Vous êtes sur la page 1sur 214

Biochimie et Médecine

• La biochimie s’occupe des bases chimiques de la vie.

L’unité de base du système vivant est la cellule.

La biochimie est la science qui concerne l'étude des molécules et constituants chimiques des cellules vivantes

et des organismes ainsi que de leurs réactions chimiques.

D'après cette définition, la biochimie englobe donc les grands secteurs de la biologie cellulaire, de la biologie

moléculaire et de la génétique moléculaire.

Biochimie et Médecine

La biochimie a pour but:

de décrire et d’expliquer, en termes

moléculaires, tous les processus chimiques

des cellules vivantes.

La relation réciproque entre Biochimie et Médecine

Les deux soucis majeurs des médecins -

sont la compréhension et le maintien de santé par le traitement efficace des

maladies.

Biochimie a un impact énorme sur ces soucis fondamentaux de médecine.

La biochimie et la médecine sont intimement

rapprochées et liées.

Acides nucléiques Biochimie Hydrates de carbones protéines lipides diabètes Anémie falciforme Maladies
Acides nucléiques
Biochimie
Hydrates de carbones
protéines
lipides
diabètes
Anémie falciforme
Maladies génétiques
athérosclérose

Médecine

1. STRUCTURE DE L'ADN * Structure en double hélice (Watson et Crick)

1. STRUCTURE DE L'ADN * Structure en double hélice (Watson et Crick)

Les nucléotides

À la fin des années 20, Phoebus Levine

(1869-1940) avait déterminé que l'ADN contenait:

du phosphore, un glucide appelé

désoxyribose et des bases azotées.

Ces molécules peuvent s'assembler pour former des nucléotides.

Comme nous le verrons, l'ADN est un polymère de nucléotides.

Structure et constitution du nucléotide

Enchaînement de 3 éléments:

Une base, un pentose et acide

phosphorique

Les constituants du nucléotide

Les constituants du nucléotide A. une base B. un sucre à 5 carbones C. un acide

A. une base

B. un sucre à 5 carbones

C. un acide phosphorique

Les constituants du nucléotide

A. la base: composés

cycliques azotées

1. Bases pyrimidiques

2. Bases puriques

Les constituants du nucléotide

1. bases pyrimidiques

Cycle hexagonal à 4 carbones et 2 azotes

La cytosine (C), la thymine (T) et l’uracile (U).

pyrimidiques • Cycle hexagonal à 4 carbones et 2 azotes • La cytosine (C), la thymine

Les constituants du nucléotide

2. bases puriques

• Accolement d’un cycle hexagonal à 4 carbones et 2 azotes et d’un cycle

pentagonal à 3 carbones et

2 azotes.

Adenine (A) et Guanine

(G)

hexagonal à 4 carbones et 2 azotes et d’un cycle pentagonal à 3 carbones et 2

Les constituants du nucléotide

B. pentose

Sucre simple à 5 C.

Ribose (ARN)

Désoxyribose (ADN)

Les constituants du nucléotide • B. pentose • Sucre simple à 5 C. • Ribose (ARN)

Les constituants du nucléotide

C. acide phosphorique

Un tri-acide

Rend le nucléotide chargé négativement

Les constituants du nucléotide • C. acide phosphorique • Un tri-acide • Rend le nucléotide chargé

Il y a donc quatre sortes de nucléotides

Il y a donc quatre sortes de nucléotides

Les nucléotides peuvent se lier les uns aux autres

par leur sucre (désoxyribose) et leur groupement phosphate :

Les nucléotides peuvent se lier les uns aux autres par leur sucre (désoxyribose) et leur groupement

Liaison Base-pentose

liaison b-osidique
liaison b-osidique

Les sucres (ribose ou désoxyribose)

se lient aux bases azotées par des liaisons impliquant un des azotes de la base (azote n°1 des Pyrimidines (C,T) ou azote n°9 des Purines A,G) et le carbone n°1 de pentose.

Ce sont des liaisons b-osidiques.

Nucléoside: sucre + base

Liaison pentose-phosphate

La liaison d’un nucléoside avec un phosphate se fait par une estérification de la fonction alcool primaire (carbone n°5’) du sucre et une des trois fonctions acides du phosphate.

du sucre et une des trois fonctions acides du phosphate. Liaisons esters L’ester obtenu est un

Liaisons esters

L’ester obtenu est un

Nucléotide:

Base +Sucre + Phosphate

Nomenclature des différents nucléotides

• Les nucléotides constituants l’ARN:

AMP, GMP, CMP, UMP

• Les nuclétides constituant l’ADN:

dAMP, dGMP, dCMP, dTMP

Du nucléotide à l’acide nucléique

Structure primaire d’ADN:

Condensation des nucléotides par des liaisons phosphodiesters

Ces liaisons définissent un sens à la molécule : le début étant le

nucléotide dont le phosphate en

5’ ne serait lié à aucun autre nucléotide et la fin correspond au nucléotide dont la fonction alcool en 3’ n’est pas estérifiée:

5’P vers 3’OH.

et la fin correspond au nucléotide dont la fonction alcool en 3’ n’est pas estérifiée: 5’P

Points clés

Les nucléotides = base azotée+ sucre pentose+acide

phosphorique

Bases azotées: purines ou des pyrimidines

Pentose: ribose ou un désoxyribose

• L’enchaînement de plusieurs nucléotides constitue un acide nucléique, qui contient l’information génétique

La double hélice de Crick et Watson

Nous souhaitons suggérer une structure pour le sel de l'acide désoxyribonucléique (ADN). Cette structure présente de nouvelles caractéristiques qui sont d'un intérêt biologique considérable."

Francis Crick et James Watson, Nature - VOL 171, page 737, 1953 - 2 Avril 1953

Crick et Watson en 1953 devant leur modèle d'ADN
Crick et Watson en 1953 devant leur modèle d'ADN

Crick et Watson en 1953 devant leur modèle d'ADN

1. STRUCTURE DE L'ADN * Structure en double hélice (Watson et Crick)

1. STRUCTURE DE L'ADN * Structure en double hélice (Watson et Crick)

Caractéristiques de l’ADN

Ces deux chaînes ont 3 propriétés essentielles:

Antiparallèles

Complémentaires

Hélicoïdales: configuration hélicoïdales

* organisation de l'ADN en deux chaînes antiparallèles:

organisation de l'ADN en deux chaînes antiparallèles: Deux brins de nucléotides sont parallèles mais dans des

Deux brins de nucléotides sont parallèles mais dans des directions opposées.

* organisation de l'ADN en deux chaînes complémentaires:

L'appariement est toujours par complémentarité

A en face de T (2 ponts hydrogènes) G en face de C (3 ponts

hydrogènes)

Par convention, l'écriture d'une séquence d'ADN se fait toujours

dans le sens 5‘P -> 3‘OH

Par convention, l'écriture d'une séquence d'ADN se fait toujours dans le sens 5‘P - > 3‘OH

* organisation de l'ADN en deux chaînes hélicoïdales:

Les deux chaînes d’ADN présentent dans l’espace une structure hélicoïdale.

Elles s’enroulent autour d’un axe central en formant un double hélice.

dans l’espace une structure hélicoïdale. Elles s’enroulent autour d’un axe central en formant un double hélice.

La structure d’ADN

La structure d’ADN
La structure d’ADN

Caractéristiques des deux chaînes de DNA

Antiparallèles

Complémentaires:

en face de A on a T

En face de C en a G

Hélicoïdales: configuration hélicoïdales

• Complémentaires: • en face de A on a T • En face de C en

* dénaturation de l'ADN

dénaturation = séparation des deux brins par

rupture des ponts hydrogènes (p.ex. sous l'effet

de la chaleur).

Tm = melting temperature (température de fusion)

= température à laquelle 50% des molécules

d'ADN sont à l'état dénaturé.

Le Tm d'une séquence nucléotidique particulière dépend, entre autres, de la richesse en A=T et

G=C

(importance pour les techniques impliquant l'hybridation d'ADN: PCR, southern blotting; cfr plus loin)

Points clés

1. ADN: deux chaînes antiparallèle, complémentaire et

hélicoïdale.

2. Les ARN sont formés par une seule chaîne de

nucléotides et on distingue:

Les ARNr (ribosomaux): traduction

Les ARNt (transfert): portent les acides aminés

– Les ARNm (messagers): qui portent l’information des gènes

codant les protéines.

2. Organisation du génome chez l’homme

L'ADN chez tous les êtres vivants possède la

même structure, seule la taille du génome varie:

- virus: ADN = 10 3 à 10 4 paires de bases

- bactéries: ADN = 10 6 pb, ADN circulaire, un seul chromosome, pas de nucléosome.

-eucaryotes: ADN = 3 x 10 9 pb (être humain), réparti sur plusieurs chromosomes, ADN est associé à des protéines (chromatine).

2. Organisation du génome chez l’homme

Chez l'homme le génome est constitué de

3.2 milliards de paires de bases.

-

les

régions

codant

les

protéines

occupent moins de 2% du génome

- estimation d'environ 32.000 gènes

Dans la cellule eucaryote, presque tout l'ADN

est contenu dans le noyau

chez les eucaryotes, chaque molécule d'ADN du noyau est enroulée sur des protéines appelées histones. Chaque segment d'ADN enroulé sur ses histones forme un nucléosome. L'ensemble (ADN et histones) s'enroule à nouveau sur lui-même pour former une structure plus compacte appelée chromosome.

Un chromosome humain peut contenir entre 20 et 100 millions de paires de bases. Le nombre de chromosomes par cellule est caractéristique de l'espèce. Les cellules humaines, par exemple, contiennent 46 chromosomes chacune.

Chez l'homme l'ADN se répartit sur 46 chromosomes: 22

paires d'autosomes, 1 paire de chromosomes sexuels X et Y (génome diploïde):

se répartit sur 46 chromosomes: 22 paires d'autosomes, 1 paire de chromosomes sexuels X et Y

* chromatine

L’organisation complexe de l’ADN nucléaire sous la

forme de chromatine a pour but de compacter une très grande ficelle d’ADN (100000 mm dans un noyau de 5 à 8 mm).

L'ADN du noyau est associé à des protéines, formant ainsi la chromatine.

Ces protéines ont un rôle structurel (histones

(compaction de l'ADN) ou fonctionnel (protéines de la

réplication, de la transcription).

Nucléosomes

5

types

d'histones:

H1,

H2A,

H2B,

H3

et

H4.

ADN

de

la

(200pb-surface

+

particule)

histones

(noyau

intérieur)

H2A,

H2B,

H3 et

nucléosome.

H4 forment un

ADN de la (200pb-surface + particule) histones (noyau intérieur) H2A, H2B, H3 et nucléosome. H4 forment

Nucléosomes

L'ensemble formé par l'ADN enroulé sur 8 histones (H2A, H2B, H3 et H4-illustrées par une petite boule sur le dessin à droite) forme ce qu'on appelle

un nucléosome.

Les histones H1 servent à relier les nucléosomes les uns aux autres de façon à former une

structure spiralée plus compacte

H1 servent à relier les nucléosomes les uns aux autres de façon à former une structure

Organisation chromosomique de l’ADN

Organisation chromosomique de l’ADN

Les acides nucléiques

Un nucléotide

Contient une base purique et une base pyrimidique

Contient un élément minéral

Peut intervenir dans la transmission du message hormonal

Peut avoir un rôle structural

Peut avoir un rôle énergétique

A.

B.

C.

D.

E.

Concernant les nucléotides

Un nucléotide est formé de 2 nucléosides

Un nucléotide peut porter plusieurs P

Un nucléotide contient un hexose

A.

B.

C.

• L’ADN est un nucléotide

D.

Les acides nucléiques

Certaines des propositions suivantes sur la

complémentarité des bases sont exactes lesquelles.

A. la base A est exclusivement complémentaire de la T.

• B. dans l’ADN, les paires de bases A-T sont stabilisées par 3 liaisons hydrogène.

• C. la base G est complémentaire de C dans l’ADN et l’ARN

• D. dans l’ADN les paires de bases G-C sont stabilisées par 3 liaisons hydrogène.

• E. les deux chaînes d’une molécule d’ADN riche en G-C sont plus difficiles à dissocier que celles d’ADN riche en A-T

Constance et variation du DNA

Résulte de 2 processus: la réplication et la

réparation

La division cellulaire est précédée par la duplication de l’information à ce que les deux cellules filles possèdent le même contenu informatif.

Cette duplication est assurée par la réplication du DNA au cours de laquelle une molécule de DNA engendre deux molécules filles rigoureusement identique à la molécule de départ. Problème: non-fidélité de la réplication et

agressions physiques et chimiques.

Réparation: système protéique assure la réparation de DNA lésé.

réplication et agressions physiques et chimiques. Réparation : système protéique assure la réparation de DNA lésé.

3. REPLICATION DE L'ADN

Mécanisme biochimiquement complexe.

ADN = stockage de l'information génétique.

Flux d'information génétique:

réplication

• Flux d'information génétique: • réplication ADN transcription ARN Réverse transcription (virus

ADN

transcription

génétique: • réplication ADN transcription ARN Réverse transcription (virus uniquement) traduction

ARN

Réverse transcription (virus uniquement)

traduction

génétique: • réplication ADN transcription ARN Réverse transcription (virus uniquement) traduction protéine

protéine

3. REPLICATION DE L'ADN

Réplication:

Synthèse d’acide désoxyribonucléique (ADN) qui reproduit exactement le génome d’une cellule au cours du cycle cellulaire afin de préparer la division de cette cellule.

3. REPLICATION DE L'ADN

• Au cours de la vie de la cellule (cycle cellulaire, d’une

division mitotique à la suivante), le DNA doit être dédoublé pour que chaque cellule fille reçoive un génome complet dans son noyau.

Cette synthèse se produit à la phase S (au milieu du cycle cellulaire) grâce à l’activité de la DNA-polymérase δ et α. D’autres DNA polymérases participent à la réparation du

DNA lésé (DNA-polymérase β) ou à la réplication du

DNA mitochondrial (DNA-polymérase γ).

Cycle cellulaire

Une cellule qui ne cesse de se diviser passe par 4 phases successives:

La phase G1 de croissance et préparation de la cellule par intensification de son métabolisme. (2n) La phase S (synthèse) durant cette phase réplication de l’ADN. (4n) La phase G2 de croissance et de préparation à la mitose (4n) La phase M: à ce stade se produit la division cellulaire et que se formeront donc 2 cellules filles diploïdes (2n).

On appelle G 0 l’état de repos des cellules qui ne se divisent pas.

donc 2 cellules filles diploïdes (2n). • On appelle G 0 l’état de repos des cellules

3. REPLICATION DE L'ADN

semi-conservatrice:

Chaque nouvelle molécule contient un brin ancien et

un brin nouveau.

3. REPLICATION DE L'ADN • semi-conservatrice : Chaque nouvelle molécule contient un brin ancien et un

3. REPLICATION DE L'ADN

La synthèse respecte les

règles de l'appariement des bases A/T et G/C

3. REPLICATION DE L'ADN • La synthèse respecte les règles de l'appariement des bases A/T et

3. REPLICATION DE L'ADN

chaque brin est synthétisé

dans le sens 5' - > 3'

3. REPLICATION DE L'ADN • chaque brin est synthétisé dans le sens 5' - > 3'

3. REPLICATION DE L'ADN

Eléments nécessaires pour la réplication:

1. ADN parental: matrice, modèle

2. nucléotides: dATP, dTTP, dCTP, dGTP

3. REPLICATION DE L'ADN

3. Enzymes

Pendant la réplication: DNA déroulé et maintenu simple brin grâce aux:

Hélicases : sépare les deux brins de la double hélice

Protéines SSB (single strand Binding) stabilise les brins de

DNA séparés.

ADN polymérases: assembler les nucléotides les uns aux autres.

Autres enzymes

3. REPLICATION DE L'ADN

Mécanismes

1. propagation

La réplication progresse de manière bidirectionnelle et d'une manière discontinue (fragments d'Okazaki) pour l'un des deux brins.

2. Origine de réplication

Plusieurs milliers.

discontinue (fragments d'Okazaki) pour l'un des deux brins. 2. Origine de réplication Plusieurs milliers.

Les étapes de la réplication: déroulement de l’ADN

La réplication implique le déroulement de l'ADN: rôle des topoisomérases

les

(hélicase

ponts hydrogènes.

supprime

Les brins du DNA ainsi séparés sont stabilisés sous forme simple brins grâce à la fixation des

protéines SSB.

• Les brins du DNA ainsi séparés sont stabilisés sous forme simple brins grâce à la

Schéma de la fourche de réplication.

En [1], l’hélicase sépare les deux brins du DNA. En [2], SSB, les protéines de liaison empêchent les deux brins de se recoller. En [3], les polymérases

synthétisent les nouveaux bras de

5’ en 3’. En [4], le brin direct est retranscrit directement. En [5], le brin retardé est synthétisé sous forme d’éléments d’Okazaki,

qui sont reliés entre eux grâce à une

ligase.

brin retardé est synthétisé sous forme d’éléments d’Okazaki, qui sont reliés entre eux grâce à une

Réplication: synthèse d’une amorce de RNA (primer)

La synthèse de DNA (par les DNA polymérases) ne peut se faire que par élongation d’une amorce (RNA polymérase).

Dans le cas de la réplication, cette amorce est de type ribonucléique.

Ce petit ARN est synthétisé par un complexe protéique appelé primase.

L’ADN polymérase III, synthétise le brin complémentaire à partir de

l’extrémité 3’OH de l’amorce ARN

L’ADN polymérase III, synthétise le brin complémentaire à partir de l’extrémité 3 ’OH de l’amorce ARN

Réplication: croissance des brins néosynthétisés est continue sur un brin, discontinue sur l’autre

Le DNA polymérase III (Pol III),

synthétise le

brin

complémentaire à

partir

de

l’extrémité 3’OH de l’amorce ARN

comme

en utilisant

matrice donc le sens

5

Les protéines SSB sont chassées au fur et à mesure de l’utilisation du brin matrice.

le

DNA

et à mesure de l’utilisation du brin matrice. le DNA 3 ’ • La pol III

3

La pol III est une enzyme très

complexe composée de plusieurs

sous unités.

du brin matrice. le DNA 3 ’ • La pol III est une enzyme très complexe

Réplication: croissance des brins néosynthétisés est continue sur un brin, discontinue sur l’autre

Il semble que 2 molécules de polymérases soient associées au niveau du point de réplication:

1 au niveau du brin avancé, synthétise en continu au fur et à mesure du déroulement des brins de DNA.

L’autre enzyme situé sur le brin retardé synthétise du DNA de manière discontinue sous forme de petits fragments (1000-2000 nucléotides) = fragments d’Okazaki.

du DNA de manière discontinue sous forme de petits fragments (1000-2000 nucléotides) = fragments d’Okazaki.

Finition du brin: hydrolyse et remplacement des amorces de RNA

Les amorces de RNA seront détruites et remplacées par du DNA.

C’est

activités

qui

le

même

ces

enzyme

catalyse

• C’est activités qui le même ces enzyme catalyse deux exonucléasique et polymérasique. Il s’agit de

deux

exonucléasique et polymérasique.

Il s’agit de

l’ADN polymérase I.

Rôle de la polymérase I

L ’ADN polymérase I fut la première polymérase

découverte par Arthur Kornberg (années 60)

Activités de POL I:

exonucléase 3

(années 60) • Activités de POL I : exonucléase 3 ’ 5 ’ exonucléase 5 ’

5 ’

exonucléase 5

exonucléase 5 ’ 3 ’

3 ’

polymérase

5

polymérase 5 ’ 3 ’

3 ’

Rôle de la polymérase I

Activités de POL I:

Rôle de la polymérase I • Activités de POL I : exonucléase 5 ’ Hydrolyser les

exonucléase 5

Hydrolyser les amorces de RNA

de POL I : exonucléase 5 ’ Hydrolyser les amorces de RNA 3 ’ polymérase Ajouter

3 ’

polymérase

Ajouter les désoxyribonucléotides en 3’ du fragment de DNA

5

3 ’

amorces de RNA 3 ’ polymérase Ajouter les désoxyribonucléotides en 3’ du fragment de DNA 5

précédent

Finalement une ligase effectuera la soudeur du brin

Une ADN ligase relie les différents fragments d'ADN.

L ’ADN ligase: formation

d ’une liaison d ’un diester entre le 3 -OH et le 5 - phosphate de deux fragments Okazaki

: formation d ’une liaison d ’un diester entre le 3 ’ -OH et le 5

Modèle de la fourche de réplication

En résumé, lors de la réplication interviennent

essentiellements:

Hélicases et protéines SSB: déroulement de la double hélice Primase (RNA polymérase): qui, permet

la synthèse d’amorces de RNA

Polymérase III: qui poursuit la synthèse

de DNA sur l’amorce Polymérase I: hydrolyse les amorces les remplace par du DNA

Ligase: qui relie les fragments de DNA

Médicaments perturbant la réplication

LES ALKYLANTS. (endoxan)

→ Molécule pouvant former des

liaisons de covalence avec l’ADN.

→ Formation de ponts entre les

chaînes d’ADN qui ne peuvent plus

être séparées.

→ Inhibition de la réplication et de la transcription des régions d’ADN

concernées

MECANISME D ’ACTION DES SUBSTANCES

INTERCALANTES

MECANISME D ’ACTION DES SUBSTANCES INTERCALANTES

3. REPLICATION DE L'ADN

*Implications

pharmacologiques

- agents anticancéreux ciblant les topoisomérases et inhibant la réplication (action

sélective)

- analogues de nucléosides:

Acyclovir -> inhibition préférentielle de l'ADN polymérase virale

peu

sélective) - analogues de nucléosides: Acyclovir -> inhibition préférentielle de l'ADN polymérase virale peu

4.Réparation d ’ADN endommagé

L ’ADN est sensible à:

Rayons UV (formation de dimères de thymine)

Radiations ionisantes (coupures de brins)

Substances chimiques (méthylation et désamination)

Modifications chimiques spontanées (dépurination et dépyrimidination)

Nucléotides endommagés et bases mésappariées sont reconnus par des enzymes de réparation:

L ’enzyme de photoréactivation pour la réparation des TT-dimères

L ’enzyme UvrABC coupant le brin au niveau de la modification,

une hélicase, Pol I et l ’ADN ligase

L ’ADN glycosylase, catalysant l ’élimination des bases désaminées

Réparation d ’ADN endommagé

Réparation d ’ADN endommagé TT-dimère

TT-dimère

Réparation d ’ADN endommagé

Réparation d ’ADN endommagé
Réparation d ’ADN endommagé

Transcription

Gène:

séquence

d'ADN

contenant

la

d’une

l'information

synthèse

nécessaire

ARN

à

d‘un

ou

protéine.

Les ARN sont produites à partir de gènes

L'expression du génome aboutit à la synthèse dans les cellules de macromolécules acides nucléiques et protéines, dont la structure primaire est déterminée par celle du DNA.

Cette expression se fait par deux mécanismes principaux :

o

la structure primaire du DNA s'exprime d'abord par la synthèse d'acides

ribonucléiques dont la structure primaire est parallèle à celle du DNA. C'est la

transcription. La synthèse se fait dans le sens 5’

3’

o

la structure transcrite sur certains RNA, dits « messagers » ou ARNm, s'exprime

enfin par la synthèse de protéines dont la structure primaire traduit en acides

aminés l'information portée par la structure primaire du DNA. C'est la traduction.

Les ARN sont produites à partir de gènes

La transcription est conduite par plusieurs enzymes :

o RNA-polymérase I qui synthétise les RNA cytoplasmiques : RNA ribosomiques (18 S- 5,8 S- 28 S) à partir des gènes ribosomaux (classe I). Les ARNr sont très stables.

o RNA-polymérase II qui synthétise les RNA messagers (ARNm) qui

contiennent l'information destinée à la traduction. Les gènes de classe II codent pratiquement toujours pour une protéine. Les ARNm demi-vie

3 min à 10 h.

o RNA-polymérase III qui synthétise les petits RNA (tRNA, rRNA 5 S,

snRNA, 7SL-RNA). Les ARNt sont stables.

Substrats pour la synthèse d ’ARN: ATP, UTP, CTP, GTP

Schéma de la transcription d’un gène

Schéma de la transcription d’un gène

Anatomie d’un gène codant pour un protéine

• Il n’existe pas de structure définie absolue.
• Il n’existe pas de structure définie absolue.
Traduction
Traduction

Code génétique

Le « langage » nucléique s'écrit avec 4 lettres.

Le « langage » protéine s'écrit avec 20 termes

correspondant aux 20 acides aminés.

Si une lettre nucléique se traduisait par un acide aminé, il ne pourrait y avoir que 4 acides aminés.

En groupant les lettres nucléiques en « mots » de 2 lettres on pourrait avoir 16 mots, mais cela ne permettrait de coder que 16 acides aminés.

En groupant les lettres nucléiques en « mots » de 3 lettres on peut avoir 64 mots, ce qui permet d'exprimer les 20 acides aminés.

Le code génétique est donc fondé sur des

mots de trois lettres : les codons.

d'exprimer les 20 acides aminés. • Le code génétique est donc fondé sur des mots de

Traduction d’un ARNm

Les éléments nécessaires

Le ribosome est le site d’accueil: il reçoit

ARNm: L'ARNm véhicule l'information génétique, du lieu de

stockage (hélice d'ADN) vers le lieu d'expression, où il sert de

matrice à la synthèse du polypeptide.

ARNt: Les ARN de transfert (ARNt) font le lien entre nucléotides et acides aminés. Ils sont chargés de collecter les acides aminés présents dans le cytoplasme et de les transporter jusqu'au ribosome où s'effectue la synthèse du polypeptide.

Les antibiotiques sont des inhibiteurs de la

traduction

• Tétracycline: bloque la fixation de l’ARNt-

aa/ au site A

• Chloramphénicol: bloque l’action de la

peptidyl transférase.

Exemple d’une chaîne peptidique

Exemple d’une chaîne peptidique

Devenir des protéines néosynthétisés

• Acquisition d’une structure tri-dimentionnelle

(repliement correcte adapté à la fonction)

Le routage (adressage) des protéines

(localisation cellulaire: membrane, sécrétion, noyau etc)

Les modifications post-traductionnelles

(clivages, ponts disulfure, hydroxylations, lipides, phosphorylation, glycosylation,

Dégradation

Points clés

• La structure repliée d’une protéine: interactions non covalentes, liaisons hydrogènes hélices a et feuillets b.

Rôle des protéines chaperons Quasi totalité des protéines des organites intracellulaires est fabriquée dans le cytoplasme et transporté vers l’organite approprié grâce à un signal de tri présent dans leur séquence amino-terminale Les protéines solubles destinées à être secrétées sont adressées au RE et passe complètement du RE, avant de suivre le flux sécrétoire via l’appareil de golgi. Les protéines transmembranaires destinées à la membrane du RE ou à d’autres membranes cellulaires sont initialement adressées de la même façon, mais restent ancrées dans la membrane du fait d’un domaine hydrophobe dans leur séquence d’aa.

Importance biomédicale des protéines

Les protéines exécutent des rôles multiples et sont donc

d’une importance vitale.

le cytosquelette, maintient la forme cellulaire et l'intégrité physique.

L'actine et des filaments de myosine, L'hémoglobine, les anticorps , les enzymes, les récepteurs cellulaires, hormones etc

La médecine moléculaire a pour but l'identification de protéines dont la présence, l'absence, ou le manque sont associés aux conditions

physiologiques spécifiques ou à des maladies (cible thérapeutique,

diagnostique moléculaire etc).

Méthodes d’études des protéines

Méthodes d’études des protéines

SDS-PAGE

Deux méthodes électrophorétiques sont utlilisées pour

analyser les protéines :

• l’électrophorèse de zone (SDS-PAGE, masse moléculaire) et la focalisation isoélectrique (gradient de pH).

En gel de polyacrylamide.

Les deux méthodes sont souvent couplées pour réaliser une séparation bidimensionnelle à haute résolution.

SDS-PAGE pour visualiser les étapes de purification successives d’une protéine recombinante.

de purification successives d’une protéine recombinante. S : protéines standard E : Extrait cellulaire

S

: protéines standard

E

: Extrait cellulaire brut

C, H : Surnageant liquide (après ultracentrifugation).

D : Fraction DEAE-Sepharose.

Focalisation isoélectrique

Si on applique un champ électrique continu à un milieu

(gel de polyacrylamide) contenant des tampons ioniques appelés ampholytes (charges + et -) il en résulte la formation d’un gradient de pH.

Les protéines déposées, migrent jusqu'à ce qu'ils atteignent la région de la matrice où le pH correspond à leur point isoélectrique, le pH auquel la charge nette d'un peptide est nulle.

Ces peptides alors ne peuvent plus migrer

G-2D

Une des techniques traditionnelles utilisées couramment

afin de séparer les protéines est l'électrophorèse sur gels de polyacrylamide (PAGE) en deux dimensions.

Les protéines sont séparées en une dimension en fonction

de leur taille, et dans la deuxième dimension en fonction de

leur charge (leur point isoélectrique).

Après la séparation, le gel est coloré afin de pouvoir repérer les zones de protéines.

Cette méthode très résolutive permet l’individualisation simultanée de quelques milliers de protéines.

Cette méthode très résolutive permet l’individualisation simultanée de quelques milliers de protéines.

2D-IEF-SDS-PAGE. Électrophorèse bidimensionnelle.

2D-IEF-SDS-PAGE. Électrophorèse bidimensionnelle.

* gènes, séquences intergéniques et

ADN répétitif

ADN répétitif:

à côté des séquences n'existant qu'en un seul exemplaire (en réalité en 2 exemplaires, le génome étant diploïde), on trouve dans le génome humain des séquences répétées un grand nombre de fois.

Elles peuvent être intra- ou intergéniques.

Devenir des protéines néosynthétisés

• Acquisition d’une structure tri-dimentionnelle

(repliement correcte adapté à la fonction)

Le routage (adressage) des protéines (localisation cellulaire: membrane, sécrétion, noyau

etc)

Les modifications post-traductionnelles (clivages, ponts disulfure, hydroxylations, lipides, phosphorylation, glycosylation,

Dégradation

* gènes, séquences intergéniques et

ADN répétitif

* minisatellites:

courtes séquences hautement répétées.

* gènes, séquences intergéniques et

ADN répétitif

* microsatellites: très courtes séquences (3-5

nucléotides) répétitives.

intérêt en pathologie: maladies caractérisées par l'augmentation du nombre de copies de microsatellites (ex. chorée de Huntington -> le gène de la protéine huntingtine possède normalement (CAG) 11-34 mais chez le malade (CAG) 42-100.

* gènes, séquences intergéniques et

ADN répétitif

* séquence Alu: 500.000 à 106 copies

par génome humain.

fonction inconnue.

5. EXPRESSION DES GENES:

transcription et maturation des ARNs

Principes généraux:

5. EXPRESSION DES GENES: transcription et maturation des ARNs • Principes généraux:

L'expression du génome aboutit à la synthèse dans les cellules de macromolécules acides nucléiques et protéines, dont la structure primaire est déterminée par celle du DNA.

Cette expression se fait par deux mécanismes principaux :

o

la structure primaire du DNA s'exprime d'abord par la synthèse d'acides

ribonucléiques dont la structure primaire est parallèle à celle du DNA. C'est la

transcription. La synthèse se fait dans le sens 5’

transcription. La synthèse se fait dans le sens 5’ 3’

3’

o

la structure transcrite sur certains RNA, dits « messagers » ou ARNm, s'exprime

enfin par la synthèse de protéines dont la structure primaire traduit en acides

aminés l'information portée par la structure primaire du DNA. C'est la traduction.

La transcription est conduite par plusieurs enzymes :

o

RNA-polymérase I qui synthétise les RNA cytoplasmiques : RNA ribosomiques (18 S- 5,8 S- 28 S) à partir des gènes ribosomaux (classe I).

o

RNA-polymérase II qui synthétise les RNA messagers (ARNm) qui

contiennent l'information destinée à la traduction. Les gènes de classe II codent pratiquement toujours pour une protéine.

o

RNA-polymérase III qui synthétise les petits RNA (tRNA, rRNA 5 S,

snRNA, 7SL-RNA).

Schéma de la transcription d’un gène

Schéma de la transcription d’un gène

* Structure de l'ARN

Similaire à celle de l'ADN, à l'exception de:

- monobrin (sauf régions appariées)

- adénine, guanine, uracile (à la place de la thymine) et cytosine.

- ribonucléodites: ribose à la place de désoxyribose.

structure des bases

structure des bases

structure de l'ARN

structure de l'ARN

* Structure de l'ARN

Nomenclature : ribo et désoxy

Ribonucléodites qui constituent l’ARN sont donc:

ATP, GTP, UTP, CTP.

Désoxyribonuclétides (ADN) : dATP, dGTP, dTTP, dCTP

Les ARN

Il existe 3 grands types ou classes d’ARN:

ARN ribosomial (ARNr) très stable

ARN de transfert (ARNt)très stable

ARN messager (ARNm) demi-vie 3 min à 10 h

6. SYNTHESE DES ARNm:

6a. Principes généraux

La synthèse de l'ARNm est catalysée par l'ARN polymérase qui copie le brin inférieur de l'ADN;

la synthèse progresse dans le sens 5' -> 3' (liaison

phosphodiester);

la synthèse respecte la complémentarité des bases A/U et G/C.

L ’ARN polymérase

L ’ARN polymérase catalyse la synthèse d ’un ARNm à

partir d ’une molécule ADN

Substrats pour la synthèse d ’ARN: ATP, UTP, CTP, GTP

(Substrats pour la synthèse d ’ADN: dATP, dTTP, dCTP, dGTP)

Chez les Eucaryotes:

Pol I synthétise les ARNr

Pol II synthétise les ARNm

Pol III synthétise les ARNt et ARN5S

Schéma de la transcription d’un gène

Schéma de la transcription d’un gène

Anatomie d’un gène codant pour un protéine

• Il n’existe pas de structure définie absolue.
• Il n’existe pas de structure définie absolue.

6b. Initiation et régulation de la transcription

La transcription commence en un site précis appelé site d'initiation de la transcription ou +1.

L'activité

de

protéines:

l'ARN

polymérase

II

est

contrôlée

par

des

(i) facteurs de transcription de base : attirent l'ARN polymérase

vers le site d'initiation de la transcription;

(ii) facteurs activateurs ou inhibiteurs de la transcription. Ces facteurs se lient sur le gène transcrit sur des séquences d'ADN

précises.

Les facteurs sont qualifiés de "facteurs trans" et leurs sites d'atterrissage sur l'ADN de "séquences cis".

Facteur trans Facteurs de transcription de base +/- ARN polymerase II ARN TATA ADN Séquence
Facteur trans
Facteurs de transcription de base
+/-
ARN polymerase II
ARN
TATA
ADN
Séquence cis
Initiation de la
transcription
(= nucléotide +1)
Séquence
TATA
(+/-
nucléotide -30)

Promoteur du gène

Partie transcrite du gène

+1) Séquence TATA (+/- nucléotide -30) P r o m o t e u r d

Par convention,

+1 est le site d’initiation de la transcription

lors de la représentation d'un gène, on n'écrit que le brin supérieur (brin codant) dans le sens 5' -> 3'.

En aval de +1: les nucléotides de la région transcrite

sont numérotés de +1 à +n, à compter à partir du site d'initiation de la transcription qui constitue le nucléotide +1.

En amont de +1: les nucléotides du promoteur sont

numérotés de -1 à -n, par rapport au site d'initiation

de la transcription (+1).

organisation d'un gène codant les ARNm:

Facteurs de

transcription Facteurs trans de base ARN polymerase II +1 ATG stop TATA AATAA Exon Exon
transcription
Facteurs trans
de base
ARN polymerase II
+1
ATG
stop
TATA
AATAA
Exon
Exon
Exon
Signal de
Intron
Intron
polyadenylation
Exon Exon Exon Signal de Intron Intron polyadenylation enhancer Promoteur (  100 pb à 500
Exon Exon Exon Signal de Intron Intron polyadenylation enhancer Promoteur (  100 pb à 500

enhancer

Promoteur (100 pb à 500 pb)

Régions régulatrices
Régions
régulatrices

Région transcrite

Enhancer

enhancer: région

située à distance du promoteur (à plusieurs milliers de

paires de bases),

liant des facteurs trans, capable d'activer fortement

la transcription.

Facteurs de

transcription

Facteurs trans

TATA Exon
TATA
Exon

ATG

de base

ARN polymerase

Facteurs trans TATA Exon ATG de base ARN polymerase Exon E Intron Intron enhancer Promoteur (
Exon
Exon

E

Intron

Intron

TATA Exon ATG de base ARN polymerase Exon E Intron Intron enhancer Promoteur (  100

enhancer

Promoteur (100 pb à 500 pb)

Régions régulatrices
Régions
régulatrices
base ARN polymerase Exon E Intron Intron enhancer Promoteur (  100 pb à 500 pb)

Région tran

Promoteur d’un gène

promoteur: région

de contrôle située en 5', au voisinage immédiat, du site

d'initiation de la

transcription, sur une longueur de 100-500 paires de

base.

Facteurs de

transcription

Facteurs trans de base
Facteurs trans
de base
ARN polymerase II TATA ATG stop Exon Exon Exon Intron Intron
ARN polymerase II
TATA
ATG
stop
Exon
Exon
Exon
Intron
Intron
II TATA ATG stop Exon Exon Exon Intron Intron enhancer Promoteur (  100 pb à

enhancer

Promoteur (100 pb à 500

pb) Régions régulatrices
pb)
Régions
régulatrices
Exon Exon Exon Intron Intron enhancer Promoteur (  100 pb à 500 pb) Régions régulatrices

Région transcrit

Par analogie aux système procaryotes

Par analogie aux système procaryotes

Promoteur d’un gène

Vers 25 à 30 on retrouve la séquence TATA (TATA

box) ou « Goldberg-Hogness Box). C’est l’équivalent de la « Pribnow-box » des procaryotes (-10).

Rôle: interagir avec le complexe protéique TBP et la RNA

Poly II pour initier correctement la transcription.

• +1: site d’initiation de la transcription.

Structure des promoteurs d’un gène transcrit

par la Pol II

Pol II 13TAF II transactivateurs TBP Enhancer TATA
Pol II
13TAF II
transactivateurs
TBP
Enhancer
TATA

TBP (TATA binding protein) TAF (TBP associated factors)

En aval de +1

• Suit une partie non codante jusqu’au codon ATG

Suivent ensuite une alternance de séquence codantes

(exons) et non codantes (introns).

• Signal d’arrêt de la traduction est donné par un codon stop

Enfin 10 à 20 bases avant la fin de dernier exon on

retrouve une séquence AAUAAA dite de polyadénylation.

Anatomie d’un gène codant pour une protéine

Facteurs de

transcription Facteurs trans de base ARN polymerase II ATG stop TATA AATAA Exon Exon Exon
transcription
Facteurs trans
de base
ARN polymerase II
ATG
stop
TATA
AATAA
Exon
Exon
Exon
Signal de
Intron
Intron
polyadenylation
enhancer Promoteur (100 pb à 500 pb) Région transcrite Régions régulatrices
enhancer
Promoteur (100 pb à 500 pb)
Région transcrite
Régions régulatrices

source

1 2304

/organism="Homo sapiens" /mol_type="mRNA"

/db_xref="taxon:9606"

/chromosome="17"

/map="17q11.2"

gene

1 2304

/gene="MAP2K3"

CDS

338 1294

/gene="MAP2K3"

Séquence traduite (338 à 1294)

translation="MSKPPAPNPTPPRNLDSRTFITIGDRN

FEVEADDLVTISELGRG

AYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLL

MDLDINMRTVDCFYTVTFYGALF

REGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILG

EIAVSIVRALEHLHSKLSVIHR

DVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMD

AGCKPYMAPERINPELNQKGYNV

KSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVV

EEPSPQLPADRFSPEFVDFTAQC

LRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKE

ILGEDS"

gene="MAP2K3" CDS 338 1294

polyA signal

2275 2280

/gene="MAP2K3"

polyA_site 2299

/gene="MAP2K3"

Séquence mRNA MAPK

ORIGIN

1 tggctggcaa tggccttgct gacctcgagc cgggcccacg tggggacctt tggagcacag

61 cctacgatcc tggtgcaagg ccggtggatg cagaggccag tccatatacc acccaggcct

gcgaggagcg tggtccccac ccatccagcc catatgtgca agtgcccttg acagagaggc

catggtgacc atttatgggc cacaacaggt ccccatctgc gcagtgaacc

acgtgatctt gcttcgtcct gcagcactgt gcggggcagg

atcctgcatg tccaagccac ccgcacccaa

accattggag acagaaactt //1201 ggagctgatg gagcacccct tcttcacctt gcacaaaacc aagaagacgg

acattgctgc

121

181 tggtcatatc

241 ctgtgctgag caccttgcag

301 aaaatccaag aggaagaagg atctacggat

361 ccccacaccc ccccggaacc tggactcccg gaccttcatc

1261 cttcgtgaag gagatcctgg gagaagactc ataggggctg ggcctcggac cccactccgg

1321 ccctccagag ccccacagcc ccatctgcgg gggcagtgct cacccacacc ataagctact

1381

gccatcctgg cccagggcat ctgggaggaa ccgagggggc tgctcccacc tggctctgtg //1921 tcgtgttttt

tttaatttat cctctgttga ttttttcttt tgctttatgg gtttggcttg

tctcccccac cccctagggt accagcaggc

ggcccaagat ctctgctcag

caggggctat

ccatcccggg tcctttccct gatgggttgg ggcagttacc tggttgctgt tttaattaaa

aaaaaaggac taaa 2304

1981 tttttcttgc atggtttgga gctgatcgct

2041 agagccttgc cctctgctca ggctggggtc cagtgggagg

2101 agaagtgcag ggggagcctt ccagctcact ctccctgagg actggcttga

2161 gggtttgctt tggtgttgtt tttaaaaaaa gaaaatatat ttttttgaaa aaacgactgc

2221

2281 aaaaaaaaaa

6c. Terminaison de la transcription

Le

mécanisme

par

lequel

la

transcription se

termine

est

mal

caractérisé chez les eucaryotes. Chez

les

séquences

terminateurs ont été identifiées.

appelées

des

procaryotes,

par

contre,

géniques

6d. Maturation de l'ARN primaire

Le transcrit primaire est presque toujours plus long que le

messager retrouvé dans le cytosol.

• Passage de l’un à l’autre

dans le cytosol. • Passage de l’un à l’autre maturation du transcrit primaire (noyau) • Cette

maturation du transcrit primaire (noyau)

Cette maturation comporte 3 étapes:

– la fixation de la coiffe (cap) au niveau 5’

– La polyadénylation au niveau 3’

– Enfin l’excision des introns et l’épissage des exons.

Addition du ‘cap’ à l’extrémité 5’

* Addition de la coiffe à l'extrémité 5des ARNm

Immédiatement après le début de la transcription.

Liaison

pyrophosphate

5-5

entre

Guanine

et

le

premier nucléotide du transcrit Primaire.

7 methyl GTP+ N (ARNm) (ARNm)

du transcrit Primaire. • 7 methyl GTP+ N (ARNm) (ARNm) 7mGTP(5 ’ -5 ’)N coiffe •

7mGTP(5-5’)N

coiffe

La coiffe est requise pour la stabilité et la traduction de l'ARNm.

Addition du ‘cap’ à l’extrémité 5’

Pour ajouter la coiffe, un complexe multienzymatique exerce trois activités :

1. l'hydrolyse du phosphate nucléotide 5' terminal du

transcrit primaire

du

2. le transfert sur le phosphate ß restant d'un guanylate à partir d'un GTP

3. la méthylation de ce guanylate

sur l'azote n°7.

le phosphate ß restant d'un guanylate à partir d'un GTP 3. la méthylation de ce guanylate

Addition du ‘cap’ à l’extrémité 5’

7 methyl GTP+ N (ARNm)

5’)N (ARNm)

5’ • 7 methyl GTP+ N (ARNm) 5 ’)N (ARNm) 7mGTP(5 ’ - – Le mRNA

7mGTP(5-

Le mRNA n’aura plus un extrémité 5libre.

Cette cap protège l’ARNm de l’attaque par les enzymes.

Rôle lors de la traduction: fixation de ribosome.

Les rRNA et les tRNA n’ont pas de cap et ne sont pas

petite su du

la

traductible.

Addition de polyA à l’extrémité 3’

Polyadénylation de l'ARN:

Une fois synthétisés, les ARNm:

– 1: Clivage au niveau de la partie 3’, 20 bases en aval de la

séquence AATAAA.

2: La polyA polymérase reconnaît la séquence AAUAAA et ajoute la queue poly A (+/- 200).

La queue protège l'ARNm contre la dégradation par

les nucléases.

Enfin l’excision des introns et l’épissage des

exons

La précision du mécanisme d’excision-épissage

Excision = élimine toutes les séquences introniques du transcrit primaire.

Epissage des exons = assemblage précis des exons

• l’excision-épissage est une opération délicate et doit être parfaitement précise et fiable.

Importance de la jonction exon-intron et du

site de branchement

Séquences du mRNA impliquées dans le processus d’épissage.

Site donneur

Site de

branchement

Site accepteur

Exon 1 GU A AG Exon 2
Exon 1
GU
A
AG
Exon 2

L’épissage est un phénomène séquentiel

complexe.

3 éléments ou séquences jouent un rôle important :

– site donneur est en 5’ de l’intron = séquence consensus GU

– Site de branchement A (20 bases en amont de AG= extrémité 3’ de

l’intron).

– Site accepteur AG = extrémité 3’ de l’intron.

Nécessite un spliceosome: RNA U1-U6 et des protéines (catalyses le processus d’épissage)

Processus:

clivage de l'ARN en 5' de l'intron (site donneur ) et formation d’un lasso (site donneur GU et le site de branchement A)

Le 3’OH de l’exon libérée se trouve en face de l’exon suivant et se

produit alors soudure des 2 exons.

Grâce à une transéstérification les deux exons seront raccordés.

L’épissage aboutit à:

ARNm avec exons raccordés, intron libéré sous forme de lasso

Ces phénomènes ont lieu dans le noyau.

Dans la première étape, il y a formation d’un premier clivage en 5 ’ de

Dans la première étape, il y a formation d’un premier clivage en 5de l’intron. L’OH situé en 2du ribose appartenant à l’A du branchement vient se souder à l’extrémité 5-phosphate de l’intron. Il y a formation d’une liaison 5-2phosphodiester. Il y a constitution d’une boucle ou lasso (« lariat »). L’extrémité 3de l’exon situé en amont du clivage (exon 1) présente un OH (3’) libre:

Une seconde étape correspond au deuxième clivage en 3de l’intron.

Il y a simultanément: soudure des deux exons avec formation d’une liaison phosphodiester entre l’OH (3’) de l’exon 1 et le phosphate (5’) de l’exon aval (exon 2) et libération

du lasso qui sera ensuite dégradé.

de l’exon 1 et le phosphate (5 ’) de l’exon aval (exon 2) et libération du

Excission suivi d ’épissage des ARNm eucaryotes

• figs
figs

Acide ribonucléique

• L’ARN

A. ne présente ni structure secondaire ni tertiaire puisque la molécule est monocaténaire.

B. absorbe dans les UV à 260 nm

• C. est plus délicat à manipuler que l’ADN

• D. est très soluble dans l’eau pure

• E. contient les mêmes bases puriques que l’ADN

Les ARNm

A. ont une taille comprise entre 100 et 140 nts.

B. ont une durée de vie considérée comme courte

C. portent une polT leur conférant une stabilité

D. sous forme matures ont la même taille que le gène.

• On réalise une expérience d’hybridation moléculaire entre

un gène et son ARNm mature.

A. la molécule 1 (

• B. la molécule 2 (

C. les boucles A à P sont des exons

D. les boucles A à P sont des introns

E. la molécule 1 est plus longue que la 2.

) est le gènesont des exons • D. les boucles A à P sont des introns • E. la

) est l’ARNsont des exons • D. les boucles A à P sont des introns • E. la

7. SYNTHESE DES ARN RIBOSOMIAUX (ARNr) ET

DES ARN DE TRANSFERT (ARNt)

7a. ARNr

4 types d'ARNr: 28S, 18S, 5.8S et 5S

Les ARNr 28S, 18S et 5.8S sont codés par un même gène, transcrit par l'ARN polymérase I

Le promoteur est plus simple que celui des gènes codant pour des protéines: il ne comporte que deux régions régulatrices .

PS: L'ARNr 5S est codé par un autre gène, de structure similaire aux gènes codant les ARNt, et transcrit par l'ARN polymérase

III.

SLI SLI UBF UBF ARN polymerase I -180 -100 -30 +20
SLI
SLI
UBF
UBF
ARN polymerase I
-180
-100
-30
+20

ARN précurseur

ARN r

18S

5.8S

28S

18S 5.8S 28S
18S
5.8S
28S

1800 b

160 b

4700 b

7. SYNTHESE DES ARN RIBOSOMIAUX (ARNr) ET DES ARN DE TRANSFERT (ARNt)

Les ARNr représente 80-90% de l'ARN total.

ils entrent dans la composition des ribosomes.

Il y a 100-200 copies identiques des gènes codant les ARNr .

ARNr: Les ARN ribosomaux sont les constituant principaux des ribosomes, lieu de synthèse des protéines.

7b. ARNt

La structure en feuille de trèfle possède 4 bras principaux

en fonction de leur structure ou fonction:

Le bras accepteur: tige de bases appariées qui se termine par une séquence dont le groupement 2’ ou 3’ –OH peut former une liaison avec une acide aminé.

Le bras TyA: présence de ce triplet dans la séquence

Y: base pseudouridine =base modifiée).

Le bras de l’anticodon: contient tjs le triplet de l’anticodon au milieu de sa boucle.

Le bras D: il contient la dihydrouridine (base modifiée).

7b. ARNt

Le bras accepteur

Le bras TyA

• Le bras de l’anticodon

Le bras D

7b. ARNt • Le bras accepteur • Le bras T y A • Le bras de

7b. ARNt

Association entre un acide aminé et son ARNt

correspondant

Un ARNt a la double propriété de reconnaître à la fois l’acide aminé et le codon (adaptateur).

– L’adénosine en 3est liée d’une manière covalente avec l’acide aminé.

Les bases de l’anticodon s’apparient avec celles du codon

situé sur l’ARNm

7. SYNTHESE DES ARN RIBOSOMIAUX (ARNr) ET DES ARN DE TRANSFERT (ARNt)

* Gènes codant les ARNt et l'ARNr 5S: ils

possèdent un promoteur situé dans la région codante. La transcription est catalysée par l'ARN polymérase III.

* Rôle des ARNt: ils véhiculent les acides aminés jusqu'au ribosome où se déroule la

synthèse des protéines.

8. Le code génétique et la traduction

8. Le code génétique et la traduction

Code génétique

Le « langage » nucléique s'écrit avec 4 lettres.

Le « langage » protéine s'écrit avec 20 termes

correspondant aux 20 acides aminés.

Si une lettre nucléique se traduisait par un acide aminé, il ne pourrait y avoir que 4 acides aminés.

En groupant les lettres nucléiques en « mots » de 2 lettres on pourrait avoir 16 mots, mais cela ne permettrait de coder que 16 acides aminés.

En groupant les lettres nucléiques en « mots » de 3 lettres on peut avoir 64 mots, ce qui permet d'exprimer les 20 acides aminés.

Le code génétique est donc fondé sur des

mots de trois lettres : les codons.

d'exprimer les 20 acides aminés. • Le code génétique est donc fondé sur des mots de

Les caractéristiques du code:

1. universel: le code est valable pour tous les organismes

(animaux, plantes, bactéries, virus

).

exceptions:(i) trypanosomes, levures; (ii) ADN mitochondrial:

p.ex. AUA = Met dans mitochondrie, au lieu de Ile.

 

2. dégénéré:

(i)

un

ac.

aminé

peut

être

codé

par

plusieurs codons (cfr tableau);

 

(ii) "wobble" : un même ARNt peut s’associer à deux codons différents mais définissant le même acide aminé. Cette flexibilité qui concerne la troisième base du codon (première de l’anticodon) est appelée wobble

3. non chevauchant: les codons sont lus sans chauvechement

Traduction de l'ARNm

Les éléments nécessaires

Le ribosome est le site d’accueil: il reçoit

ARNm: L'ARNm véhicule l'information génétique, du lieu de

stockage (hélice d'ADN) vers le lieu d'expression, où il sert de

matrice à la synthèse du polypeptide.

ARNt: Les ARN de transfert (ARNt) font le lien entre nucléotides et acides aminés. Ils sont chargés de collecter les acides aminés présents dans le cytoplasme et de les transporter jusqu'au ribosome où s'effectue la synthèse du polypeptide.

Acides aminés:

Sont les « briques » d’une chaîne peptidique.

Un groupement amine (NH 2 )

Un groupement acide

(COOH)

Une portion variable d'un acide aminé à l'autre (indiqué par la lettre R sur la molécule ci

(COOH) • Une portion variable d'un acide aminé à l'autre (indiqué par la lettre R sur

La liaison peptidique

La liaison peptidique Les acides aminés peuvent se lier les uns aux autres par une liaison

Les acides aminés peuvent se lier les uns aux autres par une liaison peptidique. La liaison peptidique se fait entre le groupement acide (COOH) d'un acide aminé et le groupement amine (NH 2 ) de l'autre. Au cours de la réaction, une molécule d'eau est

L'union éliminée de plusieurs acides aminés forme un polypeptide. Les protéines sont donc des polypeptides.

Exemple d’une chaîne peptidique

Exemple d’une chaîne peptidique

tRNA

•L’enchaînement des aa se fait selon un ordre dicté par l’ARNm

•L’assemblage ne se fait pas directement sur l’ARNm mais nécessite un adaptateur = rôle de l’ARNt (entre le mRNA et l’aa), en effet:

le tRNA (par son extrém 3’ACC) est lié à l’aa d’un côté et au mRNA (par son anticodon) de l’autre côté.

le tRNA (par son extrém 3’ACC) est lié à l’aa d’un côté et au mRNA (par

Lieu de la traduction

La traduction a lieu dans le cytoplasme, sur le ribosome. Le ribosome est une particule constituée de 2 sous-unités:

Sous-unité 60S :

Sous-unité 40S :

45 protéines

ARNr 5S, 5.8S et 28S 33 protéines

ARNr 18S

Chaque sous-unité ribosomale joue un rôle spécifique dans la

synthèse protéique et leur interaction donne une certaine

flexibilité au ribososme

Les étapes de la traduction

La synthèse protéique se divise en 3 étapes:

• L’initiation: réactions qui précédent la formation de la liaison peptidique entre les deux premiers aa. Il nécessite la fixation du ribosome à l’ARNm

• L’élongation: comprend toutes les réactions entre la synthèse de la

première liaison peptidique et l’addition du dernier aa

La terminaison: englobe les réactions nécessaires pour libérer la chaîne polypeptidique complète; en même temps, le ribosome se dissocie de l’ARNm.

Exemple d’une chaîne peptidique

Exemple d’une chaîne peptidique

Devenir des protéines néosynthétisés

• Acquisition d’une structure tri-dimentionnelle

(repliement correcte adapté à la fonction)

Le routage (adressage) des protéines

(localisation cellulaire: membrane, sécrétion, noyau etc)

Les modifications post-traductionnelles

(clivages, ponts disulfure, hydroxylations, lipides, phosphorylation, glycosylation,

Dégradation

9. MODIFICATIONS POST-

TRADUCTIONNELLES

9a. Clivage de la chaîne peptidique

* Elimination de la méthionine initiatrice

* Elimination du peptide signal

* Clivage d'un précurseur

9b. Formation de ponts disulfures

9c. phosphorylation

9d.

hydroxylation

de

proline;

9e.

methylation

de

l'arginine

9f. Addition de lipides; 9g. glycosylation

La séparation des deux brins pose des

problèmes topologiques

La double hélice n’est pas libre mais sous forme de

nucléosomes. (réplication ou transcription= dérouler)

La forme topologique native du DNA: superenroulée.

Les enzymes topoisomérases assurent les changements de forme topologique

* Topoisomères - topoisomérase

Deux molécules d'ADN de séquence

nucléotidique identique peuvent différer par leur degré de sur enroulement (indépendamment des nucléosomes).

Le degré de sur enroulement est contrôlé par des

protéines regroupées sous le terme de "topo isomérases".

le sur enroulement: est positif ou négatif (= dés

enroulement).

Le sur enroulement a pour conséquence une compaction plus grande de l'ADN

le sur enroulement

• le sur enroulement est positif ou négatif (= dés enroulement). • Le sur enroulement a

est positif ou négatif (= dés enroulement).

Le sur enroulement a pour conséquence

une compaction plus

grande de l'ADN