequenfIy cifed
sfudies, ubIishedinfhe Tornol of Personoliy
onJ Sociol Psycboloqy in2uuu, varsify-age
sfudenfs Iayedeifher fhe vioIenf game
Volfensein Dor fhe nonvioIenf Mys.
fferwards fhey answereda quesfionnaire
designedfomeasurefheiraffifudesandemofions;
fhenfhey fook arf ina comefifive acfivify
inwhichfhey couIdbIasf anofher sfudenf wifh
whife noise. Those who`dIayed Volfensein
Dnof onIy demonsfrafedfhoughfs fhaf were
more aggressive buf aIso deIiveredIonger noise
bIasfs fhanfhe Mys Iayers did. ThevirfuaI
!J# |J J|.| \
|.!\| /J

, undynumuyaIurI uwur. InaIcud,
uchicvcdIcnIcbyuaingIhcacaIruIcgica
Irnmhumunbchuvinurrcacurchcr
Chcryl Olannundclinicul paychnlngiaI
CuIhcrincSIcincr-duir
September 2014





8sfud ubIishedinPts
measuredfhe aggressieness of Jaanese and
mericanschooIkids af fodierenf fimes, ifh
fhree- fo si-monfhgas befeenassessmenfs.
Those ho habifuaII IaedioIenf ideo
games ere more IikeI fo be aggressie during
fhe nrsf measuremenf eriod, andfheir ag-
gressionas aIso more IikeI fo increase b fhe
secondone. nofher sfud, ubIishedin
lopntl Psbolo in2uI2, sureedhigh
schooIers annuaII fromGrades 9 fo I2 abouf
fheir ideo game habifs andaggressie beha-
iour. Higher amounfs of ioIenf ideo game
Ia redicfedhigher IeeIs of aggression.
If shouIdbe nofedfhaf none of fhese sfudies
Iink ideo games fo ioIenf behaiour. Thaf`s
imorfanf because fhere`s a dierence befeen
aggressionandioIence: aggressionis denned
as an behaiour carriedouf ifhfhe infenf fo
harmanofher erson, hiIe ioIence is anacf
infendedfo cause efreme hsicaI harm, such
as injuror deafh. SfiII, researchers sa, eneed
fo be concerned. I`mmuchmore inferesfed
infes of aggressione eerience inour
eerda Iies, sas Doug GenfiIe, a rofessor
of schoIog af Ioa Sfafe Uniersif.
He means fhe generaI a e inferacf ifh
one anofher: if someone bums infoou, doou
seeif as anaccidenf or a roocafion? Does our
femer daremoreeasiIfhanif normaIIouId?
Puf anofher a, do ouhandIe fhe obsfacIes
ouface inreaI Iife fhe same a ouhandIe
fhose ouface onfhe screen- ifhaggression?
The researchso far suggesfs fhaf for hea
gamers, fhe anser is es. Sfudies aIso suggesf
fhaf ideo games, hichmake ouanacfie
arficianf infhe onscreenroceedings, are
more oerfuI fhanassie media, Iike moies
or TV. Ina 2uu8 sfud, Euroeanresearchers
hadkids ages Iufo I8 do one of fhree fhings
- Ia a ioIenf ideo game, afchsomeone
eIse Ia fhe same game, or Ia a nonioIenf
game. fferards, bos ho hadIaedfhe
ioIenf game ere fhe mosf aggressie of fhe
fhree grous. (CuriousI, girIs shoedno dif-
ference inaggressionamong fhe fhree grous
- a facf fhaf fhe researchers secuIafe couId
be because bos infhe sfud hadIaeda Iof
of ioIenf ideo games oufside fhe sfud, hiIe
fhe girIs hadIaedreIafieI fe. The bos,
inofher ords, ma hae beenhardiredb
reious gameeosurefobehaeaggressieI.)
For GenfiIe, noneof fheseeecfs aresur-
rising. To habifuaII engage inioIence infhe
irfuaI orId, he beIiees, is fo frainour brain
fo fhink ina cerfaina, hichfhenmanifesfs
inaggressiebehaiourinIife. Yourgrandmofher
as a greaf neuroscienfisf, GenfiIe sas. She
aIas foIdoufhaf racfice makes erfecf.

Chris Fergusonas anakardfeenager foo.
Or af Ieasf he as a fanof unons 8ons,
aroIe-Iainggamefhaf infheI98us as afargef
of someconserafieChrisfians hofearedfhaf
ifs fans ere ona sIier sIoe foards deiI
orshi. (Ofhers fearedfhaf if uf kids ona Iess
aIarming afhfoards Renaissance fairs.) This
as fhe era during hichTier Gore mounfed
her famous crusade againsf oerI eIicif song
Irics; as a resuIf, fhe music indusfr as forced
fo uf arenfaI arning sfickers oncerfain
aIbums Iesf feenage souIs be corrufed.
Bofheenfs made Ferguson, no42, Ieer
of gron-us oerreacfing fo fhings fhe don`f
undersfand. duIfs cIearI didn`f knohaf
fhe ere faIking abouf, he sas. SfiII, his
sceficismdidn`f fuII kick inunfiI he became
anaduIf himseIf andreada researchaer
sfafing fhaf fhe Iink befeenioIenf media
andaggressie behaiour as nearI as sfrong
as fhe Iink befeensmoking andIung cancer.
Ferguson`s reacfion? Thaf`s absurd.
Muchof Ferguson`s career since fhenhas
beensenf fring fo debunk fhe nofionfhaf
a sfrong scienfinc connecfioneisfs befeen
ioIenf media - arficuIarI ioIenf ideo
games - andnegafie oufcomes of an kind.
For sfarfers, he quesfions fhe mefhodoIog
of man of fhe sfudies, arguing fhaf fhe fre-
quenfI Iack sfandardisafion, offendon`f con-
froI for gender dierences, anddon`f necessar-
iI measure haf fhe urorf fo measure.
One of his faourife eamIes is a 2uu4
sfud suosedI roing fhaf Iaing ioIenf
ideo games gae uniersif sfudenfs a more
aggressie mindsef. His grie? The research-
ers` chosenmefhodfor measuring affifudes
as asking sfud arficianfs fo nII infhe miss-
ing Ieffer infhe foIIoing ord: eIo.e. s if
haened, fhe arficianfs ho hadIaed
ioIenf games ere more IikeI fo uf a din
fhaf ord(eIode) fhanfhe confroI grou,
ho more offenchose r fo seII eIore. Buf,
Fergusononders, does fhaf reaII feII us fhaf
fhe ere IikeI fo be aggressie? He aIso sus-
ecfs ubIicafionbias - fhaf is, some journaIs
choose fo ubIishsfudies fhaf shoa resuIf
oer fhose fhaf shoniI eecfs. FinaII, he`s
conducfedseeraI of his onsfudies oer fhe
ears andsas fhe aII faiI fo roe a signincanf
negafie eecf fromIaing games.
Inone of Ferguson`s mosf recenf sfudies,
ubIishedinJanuar2uI4, heandhis co-au-
fhors eIoredfhe quesfionman hae asked
oer fhe ears: are ioIenf games arficuIarI
dangerous for eoIe ifhre-eisfing menfaI
heaIfhcondifions - secincaII chiIdrendiag-
nosedifheifher deressionor DHD? The
sfud, hichaearedinfhe Tournol of Youtb
onJAJolescence, foundnoeidenceof increased
buIIing or deIinquenf behaiours among kids
infhe friaI ho IaedioIenf ideo games.
To Ferguson, fhe Iack of imacf as fo
be eecfed. Inconfrasf foDoug GenfiIe and
ofher researchers ho beIiee fhaf ideo games
condifionour brains foresondfoerceied
fhreafs incerfainas, Fergusonsas our gre
maffer isquife caabIe of resonding fofanfas
scenarios and reaI fhreafs dierenfI. PeoIe
aren`f sfuid, he sas bIunfI. s eidence, he
nofes fhaf eenfhoughideogames haesoared
inouIarifinfheasf I8ears, fheoufhio-
Ienf crime rafe reacheda 82-ear Ioin2uI2.
Whaf abouf fhose mass shoofers ho ere
so deofedfo fheir ideo games? Nof onI is

Pnoon| |e ne e'enen|s ||
o|er ,oJ no |e e|Jres e's 'ook
n or, no |en |r, |o no onoro
nse, s,s O'son. e 'oes on|
no onoe||on, nJoe n|oros
n|s, or s nes n e
n nn'|e 'ens no no| oeoo'e.

'oren Jse nn |o oes|ress
|er soo', J| k''n s|J s o
oon |oo'. o se| soe |e rs| oJr
| one or n, soor| or ne exeo|
|e oeo kno. ' oeo nes ren'|
n oo|on, e''' 'ern |o oe' | s|ress
n e||er ,, s,s |eneror.

re|ns nnsessons n,
'eo |o rJs|r|on o',ers o|en n'|
one r n re oeroos. ns|eo,
oesn|e neree o,s, s,s
|eneror. n re|Jrn, oronse e
'on s|re|es o ne |ne so e s
ne |o one |o ne'ee'.

Tose nnerse soo|'enJos n
enoJre so'|on. To oJn|er|
||, no nes || os|er 'oren's
o|, |o o', |oe|er, s,s
|eneror. Co |o connonsense-
neoa.or, searcn |or anes oaseo on
sk''s |aJn|, ano |r, |o aree on a |e.
*TEPN5NCNITIN5 iscounIs available only Io SouIh African residenIs wiIh a SouIh African posIal address. For overseas and neighbouring sIaIe raIes, please call +27 21 405 1905. Discovery ViIaliIy oher is for acIive members,
and you cannoI receive Ihe gifI if you Iake up Ihe ViIaliIy magazine oher. SubscripIion provided on a pre-paid basis. To ensure uninIerrupIed service your subscripIion will auIomaIically renew. Billing will Iake place monIhly aI a raIe of
P33.63 per monIh. We may amend fees payable in respecI of your subscripIion. We will noIify you of such an amendmenI prior Io implemenIing iI, so if you wish Io IerminaIe your subscripIion you may do so. We may alIer Ihe paymenI
insIrucIion Io correspond wiIh any changes in your fees. Winners awarded by means of a random number generaIor. *Only 130 hampers are available, and gifIs are only available Io SouIh African prinI subscribers. Oher available
unIil 24 SepIember 2014. |f email addresses are provided, you will receive promoIional informaIion from Media24. GifIs will be awarded Io Ihe rsI fully paid subscribers and musI be claimed wiIhin six weeks of noIicaIion. Oher only
available Io new subscribers. SMSes cosI P1 each, free minuIes cannoI be used.
CaII: 0861636743
maII: menshealIh_subsmedia24.com
Goto: www.mysubs.co.za
Fa: 0214064057
MaII: Men'sHealth,FreePosI NoCB0006,CapeTown,8000
SMS: "MHSep14" andyour nameIo32511andwe'll call you
ESYwYST0SuS0RE:
SubscrIbeto
ENSHEALTH
andreceIvea
NlVhamper
GeI 12issues of Men's Healthfor
P34per monIhandreceiveaNlV
MNHMPRvaluedaI P460each!*
R

S
A

E
P
E
R
lS
S

E
ZROLCOHOL, ZROlRRlTTlON
Don'I leI shavingirriIaIeyour skin. ThenewNiveaMenSensiIiveSkinrange
wiIh0%alcohol guardsagainsI burningandirriIaIion. Pesearchshows
IhaI skinsensiIiviIyandirriIaIionaffecIs57%of men. ThisskinsensiIiviIyis
ofIenshaving-relaIed. TheNiveaMenSensiIiverangeisformulaIedwiIha
skin-calmingcockIail of viIaminE, chamomileandhamameliswhichhelps
sooIheandheal Iheskinandreducerazor bumpsandiIching. YouneedIo
lookandfeel your besI, fromshavingfoamIofacewash.
SpecIaI Report WhenKillingis a ame /
Iamingvideogames fhe2Isf cenfuryequivaIenf
of eoIe freaking ouf over fhe dangers of
8Droqons, Fergusonargues, buf
if aIso disfracfs us fromwhaf he beIieves is
fhe acfuaI issue underIying aII fhose shoofing
cases: unfreafedmenfaI iIIness.
Buf erhas fhe quesfionisn`f whefher or
nof vioIenf video games aecf you, buf rafher:
whaf are we feaching fhe nexf generafion
abouf howfo deaI wifhvioIence ondisIay
invideo games?
NicoIas vanZyI, a cIinicaI sychoIogisf af
fhe SandfonPsychoIogy Cenfre beIieves fhaf
arenfaI invoIvemenf is essenfiaI inhowwe
Iearnfo absorb video game confenf. chiId
may Iay video games aIone every day, shoof
andkiII 2uuuuvideo game characfers fo reach
a foscore andIearnfhaf aggressionis reward-
ing andenferfaining, says VanZyI.
Onfhe ofher hand, a dierenf chiIdmay
Iay vioIenf video games wifhhis fafher and
cooerafe fo reachfhaf same foscore and
Iearnfhaf cooerafionis rewarding. Iso when
arenf andchiIdIay fhese video games fo-
gefher, if rovides anoorfunify for momor
dadfo give feedback fo fhe chiIdonhowhe or
shehandIes obsfacIes or exresses aggression.
f fhenbecomes nof so mucha quesfionof
avoiding vioIenf video games, buf of encourag-
ing arenfs fo become more acfiveIy invoIved
whenfheir chiIdrenare exosedfo vioIence
fhroughvideo games, he says.
VanZyI argues fhaf bofhsides of fhe
debafe may be missing fhe essenfiaI oinf fhaf
video games aecf us dierenfIy deending
onhowwe`ve beenfaughf fo deaI wifhfhem.
chiIdwho is faughf fo feII fhe dierence
befweenrighf andwrong, fanfasy andreaI-
ify, video games andreaI Iife, by arenfs who
fake a genuine andacfive inferesf inhis or her
deveIomenf wiII nafuraIIy be more resisfanf
fo deveIoing a hosfiIe execfafionbias when
Iaying video games, he says.
PAST FEW YEARS, GAME CREATOR
WaIf WiIIiams has foundhimseIf becoming
concernednof so muchwifhfhe IeveIs of vio-
Ience invideo games as wifhfhe banaIify of if -
fhaf is, howmundane if aII seems fo fhe Iayer.
nreaI Iife, kiIIingis afraumaficexerience,
WiIIiamssays. Buf invideogames, if`ssomefhing
fhaf canhaenahundredfimes aminufe.
n2uI2, a newgame debufedfhaf WiIIiams
heIedwrife anddesign. f was caIIedSpec Ops:
1be Line, andfhe goaI was fo orfray vioIence
- and ifs eecfs - ina muchmore reaIisfic way.
f one oinf, for examIe, fhe game`s main
characfer, a soIdier namedWaIker, is faced
wifhfhe ossibiIify of having fo oennre ona
grouof civiIians, aIbeif hosfiIe ones, inorder
fo survive. s fhe acfionrogresses, WaIker
(fhaf is, you, fhe game Iayer) encounfers as
many moraI chaIIenges as hysicaI ones.
WiIIiams says one of fhe ideas driving fhe
enfire game was fhis: Whaf if fhe foII of
faking a Iife acfuaIIy weighedonyou?
For whaf if`s worfh, Spec Ops: 1be Line
receivedsome osifive crificaI nofices, buf if
was cerfainIy no GronJ 1beft Auto inferms
of saIes. Givenfhe choice befweenmoraI
ambiguify anda ower fanfasy, erhas fhe
markef has soken.





Kardash|an-sty|e postur|ng to be|es, the fema|e backs|de |s be|ng
trps
r v
|
y
H|
wss
aunted ||ke never before. Th|s |s the bottom||ne back-s|de et|quette. No bumsteers
September 2014
21ST CENTURY:
Ful l ci r cl e
PRE-RAPHAELITE ERA: Ar t y
ANCIENT
GREECE:
Wel l
scul pt ed
t's rsnn's
ks ns nn |n r.
Hw s 'n |Jn|n nr rrere on
soca' neoa, aroasnan soarkeo a
ae o| on'ne exno|onsn, cen|reo
soec|ca'', on a onan's oo||on.
Ad tt's b 'n eer, sense. BJ|
nan', oecaJse | nearkens oack |o
orn|e |nes nen |ne oJ||ocks ere
na| a||rac|eo a nan |o a onan.
'| nakes | er, ra ano sexJa'. =er
'ns|aran |eeo s orac|ca'', |oreo'a,.
|oo'e onones are no sex |o,s.
Ht " t `eo. 'Be'|es are
aooJ| aooroa'. '|'s |ne J'|na|e 'see ne:
'ke ne. `oJ're oen n|eo |o s|are.
S w ds tm swr
T B Quest|on |n 2014? Care|J'',.
|os| onen oon'| kno |ne anser,
oJ| nere nen nae a'a,s aooreca|eo
are|, n |ne snaoe ano sze o| onen-

ne ore-aonae'|es (ano r |x-
^-Lo|, ere ra|ner oar|a', |oo. |en
ano onen a'ke nae |e|snseo
|ne |Jnoanen| snce
|ne nnenora',
oJ| neer nas |
nooneo |ne Ze|-
es| as | ooes |ooa,.
'n 20!4, ner oos|eror
s |ar nore |nan a |oo'
o| seoJc|on, or een ,Js|
sone|nn con|or|ao'e
|o s| on. '|'s soca' cacne|. Bao, o|
oack ano sne's oos|n | on 'ns|a-
ran, coern | n |a||oos, |erk-
n |, orkn | ano soJa||n 'ke
|nere's no |onorro.
'Boo|,'coJs, sone nn| sa,.
On', oon'|, |or |ne 'oe o| Coo.
BecaJse een n |ns oos|-
aroasnan or'o, |ne nooern
en|'enan nas |o |reao care|J'',.
`es, |'s a'' on sno, oJ| neaen
|oroo ,oJ snoJ'o
cone
across a''
enn,
Jnene
nann oJ| |ne oack o| a ns-
o'aceo connen|. \na| |o''os s
a |e'o Joe |o |ne |ena'e g|uteus
maximus n a'' |s |orns. \e''' e
,oJ |enns|-aooroeo |os |or con-
o'nen|n, caressn ano soank-
n, o'Js oance-|'oor rJ'es |o e|
|erkn r's orkn | |or ,oJ. 'n
20!4 |ns, seenn',, s na| |Jrns
onen on. '|'s a oack-ooor
oassae |o 'oer nno-
|ons ano sexJa' exoer-
nen|a|on. `oJ'e oeen
n|eo |o oJ'' Jo |o |ne
oJnoer: |ns s na| |o
oo nen ,oJ e| |nere.
Body |anguage spec|a||st Jud| James demyst|es the dreaded
quest|on: "Does my bum|ook b|g |n th|s?"
The Ki m
Kar dashi an
sel f i e t hat
st ar t ed t he
r evol ut i on
nooo's 'J|ea' reon, no onen
|nense'es an| ar,n anoJn|s o|
,Jnk n |ne |rJnk. |an, are naoo, |o
sno | o||.
A casua|, "You |ook n|ce," won't
serve, then? No. na|'s na| ,oJ sa, |o
,oJr nJn nen ,oJ |ake ner oJ| |or |ea.
"You |ook ||ke Beyonc?" een
|ne ce'eor|es sne |o''os on soca'
neoa sn'| a oao oea, oJ| |nere s
an e'enen| o| one-Jonansno n a''
|ns, sone|nn |na| sa,s, '|, ooo,
s nore oesrao'e |nan ners. Bes| no|
|o conoare.
So what do you suggest? Deo'o,
|ne oros 'snaoe ano 'onan', a|
''. ne, ork as one-sze-||s-a'' con-
o'nen|s |o e| exac|', na| ,oJ an|.
Got |t. "Work|ng |t!" must work |n
the same way, r|ght? orr,, ,oJ're
oooneo.
Tast es change,
but t he t heor y
r emai ns t he same.
September 2014

ashes the perfect
underwear for your g|r|'s shape
\n 'n on n n
n' n o n no nn
nk 'ook |' o on.
Keep |t br|ef
Lo- | n
n Cnon D- '.
B n nn n .
uy o 'n Tnon
'' |onon nn
S|o
on 'oo' |'' n
oon-n n ''
ono o| n n 'ookn
o o| ooooon.
Keep |t br|ef
nn knk '' '
on ok--oo o'|'n
n' nn nnn
n .
uy Tn B'n
L Sn
B no n o on o
n nn n nk n
'ook . B o n
n
Keep |t br|ef
Tn | o|| o'| no
n- || n n
on' no n
'no o| kn.
uy on L |
Don \oo'on
Tn n no no onn
o. ^'' o n o o
n n oo' o no o||.
Keep |t br|ef
Sn n n no
' n |o onnn
e - cnances are sne'''
re|Jrn |ne |aoJr.
uy ^nna' Prn| Lace Tnon,
, La Senza a| Eoars
PP|L 2011
s ceebraIed Pippa's buIIocks
sIea Ihe roya weddig, proudy
preseIig oe's behid
gais accepIabiiIy.
geeraIio of woe
Iakes oIe.
Know how t o
dr ess her
pr oudest
asset and
t ease out
her i nner
exhi bi t i oni st .

ss,
es
Know how t o
dr ess her
pr oudest
asset and
t ease out
her i nner
exhi bi t i oni st .
SIarI wiIh a lirIy conversaIion. "usI being coni-
denI enough Io bring iI up is sexy," iss England
says. "sking casually, 'WhaI do you Ihink o
spanking?' will sIarI a hoI conversaIion." Peassure
her IhaI iI's only role-play, buI IhaI you are Iurned
on by power games.
hoose a nighI when neiIher o you is drinking.
"EsIablish Ihree sae words - one or red (sIop),
amber (go slow) and green (keep going)," iss
England says. ay her over your knee. "Use laI
slaps, Ihen cup your hand Io change Ihe sensa-
Iions." he Iurn-on isn'I (jusI) Ihe pain - iI's Ihe
acI o surrender.
" she can Iake iI, Iry a paddle," says iss England.
eaIher eels greaI. "nce her cheeks are rosy,
spank her sweeI spoI - Ihe lower middle parI o
Ihe bum, jusI beore her geniIals. You'll hiI a nerve
IhaI goes righI Io Ihe groin." n a good way.
Use your sae words Io bring Ihe session Io an
end. "hen massage her bum wiIh a cold cream."
You'll boIh wanI Io do someIhing wiIh IhaI build-up
o sexual energy.
|and, |n-house 'Dream
aker' at UKerot|c shop Coco de
er, revea|s howto put her over your
knee w|thout be|ng shown the door
24 UUS 213
heryl ole reveals a oral IaIIoo
adorning her whole bum. I's an
exIreme example o Ihe airer
sex's new willingness Io
draw aIIenIion Io
Iheir rears.
September 2014
em|n|st r|ter n ||-roun n o se
|n |ps|t enes the neru|es o
rs|-quette. eer h|t um-note g|n
Renenoer, ,oJ aren'| 'ookn |or a roe aocaoo. '|os|
onen 'ke an a||ec|ona|e soJeeze, oJ| oon'| ,Js| rao
a nano|J' o| |'esn, sa,s Los|z. 'Pa, a||en|on |o ner
resoonse. Does | nJr| n a ooo a,, or ooes | ,Js| nJr|
'^n exo'ora|or, |ner oJrn sex can |ee' rea|, Los|z
sa,s. 'BJ| oe c'ear aooJ| nere ,oJ're neaoeo - ano s|oo
| ,oJ nee| |n ress|ance. ^ so|| |oJcn s ke,: ,oJ're no|
n|cn-nkn.
'One o| |ne no||es| |nns ,oJ can sa, oJrn sex s, '`oJ
nae an anazn arse,' sa,s Los|z. '^oo an aooreca|e
soJeeze ano e''' oe oJ||, n ,oJr nanos. BJ| neer Jse
|ne oro 'oJ||,, oooJs',.
'P'en|, o| onen e| a |nr'' |ron oen Jren|', oen| oer
a cnar or |o'o |o 'e |ace oon n'e oen |aken, sa,s
Los|z. ''| sne's n|o |, ,oJ''' kno - ano ,oJ nn| en|Jre
a |J o| ner nar n'e ,oJ're a| |.
'Neer 'aJncn |ace |rs| n|o a rn ,oo, sa,s Los|z. ^no
oon'| o'Jsn, e|ner. Snoer |oe|ner, |nen kss a |ra' |ron
ner neck |o ner oJn. '^sk |rs|. '| '' oe Jno'easan| | sne's
|aken o, sJrorse.
'or ana' sex, oo no| ore|eno ,oJ o| 'os| on ,oJr a, |o
|ne |ron| ooor, sa,s Los|z. 'Sne's nore 'ke', |o sa, ,es
|n aoance arnn - ano |'s nore |Jn |or eer,one
|n 'Jorcan|.
'Tne carona' rJ'e o| ana' s |o a''o ner |o oc|a|e |ne oace,
sa,s Los|z. 'Le oon ano nae ner 'oer nerse'| on |oo,
so sne can con|ro' |ne oeo|n. |akn ner |ee' secJre s |ne
ke, |o Jn'easnn ner 'o soe.
he goo the
n the |e|| hen |t
omes to ks|e
term|no|og
CJ|e, sno'e ano
Jncon|roersa'. SnoJ'o
oe ,oJr o-|o oro
Tne rn| nx o| roJn ano
sex,. Ress| |ne |eno|a|on
|o sJo |n 'ass: |ns an'|
Ca'
ReassJrn', oo'|e ano
,Js| on |ne rn| soe o|
Br|sn. Ce |ne
noe So .anes cack'e
a nss
ReoJres con|oence ano
a |onJe |rn', n (|ne
o|ner, cneek, oJ| |ne
|o Jse n orase o| sze
'naosao'e, Jn'ess ,oJ're
|a'kn soJa|s
Ro'' oJ| oJrn !90s
oaseo ro'e-o'a, on',
Sno', no| sex, nen
J||ereo n an, SoJ|n
^|rcan accen|. or cns-
e''eo ^nercan ,ocks on',
No can oo. Eer
.Js| |o s,''ao'es, one
re'a|onsno onk s'o
eret ormromnstgrm's e|e e||es

|m
rsh|n
k|mkrsh|n
Tne arse |na|
neeos no
n|rooJc|on
Jen Se|ter
JenSe|ter
OJeen o| |ne
soJa|s - |n |ne
oJn |o oroe |
Iabe| Gou|art
|a_gou|art
^ \S nooe'
nose ,n
|orn s oe||er
|nan ,oJrs
Rosa Acosta
rosaacosta
PT, oa''e| oancer
ano oe'|e-|akn
oa
583 72
Anastas|a
Ash|e
anastas|a
ash|e
Tns oro sJr|er
nas |ne oes|
oJ|| on a ooaro
542 815
La|s DeLeon
|a|sde|eon
One o| Braz''s
|nes| ano |||es|
exoor|s
Nata||a
Zakharoa
our|eo
^ oenno |o
|o''o aroJno
|ne or'o
Rachae|
Mu|doon
bodofrachae|
^ okn cnano
ano a''-roJno
||ness ano
ooo|, |an
16 724 194
4 25 391
1 218 79
27 911
324 62
439 237
UGUST 2013
Mily Cyrus grinds hr boIIom
againsI Pobin Thick aI Ih
MTV wards. "Twrking" is
waponisd on danc
oors from Miami Io
MariIzburg.

NOVEMBEP 2013
Candice Swanepoel posIs her
workouI phoIos online. Women
busI ouI Ihe squaIs Io geI
similar resulIs. Your parIner's
form is now beIIer
Ihan yours...
sror aya W|yar p|as oo r ry a o sp| so
Tkn n|n n
Dn oJ' n ' ,.
'n 'n o n |n n,|nn
o |n nk n|o J'
no|on , \,,n.
'Jn o, |n ' n n, '
|' ok, o ,oJ |o n...
n 'ook ok no' , on||
o nonn| oJ| on'| nk
n, n Jn' n k.
O ok |n |Jk n|o ,oJ.
Tn |n |k, o|: nn
ok. Tn | J' o n'oo
|||on |o J| oJ| onnon
n|k. 'n || | No|nJno
n|, onn | |n o|
n |no no nk
o|| nonn| n
|| |n |n n. Do no|
Jn n, Jn|n
||no| |o |k ok. TJ| J
nooo, n| |o |n|.
Conn|| ,oJ on no
on ,oJ Joo oo,. oJ''' nk
no o n noon |n ,
|n No|nJno |J, oJn.
\,,n J| oJ||n
,oJ nn 'n|', on n |
non '. '' n' on-
n| noJn |o |k n on'|
o n, ooJ| |''n ,oJ n
n o o on'| n| ,oJ
|o |oJn.
o ,oJ , o n ,oJ
| non |o |n n,|nn
\,,n ,. ''' n
J, no ,J| |oo n
| |n, 'ook 'k o.
Cono'nn| |n , n no
no| n oJn. |J, n |n
,oJn' oJn |n|
ono'nn| n onoJ n
|n n , n .
No k |o oJ, n nk.
porn d|rec-
tor r|ka Lust exp|a|ns how
to |et her best support|ng
feature take the star ro|e
P 2013
Thr monIhs afIr giving birIh,
Kim Kardashian Iaks Io
|nsIagram Io unvil hr r-Iond,
admirably sizabl drrir.
|I is known as
a 'bl'.







































4 (P2 159, a|oas.c.za,
ncn ces |n a re|e c|r.
Tne oes| ece | aoce ' ca ||er
CJca|e, s... ao e,,.
B A

A B
AA
'A
. 147
trt
rv
o
YEAROLD SUPERSTAR SMASHED GOALSCORING RECORDS,
he resfigious Fifa BaIIond`Or awardfor fhe worId`s besf Iayer,
cafainedhis nafive PorfugaI infofhe WorIdCu, andIedReaI Madrid
fowards anunrecedenfedIufhEuroeanfifIe infhe Chamions League.
Buf somefhingisnaggingaf RonaIdo. Evenfromuhereonfheviewing
baIcony, Icanseefheuneasinessinhiseyes, fhehesifafioninhissfride. Some
feammafescaII RonaIdo -fhenxiousOne-andhecerfainIy
Iooksanxiousfoday. Somefhingisoff, aniggIe, acrim, afwingedowninfhe
fasf-fwifchmuscIefibresof hisfhigh.
The ReaI MadridcomIexinVaIdebebas, fhe neighbourhoodwhere fhe
feamfrains, has come aIive. The fieIdsrinkIers have jusf shuf off, andfhe
arking Iof is fhrongedwifhsIeekudi sorfs cars. RonaIdoandhis
feammafes -a R2.8-biIIioncasf of gIobaI Iuminaries Iike GarefhBaIe,
ngeI di Mara, SergioRamos andMarceIo-have marchedonfofhe
immacuIafe grass andbegunfraining for fhe finaI games of fhe La Liga
seasoninSain. SwaIIows darf fhroughfhe bIue sky, andfhe cIose air
resounds wifhfhe faf fhunkof soccer baIIs swerving fowards fhe nef.
September 2014
hecranesandgassfowersof Madrid`smodernskyineeekoverfhe
sfands, buf fhisisacosedracfice, oenonyfoafewinvifedguesfswho`ve
assedfhroughagaunfef of securify. Onfhebaconywifhmeisagrouof
feenagesoccerayersfromChina, whobysecia arrangemenf havecome
fofrainwifhRea Madrid`syoufhacademy. EveryfimeRonadorunsby, fheir
camerasraiseinunison: Ronado!ikekidsa overfheword, fhesefeens
havememorisedhismoves, hismannerisms, hissignafuresfeoversandhis
rifua forfakingfree-kicks. Theboysfryfokeefheircoo, buf if`saiffeike
wafchingodcisof feenagegirsreacfingfoayoungEvis.
Ronadoracfiseswifhfhefeamforahaf hour, buf fhenasfern-eyed
frainerushimasideandufshimfhroughaseriesof sfressfesfs, scrufinis-
ingfhemuscesof hiseff egasif hewerearizefhoroughbredwifhasighfy
susiciousgaif. fferI6minufes, if aearsRonadohasfaiedfhefesfs.
Caronceoffi, Rea`smanager, nofwanfingforiskfurfherinjuryfohis
greafesf(andmosfexensive)assef, dismisseshimfromracfice. Ronado
sfridesoff fhefied, oufing, gesficuafingindisarova. ewanfsfoay, buf
he`sbeenbanishedfofhechangingroomand, resumaby, fhemassagefabe.
`msuosedfomeef himafer, downinoneof fhemediarooms. ffer
keeingmewaifingforanhour, heshowsuwifharefinueof dour-faced
minders. eswaggersinandsifsdown, freshfromfheshowers, diamond
sfudsinhisears, sikyhairgeedfoerfecfion. issideburnsarecrisback
daggers, andaheffywafchginfsaf hiswrisf.
Ronadois definifeyfhe reening eacockeveryone says he is -buf
cansense a vunerabe side foo, a nervous energyfhaf us af himike an
underfow. The eg injury, whichwi ague himfor fhe resf of fhe season
andaf fhe WordCu, is cearyweighing onhimfoday. Ronadohas scored
more fhan24ugoas since coming foRea Madridin2uu9, andover fhe
years he`s wonjusf abouf everyfife andfrohysoccer has fooffer. This
year aone, he`s scoredanincredibe 6I goas for Rea. Buf wifhfwogames
eff infhe season, he`s nof safisfied.
eneverwi be.
Peoe whoknowRonadosayhe`s a workinrogress, fhaf he`s
obsessedwifherfecfing himsef, fhaf his fhirsf is unquenchabe. Ronado
woudn`f disagree. aways fryfoimrove, he fes me. Tomorrow wi
be beffer fhanfoday, andnexf year wi be beffer fhanfhis one. f score 6u
goas, wanf 66. Some eoe say`mfooserious onfhe ifch, nof smiing
andsoon. f is because `mfocusedIuu%oneverygame. aways wanf
more andmore. A
I'S NO EASY BEING CRIS RONALO. HIS QUES OR ERECION, HIS
usf for fhe highesf sfrafosheres of gory, andfhe owerfu mixof sef-ove
andsef-crificismsfirring wifhinhimmake for a sfouf sychic cockfai.
e ives ina ressure-cooker word, arfyof his ownmaking. e runs
onwhaf he cas a secia adrenaine. e`s senf muchof his rofessiona
ife jusfifying his ownexorbifanf rice fag, andif`s eff himfragie,
skiffish, overexcifed. Sif wifhhimfor a whie, andyoureaise fhaf
fhis is one hofhouse orchid.
f fimes, Ronadoseemsamosf houndedbyfhedemandsof hisown
exceence. ecravesfhebiggesf ossibesfageandsefsoufandishyhigh
ersona goas, whichhefhenmusf oufrun. Whenheays, nofedBrifish
soccerwriferBarneyRonay, yousensefhaf heisbeingchasednof jusf byfhe
oosifionbuf byeveryoneinfhesfadium.There`snodoubfinghisfaenf:
CrisfianoRonadoiswideyregarded(aongwifhhisarchriva, ione Messi)
asfhebesf ayeronfheanef, andhewi ikeybecounfedasoneof fhe
1 / VARY YOUR
INERVALS
o ee'o see n
snn CR oes sno
n 'on ne's ( se-
ons n ! seons,
ss ^nono Cs ne
Poese enne.
2/ WORKYOUR
BOY WEIGH
' on o se' ee-
ses o e s-
ss Ron'o. ' n o e
son |o ne no'e se-
son. e |os o'-o
noes o|en n RX.
3/ EMBRACE YOUR
SURROUNINGS
Con ' 'e n
neo n |e ss
Ron'o. ' snen
s''s. Ese o eses.
o n o sns. Le
ne n'' Rn .
4/ SRENGHEN
YOUR SELESEEM
Con|ene s sonenn
n ones |onon
n Ron'o ss.
nene nes nn
|ee s n oo on
'e ''s nes |ose.
5/ CROSSRAIN
YOUR GAME
Ron'o nes ns n-
nn ne o||-seson
snnn |o o |-
ness n 'nenns
n 'e enns o none
ns |ooo n eons.

Rona|do craes the b|ggest poss|b|e


stage and sets out|and|sh|y h|gh persona|
goa|s, h|ch he then must outrun
September 2014
September 2014
W
H
A

'
S
Y

U
R

A
Y
?
J J # I J J | 4 I | I | |
YUR
AEAWAY
oe|ernna|on, snar|s, ano cJr-
os|,, sa,s .onn Ba'oon, aJ|nor o| 'Leaoers
nJs| oe nno|J' o| |ner crcJns|ances, oe oooor-
|Jns|c, ano ask oJes|ons 'ke '\n,' ano '\na|
| . . .' '| ores oeoo'e |o aoo', |ner crea||,.
RA'S
AY
=e an|coa|eo |ne a'' oJ'o ,Jno |o o'ock |ne kck,
so ne n| a oas, cJ||er n|o |ne oo||on-'e|| corner.
HE USUA
IS
Beno |ne oa'' aroJno |ne a'' n|o |ne |oo-'e||
corner. r cJr' | oer |ne a'' n|o |ne |oo-'e|| corner.
HE
SIUAI
ona'oo |akes a |ree kck ersJs Ba,ern |Jncn n
|ne 20!4 Cnanoons LeaJe sen|na'.
. RonaIdo
isacomIefeIayer, amanwhocandoif aII: he`sdeadIywifhbofhfeef, his
dribbIingiscunningandarffuI, hissfrikesarebIisfering, hismovescan
scrambIeadefender`sbrains, hiswobbIingfreekicksaremagisferiaI,
and-whenRonaIdo`sgivenroomforun-hisaceisnearIyunmafched.
WhenyouIookaf fhegamefoday, fhere`s sucharemiumonfhehysi-
caI asecf -seed, sfrengfh, endurance, MichaeI BradIey, midfieIder for fhe
USnafionaI feam, saidrighf beforeJune`s US-PorfugaI WorIdCugame.
Heis aguywhochecks aII fhoseboxes. ndfhenwhenyoufaIkabouf his
B
YU HE A
"a|k up your game. |nk|ng
'You te man' w||| g|ve you
an edge." - ader
A
HI YUR GAS
"rocess goa|s work better tan
outcome goa|s." - roessor
onatan ader, sport psyco|og|st
fechnicaI abiIify-howgoodinfheair heis -he`s somebodywhocanmake
fhedifferenceaf anymomenf. BradIeyfoundfhaf ouf infhe96fhminufeof
fhaf game, whenRonaIdo`s inoinf cross IedfoagoaI fhaf sfoIea2-2draw
off TeamUS.
ThesirensreaIIygooff whenhereceivesabaII insace, oufwide, wifh
fime,saysESPNcommenfaforIexi LaIas, arefiredUSnafionaI feam
defender. Nodefenderwanfsfoseefhaf. sasecfafor, IhoIdmybreafh
becausefheofenfiaI forsomefhingmagicaI fohaenisfhere.
Thesoccercognoscenfi ufRonaIdoinacafegoryaII hisown.
RonaIdoisnofof fhisearfh,saidJosMourinho, fheCheIseamanager
whoworkedwifhRonaIdoaf ReaI Madrid.
wizard,asserfedManchesferUnifed`sformermanager, SirIex
Ferguson. CrisfianoRonaIdoisfhemosfgiffedIayerIevermanaged.
WafchinghimisIikewafchingsomefhingeIse,saidToffenhamsfriker
EmmanueI debayor. If`sIikeIayingonfhePIaySfafion.
ThesorfsagenfJorgeMendes, whohasmanagedRonaIdo`scareer,
gushedaboufhissfarasif hewereanengineeringrojecf: IfwiII beimossi-
bIefoconsfrucfanofherCrisfianoRonaIdoforfhenexf6uuyears.
RonaIdo`sabsoIufemasferyof fhegamewaserhasonfuIIesfdisIayin
Novemberof IasfyearinSfockhoIm, wherePorfugaI wasIayingSwedenina
musf-winWorIdCuquaIifier. WhiIefhehomefansscreamed, Messi! Messi!
Messi!-afaunfcaIcuIafedfounnerveRonaIdo-hesmashedinfhree
briIIianfgoaIsandsnuffedoufSweden`sWorIdCuhoes. Whenhescored
hissecondone, heoinfedfofhegroundandroared, Iamhere!
HecerfainIywas. Tobefhebesfyoucanbe, youhavefobefocused,Ron-
aIdofeIIsme. Trainingyourmindisveryimorfanf. Thendisfracfionsareno
Iongerdisfracfions. YoucanremaincaImif youareconfidenf. Theharderyou
workandfhemorecommiffedyouare, fhemoreconfidenfyoubecome.
B
A HIS RIGIUS AE,
RonaIdohasachiseIIedhysiquefhaffurnsheads
andmakessonsorssaIivafe. Infhissense, he`sabef-
fer, morefuIIyreaIisedDavidBeckham. RonaIdois
nofjusfagreafafhIefebufamodeI forhowagreaf
afhIefeshouIdIook-fheguy, ifseems, hasabsinside
hisabs. Hehasbecomesoccer`smosfrecognisabIe,
ouIarandmarkefabIemegasfar; deaIswifhNike,
Samsung, andHerbaIife, amongofhers, ushedhisfofaI earningsfoR79I
miIIionIasfyear. I`veneversensedabuzzaroundaIayerasIdowifh
RonaIdowaIkingfhroughacrowd,saysRayHudson, acommenfafor
forfhebeINSorfsnefwork. ThemancouIdsfarfariofinaconvenf.
Sofarhe`ssfayedcIearof fheaIfar, bufhedoeshaveaIongfime, noffomenfion
fabuIousIyhof, girIfriend: IrinaShayk, aRussiansuermodeI whohas
aearedonfhecoverof fheUSswimsuifissue.
Onfheofherhand, aIofof eoIejusfcan`fsfandRonaIdo. They`reufoff
byhisshowboafing. SomedisIikefhewayhescowIsandsneersandsmirks, his
habifof oufingandevenweeingonfhefieId. SfiII ofhershafehisfIashy
jeweIIery, fhebeefcakehofos, fhefoo-much-hair-roducf. Overfheyears,
RonaIdohasbeencaIIedafoofbaII in-u, agIamourboyandavariefyof
disaragingnicknames: MrSIick. TheSIySeor. Crybaby. NancyBoy.
MosfIy, fhough, eoIeseemfohafeRonaIdoforhisego, which, infairness,
canbesfaggering. C

1. CRISIARA
(or|Ja', !.85n, 80k:
|ne J'|na|e nx o| soeeo,
s|ren|n, ano s|anna
3. HEI UCHIURA
(.aoan, !.6n, 54k: o'o
neoa's| ano |oJr-|ne
or'o ,nnas|cs cnano
2. ASHEA
(^, !.85n, 84k:
oeca|n'on o'o-neoa's|
ano or'o-recoro no'oer
4. RICHRIG
(^, !.5n, 88k:
nree-|ne Cross|
Canes nner
5. REERIVAIERE
(Be'Jn, !.83n, 4k:
|ra|n'e|e ano 20!3 'ron-
nan \or'o Cnanoon
September 2014
W
H
A

'
S
Y

U
R

A
Y
?
J I l | l | | l J l | | | J |
YUR
AEAWAY
'n '|e ano oJne, eene eec ne a|e 'a,
n a'a ne oe ne Be o'o, 'a
J enn, ano ae J anoao, a
Ba'on \nen Jn ae, J'' nae ne
cn|oence ake k ano eek J ne'Jn
RA'S
AY
Un a e e, Rna'o |' ne | oe|enoe
ano cJ n Tne ecno oe|enoe 'Jne n a
Rna'o acce'eae ano o'a ne oa'' n ne ne
HE USUA
I
oo'e aa |nne oe|enoe ne Jcn'ne
ano 'aJncn a cn a
HE
SIUAI
Tnee a'aaaa oe|enoe cnee n Rna'o
n a Cnann eaJe ane
6. CAVIHS
US^ n, k
oao-,Jneo 5na
ne Cnone
. ES
US^ n, k UC
cnan n 'anoeo 4
nao ke n a |n
7. ERICURRAY
eZea'ano, !.96n,
99k: ',noc ron
cox'ess oars cnano
9. ZYRUASSAVICAS
(L|nJana, !.9n, !0k:
\or'o's S|rones| |an,
oeao'||eo 524k
10. AWICE
(SoJ|n ^|rca, !,83n,
86k: |oJr-|ne \or'o
SJr|sk Seres cnano
R RE
HE WR'S
AHEE'S
VISI H.C.ZA
C
UEASH YUR EG
"||ng you'r bttr than your
r|va| |s h|pfu|." r rw
Ramsy, psych|atry profssor

BUI A VIRUA USEU


"ot your gratst h|ts and b
data dr|vn. It stoks your
conf|dnc." adr
hemadehis rofessionaI debuf. Whenhescoredhis firsf goaI for
SorfingLisbon, his momwas soexcifedsheneededmedicaI affenfion.
ManchesferUnifed`sIexFergusonsoonfooknoficeof fheboy; RonaIdo
wasoneof fhemosf fhriIIingyoungIayershe`deverseen. Hesignedhimfor
fheunheard-of sum(forsuchayoungIayer) of I2-miIIion. TheboysfiII had
bracesonhisfeefhandabadcaseof acne. Yef RonaIdoheIdsuchromise
fhaf Fergusongavehimfhejerseywifhfhe7, fhenumberof ManU`sarisfoc-
racy, wornbyfheIikesof GeorgeBesf, EricCanfonaandDavidBeckham.
Wearingfhenumber7, saidRonaIdo, wasanhonourandaresonsibiIify.
Onugusf I, 2uu8, RonaIdomadehisfirsf aearanceaf OIdTrafford.
Fergusonwrifesinhisaufobiograhy, fhecrowdreacfedasif aMessiahhad
maferiaIisedbeforefheireyes. HisfaIenf wasinsfanfIyaarenf.
He`swornshinguardsdecorafedwifhicfuresof himseIf. HebeIievesfhaf
hisjerseynumber-seven-carriesmyfhicaI owers. Hehashisownunder-
wearIine, CR7, wifhdesignerRichardChai andDanishboufiquebrandJBS.
f hisseven-bedroommansioninfheswankLaFincaneighbourhoodof
Madrid, hehasreorfedIyadornedfhewindows, furnifureandkifchenware
wifhCR7insignias. Whenhewasaskedwhycrowdsjeeredaf him,
hefamousIyreIied: PeoIearejeaIousof me. BecauseIamrich,
handsomeandagreaf Iayer.
InDecemberof Iasf year, inhishomefownof FunchaI onfhePorfuguese
isIandof Madeira, 87ukmouf infhefIanfic, RonaIdooenedashrine
fohimseIf -fheMuseuCR7. ThisbrazenmefemIeissfuffedwifhhis
memorabiIia, frohies, signedjerseysandsoccerbaIIs, evenawaxwork
sfafue. HehasbuiIf afoofbaIIer`sGraceIand. Of course, Ienfyof afhIefes,
eseciaIIyrizefighfers, sfokefheirconfidencewifheIaborafefrohyrooms.
FIoydMayweafherhashischamionshibeIfs; Lancermsfrong, hisframed
TourdeFrancejerseys. Bycurafinghisgreafesf momenfsaf fheMuseu
CR7, RonaIdohasfakenif asfefurfher: he`sbuiIdinguhisconfidence
wifhbricksandmorfar. Mymofherfaughf mefoaIwaysbemyseIf. Some
eoIemayIikeif andsomemaynof, andfhaf`sfine,hefeIIsme. Ifhinkif
heIedmefodeveIoasfrongcharacfer.
I WAS AEIRA, I HE VCAIC HIS US ABVE UCHA,
fhaf CrisfianoRonaIdodos Sanfos veirofirsf IearnedfoIovefheBeaufifuI
Game. Hewas namedaffer RonaIdReagan, whomhis arenfs admired. The
famiIywas oor. YoungCrisfianosharedaroomwifhhis fhreesibIings ina
refabbungaIowsocramedfheyarkedfhewashingmachineonfhe
sheef-mefaI roof. His mom, DoIores, cIeanedhouses. His dad, Dinis, a
gardener, hadadrinkingrobIemandanofher affIicfion: ftbol.
Wifhhis arenfs` encouragemenf, IiffIeCris IearnedfoIayinfhenarrow
sfreefs aroundhis house. This is howhis foofworkdeveIoed: hegrewfired
of chasingerranf baIIs downsfeehiIIs. ccordingfoBonolJo, byLuca
CaioIi, fhebiggesf worrywas meanoIdMr gosfinho, whodofedonhis
garden. WhenabaII Iandedinhis yard, hewouIdfhreafenfouncfureif.
Cris Iearnedanimorfanf Iesson: if youwanf fokeeIaying, you`dbeffer
nof makeamisfake.
InfhejuniorIeaguesof FunchaI, hesoonbecameasfandouf. Hisdadwas
fhekif manforfhefeam, handIingfheuniformsandequimenf andush-
ingCrisfogreafergIory. PeoIecaIIedfheboyAbelbinbo(LiffIeBee) forfhe
high-energywayhescurriedoverfhefieId. HecouIdn`f sfandfoIose. He
wouIdcryif hedidn`f winorif afeammafedidn`f feedhimfhebaII. Whenhe
wasI2, hefIewfofhemainIandforafriaI wifhfheyoufhacademyof Sorfing
Lisbon, oneof PorfugaI`sfocIubs. If washisfirsf airIaneride, andhecried
fromhomesicknessandfheainfuI ressureinhisears.
Buf fheIankyrosecf wasaninsfanf hif. Thisone`sdifferenf,fhecoach
whiseredfoacoIIeague. He`ssomefhingseciaI.ndsoCrisfianoIeff
MadeiraandcamefoIivefuII-fimeinLisbon. f firsf, fheofheracademykids
faunfedhimforhisisIandaccenf. ssoonasIoenedmymoufh,hewrofe
inhismemoir, Moments, fheyimmediafeIysfarfedIaughingandmocking.
IfeIf IikeacIown.
CrisfianomissedMadeiraandhisfamiIysomuchfhaf severaI fimeshe
camecIosefogivingu. HecriedconsfanfIy. f fheageof I4, affer hefhrewa
chair af his feacher, hequif schooI anddevofedhimseIf fuII-fimefosoccer.
HeracfisedreIenfIessIy. His risewifhinfhecIubwas Iighfningfasf. f fhe

E
BGR CHES
a a a
a a

GE CE
a
a
a a a Ra
f faf ewaeecf febywdeadaf badabf Iafcua,
feaaededRonaIdo`sscreamingandamafeurdramaficsandhis
fendencyfohoIdonfofhebaII fooIong, erformingfIamboyanf fricksfhaf,
whiIeimressive, weren`f necessariIyeffecfive. RonaIdowas, wrofe
Ferguson, aweeshowoff... deserafefoconvinceeveryonehowgoodhe
was.Buf RonaIdosfroveconsfanfIyforoof ouf fhebadandbuiIdonfhe
good. TheracficeefhichecreafedwifhinhimseIf becameaconsfanf.
Jusf ashewasbeginninghisriseaf ManU, fheyoungIayermef wifh
famiIyfragedy: hisfafherdiedof Iiverdisease. RonaIdo, onIy2uyearsoId,
wasdevasfafed. Thedeafhremainsawoundfhaf hassfiII nof heaIed,he
wrifesinnts. IcohoI wreckedhisfafher`sheaIfh, whichisoneof fhe
reasonswhyfodayRonaIdodrinksocassionaIIy. HeisaIiveinmymind,
RonaIdohaswriffenof hisIafefafher. IfeeI hisresence. Icannof exIain
if, buf somefimesIfeeI fhaf Ihearhisadvice.
Inmanyways, FergusonfiIIedfhevoid. Numbersevenfhrivedduringhis
sixyearsaf ManU, mafuringhisgame, scoringmoreandmoregoaIs, heIing
fhecIubsecurenumerousfifIes, andwinning(in2uu8) hisfirsf BaIIond`Or
award. Fergusonnofesfhaf RonaIdo`sgreafesf sfrengfhismenfaI, hisdesire
forunwifhfhebaII againsf aII oosifion. Therearedifferenf formsof
courageandfhaf oneisfhebesf one,FergusonfoId1beGuorJion. You`ve
gof IadswhowiII runfhroughabrickwaII, IadswhogoinfofIyingfackIes,
fheywiII Iaywifhcuf heads, buf fhecouragefofakefhebaII aII fhefime
isafanfasficcourage.
LikeaII ambifioussons, RonaIdoevenfuaIIyhadfomoveonfromhisfafher
figure. In2uu9, heaccefedanofferfromReaI Madrid, whichaidManches-
ferafransferfeeof 8u-miIIion-byfarfhegreafesf sumfhaf hadeverbeen
aidforasoccerIayer. RonaIdodidnof disaoinf, scoringgoaIsinwhaf`s
beencaIIedindusfriaI quanfifies. Inhisfirsf seasonwifhReaI, hescored88.
Thenexf yearhefaIIied6I. Theyearafferfhaf, 66.
Hisfimeaf ReaI Madridreachedanaofheosisfhisasf sring, whenfhe
cIubwonfheChamionsLeagueFinaI inLisbon, PorfugaI, againsf crossfown
rivaI fIficoMadrid. RonaIdoscoredarecordIgoaIsfoowerhisfeamfo
fhefinaI, fhoughhiserformanceinif wasunremarkabIe. Hedidscorea
enaIfyIafeinfhegame, whenReaI wereu8-I. If was, inaway, ameaning-
IessaddifionaI goaI, buf RonaIdomadeheadIinesanywaybyriingoff his
shirf, fIexinghismuscIesandroaringHuIkHogan-sfyIeinahigh-fesfosfer-
oneceIebrafion. If wasaveryRonaIdomomenf, adisIayof egoandnaked
emofionfhaf manycharacferisedasdisfasfefuI. E
RonaIdohaddaredfofIyhigh, andonfhaf nighf he`dwonfheworId`s
greafesf cIubfrohy, onhomefurf. ThecIownwasking.
EE WH W IG S H R
has noficeabIymafuredas a ersonandanafhIefe
since coming foReaI Madrid. Mosf of fhe bad
habifs fromhis Manchesfer Unifeddays have
aII buf vanished. RonaIdohas become a fruIy
seasonedafhIefe, a Ieader onfhe fieId, nfonio
Gasar, RonaIdo`s Iongfime hysiofheraisf, feIIs
me. I`ve enjoyedwafching howhe`s evoIved. He`s
sfiII sfrong andfasf andquick, he sfiII has fhe fechnicaI abiIifyfodazzIe,
buf he Iays smarfer andhas fhe exerience andmafurifyfofake beffer
advanfage of his assefs. If`s fhaf fIeefing momenf af fhe eakof an
afhIefe`s frajecforywhenhis hysicaI mafurifyis insync wifhhis
emofionaI deveIomenf. RonaIdo`s come foreresenf exceIIence as an
achievemenf, nof jusf as a giff, says GrahamHunfer, whocovers La Liga
for ESPN.
Infacf, somearguefhaf RonaIdo`sragingseIf-confidenceandursuif of
erfecfionarewhaf haveheIedhimreachandsfayaf fhefo. Thedayfhaf
hesfosfryingfobeerfecf wiII befhesfarf of hisdecIine,saysHudson. His
arroganceisfhefueI fofhefire. If acceIerafeswhaf`sdrivinghim. DeaIingwifh
if onaday-fo-daybasismusf beabsoIufeheII. PressurecankiII Iayers, won-
derfuI Iayers. Buf Crisfianowearsif IikeaneckIaceof Carfierdiamonds.
RonaIdo`sfimeaf ReaI hasaIsobeencharacferisedbyinfenserivaIry. In
anyofherera, hewouIdrobabIyhavebeenjudged, handsdown, asEuroean
BR WIS CEBIES SSERE
GESHE WIS WIER WERS SCIE
GSER GE GB RECGII RECRS
H|s arrogance |s the fue| to the re. It
acce|erates whatever |s dr|v|ng h|m. Dea||ng
w|th |t on a da-to-da bas|s must be he||



Yef fheBarceIonaforwardhasbeenadominanf forceincIub
soccer, winningfheBaIIond`Orawardfourfimes. Messi`srominenceand
ouIarifyhavecreafedconfinuingfrusfrafionforRonaIdo. Foryears, he`s
friedfobreakfheMessi seII.
RonaIdohasgrownfiredof comarisonsfoMessi. If`sossibIe, headmifs,
fhaf fhefwoafhIefeshaveservedasmufuaI goads, heIinginsireeachofher.
Buf, hehassaid, Idon`f comefeagainsf Messi. Icomefeagainsf myseIf.
ndashefoIdme: IIikefofocusonmyseIf. Iammoreconcernedwifhmy
owngamefhanIamonrivaIs.
RONALDO'S EVOLVING MATURITY ON THE FIELD HAS ALSO BEEN
insiredbya facfor off if: fafherhood. On8JuIy2uIu, RonaIdo`s Facebook
andTwiffer ages osfeda curious announcemenf: If is wifhgreaf joy
andemofionfhaf I informyouI have recenfIybecome fafher foa baby
boy. For fhe miIIions infhe RonaIdoshere, fhis news was eIecfric. Buf
if raiseda quesfion: whowas fhe Iuckymofher Irina Shayk, RonaIdo`s
girIfriend, hadnof beenregnanf.
RonaIdoaskedforrivacy, buf fheworIddecIined. RumoursswirIedinfhe
fabIoids. Wasif asurrogafeone-nighf sfandWhoeverfhemofherwas, he
reorfedIyaidIu-miIIionfosiIenceherbeforefakingfuII cusfody. If wasas
fhoughRonaIdohadsingIe-handedIysawnedaMini-Meanderhaseven
Iannedif. In2uu7, RonaIdowrofeinhisbookfhaf hewouIdIikefohavea
chiIdsomefimebeforegeffingmarried.Hewenf on, If if isaboy, fhenhe
shouIdhavefhesame'foofbaII` genesasme. IwiII nof sayIwouIdIikefohave
acIone, buf hoefhaf oursimiIarifieswouIdbeeasyfonofice, af aII IeveIs.
CrisfianoRonaIdoJrisnowanadorabIefour-year-oId. Isaf nexf fohim,
erchedhighinRonaIdo`srivafebox, foraLaLigagameaf Madrid`sSanfi-
agoBernabuSfadium. TheboyromedaroundfhegIassed-inchamber,
sfyIishIydressedindesignerkiddiecIofhes, asawaifressserveddrinksand
IberianhamandfhemafchunfoIdedinfhegreendefhsbeIow. RonaIdo`s
mofher, DoIores, wasinchargeof fheboyfhaf day. ThekidIooksaIof Iike
hisdad, wifhanimishgrinandaknackforfIashingfhefhumbs-usign.
RonaIdoisufferIydevofedfohim. Fafherhoodisamazing,heIaferfeIIs
me. MysongivesmeaIof of joy. If`saImosf Iikeadreameveryday. F
ONE COLD DAY IN JANUARY THIS YEAR, IN ZURICH, SWITZERLAND, PEL
sfoodaf fhe odiumof fhe Fifa BaIIond`Or resenfafion, a gIifzyevenf
sfage-managedforesembIe a show-business awards show. The BraziIian
afriarchwas fhere foannounce fhe winner of foofbaII`s mosf resfigious
honour. The rize is givenouf fofhe Iayer whooufshone aII ofhers fhe
revious caIendar year.
sPeIheIdfheenveIoe, fhecamerascuf befweenfhefhreenominees-
France`sFranckRibry, rgenfina`sLioneI Messi, andof course, RonaIdo. He
wasdressedinasheenybIackfuxandbowfie. Shayksaf af hisside, her
gIossedIisursedinanficiafion. PeIoenedfheenveIoe: Thenameis...
CrisfianoRonaIdo.RonaIdokissedShaykandsfrodefowardsfhesfagefo
givePeIahug. ThenCrisfianoJr, imeccabIydressedinacardigansweafer
fashionedfoIookIikeafux, waIkeduonsfage.
Thankyoufoeveryone,RonaIdosaid, fighfingbackfears. Therewasnof
afraceof arroganceinhiseyes-hewashumbIe, andhisvoicebrokewifhraw
emofion. HefhankedhisfamiIyashismofherbeamedbackwifhride,
dabbingherfacewifhahandkerchief. RonaIdoheIdufhefrohyforaII fo
see-agoIdensoccerbaII, desfinedforhismuseuminFunchaI. PeoIewho
knowmeknowhowmanyeoIeheIedme,hesaid. If Ihaveforgoffen
anyone, IdoaoIogisebecauseIamdeeIymoved.
FinaIIy, forfhisyearaf Ieasf, fheMessi seII hadbeenbroken. RonaIdo
drankinfheaduIafion, buf fhenhisfearyfacehardenedinfoamaskof
deferminafion. YoucouIdsensehewasaIreadymovingbeyondfhis
ceIebraforymomenf, couIdseefhefireandworryinhiseyes.
Thismonfh, fhe2uI4LaLigaseasonkicksoff, andRonaIdo, fhenxious
One, wiII besfarfingaII overagain, resuminghisquesf forerfecfion.
Nowyou can get
a chiseIIed body
without Ieaving
the comfort of
your IoungeI
Y0UR
FlTTEST
B00Y
STARTS
HEREl
CRU5HY0UR S0L5I
LeL meLo|| Lr|n|nq experL, B.d.
0ooour rve our oo or ou w|Lh
Lhe |e|tc F|t 5eeJ 5|reJ DvDs.
Set cooI Womn' Hlh
gear for your partner and
turn up the heat together!

TKE lT UP
SERI
he M| B|q Books hve
|| Lhe |no ou neeo Lo
qeL |nLo Lhe esL shpe
o our ||e.
oaoo oe na 0
e ae. Tn aa oe
eao n oo, |a ne o
e o. Ee-ee ae
ae o|e oecoeo ne |a
0 e, ne oo ne
oaoo coeo oe na a
ae o| n oa a eao.
8IANkA
Ee occe a,e ca e
eeceo o a 00,
Noea eeacne |oo.
So ao ae cca |o a
|oao, no eeo o , |o
neaoe. ^Bn oocea,
eaeo oaoo , o||
on |ee a c NB^-on,
no. Tna ea ne ca neao
ne a ne . ee nn.
8I8kI
' a ,ca ae, oaoo
e a a o eeo
o| ao 4n. = eoe
acceeao ao nn occe
'Oeaoe n|o |e oaoa
J |na| oJ|a| |ne o||oe
|ao. =e ao na ea|
oaace ao ooo, co|o
ao ca cnae oec|o
oJc, - o ne ooo,
ne |ne J|a|e ae oeae.
Roaoo aoe |o ooce |ne
ae |a|e |na o|ne oa,e,
a, Po|eo Zoe \nJ|,
oec|o o| Pe|oace \o.
E|e a|ne|e oeeoo |a|e
e,e oee|, oo a| Jo
|o ee oace oe ecoo
eJ |ne aeae oeo
ax o| |e. \ne ne ooo
a| a oe|eoe, ne a|cne |o
oee| cJe ne ae-
|noJao o| oeJ|a|o
oa |onoJ o| oa, - ao
ne ooe |n JcocoJ,.
|AI08
Roaoo ca c exooe,,
ooe |ne oa a| a |eocoJ
!30n. SJoeo |ecnoJe
eaoe n|o ao |ne oe
o| n |oo| aoJo |ne oa ne
|a |ee c, a |ne
oa o o Jcn |na| | na a
aaoe |a,ec|o, o| Jo |o 2.
- ea|ne oooo|ea
oaeeoe neoe.
P08
8P0


2
0
1
4
P
O
S
T

R
S

R
I

S
wn|oad the en's Health Persona| Tra|ner App today

l

Men's HeaIth PersonaI TraIner App a'ao'e |or ,oJr Pnone ano Pao. Ce| 'eaner, |||er,
s|roner ano nea'|ner |ooa, |n nore |nan 350 oersona'seo |rann ororannes |or oenners
ano oros. Don'oao | no|or |ree.

80I88I0h0Fh8:

8
8
0I
800
80
808I
8888?
88
8IhIh0
h0

J08hh8080
30.11.14
P
R
E
S
E
N
TE
D
B
Y

Not for SaIe to Persons Under the Age of 18.

D
C
_
8
0
8

_
N
H




... ..4)':|: ;.'!: |. t4.'!; 4:| '. !! t'. .!|'' '| '''t .'' |: .!:
J);.!: ... .' t'''t |. '| 1t|:. '| |: .';| ;:. :t| ..|t !! :/):.| |')t
J:!|':4:! t|.| ... t4.:.t
September 2014

a meaf evieffe. f nf fhaf fheye
anfi-fhing-fhaf-aenf-meaf; fhey jf
eaIIy Iike fhei meaf. nd fhey hId.
f damn gd.
CaIIie w, fhe winemake af
eIeinbeg and c-wne wifh Caig
Ifz f SfhenSmke, exIain why
if gd whiIe chewmy way fhgh
a meaf evieffe bIging wifh IIed k.
The ean, he ay, i becae if been
cking f haIf a day. Wee na famf-
ide Riebeeck afeeI fhaf eched na
addIe Iking dwna Ie fhaf cacade
fwad fhe gnaIed bh vine f fhe
SwafIand. The ef f fhe b
feami hee f. Y knw, f eeach.
Wee infhe hadwf a ban, fanding in
fnf f whaf wa nce anai-cndifining
nif fhaf ha ince beenfned inf a
mke fhgh fhe boer-ook-n-plon
ingenify f Ifz and w.
w, wiing hi fehead nde fhe
bimf hi fcke ca, exIain whaf
gne inf fhe meaf-making: wdchi,
a gaIic and mfad b and - mfIy -
afience. wned fhe mke af
8amand nwhe fafing fhe fif f hi
Iab - fende k fhaf Iide fhe
bne affe having enf h abve fhe
mIdeing wdchi.
e haI fhe caameIied meaf f
f fhe mke. Ce a bnch f jn
gnawing af hnk f k, beef hf ib
and Iamb, and wigging gIae f fhe
neighb deeambe ndia aIe Ie.
nd fhen we decided f fef if
f eIve. The fIIwing mnfh
edifiaI bdgef incIded a hnk f
eefd bikef, a Iab f hf ib,
fhe hIde fma ig fed n acn in
Igin and a yeIIwfaiI fmfhe fIanfic.
T aif wifh fhi gIi exeimenf,
we caIIed efe e-Wd, wne f
ifchen Cwby andMosterbef Sfh
fica jdge, fmanfhe fng a he fk
fhgh fhe BBQugrade every man
shouId make.
Braaing isn`f barbecue, he says. We
haveafendencyfofhinkif`s oneinfhesame,
buf if`s disfincfIy dierenf. Braaing is, as
fhe mericans say, griIIing. If`s infensive
cooking: you uf somefhing direcfIy over
fhe coaIs, sear if and cook if quickIy.
Wifh barbecuing, if`s abouf indirecf
cooking, so you`re generafing and reguIaf-
ing heaf, buf you`re nof cooking direcfIy
over if, Goe-Wood exIains. You`re aIso
using smoke fo davour somefhing, so if`s a
disfincfIy dierenf fechnique and if`s usu-
aIIydonewifhmuchIarger cufs of meaf.
This is smoking. The meaf doesn`f
come wifh a Disney noveIfy foy and if
doesn`f come quickIy. nd fhis is why
CaIIie Louwdoes if. SoufhernSmoke isn`f
a franchise emire; if`s anexcuse fo have
a good fime. We`re going fo showyou how
fo make fhe move fromdiing chos fo
buiIding banquefs. Because if`s mandafory
fo make nres, drink beer, Iay wifh gad-
gefs and faIk shif wifh mafes. Whaf`s nof
fo Iike? Sfo saIivafing and sfarf smoking.
1/SMOKE STACK
The aircon unit
that became
a smoker at
Southern Smoke.
2/APPLY THE RUB
Liberally coat
the meat with a
dry rub two hours
before smoking.
3/DELICATE FISH
Oily sh Snoek
and Yellowtail
work best.
4/SMOKING FEAST
You can smoke
anything.
Just prepare a
timeline.
5/BEERS & STEERS
Craft beer pairs
perfectly with
smokey BBQ.
6/LOVE THE PIG
Pork shoulder is
cheap and never
fails to deliver
avour.
7/SPARE A RIB
Smoke ribs four
hours before
game time for
starters.
8/SMOKE-MASTER
Chef Pete Goffe-
Wood slices
12-hour brisket.
September 2014
ll Ihc Innla,
Icchniquca, rccipca
undakilla ynunccdIn
aIurI building mnrc
dclicinua, nuIriIinua
mcula Induy


as|es, sa,s
Cra C'J|z o| SoJ|nern
Snoke. So |ake ,oJr
|ne. '|ake a |re.
S'o| | n. Drnk oeer.
v|ce
fromthe best |n the
meat bus|ness

'| ,oJ o |o a sJoernar-
ke|, ,oJ're no| on
|o oe ao'e |o ask |or
aoce on no |o cook
|nns ,oJ're no| |an'-
ar |n, ^no, enner,
oJ|cner |ron ranke
enner |ea| |ercnan|s,
sa,s. ''| ,oJ're oJ,n
nea| |ron a oJ|cner,
,oJ can |ake nn a
oc|Jre ,oJ'e seen
or oescroe a cJ| |na|
,oJ'e nao sonenere,
ano ne''' cJ| | |or ,oJ.
Tne,''' kno nere |ne
nea| cane |ron, na|
|ne anna' a|e, no
o'o | as nen | as
s'aJn|ereo ano no
'on |ne nea| nas nJn
n |ne co'o roon.
September 2014
9am J| |n ork snoJ'r n
6am |r| |n r n J|
n ,oJr 6k rsk|
7am | |n n| norn |n
0 n 30 o k |o
o''o |ns |n'n |o 'n ,oJr snok, O
|o oer|ec|on. '| ,oJ're oon seera' cJ|s n
one snoker, 'oao |ne neaes n |rs|.
WHEN ANDY FENNER OF FRANKI E FENNER
Meaf Merchanfsbuyshismeaf hebuysfheenfire
carcass. There`samovemenf heexIains fowars
nose-fo-faiI eafing whereeoIeareusingasmuch
o fheanimaI asossibIe insfeao ickingfhe
commonIyuserimecufs. I fheanimaI is
sIaughfere if`sourresonsibiIifyfoIiferaIIy
eaf asamuchaswecanhesays. Froman
en-consumeroinf o viewfherearesome
increibIyunerrafecufsfhaf aremore
cosf-eecfiveanerecf orsmoking.
We`re very orfunafe in Soufh rica in fhaf
meaf is reIafiveIy chea an because o fhis we`ve
never ha fo use fhe whoIe animaI says Goe-
Woo. There are Iofs o eoIe who say 'I grew
u on a arman I use fhe enfire fhing` buf
or us fownies growing u in fhe suburbs meaf
comes in ackefs an fhaf`s whaf you`re use
fo buying. You sear some sirIoin you griII some
rum you roasf a nIIef. You`ve never ha fo fhink
abouf uffing somefhing in fhe oven or our or
nve hours an sIowIy braising if. Nose-fo-faiI
eafing means geffing in fouch wifh fhe resf o fhe
animaI an showing fhe beasf some resecf.
Fenner agrees. We`ve gof fo honour fhe
animaI by seIIing every scra we can.
Snokn orks oes|
|n |ne 'esser-knon
cJ|s |na| are |oJno
oreoonnan|', n |ne
|oreoJar|er, sa,s Caoe
Ton nea| nercnan|
^no, enner. Tnese
are |ne seconoar,
cJ|s, ano na| |ne,
'ack n orce, |ne,
nake Jo |or n |'aoJr.
Co |or o s'aos o|
orske|, snoJ'oer ano
ros, ra|ner |nan orne
cJ|s - sJcn as rJno,
|''e|, sr'on. Cne| Pe|e
Co||e-\ooo exo'ans:
'BecaJse |ne,'re |ne
orkn oar| o| |ne an-
na', |ne, neeo a '||'e
o| nore ork ano a o|
nore |ne, oJ| |ne,'re
a 'o| |as|er. To orn
oJ| |ne |a||, |'aoJr ano
oreak oon |ne nea|, |
reoJres cookn | 'on
ano s'o. CJ|s 'ke ors-
ke| are oea': |ne,'e
o| a nce 'a,er o|
e'a|noJs |a| oJ| a||er
!0 noJrs |ne,'re so||
ano |a'' aoar|.
Tne cJ|s |na| e're
s'o', szz'n n |ne
snoker are |ron cos
|na| razeo |ne oas-
|Jres o| PaJ' C'Jer
\nes n E'n \a''e,,
no| |ar |ron Oak \a'-
'e, nere |ne o |na|
orooeo |ne snoJ'oer
soen| |s oa,s nJncn-
n acorns. '^'' |ne oee|
|na| e se'' s !00
rass-|eo, enner
sa,s. 'ron an e|nca'
oon| o| e, |'s nJcn
oe||er |or a co |o oe
ea|n na|Jra' rass |or
|s oes|on. '| a'so oro-
oes nore cono'ex|,
n |ne |'aoJr oro|'e o|
|ne nea|.
PORK SHOULDER
BEEF SHORT RIB
BRISKET
PORK RIB


September 2014
1pm .
12pm Renoe |sn |ron orne,
snoke |or 20 nnJ|es. En,o,.
11am PJ| |ne snor| ros n.
-Wooduses a
meaf fhermomefer
foensure fhe righf
infernaI femera-
fure. For besf resuIfs,
use a bif of chef sci-
ence! Goffe-Wood
adises: For
mediumrare if
shouIdbe 66; u
for medium;
and6 Ius for
eII-done.
KnowWhen
|t's one
aIcuIafe our cook-
ing fime beighing
our meaf andsmok-
ing for fohours er
kiIogramaf a consis-
fenf femerafure,
Goffe-Woodadises.
f`s nof a fierce heaf
soif fakes Ionger fo
enefrafe a fie-kiIo
iece of meaf fhan
ou`dfhink, Goffe-
WoodeIains. You
anf if genfIe sofhe
meaf doesn`f Iose ifs
moisfure.
o the aths
Wifhsmoking, heaf
fakesaIofIongerfo
enefrafefhemeaf,
soifneedsfobecon-
sisfenf-fheheafof
fhesmokershouId
hoerbefeenIIu
andI8u. Goffe-
Woodrecommends
fhaffhemeaf`sinfer-
naI femerafure
shouIdbebefeen
7uand9u. f ou
smokedabigieceof
meafaf2uu, ou`d
gefif donequife
quickI, bufou`dIose
fhemoisfure; ifouId
bedrasabone
becauseououId
haeshockedaII fhe
Iiquidoufof if.
Keep a teady
Core
oaf our meaf ina
generous ruband
massage if info
hours before cook-
ing. The saIf andfhe
sugar sfarf fodra
some of fhe juice ouf
of fhe meaf, andif
nafuraIIsfarfs fo
cure if andfhaf
forms a IiffIe bif of a
sfickasfe, Goffe-
Woodsas. nsfead
of jusf uffing a dr
rubon, fhe meaf
juices are dranouf
andou`II gef a beau-
fifuI crusf fhaf iII
imarf a rich, faff
BBQfIaour.
ub |t n
Goffe-Wood
recommends sfarf-
ing sIoIandsmok-
ing a rime cuf Iike
fiIIef or rum. The
don`f needIuor I2
hours; if`s somefhing
oucandooer an
hour or fo. Eeri-
menf ifhfhaf and
gef comforfabIe ifh
generafing smoke -
buf be carefuI: You
can`fIeffheoodchis
ignife because fhen
ougef a er acrid
fasfe. f`s a deIicafe
baIance. Sfarf ifh
somefhing smaIIer
fhaf oucandoinan
affernoonandfhen
sIoIrogress ufo
Iarge ieces.
tart |mp|e
ete ohe-Wood, chef and outh fr|ca |udge, ta|ks you through the sc|ence of smok|ng
What you'|| need
J NN |
| J| N
| | | | | | | N
| | N |
J | |N JJ |
J J | | | |
J |
J | | | |
| | | J N
| NN | | | |
ake |t
Roas| a'' o| |ne seeos
|oe|ner n a oan |or a
|e nnJ|es ano |nen
rno |nen n a
o'enoer n|o a |ne
oooer. Conone
|nese soces |oe|ner
|n |ne res| o| |ne
nreoen|s.
Comb|ne the fo||ow|ng
J| N | J|JN
| |
J| | | | |
J| | | | |
J| |
J| |
|N JJ |
| J | | | |
| J|JN J| N

10am Soak a |sn
( oea' ' , ,e' ' o|a ' , n orne.
September 2014
0 I
'Peces ea| skeo r
!0 nJrs '|era'', 'k 'ke
an| oeces cnarca',
sa,s e-o. e'ax.
'Tns s na| naooens, oar-
|cJ'ar', ,J'e | soce
rJos |n sJar n |ne. Tna|
sJar s n | carae'se
n |e. Js| cJ| |ne o'ack
J|er 'a,er , ne aoses.
I Y
es|n |ne ea| s essen|a',
sa,s e-o. '| a''s
|ne s|Jre | oe re|aneo
ano |ne nea| ano c'Jr |
oe een', os|roJ|eo. e
aoses res|n ,Jr ea| r
aoJ| 20 |ne ckn
|e. 'Tne anser | keeo-
n |ne ea| ar n'e |ns
res|n oero s |akn o'ace
s | rao Jo |ne ea| n |n
' ano |nen o'ace | n| an
eo|, c'er ox. ^|er res|-
n Jr ea| r | nJrs |
as s|'' oon n| ano e
's| r|Ja'', n 'oJo.
II, II
Ooenn ano c'sn |ne
sker | cneck ,Jr ea|
s n| rea'', a oro'e as
'n as ,J on'| o | eer,
!0 nJ|es, sa,s e-o.
'Cneckn | J| nce eer,
| nJrs sn'| a oro-
'e. BJ'on a re | !!0
oesn'| |ake a 'n |e, oJ|
reoJres 'ance.
Howo urn pr
u |no u||mate
man mea|
1 , Y00.0
The |g Green gg
(Large)
h g rgg
s fh

f g
v f`s vrsf
ghfgr sfs
hs wrs s
w s wrg s
v sr
h`r fh
ssfh`r s
ffh`r
frfhf
ss
1 5,
I.0.Z
The Mono||th
s rsg
fhs s s
rv
vrgg
frfrs r
8ufo88u. Youcan
sef if af a goodfem-
erafure andif can
reguIafeifseI, oe-
WoodexIains.
They`re goodaf
mainfaining fhe
femerafure.
, .0
Weber Smokey
Mounta|n 57cm
I you`ve beenusing a
Weber, fhis is a greaf
nexf sfe. Boosf your
briskef`s Iavour wifh
fhis barbecue
designedor sIow
cooking meaf, ouI-
fryandish. If`s er-
ecf or IowandsIow
barbecuing and
hof smoking.

..|
|JJ
\J/.
romcater|ng
for crowds to
smok|ng
snacks, we've
got you covered
5pm S|ar| s|eern |ne n|erna' |eoera|Jre
| ,Jr oreerence: r eoJ rare. 60 r
eoJ. 6 r e'' one.
3pm e,, nae an|ner
oeer. Tns s naro rk.
2pm Cneck |eoera|Jre. J an|
!!0 | !30C ano a cre |eoera|Jre
0 | 90.
4pm eo'ensn cno sJoo',,
na' a cJo a| a |e.
September 2014 | MH.CO.ZA 165
ak sx cJos o| ooocnos n a|er
|or a| 'eas| 30 nnJ|es or oernn|.
'n|e |o cJos o| or, ooocnos oer
|ne no| coa's ano e| |nen snoJ'-
oern [A]. eeo ,oJr oro |ra, [B]
orec|', oe'o |ne nea| |o co''ec| |a|.
P'ace snoker oox oer |ne no| coa's,
aoo na'| a cJo o| soakeo ooocnos
|o |ne oox ano c'ose 'o.
P'ace |ne orske|, |a||, soe Jo, on
|ne ra|e as |ar aa, |ron |ne |re as
,oJ can [E]. C'ose |ne 'o ano snoke
|ne nea|, ress|n |ne Jre |o ooen
|ne r'' reJ'ar',. ^o,Js| nea| as
neeoeo |o keeo |ne |enoera|Jre
s|eao,. Cneck |ne cnos eer, 45
nnJ|es or so, aoon soakeo ones
o, |ne na'| cJo|J' as neeoeo |o keeo
a s|eao, sJoo', o| snoke.
Tne ooocnos [C] '' s|ar| |o
snoJ'oer ano re'ease a s|rean
o| snoke [D]. To e| nore snoke
|noJ| ncreasn r'' nea|, aoo a
|eor, cnos anons| |ne e| ones.
0 w8.00.Z
Sta|n|ess Stee|
Smoker Box
H0w I0 8I 0P
Y008 08|
e
your barbecue skiIIs
before yousheII ouf
your cash, fhis
smoker boxis your
firsf orf of caII. If fifs
infoyour average
Weber braai, andyou
addyour chis wifh
fongs as yougo. This
is whaf you`re Iooking
for for a smaIIer iece
of meaf or fish,
Goffe-Woodadvises.
WiIhu Ihcrmnmc-
Icr, ynu'll huvc unidcu
nI Ihc inIcrnul Icm-
pcruIurc nI Ihc mcuI.
Bccuuac ynucun'I
wuIchIhc cnnkcr Inr
1uhnura, Ihc hcuI will
drnpnvcr Iimc nr iI
mighI Ilurc up," auya
GnIIc-Wnnd.
GET
THERMOMETER
Whcnynu'rcamnk-
ingInr mnrcIhunIivc
hnura, anukIhcchipa
inwuIcr InmuinIuin
ulnwcr IcmpcruIurc.
Fnr ahnrI buraIa, likc
Inr ycllnwIuil Inr cxum-
plc, drychipa urcbcaI. A
highcr IcmpcruIurcwill
cnnkIhcIiahquickly."
SOK 'EM
Kccpuncyc nnIhc
Iirc," hc wurna. I Ihc
windcnmca up, mukc
aurc Ihc cnula dnn'I
Ilurc. Thcrc'a ulan u lnI
nI IuI IhuI cnmca nII an
ynu'vc gnI In mukc aurc
IhuI dncan'I cuIchIirc:
iI iI gnca up, iI'll juaI
burnIhc mcuI."
NOT ON
OUR WTH
ExIru vidcn wiIh
cxcluaivc inaIrucIinn
undIipa Irnmnur BBg
cxpcrIa undchcIa uI
MH.cn.zuJvidcn
MORE BBQONLlNE
Got a Weber?You've a|ready got a
smoker. Fo||owthese tr|cks and upgrade
your BBQarsena|
C
D
E
B
A
6pm Renoe nea| |ron snoker, 'e| | res| |or
|o noJrs n |n |o' n a coo'er oox.
8pm Ea| |ne nea| a'reao,.
7pm =e,, |nose oeers aren'| on
|o ornk |nense'es.
Cheers!
MH.O.Z | September 2014

Q
Hon|gk||p B|onde
-noooeo Be'an-
s|,'e o'onoe s a nore |'aoJr-
sone reo'acenen| |or 'aers.
'|'s a rare one so | ,oJ see |,
oJ, |.
Or tr th|s one...
Dar||ng Nat|ve A|e Tns s a oa'e
a'e |na| nas n'o o||erness, oJ|
s er, e'' oa'anceo ano naoe
|o oe orJnk eas', ano o||en
Ch|ntsa Emera|d Va|e Pa|e A|e
'| ,oJ'e cone across |ns one,
| as e|ner on a no'oa,
|o |ne Transke or |ron a |reno
no oroJn| sone oack. Ln|,
|rJ|,, eas,-on.
Or tr th|s one...
Three Sku||s Graved|gger
B|onde A|e Tns one sJ|s nan,
oa'a|es ano nan, occasons. '|
nas enoJn |'aoJr |o aoo
cnarac|er, oJ| s a'so c'ean -
rea| | ,oJ're ne|o cra|| oeer.
CBCLager
Tns one's a'reao, an o'o
|aoJr|e |n a nce oa'ance o|
see| ano o||er. TrJe |o |orn
|or an a''-ran 'aer, |'s nore
|J''-|'aoJreo |nan o|ner 'aers.
Or tr th|s one...
Brewers & Un|on Dark Lager
Tns or,, e''-noooeo 'aer s
crso ano re|resnn, n'e s|''
oso'a,n sone o| |ne rcn oark
na'| cnarac|ers. Ln| nooo,, |ns
cono'ex oeer nas a near|, |as|e.
What ou'|| need
' | ' | | |J |
| | N|
|| | | ' | N
J| ' | J |
' | | | | | | |
Make |t

What ou'|| need


| | |
' |
|JN ' |
' | N | | | | | | | '
' | | | | | | | | | J| N'
|J' | '
Make |t



What ou'|| need


|| | | | N
| ' || | |
| |J '
| | | | | N | |
| J| | '
' | |' | | J| |
| ' |
' | |J|
| N | | NN| | | | | | |
| | | ' N| |
| | | |
' | | | ||
|J| ' | | ' |
Make |t
1



Iuminufes
unfiI fheeggis cooked
andfhemixfurebegins
fofhicken. ddfhe
creamandconfinue
cookingfor afurfher
minufes.
3 Removefromfhe
heaf andIeavefocooI,
fhenaddfhehorserad-
ishandseasonfofasfe
wifhsaIf andeer.
Pour over fhecabbage
andcarrofs, mixing
fhoroughIy.
\\|. J \\/
Ye||owta||s and pa|e a|es - |t's not a|| about
the meat
ON THE S I DE

A 0 v L R T l S l h 6 P R 0 M0 T l 0 h
Busting
5ugar Myths
ur in mortion n
prt o Ity it
Sugar isn't all bad and the good
news is this delicious sweetener
can be a part oI a healthy diet,
as long as you keep your intake
moderate.
You gan weght when you eat
more kIojouIes than your oody
can ourn, and excess kIojouIes
are stored as at. No sngIe
actor causes weght gan, so
rather than eImnate specc
oods, t's oetter to match the
amount o energy consumed
rom ood wth the amount o
energy expended.
ln act, addng a IttIe sugar
to nutrtous oods, Ike on
your whoIegran cereaI, may
encourage you to eat more o
these heaIthy oods oy makng
them more tasty, accordng
to CIncaI Nutrton. $ugar s
aIso mportant or when you
need energy, (Ike durng an
endurance run).
Many peopIe assocate sugar
wth a trp to the dentst, how-
ever, aII caroohydrates can
controute to the ormaton o
cavtes. Brushng your teeth
properIy and reguIarIy s an
eectve way to prevent cav-
tes, not just oy avodng sugar.
Don't shelve the sugar entirely,
just be sensible about how much
oI it you eat. Doesn't that sound
better than depriving yourselI oI
a spoon oI sugar in your coIIee?
2
O
1
1
2
O
1
2
2
O
1
3
Mh C 0 MP L T l T l 0 h
YOU
2014
OVR

|1I|I
11W|
|I' 11|
1 I1...
|s |oo|n o th nt co y '
|nch|n nt|on|d sch o y |th th
condnc, |oos nd ody yo'd ct to s on th
co yo th|n yo' ot ht |t ts, nt to h
omyo Th s|d? Fm nd |n |hts nd o
cos, |n on n co |n smm 1
nter our reder competItIon to be on
the coer of the ecember 214 Iue.
Covguy.mh.co.za nd |od yo hotos nd son|
dt||s Rds ||| sco|| thoh nd ot Th d|to's
dc|s|on |s n| ||| hotoh th to 1
Ts |y |s|t mhco
o nIr qo Io ovrquy.

2
O
1

TS F USFU STUFF
September 2014

J|
l|llJ|
JJ
nnHo?
n|t comes tocomedy, every manth|nks he's astand-upguy
! !
|| ||
| '!|J
/
rn| o| nn
o' |r |o oss o||
s|o'n ok s |r on
/|
rn| o'
|oJ| oJ| |kn
|Jrn | s|nJo
||
rn| o s
|, oJ' 'n 'Js|
on oo ok
Jnr o| J,s o
onsr srsn |
|Jnns| |orn o| JnoJr
rn| o| nn o' |o' ok
Jrn sx || n'| o or '' (ns|
o| oJ||n ' |, r ,
Jnr o s,
|'s r|, JnoJr
'' | ,
Jnr o' Jno
r' |or r nno,n 'J
rn| o oJ' r|r r
onn s, 'oJ'r 'roJs. |nan '`oJ're
no|. Bes| o| a'': '`oJ're so |Jnn,, |'s no|.
Por|on o| nen no'o
neer oa|e a onan no
s |Jnner |nan |ne, are
! I |!
Percen|ae o| nen
no |nnk |ne,'re
|Jnner a||er a |eores
NJnoer o| on|s
|ne, neeo |o 'oosen
Jo |ne 'aJn |rack
Prooor|on o| J,s no
sa, |ne,'re |ne c'on
n |ner croo o| |renos
Percen|ae no
(oon'| 'aJn., are
|err|eo o| rea' c'ons
Deao conc |ne aerae
J, snes coJ'o oo one
nore se|: George arIIn
^erae J,'s |aoJr|e
T\ coneo,:
lJ|l'Jll\J
lJ|Jl
S|conJ, ne snes ne coJ'o
oe: 's. . .
lll\|
l'\J\
Too |nree ,okers ne
oJ'o oa, s'', none,
|o see 'e:
1 ae haeIIe
Treor Noah
LoIs K
| '!!
Ooos |na| ne's o'a,eo
an ^or' oo's' orank
a| ns o||ce... or oeen |ne
|are| o| one
/|
Prooor|ono| nrnnana-
ers nosa, a ooosense
o| nJnoJr coJ'oea ,oo
canooa|eaneoe
|J
Percen|ae o| nen no'e
neck'eo a coneoan

=ae =R nre a conc:


a s|Jo, n |ne Jor-
na| of Manageria| Ps-
cho|og sJes|s |na|
nJnoJr a| ork can
noroe oer|ornance.
'BJ| |ne oJa'|, o| ,oJr
,okes s nore noor-
|an| |nan |ne oJan-
||,, sa,s |ark Sna|z,
a oro|essor o| os,cno'-
o, a| Ono Uners|,
a| Zanes''e ano co-
aJ|nor o| Comeo Wri-
ing $ecres. So s|eer
aa, |ron|ne racer
na|era'. '`oJr aJo-
ence sn'| ,oJr oes|
oJoo,, Sna|z sa,s. '|'s
,oJr nos| consera|e
co''eaJe.

\nenUresearcners
sJre,eo350000oeo-
o'e|o|no|neor'o's
|Jnnes| ,oke, oneen|r,
onoJ|. =ereoes:
Tohners areo in
heooos henone
co||apses. Heooesn
seemobebreah-
ing. Theoher g
ca||s mergenc $er-
ices. Hegasps, 'M
frienois oeao! Wha
canl oo? Theopera-
or sas, 'Ca|moon.
l canhe|p. iirs, |es
makesrehes oeao.
Theres a si|ence, hen
a sho is hearo. Back on
hephone, heg sas,
'Oka, noha?
vvv.!ord.co.za
Vlsl! FordSou!hA!rlca
SYNC

keeps you connected to themaII.


l!'s SMART hands-!ree cOnnec!lvl!y !ha! le!s yOu play muslc,
make calls and even have !ex! messages read !O yOu.
Get SMART. Get connected, Z4 hours a day.
SMART CCNNECTlVlTY
SYNC

- SMART vOlce
cOmmand !echnOlOgy.

IAG HUk CAkkkA CAIIk 1887


Pushi ng ]ou l o l he e/l r eme, oer comi ng dl l bounddr i es md|es lor mul d 1 mor e
l hdn j usl d ph]si cdl chdl l enge, i l i s d l esl ol menl dl sl rengl h. li |e IA0 heuer,
]ou hde l o sl r i e l o be l he besl dnd neer cr dc| under pressure.
T
A
G
H
e
u
e
r
B
o
u
t
i
q
u
e
s
;
S
a
n
d
t
o
n
C
i
t
y
&
V
&
A
W
a
t
e
r
f
r
o
n
t
.
/
l
s
o
a
t
s

c
t

o
n
n

l
l

r
s
n
a
t
i
o
n
w
i
o

.
F
o
r

u
r
t
h

r
i
n

o
r
m
a
t
i
o
n
p
l

a
s

c
a
l
l
C

.
6
6
9
.
C
5
C
C
.
w
w
w
.
p
i
c
o
t
a
n
d
m
o
s
s
.
c
o
.
z
a
lF ElNG ONE OF HE MO LENE0 OE
infheworIdweren`f enogh, CrisfianoRonaIdo
aIsoboasfs oneof fhegame`s mosf chiseIIedsix-acks.
Wanf foemIafehis abs?ThinkgIobaI, nof IocaI, says
cerfifiedsfrengfhandcondifioningcoachEricCressey,
whocreafedfhis monfh`s frainingIan. Washboardabs
don`f comefromconfIess sif-s -fhey`rescIfedwifh
afhIefic, high-infensifyexercises fhaf revyor mefabo-
Iismandworkyor enfirebody. oIIowhis rogramme
for 28days andyo`II nof onIyscIf amoremscIed
middIebf aIsodeveIofhekindof exIosiveseedand
sfrengfhfhaf kees RonaIdoaheadof fhecomefifion.
|x-k
A|rtor
2
0
1
4

A1 n-s|st ktr op
cn a ress|ance oano |o a oo'e ano, |n |ne oo'e on oJr 'e||, 'ooo |ne oano
aroJno oJr as|. PJsn oJr nos oack as oJ oreoare |o ooJno |o |ne rn| :
|nen oo so . Do 5 reos, |Jrn aroJno, ano reoea|, |ns |ne ooJnon 'e||.
1 umbb|| Wa|k|ng Lung
=o'o a oar o| oJnooe''s nex| |o oJr soes . S|eo |oraros n|o a 'Jne |n
oJr 'e|| |oo| . S|ano Jo, s|eoon |oraros |n oJr rn| |oo|. Tna|'s ! reo.
Do !6, a'|erna|n |ee|.
A2 Ab W| Ro||out
nee' on |ne |'oor ano rao |ne nano'es o| an ao nee' . Ro'' | |oraros as
|ar as oJ can, keeon oJr oack s|ran| ano 'J|es |n| . Use oJr core |o
oJ'' | oack. Do 6 reos. No ao nee' Use a oaroe'' 'oaoeo |n 5k en|s.
B2 C|n-up
Crao |ne oar Jsn a snoJ'oer-o|n, Jnoernano ro, ano nan a| arn's 'en|n,
oJr ank'es crosseo . PJ'' oJr cnes| |o |ne oar . PaJse: s'o' re|Jrn |o
|ne s|ar|n oos|on, s|ooon ,Js| snor| o| a oeao nan. Do 6 reos.





Cono'e|e|ne|nreeorkoJ|s on|ns oos|er oncea eek, |n
48noJrs o| res| oe|een|nen. (SooJnn| oo\orkoJ| !on
|onoa, \orkoJ| 2on\eonesoa, ano\orkoJ| 3onroa, |or
exano'e., Per|orn|ne|rs| 2exercses neacnorkoJ| (|ne^
exercses, as a sJoerse| -|na| s, oack-|o-oack. Do4sJoerse|s
na'', res|n2nnJ|es oe|een|nen. Tnenoo|nesane|n
|neBexercses, oJ| |ns |neoo,Js| 3sJoerse|s.

Brakfast
| | J | |
| J J N
Snaks
JJ| | J | | J
N N
. . )
Lun
J J| J| J
N |
| | N J|
N
Suppr
J| N N
J || N
J|
'|'s sno'e, oJ| no| eas.
S|eer c'ear o| |reo |ooo
ano a'cono' ano keeo
eer|nn e'se n
nooera|on, sas LJs
Laraoor, cne| |or |ne
Por|JJese na|ona'
soccer |ean.


WHY IT WORKS
1. Prb|ot|s (wo|gra|ns) an prob|ot|s (ogurt) boost our |gst|v
trat an opt|m|s our mtabo||sm.
2. Prot|n |ts at |un |nnr an snak braks nour|s our mus|.
3. F|n|ng a|t foos ou ||k an at|ng tmnsurs |t arn.
PROESSOR |'C=^EL ROUSSELL, NUTR'T'ON ^D\'SOR

I
E

A e|f
|n ,oJr |ee| one ano a na'| |nes no-o|n aoar|, |oes an'eo s'n|',
oJ|. Crao a oaroe'' . eeon ,oJr oack |'a|, s|ano Jo as ,oJ |nrJs| ,oJr nos
|oraros, keeon |ne oar as c'ose |o ,oJr ooo, as oosso'e . Do 3 reos.
A evee ge F
=o'o a oaroe'' so |na| | res|s on |ne |ron| o| ,oJr snoJ'oers ano ,oJr |ner|os
. S|eo oackaros |n ,oJr rn| 'e n|o a 'Jne . PaJse, ano oJsn oack
|o |ne s|ar|n oos|on. Do 6 reos. Reoea|, s|eoon oack |n ,oJr 'e|| 'e.
B Be|| e Bge
Le on ,oJr oack on |ne |'oor |n a oaroe'' aooe ,oJr nos, ,oJr knees oen|
ano |ee| |'a| . Rase ,oJr nos Jn|' |ne,'re a'neo |n ,oJr knees ano
snoJ'oers . PaJse, ano re|Jrn |o |ne s|ar|n oos|on. Do !2 reos.
B g|e-eg H
P'ace |o oencnes aooJ| !naoar|. Pos|on ,oJr Jooer oack on one ano ,oJr
'e|| |oo| on |ne o|ner, ano |nen nJ ,oJr rn| knee |o ,oJr cnes| . Rase ,oJr
nos as nn as ,oJ can . Do !0 reos, s|cn 'es, ano reoea|.
A e|| g|e-ABe e
Crao a oJnooe'' n ,oJr 'e|| nano ano 'e on ,oJr oack on a |'a| oencn. =o'o |ne
oJnooe'' aooe ,oJr cnes|, oa'n|Jrneo s'n|', n , ano |nen 'oer |ne
oJnooe'' |o |ne soe o| ,oJr cnes| . Do 8 reos, s|cn soes, ano reoea|.
A Ivee
SecJre a oar a| as| nen|: |nen rao |, Jsn an oernano ro, ano nan
|n ,oJr nanos aooe ,oJr snoJ'oers . PJ'' ,oJr cnes| |o |ne oar . S'o',
'oer ,oJr ooo, oack |o |ne s|ar|n oos|on. Do !0 reos.
B e|| g|e-A
\|n a oJnooe'' n ,oJr rn| nano, o'ace ,oJr 'e|| nano on a oencn n |ron| o|
,oJ. Le| |ne en| nan a| arn's 'en|n, oa'nn . Ro|ne oJnooe'' |o ,oJr
soe . Do 8 reos, s|cn soes, ano reoea|.
B g -
^ssJne a oJsn-Jo oos|on, keeon ,oJr ooo, s|ran| . Loer ,oJr ooo,
Jn|' ,oJr cnes| near', |oJcnes |ne |'oor . PJsn Jo, rasn ,oJr nos as nn
as ,oJ can . Re|Jrn |o |ne s|ar|n oos|on. ^n|or !0 reos

Centres d'intérêt liés