Vous êtes sur la page 1sur 92

Novembre2014

Remerciements

M.DidierAgar,AcadmiedeToulouse
M.GuyBarral,LeBibliophilelanguedocien
M.RmyCazals,UniversitdeToulouseJeanJaurs
MmeSarahGrossert,Lautarchiv,UniversitHumboldtdeBerlin
M.JeanLucLafon,CentreCulturelOccitanduRouergue
M.JeanJacquesMurat,CercleOccitandeLaSeynesurMer
MmeJosphinePags,Brommes,MurdeBarrez
MmeMarieNollePerrin,ArchivesMunicipalesdeMarseille
MmeRaymondeVialette,SaintJeandAlcas
2
Lenga(s)degurra:DocumentsoccitansdelaGrandeGuerre

1.PRESSEETREVUES
1.1Journauxdetranchesenoccitan
1.2Journauxetrevuesdeguerreenoccitan
1.2.1Journauxetrevuescrspendantlaguerre
1.2.2.Revuesoccitanespendantlaguerre
1.3Loccitandanslapresseetlesrevuesfranaises
1.3.1Publicationsdufront
1.3.2Publicationsdelarrire
2.AFFICHESETCARTESPOSTALES
2.1Cartespostalesenoccitan
2.2Affichesenoccitan
3.CHANSONSETPARTITIONS
3.1Pendantlaguerre
3.2Aprslaguerre
4.TMOIGNAGES
4.1Carnetsetrcitsdeguerre
4.2Correspondancedescombattants
4.2.1Correspondancesenoccitan
4.2.2Correspondancesavecdesmentionsenoccitan
4.3Enregistrementssonores
4.4Photographies
4.5Manuscrits
5.MONUMENTSAUXMORTSETLIEUXDEMMOIRE
6.LITTRATURE
6.1Ouvragespublisdepuislaguerrejusqunosjours
6.2Affairedu15meCorps(enfranais)
7.ARTSSCNIQUES
8.RESSOURCESENLIGNE


3
INTRODUCTION

La question linguistique demeure curieusement absente de l'historiographie de la Premire Guerre


mondiale en France. Parmi les soldats bretons, basques, ch'tis le terme est d'ailleurs sorti des
tranches, cr par des soldats mis au contact de ces gars du Nord qui parlaient une langue particulire
provenaux, languedociens, auvergnats ou encore gascons pour l'espace occitanophone, une grande
majorit a tmoign de son exprience de la guerre dans des carnets, lettres, mmoires et souvenirs, en
franais. Partant de ce constat, les historiens ont sembletil dfinitivement clos le dossier des langues dans
laguerre.

On ne peut s'empcher de penser, au regard de la littrature et des discours antipatois qui dominent
encore largement la pense officielle au XXe sicle, que nombre d'historiens ont t dtourns du sujet
linguistique par l'ide, dsormais classique, du faible intrt de la ralit sociolinguistique d'un pays dont la
langueestrpute,depuisl'abbGrgoire,uneetindivisible.

L'histoire de la Grande Guerre en France a pourtant considrablement volu ces quarante dernires
annes, grce une plus grande considration pour les documents produits par les combattants
euxmmes, au dtriment des sources traditionnelles de l'administration et de la presse, plus aptes
vhiculer, en temps de guerre et de censure, l'idologie officielle le fameux bourrage de crne que
la ralit des expriences vcues de la guerre. On aurait pu penser que ce retour la masse , aux
sources directes des combattants et des populations de l'Arrire, la question sociale, voire territoriale,
aurait permis de mettre jour les nombreuses questions linguistiques que le conflit met en lumire pour
comprendre la France de 1914, comme celle, bouleverse, de l'aprs1918. Force est de constater que a
n'a pas encore t le cas malgr un certain nombre de chantiers (enfin) ouverts, en majorit pour les
soldats bretons ou, en ce qui concerne la question occitane , avec l'analyse de l'affaire du 15e corps qui
permit un nouvel examen de la doctrine de l'Union sacre, comme dans le temps plus long, de la suspicion
denombreuseslitesfranaisespourunMidiculturellementetlinguistiquementsidiffrents.

Les traces et les documents sont pourtant bien l : mots, expressions voire passages entiers dans les
carnets et correspondances de soldats, articles et journaux de guerre entirement rdigs en occitan, en
breton, en basque. De l'occitan, on en trouve finalement partout : sur les affiches, en lgende de cartes
postales et de caricatures de propagande, dans les journaux de tranches, dans la presse y compris
nationaledel'poque,etjusquesurlesmonumentsauxmortsetautreslieuxdemmoiredelaguerre.

Le CIRDCMediatca occitana a entam en 2014 un grand chantier de reprage, d'tude, de


sauvegarde des documents occitans de la Grande Guerre, auquel tous les dtenteurs de documents,
institutionnels et privs, sont invits participer en signalant une documentation parfois unique, souvent
rarissime,et,danslagrandemajoritdescas,encoreinconnuedeshistoriens.

4
1.PRESSEETREVUES
1.1Journauxdetranchesenoccitan

Les journaux de tranches reprsentent un type de publication li l'volution de la guerre de


19141918. Ils apparaissent ds que le front se stabilise et que commence une guerre de tranches,
conuspardessoldatsetdesofficiersaufront.
Enterrs dans les tranches, des soldats rdigent, de manire manuscrite d'abord, puis sous forme de
petites feuilles ronotypes ou imprimes, des journaux destins distraire leurs camarades. Ils jouent
un rle essentiel pour le moral des troupes, comblant l'absence de nouvelles et aidant, grand renfort
d'humour,vaincrel'ennui,voireledsespoir.

Le premier d'entre eux, l'cho de l'Argonne, nat en octobre 1914. Les journaux de tranche
prolifrent sur le front franais. Le Petit Colonial, Lcho de lArgonne, Le Poilu et Lcho des
marmites sont les premiers tre crs, suivis par beaucoup d'autres. Leur priodicit est bien souvent
incertaine. On recense pourtant plus de 450 titres souvent tir un trs faible nombre d'exemplaires,
l'exception de quelquesuns comme Le Crapouillot, imprim Paris plus de 1500 exemplaires, et qui
connatrauneexceptionnellelongvit.
Les journaux dits par les troupes de premire ligne sont majoritaires alors que les journaux des units
de seconde ligne (artilleurs et territoriaux, soldats du gnie, cavaliers et blinds) ne reprsentent quun
tiers des publications. Les titres sont rdigs dans les units, moins exposes que linfanterie de premire
ligne. Ils manent gnralement de soldats ayant une spcialit (fourriers, brancardiers, tlphonistes,
vaguemestres,cyclistes,cuisiniers,etc.).
Plusieurs journaux de tranches sont rdigs entirement en occitan. La plupart dentre eux sont crs
parlessocitsflibrennesconstituesauFront.


5
EcduBousquetoun.EscoloduBoumbardamen.[S.l.]:[s.n.],19151919.

Lieuxdeconservation:CIRDC(Bziers),fondsJouveau[JOU192]:n.13,1917n.14,1917
BnF [4LC6281 (A)] : [1915] (n3446). juin 1916 [II, n3031] 1917 [III, n13,12], Bibliothque du
PuyenVelay[4164].
Datesextrmesdepublication:19151919
Priodicit:Hebdomadairepuisbimensuel
Documentdisponibleenligne:http://www.purl.org/occitanica/bibliotecanumerica/corpus/4928
Rdacteurs : Francis Pouzol Marius Jouveau Albert Boudon Louis Abric Louis Fourmaud Alain
CharrasseGustaveArsac(...)

Lcole flibrenne L'Escolo du Boumbardamen est cre le 28 janvier 1915 dans une tranche de
Lorraine, Remires. Fonde par Albert BoudonLashermes (18821967), elle comprend en grande
majorit des flibres issus du Velay. Ses statuts relevs dans le bulletin prcisent que "pour devenir
flibre de l'Escolo il faut tre soldat dans une unit combattante, tre sur le front ou avoir t
vacu comme bless ou malade". Sa devise est "lou canoun me fai canta", pastiche de la devise
mistralienne "lou soulu me fai canta". Cette devise se trouve grave sur plusieurs cagnas (abris) de
premire ligne. Les statuts de cette Escolo navaient quun article: Li mmbre de lEscolo sacampon
quand podon e coume podon, pr faire un boun repachoun e pr felibreja (Les membres de
l'cole se runissent quand ils peuvent et comme ils peuvent, pour faire un bon repas et pour
flibrger).
Ds 1915, l'Escolo du Boumbardamen imprime sur le front trois numros d'un journal intitul L'Echo
des cagnas Remires qui cdera vite la place L'Echo du Boqueteau (45 numros dits en 1915).
Jusqu'en mars 1916, la revue est bilingue (franais/occitan) tout en gardant son nom franais. Elle publie
essentiellement des pomes de circonstance en occitan, inspirs de la vie quotidienne au front, dans la
tradition des activits flibrennes ainsi que des nouvelles des soldats flibres faits prisonniers, blesss ou
disparus.
C'est le 16 avril 1916 qu'est cre l'dition provenale intitule L'Ec du bousquetoun distincte de
l'dition franaise qui continue publier quelques textes en occitan. En 1917, BoudonLashermes lance
une troisime dition parallle de ce journal sous la forme d'une dition vellave (du Velay) intitule L'Ec
deiBousquetoun.Cestroisversionsparaissentjusqu'enjanvier1919.
N, comme tous les journaux du front, de lennui et du dsuvrement de la vie de tranche, L'Eco tait
imprim avec un procd de type polycopie , moins coteux et plus simple mettre en place qu'une
impressionprofessionnelleentempsdeguerre.
Pourensavoirplus:
BOUDONLASHERMES, Albert. Un journal de tranche : lEcho du boqueteau. Le Puy. Impr. des
Flibres,1919.(CoteCIRDC(Bziers)[JOUC308])

7
Buletindel'EscoloduBoumbardamen.EscoloduBoumbardamen.[S.l.]:[s.n.],1916.

Lieuxdeconservation:CIRDC(Bziers),fondsJouveau[JOU195]:[1916]12numros
Datesextrmesdepublicationconnues:1916
Priodicit:Numrosnondats
Documentdisponibleenligne:http://www.purl.org/occitanica/bibliotecanumerica/corpus/4863
Rdacteurs : Francis Pouzol Marius Jouveau Lon Teissier Jdi Maillet Louis Abric, SullyAndr
PeyrePierreCaussePierreAzmaJeanHustachLouisBonfils(...)

Cest sous lgide de L'Escolo ponyme que commence paratre en 1916 Lou Buletin de l'Escolo
du Boumbardamen. Une partie des collaborateurs de lcole flibrenne ayant disparu et une autre
grande partie se trouvant hospitalise linstar de son fondateur Albert BourdonLashermes , la
survie du mouvement tint laction de Francis Pouzol qui recruta de nouveaux membres parmi les
flibres de sa connaissance pars sur le front pour cette nouvelle publication. Ce petit bulletin de quatre
pages est conu et rdig au front, dupliqu la pte polycopier. Le Buletin se distingue du journal de
tranche publi par lEscolo du Boumbardamen (L'Ec du bousquetoun, voir cidessus) en tant
un organe dopinion interne lorganisation flibrenne. Il permet aux jeunes flibres mobiliss au front
d'changer leurs ides et de dbattre de leurs projets concernant l'organisation du Flibrige, son projet
politiqueetlastratgiemettreenoeuvreaprslaguerre.
Pourensavoirplus:
BOUDONLASHERMES, Albert. Un journal de tranche : lEcho du boqueteau. Le Puy. Impr. des
Flibres,1919.(CoteCIRDC[JOUC308]).

Lou Boulet rouge [du LioTennt Teissier 12e Cie du 416e S.P. 198]. [S.l.] : [s.n.],
19171919.

Lieux de conservation : CIRDC (Bziers), fonds Jouveau [JOU 196] : n.3, 1917n.19, 1919 (lac. n.9,
n.11,n.14)
Datesextrmesdepublicationconnues:19171919
Priodicit:nonrgulire.Touslesdixjours,mensuel,bimestriel,trimestriel.
Documentdisponibleenligne:http://www.purl.org/occitanica/5095
Rdacteurs:LonTeissierBrunuRougi

Journal ralis par Lon Teissier (18831981), manuscrit et ronotyp, Lou Boulet Rouge compte une
vingtaine de numros imprims entre 1917 et 1919. Son titre fait rfrence aux vers de Frdric Mistral
dans Calendau : Lengo damour, () Tapararen boulet rouge / Car es tu la patrio e tu la liberta ! (
Langue damour (...) Nous te dfendrons boulets rouges / car cest toi la patrie et toi la libert ! ). Ce
journal publie principalement des pomes, des correspondances et donne des nouvelles des soldats
flibres.Ilcontientgalementquelquescomptesrendusdepublicationsflibrennes.
8
Lon Teissier, disciple de Pierre Dvoluy , fait partie des flibres qui souhaitent rformer lorganisation
1
du flibrige. Il exprime librement ses opinions dans le journal, comme en tmoignent quelques vers trs
moqueursdanslen6du25novembre1917:
Avnlacigaloaucapu
Edinslamanunbravepu
(Nousavonslacigaleauchapeau
Etdanslamainungrospoil)


1
Pierre Dvoluy (18621932) de son vrai nom Paul GrosLong, est un pote et romancier occitan, capouli du flibrige
entre 1901 et 1909. Officier de carrire, il est galement adjoint au maire de Nice Jean Mdecin entre 1929 et 1932.
Directeur des revues Prouvno (1905) et Vivo Prouvno! (19071914), il entretient de bonnes relations avec
Frdric Mistral qui lui permet dditer ses Discours e Dicho, mais galement son premier texte, demeur jusquel
inditLiMeissoun.
9
1.2Journauxetrevuesdeguerreenoccitan

la diffrence des journaux de tranches, ces titres sont labors l'arrire, et pour ce qui concerne
l'espace occitanophone, bien loin du front. Pour autant, ils sont parfois en contact direct et permanent
avec les combattants, soit par la correspondance, soit parce que leur rdacteur, comme Pierre Azma
pour Lou Gal de Montpellier, a fait l'exprience du feu avant d'tre rform suite une grave blessure.
Ils peuvent aussi tre un trait dunion entre les combattants comme dans le cas de la Gazeto
Loubetenco o le rdacteur Joseph Loubet qui se dfinit comme un greffier grafi de tuti se charge
de recueillir les nouvelles quil reoit du front et de les faire circuler auprs de ses
lecteurscorrespondants. Pour les uns comme pour les autres il fallait pour parvenir la publication,
surmonter la fois les conditions matrielles imposes par la ralit des combats et la surveillance accrue
delacensurequiapportaitsonvisasurtoutchangedecorrespondanceaveclefront.

1.2.1Journauxetrevuescrspendantlaguerre

LaGazetoLoubetenco.[Paris]:[J.Loubet],19151917.

Lieuxdeconservation:CIRDC(Bziers),fondsJouveau[JOU191]:n.17(1915)n.58(1917)
Mdiathque dArles [RB 228 M], Mdiathque EmileZola (Montpellier) [MS 432] : n1, 31 juillet 1915
n58,30juillet1917.
Datesextrmesdepublicationconnues:19151917
Priodicit:Hebdomadaire
Documentdisponibleenligne:http://www.purl.org/occitanica/bibliotecanumerica/revista/4879
Rdacteurs : Joseph Loubet SullyAndr Peyre Pierre Azma Francis Pouzol, Louis Bonfils Marius
JouveauJeanBaptisteBgarie(...)

Joseph Loubet (18741951), flibre montpellirain install Paris dcide de soutenir ses amis flibres
mobiliss par lenvoi dune correspondance rgulire afin dentretenir leur courage et leur apporter
consolation. En 1915 il trouve le moyen de relier entre eux tous ses correspondants par ldition dune
chronique rgulire ralise partir des lettres reues de lensemble du front. Chez lui, boulevard de
Vaugirard Paris, il transcrit la main les lettres sur une feuille (feuillet de 4 pages) qui est duplique et
parat chaque samedi. Ds son lancement la gazette connat un succs important et son tirage passe de
60 100 exemplaires. Baptise Gazeto Loubetenco, plus qu'un lien entre flibres combattants, elle
devient rapidement un lieu d'change d'ides qui participent au mouvement flibren. La gazette
comportait la fois des ides sur les buts flibrens, des souvenirs savoureux et des renseignements
personnels sur les uns et les autres. En deux annes paratront 58 numros et 22 supplments, soit un
recueil de plus de 300 pages exclusivement en occitan qui passe pour une oeuvre majeure de Joseph
Loubet.
10
Pour en savoir plus : INARD, Lon. La Gazetto Loubetenco et son Grafi (19151917), La France
latine,5859,1974,p.6067.


11
Lou delubre : Santo Ventri ! [Le Mont de la Victoire] : buletin di felibre de la grando
guerro.AixenProvence:[s.n.],19151916.

Lieuxdeconservation:CIRDC(Bziers)[AG]:n.1(1915)n.4(1916)
BnF [FOL LC6 641] : n1,1915n4, 1916, Bibliothque Centrale de Toulon [30182] : n1,1915n4, 1916,
Bibliothque dEtudes et du Patrimoine (Toulouse) [P4137] : n1,1915n4, 1916, Bibliothque de lAlcazar
(Marseille) : n1, 1915n4, 1916, Mdiathque EmileZola (Montpellier) : n1, juin 1915n2, novembre
1915.
Datesextrmesdepublicationconnues:juin1915mai1916
Priodicit:Trimestriel
Rdacteur:MarcelProvence

Publi Aix par Marcel Provence (18921951) entre juin 1915 et mai 1916 (parution de 4 numros),
Lo Delubre : Santo Ventri doit son titre un monument emblmatique de lhistoire de la Provence.
Lou Delubre est en effet un monument dress par le gnral Marius (15786 av. J.C.) au pied de la
MontagneSainteVictoirelammoiredessoldatsromainsayantvaincuslesbarbaresgermains.
Le bulletin se veut un lien entre les flibres du front et ceux rests larrire. Chaque numro dbute par
la liste des flibres morts pour la patrie, suivie dune lettre du capouli (ou dun membre important du
flibrige) en soutien la cause flibrenne sur le front. Il est complt par les actualits lies au flibrige,
et parfois par des discutions et dbats autour de celuici. Le journal bien que relatant principalement
l'vnementiel nen demeure pas moins patriotique et noublie jamais de saluer et soutenir la Grande
Patrie.


12
LouGal.MountPeli:[s.n.],19151920.

Lieuxdeconservation:CIRDC(Bziers)[AG1]:n.2(1915)n.116(1920)
BnF [JO66147] : 1914 [n17], 1917 [n37], juin 1920 [VI, n115], BDIC (Nanterre) [4 PRES 145] :
n1,1915n36, 1916, Bibliothque dEtudes et du Patrimoine (Toulouse) [P16294], Archives
dpartementales de lHrault (Montpellier) : 1914 [n1, 46], 1917 [n 3744, 4648, 5160], 1918 [n6164,
6678,8084],1919[n8587,8990,9294,97,101102],1920[n103110,112116]
Datesextrmesdepublicationconnues:19151920
Priodicit:Mensuel(19151916),bimensuel(19161919),hebdomadaire(1920)
Documentdisponibleenligne:http://occitanica.eu/omeka/items/show/1851
Rdacteurs : Pierre Causse Jean Bardin Louis Bonfils Pierre Azma : Jrdi Maillet Louis Abric
LouisFourmaud(...)

Lou Gal ( Lo Gal en graphie classique, Le coq en franais) est un mensuel (1915), puis
bimensuel (19161919), puis hebdomadaire (1920), d'expression occitane fond en 1915 par Jan
Bardin (Jean Bardin, 18931966) et Pierre Causse (dit Caussou de l'Oulivi, 18831951), rapidement
rejoints par Louis Bonfils (18911918), Jrdi Maillet et surtout Pierre Azma (18911967), figure
majeureduFlibrigelanguedocienpuisdel'occitanismecontemporain.
Ralis l'arrire et imprim Montpellier, le journal se veut un soutien en forme de divertissement per
lossoldatsdauMigjorn("pourlessoldatsduMidi")commeindiqusurlapremirepage:
MandasaufrontlouGal!
Souncantesunregal
Perlouspialutsdinssatranchada

Quandreaupranaqueljournal
Queiportalasourelhada
Elrdaupasmiejournal.

Organe d'esprit flibren, Lou Gal est l'un des rares exemples de journal en occitan qui parat
rgulirement pendant la Premire Guerre mondiale. Les premiers numros sont ronotyps et conus
comme une sorte de bulletin de liaison entre les combattants flibres. Le journal volue dans son
discours et se professionnalise partir de janvier 1916. Il publie essentiellement des textes
d'encouragement patriotique et des divertissements (caricatures, chansons, textes humoristiques) ainsi
que des lettres et tmoignages, souvent anonymes, prsents comme manant de soldats au front. Aprs
la guerre, Lou Gal continue de paratre en accordant une place de plus en plus importante des textes
en franais. Le journal s'arrte en 1920 sous le coup de la crise du papier mais sans doute galement
causedunecriseditoriale(findelaguerre,dveloppementdescontenusenfranais,etc.).

13

14
Cacalaca.Als:[s.n.],19161936.

Lieux de conservation : CIRDC (Bziers) [E6E0] : n.5 (1916)n.70 (1919) n.72 (1926)n.175
(1936)
BnF [JO 56042] : n1, 1916 n 158, 1934, 1936 [n172, 174176], BDIC (Nanterre) [FP 55] : n1, 1916
n70,1919.
Dates extrmes de publication connues : 19161936, devient Le Pays Cvenol et Cacalaca (1 mai
1938).
Priodicit:Bimensuel,parfoismensuel
Documentdisponibleenligne:http://www.purl.org/occitanica/bibliotecanumerica/corpus/4396
Rdacteur:JulienBrabo

Journal cr par Jan Castagno, pseudonyme de Julien Brabo (18591938), flibre cvenol, qui est la
fois directeur du journal, imprimeur et auteur de la plupart des articles sous des pseudonymes diffrents :
L'Angls de Malataverno, l'Espagnoulet, Julian de la Lgo, Julian de la Vabreio, Mas d'Avno, Lou
Mouissau.
Cacalaca ! est le nom du chant du coq en occitan, lquivalent de Cocorico ! en franais. Les
textes publis glorifient les Cvennes et galement la patrie. Le journal est adress pendant toute la
guerre aux soldats alsiens du front, il porte la mention Es gratis per lous pelous dau Front : Il est
gratuitpourlespoilusduFront.

15
LouSecrt.LeCailar(Gard):[s.n.],19181919.

Lieuxdeconservation:CIRDC(Bziers)[JII1]:n.12(1918)n.9101112(1918)[lacn.34]
CRDOccitane(MouansSartoux)[T20]:n.1(1918)n.16(1919)[lac]
Datesextrmesdepublicationconnues:19181919
Priodicit:Mensuel
Documentdisponibleenligne:
http://www.purl.org/occitanica/bibliotecanumerica/corpus/4828
Rdacteurs:SullyAndrPeyreElieViansAmadiuGambardellaFrancisPouzol

Journal cr en 1918 par SullyAndr Peyre (18901961) sous le pseudonyme de Jan de la Vaulongo.
2
Ses principaux collaborateurs sont Alri Sivanet (pseud. d'Elie Vians), Amadiu Gambardella et
Francis Pouzol, tous mobiliss. la cration de Lou Secrt la volont de S.A. Peyre est de poursuivre
loeuvre de Joseph Loubet et de sa Gazeto Loubetenco dont la publication sest interrompue en 1917.
Cinq numros seulement seront ainsi publis entre 1918 et 1919. Ils portent la mention "A grtis pr lou
Front", Gratuit pour le Front. Chaque numro comporte une rubrique "Biblioutco Circulanto
Prouvenalo", liste d'ouvrages destins faire circuler la littrature provenale entre soldats. Le journal
est surtout le lieu pour les jeunes flibres de dbattre de leur nouveaux projets, principalement la
cration dun quotidien en provenal, qui ne verra jamais le jour. S.A. Peyre est un fidle de Pierre
Devoluy et farouche adversaire des dialectes : il publie ce sujet dans le numro de janvierfvrier 1918
uneLetrodubertoFihou(LouisBonfils).

LEscolodelUbaLuen[delExtrmeNord].[S.l.]:[s.n.],[s.d.].

Lieuxdeconservation:Nonlocalis.
Datesextrmesdepublicationconnues:inconnues
Priodicit:inconnue

On ne connat ce jour aucun exemplaire de ce journal et nous navons ce jour que peu dlments
sur son contenu. On sait grce aux informations contenues dans Lou Libre dor de Santo Estello
(p.63) et Noto de guerro de Marius Jouveau (p.48) quil a t fond Cuxide en Flandres et que
Frdric Mistral (neveu) du 21me de gnie, Louis Fourmaud, 141me de ligne et Louis Marsal, 3me
deligneontfaitpartiedesesrdacteurs.
2
SullyAndr Peyre, pote et homme de lettres, a crit en franais, en provenal et en anglais. Rform car de sant
fragile il ne participe pas aux combats et reste larrire sur toute la dure du conflit. A partir de 1921 et jusqu sa
mortilsoccuperaseuldelarevueMarsyas.(cf.LAstradoN25,1990).
16
1.2.2.Revuesoccitanespendantlaguerre

Beaucoup de publications dexpression occitane sont en grande majorit dinspiration flibrenne et


nes avant la guerre. Elles vont sarrter de paratre pendant le conflit, pour parfois reprendre aprs
larmistice, ou tout simplement steindre dfinitivement. Pour autant, beaucoup ont publi un dernier
numro avec des ractions chaud de lannonce de mobilisation gnrale. Certaines de ces
publications traverseront les annes de guerre par une activit rduite se mesurant au changement de
priodicit,deformatoudevolume.

Vivo Prouvno ! Portoparaulo mesadi di remembrano miejournalo. Avignon : [s.n.],


19081914.

Lieuxdeconservation:CIRDC(Bziers)[AF]et[N0]:n.37(1908)n.113(1914)
Bibliothque Mjanes (AixenProvence), Mdiathque Ceccano (Avignon), Bibliothque Inguimbertine
(Carpentras), SESA (Draguignan), Archives dpartementales des BouchesduRhne (Marseille), Mmo
(Montauban), BU Lettres et Sciences Humaines Universit PaulValry (Montpellier), CRD Occitane
(MouansSartoux), Bibliothque Louis Nucra (Nice), Bibliothque du protestantisme franais (Paris),
BibliothquedEtudesetduPatrimoine(Toulouse).
Datesextrmesdepublicationconnues:19081914
Priodicit:mensuel

Publication mensuelle qui a pris la suite de Prouvno !, galement dirige par Pierre Devoluy. Ce
dernier donne la seconde version de sa revue une orientation plus politique, alors que la prcdente
version se voulait dans la droite ligne de lAili, tout juste diparu, et souhaitait rassembler une grande
partie de la production littraire, scientifique et critique des auteurs de langue doc. Lapproche de la
Grande Guerre et le mtier des armes imposent toutefois une certaine retenue aux articles consacrs la
dcentralisation. Lditorial du n 113, dat du 1er aot 1914, dernier numro paru, tmoigne dun
importantsentimentdardeurpatriotique.


17
Buletinde..?Prouvno!..Marsiho:Prouveno,19071924.

Lieuxdeconservation:CIRDC(Bziers)[G5]:n.19(1910)n.106(1922)
Bibliothque Mjanes (AixenProvence) [PER 1567] : 1916 1919, BnF, Bibliothque de lAlcazar
(Marseille) [PER 11209] : no. 70, jul1916 no. 390, jun1982 [lac(nos7175)], CRD Occitane (Mouans
Sartoux) [C06] : 1913 1914 1921 1922 [lac], Bibliothque dEtude et du Patrimoine (Toulouse)
[P9314]:n65(1915)n66(1915).
Datesextrmesdepublicationconnues:19071924
Priodicit:mensuel
Rdacteur:CharlesVivars
Son contenu est principalement rdig par le marseillais Charles Vivars, prsident de la revue. Il y
publie des article du capouli Valre Bernard sur lactualit flibrnne ainsi que les nouvelles des
souscripteurs et membres des familles des souscripteurs prsents ou morts sur le front. partir de
janvier 1916, la revue laisse une place de plus en plus importante la littrature. Elle publie alors les
pomes et textes sur la guerre de Marius Jouveau et Mste Piarre, pseudonyme de PierreHenri
Colombon (18511937). Le sentiment patriotique sy fait de plus en plus sentir et ce jusquau lendemain
delaguerre.

Lis Annalo du pople de Prouvno. Veisoun : Lis Annalo du pople de Prouveno,


19121914.

Lieuxdeconservation:CIRDC(Bziers)[N0]:no.1,1912no.24,1914,
Bibliothque Inguimbertine (Carpentras) [4o 104] : no. 9, 1913 no. 22, 1914 [lacunes (nos1115,1721)],
CRD Occitane (MouansSartoux) [T20] : no. 1, 1912 no. 4, 1913 no. 27, 1923 no. 28, 1923, CEROC
(Paris) [4248] : vol. 7, 1913 vol. 32, 1923 [lacunes], Bibliothque dtudes et du Patrimoine (Toulouse)
[p4139] : no. 23, 1914 no. 25, 1923 no. 32, 1923, BnF [JO72234] : mars, avr., juil., aot 1923 (3e anne,
n27,28,31,32).
Datesextrmesdepublicationconnues:19121914
Priodicit:Mensuelle
Journal dopinion catholique, Lis Annalo du pople de Prouvno prend la suite de trois journaux
antrieurs : Lou Gau (18971910), lo Rampu (19041910) et La Coupo santo (1912). Le
journal connat une existence phmre, de 1912 1914, il reprend en 1923 sous le titre dAnnalo
felibrenco.
Au dbut de la guerre, il se montre clairement antigermaniste et publie notamment un article intitul :
EquandloucoulobreTutoun
18

19
CartabudeSantoEstello.Buruducounsistrifelibren.Avignoun:Roumanille,18761946.

Lieuxdeconservation:CIRDC(Bziers)[G5]:18761946
Muse Arbaud (AixenProvence), Mdiathque dArles, Mdiathque Ceccano (Avignon), BnF,
Mdiathque Noailles (Cannes), Archives dpartementales des AlpesdeHauteProvence (Digne),
Mdiathque intercommunale Franois Mitterand (Digne), Archives dpartementales des HautesAlpes
(Gap), Bibliothque de la PartDieu, coll. jsuite des Fontaines (Lyon), Archives dpartementales des
BouchesduRhne (Marseille), Bibliotque de lAlcazar (Marseille), Mmo (Montauban), Archives
dpartementales de lHrault (Montpellier), CRD Occitane (MouansSartoux), CEROC (Paris),
BibliothqueJ.H.Fabre(Srignan/Comtat),BibliothqueCentrale(Toulon).
Datesextrmesdepublicationconnues:18761946
Priodicit:Annuelle

N avec le flibrige le Cartabu est sa publication officielle. Il fait le compterendu annuel de ses
activits et donne la liste de ses membres et leur adresse. Le Cartabu contient aussi parfois des notes
bibliographiques sur les publications flibrennes. Au cours du conflit, le Cartabu cesse de paratre.
Ce nest quen 1922 que parat un numro cumulatif (n12) qui couvre toute la priode de la guerre. Le
volume plus volumineux qu'auparavant dresse ltat du flibrige et de ses actions pendant le conflit et
aprs, jusqu la date de sa nouvelle parution. Le Cartabu se voulant une publication strictement
officielle,ilnestpasfaitdementionparticuliredesfaitsdeguerre.

LouBartavu:ArmanaPoupulridenProuveno.Vaison:[s.n.],19021942.

Lieuxdeconservation:CIRDC(Bziers)[Al7]:1915
Bibliothque Mjanes (AixenProvence), BU Lettres (AixenProvence), Mdiathque Ceccano
(Avignon), BnF, Bibliothque Inguimbertine (Carpentras), Archives dpartementales des HautesAlpes
(Gap), Bibliothque de lAlcazar (Marseille), CRD Occitane (MouansSartoux), Bibl. J.H Fabre
(Srignan/Comtat),BibliothquedEtudeetduPatrimoine(Toulouse).
Datesextrmesdepublicationconnues:19021942
Priodicit:Annuel

Lou Bartavu (19021942) est un almanach apparent au flibrige principalement rdig par un certain
E. Jacomet utilisant aussi le pseudonyme de Lou Bartavu. Lalmanach est en grande partie compos
de farces et dhistoires drles. On y trouve aussi quelques fois des caricatures, des chansons
accompagnesdeleurpartitionetdespomes.
Certains textes du numro de 1915 de lalmanach du Bartavu concernent la guerre. On y retrouve 4
caricatures, une prophtie et des pomes comiques sur la guerre. Le propos initial de lalmanach est
dabord humoristique et ne cherche donc pas se mler de politique ou dactualit, do limpact
modrdelaguerresursoncontenu.
20

La Terro d'Oc : revisto felibrenco e federalisto. Escolo Moundino. Toulouso : [s.n.],


18941933.

Lieuxdeconservation:CIRDC(Bziers)[P4]:18941933,
Bibliothque Mjanes (AixenProvence), Mdiathque Ceccano (Avignon), BnF, Bibliothque de la
PartDieu, coll. jsuite des Fontaines (Lyon), Mmo (Montauban), BU Lettres (Montpellier), CRD
Occitane (MouansSartoux), Archives dpartementales de la HauteGaronne (Toulouse), Bibliothque
dEtudeetduPatrimoine(Toulouse),BUCMirail(Toulouse)
Datesextrmesdepublicationconnues:18941933
Priodicit:bimensuelpuismensuelpuisbimestriel

La Terro doc est une revue felibrenne et fdraliste publie Toulouse par lEscolo Moundino. Son
bureau est compos de LouisXavier de Ricard, prsident dhonneur ainsi que Louis Vergne, Antonin
Perbosc et Prosper Estieu. Tous ces auteurs sont connus pour leurs positions dcentralisatrices et
rpublicaines,alorscontrecourantdunflibrigeplusconservateur.
21
La revue parait rgulirement de 1914 1917 puis sessouffle en 1918 (un seul numro entre janvier
1918 et janvier 1920). Elle publie sous forme de chroniques de nombreux textes sur la guerre :
Souvenis de guerro de Yvan Cazottes, Journal de guerro de Jan de lIrge, La guerro,
paraulos dun filousofo dAndrieu del Sourelh ainsi quune rubrique Les Nostres donnant des
nouvelles des compatriotes au front. A noter en 1915 (p.62) un pome de ladjudant Paul Sibra La
3
lengodocalaguerro.

LouBournat:revueflibrenneduPrigord.Prigueux:[s.n.],1902

Lieuxdeconservation:CIRDC(Bziers)[AD1]:1902
BnF, Bibliothque de Bordeaux, Muse dAquitaine (Bordeaux), BFM (Limoges), Bibliothque de la
PartDieu, coll. jsuite des Fontaines (Lyon), Bibliothque de lAlcazar (Marseille), CRD Occitane
(MouansSartoux), CEROC (Paris), Archives dpartementales de la Dordogne (Prigueux), Bibliothque
Centrale(Prigueux),BibliothquedEtudesetduPatrimoine(Toulouse).
Datesextrmesdepublicationconnues:1902
Priodicit:Bimestrielpuistrimestriel

Lou Bournat est une revue bimestrielle de lcole flibrenne du Prigord publie depuis 1902 jusqu
nosjours.
La revue sadresse ses souscripteurs rests larrire. Dans un premier temps, la question de la guerre
semble relativement lointaine, aucun article ne lui est consacre, et seuls quelques pomes viennent en
rappeler lexistence. Cest partir du numro de juilletaot 1915 que le bulletin commence publier
son Libre dOr, qui donne des nouvelles des diffrents soldats morts, blesss ou promus sur le front.
Les publications lies la guerre sont alors plus nombreuses mais restent trs minoritaires. Le journal
revendique cependant un fort sentiment patriotique, et exalte ds quil le peut le sentiment
dappartenancelapetitepatriepleinementintgrelagrande.


3
Paul Sibra (18891951) est un peintre lauragais n Castelnaudary. Flibre, il se lie damiti avec Prosper Estieu en
1927. Quelque peu ignor par le public parisien, il se spcialise dans les portraits de flibres et de villages occitans.
Durant la guerre, Sibra est un simple soldat attach un rgiment dartillerie. Ayant dj dbut sa formation
artistique, il dcore des cagnas de figures de chevaliers et de troubadours. Aucune de ses productions na
malheureusementputreconserve.
22
LArmanaProuvenau.Flibrige.Avignoun:AubanelRoumanille,1855

Lieuxdeconservation:CIRDC(Bziers)[AL1]
Bibliothque Mjanes (AixenProvence), Muse Arbaud (AixenProvence), Mdiathque dArles,
Mdiathque Ceccano (Avignon), BnF, BU Lettres (Bordeaux), Bibliothque des Quatre Piliers
(Bourges), Mdiathque Noailles (Cannes), BCIU Patrimoine (ClermontFerrand), BU Lettres
(ClermontFerrand), Archives dpartementales des AlpesdeHauteProvence (Digne), Mdiathque
intercommunale Franois Mitterand (Digne), Mdiathque Villa Marie (Frjus), Archives Dpartementales
des HautesAlpes (Gap), Muse Fragonard (Grasse), BFM (Limoges), Bibliothque de la PartDieu, coll.
jsuite des Fontaines (Lyon), Archives dpartementales des BouchesduRhne (Marseille), Archives
Municipales de Marseille, Bibliothque de lAlcazar (Marseille), Bibliothque de la CCI de Marseille,
Mmo (Montauban), BU Lettres (Montpellier), Bibliothque de la Facult de Thologie Protestante
(Montpellier), CRD Occitane (MouansSartoux), Bibliothque Louis Nucra (Nice), Bibliothque de la
Sorbonne (Paris), EPHE (Paris), Bibliothque Mazarine (Paris), CEROC (Paris), Les Champs Libres
(Rennes), Bibliothque J.H. Fabre (Srignan/Comtat), BNU (Strasbourg), Bibliothque Centrale (Toulon),
BibliothquedEtudeetduPatrimoine(Toulouse),BUArsenal(Toulouse)
Datesextrmesdepublicationconnues:1855
Priodicit:Annuel
Documentdisponibleenligne:http://occitanica.eu/omeka/items/show/3855

Instrument de communication de lorganisation flibrenne, lArmana Prouvenau ouvre sa Crounico


felibrenco pour lanne 1915 en invitant au rconfort et la foi en lavenir, reprenant la parole
mistralienne prchant la fe dins lan que vn. La chronique est suivie par une chanson (avec partition)
dAuzias Jouveau Li Bessoun de Merindu, suivi dun texte de Fouquet de la Granado intitul Lou
MiejourdounoalaFranoliquatregenerauchfedesisarmado.
Tout au long des quatre annes de guerre lArmana va se faire cho des faits de guerre, exaltant la fibre
patriotique et provenale tout en restant inspir par les vnements du front comme le pome de Jus
Chevalier (1916, 33) : nouv du XVe corps pr larmado prouvenalo, Catoun de guerro
dAuzias Lieutaud (1916, 35) ou Un tros de moun journau de routo de J.P. Gras (1916, 71).
ChaquevolumesachveparlalistedessoldatsmortsaufrontdanssonMortuorum.


23
La Crounico de Sant Maiou sedito douge cops chasque an pr de felibres de la
maintenenodeVelai.LePuy:[s.n.],19131925.

Lieuxdeconservation:CIRDC(Bziers)[P5]:(n.8,1919n.7,1925),
BCIUPatrimoine(ClermontFerrand):1913191419241925
Datesextrmesdepublicationconnues:19131925
Priodicit:mensuel

Journal illustr publi partir de 1913 prs du Puy en Velay par Albert BoudonLashermes
(18821967). Mobilis il devient sergent major au 286e rgiment dinfanterie et fonde lEscolo du
Boumbardamenetplusieursjournauxdetranches.
Durant la guerre La Crounico de Sant Maiou continue paratre. Au lendemain de la guerre, la
publication se poursuit sous la direction de BoudonLashermes domicili en sa vigno de Chaussoun
prchi lou PueiSantoMario (AutoLiro) jusquen 1925. Le journal parat sur des pages grand
format (310 x 250) sous forme de fascicules qui suivent une pagination unique. Il est publi en occitan et
runit aprs un ditorial les pomes qui lui sont envoys, illustrs de dessins. La livraison [11] de 1919
publie une partie des pomes de Marius Jouveau dits la mme anne par la librairie Roumanille sous le
titre Flour au Casco (voir imprims). Le premier numro connu de lanne 1919 (7e anne, n.8, du 15
dAvoust 1919) indique quil fait suite des numros dj parus dans les annes prcdentes. Les
numros de guerre nont pas t localiss, il est ainsi difficile de dire si la ligne ditoriale volue en temps
deguerre.

24
Lou Felibrige, Buletin mesadi, Proupagacioun mistralenco Rgiounalisme. Maiano : [s.n.],
1887

Lieuxdeconservation:CIRDC(Bziers)[I1]:1887
Bibliothque Mjanes (AixenProvence), BU Lettres (AixMarseille), Mdiathque dArles, Mdiathque
Ceccano (Avignon), BU (Avignon), BnF, Mdiathque de BrivelaGaillarde), Mdiathque Noailles
(Cannes), Bibliothque Inguimbertine (Carpentras), Archives dpartementales des
AlpesdeHauteProvence (Digne), Mdiathque intercommunale Franois Mitterand (Digne),
Mdiathque Villa Marie (Frjus), Bibliothque Antoine Maure (Grasse), Muse Fragonard (Grasse),
Archives dpartementales de HauteVienne (Limoges), Archives dpartementales des BouchesduRhne
(Marseille), Bibliothque de lAlcazar (Marseille), Archives dpartemantales du TarnetGaronne
(Montauban), Mmo (Montauban), CRD Occitane (MouansSartoux), CEROC (Paris), BU (Perpignan),
Bibliothque Centrale (Toulon), Bibliothque de lAcadmie des sciences, inscriptions et belleslettres
(Toulouse),BibliothquedEtudeetduPatrimoine(Toulouse),BUMirail(Toulouse)
Datesextrmesdepublicationconnues:1887
Priodicit:mensuelpuisbimestriel

La revue Lou Flibrige, bulletin mensuel du mouvement mistralien, fond par Frdric Mistral en 1887,
s'interrompt la veille de la guerre et au lendemain de la mort de Frdric Mistral. Une nouvelle srie
voit le jour en 1916, sous la direction de Marie Frdric Mistral, sa veuve. Le n1 de cette nouvelle
srie, dat de septembreoctobre 1916 rend hommage aux soldats du Midi par un pome de la reine du
flibrige Margarido Priolo intitul: Als soudartz del mietjourn. Chaque numro contient une
bibliographie des ouvrages publis et une chronique intitule Courrespoundnci du Front. Le premier
numro de 1919 (n.10) publie le pome de Louis Abric La Vitri dat du 11 novembre 1918 et rend
hommage Francis Pouzol fondateur du Buletin de l'Escolo du Boumbardamen et collaborateur de
nombreusesrevues.

EraBoutsderamountanho.EscoloderasPirenos.SenGaudns:Abadie,19051992.

Lieuxdeconservation:CIRDC(Bziers)[AB1]:19051992
Archives dpartementales du Gers (Auch), Bnf, Mmo (Montauban), BU Lettres (Montpellier), CRD
Occitane (MouansSartoux), CEROC (Paris), Bibliothque de la Socit des sciences, letrres & arts
(Pau), Archioves dpartementales de la HauteGaronne (Toulouse), Bibliothque dEtudes et du
Patrimoine(Toulouse),COMDT(Toulouse),BUArsenal(Toulouse),BUMirail(Toulouse)
Datesextrmesdepublicationconnues:19051992
Priodicit:mensuelpuisbimestriel

Revue flibrenne de lEscolo deras Pirenos, paraissant Bagnres de Luchon. La revue trimestrielle
devient annuelle pendant la dure de la guerre. Elle publie la liste des membres de lEscolo morts au
champ dhonneur avec des pomes patriotiques de J. Soul Venture, Bernard Sarrieu (1917), Dasque,
25
Servat, Bd Le numro de lanne 1916 publie une correspondance du front crite par Marcel
Lacroix,endatedu11juillet1915(p.3).

RclamsdeBiarneGascounhe.Pau:EscoleGastouFebus,1897

Lieuxdeconservation:CIRDC(Bziers)[Y24]:1901
Bibliothque Mjanes (AixenProvence), BU Lettres (AixMarseille), Archives dpartementales du Gers
(Auch), Mdiathque de Bagnres de Bigorre, Mdiathque de Bayonne, BnF, BU Lettres (Bordeaux),
Bibliothque Meriadeck (Bordeaux), Bibliothque diocsaine (Dax), Bibliothque de lAlcazar (Marseille),
Archives dpartementales des Landes (MontdeMarsan), Mdiathque du Marsan (MontdeMarsan),
Archives dpartementales du TarnetGaronne (Montauban), BU Lettres (Montpellier), CRD Occitane
(MouansSartoux), Bibliothque Sainte Genevive (Paris), CEROC (Paris), Archives dpartementales des
PyrnesAtlantiques (Pau), BM (Pau), BU Lettres (Pau), Socit des sciences lettres & arts (Pau),
Archives dpartementales des HautesPyrnes (Tarbes), Mdiathque LouisAragon (Tarbes),
Bibliothque dEtudes Mridionales (Toulouse), Bibliothque dEtude et du Patrimoine (Toulouse), BU
Mirail(Toulouse)
Datesextrmesdepublicationconnues:1897
Priodicit:mensuel
Documentdisponibleenligne:http://occitanica.eu/omeka/items/show/2019

Cre en 1897 par lEscole GastouFebus, cole flibrenne qui souhaite conserver la langue parle
dans le SudOuest, la revue Reclams de Biarn e Gascounhe est une revue littraire qui publie dans
chacundesesnumrosunedizainedetextesenversouenprosedauteurscontemporainsouanciens.
La publication est interrompue de novembre 1914 juin 1916. De 1916 1918 le journal publie des
textes patriotiques et met en avant le courage et les faits darmes des soldats gascons, avec de
nombreuses rfrences aux Cadets de Gascogne ex. : Lous peluts de Gascougne de Pascal Abadie
(18561932) et Lous gouyats noustes de Auguste Costedoat (188719..). La revue publie aussi des
tmoignages, extraits de lettres de soldats dans la rubrique Noubles dous noustes sourdats, souvenirs
personnels et fragments de journaux intimes : Younau du brancardi dou 58e de ligne de Jean
Hustach(18941947)n1etn4,1919.


26

1.3Loccitandanslapresseetlesrevuesfranaises

Loccitan est prsent dans la presse et les revues franaises publis au cours de la Premire Guerre
mondiale. On en trouve la trace dans les publications qui paraissent sur le front et qui sont nes
avec la guerre, mais aussi dans celles qui paraissent larrire et qui sont pour la plupart des revues
rgionales ourgionalistes.
4

1.3.1Publicationsdufront

Hurle Obus chos des terribles torriaux, organe des tranches du 12e territorial infanterie.
[S.n.]:[s.l.],19161917

Lieuxdeconservation:BnF[FOLLC6310],BDIC[FP335]
Datesextrmesdepublicationconnues:19161917
Priodicit:mensuel
Documentdisponibleenligne:http://gallica.bnf.fr/ark:/12148/cb32787828s/date

Hurle obus est un journal du front qui avait pour directeur Henri Gougerot. Fond en 1916, il parat
peu prs chaque mois jusquen mars 1917. Il est dfini par les rdacteurs comme le chant de notre
esprance. Le titre est inspir du bruit des obus qui hurlent dans la nuit. Chaque numro posait des
charades qui trouvaient les solutions dans le numro suivant. Les exemplaires de son 8me numro sont
rarissimes : ils furent enfouis avec le porteur dans une cagna lors dun violent bombardement.. A la
deuxime page du numro 7 (p. 26) on relve lexistence dune rubrique en picard Pour chs picard.
Les Noto de Guerro de Marius Jouveau signalent galement lexistence possible dun pome en
patois de Camille Dupetit qui serait paru dans cette revue, il nest cependant pas en mesure dindiquer
lenumrodecettepublicationpotentielle.


4
On relvera une illustration sur la dimension rgionale de lorigine des soldats dans : Le Lapin plumes.
SupplmentillustrduCanardpoilu(19141916).http://gallica.bnf.fr/ark:/12148/bpt6k111441p/f15.image
27
Poil et Plume, Gazette inoffensive et intermittente: poil des rudes lapins, plume des joyeux
coqsdu81meRgimentd'Infanterie.[S.l.]:[s.n.],1916.

Lieux de conservation : BDIC (Nanterre) [FP318], Bibliothque dEtudes et de conservation


(Besanon)[PER2772],BibliothquedelaPartDieu(Lyon)[15095029].
Datesextrmesdepublicationconnues:1916?
Priodicit:inconnue

Le premier numro et seul connu (du 1er mai 1916, prix 5 centimes pour les poilus ) nous donne les
orientations du journal qui revendique son attachement par la plume cette civilisation
5
mditerranenne construite sur la pense, sur la douceur et sur la gnrosit dme. Les
rdacteurs, manieurs dpe, manient aussi le verbe ceuxci pour rire, ceuxl pour rflchir,
dautres pour conter leurs souvenirs de combat. Lditorial indique quil serait souhaitable
galement, que, dans ce rgiment o la plupart... parlent la vivante et vnrable langue doc,
nous donnions quelques posies, contes, rcits ou galjades en provenal, en languedocien, en
catalan ou en tout autre dialecte. Il annonce la parution dans le Bulletin des Armes dun amusant
croquis en gascon . Le complment de titre Vivo lou Clapas! repris dans les trois premiers numros
6 7
sera contest et remplac par la suite par Vivo lou Miejour (Vive le midi). Imprim Cavaillon, son
tiragevariaitentre2000et3000exemplaires.Desarticlesyparaissaientenlanguedocien.

LaViepoilusienne:Journaldu142ergimentdinfanterie.[S.l.]:[s.n.],19161917.

Lieux de conservation : BnF [Lc6599], Bibliothque dEtudes et de conservation (Besanon) [PER


2781]:n2,1916,BDIC(Nanterre)[4P3010]:vol.1,no.1,1916vol.2,no.8,1916.
Datesextrmesdepublicationconnues:19161917
Priodicit:irrgulier
Documentdisponibleenligne:http://gallica.bnf.fr/ark:/12148/cb32889279p/date

Ce journal fond par Pierre Causse (18831951) flibre montpellirain, vigneron et pote connu sous le
nom de Caussou de lOulivi ou du flibre de lOulivi voit son premier numro paratre en mai 1916
dans les tranches droite de la ferme de Beausjour, imprim sur 4 pages, tir 1200 exemplaires. La
Vie poilusienne qui sadressait au 142e rgiment constitu de soldats du Midi, publiait vers et proses
en langue doc. Le Journal imprim Montpellier partir du numro 6 connatra neuf numros, le
dixime achev ne parut jamais car le colonel charg de la censure oublia de restituer le manuscrit au
directeur.
5
LetitrePlumeetPoilestrelevparMarieThrseJouveaudans:JouveauMarius,Notodeguerro,op.cit.p.48.
6
Probablementle:BulletindesarmesdelaRpublique:rservlazonedesarmes,[s.n.](Paris),19141917.
BnF,FOLLc6105.
7
Clapas,Tasdepierres.Nomquidsigneenoccitan,lavilledeMontpellier.
28

choduboqueteau.[S.l.]:[s.n.],1915.

Lieuxdeconservation:CIRDC(Bziers)[JOU192]:n.3,4,7,10,11(1916)
BnF [4LC6281] : janv.dc 1916 [II n12, 818, 23, 2627, 29, 32, 36, 41, 43, 59], janv.oct. 1917 [III
n15,79,1522,24,2631,3336,3846]
Datesextrmesdepublicationconnues:19151919
Priodicit:Hebdomadaire
Documentdisponibleenligne:http://www.purl.org/occitanica/bibliotecanumerica/revista/5042

Voir:L'Ecdubousquetoun

1.3.2Publicationsdelarrire

Le Rayon. Supplment du Poilu SaintEmilionnais. Bulletin religieux. Bordeaux : [s.n.],


19171919.

Lieuxdeconservation:BnF[4LC6270(BIS)]
Datesextrmesdepublicationconnues:19151919
Priodicit:inconnue
Documentdisponibleenligne:http://gallica.bnf.fr/ark:/12148/bpt6k1040839w/f3.image

Fond par labb Daniel Bergey (18811950) prtre puis cur de Saint Emilion, mobilis au 18e
rgiment dinfanterie, ce journal imprim Bordeaux est illustr de gravures et de photographies. Le
Rayon est le 2me supplment du Poilu SaintEmilionnais. Ce ntait pas seulement lorgane du 18e
R.I. mais celui des combattants de toute une commune et de leur famille le journal recevait des
nouvelles de tous les poilus de SaintEmilion dissmins sur le front. Il publie des articles et des
pomes en langue doc (barnais), et en basque sadressant plus particulirement aux soldats du 18e
R.I.Fonden1915,lejournaldisparatraen1919,avecsessupplments.


29
LePetitVar.Toulon:[s.n.],18801944.

Lieux de conservation : Archives dpartementales du Var (Draguignan), BnF [JO87982], BDIC


(Nanterre)[FP4056],BibliothqeCentrale(Toulon)[P.81]
Datesextrmesdepublicationconnues:18801944
Priodicit:quotidien
Documentdisponibleenligne:http://www.archives.var.fr

Le Petit Var est un quotidien rpublicain socialiste. limage dune grande partie de la presse
mridionale, il prend fait et cause pour les soldats du 15e corps contre laccusation de lchet lance
8
par le snateur Gervais. On sexpliquera plus tard, crit Le Petit Var, le 26 aot 1914 et tenant
promesse, il publie une campagne pour une rparation morale durant tout le mois de juillet 1919.
Lheure est venue de sexpliquer, tonne le quotidien, qui rclame le chtiment de celui qui en
face de lenvahisseur voulut diviser le pays []. Il y a l un crime contre la patrie, nous avons le
droit et nos lus ont le devoir den exiger le chtiment. Le Petit Var publie de manire irrgulire
desdessinshumoristiquesrdigsenoccitandontlauteurresteaujourdhuiinconnu.

RevueMridionale.Carcassonne:[s.n.],18891915.

Lieuxdeconservation:CIRDC(Bziers)[L3]:18891915
Mdiathque Ceccano (Avignon), BU Lettres (Montpellier), CRD Occitane (MouansSartoux), INHA
(Paris),BibliothquedEtudeetduPatrimoine(Toulouse).
Datesextrmesdepublicationconnues:18891915
Priodicit:mensuel

Fonde Carcassonne par Achille Rouquet en 1886, originellement sous le nom de Revue de l'Aude, la
Revue Mridionale est une revue rgionaliste qui publie les textes des grands crivains du Midi : Achille
Mir, Frdric Mistral, Roumanille, Gaston Jourdanne, Auguste Fours. Elle fait une large place
loccitan et publie aussi des auteurs parisiens connus comme Mallarm. Sa prsentation soigne
saccompagne dillustrations, bois gravs par Achille Rouquet partir des dessins raliss par Melle
Jeanne Rouquet. En 1915, la revue en est sa 30me anne quand elle publie le Clam de guerra
occitan [Cri de guerre occitan] de Prosper Estieu dat du 27 aot 1914. Les annes de guerre seront
marques par la publication de correspondances de guerre, de nouvelles du front et de pomes
patriotiques.Larevuecesseradeparatreen1916.

8
Surle15eCorps:Voirciaprs.
30
31
LeFeu.AixenProvence:[s.n.],1905[1943?].(NS1917)

Lieuxdeconservation:CIRDC(Bziers)[N5]:19171942
Archives dpartementales des BouchesduRhne (AixenProvence) [4PER04], Bibliothque Mjanes
(AixenProvence) [PER820], Muse Arbaud (AixenProvence) [8.108], Bibliothque universitaire
Schuman (AixenProvence) [Rp 1573], Mdiathque Ceccano (Avignon) [P5075], Mdiathque dArles
[B762M], BnF [8Z16929], Mdiathque Noailles (Cannes) [24], Bibliothque Inguimbertine
(Carpentras), Bibliothque du Patrimoine (ClermontFerrand) [181452], Archives dpartementales des
AlpesdeHauteProvence (Digne) [Per 324], Muse dArt et dHistoire de Provence et Muse
Fragonard (Grasse), Bibliothque de la PartDieu. Collection jsuite des Fontaines (Lyon) [SJ2402h],
Archives dpartementales des BouchesduRhne [PHI 0551] Bibliothque de lAlacazar (Marseille)
[PER 10320], Bibliothque de la CCI de Marseille [RK0431], Archives dpartementales de lHrault
[PAR1111], BU Lettres (Montpellier) [460745XE], CRD Occitane (MouansSartoux) [T48], BDIC
(Nanterre) [4P39], Archives dpartementales des AlpesMaritimes (Nice) [PERA0089] , Muse Lascaris
(Nice), Archives municipales de Nice [REV 040], Bibliothque littraire Jacques Doucet (Paris) [KII7],
Bibliothque de la Sorbonne (Paris) [P4=410], Bibliothque des Arts Dcoratifs (Paris) [BC274/5] ,
Bibliothque du saulchoir (Paris) [Spcimen 2054], CEROC (Paris) [4243], Mdiathque intercommunale
Andr Labarrre (Pau) [30110], Archives dpartementales des PyrnesOrientales (Perpignan) [PER
632], Mdiathque de Perpignan [pm65], Bibliothque Centrale (Toulon) [16467], Service Historique de la
Dfense(Toulon)[PXVII/24],BibliothquedEtudeetduPatrimoine(Toulouse)[P4193].
Datesextrmesdepublicationconnues:19051943?
Priodicit:bimensuel

Organe du rgionalisme mditerranen, la revue le Feu est publie deux fois par mois
AixenProvence par Emile Sicard et Joseph dArbaud. Aprs avoir cess de paratre lors de la
dclaration de guerre Le Feu, reparat dans une nouvelle srie en janvier 1917. Affichant son
attachement Mistral, la renaissance provenale et la fraternit des pays dOc, la revue revendique
la renaissance des provinces et dfend la cause rgionaliste. Bien qucrite en majorit en franais la
revue consacre plusieurs articles aux auteurs occitans : La langue provenale aux tranches de Pierre
Lougal (3, 1917, 11), La provence hroque (confrence prononce le 8 mars 1917, au Thtre
Municipal dAix en Provence) par Joseph dArbaud (6, 1917, 15), Unification de la langue
provenale de Joseph dArbaud (8, 1918, 117). En septembre 1918, la revue publie un numro
consacr Joffre et Foch qui contient le pome de Carles Grando Al Marical Joffre. La plupart des
textesoccitansdelarevue,sontdespomessignsJosephdArbaud.


32
2.AFFICHESETCARTESPOSTALES
2.1Cartespostalesenoccitan

SrieLouPichounPoucetelOgreAllemand
9

Lieux de conservation : Archives municipales de Marseille [34 Fi 7326 7335], CIRDC (Bziers)
[IC]

Srie de 10 cartes postales illustres de caricatures par JAN, lgendes dun quatrain en occitan par
Pascal Cros . Pascal Cros (18591921) fondateur du journal La Sartan en 1891, rdacteur au Petit
10
marseillais, est connu comme un adversaire du flibrige. Jan est le pseudonyme de Jean Metteix,
toulousaindorigineauvergnate,illustrateuretditeurdecartespostalessatiriques.

9
Cartes publies et commentes dans : Claudi Barsotti, Cartas postalas patrioticas de la guerra de 1914, dans :
Antologiadeisescrivanssociausprovenaus,Montpelhier,PichonsClassicsOccitans,CEO,1977,10p.[5f.]
10
La signature des deux auteurs apparat seulement sur la carte n10 et sur la pochette qui relve : Rcit de Mstre
Pascau.DessinsdeJoan.
33
34

BastideBlesssmilitaires
11

Lieuxdeconservation:inconnu
Mention d'dition : Carta postala editada per La Bastide des blesss militaires sous le patronage des
Excursionnistesmarseillais.Alauch.BocasdeRse

Textefigurantsurlacarte:
LOUDRAPEOUFLOURI
Poulidbluretdazurpinta,
Etu,blancoMargaridetto,
Cocolico,roujoesteletto,
SiatzleiflorsdelaLibertat!
SiasleicoulourdelaPatrio:
Siasloudrapeoutoujourpusaout,
LoudrapeoudeFranoquebrihao
CoumolousouleouProuvenaou!
MstePASCAOU
Marsilho,14dejunh1916.

11
http://pedagogie.actoulouse.fr/languesvivantes/IMG/pdf/Primiera_Guerra_mondiala_Documents_no2.pdf
35

GuillaumefaitprisonnierparlesAuvergnats

Lieuxdeconservation:CIRDC(Bziers)[IC]

Carte postale patriotique, caricature du soldat allemand fait prisonnier par les Auvergnats, (circa
191418),illustreparA.Garrias
Textefigurantsurlacarte:
Quitequoletenin,tarrpondelelacahrinpasdinguerro
Cettefoisnousletenons,jevousassurequenousnelelcheronspasencore.


36
La Guerre Srie comique : La guerre [1914]. N 8. Le TustoBatistou (Tape fort
Baptiste)

Lieux de conservation : CIRDC (Bziers) [IC], Archives Municipales de Toulouse [9 Fi 5079], [9 Fi


5114]
Documentdisponibleenligne:
http://basededonnees.archives.toulouse.fr/4DCGI/Web_VoirLaNotice/34_01/9Fi5079/ILUMP3249

Carte postale satirique et patriotique consacre la guerre de 1914, illustre et dite par Jean Metteix
(JAN). La carte n8 porte la mention : Le Tustobatistou (Tape fort Baptiste). Allonsy les enfants
deboncoeur.etvivelaFrance.

[Cartespostaleshumoristiques]

Lieuxdeconservation:inconnu

Cartes postales humoristiques sur la guerre (Edition en langue provenale) assortiment de 4 sujets
d'actualit grand succs la douzaine : 0,50 Franco par la poste. En vente la Bonne presse du midi
Villedieu(Vaucluse)etchezledpositairedecetAlmanach.
(publicitrelevedansLoBartavu,1915).

2.2Affichesenoccitan

Pendant toute la guerre, lEtat doit faire face des dpenses sans cesse plus importantes. Pour y faire
face, le gouvernement fait appel aux contributions directes et indirectes : impt sur le revenu cr en
juillet 1914, impt sur les bnfices de guerre partir du 1er juillet 1916, relvement des droits sur les
alcools, les sucres, etc. Mais lEtat souhaite limiter le recours limpt afin de ne pas imposer un
sacrifice supplmentaire une population civile trs prouve. LEtat lance donc une srie demprunts
nationaux, dette financire long terme contracte auprs des citoyens. Quatre grands emprunts sont
lancs pendant le conflit : en novembre 1915, octobre 1916, novembre 1917 et le dernier en octobre
1918. Afin dinciter la population contribuer financirement leffort de guerre, le gouvernement met
enplaceunepropagandesousformedaffiches.
Ces affiches sont souvent illustres par de grands artistes (Abel Faivre, Francisque Poulbot, etc.) dans le
but de rendre la souscription synonyme de soutien aux soldats partis au front : les bas de laine
souvriront spontanment, par sentiment, par ce fait que ces braves gens qui nous parlent sur le mur sont
ceux qui savent le mieux et le plus simplement tenir notre sensibilit des propos qui sont irrsistibles.
(LIllustration,n3795,27nov1915).
37
LaFranceruraleestdailleurssouventlacibledecescampagnesdecommunication.
Les affiches dappel souscription lemprunt national demeurent un rare exemple de propagande
officielle ayant utilis les langues rgionales. Les autres affiches connues sont des affiches publicitaires qui
serapportentlaparutiondoeuvresenrapportaveclaguerre.

Brabesaudencs,...SouscribtzlEmprunt

Lieuxdeconservation:ArchivesdpartementalesdelAude(Carcassonne)[1M1069]

Cette affiche diffuse dans le dpartement de lAude est un document particulirement original parmi le
corpus des affiches des emprunts nationaux. Ici, pas dimage, et de trs faibles appels lmotion et la
solidarit pour les frres et les fils qui sont au front, ni dailleurs au patriotisme. Sur cette affiche sans
date et sans signature, le propos entirement rdig en occitan est un argumentaire assez dtaill en vue
de convaincre les prteurs sur les garanties financires de lemprunt national. Largumentaire nhsite
dailleurs pas sousentendre quil sagit de faire une bonne affaire. Laffiche semble sadresser aux
populations paysannes de lAude dont les plus gs sont sans doute encore trs peu francophones. On
peut penser galement quun argumentaire en occitan permettait de crer une connivence avec des
populations qui, mme lorsquelles parlaient franais, continuaient de traiter leurs affaires commerciales
en occitan dans le cadre dune conomie encore trs rgionale. Il est possible que cette affiche fut cre
par la Banque de France. Elle constituerait donc un rare exemple de communication officielle en langue
occitane.
Les Archives dpartementales du Finistre conservent une affiche assez semblable, prsente ciaprs,
entirement rdige en breton et contenant lentte officiel Rpublique franaise. [ADFinistre 1 M
2901.]

38

39
4meempruntnational.BanqueFranoisCasatietCie

Lieuxdeconservation:CollectionPrivePierreGrzard,(Nouma) .
12
Caractristiques physiques : 83.5 x 113.5, lithographie couleur. Illustrateur : B. Chavannaz
imprimeur:Crt,1918
Mention:Marsihsfaitoundev!Onlestient!
Affiche pour le 4eme emprunt national linitiative de la banque Franois Casati et Cie Marseille en
1918.


12
http://centenaire.org/fr/fondsprivees/archives/collectionpriveelesregionsdanslesaffichesdelagrandeguerre
40
5meempruntnational.BanqueFranoisCasatietCie

Lieuxdeconservation:CollectionPrivePierreGrzard,(Nouma)
Descriptionphysique:120x80,lithographiecouleur.
Mentionsddition:Illustrateur:JeanAmdGibert,Impr.provenaleGuiraud,Marseille,1919

Affiche pour le 5eme emprunt national linitiative de la banque Franois Casati et Cie Marseille en
1919.
Mention:AfourtissenlaVitrienpouertantnouesteisualemprundelapas!


41
LouGal[affichepublicitaire1916]

Lieuxdeconservation:CIRDC(Bziers)[AFF685]

AffichepublicitaireduJournalLouGaldatantprobablementdelanne1916,diffusesurleslieuxde
ventedujournal,essentiellementdanslHraultetdansleGard.Cestpartirdumoisdavril1916
(n.19)quesemetenplacelapublicitdujournal(p.4)invitantlesmarrainesdeguerreabonnerleurs
poilusetfournirladressedesoldatspourleurenvoyerautantluquauquesnumerots.
Textefigurantsurlaffiche:LouGal/Enventapertout/DousSos/LgissesLouGalMandslouau
Front.


42
Affiche:Lousproufitaires(2223avril1922)

Lieuxdeconservation:CIRDC(Bziers)[AFF683]

Affiche publicitaire de la pice dEmile Barthe joue au Thtre municipal de Bziers les 22 et 23 avril
1922(Voirciaprs).
Lous proufitaires est unJugement, motif classique du thtre occitan. Ici, ce sont M. et Mme
Ventredor qui sont jugs pour stre enrichis pendant la Premire Guerre mondiale. La pice se passe
dans un tribunal quelques temps aprs larmistice et met en scne les accuss, un juge, deux avocats aux
plaidoyers burlesques, ainsi que plusieurs tmoins, notamment danciens clients des poux Ventredor,
mais galement le Soldat inconnu prsent au nom de toutes les victimes civiles et militaires de la guerre.
Lapice,engage,prsenteds1922rencontreraungrandsuccsetserareprisejusquen1959 .
13


13
Cf. Emile barthe, Los Profitaires / Les profiteurs : comdie en langue d'oc avec la trad. franaise en regard prf. par
Marcel Carrires et Lon Cordes. Paris, Les Amis de la Langue d'Oc, 1969. 172 p. (Collection des Amis de la langue
d'Oc).
43
3.CHANSONSETPARTITIONS

3.1Pendantlaguerre

Aussoloufront,Prouveno!:cansoundeguerro

Lieuxdeconservation:CIRDC(Bziers)[CQ102/1]

Texte et partition (au verso) manuscrits. Chant patriotique exaltant la fiert des soldats provenaux cr
par Melle Magdelon, paroles de J. Fallen, musique de M. Arnaud. 1 p. polycopie [s.d.]. Ce chant a
tpublidanslArmanaprouvenau,n63,1917(pp.3840)

LesChantsaufronten1916,Castres:Imprimerieduprogrs,[s.d.]

Lieuxdeconservation:CIRDC(Bziers),BibliothqueetArchivesduCollgedOccitanie

Imprim rectoverso contenant les chants patriotiques de la guerre. Aux cots de la Marseillaise figure
(au recto) Lou cop d Guillaoums par E. Ratoul, pote chansonnier, Laurat du Concours
dAvignon en 1916. Le pome patriotique se rapporte linvasion de la Belgique par larme allemande
etdnoncelarusedelempereurGuillaumeIIdjoueparlarmefranaise:
Guillaoumsetsaclico
Abiofachloucalcul,
DesclafalaBelgico,
Cnthommescontroeun
Guillaumeetsaclique
Avaitfaitlecalcul
DcraserlaBelgique
Centhommescontreun

ABADIE, Pascal / CASTAINGT M. . Lous Pluts de Gascougne, Reclams, n5, heur


1917,pp.8081.

Lieuxdeconservation:CIRDC(Bziers),[Y2]

Cechantexaltelaforce,lecourageetlaqualitdessoldatsgascons.

44

BENOIT,Roubert.LousVerenous,LouFlibrige,n8,1918,pp.67

Lieuxdeconservation:CIRDC(Bziers),[I1]

Dans ce chant patriotique, lauteur tente exalter le courage des franais rests larrire et leur demande
dersisterfaceauxverenous(venimeux)allemands.

COSTEDOAT,A./LESCAZES,E.de.LousGouyatsnoustes,Reclams,n3,yulhet1918,p.39

Lieuxdeconservation:CIRDC(Bziers),[Y2]

De la mme manire que le chant Lous Pluts de Gascougne paru lanne prcdente, ce chant exalte
laforce,lecourageetlaqualitdessoldatsgascons.

JOUVEAU Marius / JOUVEAU Auzias. Bressarelo de guerro, Armana prouvenau, 1917, pp.
6465

Lieuxdeconservation:CIRDC(Bziers),[Al11]

Dans cette berceuse adresse sa fille, Marius Jouveau tablit un parallle entre le calme du sommeil
dunenfantetleshorreursquilvitsurlefront.

RIEU,Charloun.LabataiodelaMarno,Armanaprouvenau,1918,pp.7374.

Lieuxdeconservation:CIRDC(Bziers),[Al11]

Chant antigermanique, chant sur lair Les Pontes de Paris, tournant en ridicule les soldats allemands
enroutepourlabatailledelaMarne.


45
3.2Aprslaguerre

ROGERHenriette.LesmortsdelaGrandGuerro(1925)

Lieux de conservation : CIRDC (Bziers), Archives et Bibliothque du Collge dOccitanie [CQ


017/7]

Manuscrit dHenriette Roger qui a mis en musique une ode de Prosper Estieu. Le texte patriotique
souhaiterendrehommagetouslesmortsdelaGrandeGuerre.

DELFAU, Augusto. Cansoun de Felibre : Camp de prisounis de guerro de Konigsbrck lou 7


dejanvide1917,Terrodoc,n335,1921,p.21.

Lieuxdeconservation:CIRDC(Bziers)[P4]

Chant dAuguste Delfau crit le 7 janvier 1917 au camp de prisonniers de guerre de Konigsbrck. Sans
faire de rfrence directe la guerre, le chant exprime la ncessit dcrire pomes et chansons dans
unepriodesitrouble.


46
4.TMOIGNAGES
4.1Carnetsetrcitsdeguerre

CarnetdeguerredeMargueriteGens

Lieu de conservation : Archives municipales, BrivelaGaillarde [Srie : S Documents entrs par voie
extraordinaire][Soussrie:4SFondsMargueriteGens]
Documentdisponibleenligne:http://1418.brive.fr/

Marguerite Gens (18681955), institutrice BrivelaGaillarde (Limousin, Corrze), fut une des
14
actrices importantes du dveloppement d'un flibrige limousin autour de l'action de l'abb Joseph Roux
(18341905). Elle tient un carnet rgulier pendant toute la dure de la guerre alors quelle est infirmire
bnvole. Ces manuscrits indits font l'objet d'une publication lectronique dans le cadre du Centenaire
de la Premire Guerre mondiale, mis en ligne au fur et mesure du centenaire et accompagns de textes
explicatifs.

CarnetdeguerredeMariusJouveau

Lieuxdeconservation:CIRDC(Bziers)FondsJouveau[JOU1971]
Descriptionphysique:Carnetmanuscrit145x95[68p.]notes[p.118](pagesarraches)

Marius Jouveau (18781949), majoral du Flibrige en 1913 est mobilis comme sergent au 261e
rgiment dinfanterie de ligne 17e Compagnie. Il tient jour un journal entirement en occitan sous le
titre Davant li Bchi dans lequel il dcrit le quotidien des tranches sous les obus, mais aussi lactivit
littraire et flibrenne quil mne notamment dans le cadre de lEscolo du Boumbardamen. Ces
notesdeguerreonttpubliesenintgraliten1980parsabellefilleMarieThrseJouveau.

14
Ne Marseille le 26 janvier 1868, fille de Louise Delort de la Flotte, issue de l'aristocratie corrzienne, et d'un certain
Henri Gens qu'elle semble n'avoir pas connu, elle arrive un jeune ge BrivelaGaillarde, berceau de sa famille
maternelle. Marguerite Gens quitte la Corrze pour poursuivre ses tudes suprieures Paris et revient vers 1890
Brive, o elle enseigne le franais dans une institution prive. Elle participe au mouvement flibren en Limousin ds
ses dbuts en 1893 en adhrant l'escolo Bertran de Born, premire cole flibrenne cre dans la rgion, et qui
constitue avec la revue de l'escolo, Lemouzi, le foyer de la renaissance d'oc en Limousin. Elle participe ds 1894 la
renaissance des jeux floraux du Limousin, les Jeux de lglantine, o elle figure parmi les premiers laurats du prix et
est proclame Reine du flibrige limousin. La mme anne, elle reoit le titre de mainteneursupplant de M.
Charles Teyssier. Auteur de pices de thtre, elle anime la socit thtrale de l'Escolo Bertran de Born, la
Mnestrandie.
47
4.2Correspondancedescombattants

Alors que la pratique pistolaire ne concernait quune part minoritaire de la socit au tournant du XXe
sicle, la Grande Guerre, en loignant les poux, les amis, les parents, a provoqu une vritable marre
pistolaire, ouvrant ainsi un accs exceptionnel la parole des franais de toutes origines et conditions.
On estime 1000 lettres par soldat et par anne de conflit le nombre de correspondances changes
entre le front et larrire pendant les quatre annes de conflit. Les soldats et leurs familles ont chang en
franais. Pour autant, cela nest pas un indicateur totalement fiable pour dceler la ralit des usages
linguistiques en 19141918. Comme lont bien tabli Grard Braconnier et Andr Minet dans leur
ouvrage consacr aux correspondances des soldats du midi , les productions crites ne rendent compte
15
que de manire indirecte de lusage massif de la langue loral (les tmoignages cet gard son
innombrables), car elles sont dans leur immense majorit en franais, la langue de lcrit acquise
lcole, souvent trs hsitante et bourre doccitanismes. En Alsace, o la population a encore comme
langue dusage lalsacien au sortir de la guerre, les soldats ont crit en allemand standard, langue apprise
lcole. Si les correspondances entirement rdiges en occitan sont rares, et manent de militants
linguistiques, engags avant la guerre dans les mouvements renaissantistes et flibrens, il nest toutefois
pas rare de trouver des passages en occitan dans les correspondances. Leurs auteurs, soldats
mridionaux dplacs loin de leur patrie natale tmoignent de la dure ralit de leur condition, moins
par aspiration patriotique comme cela sera le cas dans la plupart des pomes publis, mais dans le souci
de se rapprocher, par le souvenir, de la terre quils ont quitt. Pour cela ils utilisent au quotidien dans
leurs crits, les expressions qui leurs sont familires permettant la fois de mieux traduire leur
tmoignage et de retrouver par lcriture le lien avec leur terroir dorigine. Cette aspiration se remarque
particulirement pour lvocation de la nourriture qui sera un des marqueurs de lidentit locale et lien
troitaveclepays entretenuparlenvoidecolisauxsoldatsdufront.
16


15
Grard Baconnier, Andr Minet, Louis Soler, La Fleur au Fusil: les poilus du Midi travers leur correspondance,
Toulouse,Privat,1985.
16
Le pays dsigne dans le langage populaire, la petite rgion, le canton o le village do sont originaires les soldats.
Lappartenance au mme pays est une marque de solidarit qui se traduit par lusage de la mme langue (patois)
etquifacilitelesrencontres,leschangesdenouvellesoudenourriture.
48

4.2.1Correspondancesenoccitan

CorrespondancedePierreAzma

Lieuxdeconservation:CIRDC(Bziers),FondsPierreAzma(Bziers)[AZP]

La correspondance de Pierre Azma (18911967) conserve au CIRDC comprend une partie de ses
changes avec ses correspondants de guerre dont : DelponDelascabras (pseud. de Louis Stehl), Julien
Brabo,LonTeissier,JosephLoubet...
On trouve au sein de cette correspondance des cartes postales, une reproduction dune affiche pour
lemprunt partiellement en occitan, des pomes de DelponDelascabras, des lettres sur la mort de Louis
Bonfilsetdescorrespondancesdeguerreillustresdepomes.
Parmilespicesemblmatiquesdecettecorrespondanceonpeutsignaler:
la reproduction couleur de l'illustration de Jules A. Faivre pour la souscription au 2me emprunt de la
dfense nationale lanc en octobre 1916 appelant les civils soutenir leffort de guerre de la nation. Son
titre reprend une phrase du Marchal Ptain au plus fort de la bataille de Verdun On les aura. Sous
titre Lous Aven, adresse par Louis Stelh soldat permissionnaire et collaborateur du journal Lou
Gal, sous le pseudonyme de DelponDelascabras, Pierre Azema Montpellier. De Ganges le 1er
janvier 1919 (AZP4 3.2.23) Bonjour de touta loustalada et bonna annada (Bonjour de toute la
maisonneHenri,ZztteetPireStehl).

49
la carte postale Correspondance des armes de la Rpublique illustre par lemprunt de la Victoire
contenant un pome Counsel damic adresse par DelponDelascabras le 5 fvrier 1918 (AZP4
3.2.54).
une carte illustre reprsentant les remparts de Salonique contenant un pome Per amus la femna
dun pialut adresse par DelponDelascabras Pierre Azema Montpellier le 29 dcembre 1917
(AZP43.2.53).
des correspondances de guerre, illustres de pomes, adresses Pierre Azma de Montpellier par
LonTeissierSouslieutenantau416ergimentdinfanterie.
flammespostalesperFranoemiejourfautnetoujour!(A.Brabo).
unelettreduLieutenantcolonelGrosLongplusconnusouslepseudonymedePierreDvoluy
PierreAzemadu5aot1918surlamortdeLouisBonfils,soldatayantrdigunecorrespondancede
guerrenourrietoutenoccitan.

50

CorrespondancedeMariusJouveau

Lieuxdeconservation:CIRDC(Bziers),fondsJouveau[JOU40]

Marius Jouveau (18781949), majoral du Flibrige (1913) lorsque la guerre clate est mobilis au front
et entretient une correspondance continue avec sa famille et avec les autres flibres mobiliss. La plupart
des lettres quil reoit sont crites en occitan et proviennent de nombreux collaborateurs des revues quil
anime, mais aussi des sympathisants de la cause provenale comme Jules Bellaudy, journaliste politique
etcritiquedartprochedesflibresquiprendpositionen1916,enfaveurdu15eCorps.
(Voirciaprs:Affairedu15eCorps).


51
CorrespondanceLouisBonfils

Lieudeconservation:MdiathqueEmileZola(Montpellier)
Documentdisponibleenligne:
http://bibliophilelanguedocien.blogspot.fr/2012/02/journaldeguerredelouisbonfilsavec.html

Louis Bonfils (18911918) est un flibre montpellirain, mobilis sur le front ds le dbut de la Premire
Guerre mondiale. Du front, il crit rgulirement Pierre Azma, flibre montpellirain directeur du
journal Lo Gal, rform et retourn l'arrire. Avant le dbut de la guerre, Bonfils est trs engag dans
le mouvement flibren, ses premiers vers sont publis dans la revue occitane la Campana de
Magalouna en 1908. Avec Pierre Azma et Pierre Triaire il se lance dans le thtre et rdige avec ces
dernierslasaynteJoutunbalcon.Ilsfondentensembleen1912unesocitthtrale:LaLauseta.
Capitaine au 319me rgiment d'infanterie il publie des articles tout au long du conflit dans Lou Gal,
sous le pseudonyme de Filhou. Il y publie des tableaux de guerre et chroniques dans lesquelles il
commentel'actualitdupointdevuedeladoctrineflibrenne.
Dans le mme temps il adresse une correspondance nourrie Pierre Azma, intgralement en occitan et
dans laquelle il dveloppe une forte critique de la hirarchie militaire. Dans une de ses lettres, il indique
d'ailleurs qu'une dentre elles a t intercepte par la censure car rdige en franais et contenant des
critiques contre la hirarchie. Pour lui, la langue occitane, gnralement non comprise par la censure, est
galementunmoyendefaireparvenirsesidesetcritiquesl'arrire.
Il retranscrit presque quotidiennement ce qui se passe sur le front, en premire ligne. Il veut tre le relais
des petites gens, soldats de premire ligne qui n'ont habituellement pas le temps ni les moyens de
s'exprimer (les journaux de tranches sont souvent raliss loin de la ligne de front et souvent par des
soldats noncombattants). En 1915, quelques mois aprs l'affaire du 15me corps, Louis Bonfils
commande une compagnie recrutement normand et parisien l'ensemble de sa correspondance est
alors centr sur la complexit de rapports Nord/Sud. Suite cet pisode, il se lance dans une lutte pour
la cause des mridionaux humilis aprs laffaire du 15me Corps et la dfense de la dignit de leur
langue. Il signale d'ailleurs plusieurs reprises qu'il est un des seuls grads s'adresser ses hommes et
lancerdesordresdecombatenlangued'oc,cequiparticipeselonluisapopularit.
Le capitaine Bonfils meurt au combat Mlicoq le 11 juin 1918. Au lendemain de la mort de son
correspondant et la fin de la guerre, Pierre Azma destinataire de toutes ces lettres dcide de les
publier. Il commence alors les recopier. Ces 90 feuillets 21 x 27 cm, dposs la mdiathque de
Montpellier, recopis de la main de Pierre Azma sont aujourd'hui la seule trace qu'il nous reste de cette
correspondance . Il ne s'agit cependant pas d'une retranscription intgrale, quelques passages jugs
17
dlicats semblent avoir t coups. On ne trouve galement pas de mention des publications de Bonfils
dans le journal Lo Gal dont la publication est assure par Pierre Azma. Enfin, tous les passages qui
contiennent des informations plus personnelles (nouvelles sur l'tat moral et l'tat de sant...) semblent
17
Voir : JeanPierre Cavaill, Les Lettres du front du flibre Louis Bonfils dans : Amb un fil damistat, mlanges
offertsPhilippeGardy,Toulouse,Centredtudedelalittratureoccitane,2014,p.313325.
52
galement n'avoir pas t recopis. Il s'agit de plus d'une correspondance sens unique : Azma n'a
recopiqueleslettresqu'ilavaitreudeBonfils.

CorrespondanceValreBernard(AffaireFolcodeBaroncelli)

Lieu de conservation : CIRDC (Bziers) : Bibliothque et Archives du Collge dOccitanie, fonds


ValreBernard[CQ105/2]

En 1915, une mesure disciplinaire tait prise contre le soldat Folco de BaroncelliJavon (18691943)
classe 1889, 118me Territorial, 14me Cie , membre actif du flibrige, pote et manadier camarguais,
pour avoir tenu des propos dmoralisants. Baroncelli est alors condamn une peine disciplinaire : la
dtention en forteresse Toul. Cette sanction dclenche une leve de boucliers au sein des membres du
Flibrige qui militent pour sa rhabilitation. Tous cherchent un moyen de faire pression sur le
commandement pour obtenir la rhabilitation du soldat. Cela aboutira la publication dune ptition en
franais adresse au Commandant de la XVme Rgion et demandant lacquittement de Folco de
Baroncelli.
Un change nourri de correspondances entre les grands noms du Flibrige a pu tre conserv dans les
collections du Collge dOccitanie au sein de la correspondance de Valre Bernard (18601936) alors
Capouli. Outre les documents sur laffaire ellemme, le dossier contient des changes de lettres entre
flibrespoursarhabilitationetletexteimprimduneptitionenfranaisvisantsarhabilitation.
Une lettre de Marguerite Priolo, adresse Valre Bernard, date du 18 aot 1915 indique que grce
laction de ses amis flibres, Folco de Baroncelli a pu tre acquitt et chappe donc
lemprisonnement.


53
[Laguerre1914Toulouse].HpitalmilitairedeToulouse

Mentionsddition:HpitalmilitairedeToulouse"Entreprincipale"..19141918.,clichLouisAlbinet.
Lieuxdeconservation:ArchivesmunicipalesdeToulouse,collectionJacquesSicart[1Num6/57]
Description physique : Reproduction, Archives municipales de Toulouse, 2008, Procd numrique,
1629x1059pixels,cartepostaleN&B.Documentreproduit.Format:9x14cm.Technique:phototypie.
Documentdisponibleenligne:
http://basededonnees.archives.toulouse.fr/4DCGI/Web_VoirLaNotice/34_01/1Num6xzx57/ILUMP27448

Carte postale reprsentant lhpital militaire Larrey de Toulouse. Des hommes en uniforme et deux
hommes en costume posent devant la porte dentre. Le recto de la carte est entirement rdig en
occitan:lexpditeuryracontesonentreetsjourlhpital.

LettredAnnaMoutondeMontbrun(SaintGineysenCoiron,Ardche)

Source : Bruno Teyssier. Revue de la socit des enfants et amis de VilleneuvedeBerg, n 54, 1998
J.B. Martin (dir), Les poilus parlaient patois. Documents dialectaux de RhneAlpes : un regard
diffrentsurlaguerrede19141918.

Lettre dAnna Mouton son futur mari, Amde Teyssier, soldat sur le front en date du 20 octobre
1918. Dans cette lettre entirement rdige en occitan, dans une graphie non normalise, trs
phontique, la fiance reproche son futur mari la brivet de ses lettres, pensant quil a plus de temps
librequelle

4.2.2Correspondancesavecdesmentionsenoccitan

CorrespondancedusergentfourrierPags(1915)

Source:AlCantonMurdeBarrez.Rodez:Missiondpartementaledelaculture,1996.
Lieuxdeconservation:CollectionpriveMmeJosphinePags,Brommes,MurdeBarrez(Aveyron)

Le sergent Antoine Pags originaire du nordAveyron (Brommes) crit quotidiennement son pouse
Emilie pour lui parler de sa vie quotidienne. La correspondance en franais est maille de nombreux
termes ou expressions en occitan. Elle se compose de 36 lettres sur papier libre et cartes militaires
dates de 1915 1917. La plupart des lettres sont adresses depuis Rodez (13 lettres), du Camp du
Larzac (4), de Bdarieux (14), Troyes (1) jusqu son arrive sur le front (2) le 9 aot 1915. Deux
54
autres lettres crites en 1917, probablement au retour de permission, nous indiquent que la
correspondanceestincomplte.
A son arrive sur le front il crit: Je te raconte ma premire nuit de tranche prs des boches
nous voila partis quittant la ronde peine 500 mtres et nous enfilant dans un boyau [croquis
dessin dans la lettre] conduisant la tranche qui fait face lennemi, comparant le boyau au
tudl de la font [tuyau de la source] et sinquitant pour savoir si la source (de sa maison) na pas tari
e a perpaus es pas tarida ?. Il y voque aussi les balles perdues qui passent sur les ttes faisant :
dsio, pio ! Ieu quaimo pas las abelhas, aqu me fasia baissar lo cap [dsio, pio! moi qui
naimepaslesabeilles,celamefaisaitbaisserlatte]

CorrespondanceMartialVialettes(17fvrier1915)

Source:Alcanton:SaintAffrique.Rodez:Missiondpartementaledelaculture,2002
Lieuxdeconservation:CollectionpriveRaymondeVialette,SaintJeandAlcas(Aveyron)

Martial Vialettes, sousofficier au 57me rgiment dartillerie, originaire de Saint Jean dAlcas
correspond avec sa famille. Il y utilise loccitan de faon consquente. Du front, le 17 fvrier 1915, il
adressedanssacorrespondancelecroquisdesonabriavecuncommentaireenoccitan.

CorrespondanceClmentMassignac(18941917)

Source:http://www.crid1418.org/temoins/2010/01/07/massignacclement18941917/

Clment Massignac mobilis le 8 septembre 1914 au 11e RI de Montauban est envoy sur le front do
il adresse 250 lettres pour une priode de 879 jours de campagne. Sa correspondance rgulire soit
un courrier tous les 3 4 jours est crite dans un style difficile, contraint par un faible niveau de
scolarisationquemarquelasuperpositiondufranaislusagedugascon.
Pour en savoir plus : Laurent Sgalant. Lignes de vie, Des Gascons dans la Grande Guerre. 3
volumes.Orthez:ditionsGascogne,2009.


55
CorrespondanceMarcValette(18421945)

Source:http://www.crid1418.org/temoins/2008/02/23/valettemarc18921945/

Dans ces lettres crites par Marc Valette sa mre depuis le front on peut suivre avec prcision le
quotidien dun soldat du front qui dcrit avec minutie son parcours durant la guerre. Il se retrouve ainsi
en Belgique au dbut de la guerre, dans la Marne, en Champagne et en Artois en 1915 puis dans
lAisne en avril 1917. Marc Valette sautocensure pour ne pas effrayer sa petite mre (il cache sa
participation la bataille de Verdun et ne la dvoile que plus tard), tout en expliquant ce quil voit et ce
quil ressent Marc voque rgulirement le pays et note quelques phrases en occitan quil utilise
avecsescamaradesduSudOuest.
Pour en savoir plus : Nathalie Salvy, mmoire de matrise Petite mre . La correspondance de la
famille Valette pendant la Grande Guerre (Universit Toulouse le Mirail, sous la direction de R. Cazals,
2004(BUTM,cote11MM667,1et2).

4.3Enregistrementssonores

EnqutelinguistiqueetanthropologiqueauprsdeprisonniersdeguerreenAllemagne

Lieuxdeconservation:HumboldtUniversitt(Berlin),Lautarchiv
Accsaucatalogue:http://www.sammlungen.huberlin.de/sammlungen/78/

Enregistrements effectus sur des prisonniers de guerre en Allemagne au cours de la Premire Guerre
mondiale. Ces collectages raliss par les universitaires allemands concernent les diffrents dialectes de
la langue occitane rfrencs comme : auvergnat, gascon, saintongeais, dauphinois, francoprovenal,
niois,gascon,languedocien,limousin,occitan,provenal.

Fonde en 1915, la Commission phonographique royale de Prusse, qui regroupe une trentaine de
chercheurs (linguistes, musicologues, anthropologues), mne durant la Premire Guerre mondiale une
vaste enqute sonore auprs des prisonniers de guerre, dans lobjectif annonc de documenter les
langues et musiques des peuples du monde. Jusquen 1918, ce sont 250 langues et dialectes dEurope
et de ses colonies, de Russie comme dAmrique du Nord qui seront recueillis en prs de 3 000
enregistrements. Pour cette tude linguistique et anthropologique (qui sintresse en particulier aux
musiques traditionnelles) il est demand aux prisonniers interrogs de sexprimer dans leur langue
56
maternelle pour rciter la Parabole de lenfant prodigue , interprter des chansons ou narrer une
18
histoire (contes populaires comme rcits personnels). Un corpus de 1022 rouleaux de cire est ainsi
constitu, accompagn dune documentation mthodique : noms, dates, fiches de renseignements
biographiques compltes sur linformateur, transcriptions phontiques et traductions des enregistrements.
Aux cts du galique, du crole ou du cheyenne, la langue occitane dans sa diversit est fortement
reprsentedanslesenqutes.

4.4Photographies

[CartepostalephotographieLouClotdeNouste]

Lieux de conservation : Archives dagglomration de Pau, documents relatifs Louis Pguilhan


(18751937)[15Z941Fi283].
Descriptionphysique:CartepostaleNoiretBlanc.90x140mm

Photographie reprsentant l'entre d'un abri ralis dans une cave durant la guerre de 19141918 et
baptisLouClotdenouste.Onyvoitdeuxsoldats.

[Photographiesdesoldats]

Lieux de conservation : CIRDC (Bziers) : Bibliothque et archives du Collge dOccitanie, fonds


ArmandPraviel[AL002]
Descriptionphysique:6cartesphotographiques.90x140mm

Clichs reprsentant des groupes de soldats, souvenirs de guerre dArmand Praviel (18751944),
journaliste et crivain, auteur dune Anthologie du Flibrige (1909) et dune Histoire anecdotique des
JeuxFloraux(1923).
Les photographies reprsentent le lieutenant Armand Praviel trois poques diffrentes. Une premire
srie de deux clichs identiques le reprsente en compagnie dautres soldats. Sur la seconde srie il
pose en compagnie dofficiers. Enfin la troisime srie le reprsente alors quil est prisonnier de guerre
enAllemagneOsnabrck.
18
Durant la guerre, la Commission prussienne de phontique enregistre les prisonniers trangers dans le cadre de son
programme " Voix des peuples" (Stimmen fremder Vlker). Nol Larribre, n en 1892, dit "La parabole de lenfant
prodigue"enoccitandeBigorre,aucampdeDyrotzen1916.PrsentsurlesitedelAcadmiedeToulouse:
http://pedagogie.actoulouse.fr/languesvivantes/IMG/mp3/Eth_mainat_prodigue_Larribere_1916_Camp_de_Dure
tz.mp3

57
On ne sait que peu de choses sur cette dtention, si ce nest quil profita de son temps libre pour lire
lintgrale des uvres de Balzac et dbuter la rdaction de son premier roman L'Assassinat de
Monsieur Fualds, thme galement trait par Balzac qui connat au dbut des annes 1920 un
succsimportantetdenombreusesrditions.

Photographie : Un coin de la salle de rdaction de lcho [du Boqueteau] [= lEc du


Bousquetoun]

Lieuxdeconservation:CIRDC(Bziers):BibliothqueetarchivesducollgedOccitanie,fonds
ValreBernard[CQ102/1].
Descriptionphysique:1photographie.90x130mm

Photographie de deux soldats durant la guerre 19141918. Ces soldats posent devant une chemine
(dans un abri ?) o est porte la devise : "Lou canoun me fai canta" devise de L'Escolo du
Boumbardamen. Au recto de la photographie mention manuscrite : "Un coin de la salle de rdaction de
l'Echo" .VoirarticlesurlEcduBousquetoun:partie1.1
19

19
Photographiepubliedans:JouveauMarius,Notodeguerro,op.cit.p.11etdans:LouProuvenaulEscolo.
NS.LaGrandoguerro,n.35,2013,p.79.
58
4.5Manuscrits

VelhadaLorana(1924)deJulesCubaynes

Lieux de conservation : CIRDC (Bziers), fonds de la Socit Archologique de Bziers


[SABA9014]
Descriptionphysique:manuscritde4feuillets,210160mm

Le manuscrit Velhada Lorana (1924) de Jules Cubaynes majoral du flibrige quercynois conte une
veille lorraine laquelle il participa durant sa mobilisation. Il y raconte le vcu des paysans lorrains
vivantlaguerredeprs,etquiluirappellentlaviedespaysansdesonQuercynatal.
Sil ne sagit pas un pome prcisment sur la guerre, le pome demeure nanmoins une vocation
littraire intressante sur le vcu direct de personnes touches par la guerre ainsi quune comparaison
originaleentrepaysanslorrainsetquercynois.

Loumatricule1628pndnlaguerre(1931)dEdouardMoulia

Lieuxdeconservation:CIRDC(Bziers)[Ms353]
Descriptionphysique:Dactylographiede55feuillets,270210mm
Documentdisponibleenligne:http://www.occitanica.eu/omeka/items/show/2777

Edouard Moulia (18891939) est un journaliste reconnu pour ses articles engags. Lou matricule 1628
pndn la guerre (1931) est la dactylographie du roman autobiographique dans lequel il raconte son
expriencedelaPremireGuerremondialeentantquesoldat"rserviste".
Ce texte a t publi en 1931 (Orthez : imp. Nabre). Il en existe galement une version destine au
thtrepubliedansReclamsdeBiarneteGascougne,36meanne,p.148.

Nadaldeguerra,(Nol1916)deMargaretaPriolo(MargueritePriolo)

Descriptionphysique:Posieettraduction(F),1p.manuscrite
Lieux de conservation : CIRDC (Bziers), Bibliothque et archives du Collge dOccitanie, fonds
ValreBernard[CQ102/1].

Dans ce pome de Nol Marguerite Priolo reprend les figures emblmatiques de la fte religieuse
(naissance de lenfant Jsus, bergers) et recontextualise ces lments autour de la thmatique de la
guerre.

59
LacrousdeguerrodeLouisAbric(16septembre1915)

Description physique : Carte postale illustre d'une Croix militaire peinte la main, portant le texte :
"Gloire nos braves" et au verso le pome manuscrit" : "La crous de guerro" de Abric, 16 septembre
1915
Lieux de conservation : CIRDC (Bziers), Bibliothque et archives du Collge dOccitanie, fonds
ValreBernard[CQ102/1]

Courtpomepatriotiquefranais,clbrantunevictoireprochainedelanationfranaise.

DinslesildeLouisBonfils(1914)

Lieux de conservation : CIRDC (Bziers), fonds de la Socit Archologique de Bziers


[SABA8018]
Descriptionphysique:3feuillets,220x140mm.
Documentdisponibleenligne:http://occitanica.eu/omeka/items/show/10536

Texte propos par Louis Bonfils au concours de posie de la Socit archologique scientifique et
littraire de Bziers. Dans ce pome de trois pages Louis Bonfils expose le maltre de son vcu de
soldat,lesabsurditsetlesparadoxesauxquelsluiettouslescombattantssontconfrontsauquotidien.


60
5.MONUMENTSAUXMORTSETLIEUXDEMMOIRE

Prsents dans quasi toutes les communes franaises, les monuments aux morts commmorant le
sacrifice de toute une gnration lors de la guerre 19141918 refltent les traumatismes traverss par les
populationsdel'poque,aussibiensurlefrontqu'l'arrire.
Si la plupart exaltent l'immense amour de la patrie qui a men ses enfants au sacrifice, quelquesuns,
plus rares, se font la dmonstration plus concrte de la douleur des survivants par l'utilisation, non pas
d'allgoriesmaisdepersonnagesfamiliers,souventmresouveuves,pleurantleursmorts.
Au sortir de la Grande Guerre les quelques 38 000 monuments qui fleurissent en France sont pour la
plupart rdigs en franais (ils restent commandits et en partie financs par les communes et l'Etat ),
quelques uns portent pourtant des inscriptions occitanes. Loin d'tre la langue du discours patriotique de
l'aprsguerre, l'usage de l'occitan sur ces lieux de mmoire d'un culte rpublicain rendu par l'ensemble
citoyens aux citoyens tombs aux combats semble vouloir toucher au plus prs la population en
s'adressant elle dans sa langue courante, elle peut galement tre le reflet d'un militantisme linguistique
dansunepriodeola"chasseaupatois"estsonapoge.
Quelquesuns de ces monuments aux morts portant des inscriptions en occitan, plus qu'une simple
commmorationsevoientchargsd'uneforcepacifisteoutoutaucontraire,pluspatriotique.

Aniane(Hrault)

Monument ralis par le sculpteur hraultais Jacques Louis Robert Villeneuve, dit Jacques Villeneuve
(18651933), n Bassan, lve dInjalbert. Le monument ralis entre 1923 et 1924 sera achev le
24 juin 1924. Le monument se situe lentre du cimetire vu village, sur un socle en forme
doblisque. On y voit le visage dun soldat visiblement trs marqu par la douleur. Sur le socle, un
court texte en occitan dinspiration pacifiste, rgionaliste et internationaliste attribu Antonin Perbosc
est prsent, on le retrouve dans une graphie lgrement diffrente sur le monument de
SaintFlixLauraguais:
Anosmorts
Laguerrequanvougut
Eslaguerraalaguerra
Sonmortspernostraterra
Epertoutalaterra
Laguerrequilsontvoulu(faire)
Cestlaguerrelaguerre
Ilssontmortspournotreterre
Etlaterretouteentire
[AntoninPerbsc]
61

LesBauxdeProvence(BouchesduRhne)

Simple stle mmoriale situe dans le cimetire de la commune, le monument aux morts comprend
audessus de la liste des morts pour la patrie une inscription en occitan : Aquesti di Baus soun morts
per la Frano ( Ceuxl des Baux sont morts pour la France). Une autre phrase en franais figure
sur une plaque appose au bas du monument : la mmoire de celles et ceux qui sont morts partout
danslemondepourlaFranceetpourladfensedelalibert.

BeaumontduVentoux(Vaucluse)

Situ dans le cimetire de BeaumontduVentoux, ce monument aux morts contient quelques vers en
occitan adressant la reconnaissance de lensemble des habitants de la commune aux soldats morts pour
laFrance:
BravisEnfantmortpersousta
LouNis,louDretlaLiberta
Vieuresdisnnostosouvenno
PerGagedeReconneisseno
BeuMountRespetuousamen
VousaubouroaquestMounumen
1919
Bravesenfantsmortspourprotger
Lenid,ledroit,lalibert
Vousvivrezdansnotresouvenir
Engagedereconnaissance
Beaumont,respectueusement
Vousrigecemonument
1919


62
Bruniquel(TarnetGaronne)

Patriotique, le monument aux morts de Bruniquel (TarnetGaronne) a t inaugur en 1922 et ralis


par le sculpteur local Jean Blaygue. Flibre, ce dernier a appos un quatrain en occitan de sa
composition qui exalte le sacrifice fait par les morts au combat au nom de la Patrie. Auteur d'une
trentaine d'autres monuments aux morts dans la rgion, l'auteur avait l'habitude de composer pour
chacund'entreeuxunpomequ'ildclamaitlejourdel'inauguration.

Susaquelmounumeinountounelsescarquilho
Passanyltxiraslounoumdelafamilho
QuadesounsangpagatdelaFranontailhou
Queperelladounnatoquabiodemilhou
Surcemonumentotonilscarquille
Passanttuyliraslenomdelafamille
QuiapaydesonsanguneportiondeFrance
Qui,pourelle,adonncequelleavaitdemeilleur
63

Cabannes(BouchesduRhne)

Inaugur le 2 octobre 1921 par lhistorien local Lopold Vidau, le monument aux morts de la ville de
Cabannes reprsente un poilu firement dress, le buste en avant. Le monument qui porte une
inscription en franais sera complt plus tard par une inscription en provenal extraite du discours
prononcparVidaulorsdelinauguration:

Frano
Pertu
LiCabanen
Anfa
oquepoudien
France
Pourtoi
Lescabannais
Ontfait
Cequilspouvaient

Cette inscription est loin dtre innocente, en effet parmi les 78 morts figurant sur la liste, ceux de l'anne
1914 appartiennent tous aux rgiments d'infanterie du 15me Corps d'arme durement touchs lors des
premiers mois de la guerre suite de dsastreuses dcisions stratgiques et qui subirent partir de la fin
du mois d'aot 1914 une importante calomnie par voie de presse (Voir : Affaire du 15e Corps). Cette
affaire est reste trs prsente dans la mmoire de tous les provenaux d'aprs guerre mais n'a t que
trspeutraduitedanslesmonumentsauxmorts.
Ce monument fait donc plus appel la mmoire des disparus qu lexaltation du sentiment
patriotique.


64
ChteauneufdeGadagne(Vaucluse)

Ce monument sculpt par JeanPierre Gras, fils du capouli du Flibrige Flix Gras, est situ sur le
plateaudeCampbau,prsduchteaudeFontSgugne,hautlieuduFlibrige.
Compos d'une pyramide de blocs de pierre portant une statue d'un poilu assis accoud un
rocher, tenant un bouquet de fleurs, il comporte sur le ct une inscription reprenant quelques vers de
FlixGras:
Amemounvilagemaiquetounvillage
Amemaprouvenomaiquetaprouvino
AmelaFranomaiquetout
FlixGras
Jaimemonvillageplusquetonvillage
JaimemaProvenceplusquetaprovince
JaimelaFranceplusquetout
FlixGras

Clairac(LotetGaronne)

Le monument aux morts de Clairac est inaugur en 1922, conu par le sculpteur clairacais Eugne
Delpech il est constitu dun exdre qui encadre une femme et son enfant en costumes rgionaux, et est
lgendduneinscriptionenlanguedoc:
Noublidespas
Pichiou,
loustusounmorsperlaPatriou
Noubliepas
Petit,
Lestienssontmortspourlapatrie

LaFarelesOliviers(BouchesduRhne)

Le monument aux morts de LaFarelesOliviers situ au sein de son cimetire, est un monument massif
ddi aux morts de toutes les guerres depuis 1870. Il reprsente une femme voile, visiblement
endeuilleetquitientdanssamaindroiteunglaive.
Ce monument est ralis en 1920 par le statuaire marseillais Paul Gondard et est complt par quelques
versoccitansdupotelocalVictorinLavison.

65
Sevautresiascoucha,laFranoespascouchado
Pugrandoquejama,graavostiefort,
Percounservalountenvostobellomemory
Vousausso,depertoudemounumendeglory
Dourmes,enfant,dourmes,dourmessublimeimort!
VictorinLavison
Sivous,voustescouchs,laFrance,elle,nel'estpas,
Plusgrandequejamaisgrcevosefforts.
Pourconserverlongtempsvotrebellemmoire
Onvouslvepartoutdesmonumentsdegloire.
Dormez,enfants,dormez,dormez,sublimesmorts.
VictorinLavison

Lavercantire(Lot)

rig en 1924 par Emile Mompart, sculpteur local bless au combat, le monument aux morts de
Lavercantire (Lot) est considr comme l'un des plus reprsentatifs du sentiment pacifiste mergeant.
Aux cts de la formule canonique "Aux enfants de Lavercantire morts pour la France" figure
l'inscription "Paours Drols" (Pauvres enfants), grave aux pieds dune Gourdonnaise en pleurs, en
habitpaysan.Ladouleurdelafigurematernelleploresupplantelexaltationdusacrificepatriotique.
66

LeParadou(BouchesduRhne)

Plac dans le cimetire, ce monument aux morts est surmont dune croix. Une plaque en marbre blanc
appose sur sa base comporte quelques vers de CharlounRieu (18461924), potepaysan, flibre
originaireduParadou:

SesounmortpersauvalaFrano
Aprestantdereboulimen
Vieurandinsnostoremembrano
Alombrodaquestmonumen
CharlounRieu
SilssontmortspoursauverlaFrance
Aprstantdeturpitudes
Ilsvivrontdansnotremmoire
Alombredecemonument
CharlesRieu

Maillane(BouchesduRhne)

Le monument sculpt par Henri Endignoux est situ au centre du cimetire. Reprsentant une statue de
poilu sur un pidestal qui une femme en costume darlsienne offre une couronne de laurier, il
comporteuneddicaceenoccitan:
Alamemori
DiMaanen
Mort
SuslouPratbataie
19141918
Ensouvenipietadous
Erecouneissent
Alammoire
DesMaillanais
Morts
Surlechampdebataille
19141918
Ensouvenirpieux
Etreconnaissant
67

SaintFlixLauragais(HauteGaronne)

Monument aux morts sur lequel est appos un plaque contenant un pome pacifiste attribu Antonin
Perbosc, que lon retrouve galement sur le monument dAniane dans lHrault mais dans une graphie
lgrementdiffrente:
Laguerraquanvolguda
Eslaguerralaguerra
Sonmortspernostraterra
Epertoutalaterra
Laguerrequilsontvoulu(faire)
Cestlaguerrelaguerre
Ilssontmortspournotreterre
Etlaterretouteentire
(AntoninPerbsc)


68
SaintRmydeProvence(BouchesduRhne)

La ralisation de ce monument aux morts fut confie en 1916 par le conseil municipal un comit de 74
membres. Ayant rejet plusieurs projets, le comit fait appel une statuaire de la ville, Clara Saint Ren
Taillandier. Inaugur le 29 mai 1921, il comporte une silhouette du mont des Alpilles sur laquelle une
femmeencostumedArlsiennehisseunpanneaucomportantuneddicaceenoccitan:
Glori
Isefant
DeSantRoumie
Quesounmort
PerlaPatrio
Dinsla
Grandoguerro
19141918
Gloire
Auxenfants
DeSaintRmy
Quisontmorts
Pourlapatrie
Dansla
Grandeguerre
19141918
Au bas du monument, une veuve et un enfant plors ainsi quun groupe de poilus au combat sous
undrapeaudployexprimentunpatriotismeattrist.

SaintSaturnindeLucian(Hrault)

Cr en 1934, au lieudit le Rocher des deux Vierges, linitiative des flibres de ClermontlHrault,
ce lieu est ddi aux flibres morts la guerre de 1418. Pour conserver leur souvenir furent plants
autant darbres que de flibres disparus dans un site inaugur les 9 et 10 juin 1935 (voir ciaprs :
Antoulougio di felibre mort a la guerro) qui conserve le nom de bois des flibres. Sur le rocher a
tapposeunetoileseptbranches(symboleduflibrige)surmontantuneinscription:

Alsfelibresmortsperlapatria
Auxflibresmortspourlapatrie

69
SauveterreduBarn(PyrnesAtlantiques)
Monument aux morts rig par le sculpteur Ernest Gabard, il montre une femme plore, la tte dans les
mains,auxctsduneinscriptionengasconattribuelousBiarns(lesBarnais):
Hemnessecatsbosteperpre
Esiatshortessidiuspren,
Arrnoucousteacobalent
EntahalaFrancemeybre!
(lousBiarns)
1914
Femmesschezvotrepaupire
EtsoyezfortessiDieunousprend,
Ilnencoterienuncurvaleureux
[sicenest]pourrendrelaFranceplusbelle
(lesbarnais)
1914

Toulon(Var)

Cemonumentestraliseentreaot1924etjuin1925parlesculpteurHonorSausse.
On y voit un alignement de sept poilus et marins surmonts d'une femme voile. Elle tend les bras,
protgeant les soldats, la manire d'une Vierge de Misricorde du Moyen Age. Elle tient sur le bras
gauche un bouclier qui la dsigne comme l'allgorie de la France, attriste devant ses morts. une
inscriptionenoccitanestgalementprsentesurlemonument:

SounmouartprloupasenfieudelaProuveno
DavansleiNoumSacradunotalojouveno
Passant,descurbeti!
IlssontmortspourlepaysenfilsdelaProvence
Devantlesnomssacrsdunetellejeunesse
Passantdcouvretoi!


70
6.LITTRATURE

Ds le dbut du conflit la littrature fut mise contribution. l'Acadmie des Jeux Floraux de Toulouse
aucun concours neut lieu en 1915 en raison des vnements. En 1916 et en 1917 les concours sont
rtablis avec louverture en 1916 dun concours exceptionnel aux posies ddies la gloire de
larmefranaise.

En 1917 un double concours est ouvert aux posies franaises et aux posies en langue doc ddies
la France. Sur les pices prsentes cent vingt huit sont en vers franais et dix sept en langue doc. La
Violette dargent destine la meilleure posie en langue doc sera attribue M. Louis Gouyer, de
Pont Saint Esprit pour son Oda a la Fransa . Les autres pices seront analyses par le Baron
20
Desazars de Montgailhard, lun des quarante mainteneurs dans son rapport lu en sance publique le 3
mai1917quimentionneentreautrespomesreusLaBousdelaFrano.

En 1918, l'Acadmie attribuera une ou plusieurs Violettes d'argent aux meilleures posies en langue
d'oc traitant du sujet La Fransa totjorn vivnta. La primevre ira la pice intitule Lusido dins
lescur en dialecte rhodanien de labb Lon Spariat et loeillet la pice intitule Fransa tremuda
21
de labb Jules Cubaynes (p. 4651). Les autres pices releves dans le rapport ont pour titre: La
Despacho, LEstello, Le Pichot Tambour, La Guerro Voe victis!, A la Frana roca e
imortala. Dautres sonnets reus sont intituls: La Vu dou Cluchi qui clame le danger la frontire,
La guerra moundiala o il est question du fils mort pour la France. Ou encore la pice intitule o que
diran les blats de la partizou pome arigeois, Joffre lou catalan, nostre marescu de Frano, Salut
Gallini, Fe, Amour, Esperano, lhymne Visiu de victorio alpreb de la santo Viergo, Visiou de
tranchado,Cocorico!.

Au lendemain du conflit, la littrature reste encore imprgne des souvenirs de guerre et la reprise de
lactivitculturellepermetlditiondetextesnsetinspirsparlaguerre.
En 1919 les pices primes au concours des jeux Floraux seront Soulomi, Aven pas fa la grando
guerro de Pierre Fontan de Toulon , Nadal de Fransa (p. 6571) de labb Jules Cubaynes, Quau
22
vivo? Frano! (p. 7283) de labb Lon Spariat, Lo Case (p. 8485) de M. Arthur Cambos de
Bergerac.

En 1924 lAssociation des crivains combattants publie une Anthologie des crivains morts la
guerre 19141918 qui relve aprs une courte notice biographique des extraits doeuvres. On y relve
20
RecueildelAcadmiedesjeuxfloraux,191517,p.8191.
21
RecueildelAcadmiedesjeuxfloraux,1918,p.3745.
22
RecueildelAcadmiedesjeuxfloraux,1919,p.4364.
71
quatre auteurs occitans: Louis Bonfils, Roger Brunel, Francis Pouzol, Louis DulhomNogus. (Voir
dtailciaprs)

6.1Ouvragespublisdepuislaguerrejusqunosjours

La guerre de 19141918 a laiss une trace importante dans la littrature d'expression occitane. Si pour
des raisons videntes la production imprime reste modeste pendant la dure du conflit et trouve son
expression diffuse dans les publications priodiques, elle devient plus importante au lendemain de la
guerre. Les tmoignages resurgissent alors et se confondent avec les hommages aux soldats disparus.
Ce sont des transcriptions de correspondances, des rcits ou pomes du front ou des rdition de textes
crits ou dits en priode de guerre. La production importante ds la fin du conflit stale jusqu nos
jours au gr des dcouvertes et des hommages rendus. Les ouvrages sont ici relevs dans leur ordre de
parution.

DEZEUZE,Franois.PerJoffre,deRibasaltas,[MountPeli]:[s.n.],[1915].

CoteCIRDC:[CBA1537]

Long pome patriotique la gloire du Marchal Joffre, vainqueur de la bataille de la Marne, dat du 15
mars1915,Montpellier,publiparFranoisDezeuzesouslepseudonymedelEscoutaire.

SPARIAT,Lon.LaguerrodedemaneRemembrano,Toulon,G.Mouton,1917.
TirpartduBulletindelAcadmieduVar,1917.(7p.)

CoteCIRDC:[CBB40123]

Lon Spariat (18611936), majoral du flibrige en 1898 et titulaire de la Cigalo de Marsiho est un
prtre aumnier de lhpital maritime de Saint Mandrier prs de Toulon. Il publie en 1918 et 1919
plusieurspomessursonexpriencelaguerre.
Les deux pomes publis contiennent ici le rcit du vcu du soldat Lon Spariat, ils content la lassitude
ressentieparSpariatettouslesautressoldatsauquotidien.


72
SPARIAT,Lon.LusidodinslEscur,Lueursdanslombre,[s.l.],[s.n.],1918,(18p.)

CoteCIRDC:[CBB41524]

Pice crite en Hommage lAmrique et couronne aux jeux Floraux de Toulouse le 3 mai 1918. Le
document contient le pome avec sa traduction suivi de lextrait du rapport sur le concours de posie en
langue doc par M. le Baron Desazars de Montgailhard suivi dun extrait du Tlgramme de Toulouse
du3mai1918.
Le pome traite de lespoir n chez le soldat Spariat lors de lentre en guerre des tatsUnis
dAmrique.

SPARIAT, Lon. Quau vivo? Frano!, Pice qui a obtenu un rappel de primevre, Toulouse,
Imp.Douladoure,1919(14p.)

CoteCIRDC:[CBB479]

Pome patriotique qui exalte la patrie et lme vaillante du Midi (Amo valnto du Miejour). Le texte
contientunetraductionfranaise.


73
DARBLADE, Frantz. Pelut e Blu : Nadau gascon de la grane guerre : Nadal 1917 :
pome illustrad S bn la Librairie Jeanne d'Arc, Auch en o de l'autou, Courrensan,
1919.
(QuatrimediciounCauquespcesinditesepourtrtsnautsjuin1919)

CoteCIRDC:[CRXX273]

Dans un volume luxueusement prsent, labb Franois Darblade (18681946) a runi pomes, chants
et prires ddis aux poilus gascons et leurs familles. Louvrage illustr de gravures et
photographies comporte une partie complter (Lou soubeni gascoun Paje reserbade ue photo
dunsouldatdfun)parlafamilledessoldatsdisparus.

AZMA,Pierre.Loburetour.Montpelhir:ed.dauGal,1919.

CoteCIRDC:[CBB40614]

Mobilis en 1915 au 122e rgiment dinfanterie, Pierre Azma est envoy rapidement sur le front.
Grivement bless dun clat dobus, il retourne larrire et fonde Montpellier la premire
association des mutils de guerre. De 1916 1920, il rdige le journal de langue doc Lou Gal, (voir
74
cidessus) pour soutenir le moral des soldats et rfuter les calomnies odieuses propages alors contre
le15eCorps.
23
En septembre 1919, Pierre Azma (18911967) crit Lo Bu retour, brlot qui exprime la dception
desancienscombattantsetdonnelercitdudifficileretourdespoilusen1919.

BOUDONLASHERME, Albert. Un journal de tranche : lcho du boqueteau. Le Puy.


Impr.desFlibres,1919.

CoteCIRDC:[JOUC308]

Au lendemain de la guerre, les textes parus dans le journal de tranche : Lcho du boqueteau sont
runis par BoudonLasherme, son rdacteur, dans un volume qui parat en 1919, contenant lhistorique
dujournal.

23
Omenatge a Peire Azema (18911967), IEO CIDO, 1987, donne la liste des articles publis par Pierre Azema
notammentdansLaCampanadeMagalounaetsurtoutdansLouGalpendantlapriodedelaguerre19161918.
75
JOUVEAU,Marius.Laflouraucasco,pouesodeguerro,Avignoun:Roumanille,1919.

CoteCIRDC:[CAB929]

Marius Jouveau publie en 1919 un recueil de posies crites pendant la guerre, ordonnes
chronologiquement suivant les diffrents champs de bataille de juillet 1915 octobre 1918 : En
Argouno, En Vovre, En Champagno, Davans Toul, Davans Flirey, Davans Verdun, En Loureno
(courrespoundnci M. Jouveau A. BoudonLashermes [pomes]), A la Costo 304, En Itali,
Soumo, Aisne e Oise, In Mmoriam. Certains de ces pomes seront publies dans les journaux
dpoque (La Crounico de San Maiou). Elles sont prcdes par un historique de lEscolo du
Boumbardamen

Lou Libre dOr de Santo Estello Li vitimo de la grando guerro Nstis eros, Avignoun :
BuruduFelibrige,1920.

CoteCIRDC:[CBB794]

Pendant toute la dure du conflit le consistoire flibren a continu de fonctionner. Il a ouvert un Livre
dor qui recensait les flibres morts la guerre. Les noms des flibres y sont regroups par Escolo
avec une courte notice biographique, prcde par leur affectation militaire. Louvrage dbute (p. 515)
par un hommage au soldats du 15e corps, constitu de soldats provenaux, injustement accuss de
lchet et finalement rhabilits en juillet 1919 par le Marchal Joffre. Il sachve par un chapitre
consacrauxEscoloejournaudufrontprsentationdesjournauxdufrontetdeleurscollaborateurs.

ARBAUD,Jusd.LirampaudAram,poumo,Aixenprovence,LeFeu,1920.

CoteCIRDC:[CAB164]

Dans ce recueil de pomes quil publie au lendemain de la guerre Joseph dArbaud rend hommage aux
soldats mridionaux disparus dans les plaines du Nord, travers quatre longs pomes quil accompagne
de notes biographiques sur certains d'entreeux : Henri Bertrand de Dieulefit, Charles Benoit dAvignon,
JeanMarc Bernard de SaintRambert dAlbon, Paul Fiolle de Pertuis, Frdric Charpin de
SaintMartindeCastillon,AlexandrePeyrondeLamanonetMarcelRaybauddeSalondeProvence.

76
POUZOL, Francis, Poumo, Letro et article, e li testimoni de sis amis, emun retra, Ales,
LoSecret,1921.

CoteCIRDC:[CAB1056]

Franis Pouzol n en 1891 est tu au front en 1918. Fondateur de lEc du Bousquetoun et du


Bulletin de lEscolo du Boumbardamen, il collabore aussi Marsyas, Cacalaca, Calendau et
LArmana occitan. Une partie de son oeuvre indite est publie de manire posthume par SullyAndr
Peyre qui prface louvrage sous le pseudonyme de Jan de la Vaulongo. Cette dition comporte
galement des pomes et des articles et une partie de la correspondance du soldat Pouzol crite entre
19141918.

DELPONDELASCABRAS, COURTIOL, G. , DEZEUZE, Franois. Grels de lauri,


Montpellier:F.Dezeuze,1921.

CoteCIRDC:[CBA16516]

Sous le pseudonyme DelponDelascabras, Louis Stehl (18821933) publie avec G. Courtiol et


Franois Dezeuze, montpellirain connu sous le nom de lEscoutaire, un recueil de trois pomes ddis
aux soldats de la grande guerre en voquant ceux qui en sont revenus Pr lous que sount tournats,
ainsiquelesouvenirdeceuxdufrontPialutsetdeceuxquinereviendrontpasDequasrevist?...

77
PERBOSC, Antonin. Cansons del pble, Toloza : Edicions de la Revista muzicala occitana,
1923.

CoteCIRDC:[CBA2]

Ce texte dAntonin Perbosc, clairement pacifiste, est un hymne la gloire des paysans, laboureurs,
vigneronsetbouviersquijourentunrlecentralpendantlaGrandeGuerre.
Qual es que maiquemai a fach brri de carn tot lo temps qua calgut per menar lorra gurra
sa fin ? Los pacans, los omes de la trra. (Qui estce qui plus que tout a fait barrire de chair tout le
tempsquilafallutpourmenerlhorribleguerresonterme?Lespaysans,leshommesdelaterre.)

Anthologie des crivains morts la guerre 19141918, Amiens : Association des crivains
combattants,1924(5volumes192426).

CoteCIRDC:[CAC863]

Cette Anthologie fournit une notice biographique pour chaque crivain mort la guerre suivie dun
choixdetextesextraitsdeleuroeuvre.Onyrelve:
Louis DulhomNogus (I, 227234), auteur de posies gascones publies dans Era Bouts dera
mountanho, biographie par Marc Leclerc, suivie du pome Printemps Francis Pouzol (I, 553555),
biographie par Frdric Mistral neveu, suivie du pome Autar Louis Bonfils (II, 7278), biographie
par Pierre Azema, suivie du pome La Serenada (1910) Roger Brunel (II, 9498) biographie par
AlcideBlavet,suiviedespomesLaProvenceetAlavenusdeMilo.

AZEMA, Peire. A boulet rouge..., crounicas dau tems de la guerra. Touloun, La Pignato,
1930.

CoteCIRDC:[CAB878]

Ce livre est constitu de chroniques publies dans Lou Gal entre 1916 et 1920. La couverture porte un
vers de Mistral extrait du pome Calendau Tapararen boulet rouge Car es tu la Patrio e tu la
Liberta.Noustedfendronsbouletrouge/CarcesttoilaPatrieettoilaLibert.


78
MOULIA,douard.LouMatricule1628pndnlaguerre,Orthez,imp.Nabre,1931.

CoteCIRDC:[CAB3405]

A travers une trentaine de petites scnes en gascon, louvrage autobiographique permet de suivre le
parcours dun soldat, de la caserne aux tranches, l'hpital ou en permission, jusqu la fin de la
guerre.

DANTOINE, Pierre. La guerre vue par Dantoine, Carcassonne : Impr. Rennes, 1932. 1 vol.
(nonpagin[40]f.):ill.,couv.ill.24x33cm

CoteCIRDC:[CRG30]

Pierre Dantoine (18841955), n Carcassonne, soldat au 272e rgiment dinfanterie consacre pendant
la guerre son temps libre la ralisation de croquis et dessins dont une partie sera publie aprs la
guerre sous le titre La guerre vue par Dantoine (recueil de 43 dessins). Trs attach sa rgion,
Dantoine lgende ses dessins humoristiques en occitan. Aprs la guerre, il collabore plusieurs journaux
rgionaux comme La Dpche du Midi et La Dmocratie de lAude qui publieront ses dessins,
estimsprsde2000.

79

80
Antoulougiodifelibremortalaguerro,19141918,MountPeli:Vernhes,1935.

CoteCIRDC:[F4]

Anthologie publie dans le n30 (1935) de Calendau, dite Montpellier. LAntoulougio di felibre
mort a la guerro est publie loccasion de linauguration de la fort de Santo Estello SaintSaturnin,
prs de ClermontlHrault les 9 et 10 juin 1935. (Voir ciaprs). Le volume est exclusivement consacr
aux flibres morts la guerre. lintrieur on retrouve la liste alphabtique de tous les flibres, ainsi que
leurproductiondauteurdelanguedoc:posie,prose,correspondance,essai...

GASTELLUSABALOT, JAN. Marite l'Au srote : pastorale dramatique rimade n coate


hytes sguide per la musique, las danses e l'splic dous bstissis, [Orthez] : [Moulia],
1936.

CoteCIRDC:[CAB967]

Pastorale barnaise en quatre actes se droulant pendant la guerre : Lamou qu pioule, Lous Adius,
La Guerre et La Nouce biarnse. La pastorale raconte lhistoire de simples paysans envoys la
guerre mise en parallle avec celle de profiteurs rests larrire et profitant de loccasion pour
senrichir.LetexteestpubliparYandouSabalotpseudonymedeJanGastelluSabalot.
Le pome Nous auts qum lous ptits (p.109) a t repris par Los de Nadau dans lalbum
Limmortlaed.Ventadorn,1978

MOULY,Henri.Entutantlogrelh,Rodez:Subervie,1965.

CoteCIRDC:[CAB256]

Henry Mouly raconte dans cet ouvrage lhistoire du Grelh Rouergat, cole flibrenne rouergate
travers ses personnages et leurs aventures. Dans son premier chapitre il donne trois tmoignages sur la
guerre de 1914 (p. 1750) : Sguret, Volontaris, Verdun, Dins las peirieiras de Curlu, Una nuetch
calhola,Vingtans.


81

CASEBONE, Julien. U souldat biarnes a la guerre, Bordes (64320) : ed. de l'Escole Gasto
Febus,1988.
Traduction parue en 2011 : Yulien de Caseboune, JeanPierre Breths (trad.) Un soldat
barnaisdanslaguerre,[s.l]:InstitutBarnaisetGascon,2011.

CoteCIRDC:[CBB3721]

Julien Casebonne (18971978), flibre barnais, issu d'une famille de paysans de la Valle d'Ossau
rejoint en 1923 l'Escole Gasto Febus et commence ds 1927 publier des romans (Esprabes
d'Amou), salus par ma critique de l'ensemble des revues gasconnes. Devenu Mste en Gai Sab, il est
mobilis en 1916 et est envoy ds le mois d'aot au Front. Il participera aux combats jusqu' la fin de
laguerre.
Ce n'est qu'en 1968 que paratra en feuilletons, dans la revue Reclams de Biarn e Gascougne( n34
1968 n78 1969 n 34 n910 1970) son journal de guerre, tenu au jour le jour, au plus prs
des combats. Il y raconte dans sa langue maternelle, depuis son dpart du village d'Escou en 1916
sonretourPauen1919,lequotidiend'unjeunesoldatbarnaisdanslestranches.

JOUVEAUMarius.Notodeguerro,[s.l.],M.Th.Jouveau,1980,48p.

CoteCIRDC:[CBB40314]

En 1980, MarieThrse Jouveau publie les notes de guerre de Marius Jouveau, son beau pre,
partir de sa correspondance, des notes prises pendant la guerre et du journal tenu sur un carnet partir
dejuillet1915.
Marius Jouveau (18781949) est le fils dElzar ou Auzias Jouveau (18471917), facteur, chansonnier
et Majoral du flibrige en 1897. Marius Jouveau nat Avignon en 1878 o il est est enseignant.
Fondateur et directeur de plusieurs revues flibrennes, Fe (1940), En Terro dArle (19071912). Il
devient directeur de la revue Lou Flibrige (19191945) et de lArmana Prouvenau (19061913).
Majoral du Flibrige en 1913 il en sera le capouli de 1922 1941. Son fils Ren Jouveau
(19061997) lui succdera comme capouli de 1971 1982. Cest son pouse MarieThrse ne
Gauthier (19212005), galement majoral du flibrige, que lon doit la publication des carnets de guerre
deMariusJouveau.


82

NOGUIER,Jorgi.Recaliuebelugueto,pref.DeGeorgesMartin,Nmes:impr.Bene,1980.

CoteCIRDC:[CAC8426](1980)autreditionCAC8427(2002)

Lauteur, flibre, laurat des Jeux Floraux dAls et de la Socit archologique de Bziers a t
correspondant de diverses revues occitanes notamment Lou Gal et Cacalaca partir de 1917. Ce
recueil posthume publi par sa fille regroupe un grand nombre de pomes occitans crits pendant la
guerre (p. 2257) avec leur traduction. Le premier pome Eli (Eux) sadresse au snateur Gervais
24
snateur embusqu et marchand de fromages auteur de larticle du Matin sur les soldats du 15e
corps.(Voir:affairedu15eCorps) .
25

DURAND, Jos. La tuairo roujo, poumeis sus la Grando Guerro en vers perigordis
(1932),[S.l.]:E.KieferDurand,1991.

CoteCIRDC:[CBB4047]

Le recueil de pomes en occitan prigourdin est divis en trois parties : Lou champ dounour e
dorrour Lus Bourruts dins lours talpanieras En ai de la rego de mort. Mobilis, lauteur
tmoigne de son vcu pendant la guerre et plus largement de la vie quotidienne des soldats dans les
tranchesetlarrire.

POMMIER,Paul.FlourdErmas,Avignon:A.Barthlemy,1993.

CoteCIRDC:[CAC5466]

Ce recueil de posies indites de Paul Pommier (18881947) publi par son fils Georges Pommier,
contient trois textes composs alors quil tait soldat au front dans le secteur de Raulecourt (Meuse) :
Flour de Lourreno Raulecourt (Meuse), 18 novembre 1914 LAtaco de Richecourt dou 15
desembre 1914 Raulecourt, 20 dcembre 1914 Gramaci a louvroir de lescolo maco que ma
mandaunpaquetdeNouveRaulecourt(Meuse),1erjanvier1915.
Avant guerre Paul Pommier avait compos un pome aux accents fortement antimiltaristes Per servi la
patrio:Icouscridelaclasso1910quifaisaitnotammentallusionauxmutinslanguedociensde1907:
25
Il sy trouve aussi des copies de lettres de Franois Pouzol (avec facsimil) et dautres adresses Louis Bonfils
publiesdansLouGal.

83
Unjourvousmandaran
Controlipasan
Quepoudrienestrevostrifraire...

DELERIS,Ferran.PireeMari,Tolosa:Institutd'EstudisOccitans,1996.

CoteCIRDC:[R.LANDEL]

Le roman conte la sparation tragique, de deux jeunes maris Pire et Mari, une semaine avant la
mobilisation

BERLAND, Roland. Los Jorns Telhu, Limoges : Cercle Limousin d'Etudes Occitanes et
d'ActionPopulaire,1996.

CoteCIRDC:[CAC6229]

Leromancontelevcudunsoldatlimousinplongdanslenferdelaguerre.

DEGIOANNI,Andriu.LouTourteiru,LaFarlde,AVEP,2003.

CoteCIRDC:[CAC7292]

Andr Degioanni est n en 1930. Il laisse une oeuvre crite importante de romancier. Lou Tourteiru
est la chronique dun sicle illustre dune centaine de rcits imags. Parmi ceuxci, plusieurs couvrent la
priode de la grande guerre: An tua Jaurs (1914), Retour dei paire de siis enfant (1915), Lou
Desertour (1916), Fatima (1917), La Fieiro de SantMartin (1918), Clmenceau (1919) (p.
3042).


84
BOUDONLASHERMES, Albert. Ouros de guerro, SaintMartindeValgalgue : Aigo Vivo,
2008.

CoteCIRDC:[CBB78530]

Ouros de guerro est un recueil compos quasi exclusivement de pomes, textes et articles issus du
bulletinL'EcdubousquetounetcentrssurlevcuquotidiendusoldatBoudon.

ROUQUETTE,Max.MijaGautaoLogentilmedeveire,Perpignan:Trabucaire,2010.

CoteCIRDC:[R.LANROUQ]

Dernier roman de Max Rouquette, publi titre posthume. Le personnage surnomm MijaGauta est
une gueule casse de 1418, il se fait appeler : Commandant X, son entourage le croit mort, il disparat
de la vie sociale. La rencontre entre le personnage et celui qui va raconter sa vie, alors jeune tudiant en
mdecine,vasefaireplacedelaCanourgueMontpellier.

BOUERY, JanBernat. Istri d'un couscrit de 1913, raconte de la Grando Guerro, Marsiho
:Prouvnod'aro,2012.

CoteCIRDC:[CAC9460]

LIstri dun couscrit de 1913 est un roman de JanBernat Bouery inspir de la vie de son pre
IrneFranois Bouery, gueule casse de la Premire Guerre mondiale, originaire de la Colle de
SaintJeanduDsert. Le roman bien que contant une biographie complte dIrneFranois Bouery
est principalement centr autour de son exprience de soldat. Le livre rapporte de manire romance les
souvenirsdufilsquivoqueleslonguesdiscussionsquileutavecsonpre,ausujetdesaviemilitaire.

LouProuvenaulEscolo:LaGrandoGuerro,n.35,2013.

CoteCIRDC:[C1]

Dans sa deuxime livraison de lanne 2013, la revue Lou Prouvenau lEscolo prsente un dossier
sur la Grande Guerre. On y retrouve des textes de Joseph dArbaud, de Marius Jouveau, J.P. Gras,
Folco de Baroncelli, Auzias Lieutaud, J.B. Boury, Auzias Jouveau, Andriu Degioanni et Paul Ruat
accompagnsdundossierpdagogiqueralisparNatalieSeissonetSimonCalamel.
85
MARTIN, JeanBaptiste. Les poilus parlaient patois. Documents dialectaux de
RhneAlpes,unregarddiffrentsurlaguerrede19141918,Lyon,EMCC,2014.

CoteCIRDC:[944.3MAR]

Ce livre est une anthologie de textes occitans et francoprovenaux traduits en franais. Une petite partie
du livre est consacre loccitan, minoritairement reprsent dans la rgion RhneAlpes o est dit le
recueil. La partie occitane est compos de lettres et pomes de poilus ou de leur familles et sont
principalementcentrssurlevcuetlequotidiendessoldats.

6.2Affairedu15meCorps(enfranais)

Au dbut du mois daot 1914, lannonce de mobilisation gnrale se propage partout en France. Les
hommes en ge de combattre partent pour le front, des corps darme sy retrouvent : le 15e est
compos de soldats de Provence, des AlpesMaritimes, de Corse, du Gard et de lArdche il y ctoie
le20ecorpsdeLorraineetle18eduLanguedoc.
Dans les premiers jours, ces trois corps darmes ne cessent davancer, suivant la stratgie d'agression
outrance dcrte par le gnral Foch. Et pour cause, les allemands se drobent au combat. Ce nest
que pour mieux prendre ces trois corps darme au pige et plus particulirement le 20e corps lorrain,
qui jouit dune rputation dexcellent soldat et qui lont prte le meilleur tat desprit car premier
concern, gographiquement parlant, par les combats. Le 19 aot, le 15e corps est immobilis par
dintense bombardement prs de Dieuze. Fidle sa stratgie, Foch dcide de faire avancer le 20e
corps alors tout proche. Les soldats allemands contrent habilement cette manuvre et la retraite des
lorrains qui rejoignent les positions du 15e corps est catastrophique. partir du 22 aot les positions se
stabilisent, mais sans avoir pu tirer un seul coup de fusil certaines compagnies du Midi enregistrent des
pertes de lordre de 80%. Pour ne pas affaiblir le moral de la nation, dj mis rude preuve, Joffre
dsigneuncoupableceseralessoldatsdu15ecorps.
Ces soldats sont dj victimes lpoque dune trs mauvaise image aux yeux des conservateurs et des
nationalistes. Cette image est dj encre dans leur esprit depuis longtemps, elle est lie au succs rcent
du couard Tartarin de Tarascon et la thorie des climats, vestige du XVIIIe sicle, qui prte aux
soldats du Midi un caractre avilissant car notamment mtiss, romanis et enjuiv, et aux habitants des
froides contres du nord le dynamisme, lnergie, la virilit et lintelligence Ces aprioris nont
jusqualors que trs peu influenc le soldat lambda septentrional. Cependant, laccusation publique
laquellelessoldatsmridionauxdevrontfairefaceseraparticulirementdifficilesurmonter.

Le 24 aot 1914 dans le journal Le Matin parat un article sign dAuguste Gervais et rdig par le
MinistredelaGuerreAdolpheMessimy(1),mettantencause:
86

une division du 15me Corps compos de contingents dAntibes, de Toulon, de Marseille


et dAix [qui a] lch pied devant lennemi () entranant la retraite sur toute la ligne.
Le ministre de la Guerre () a prescrit les mesures de rpression immdiates et
impitoyables qui simposaient. Les troupes de laimable Provence ont t prises dun subit
affolement.Laveupublicdeleurfaiblessesajouteralarigueurdeschtimentsmilitaires.

La presse rgionale prend alors la dfense des soldats mridionaux notamment Lou Gal et Le Petit
Var. En 1915, quelques mois aprs l'affaire du 15me corps, Louis Bonfils capitaine au 319e
dinfanterie voque dans sa correspondance la complexit de rapports Nord/Sud et se lance dans une
lutte pour la cause des mridionaux humilis et la dfense de la dignit de leur langue. Il signale d'ailleurs
plusieurs reprises qu'il est un des seuls grads s'adresser ses hommes et lancer des ordres de
combatenlangued'oc.

Affichepourlarhabilitation15mecorps(14juillet1932)

Lieuxdeconservation:CIRDC(Bziers)FondsAzma[AZP91326AZP133417].

Lors de la remise de la dignit de Grand Officier de la Lgion dhonneur au Gnral Messimy


(18691935), en juillet 1932, le souvenir de la blessure faite laimable Provence sera ravive par un
groupe de jeunes fdralistes de Provence qui signent laffiche Aux anciens combattants provenaux
uneinsulte!.

LeLapinplumessupplmentillustrduCanardpoilu,[s.l.]:[s.n.],19151916

Lieuxdeconservation:BnFRs.Fol.Lc6146
Datesextrmesdepublicationconnues:19151916
Priodicit:Hebdomadaire
Documentdisponibleenligne:http://gallica.bnf.fr/ark:/12148/bpt6k111441p

Journal officiel du 15e Corps qui reproduit des images de strotypes rgionaux, largement diffuss par
la littrature et limagerie sous la IIIe Rpublique. On y relve dans le n4 : La babillarde, pome et
dessins humoristiques (vocation dune correspondance entre un soldat marseillais et sa femme en
provenal) ainsi que dans le n 8 Les origines pome et dessins humoristiques qui joue sur la
26
dialectiquedespetitespatrieslocalesauseindelagrande,franaise .
27
26
http://gallica.bnf.fr/ark:/12148/bpt6k111441p/f7.image
27
http://gallica.bnf.fr/ark:/12148/bpt6k111441p/f15.image
87
BELLEUDY, Jules. La Lgende du XVe corps d'arme : L'Affaire de Dieuze, Avignon,
FrancoisSguin,1916.IV51p.:1c.Grandin8

Lieuxdeconservation:BDICQ192(F)(ouvragecensur,seulexemplaireconnu)

Jules Belleudy dbute sa carrire comme jeune journaliste Marseille dans L'galit sous le
28
pseudonyme de Jules Branger. Il collabore ensuite l'Ordre social et au Phare du Littoral de Nice,
puis de nouveau L'galit Marseille et la Jeune Rpublique, qu'il fonde avec son ami le flibre
Clovis Hugues. Rdacteur en chef du Journal du Midi Avignon, il cre en 1877 Le Rveil du Midi,
dont le premier numro parat le 12 aot, jour symbolique de sa sortie de prison, aprs un mois
d'enfermement assorti d'une amende de mille francs, pour ses ides politiques et militantes parues dans
le Journal du Midi. En 1916, il publie en plein conflit, un livre qui rhabilite sans appel l'honneur des
rgiments du 15e corps. Louvrage qui est publi Avignon chez Franois Sguin sera aussitt censur.
Ilserarditaprsleconfliten1921.

Gnral Carbillet, Premires armes d'une division du Midi sur le front : confrence du 18
janvierNice,Nice:impr.del'Eclaireur,1918.

Lieuxdeconservation:CIRDC(Bziers)[CBA16613](+1)(seulsexemplairesconnus)

Au cours de lanne 1918, une des premires publications visant rhabiliter le 15e corps se fait
linitiative de Pierre Devoluy, ancien capouli du Flibrige et directeur de la revue Vivo Prouvno !.
Celuici contacte le gnral JeanBaptiste Jules Carbillet, grandofficier de l'ordre national de la Lgion
d'honneur, qui apporte son tmoignage lors dune confrence donne Nice le 18 janvier 1918, et
dite par Devoluy la mme anne. Le gnral Carbillet porte notamment son regard sur la calomnie
contrelesPoilusmridionaux.(Voir:LeBouletrouge,n.13,marsavril1918).

BELLEUDY, Jules. Que fautil penser du 15e corps ? Prf. du colonel Gros Long. Menton :
Impr.cooprative,1921.1vol.(XII356p.):cartes23cm.Notesbibliogr.

Lieuxdeconservation:BnFTolbiacRezdejardinmagasin8LF207966(seulexemplaireconnu).

Pierre Devoluy (pseud. de Paul Gros Long) prfacera une nouvelle dition de louvrage de Jules
Belleudy,en1921.

28
http://www.inha.fr/fr/ressources/publications/dictionnairecritiquedeshistoriensdelart/belleudyjules.html
88
MISTRE, Maurice. La lgende noire du 15
e
corps. Lhonneur vol des Provenaux par le feu et
linsulte,StMichellObservatoire:Cestdireditions,2009.

JeanYves Le Naour, La lgende noire des soldats du Midi, Paris : Vendmiaire, impr. 2013, cop.
2013.

7.ARTSSCNIQUES

BARTHE, mile. Lous proufitaires Coumedio en brses lengadoucians, Bziers, [s.n.],


1922.
Lieuxdeconservation:CIRDC(Bziers)[COD153](voiraffichecidessus)
Lous proufitaires est un Jugement, motif classique du thtre occitan et plus particulirement de son
thtre de Carnaval. Ici, ce sont M. et Mme. Ventredor qui sont jugs pour stre enrichis pendant la
Premire Guerre mondiale. La pice se passe quelques temps aprs larmistice dans un tribunal. Elle met
en scnes les accuss, un juge, deux avocats aux plaidoyers burlesques, ainsi que plusieurs tmoins
notamment danciens clients des poux Ventredor mais galement le Soldat inconnu prsent au nom de
toutes les victimes civiles et militaires de la guerre. La pice engage, prsente ds 1922 rencontrera un
grandsuccsetserareprisejusquen1959 .
29
Ensavoirplus:
BOULOC, Franois. Senrichir pendant la Grande Guerre, une anomalie complexe. Lexemple
desProfitairesdEmileBartheetdesMarchandsdegloiredeMarcelPagnol[enligne]
http://www.crid1418.org/doc/textes/Bouloc_Barthe&Pagnol.pdf(consultle28ocotbre2014)


29
Cf.Emilebarthe,LosProfitaires/Lesprofiteurs:comdieenlangued'ocaveclatrad.franaiseenregardprf.par
MarcelCarriresetLonCordes.Paris,LesAmisdelaLangued'Oc,1969.172p.(CollectiondesAmisdelalangue
d'Oc).
89
NEYTON,Andr.LalgendenoiredusoldatO.

Production:Centredramatiqueoccitan,2013

PourquoilesoldatOestilmort?
Pas au bout des fusils de lennemi comme il est naturel selon les lois de la guerre. Mais tomb sous les
balles de ses frres d'armes. Pas par le hasard tragique d'une erreur de tir comme il en existe
naturellement dans toute guerre qui fait de son mieux et n'y parvient pas toujours. Mais dans le calme
terribleetordonnancd'unpelotond'excution.
A qui le soldat O doitil de n'avoir pas eu le temps de montrer le courage et la loyaut qu'il s'tait promis
face l'ennemi ? A Montesquieu ? Michelet ? Victor Hugo ? Balzac ? Taine ou Daudet... ? Pas encore
Cline ou Alexis Carrel. L'ombre de nos grands crivains n'atelle pas scell par avance le sort du
soldat O ? Limmense poids de leur renomme natil pas eu sa part de responsabilit dans son destin
tragique?
Sur un fond de lgret vatenguerre entretenue par une Madelon exaltant le courage des "pioupiou
de Provence", le Soldat O crit entre deux obus. Il parle du trou creus et recreus dans la boue pour
s'enterrer, des godasses qu'il a empruntes celui qui n'en avait plus besoin il a fallu chercher pour
enlever la deuxime l'autre pied, un peu plus loin du dernier colis, du papier lettres qui ne
supportepaslapluied'ici.
La Madelon, omniprsente, le remet debout par la magie de son exhortation aux charmes dbordants.
Pendant que le soldat O raconte, des images dfilent derrire lui. Celles d'une camra qui fait ses
premiers pas dans la vrit de la guerre. L'image bascule. L'oprateur n'a peuttre pas vu venir lobus
qui On appelle le soldat O. Pour la relve ou pour monter l'attaque? Il reviendra dans son nid de
poule,blessaupied.
LeSoldatOseradoncfusill.
Alors le soldat O se souvient. Il se souvient, puisque cela a t crit, qu'il ne peut tre qu'un lche parce
quil est du Midi. Il va alors se prter, dans un procs tragicomique, au jeu de l'ethnotype mridional
auquel il tait condamn par avance, un procs conduit par les plus emblmatiques de nos grands
crivains, philosophes, historiens qui, travers leurs crits sur le Sud, sont tonnants de mpris, d'ironie
voire dhostilit. Un procs qui suscite des rires parfois grinants et branle les gloires les plus
immortelles.


90
1562jorns:testimnidunchaple

Production:CEPdOCavecJ.P.Belmon,Liza,JoanPeireCazot,2014

Spectacle en occitan et franais partir de tmoignages et chansons dpoque mettant en lumire


l'impossible antimilitarisme, le racisme antisudiste, et la grande dtresse de ceux qui vont disparatre
danslabouedelaSomme.


91
8.RESSOURCESENLIGNE

LaPrimiragurramondiala(consultle13octobre2014)
Recueil de documents en occitan et en franais pour la classe, mis disposition par lAcadmie
deToulouseetrecueillisparDidierAgar(8novembre2013).
http://pedagogie.actoulouse.fr/languesvivantes/spip.php?article1245

LeBibliophilelanguedocien(consultle13octobre2014)
Un blog consacr aux livres, aux revues, aux crivains, diteurs, bibliophiles ou collections du
Languedoc, publi par Guy Barral. Contient la transcription intgrale de la correspondance de
LouisBonfils(18fvrier2012)
http://bibliophilelanguedocien.blogspot.fr/2012/02/journaldeguerredelouisbonfilsavec.html

CRID(consultle13octobre2014)
Site du Collectif de recherche international et de dbat sur la guerre de 19141918, association
de chercheurs qui vise au progrs et la diffusion des connaissances sur la Premire Guerre
mondiale, anim par Rmy Cazals diteur des Carnets de guerre de Louis Barthas. Contient de
nombreusesinformationsetundictionnairebiographiquedesauteursdetmoignagesdeguerre.
http://crid1418.org/espace_scientifique/ouvrages/barthas.htm

MARSYAS2(consultle13octobre2014)
Transcription de lintgralit du tout premier journal de tranche flibren qui a pour titre
LEcho des cagnas de Remires, du nom dun lieudit de la commune de Seicheprey (prs de
Toul)otaitcantonnAlbertBoudonLashermessonanimateur.
http://marsyas2.blogspot.fr/2014/10/lechodescagnasderemieresuneidees.html


92