H

2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Genética Molecular de las Patologías
Tiroideas
Prof. Dra. Carina M. Rivolta
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Hipotiroidismo Congénito con Bocio
Hipotiroidismo Congénito
Incidencia: 1/1900 - 1/3000 recién nacidos.
Hipotiroidismo sin bocio (75 %)
Hipotiroidismo con bocio (15-20 %)
Hipotiroidismo transiente: < 10% de los casos con HC diagnosticado.

Pesquisa Neonatal de Hipotiroidismo Congénito
Provincia de Córdoba

Muestras Procesadas en el Hospital de
Niños desde 1996: 252599

Pacientes diagnosticados: 124



Pac. derivados de otros Centros: 44

Total de pacientes en el programa:168


Línea de Corte de TSH 10 ųUI/ml
Incidencia 1/2122
Clasificación Etiológica de hipotiroidismo congénito
n=168 pacientes
Disgenesias
105 pacientes
Glándulas eutópicas
58 pacientes
2pac no
determ
3 pac
transitorio
62.5%
34.5%
12%
23%
3%
62%
Con TG baja
Con TG normal
Con TG alta
Otros
Glándulas eutópicas n=58
6 pacientes (4 flias no
relacionadas).
19 pacientes (15 flias no
relacionadas).
Muestras analizadas
I
+
I
-
H
2
O
2
Mit
Dit
Mit
Dit
T
3
T
4
TG
TG
Lumen folicular
Pendrina
Duox TPO
NIS
I
-
Na
+
Circulación sanguínea
Esquema simplificado de la síntesis de hormonas tiroideas
hAIT: transportador de yodo apical
RXR
Zn
TR
Zn
Co-activador
OH
NH2
I
I
I
Gen Blanco
TRE
O HO CH2
COOH
TATA
TF IIB
TBP
Transcripción
T
3
RNA pol
H
2
O
2
Gen de la TG

Transcripción
ARNm
T raducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS 
TG
TPO
NIS
Pendrina
Membrana basolateral
Membrana apical
I
-
TTF-1, TTF-2, PAX8
ThOX
Fisiología molecular
Diagnóstico bioquímico de bocios congénitos
Por defecto de TG
Por defecto de
Organificación
T3 y T4  
TSH  
TG sérica  
Descarga de perclorato Negativa Positiva
Defecto de
organificación
Normal
ClO4
-
2
30
20
C
a
p
t
a
c
i
ó
n

d
e

Y
o
d
o

R
a
d
i
a
c
t
i
v
o


(
%

d
e

l
a

d
o
s
i
s

a
d
m
i
n
i
s
t
r
a
d
a
)

Prueba de descarga de perclorato
10
horas 5
TSH TSH TSH TSH TSH
T
4
T
3

T
4
T
3

T
4
T
3

T
4
T
3

T
4
T
3

TG TG
TG TG TG
TG TPO
DUOX2
DUOXA2
TTF1
TTF2
PAX8
NKX2.5
TSHR
DEHAL1
TSH sérica y

TT
4
y TT
3
sérica



TG sérica


Tamaño de la Tiroides
Test de descarga de
Perclorato
Gene(s) involucrados
Disgenesias
Tiroideas y
Resistencia a
TSH

Defecto de la
Organificación
del Ioduro
Defecto de la
Síntesis de la
Tiroglobulina

Defecto del
reciclado del
Ioduro
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
Descarga de Perclorato
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Hipotiroidismo Congénito con Bocio
Búsqueda de mutaciones en el gen de TPO
1 2 3 4 5 6 7 8* 9* 10* 11 12 13 14 15 16 17
5’
3’
Gen: 131 Kb
5’ 3’
NH
2
COOH
ARNm: 3048 nts
Proteína: 933 aa
2p24-p25
Cromosoma 2
Representación esquemática del gen de TPO y su proteína
S
S
S
S
G 307
G 342
H 407
478 G
H (494,511,520,586) (Distal)
G 569
G: sitios de glicosilación
H: residuos histidina
Membrana Apical
Lumen
Citoplasma
G 129
NH
2
Leu 933
(Proximal)

dH239 pH494
An peroxidase CCP EGF
COOH NH
2
TM ICD ECD
SP
D238 E399
1 125 250 375 500 625 750 875 933
wild type
aa
Representación esquemática de la TPO
Ex. 5-12 Ex. 13 y 14
Ex.14
Ex.15
Ex.16 y 17
CCP: prot. control del complemento
Exón Posición
a
Cambio nucleotídico Naturaleza de la mutación
1 -35 A  G Polimorfismo (Promotor)
1 11 G  A Polimorfismo (5´-utr)
2 141 ins 20 pb Frameshift, conduciendo a una señal de terminación
temprana en el exón 3.
3 247 G  C Ala 53 Pro
intrón 4 T  C Polimorfismo
4 439 G  C GG/gt  GC/gt (posiblemente afecte al splicing)
7 808 G  A Asp 240 Asn
7 859 G  T Polimorfismo (Ala  Ser)
8 1066 G  A Ala 326 Thr
8 1207 G  T Polimorfismo (Ala  Ser)
8 1277 ins GGCC Frameshift , conduciendo a una señal de terminación
temprana en el exón 9.
8 1283 G  C Polimorfismo (Ser  Thr)
8 1425 del C Frameshift , conduciendo a una señal de terminación
temprana en el exón 9.
9 1429 A  T Ile 447 Phe
9 1463 T  C Leu 458 Pro
9 1447 T  G Tyr 453 Asp
9 1562 G  A Arg 491 His
9 1567 G  A Gly 493 Ser
9 1671 G  T Trp 527 Cys
10 1708 C  T Arg 540 stop
10 1818 G  A Polimorfismo (Ala  Ala)
10 1858 G  A AG/gt  AA/gt (posiblemente afecte el splicing)
+1 intrón 10 G  A AG/gt  AG/at (posiblemente afecte el splicing)
11 2033 G  A Arg 648 Gln
11 2068 C  G Gln 660 Glu
11 2088 C  T Polimorfismo (Asp  Asp)
Intrón 11 C  T Polimorfismo
12 2167 C  T Arg 693 Trp
12 2235 C  T Polimorfismo (Pro  Pro)
12 2243/2244 del TT Frameshift , resultando directamente en una señal de
terminación temprana: Phe 718 stop.
12 2263 A  C Polimorfismo (Thr  Pro)
13 2333 del T Frameshift , conduciendo a una señal de terminación
temprana en el exón 14.
13 2358-2359 ins T Frameshift , conduciendo a una señal de terminación
temprana en el exón 13.
13 2476 G  T Asp 796 Tyr
14 2485 G  A Glu 799 Lys
14 2505-2511 ins C Frameshift , conduciendo a una señal de terminación
temprana en el exón 16.
14 2512 del T Frameshift , conduciendo a una señal de terminación
temprana en el exón 14.
17 2973 G  C Polimorfismo (3´-utr)
17 3007 G  T Polimorfismo (3´-utr)

Mutaciones y polimorfismos en el gen de TPO
Numeración de
posición según
nomenclatura de
Kimura (1989).
Frameshift
Missense
Splicing
CTP

Frecuencia mutaciones
+
-
Objetivo
Identificar nuevas mutaciones en el
gen de TPO y desarrollar nuevas
herramientas diagnósticas
moleculares.
Muestras de Sangre Periférica


Purificación ADNg
Técnica de CTAB


PCR










Productos con patrón diferencial de migración

Secuenciación



Materiales y Métodos
RFLP
Poblacional
Poliacrilamida 8-10%
Tinción Argéntica
Agarosa 3%
16 Familias
SSCP
Clonado
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Predicción de Cambio en la Estructura Secundaria de TPO
Wilde Type
TERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLYKHPD
hheeeeeccccchhhhhhhhhcccccccccccchhhhcccccccccccchhhhhhhhhhhhhhhhhcccc
p.R595K
TERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLYKHPD
hheeeeeccccchhhhhhhhhcccccccccccchhcccccccccccccchhhhhhhhhhhhhhhhhcccc


Análisis
Bioinformático
TPO
Promotor y
17 exones + regiones
intrónicas flanqueantes

TPO: p.R396fsX472
SSCP
Diseño de primers
PCR: 300 pb
Exón
Duplicación en el exón 8B
c.1186_1187insGGCC
p.R396fsX472

Análisis con ER
La duplicación genera un
nuevo sitio de corte Nae I .
Gel de agarosa al 3 % . 1: Marcador de
PM; 2: PD sin digerir; 3: N14 incubado
con NaeI pero no digerido por la misma;
4: PD digerido; 5: PL digerido.
1 2 3 4 5
246 pb
214 pb
Exon 8 p.R396fsX472
Exon 11 p.R595K
Exon 11 p.R595K Exon 8 p.R396fsX472
II-1 II-2 II-3 II-4 II-5 II-6 II-7 II-8 II-9 II-10
I-1
I-2
Family 1
?
T G A G T G G A A G G A G T T C
G
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
Patient A Patient B
TPO gene
I-2 I-1
II-2
Family 2
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
Exon 8 p.R396fsX472
Exon 11 wild-type
T G G A G G G A G T T C T
Exon 8
Exon 11
T G G A G G G A G T T C T
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
A
Exon 8
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
Exon 11
T G G A G G G A G T T C T
A
II-1
T G G A G G G A G T T C T
A
Exon 11 p.R595K
Exon 8 p.R396fsX472
Exon 11 p.R595K
G A G A C G G C C G C G C C A
Patient C Patient D
Exon 11 wild-type
TPO gene
Exon 11 p.R595K
Family 3 I-1
II-1
II-2
III-1 III-2 III-3 III-4
I-2
II-3
?
?
G G A A G G A G G G A A G G A G G G A G G G A G
G G A A G G A G
G G A A G G A G
G
G G A A G G A G
G
G
G G A A G G A G
Paciente E Paciente F
TPO gene
I-1
II-2
Family 4
I-2
Exon 7 p.Q266X Exon 7 wild-type
Exon 7 p.Q266X

Exon 7 p.Q266X
Exon 11 p.G667D
T G C G G G A C G G T G A C T
Exon 11 p.G667D
T G C G G G A C G G T G A C T

Exon 11 p.G667D

T G A G A A C C A A A A C C C
T G A G A A C C A A A A C C C T G A G A A C C A A A A C C C
Exon 11 wild-type
T G C G G G A T G G T G A C T

T
A
T
T A
Patient G
TPO gene
I-2 I-1
II-2
Family 5
II-1
Exon 8 p.R396fsX472
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
Exon 8
G A G A C G G C C G C G C C A
G A G A C G G C C G G C C G C
Exon 8
TPO gene
I-2 I-1
Family 6
II-1
?
ESEFINDER2.0

Desaparición de un Sitio Aceptor de Splicing
WT
MUT
WT MUT
T C T G C A T T T T T G C A G G A G A G T G C
C
Intron 16
T C T G C A T T T T T G C A G G A G A G T G C
C
Intron 16
Intron 16 g.IVS16-2AC
TPO gene
Predicción de Cambio en la Estructura Secundaria de TPO
Wilde Type
TERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLYKHPD
hheeeeeccccchhhhhhhhhcccccccccccchhhhcccccccccccchhhhhhhhhhhhhhhhhcccc

p.R595K
TERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLYKHPD
hheeeeeccccchhhhhhhhhcccccccccccchhcccccccccccccchhhhhhhhhhhhhhhhhcccc


http://npsa-pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_nn.html
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Homo sapiens TPO p.R595K VLSNSSTLDLASINLQRGRDHGLPGYNEWKEFCGLPRLETPADLSTAIASRSVADKILDLY
Homo sapiens TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Pan troglodytes TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAITSRSVADKILDLY
Macaca mulatta TPO VLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLY
Bos taurus TPO VLSDAGTLDLASINLQRGRDHGLPGYNEWRQFCGLSRLETRADLGAATANGSMADRILDLY
Rattus norvegicus TPO VLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLDTGAELNKAIANRSMVNKIMELY
Mus musculus TPO VLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLY
Canis familiaris TPO VLGSSGSLDLGSINLQRGRDHGLPGYNAWREFCGLGRLHTRAELRSAVANATLAGRIMDLY
Homo sapiens MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Pan troglodytes MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQY
Macaca mulatta MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPNTVGELGTVLRNLELARKLMEQY
Bos taurus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPVPNTVGELGTVLRNLDLARRLMKLY
Rattus norvegicus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Mus musculus MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQY
Canis familiaris MPO QVMRI-GLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELATVLRNLDLAQKLMQQY
Homo sapiens LPO PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLY
Bos taurus LPO PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDLY
Rattus norvegicus LPO PTHTIHGFDLASINIQRCRDHGMPGYNSWRAFCGLSQPKTLEELSAVMENEVLAKKLLDLY
Mus musculus LPO PNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQPKTLEELSAVMKNEVLAKKLMDLY
Homo sapiens EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Pan troglodytes EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Macaca mulatta EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLY
Rattus norvegicus EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLARKFLNLY
Canis familiaris EPO QVRRI-GLDLAALNMQRSRDHGLPGYNAWRRFCSLSQPRNLAQLSRVLRNQDLARKFLNLY
Análisis Evolutivo - Homología Proteica
c.1874 G>A, p.R595K
Representación de la estructura modelada de TPO.
Swiss Model
Modelado por homología (Isoforma C de la mieloperoxidasa)
TYR 591
ARG 595
GLU 641
PRO 601
LYS 595
TYR 591
PRO 601
GLU 641
p.R595K
Superficies electrostáticas de wt R595 y mut K595
Table 1: Laboratory data in patients with congenital goitrous
hypothyroidism and organification defect.

Families Patie
nts
Age
(years)
Mutations Age at
diagnosis
Serum
TSH
(uIU/ml)
Serum
FT4
(ng/dl)
Serum TT4
(ug/dl)
Serum
TT3
(ng/dl)
Serum TG
(ug/l)
1 A 17 p.R396fsX472/p.R595K 2 months,
24 days
> 50 0.02 0.42 31 605
1 B 9 p.R396fsX472/p.R595K

1 month >100 0.05 0.42 24 1000
2 C 15 p.R396fsX472/p.R595K 27 days 19 2.4 N/A N/A 145
2 D 13 p.R396fsX472/p.R595K

1 month 350 0.01 0.42 34 3500
3 E 11 p.R595K 2 month 420 0.01 0.42 35 1260
3 F 8 p.R595K

7 days 524 0.14 1.4 49.3 528
Reference
Range:
0.64-10.5
(0-15 days)
0.44-8.8
(15-30
days)
1.1 - 7.0
(30-60
days)
0.9 – 2.3 8.0-17
(1-4 weeks)
7.2-15.6
(1-12
months)
117-263
(1-4
weeks)
105-245
(1-12
months)
28.9-173
(<15 days)
6.44-82.8
(>15 days)
Families Patients TPO Mutation DUOX2
Mutation
Family 4 G p.V748M/ ?
Family 5 H p.R396fsX472/?
Family 6 I g.IVS16-2AC/?
Family 7 J p.A1088fs1100/
?

Table 2: TPO and DuoxA2 mutations in patients with congenital goitrous
hypothyroidism and organification defect.
Exón Cambio nucleotídico Consecuencia a nivel
proteico
Nº de
pacientes
Test de
Perclorato (%)
5 c.387delC Cambio de marco de
lectura p.N129fsX208
1 80
8 c.920A>C (AAC>ACC) Cambio de aminoácido
(p.N307T)
2 69/80
8 c.1186_1187insGGCC Cambio de marco de
lectura p.R396fsX472
2 84/99
8 c.1297G>A (GTG>ATG) Cambio de aminoácido
(p.V433M)
1 99
9 c.1496C>T (CCG>CTG) Cambio de aminoácido
(p.P499L)
1 99
14 c.2422T>C (TGC>CGC) Cambio de aminoácido
(p.C8O8R)
1 77

Exón Posición Cambio nucleotídico Consecuencia a nivel proteico
1 -35 A  G Polimorfismo (promotor)
1 11 A  G Polimorfismo
intrón 3 -47 A  C Polimorfismo
intrón 4 +31 T  C Polimorfismo
8 1207 G  T Polimorfismo (A373S)
8 1283 G  C Polimorfismo (S398T)
9 1473 G  A Polimorfismo (R461E)
11 2068 C  G Polimorfismo (Q660E)
11 2088 C  T Polimorfismo (D666D)
15 2630 T  C Polimorfismo (V847A)
intrón 16 +44 G  T Polimorfismo

Mutaciones identificadas en el gen de TPO
Polimorfismos identificados en el gen de TPO
8 c.1159G>A (GGG>AGG) Cambio de aminoácido 1 80
(p.G387R)
4 c.215delA Cambio de marco de
lectura p.Q72fsX86 1 77
A
n
a
l
i
z
a
n
d
o

e
l

R
N
A
m

s
e

p
o
d
r
í
a

e
s
t
u
d
i
a
r

s
i

e
x
i
s
t
e

u
n

s
p
l
i
c
i
n
g

c
o
r
r
e
c
t
o
r

d
e
l

m
a
r
c
o
.

Transcriptos de TPO generados por splicing alternativo
TPO-2: sin ex. 10
TPO-3 (TPOzanelli): sin ex. 16
TPO-4: sin ex. 14
TPO-5: sin ex. 8
TPO 2/3: sin ex. 10 ni 16
TPO 2/4: sin ex. 10 ni 14
TPO-6: sin ex. 10, 12, 13, 14 ni 16.
dH239 pH494
An peroxidase CCP EGF
COOH NH
2
TM ICD ECD
SP
D238 E399
1 125 250 375 500 625 750 875 933
COOH NH
2
p.G387R
COOH NH
2
p.C808R
COOH NH
2
NH
2
COOH p.N129fsX208

p.Q72fsX86
wild type
p.C808R
p.G387R

aa
Representación esquemática de los dominios
en las TPO wild-type y mutadas
Podría estar alterado el mecanismo
catalítico, por daño en los sitios de
unión al hemo.
Desaparece una de las C que forman ptes disulturo alterando la
estructura 3º del dominio que une calcio del sitio EGF.


Debido a que el modo de herencia de este defecto de
organificación es autosómico recesivo, análisis adicional por
secuenciación es necesario para el resto de los exones de TPO en
en los pacientes en los cuales se identificó una mutación con el
objeto de encontrar la otra. En aquellos pacientes en los cuales no
se identificaron mutaciones en el gen de TPO, debería hacerse
una búsqueda de mutaciones en el gen DUOX2
Las mutaciones identificadas en este estudio mejorán el
diagnóstico de esta patología genética recesiva.
Conclusiones TPO
Detección de la actividad in situ con 3,3’ diaminobenzidina
Línea de células de insecto Mimic Sf9
Determinación de la actividad de TPO por ensayos de expresión.
Detection of in situ Horseradish Peroxidase activity by plaque assay with
3,3’diaminobenzidine.(Mendive FM, Segura MM, Targovnik HM, Cascone O,
Miranda MV. Brazilian Journal of Chemical Engineering 20: 33-38, 2003)
Baculovirus
Vector de
transferencia
Baculovirus ADN lineal


Cosecha del baculovirus recombinante
o
Baculovirus
ADN lineal 150 kb
Sistema del Baculovirus
Gen de la proteína de la cubierta
Gen de interés
clonado en pAcGP67B
Vector de transferencia
Transfección en células de insecto
Recombinación homóloga
El virus provoca lisis celular
Las células captan el virus y
el vector
Infección de nuevas células con
virus recombinantes
Procesamiento
para comprobar
producción de
proteína
(fosfato de Calcio o liposomas)
Vector de transferencia y expresión del
Sistema del Baculovirus
+ ATG
+ TGA
Baculovirus
ADN lineal 150 kb
Sistema del Baculovirus
Gen de la proteína de la cubierta
Gen de interés
clonado en pAcGP67B
Vector de transferencia
Transfección en células de insecto
Recombinación homóloga
El virus provoca lisis celular
Las células captan el virus y
el vector
Infección de nuevas células con
virus recombinantes
Procesamiento
para comprobar
producción de
proteína
(fosfato de Calcio o liposomas)
Utilidades del Sistema del Baculovirus
Detección de la actividad in situ con 3,3’ diaminobenzidina
Línea de células de insecto Mimic Sf9
Expresión de alelos mutados de la TPO y determinación de la
actividad enzimática
Cosecha del baculovirus recombinante
Clonado de productos de PCR
X
X
X
X
X
X
X
X
Síntesis del vector mutado
obtenido de E. Coli dam+
Digestión del templado con Dpn1
la cual reconoce: 5´ Gm
6
ATC-3´
Transformación de células “XL1-
Blue supercompetent cells”
pGEMT + inserto
Primer Foward: 5´CCA TGA TTA CGC TAA
GCG CGC AAT TAA CCC TCA C 3´
Primer Reverse: 5´GTG AGG GTT AAT TGC
GCG CTT AGC GTA ATC ATG G 3´
Introducción de la mutación deseada por medio de primers

TPO 5787pb
3015 pb
pGEMT
pGEMT easy
I
Digestión con EcoRI
Vector de transferencia
recombinante
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Hipotiroidismo Congénito con Bocio
Búsqueda de mutaciones en el sistema DUOX
Hipotiroidismo Congénito
Incidencia: 1/3000 - 1/4000 recién nacidos.
eje pituitario
Origen del defecto:

terciario eje hipotalámico
secundario
primario
tiroides
Existencia de bocio:
Hipotiroidismo no bocioso (80 %)
 Causas: agenesia, disgenesia o hipoplasia
 Genes alterados: TSH-, TTF1, TTF2, PAX 8, RTSH
Hipotiroidismo con bocio (20 %)
 Causa: defectos en la síntesis de hormonas tiroideas
 Genes alterados: TG, TPO, Pendrina, NIS, DUOX2
Modo de herencia: Autosómico recesivo
5’
3’
Gen: 21,5 Kb
5’ 3’
NH
2
COOH
ARNm: 6376 nts
Pre-Proteína: 26+1522 aa
Cromosoma 15
Representación esquemática del gen de DUOX2 y su proteína
(miembro de la familia NOX de NADPH oxidasas)
33 exones
Representación esquemática de la proteína DUOX2
TPO - like
EF - hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V V I VII
SP
TPO - like
EF - hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V V I VII
SP
Y

Y


O
2
-
NADPH
FAD
hemo
hemo
N
C
Ca
2+
Ca
2+
wild type
1548aa
Primeras mutaciones inactivantes
identificadas en el gen de DUOX 2
-p.R434X
-p.Q686X
-p.R701X

-p.S965fsX994
Gen DUOX 1
-Codifica una proteína de 1551 aas con 83% de
homología con DUOX 2.

-No se han identificado mutaciones en el gen de
DUOX 1.

Objetivo
Identificar nuevas mutaciones en el
gen de DUOX2 y desarrollar nuevas
herramientas diagnósticas
moleculares.
Selección de 17 pacientes (descarga de perclorato ≥ 38 %)
PCR de los exones + uniones exón/intrón + el promotor
SSCP en geles de poliacrilamida al 8 % y 10 % con o sin 10 % glicerol
Pacientes
Metodología
Purificación de ADN genómico a partir de sangre periférica.
Secuenciación
Muestras con patrón de migración diferencial en SSCP
B
I-1 I-2 II-1 II-2
I-1 I-2 II-1 II-2
I-1 I-2 II-1 II-2 II-3 II-4 III-1
I-1 I-2 II-1 II-2 II-3 II-4 III-1
c.108G>C;
p.Q36H
c.2895-
2898delGTTC;
p. S965fsX994
c.1253delG;
p.G418fsX482
g.IVS19-2A>C
A
II-4
I-1
I-2
II-1 II-2 II-3
III-1
II-2
I-1
I-2
II-1
Family 1 Family 2
46% de descarga
60% de descarga

Ex 2
Ex 11
Ex 21
(conocida)
Intrón 19
Análisis de segregación de los alelos mutados
Afectará el
splicing?
O
2
-
NADPH
FAD
hemo
hemo
N
C
Ca
2+
Ca
2+
c.2895-2898delGTTC;
p. S965fsX994
c.1253delG;
p.G418fsX482
Frameshift mutations identificadas en DUOX2
5’ EcoR I Sac I Xho I Not I Pst I BamH I EcoR V 3’
pSPL3
Sitio de
clonado
(SC)

5’ SS 3’ SS
Señal de poliadenilación
6030 pb
SV40 origen y
promotor
Amp R
ori
Vector pSPL3 y estudios de splicing
In17F-NotI
In22R-BamH1
18 19 20 21 22
Intrón 17
Intrón 22
Prod. de 3900 pb (Elongasa)
Purificación a partir del gel de agarosa
Purificación con columna
Digestión con NotI y BamH1
Clonado direccional en el vector pSPL3 dentro de los sitios NotI y
BamH1 y cél DH5 competentes.
Purificación del plásmido con columna y secuenciación.
X
Vector pSPL3 y estudios de splicing
Métodos 1
Vector pSPL3 y estudios de splicing
1- Clonar un fragmento de DNA genómico dentro del
sitio de clonado (mini gen).
2- Transfectar células COS o CV1.
3- Expresión desde el promotor SV40 producto de
RNA
4-Aislar el ARN y usarlo como templado para producir
cDNA
5- Amplificar por PCR usando los primers específicos
para los exones del vector.
Métodos 2
Wild-Type RT-PCR product
Mutant RT-PCR product
g.IVS19-2A>C
e18 e19 e20 e21 e22
i17 i18 intrón 19 i20 i21 i22
Bam HI Not I
gt
ag
ag
cg
pSPL3
pSPL3
SV40
promoter
e18F e22R
exons: 18 19 22
exons: 18 19 20 22
gt
438 pb
241 pb
gt
MW WT Mut C (-)
438 pb
241 pb
Expresión in vitro de minigenes wild-type y mutante
Gel de agarosa al 2 %
QDALSLPWEVQRYDGWFNNLRHHERGAV

Duox2 [Homo sapiens] QDALSLPWEVQRYDGWFNNLRHHERGAV
Duox2 [Bos taurus] QDALSLTWEVQRYDGWFNNLRQHEHGA-
Duox2 [Sus scrofa] QDALSLTWEVQRYDGWFNNLRQHEHGA-
Duox2 [Rattus norvegicus] QDAPSLPREVQRYDGWFNNLKYHQRGA-
Duox2 [Gallus gallus] -------WEVQRYDGWYNNLQHRSRGSV
Duox2 [Mus musculus] QNSIS--WEVQRFDGWYNNL--------
Duox1 [Homo sapiens] QNPIS--WEVQRFDGWYNNL--------
Duox1 [Rattus norvegicus] QNPVS--WEVQRFDGWYNNL--------
Duox1 [Canis familiaris] -------WEVQRFDGWYNNL--------

Análisis de Homología Proteica
Conservación del residuo glutamina involucrado en la
mutación p.Q36H?.

A Wild-Type
NH
2
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
B p.Q36H
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
COOH
C p.G418fsX482
Premature stop codon at
amino acid position 482
Y Y Y
TPO-like
SP
D g.IVS19-2A>C
NH
2 COOH
Premature stop codon at
amino acid position 886
Y Y Y Y Y
TPO-like
EF-hand
I
SP
E p.S965fsX994
NH
2 COOH
Premature stop codon at
amino acid position 994
Y Y Y Y Y
TPO-like
EF-hand
I
SP
A Wild-Type
NH
2
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
B p.Q36H
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
B p.Q36H
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
TPO-like
EF-hand
NH
2 COOH
Y Y Y Y Y
FAD
binding
site
NADPH
binding
site
I II III IV V VI VII
SP
COOH
C p.G418fsX482
Premature stop codon at
amino acid position 482
Y Y Y
TPO-like
SP
COOH
C p.G418fsX482
Premature stop codon at
amino acid position 482
Y Y Y
TPO-like
SP
D g.IVS19-2A>C
NH
2 COOH
Premature stop codon at
amino acid position 886
Y Y Y Y Y
TPO-like
EF-hand
I
SP
D g.IVS19-2A>C
NH
2 COOH
Premature stop codon at
amino acid position 886
Y Y Y Y Y
TPO-like
EF-hand
I
SP
E p.S965fsX994
NH
2 COOH
Premature stop codon at
amino acid position 994
Y Y Y Y Y
TPO-like
EF-hand
I
SP
E p.S965fsX994
NH
2 COOH
Premature stop codon at
amino acid position 994
Y Y Y Y Y
TPO-like
EF-hand
I
SP
Efecto de las mutaciones sobre la estructura proteica
CTP Ex:12
CTP Ex: 22
TPO and DUOX2 mutations identified in patients with congenital goitrous hypothyroidism and organification defect.


Individuals
Perchlorate
discharge test,
%

TPO mutations

DUOX2 mutations

AE 69 p.N307T/ ? Buenos Aires/Argentina
CR 99 p.P499L/ ? Buenos Aires/Argentina
CS 46 p.Q36H/ p.S965fsX994 Buenos Aires/Argentina
GA 80 p.N129fsX208/p.G387R Buenos Aires/Argentina
GF 60 p.G418fsX482/g.IVS19-2A>C Buenos Aires/Argentina
LC 90 Buenos Aires/Argentina
OC 67 Buenos Aires/Argentina
PD 84 p.R396fsX472/? Buenos Aires/Argentina
SF 80 p.N307T/? Buenos Aires/Argentina
SA 66 Buenos Aires/Argentina
PL 99 p.R396fsX472/ p.V433M Buenos Aires/Argentina
TM 77 p.Q72fsX86/p.C808R Buenos Aires/Argentina
Reference values <10 Buenos Aires/Argentina

Perspectivas
Hasta el presente se analizaron en nuestra población
de pacientes, los genes de TPO, DUOX2 y DUOX A2.
Los objetivos siguientes son: - buscar mutaciones en
los genes DUOX1, DUOX A1.
- continuar con el
desarrollo de los experimentos de expresión en TPO y
DUOX2
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Hipotiroidismo Congénito con Bocio
Búsqueda de mutaciones en el gen de TG
Here comes your footer  Page 65
El gen, ARNm y
proteína
tiroglobulina (TG)
humana
8q24.2-
8q24.3
Cromosoma 8
Gen: 270 Kb
ARNm: 8,5 Kb
Monómero
proteico: 2749 aa,
330kDa
1- 1 1-2 1-3 1-4 1- 5 1-6 1-7 1-8 1-9 1-10 2-1 -2 -3 1-11 Unidad Repetitiva 3a-1 3b-1 3a-2 3b-2 3a-3
Tipo I
Tipo 3 Homología ACHE
COOH NH 2
Tipo 2
3’ 5’
20 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 26 27 28 31 32 35 37 38 40 45 48 29 30 33 34 36 39 41 42 43 44 46 47
AAAAAAAAAAAAAAA
5’ 3’
Flia Paciente
estudiad
o
Familiar
analizado
Variación de
secuencia en el
ADN
Cambio en la
Proteína TG
8 3 Hnos M, P,
A y T
c.886C>T/
c.886C>T
p.R277X/
p.R277X
9 3 Hnos M y Hna c.886C>T/
c.886C>T
p.R277X/
p.R277X
10 1 M, P y 4
Hnos
c.378C>A
/c.3842G>A
p.Y107X/
p.C1262Y
11 2 Hnos M, P y
2 Hnos
c.2736delG
/c.6701C>A
p.R893fsX946/
p.A2215D
12 1 M, P y
1 Hno
c.5466delA/
c.7006C>T
p.K1803fsX1833/
p.R2317X
Mutaciones identificadas en el gen de TG
p.R277X (Ex 7)
p.Y107X (Ex.4)
p.C1262Y (Ex 17)
p.R893fsX946 (Ex 10)
p.A2215D (Ex 38)
p.K1803fsX1833 (Ex 28)
p.R2317X (Ex 40)
1- 1 1-2 1-3 1-4 1- 5 1-6 1-7 1-8 1-9 1-10 2
-1 -2 -3
1-11 Repetitive units 3a-1 3b-1 3a-2 3b-2 3a-3
Type 1 Type 2 Type 3 ACHE-like domain
COOH NH
2
Wild Type
1- 1 1-2 1-3
COOH NH
2
p.R277X
II-3
I-1 I-2
II-1
II-2
WT/p.R277X
p.R277X/WT
p.R277X/p.R277X p.R277X/p.R277X p.R277X/p.R277X
Familia 8
5’ 3’
20 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 21 22 23 24 25 26 27 28 31 32 35 37 38 40 45 48 29 30 33 34 36 39 41 42 43 44 46 47
c.7920C
c.229G c.2200G
c.2334C
c.3082G
c.3474C
c.5512G
c.5995C
c.6695C c.7408T
c.7501C
c.7589A
c.3935G
c.4506T
c.2488C
p.R277X
Mutación en TG y polimorfismos en familia 1
Exon
I
n
t
r
o
n

1- 1 1-2 1-3 1-4 1- 5 1-6 1-7 1-8 1-9 1-10 2
-1 -2 -3
1-11 Repetitive units 3a-1 3b-1 3a-2 3b-2 3a-3
Type 1 Type 2 Type 3 ACHE-like domain
COOH NH
2
Wild Type
1- 1 1-2 1-3
COOH NH
2
p.R277X
II-3
I-1 I-2
II-1
II-2
WT/p.R277X
p.R277X/WT
p.R277X/p.R277X p.R277X/p.R277X p.R277X/p.R277X
Familia 9
12%
23%
3%
62%
Con TG baja
Con TG normal
Con TG alta
Otros
Glándulas eutópicas n=58
Mutaciones gen TPO: 4 pac. complejos
heteroc; 2 pac. homoc. ; 3 pac. con
única mutac. heteroc. hasta el momento.

Mutación gen DUOX2: 2 mutac .heteroc.
hasta el momento
Mutaciones gen TG: 3
pac. complejos heteroc.
y 2 pac. homoc.
“Resistencia a Hormonas Tiroideas”
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX

Resistencia a Hormonas Tiroideas (RTH)

Diagnóstico:
 Elevados niveles de T3 y de T4 séricas
 Niveles de TSH normales o levemente elevados



Incidencia: 1/50000 nacidos vivos

Síntomas y signos:
Indicativos de hipotiroidismo e hipertiroidismo

BOCIO
TAQUICARDIA
DEFICIT DE ATENCIÓN
HIPERACTIVAD/TRANSTORNOS EN EL
APRENDIZAJE
BAJO IQ
BAJA ESTATURA
RETRASO EN EL DESARROLLO ÓSEO
PÉRDIDA DE AUDICIÓN
Manifestaciones de RTH
Objetivos Generales
Resistencia Generalizada a hormonas tiroideas

ESTUDIOS DIRECTOS:
Identificación de mutaciones en el gen THR
Diagnóstico racional para la aplicación del
tratamiento adecuado
Modelo molecular para la represión basal por co-
represores en la ausencia de T3
Co-represores: NCoR, SMRT
RXR
Zn
TR
Zn
Gen Blanco
TRE TATA
TF IIB
TBP
Transcripción
RNA pol
X
Co -represores
HDACs sin 3
Complejo co-represor
Deacetilación de histonas
TAFs
Activación transcripcional por co-activadores en la
presencia de T3



RXR
Zn
TR
Zn
Co -activador
Gen Blanco
TRE TATA
TF IIB
TBP
Transcripción
OH
NH2
I
I
I
O HO
CH2
COOH
T
3
RNA pol
CBP/P300
P/CAF
Acetilación
de histonas
Complejo SRC/p 160
TRAP 220/
DRIP205
Complejo DRIP/TRAP
TAFs
Genes que codifican a los Receptores de
Hormonas Tiroideas (TRs)
Gen Cromosoma Isoformas Localización del TR
TR  17
TR 1 Generalizada
TR 2 Generalizada
TR  3
TR 1 Generalizada
TR 2 Pituitaria/SNC
Estructura y funciones de las isoformas del receptor
de hormonas tiroideas
492
TR-2 DBD
LBD
1
514
1
461
100 100
TR-1
1
410
82 86 TR-1
1
82 86
c-erbA -2
DNA binding T3-binding Transactivación
+
+
+
+
+
+
+
+
+
+
- -

Gen: 372 Kb
1 2 3 4 5 6 7 8 9 10
5’
171 72 64 261 101 148 206 147 259 269 pb
3’
Proteína: 461 aa COOH NH
2
DBD LBD
ARNm: 1.698 b 5’ 3’
Cromosoma 3
3p22-24
Representación esquemática del gen TR y su proteína TR 1
1 461 aa
Cluster 1 Cluster 2 Cluster 3
Hinge
AF-2
NH
2
-

-COOH

DBD LBD
Localización de mutaciones en el gen TR
12 hélices
Unión a T3
Heterodimerización
con RXR
Interacción con co-represores y
co-activadores
D216A P247L V284I C298A V319K R338L R383H K424A K443N F455L
E217R L266K V284R C298R R320C R338W P384R T426R V444R L456R
W219K A268D D285A E299A R320H Q340H V389A T426I C446R E457A
E220R F269A K288A I302A R320L K342I V389K D427A C446X E457D
K223A G251E K288I I302M Y321C G344A E390R L428R T448R E457K
T224R K274E K289A I302R D322H G344E E393R R429A E449R E457R
E227R I276L I302V D322N G345D Q396R R429Q E449X E457T
A228G T277R L305I E324R G345R L400R R429W L450H V458A
A228M V264D K306A L328F G345S L401R M430R F451A V458E
H229G A279V K306E T329N G345V Y406K I431T F451I V458G
H229M I280S C309A L330F L346V Y409K A433R F451X V458M
V230R I280K C309K L330S G347E R410A C434X P453A F459C
A231R I280M C309W G332E V348E H413R C434R P453E E460K
T232G T281V M310I E333D V348R V414K H435L P453H
T232M T281R M310L E333Q V349M H416R H435Q P453S
A234T T281Q M310T M334K D351A W418K S437R P453T
A234X T281L M313T M334R D355A P419R R438C P453X
Q235R T281I S314C M334T M358A K420A R438H L454A
R243Q R282S S314F V336M S361R L421R L440R L454R
R243W V283I S314Y T337A N364R L422R M442T L454S
V283M R316H T337H D366R M423R M442V L454T
V284A A317T T337I D367R K424R K443E L454V
Mutaciones identificadas en el gen TR
c.1297-
1304del
GCCTG
CCA
c.1305-
1306ins
T
c.1358-
1359ins
C
Exón
7
Exón
8
Exón
9
Exón
10
25% 75%
Tipo de mutación: Germinal
Presencia alélica: Heterocigota
Tipo de Herencia: Autosómica
dominante

Características
Unidad de transcripción
c.1358C>T
(CCT>CTT)
p.P453L
c.1297-1304delGCCTGCCA p.A433fsX461
Nomenclatura
RTH
Fenotipo Normal
Tests de función tiroidea
normales
RTH
Evidencias genéticas y clínicas para la actividad
dominante negativa ejercida por los TR mutados
TR heterocigota
TR
TR 
Mutación puntual
TR heterocigota
TR homocigota
X
Deleción
X
X
Doble deleción
H
e
r
e
n
c
i
a

a
u
t
o
s
ó
m
i
c
a

d
o
m
i
n
a
n
t
e

H
e
r
e
n
c
i
a

a
u
t
o
s
ó
m
i
c
a

r
e
c
e
s
i
v
a

Dicha actividad disminuye introduciendo mutaciones en el dominio DBD
Objetivo
Investigar la alteración molecular en el gen TR en 5
familias con un cuadro clínico compatible con GRTH.
Metodología
Purificación de ADN genómico a partir de sangre periférica.
PCR de los exones 9 y 10
Secuenciación
SSCP para validar nuevas mutaciones

3’
T
G
T
T
T
C
C/A
C
C
C
C
T
T
C
T
C
5’

TCAG TCAG TCAG TCAG TCAG
Padre Madre F.B. Ve.B. Vi.B.
Mutación en el exón 10
p.P453T
Familia 1
1357:
Alelo Normal Alelo Mutado
CCT ACT
Pro (453) Thr (453)
Nueva mutación en el exón 10
p.I431M
Familia 2

3’
G
T
C
C
G
A
G
G
A/G
T
A
G
T
A
5’

TCAG TCAG TCAG TCAG
Control M.A Padre Madre
1293:
N1 N2 N3 Vi.B. M.A. N4 N5 N6 N7 N8
SSCP : Gel de poliacrilamida al 10 %.
Al. normal Al. mutado
ATA ATG
Ile (431) Met (431)
¿Origen “de novo”?
-TGrI29 y TGrI30
-HLA: Ex. 2 del gen DQ1
Alelo normal Alelo mutado
CGG TGG
Arg (338) Trp (338)
Mutación en el exón 9
p.R338W
3’
A
C
C
G
G
G
G
C/T
A
C
A
G
T
G
A
C
G
5’

TCAG TCAG
M.A. J.A.
1012:
Familia 3
TCAG TCAG TCAG TCAG TCAG
Padre C.B. Madre Hna 1 Hna 2
3’ 3’
G C
A C
C T
C T
G C
T G
A C
C C
C G
G A
T C
C C
C G
G T
A A
G G
G G
A A
T T
A A
G G
5’ 5’

N M
Nueva deleción en el exón 10 : c.1297-1304delGCCTGCCA

Madre Padre C.B. Hna1 Hna2 Control
203 pb
201 pb
199 pb
197 pb
538 pb

Madre Padre C.B. Hna1 Hna2 Control
502 pb
Alelo Normal
1145 Exon 10
.................................................ATCGCCCGGGG
R P G
CTTGCCTGTGTTGAGAGAATAGAAAAGTACCAAGATAGTTTCCTGCTGGCCTTTGAACAC
L A C V E R I E K Y Q D S F L L A F E H
TATATCAATTACCGAAAACACCACGTGACACACTTTTGGCCAAAACTCCTGATGAAGGTG
Y I N Y R K H H V T H F W P K L L M K V
1297 1304
ACAGATCTGCGGATGATAGGAGCCTGCCATGCCAGCCGCTTCCTGCACATGAAGGTGGAA
T D L R M I G A C H A S R F L H M K V E
TGCCCCACAGAACTCTTCCCCCCTTTGTTCCTGGAAGTGTTCGAGGATTAGACTGACTGA
C P T E L F P P L F L E V F E D
*
1413
ATTCATTCTCATAATTCC..........................................
Alelo Mutado
1145 Exon 10
.................................................ATCGCCCGGGG
R P G
CTTGCCTGTGTTGAGAGAATAGAAAAGTACCAAGATAGTTTCCTGCTGGCCTTTGAACAC
L A C V E R I E K Y Q D S F L L A F E H
TATATCAATTACCGAAAACACCACGTGACACACTTTTGGCCAAAACTCCTGATGAAGGTG
Y I N Y R K H H V T H F W P K L L M K V
1297-1304delGCCTGCCA
ACAGATCTGCGGATGATAGGA TGCCAGCCGCTTCCTGCACATGAAGGTGGAA
T D L R M I G C Q P L P A H E G G M
TGCCCCACAGAACTCTTCCCCCCTTTGTTCCTGGAAGTGTTCGAGGATTAGACTGACTGA
P H R T L P P F V P G S V R G L N
*
1413
ATTCATTCTCATAATTCC..........................................
Análisis de microsatélites
TGrI29 TGrI30
Familia 4
1 461 aa
Cluster 1 Cluster 2 Cluster 3
Hinge
AF-2
Wild Type
NH
2
-

-COOH

DBD LBD
1297-1304delGCCTGCCA
1 460 aa
Hinge
Cluster 1 Cluster 2 Cluster 3
AF-2
NH
2
-

-COOH

DBD LBD
TCAG TCAG
M.F. Control
Nueva mutación en el exón 9
p.L341P
Alelo Normal Alelo mutado
CTG CCG
Leu (341) Pro (341)


3’
T
A
A
A
A
A
G
T/C
C
G
A
C
C
G
G
5’

1307 :
Familia 5
Mutaciones identificadas en el gen TR
Exón Pacientes Mutaciones Nuevas Instituciones
9 PC c.991A>G
(AAT>GAT)
p.N331D H. Gutiérrez
ARGENTINA
9 MF c.1022T>C
(CTG>CCG)
p.L341P H. Gutiérrez
ARGENTINA
9 AS c.1036C>T
(CTT>TTT)
p.L346F H. Gutiérrez
ARGENTINA
10 MA c.1293A>G
(ATA>ATG)
p.I431M H. Garrahan
ARGENTINA
10 CB c.1297-
1304delGCCT
GCCA
p.A433fs
X461
H. Militar
Central
ARGENTINA
10 ED c.1358C>T
(CCT>CTT)
p.P453L H. Gutiérrez
ARGENTINA
10 MF c.1339C>A
(CCC>ACC)
p.P447T H. R. Mejía
ARGENTINA
Exón Pacientes Mutaciones conocidas Instituciones
9 MA c.1012C>T
(CGG>TGG)
p.R338W H. Garrahan
ARGENTINA
10 GC c.1357C>A
(CCT>ACT)
p.P453T H. Durán
ARGENTINA
10 VB c.1357C>A
(CCT>ACT)
p.P453T H. Eva Perón
ARGENTINA
10 NL c.1357C>A
(CCT>ACT)
p.P453T H. M.Central
ARGENTINA


9 EM c.1003G>C p.A335P IDIMI
10 (GCA>CCA) CHILE
10 AE c.1376T>G p.F459C H. Clínicas
(TTC>TGC) Uruguay
8 GF c.803C>G p.A268G H. Clínicas
(GCC>GGC) ARGENTINA

312pb
262pb



50pb
312pb
Exón 10
Amplificación por PCR
262pb 50pb
ccannnnn nnnntgg
cccnnnnn nnnntgg
XcmI
XcmI
Agarosa 3%
MK Ndig GC BGL s/enz
Validación de la mutación p.P453T por digestión con XcmI
THR-WT
ESP

THR-N331D
ESP
THR-R338W
ESP
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
HHEE-----HHHHHHHH----------E-H---HHHHH--------EEEE--EHHH----
HHEE-----HHHHHHHH------------H---HHHHH--------EEEE--EHHH----


QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTWGQLKNGGLGVVSDAIFDLGMSL
HHEE-----HHHHHHHH----------E-H---HHHHH--------EEEE--EHHH----
THR-L341P
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQPKNGGLGVVSDAIFDLGMSL

ESP
HHEE-----HHHHHHHH----------E-H---HEH----------EEEE--EHHH----


THR-L346F
ESP
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGPGVVSDAIFDLGMSL

HHEE-----HHHHHHHH----------E-H---HHHHH---------EEEE-EHHH----


QIILLKGCCMEIMSLRAAVRYDPESETLTLDGEMAVTRGQLKNGGLGVVSDAIFDLGMSL


Exón 9
Análisis predictivo de la estructura secundaria del receptor
E: lámina  H:  hélice -: aa conectores
Exón 10
Análisis predictivo de la estructura secundaria del receptor
E: lámina  H:  hélice -: aa conectores
THR

- WT LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
ESP HHH - H --- HEHE --- HHHHHH ------------- HHHH ---

THR

- p.I431M LLMKVTDLRMMGACHASRFLHMKVECPTELFPPLFLEVFED
ESP HHH - HH -- HHHHH -- HHHHHH ------------- HHHH ---

THR

- p.P447T LLMKVTDLR MIGACHASRFLHMKVECTTELFPPLFLEVFED
ESP HHH - H --- HEHE --- HHHHHHH ------------ HHHH ---

THR

- p.P453T LLMKVTDLRMIGACHASRFLHMKVECPTELFPTLFLEVFED
ESP HHH - H --- HEHE --- HHHHHH ----------- HHHHHH ---

THR

- p.P453L LLMKVTDLRMIGACHASRFLHMKVECPTELFPLL FLEVFED
ESP HHH - H --- HEHE --- HHHHHH ---------- HHHHHHH ---
Homo sapiens
Macaca mulatta
Macaca fascicularis
Mus musculus
Rattus norvegicus
Equus caballus
Canis familiaris
Conger myriaster
Danio rerio
Gallus gallus
Xenopus laevis
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKVCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
LPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSD
p.N331D p.L346F p.R338W
p.L341P
296
296
296
296
296
296
302
232
230
204
208

351
351
351
351
351
351
357
287
285
259
263

Homo sapiens
Macaca mulatta
Macaca fascicularis
Mus musculus
Rattus norvegicus
Equus caballus
Canis familiaris
Conger myriaster
Danio rerio
Gallus gallus
Xenopus laevis
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVGCPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHKVSYFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHKVAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHHVAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
INYRKHNIAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
p.P447T p.P453L
p.P453T
p.I431M
407
407
407
407
407
407
413
343
341
315
319
461
461
461
461
461
461
467
397
395
369
373
Análisis evolutivo del receptor
P453
L456
E457
L453
L456
E457
T453
L456
E457
Mutaciones identificadas en el gen TR
Exón Pacientes Mutaciones Nuevas Instituciones
9 PC c.991A>G
(AAT>GAT)
p.N331D H. Gutiérrez
9 MF c.1022T>C
(CTG>CCG)
p.L341P H. Gutiérrez
9 AS c.1036C>T
(CTT>TTT)
p.L346F H. Gutiérrez
10 MA c.1293A>G
(ATA>ATG)
p.I431M H. Garrahan
10 CB c.1297-
1304delGCCT
GCCA
p.A433fs
X461
H. Militar
Central
10 ED c.1358C>T
(CCT>CTT)
p.P453L H. Gutiérrez
10 MF c.1339C>A
(CCC>ACC)
p.P447T H. Ramos
Mejía
Exón Pacientes Mutaciones conocidas Instituciones
9 MA c.1012C>T
(CGG>TGG)
p.R338W H. Garrahan
10 GC c.1357C>A
(CCT>ACT)
p.P453T H. Durán
10 VB c.1357C>A
(CCT>ACT)
p.P453T H. Eva Perón
10 NL c.1357C>A
(CCT>ACT)
p.P453T H. Militar
Central
En el 90 % de casos de RTH no existen síntomas ni
signos patognomónicos por lo cual la identificación de
nuevas mutaciones en el gen TR aumentará la
precisión en el diagnóstico y tratamiento de RTH.



Conclusiones
El análisis de la estructura secundaria de las
proteínas mutadas y los estudios evolutivos proteicos
permiten inferir que las mutaciones identificadas son
de tipo inactivante.

El análisis poblacional indica que la mutaciones
identificadas no se tratan de polimorfismos
frecuentes.
Perspectivas
2) Expresión in vitro de los alelos TR
conteniendo las mutaciones identificadas.
Determinación de la afinidad de las hormonas
tiroideas por los receptores mutados.
1) Búsqueda de mutaciones en los exones 7 y
8 del gen TR en aquellos pacientes en los
cuales no se han identificado alteraciones.
Binding a co-represores
Binding a co-activadores
“Mutaciones del Receptor de TSH en Patología Tiroidea”
H
2
O
2
Gen de la TG Transcripción
ARNm
Traducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS
TG
TPO
NIS
Pendrina
RXR
Zn
TR
Zn
Co-activador
TRE
O HO CH2 OH
NH2
COOH
I
I
I
TATA
Gen Blanco
TF IIB
TBP
Membrana basolateral
Membrana apical
Transcripción
T
3
I
-
RNA pol
TTF-1, TTF-2, PAX8
ThOX
Molecular cloning of the thyrotropin receptor. Parmentier
M, Libert F, Gerard C, Perret J, Van Sande J, Dumont J,
Vassart G. Science 246: 1620 – 1622, 1989.

Cloning, sequencing and expression of the human
thyrotropin (TSH) receptor. Libert F, Lefort A, Parmentier
M, Ludgate M, Dumont J, Vassart G. Biochemical and
Biophysical Research Communications 165: 1250 – 1255,
1989.

Estudio del Hipertiroidismo
sin componente inmunitario.
Identificación de mutaciones en el gen del Receptor de TSH
responsables de la patogenia de formas localizadas
o generalizadas de la hiperfunción
de las células tiroideas.
Antecedentes
I
+
I
-
H
2
O
2
Mit
Dit
Mit
Dit
T
3
T
4
TG
TG
Lumen folicular
Pendrina
DUOX TPO
NIS
I
-
Na
+
Circulación sanguínea
Esquema simplificado de la síntesis de hormonas tiroideas
Membrana
basolateral
NH2
COOH
Y Y
Y
Representación esquemática del Receptor de TSH
motivos de 25 residuos ricos en leucina
Dominio extracelular: 398 AA
6 sitios de glicosilación
especificidad de “binding”
Dominios transmembrana: 270 AA
Homología con R de LH/CG y R de FSH
Dominio intracelular: 76 AA
Activación de Gs
TSH
Cascada regulatoria controlada por el receptor de TSH
Receptor de TSH
Proteína Gs
inactiva
GDP



GTP
Receptor de TSH
GTP



GDP
TSH
OFF
Receptor de TSH
GTP



Proteína Gs
activa
Adenil ciclasa activa
ATP
AMPc
TSH
ON
Receptor de TSH
GDP



Adenil ciclasa
GTP
RXR
Zn
TR
Zn
Co-activador
OH
NH2
I
I
I
Gen Blanco
TRE
O HO CH2
COOH
TATA
TF IIB
TBP
Transcripción
T
3
RNA pol
H
2
O
2
Gen de la TG

Transcripción
ARNm
T raducción
I
-
Gen de la TPO
TSH
receptor de TSH
proteína G
GDP
GS 
TG
TPO
NIS
Pendrina
Membrana basolateral
Membrana apical
I
-
TITF-1, TITF-2, PAX8
DUOX
Fisiología molecular
Adenil ciclasa

Gen: 60 Kb
1 2 3 4 5 6 7 8 9 10
5’
203 71 74 74 74 77 68 77 188 1000 pb
3’
Proteína: 764 aa COOH NH
2

ARNm: 2.295 b
5’ 3’
Cromosoma 14
14q31
Representación esquemática del gen del Receptor de TSH
Mutaciones en el gen del Receptor de TSH
Las características y severidad de los fenotipos que resultan de la
expresión de receptores anómalos varían, dependiendo de:
1) Naturaleza de la mutación
 Somática

 Por línea germinal
Familiar
Esporádica (de novo)
2) Localización de la mutación en la secuencia codificante
Dominios
Extracelular
Transmembrana
Intracelular
3) Base genética del paciente
4) Factores ambientales
Afecta a una célula tiroidea y a las células hijas que derivan de su
multiplicación.
Afecta a toda la tiroides
Mutaciones en el Receptor de TSH
Pérdida de Función Ganancia de Función
Resistencia a la tirotrofina Hipertiroidismo no Autoinmune
Hipertiroidismo
 Autoinmune: Autoanticuerpos activan la
cascada adenilciclasa-AMPc.
 No autoinmune: Mutaciones en el receptor
de TSH y en la proteína G activan en forma
autónoma la cascada adenilciclasa-AMPc.
Mutaciones del Receptor de TSH
Autonomía Tiroidea




Tiroides Normal
Adenoma Tiroideo
Tóxico
Bocio Multinodular
Tóxico
Hiperplasia Tiroidea
Tóxica
Formas clínicas de hipertiroidismo no autoinmune
Mutaciones en el receptor que producen
fenotipos con ganancia de función.
Causas:
GTP



Proteína Gs
activa
Adenil ciclasa
Receptor de TSH
ATP
AMPc
PKA
Activación de la Función Tiroidea
Proliferación celular
Mutación
Autonomía de la cascada regulatoria como
consecuencia de mutaciones activantes
Ganancia de función: activación del receptor en ausencia de ligando.
Estrategia experimental
Purificación de ADN de leucocitos, tejido tiroideo (nodular y
perinodular)
Amplificación del exón 10 y secuenciación
Estudios funcionales
Producción de AMPc
Acumulación de inositol fosfato
Binding con
125
I-TSH
COS 7
Vector pSVL Receptores Mutados

Identificación de mutaciones
Mutación Exón Localización en la proteína
Serina 281 Asparagina 9 Dominio aminoterminal Extracelular
Serina 281 Treonina 9 Dominio aminoterminal Extracelular
Serina 281 Isoleucina 9 Dominio aminoterminal Extracelular
Metionina 453 Treonina 10 Segundo segmento de transmembrana
Isoleucina 486 Metionina 10 Primer “loop”extracelular
Isoleucina 568 Treonina 10 Segundo “loop”extracelular
Aspártico 619 Glicina 10 Tercer “loop” intracelular
Alanina 623 Valina 10 Tercer “loop” intracelular
Alanina 623 Isoleucina 10 Tercer “loop” intracelular
Alanina 623 Serina 10 Tercer “loo p” intracelular
Leucina 629 Fenilalanina 10 Sexto segmento de transmembrana
Isoleucina 630 Leucina 10 Sexto segmento de transmembrana
Fenilalanina 631 Leucina 10 Sexto segmento de transmembrana
Fenilalan ina 631 Cisteína 10 Sexto segmento de transmembrana
Treonina 632 Isoleucina 10 Sexto segmento de transmembrana
Aspártico 633 Glutámico 10 Sexto segmento de transmembrana
Aspártico 633 Treoni na 10 Sexto segmento de transmembrana
Aspártico 633 Histidina 10 Sexto segmento de transmembrana
Aspártico 633 Alanina 10 Sexto segmento de transmembrana
Prolina 639 Serina 10 Sexto segmento de tran smembrana
Valina 656 Fenilalanina 10 Tercer “loop” extracelular
Del 613 - 621 10 Tercer “loop” extracelular
Del Tirosina 655 10 Tercer “loop” extracelular”
Del 658 - 661 10 Tercer “loop” extracelular

Mutaciones en el gen del receptor de TSH en el adenoma
tiroideo tóxico y en el bocio multinodular tóxico.
Tipo de Mutación: Somática
Presencia Alélica: Heterocigota
Adenoma tiroideo tóxico
Mutaciones en Gs
(Arg 201, Glu 227)
Mutaciones en el gen del R de TSH en la Hiperplasia Tiroidea Tóxica
Congenital hyperthyroidism caused by a mutation in the thyrotropin-receptor gene. Peter
Kopp, Gilbert Vassart. The New England J ournal of Medicine, 1995.
Alelo Normal Alelo mutado
CTC TTC
Leu (631) Phe (631)
Mutación por línea
germinal esporádica
(6º segmento de TM)
Mutación Exón Localización en la proteína Tipo de herencia
Serina 281 Asparagina 9 Dominio aminoterminal EC Esporádico
Metionina 453 Treonina 10 Segundo segmento de TM Esporádico
Serina 505 Asparagina 10 Tercer segmento de TM Esporádico
Serina 505 Arginina 10 Tercer segmento de TM Familiar
Valina 509 Alanina 10 Tercer segmento de TM Familiar
Alanina 623 Valina 10 Tercer “loop” intracelu lar Familiar
Leucina 629 Fenilalanina 10 Sexto segmento de TM Familiar
Fenilalanina 631 Leucina 10 Sexto segmento de TM Esporádico
Tronina 632 Isoleucina 10 Sexto segmento de TM Esporádico
Asparagina 650 Tirosina 10 Sexto segmento de TM Familiar
Asparagina 670 Serina 10 Séptimo segmento de TM Familiar
Cisteína 672 Tirosina 10 Séptimo segmento de TM Familiar
Del 613 - 621 10 Tercer “loop” extracelular Familiar / E sporádico
Del 655 10 Tercer “loop” extracelular Familiar / Esporádico
Del 658 - 661 10 Tercer “loop” extracelular Familiar / Esporádico

Mutaciones en el gen del receptor de TSH
Hiperplasia Tiroidea Tóxica.
Tipo de Mutación: Germinal
Presencia Alélica: Heterocigota
Tipo de herencia: Autosómica Dominante
Hipertiroidismo familiar gestacional
Por mutagénesis dirigida se determinó que la ganancia de
función era debida a la pérdida de la lisina en la posición 183.
Mutación identificada: Lys 183 Arg, Met, Gln
Localización en la proteína: Dominio extracelular aminoterminal
Tipo de Mutación: Germinal
Presencia Alélica: Heterocigota
Tipo de herencia: Autosómica Dominante
Efecto: Sensibilidad aumentada a la estimulación por hCG
respecto del receptor WT
Mutaciones en el gen del receptor de TSH
Carcinomas de tiroides
Mutación Exón Localización en la proteína
Alanina 623 Serina 10 Tercer “loop” intracelular
Treonina 632 Alanina, Isoleucina 10 Sexto segmento de TM
Aspártico 633 Histidina 10 Sexto segmento de TM
Del 613 - 621 10 Tercer “loop” extracelular
Del 655 10 Tercer “loop” extracelular
Del 658 - 661 10 Tercer “loop” extracelular

Carcinomas tiroideos
Mutaciones en Gs
(Arg 201, Glu 227)
Tipo de Mutación: Somática
Presencia Alélica: Heterocigota
Mutaciones activantes en el receptor de TSH
Gs
Gs
S281L
Gs
-
+
+
Modelo de la activación de Gs por el Receptor de TSH
Más de 37 mutaciones activantes han sido descriptas
siendo una valiosa herramienta para el análisis de la
estructura / función del R de TSH.
No existe una relación simple entre la posición de las
mutaciones o la naturaleza de la sustitución aminoacídica y
sus características funcionales.
 Adenoma tiroideo tóxico
 Hiperplasia tiroidea tóxica
Mutaciones activantes en el Receptor de TSH son la
principal causa de:
Conclusiones: Autonomía
Es necesario para estudios funcionales usar un contexto celular
correcto en donde las características bioquímicas de ganancia
de función de los receptores mutados sean representativas del
escenario fisiológico o patofisiológico de la tiroides.
Mutaciones del Receptor de TSH
Resistencia a la Tirotrofina
Incidencia: 1/3000 - 1/4000 recién nacidos.
Hipotiroidismo sin bocio o disembriogénesis (80 %)
 Causas: agenesia, hipoplasia, ectópica

 Genes alterados: TTF1, TTF2, PAX 8, TSHR, NKX2-5
Hipotiroidismo con bocio o dishormonogénesis (20 %)
 Causa: defectos en la síntesis de hormonas tiroideas
 Genes alterados: TG, TPO, Pendrina, NIS, Duox 2, Duox A2,
DEHAL1
Hipotiroidismo Congénito
TSH TSH TSH TSH TSH
T
4
T
3

T
4
T
3

T
4
T
3

T
4
T
3

T
4
T
3

TG TG
TG TG TG
TG TPO
DUOX2
DUOXA2
TTF1
TTF2
PAX8
NKX2.5
TSHR
DEHAL1
TSH sérica y

TT
4
y TT
3
sérica



TG sérica


Tamaño de la Tiroides
Test de descarga de
Perclorato
Gene(s) involucrados
Disgenesias
Tiroideas y
Resistencia a
TSH

Defecto de la
Organificación
del Ioduro
Defecto de la
Síntesis de la
Tiroglobulina

Defecto del
reciclado del
Ioduro
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
hours
%

u
p
t
a
k
e

o
f

1
3
1
I

KClO4
Descarga de Perclorato
Mutaciones inactivantes en el receptor de TSH
Exon
1
4
6
6
10
10
10
10
10
10
10




ttcattctctctctctctttctctctctccctctagTTACCTAAACAAGAATAAATACC


ttcattctctctctctctctctttctctctctccctctagTTACCTAAACAAGAATAAATACC


ttcattctctctctctctctctctttctctctctccctctagTTACCTAAACAAGAATAAATACC
pSPL3-[CT]
6
pSPL3-[CT]
8
pSPL3-[CT]
9
Estudios de splicing
c.553T>C (p.N187N) g.IVS6+13A>G g.IVS5-69C>T
C A
T
Exon 6 Exon 7
Haplotype CAT
T G
C
Exon 6 Exon 7
Haplotype TGC
C/T A/G
T/C
Exon 6 Exon 7
Haplotype CAT/TGC
c.553T>C (p.N187N) g.IVS6+13A>G g.IVS5-69C>T
C A
T
Exon 6 Exon 7
Haplotype CAT
C A
T
Exon 6 Exon 7
Haplotype CAT
T G
C
Exon 6 Exon 7
Haplotype TGC
T G
C
Exon 6 Exon 7
Haplotype TGC
C/T A/G
T/C
Exon 6 Exon 7
Haplotype CAT/TGC
C/T A/G
T/C
Exon 6 Exon 7
Haplotype CAT/TGC
Pattern A
Pattern B
Pattern C
TGTACAACAATGGCTTTACTTCA TGTACAACAATGGCTTTACTTCA AGTGCATATGCGCAGCAAGA AGTGCATATGCGCAGCAAGA AGTATTACCAGTTCTACTCC AGTATTACCAGTTCTACTCC
C/C A/A
T/T
GAGTATTACCGGTTCTACTCC GAGTATTACCGGTTCTACTCC AGTGCATATGTGCAGCAAGA AGTGCATATGTGCAGCAAGA TGTACAACAACGGCTTTACTTCA TGTACAACAACGGCTTTACTTCA
T/T G/G C/C
AGTGCATATGNGCAGCAAGA AGTGCATATGNGCAGCAAGA AGTATTACCNGTTCTACTCC AGTATTACCNGTTCTACTCC TGTACAACAANGGCTTTACTTCA TGTACAACAANGGCTTTACTTCA
C/T A/G T/C
Exon 6 Exon 7
TGTACAACAATGGCTTTACTTCA TGTACAACAATGGCTTTACTTCA AGTGCATATGCGCAGCAAGA AGTGCATATGCGCAGCAAGA AGTATTACCAGTTCTACTCC AGTATTACCAGTTCTACTCC
C/C A/A
T/T
AGTGCATATGCGCAGCAAGA AGTGCATATGCGCAGCAAGA AGTATTACCAGTTCTACTCC AGTATTACCAGTTCTACTCC
C/C A/A
T/T
GAGTATTACCGGTTCTACTCC GAGTATTACCGGTTCTACTCC AGTGCATATGTGCAGCAAGA AGTGCATATGTGCAGCAAGA TGTACAACAACGGCTTTACTTCA TGTACAACAACGGCTTTACTTCA
T/T G/G C/C
GAGTATTACCGGTTCTACTCC GAGTATTACCGGTTCTACTCC AGTGCATATGTGCAGCAAGA AGTGCATATGTGCAGCAAGA TGTACAACAACGGCTTTACTTCA TGTACAACAACGGCTTTACTTCA
T/T G/G C/C
AGTGCATATGNGCAGCAAGA AGTGCATATGNGCAGCAAGA AGTATTACCNGTTCTACTCC AGTATTACCNGTTCTACTCC TGTACAACAANGGCTTTACTTCA TGTACAACAANGGCTTTACTTCA
C/T A/G T/C
AGTGCATATGNGCAGCAAGA AGTGCATATGNGCAGCAAGA AGTATTACCNGTTCTACTCC AGTATTACCNGTTCTACTCC TGTACAACAANGGCTTTACTTCA TGTACAACAANGGCTTTACTTCA
C/T A/G T/C
Exon 6 Exon 7 Exon 6 Exon 7

Sign up to vote on this title
UsefulNot useful