Vous êtes sur la page 1sur 380

MIEUX LGIFRER, MIEUX VALUER :

15 PROPOSITIONS POUR
AMLIORER LA FABRIQUE DE LA LOI

RAPPORT DINFORMATION DPOS

PAR LA MISSION DE LA CONFRENCE DES PRSIDENTS

sur la simplification lgislative

ET PRSENT PAR

M. RGIS JUANICO,
Dput
____

Version du 2 octobre 2014 17:43

/D PLVVLRQ GLQIRUPDWLRQ VXU la simplification lgislative est compose


de : Mme Laure de La Raudire, prsidente ; M. Rgis Juanico, rapporteur ;
MM. tienne Blanc, Marc Dolez, Daniel Fasquelle, Hugues Fourage et Philippe
Gosselin, Mme Estelle Grelier, Mme Marietta Karamanli, MM. Pierre-Yves Le
%RUJQ 3LHUUH 0RUHO-A-/+XLVVLHU )UDQoRLV GH 5XJ\ et Alain Tourret,
Mme Ccile Untermaier et M. Michel Zumkeller.

SOMMAIRE

___
Pages

INTRODUCTION ...........................................................................................................

11

PREMIRE PARTIE : MIEUX PRPARER LA NORME EN AMONT


DE LA PROCDURE LGISLATIVE ....................................................................

15

, 5(1'5( /e9$/8$7,ON EX ANTE DE LA NORME PLUS


INDPENDANTE ..........................................................................................................

17

$ /e/$%25$7,21 '(6 e78'(6 ',03$&7 EN FRANCE : UN


PROCESSUS PUREMENT INTERNE AUX ADMINISTRATIONS
PRODUCTRICES DE TEXTES. ...........................................................................

18

 /REOLJDWLRQ FRQVWLWXWLRQQHOOH GDVVRUWLU GH QRPEUHX[ SURMHWV GH ORL GXQH
pWXGHGLPSDFWHVWUpFHQWH .....................................................................................

18

D$YDQWODUpIRUPHFRQVWLWXWLRQQHOOHGXMXLOOHWOpODERUDWLRQGXQHpWXGH
GLPSDFWQpWDLWTXXQHIDFXOWpDXUHJDUGGHVH[LJHQFHVGHOD&RQVWLWXWLRQ .........

18

i. Le rapport de la mission conduite par M. Jean Picq sur les responsabilits et


ORUJDQLVDWLRQGHOeWDW .......................................................................................

18

ii. Les circulaires du Premier ministre des 21 novembre 1995 et 26 janvier 1998 .............

19

E'HSXLVODUpIRUPHFRQVWLWXWLRQQHOOHGXMXLOOHWOpODERUDWLRQGXQHpWXGH
GLPSDFWHVWXQHREOLJDWLRQFRQVWLWXWLRQQHOOHGRQWOHQRQ-UHVSHFWQDFHSHQGDQW
pas encore t sanctionn par le Conseil constitutionnel. .....................................

21

i. La Constitution et la loi organique du 15 avril 2009 contraignent le Gouvernement


DVVRUWLUGHQRPEUHX[SURMHWVGHORLGXQHpWXGHGLPSDFW .......................................

22

LL /D &RQIpUHQFH GHV SUpVLGHQWV GH O$VVHPEOpH QDWLRQDOH QD MDPDLV XVp GH OD
SRVVLELOLWp TXL OXL HVW UHFRQQXH GH VRSSRVHU j OLQVFULSWLRQ j ORUGUH GX MRXU GH
O$VVHPEOpH QDWLRQDOH GXQ SURMHW GHORL GRQW OpWXGHGLPSDFW SUpVHQWHGHJUDYHV
insuffisances. ....................................................................................................

25

/DFXOWXUHGHOpYDOXDWLRQGHOLPSDFW commence se dvelopper au sein des


administrations. ......................................................................................................

30

D/DPpWKRGRORJLHGpODERUDWLRQGHVpWXGHVGLPSDFWHVWGpWDLOOpHGDQVOHJXLGH
de lgistique tabli par le secrtariat gnral du Gouvernement ...........................

30

E 8Q PDQXHO GDLGH DX FDOFXO GH OLPSDFW ILQDQFLHU GH OD UpJOHPHQWDWLRQ D pWp
tabli par le secrtariat gnral du Gouvernement ...............................................

32

i. Description du modle des cots standards ( standard cost model ) ..........................

33

6
ii. Description du modle OSCAR ........................................................................

36

c. Les consultations facultatives et obligatoires sont largement pratiques. ...............

38

 /pYDOXDWLRQ ex ante GH OLPSDFW GHV QRUPHV HVW HQFRUH LQpJDOH HW
structurellement oriente. .......................................................................................

40

a. De nombreuses critiques pointent la partialit et les insuffisances des tudes


GLPSDFW ............................................................................................................

40

b. Des tudes dont le Parlement se saisit encore trop peu .........................................

44

c. Des tudes dont le contenu pourrait tre enrichi ...................................................

45

i. Rendre obligatoire, pour les textes lgislatifs, la ralisation de tests entreprises,


FROOHFWLYLWpVORFDOHVHWXVDJHUVGHODGPLQLVWUDWLon ...............................................

46

LL $PpOLRUHU OpYDOXDWLRQ GHV FRWV HW EpQpILFHV pFRQRPLTXHV DLQVL TXH GHV
consquences socitales des mesures envisages....................................................

47

iii. Fournir une analyse et une justification approfondies des mesures transitoires et des
GDWHVGHQWUpHHQYLJXHXUUHWHQXHV .......................................................................

48

LY ,QWpJUHU OH[LJHQFH GH TXDQWLILFDWLRQ GHV FKDUJHV DGPLQLVWUDWLYHV VXSSULPpHV HQ
contrepartie et hauteur des charges administratives cres ( one-in, one-out )
DXMRXUGKXLFLUFRQVFULWHDX[WH[WHVUpJOHPHQWDLUHV .................................................

49

Y0LHX[LGHQWLILHUOHVFULWqUHVVXUOHVTXHOVVHIRQGHUDOpYDOXDWLRQex post des mesures ....

51

% /e/$%25$7,21'(6 e78'(6 ',03$&7 CHEZ CERTAINS DE NOS


VOISINS : UN PROCESSUS PLAC SOUS LE CON75/( '81
ORGANISME CONSULTATIF EXTERNE ET INDPENDANT ......................

52

$OOHUSOXVORLQTXHOHPRGqOHHXURSpHQGHO Impact Assessment Board qui


GLVWLQJXHORUJDQHFKDUJpGHOpODERUDWLRQGHOpWXGHGLPSDFWGHFHOXLFKDUJp
GHOpYDOXDWLRQGHVDTXDOLWpVDQVUecueillir un point de vue extrieur celui de
ODGPLQLVWUDWLRQ .....................................................................................................

53

D/D&RPPLVVLRQHXURSpHQQHHWOH3DUOHPHQWHXURSpHQVHIIRUFHQWGREMHFWLYHUOH
SURFHVVXVGHSURGXFWLRQGHVpWXGHVGLPSDFW ...................................................

53

L/HFRPLWpGDQDO\VHGLPSDFWGHOD&RPPLVVLRQHXURSpHQQH .....................................

53

LL/XQLWpGpYDOXDWLRQex ante GHOLPSDFWGX3DUOHPHQWHXURSpHn ................................

55

EPDLVFHOXL-ci reste interne aux services des institutions europennes. ...............

56

6LQVSLUHUGHVPRGqOHVEULWDQQLTXHHWDOOHPDQGTXLFRQILHQWjGHVSHUVRQQDOLWpV
H[WpULHXUHVjODGPLQLVWUDWLRQOHVRLQGHVHSURQRQFHUVXUODTXDOLWpGHOpWXGH
GLPSDFW.................................................................................................................

57

a. Le comit britannique de la politique de la rglementation ( RPC ) ...................

57

i. Cration et composition.........................................................................................

57

ii. Rle du RPC GDQVOHSURFHVVXVEULWDQQLTXHGpODERUDWLRQGHVpWXGHVGLPSDFW .......

58

b. Le conseil allemand de contrle des normes .........................................................

63

i. Cration et composition.........................................................................................

63

ii. Rle du NKR GDQVOHSURFHVVXVDOOHPDQGGpODERUDWLRQGHVpWXGHVGLPSDFW ..........

64

PISTES POUR UN NOUVEAU CADRE INSTITUTIONNEL


'e/$%25$7,21 '(6 e7UDES ',03$&7 0,(8;  0ME DE
GARANTIR LEUR QUALIT. ................................................................................

69

C.

1. Confrer une autorit de contrexpertise un ancrage organique et lgislatif, sur


les modles belge et allemand ................................................................................

71

2. Clarifier en consquence la rpartition des tches entre l'autorit de


contrexpertiseGXQHSDUWHWGDXWUHSDUWOHFRQVHLOGHODVLPSOLILFDWLRQpour
OHVHQWUHSULVHV HW OHFRQVHLOQDWLRQDO GpYDOXDWLRQGHVQRUPHVDSSOLFDEOHV DX[
collectivits territoriales .........................................................................................

72

,, 5(1'5( /e9$/8$7ION EX ANTE DE LA NORME PLUS


SYSTMATIQUE ..........................................................................................................

77

A. LE CARACTRE FACU/7$7,) '(6 e78'(6 'IMPACT POUR LES


PROPOSITIONS DE LOI ET POUR LES ORDONNANCES...........................

77

/DUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVSURSRVLWLRQVGHORLQHVWSDVXQH
REOLJDWLRQ............................................................................................................

77

D /HV SURSRVLWLRQV GH ORL QRQW SDV j rWUH DVVRUWLHV GpWXGHV GLPSDFW PDLV
SHXYHQWrWUHVRXPLVHVSRXUDYLVDX&RQVHLOGeWDW ............................................

77

E8QH[HPSOHGHSURSRVLWLRQGHORLDGRSWpHjODVXLWHGXQHpYDOXDWLRQ ..................

79

/DUpDOLVDWLRQGXQHpWXGHGLPSDFWHVWpJDOHPHQWXQHIDFXOWpSRXUODPDMRULWp
des ordonnances. ....................................................................................................

80

D 6L OHV SURMHWV GH ORL GKDELOLWDWLRQ j SUHQGUH GHV PHVXUHV OpJLVODWLYHV SDU
orGRQQDQFHGRLYHQWrWUHDVVRUWLVGXQHpWXGHGLPSDFWDXFRQWHQXDOOpJp .........

80

E  OHV RUGRQQDQFHV HOOHV-mmes ne sont soumises aucune obligation


GpYDOXDWLRQGH OHXULPSDFWORUVTXHOOHVQHFRQFHUQHQWQLOHVHQWUHSULVHVQLOHV
collectivits territoriales. .....................................................................................

81

B. TENDRE AUX PROPOSITIONS DE LOI ET AUX ORDONNANCES


/2%/,*$7,21 'e9$/8$7,21 '( /,03$&7 $8-285'+8,
CANTONNE AUX PROJETS DE LOI ET CERTAINS PROJETS
'$&7(65e*/(0(17$,5ES. ...........................................................................

82

5HQGUHREOLJDWRLUHODUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVSURSRVLWLRQVGH
loi............................................................................................................................

82

5HQGUHREOLJDWRLUHODUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVRUGRQQDQFHV .......

84

& $0e/,25(5 /e9$/8ATION EX ANTE '( /,03$&7 (1


DVELOPPANT LE RECOU56/(;3e5,0(17$7,ON.............................

85

DEUXIME PARTIE : MIEUX LABORER LA NORME AU COURS


DE LA PROCDURE LGISLATIVE ....................................................................

88

, 'e9(/233(5 /e9$/8$7,21 '( /,03$&7 $U COURS DE LA


PROCDURE LGISLATIVE ....................................................................................

88

A. EN AMONT DES DBATS PARLEMENTAIRES, RENDRE PUBLIQUE


/$ 3$57,( '( /$9,6 '8 &216(,/ 'e7$7 68R LES TUDES
',03$&7$66257,66$1T LES TEXTES DE LOI. ........................................

88

8QHFRQILGHQWLDOLWpSUHVTXXQDQLPHPHQWFULWLTXpH ................................................

89

2. Une ncessaire publicit .........................................................................................

90

LORS DES DBATS PARLEMENTAIRES, RENFORCER LE


CONTRLE DU PARLEMENT SUR LA QUALIT DES TUDES
',03$&7 .................................................................................................................

91

B.

& e7(1'5( /2%/,*$7,21 'e9$/8$7,21 '( /,03$&7 $8;


AMENDEMENTS SUBSTANTIELS ...............................................................

95

/DUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVDPHQGHPHQWVHVWXne facult qui


QDMDPDLVpWpH[HUFpH ...........................................................................................

95

D /H 5qJOHPHQW GH O$VVHPEOpH QDWLRQDOH SHUPHW DX FRPLWp GpYDOXDWLRQ HW GH
FRQWU{OHGHUpDOLVHUOpYDOXDWLRQSUpDODEOHGHFHUWDLQVDPHQGHPHQWV ...................

95

b. Aucune saisine du CEC dans le cadre des articles 98-1 et 146-6 du Rglement
GHO$VVHPEOpHQDWLRQDOH ....................................................................................

96

2. De bonnes pratiques ont pourtant t adoptes au niveau europen en matire


GpYDOXDWLRQGHOLPSDFWGHVDPHQGHPHQWV ..........................................................

99

a. Les pratiques du Parlement europen ...................................................................

99

b. Les pratiques des Parlements allemand et nerlandais .......................................... 101

3. Adapter les exemples trangers la procdure lgislative franaise ...................... 103


II. AMNAGER LA PROCDURE LGISLATIVE POUR CONSOLIDER LA
QUALIT DE LA NORME........................................................................................... 105
A. MIEUX ENCADRER LA DISCUSSION DES TEXTES ET DES
AMENDEMENTS. ................................................................................................... 105
1. Appliquer un dlai de dpt aux amendements du Gouvernement ........................ 105
 0RGLILHU OD SURFpGXUH DFFpOpUpH SRXU SUpVHUYHU XQ WHPSV PLQLPDO GH[DPHQ
parlementaire .......................................................................................................... 108
3. 5HSHQVHU ORUJDQLVDWLRQ GHV GpEDWV EXGJpWDLUHV HQ OHV UHFHQWUDQW VXU OD ORL GH
rglement. ............................................................................................................... 110
B. ADOPTER UNE MTHODE DE TRANSPOSITION DES DIRECTIVES
EUROPENNES SUSCEPTIBLE DE LIMITER LES RISQUES DE
SURTRANSPOSITIONS INUTILES. ............................................................. 112
1. La propension franaise transposer au-del de ce qui est utile et ncessaire. ...... 113
2. La mthode de la transposition en deux temps (ou double corbeille )............... 116
3. Pistes pour amliorer le processus de transposition des directives. ........................ 118
D 3ODFHU OpWXGH GLPSDFW DX FXU GHV QpJRFLDWLRQV GHV WH[WHV HXURSpHQs et en
analyser les implications au niveau national ........................................................ 118
b. Mieux identifier les ventuelles surtranspositions................................................. 122

TROISIME PARTIE : MIEUX VALUER LA NORME EN AVAL DE


SON ADOPTION ........................................................................................................... 125
I. CLARIFIER LE PAYS$*( '( /e9$/8$7,21 DES POLITIQUES
PUBLIQUES .................................................................................................................. 125
A.

UNE VALUATION A POSTERIORI ABONDANTE MAIS PAS


TOUJOURS ORGANISE..................................................................................... 125
1. Ce que fait le Parlement .......................................................................................... 126
D/HVUDSSRUWVGDSSOLFDWLRQGHVORLVDGRSWpHV ......................................................... 126
E /HV FRPPLVVLRQV GHQTXrWH PLVVLRQV GLQIRUPDWLRQ GHV FRPPLVVLRQV
SHUPDQHQWHVHWPLVVLRQVGLQIRUPDWLRQGHOD&RQIpUHQFHGHV3UpVLGHQWV .............. 127

c.

/RIILFH SDUOHPHQWDLUH GpYDOXDWLRQ GHV FKRL[ VFLHQWLILTXHV HW


technologiques (OPECST) et les diverses dlgations parlementaires ................. 127

G/DPLVVLRQGpYDOXDWLRQHWGHFRQWU{OH 0(& ..................................................... 128


H /D PLVVLRQ GpYDOXDWLRQ HW GH FRQWU{OH GHV lois de financement de la scurit
sociale (MECSS) ................................................................................................ 129
I/HFRPLWpGpYDOXDWLRQHWGHFRQWU{OH des politiques publiques (CEC) .................. 129
J/DFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLV .................... 130

2. Ce que font les juridictions ..................................................................................... 132


a. Les rapports de la Cour de cassation..................................................................... 132
E/HVUDSSRUWVGX&RQVHLOGeWDW ............................................................................. 132

3. Ce que fait la Cour des comptes ............................................................................. 133


4. Ce que fait le Conseil conomique, social et environnemental .............................. 134
&HTXHIRQWOHVVHUYLFHVHWOHVFRUSVGLQVSHFWLRQGHOH[pFXWLI .............................. 135
D/HVFRUSVGLQVSHFWLRQ ......................................................................................... 135
b. Le commissariat gnral la stratgie et la prospective ..................................... 137
c. Le secrtariat gnral pour ODPRGHUQLVDWLRQGHODFWLRQSXEOLTXH ......................... 137

B. UNE VALUATION QUI GAGNERAIT TRE MIEUX COORDONNE. .... 138


,,5(1'5(/e9$/8$7ION EX POST DE LA NORME PLUS MTHODIQUE .. 140
$ 'e9(/233(5 /,16(RTION DE CLAUSES DE RVISION DANS
CERTAINS TYPES DE LOI. .................................................................................. 140
1. La pratique franaise des clauses de rvision ......................................................... 141
2. Les pratiques britannique et allemande des clauses de rvision ............................. 141
a. Les clauses de rvision et de caducit au Royaume-Uni ....................................... 141
b. Les clauses de rvision en Allemagne .................................................................. 142

B. ADOPTER UNE PRATIQUE TENDANT SYSTMATISER LA


JUSTIFICATION DES RETARDS EN MATIRE DE PUBLICATION DES
'e&5(76'$33/,&$7,2N. ................................................................................ 143
'HQHWVHIIRUWV ..................................................................................................... 143
TXLPpULWHQWGrWUHSRXUVXLYLV ........................................................................... 145
C. MIEUX ORDONNER LES M,66,216'e9$/8$7,21 DU PARLEMENT ... 149

CONCLUSION ................................................................................................................ 152


EXAMEN DU RAPPORT EN MISSION ................................................................ 153
SYNTHSE DES PROPOSITIONS ........................................................................ 155
CONTRIBUTIONS ........................................................................................................ 159
ANNEXES ........................................................................................................................ 161

11

MESDAMES, MESSIEURS,
Sous la XIIIe lgislature, 266 textes de loi ( VL ORQ FRPSWH FHX[ TXL
autoriseQWODUDWLILFDWLRQGXQWUDLWpRXODSSUREDWLRQGXQDFFRUGLQWHUQDWLRQDO RQW
t dfinitivement adopts. Sous la prsente lgislature, le Parlement a
dfinitivement adopt 122 textes de loi (198 avec ceux autorisant la ratification
GXQWUDLWpRXODSSUREDWLRQGXQDFFRUGLQWHUQDWLRQDO) entre le 26 juin 2012 et le
31 aot 2014.
On ne compte plus les rapports qui, depuis plus de vingt ans, dnoncent
cette inflation normative ( 1 ). Pourtant, PDOJUp OpODERUDWLRQ GXQ droit de la
QRUPH FHVW--GLUH XQ GURLW SRUWDQW VXU ODUW GH OpJLIpUHU >@ dans le but de
rguler le flux normatif >@ RQ GpSORUH WRXMRXUV OLPSRUWDQFH GH OLQVpFXULWp
juridique (2).
Nos concitoyens ne supportent plus une inflation normative qui, en plus de
GpYDORULVHU ODFWH GH OpJLIpUHU HQ IDLVDQW SHUGUH j OD ORL VRQ FDUDFWqUH VDFUp les
touffe au quotidien. Notre conomie ne peut davantage VH VDWLVIDLUH GXQ GURLW
complexe, illisible et instable qui entrave son dploiement (3).

(1) 9RWUHUDSSRUWHXUQHQFLWHUDTXHTXHOTXHV-uns :
- &RQVHLOGeWDW5apport public 1991, De la scurit juridique ;
- &RQVHLOGeWDW5DSSRUWSXEOLF Scurit juridique et complexit du droit ;
- OCDE, Mieux lgifrer en Europe : France , 2010 ;
- 5DSSRUWGLQIRUPDWLRQQ 317 (session 2010-2011) sur les normes applicables aux collectivits territoriales,
fait au nom de la dlgation aux collectivits territoriales et la dcentralisation, par le snateur
Claude Belot ;
- 5DSSRUW GH OD PLVVLRQ GH OXWWH FRQWUH OLQIODWLRQ QRUPDWLYH pWDEOL SDU 00 Alain Lambert et Jean-Claude
Boulard, et remis au Premier ministre le 26 mars 2013.
(2) Audition de M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II Panthon-Assas, membre
du Club des juristes, le 10 avril 2014. Voir le compte-rendu en annexe n 16.
(3) Selon le rapport sur la comptitivit mondiale 2013-2014 tablie par le Forum conomique mondial, le
poids des normes lgislatives et rglementaires place la France au 130e rang, parmi les 148 pays tudis
(World Economic Forum, Global Competitiveness Report 2013-2014, 2013, p. 187). Selon une tude mene
HQ  SDU OD FKDPEUH GH FRPPHUFH HW GLQGXVWULH GH 3DULV &&,3   % des entrepreneurs consults
FRQVLGpUDLHQWTXHOLPSDFWGHODUpJOHPHQWDWLRQQDWLRQDOHHQYLJXHXUVXUOHXUDFWLYLWppWDLWQpJDWLIWDQGLV
que seuls 14 GHQWUHHX[OHMXJHDLHQWSRVLWLI. 'DQVORUGUHGHFHTXLOHXUVHPEODLWDORUVSULRULWDLUHSRXU
XQHVLPSOLILFDWLRQOHVFKHIVGHQWUHSULVHFLWDLHQWSOXVSDUWLFXOLqUHPHQWOHGURLWGXWUDYDLOHWGHODSURWHFWLRQ
sociale (80 %), la fiscalit (58 %), OHV GLVSRVLWLIV GDLGHV SXEOLTXHV DX[ HQWUHSULVHV  %), le droit des
marchs publics (34 %), le droit pnal (14   OH GURLW GH OHQYLURQQHPHQW ) et le droit commercial
(10 %) (M. Laurent, 6LPSOLILHU OHQYLURQQHPHQW UpJOHPHQWDLUH GHV HQWUHSULVHV : une urgence pour la
croissance franaise , CCIP, 17 mars 2011, p. 89).
(Q  OH &RQVHLO GeWDW VRXOLJQDLW GpMj TXH OH[FHOOHQFH GHV LQIUDVWUXFWXUHV GH WUDQVSRUW GH
FRPPXQLFDWLRQHWGpQHUJLHDLQVLTXHOHIRUWSRWHQWLHOVFLHQWLILTXHHWWHFKQLTXHGH la France, reconnus par
O2&'( HW SDU OD %DQTXH PRQGLDOH QH SHXYHQW IDLUH RXEOLHU TXH QRPEUH GHQWUHSULVHV FDQGLGDWHV j XQH
implantation en France sont parfois dcourages par la lourdeur des procdures administratives et surtout
SDUOLQVWDELOLWp GXGURLt. >@ Le cot de la complexit des normes et des procdures est valu, pour les
SD\VGHO2&'(j XQH VRPPH UHSUpVHQWDQW HQHQWUHWURLVHWTXDWUHSRLQWVGH3,%VHORQOHVSD\V

12

/DFWXHOOHPDMRULWpODELHQFRPSULVHOOHTXLGHSXLVGHX[DQVDHQJDJp
DX QLYHDX GH OH[pFXWLI XQH vaste entreprise de rduction du stock normatif.
Dans le cadre du choc de simplification annonc par le Prsident de la
5pSXEOLTXHOHPDLOH*RXYHUQHPHQWDpWpjOLQLWLDWLYHGHcinq textes de
simplification (1).
200 mesures de simplification VXVFHSWLEOHV GDYRLU XQ impact sur la vie
quotidienne des Franais, ont t dcides lors du comit interministriel pour la
PRGHUQLVDWLRQ GH ODFWLRQ SXEOLTXH (CI M AP) du 17 juillet 2013. Trois autres
CIMAP (des 18 dcembre 2012, 2 avril 2013 et 18 dcembre 2013) ont
FRQGXLWjODGRSWLRQ des principes :
GH VXSSUHVVLRQ GXQH QRUPH UpJOHPHQWDLUH SRXU WRXWH FUpDWLRQ GXQH
nouvelle norme de la mme nature (principe inspir de la pratique britannique du
one-in, one-out , dsormais one-in, two-out ) ;
de transposition a minima des directives europennes ;
de rduction des nombreuses donnes comptables ou sociales
DXMRXUGKXLGHPDQGpHVDX[HQWUHSULVHV programme Dites-le nous une fois ,
inspir du dispositif britannique Say once  TXL SHUPHWWUD j OKRUL]RQ 
TXXQHHQWUHSULVHQDLWTXXQLGHQWLILDQWjIRXUQLUSOXW{WTXHGHPXOWLSOHVGRQQpHV
GLGHQWLILFDWLRQ 
$ILQGLPSXOVHUHWGDQLPHUOHFKDQWLHUGHODVLPSOLILFDWLRQXQconseil de
la simplification pour les entreprises, coprsid par notre collgue Laurent
Grandguillaume et par M. Guillaume Poitrinal, FKHIGHQWUHSULVH, ancien prsident
GX GLUHFWRLUH G8QLEDLO 5RGDPFR a t cr en janvier 2014 (2). Plac auprs du
Premier ministre pour une dure de trois ans, ce conseil est charg de proposer au
Gouvernement les orientations stratgiques de la politique de simplification
Ogard des entreprises. ce titre, il a annonc, le 14 avril dernier, la mise en
XYUHGHpremires mesures de simplification, parmi lesquelles la conscration
GXQ SULQFLSH GH QRQ-rtroactivit de la loi fiscale pour les entreprises, le
dploiement de la dclaration sociale nominative (DSN) ou encore le
(&RQVHLOGeWDWRapport public annuel 2006 : Scurit juridique et complexit du droit, La Documentation
franaise, p. 277).
(1) ,OVDJLWGHVORLV :
- n 2013-569 du 1er juillet 2013 habilitant le Gouvernement adopter des mesures de nature lgislative pour
acclrer les projets de construction ;
- n 2013-1005 du 12 novembre 2013 habilitant le Gouvernement simplifier les relations entre
ODGPLQLVWUDWLRQHWOHVFLWR\HQV ;
- n 2014-1 du 2 janvier 2014 habilitant le Gouvernement simplifier et scuriser la vie des entreprises.
ces textes dfinitivement adopts et pURPXOJXpVLOIDXWDMRXWHUOHVSURMHWVGHORLHQFRXUVGH[DPHQUHODWLIV
- la modernisation et la simplification du droit et des procdures dans les domaines de la justice et des
affaires intrieures ;
- la simplification de la vie des entreprises.
(2) Dcret n 2014-11 du 8 janvier 2014 instituant le conseil de la simplification pour les entreprises. La
composition de ce conseil a t fixe par arrts du Premier ministre en dates des 20 janvier et
28 fvrier 2014.

13

dveloppement du rescrit. Parmi ces 50 mesures, la plupart de celles qui ont une
nature lgislative ont t inscrites dans le projet de loi relatif la simplification de
la vie des entreprises, examin en premire lecture en juillet dernier par notre
Assemble.
6LJQH IRUW GH OLQYHVWLVVHPHQW GX *RXYHUQHPHQW VXU OHV TXHVWLRQV GH
simplification, M. Thierry Mandon, ancien rapporteur de la mission, a t nomm
OH  MXLQ GHUQLHU VHFUpWDLUH GeWDW DXSUqV GX 3UHPLHU PLQLVWUH FKDUJp GH OD
simplification. Ce dernier a annonc, lors de OH[DPHQGXSURMHWGHORLUHODWLIjOD
simplification de la vie des entreprises, que le Conseil de la simplification pour les
entreprises DYDLWOLQWHQWLRQ de proposer tous les six mois environ une cinquantaine
de mesures de simplification. La cadence imprime par la fabrique simplifier
devrait ainsi amener le Gouvernement soumettre rgulirement au Parlement
plusieurs trains de mesures de simplification (1).
LDFWXHOOH PDMRULWp D en outre parfaitement conscience que les efforts de
UpGXFWLRQ GX VWRFN GHV QRUPHV H[LVWDQWHV VHURQW YDLQV VLOV QH VRQW SDV
accompagns par des mesures de rationalisation du flux normatif propres
MXJXOHUSRXUODYHQLUODSURGXFWLRQGHQRUPHVHQ)UDQFH
&HVWODUDLVRQSRXUODTXHOOHOD&RQIpUHQFHGHV3UpVLGHQWVGHO$VVHPEOpH
QDWLRQDOH D GpFLGp OH  QRYHPEUH  j OLQLWLDWLYH GX 3UpVLGHQW &ODXde
Bartolone, OD FUpDWLRQ GXQH PLVVLRQ GLQIRUPDWLRQ sur la simplification
lgislative, charge de rflchir aux moyens de mieux lgifrer.
Compose de 17 dputs appartenant aux diffrents groupes de
O$VVHPEOpH et prside par Mme Laure de La Raudire, dpute UMP
G(XUH-et-Loir, cette mission a consacr une part importante de ses travaux
OpWXGH GHV ERQQHV SUDWLTXHV PLVHV HQ XYUH chez nos voisins europens o le
nombre de lois adoptes se rapproche du ntre VRXV UpVHUYH GH OH[FHSWLRQ
britannique qui tient la conception des domaines de la loi et du rglement au
Royaume-Uni (2). Outre des dplacements en Belgique, au Royaume-Uni, en
Allemagne et aux Pays-Bas, elle a effectu 20 DXGLWLRQV j O$VVHPEOpH
nationale, en recueillant le point de vue non seulement des acteurs institutionnels
GLUHFWHPHQW FRQFHUQpV &RQVHLO GeWDW &RXU GHV FRPSWHV VHFUpWDULDW GeWDW DX[
Relations avec le Parlement, secrtariats gnraux du Gouvernement, des Affaires
HXURSpHQQHV HW GH OD PRGHUQLVDWLRQ GH ODFWLRQ SXEOLTXH Htc.), mais aussi de
nombreux universitaires et lus ayant abondamment rflchi aux enjeux de
rationalisation du flux normatif (3).
Le prsent rapport et les 15 propositions TXLOFRPSRUWHVRQWOHIUXLWGHFHV
neuf mois de travail. Plutt que de se perdre GDQV GLQQRPEUDEOHV
(1) Audition de M. Thierry MandRQ VHFUpWDLUH GeWDW DXSUqV GX 3UHPLHU PLQLVWUH FKDUJp GH OD UpIRUPH GH
OeWDWHWGHODVLPSOLILFDWLRQPHUFUHGLMXLOOHW
(2) Voir le tableau figurant en annexe n 2.
(3) Les comptes-UHQGXVGHOHQVHPEOHGHVDXGLWLRQVDX[TXHOOHVODPLVVLRQDSURFpGpjO$VVHPEOpHQDWLRQDOH
et dont votre rapporteur citent quelques extraits tout au long du prsent rapport figurent en annexe n 16.

14

UHFRPPDQGDWLRQV TXL VRQQHUDLHQW FRPPH DXWDQW GH YX[ SLHX[ OD PLVVLRQ D
prfr retenir un nombre restreint de propositions GRQWHOOHHVWLPHTXHOOHVVRQW
VXVFHSWLEOHV GH IDLUH OREMHW GXQ ODUJH FRQVHQVXV SROLWLTXH HW GRQF GrWUH
conFUpWLVpHV j FRXUW WHUPH /D PLVH HQ XYUH GH FHV SURSRVLWLRQV OXL DSSDUDvW
LQGLVSHQVDEOHVLORQQHYHXWSDVTXHOHGLYRUFHHQWUHOHV)UDQoDLVGXQHSDUWHW
les normes et les acteurs qui les laborent (au premier rang desquels les politiques)
soit irrmdiablement consomm.

15

PREMIRE PARTIE : MIEUX PRPARER LA NORME


EN AMONT DE LA PROCDURE LGISLATIVE
/LQIODWLRQHWODGpJUDGDWLRQGHODTXDOLWpdes normes sont en grande partie
OLpHV DX[ PDXYDLVHV FRQGLWLRQV GH VD SUpSDUDWLRQ HW QRWDPPHQW j OpYDOXDWLRQ
insuffisante voire inexistante de son impact social, conomique,
environnemental, etc.
La loi n 2005-102 du 11 fvrier 2005 SRXU OpJDOLWp GHV GURLWV et des
chances, la participation et la citoyennet des personnes handicapes en est un bon
exemple.
48$1'/,168)),6$17(35e3$5$7,21'(/$/2,12855,7/,1)/$7,21
LGI SLATI VE /(;(03/('(/$/2,'8)e95,(53285
/e*$/,7e'(6'52,76(7'(6&+$1&(6, LA PARTI CI PATI ON ET LA
CI TOYENNET DES PERSONNES HANDI CAPES
Si, la demande du Premier ministre, M. Jean-Pierre Raffarin, XQH pWXGH GLPSDFW
avait bien t jointe au projet de loi initial, dpos en janvier 2004 sur le bureau du Snat,
celle-ci ne FRPSWDLWTXXQHYLQJWDLQHGHSDJHVHWFRQVLVWDLWSRXUOHVVHQWLHOHQXQHVpULHGH
ILFKHV GLPSDFW SDUIRLV WUqV VXFFLQFWHV  FRQFHUQDQW FHUWDLQHV GLVSRVLWLRQV GX SURMHW GH ORL
(articles 2 4, 6 12-,9jjHW jOexclusion des articles 21 et 24, devenus
les articles 41 et 45 du texte dfinitif.
/DORLSRXUOpJDOLWpGHVGURLWV HW GHVFKDQFHVODSDUWLFLSDWLRQ HW OD FLWR\HQQHWpGHV
personnes handicapes a ainsi t dfinitivement adopte en fvrier 2005 sans que le
Parlement ait t mis en PHVXUHGpYDOXHUOLPSDFWGH ces deux articles.
/DUWLFOHGHODORLGXIpYULHUDLQWURGXLWGDQVOHFRGHGHODFRQVWUXFWLRQHW
GHOKDELWDWLRQXQDUWLFOHL. 111-LPSRVDQWODFFHVVLELOLWpDX[SHUVRQQHVKDQGLFDSpHV TXHO
que soit le type de leur KDQGLFDS  GHV ORFDX[ GKDELWDWLRQ DSSDUWHQDQW DX[ SHUVRQQHV
publiques ou prives), des tablissements recevant du public (ERP), des installations
ouvertes au public (IOP) et des lieux de travail sous peine, pour les utilisateurs du sol, les
bnficiaires des travaux, les architectes, les entrepreneurs et les autres personnes
UHVSRQVDEOHVGHOH[pFXWLRQGHVWUDYDX[ GHVDQFWLRQVSpQDOHVSUpYXHVSDUOarticle L. 152-4
du mme code (amende de 45 000 euros pour une personne physique, amende de
225 000 euros pour une personne morale et, en cas de rcidive, peine de six mois
GHPSULVRQQHPHQW 
/DUWLFOH L. 111-7-3 du mme code a ajout que les tablissements existants
recevant du public doivent tre tels que toute personne handicape puisse y accder, y
circuler et y recevoir les informations qui y sont diffuses, dans les parties ouvertes au
public  HW TXLOV devront rpondre ces exigences dans un dlai, fix par dcret en
&RQVHLOGeWDWTXLSRXUUDYDULHUSDUW\SHHWFDWpJRULHGpWDEOLVVHPHQWVDQVexcder dix ans
compter de la publication de la loi . Le dcret n 2006-555 du 17 mai 2006 a fix
OpFKpDQFHDXer janvier 2015.

16

/DUWLFOHGHODORLGXIpYULHUD IL[pXQGpODLGHGL[DQVjFRPSWHUGHOD
GDWHGHODSXEOLFDWLRQGHODORLjOissue duquel les services de transport collectif devront
tre accessibles aux personnes handicapes et mobilit rduite - soit au 13 fvrier 2015.
Or, ds 2008, une tude mene par Accsmtrie, la Fdration franaise du btiment,
la Fdration des associations pour adultes et jeunes handicaps (APAJH) et la banque Dexia
D HVWLPp j HQYLURQ  PLOOLDUGV GHXURV OH FRW GH OLQYHVWLVVHPHQW SRXU OD PLVH HQ
accessibilit des ERP grs par les collectivits locales.
En 2010, la Fdration des APAJH a revu jODKDXVVHOHPRQWDQWGHOLQYHVWLVVHPHQW
jODFKDUJHGHOeWDWHWGHVFROOHFWLYLWpVterritoriales (environ 20 PLOOLDUGVGHXURVGRQWj
ODFKDUJHGHOeWDW et 16,8 la charge des collectivits territoriales). Une tude a alors rvl
TX mi-chemin GH OpFKpDQFH IL[pH SDU OD ORL GX  IpYULHU  [il existait] des
LQWHUURJDWLRQV TXDQW DX UHVSHFW GHV GpODLV LPSDUWLV HQ PDWLqUH GDFFHVVLELOLWp JOREDOH GHV
ERP (1).
En 2011 XQH PLVVLRQ FRQMRLQWH GX FRQVHLO JpQpUDO GH OHQYLURQQHPHQW HW GX
dveloppePHQWGXUDEOHGHO,QVSHFWLRQJpQpUDOHGHV$IIDLUHVVRFLDOHV ,*$6 HWGXFRQWU{OH
gnral conomique et financier (CE*(),  VXU OHV PRGDOLWpV GDSSOLFDWLRQ GHV UqJOHV
GDFFHVVLELOLWp GX FDGUH EkWL DX[ SHUVRQQHV KDQGLFDSpHV D FRQVWDWp TXH OpFKpDQFH GX
1er MDQYLHUSRXUODPLVHHQFRQIRUPLWpGHV(53DX[QRUPHVGDFFHVVLELOLWpQHSRXUUDLW
HQ DXFXQ FDV rWUH WHQXH FDU OH GpODL pWDLW WURS FRXUW IDFH DX[ PDVVHV GLQYHVWLVVHPHQW
ncessaires, sans oublier les dures des oprations ncessaires toutes les phases (diagnostic,
pWXGHV WHFKQLTXHV SURFpGXUHV DGPLQLVWUDWLYHV UHODWLYHV j OD VpFXULWp j ODFFHVVLELOLWp HW j
OXUEDQLVPH GDXWDQWTXHOHVWUDYDX[GHYDLHQWrWUHUpDOLVpVGDQVGHVpWDEOLVVHPHQWVTXLHQ
gnral, devaient continuer fonctionner.
Le Premier ministre, M. Jean-Marc Ayrault, a alors confi notre collgue snatrice
Mme Claire-/LVH &DPSLRQ OD PLVVLRQ GH IDLUH OH SRLQW VXU OpWDW GDYDQFHPHQW GH
ODFFHVVLELOLWpHQ)UDQFHHWGHUHFKHUFKHUGHVVROXWLRQVSHUPHWWDQWjQRWUHSD\VGHUpSRQGUHOH
mieux possible aux attentes lgitimes suscites par la loi du 11 fvrier 2005.
En mars 2013, Mme Claire-Lise Campion a remis au Premier ministre un rapport
intitul Russir 2015 . Partant du constat que la loi du 11 fvrier 2005 avait t adopte
alors que OH FRW GHV WUDYDX[ QDYDLW SDV pWp pYDOXp HW TXH OHV GpODLV QpFHVVDLUHV j OHXU
ralisation avait t mal apprcie une dure de dix ans tant insuffisante pour les
tablissements scolaires ou les transports, qui connaissent des priodes de renouvellement de
PDWpULHOVpFKHORQQDQWSDUIRLVVXUSOXVGHYLQJWDQV Mme Claire-Lise Campion a propos
DX[DFWHXUVSXEOLFVHWSULYpVGHUHSRUWHUGHTXHOTXHVDQQpHVOpFKpDQFHGXer janvier 2015
en contrepartie de leur engagement sur un calendrier prcis et chiffr de travaux
GDFFHVVLELOLWp, DUUrWpGDQVOHFDGUHGDJHQGDVGDFFHVVLELOLWpSURJUDPPpH $G$3 ). Lors
du comit interministriel du handicap du 25 septembre 2013, le Premier ministre a dcid
GRXYULUGHX[FKDQWLHUVGHFRQFHUWDWLRQ OXQVXUODPLVHHQ XYUHGHV $G$3 HWODXWUH
VXUODGDSWDWLRQGHVQRUPHVGDFFHVVLELOLWpGXFDGUHEkWLGHODYRLULHHWGHVWUDQVSRUWVSXEOLFV
jOpYROXWLRQGHVWHFKQLTXHVDX[EHVRLQVGHVSHUVRQQHVKDQGLFDSpHVHW DX[FRQWUDLQWHVGHV
oprateurs. En fvrier 2014, Mme Claire-Lise Campion a remis au Premier ministre un
rapport regroupant les propositions issues de la concertation, dont certaines appelaient des
mesures de nature lgislative.
Sur la base de ce rapport, un projet de loi habilitant le Gouvernement adopter des
mesures lgislatives pour la mise en accessibilit des ERP, des transports publics, des
EkWLPHQWV GKDELWDWLRQ HW GH OD YRLULH SRXU OHV SHUVRQQHV KDQGLFDSpHV D pWp pODERUp assorti

(1) La Semaine juridique Administrations et Collectivits territoriales, n 19, 10 mai 2010, act. 381.

17

GXQH pWXGH GLPSDFW DSSURIRQGLH GHQYLURQ FLQTXDQWH SDJHV et dpos sur le Bureau du
Snat en avril 2014.
Aprs que la procdure acclre a t engage, le Parlement a adopt la loi
n 2014-789 du 10 juillet 2014 GRQW ODUWLFOHer autorise le Gouvernement prendre par
YRLH GRUGRQQDQFHV WRXWH PHVXUH UHOHYDQW GX GRPDLQH Ge la loi afin de >@ dfinir les
conditions dans lesquelles peut tre prorog [de trois neuf ans] le dlai fix pour que les
tablissements recevant du public et les installations ouvertes au public soient >@rendus
accessibles tous, et notamment aux personnes handicapes, quel que soit le type de
KDQGLFDS ORUVTXH OH SURSULpWDLUH RX OH[SORLWDQW GH OpWDEOLVVHPHQW RX GH OLQVWDOODWLRQ
GpSRVH RX VHQJDJH j GpSRVHU XQ DJHQGD GDFFHVVLELOLWp SURJUDPPpH VRXPLV j
ODSSUREDWLRQ GH ODXWRULWp DGPLQLVWUDWLYH HW TXLO UHVSHFWH FHW DJHQGD FHV IRUPDOLWpV
VLPSRVDQW SRXU WRXW pWDEOLVVHPHQW UHFHYDQW GX SXEOLF RX LQVWDOODWLRQ RXYHUWH DX SXEOLF
QD\DQWSDVDFFRPSOLOHVGLOLJHQFHVGHPLVHHQDFFHVVLELOLWpSUpYXHVSDUODORLQ 2005-102
GXIpYULHUSRXUOpJDOLt des droits et des chances, la participation et la citoyennet
des personnes handicapes .
La loi du 11 fvrier 2005 ayant t adopte sans que son impact ait t
correctement valu en amont, le Parlement a ainsi d lgifrer nouveau (et dans
OXUJHQFH  Sour KDELOLWHU OH *RXYHUQHPHQW j DPpQDJHU SDU YRLH GRUGRQQDQFHV OH
dispositif initial, compte tenu GHVGLIILFXOWpVFRQFUqWHVDX[TXHOOHVVRQDSSOLFDWLRQVHVW
KHXUWpH&HVWOjXQERQH[HPSOHGXQHPpWKRGH RXSOXVH[DFWHPHQW GXQHDEVHQFHGH
mthode) de production normative avec laquelle il faut rompre, car mal lgifrer
conduit lgifrer davantage.

M al lgifrer conduit non seulement faire peser sur les destinataires


de la loi des charges excessives et des contraintes irralistes, mais aussi
OpJLIpUHU HQFRUH GDYDQWDJH SXLVTXLO IDXW XQH nouvelle loi pour rparer les
malfaons (et, dans le cas de la loi du 11 fvrier 2005, reporter les effets)
GXQHORLDQWpULHXUHPDOSUpSDUpH
Si des progrs ont incontestablement t rpDOLVpVGHSXLVTXHOpODERUDWLRQ
GXQHpWXGHGLPSDFWHVWGHYHQXHXQHREOLJDWLRQFRQVWLWXWLRQQHOOHSRXUOHVSURMHWV
de loi que le Gouvernement dpose sur le bureau des assembles
parlementaires (1), LO QHQ GHPHXUH SDV PRLQV TXH OD TXDOLWp GH OpWXGH GLPSact
sera sujette caution WDQWTXHOHWUDYDLOGpYDOXDWLRQrestera purement interne aux
DGPLQLVWUDWLRQVjORULJLQHGHVSURMHWVGHORLHWTXLOQHVHUDSDVVRXPLVau regard
externe et indpendant de reprsentants de la socit civile.
I. 5(1'5(/e9$/8$7,21EX ANTE DE LA NORME PLUS INDPENDANTE

Devant la mission, le secrtaire GeWDWDXSUqVGX3UHPLHUPLQLVWUHFKDUJp


des relations avec le Parlement, M. Jean-Marie Le Guen, notait que les tudes
GLPSDFW DSSDUDLVVHQW DXMRXUGKXL FRPPH XQ H[HUFLFH LPSRVp HW SUHQQHQW
SDUIRLVODIRUPHGXQH[SRVpGHVPRWLIVbisDORUVTXHOOHVGHYUDLHQWSHUPHWWUH
DX *RXYHUQHPHQW GH VDVVXUHU TXH OD UpIRUPH TXLO YHXW PHWWUH HQ XYUH HVW
(1) Article 39 de la Constitution tel que modifi par la loi constitutionnelle n 2008-724 du 23 juillet 2008 de
modernisation des institutions de la Ve Rpublique, et loi organique n 2009-403 du 15 avril 2009 relative
Oapplication des articles 34-1, 39 et 44 de la Constitution.

18

RSSRUWXQH HW DX 3DUOHPHQW GrWUH FRUUectement inform sur la porte sociale,
pFRQRPLTXH EXGJpWDLUH RX HQYLURQQHPHQWDOH GHV WH[WHV TXRQ OXL GHPDQGH
GDGRSWHU/XQHGHVFDXVHVGHFHWWHGpIDLOODQFHHVWTXHOHPLQLVWqUHSRUWHXUGXQ
WH[WHHVWDXVVLFHOXLTXLUpGLJHOpWXGHGLPSDFW'XQSRLQW de vue scientifique, il
HVWSUREOpPDWLTXHGHGHPDQGHUjTXHOTXXQGHMXJHUGHORSSRUWXQLWpGHODFWLRQ
TXLOYHXWPHQHU .
Si OpYDOXDWLRQ ex ante GH OLPSDFW GHV QRUPHV WHQG j VDPpOLRUHU GHSXLV
TXHOOH HVW GHYHQXHSRXU OHV SURMHWVGH ORL XQHREOLJDWLon constitutionnelle, elle
IDLWHQFRUHOREMHWGHQRPEUHXVHVFULWLTXHVWHQDQWQRWDPPHQWjFHTXHOOHUHVWHXQ
processus purement interne aux administrations qui produisent les textes,
contrairement aux pratiques adoptes par certains de nos voisins europens en
PDWLqUHGpWXGHGLPSDFW
A. /e/$%25$7,21 '(6 e78'(6 ',03$&7 EN FRANCE : UN
PROCESSUS
PUREMENT
INTERNE
AUX
ADMINISTRATIONS
PRODUCTRICES DE TEXTES.

Sans ngliger les importants progrs accomplis par les administrations en


PDWLqUH GpODERUDWLRQ GHV pWXGHV GLPSDFW GRQW LO IDXW VRXOLJQHU TXH OH FDUDFWqUH
REOLJDWRLUH HVW UpFHQW OD PLVVLRQ D SX FRQVWDWHU TXH OpYDOXDWLRQ ex ante de
OLPSDFWGHQRUPHVVRXIIUe GHODFXQHVTXHOOHSURSRVHGHFRPEOHU
1. /REOLJDWLRQ constitutionnelle GDVVRUWLU de nombreux projets de loi
GXQHpWXGHGLPSDFWHVWUpFHQWH.

a. Avant la rforme constitutionnelle du 23 juillet 2008 OpODERUDWLRQ


GXQHpWXGHGLPSDFWQpWDLWTXXQHIDFXOWp au regard des exigences de
la Constitution.
Dans le sillage du clbre rapport public du ConsHLOGeWDWGHVXUOD
scurit juridique, dans lequel la haute juridiction avait mis un jugement svre
sur la prolifration des normes et la dtrioration de leur qualit, la mission sur les
UHVSRQVDELOLWpV HW ORUJDQLVDWLRQ GH OeWDW FRQGXLWH SDU 0 Jean Picq avait appel
en 1994 lgifrer avec mesure et matriser la production des normes,
leur nombre et plus encore leur qualit  HQ DPpOLRUDQW OpYDOXDWLRQ ex ante de
leur impact ( 1 ). Ces recommandations inspirrent les circulaires du Premier
PLQLVWUHGHVQRYHPEUHHWMDQYLHUUHODWLYHVDX[pWXGHVGLPSDFW
DFFRPSDJQDQWOHVSURMHWVGHORLHWGHGpFUHWHQ&RQVHLOGeWDW
i. Le rapport de la mission conduite par M. Jean Picq sur les
UHVSRQVDELOLWpVHWORUJDQLVDWLRQGHOeWDW
CoQVWDWDQWTX en trente ans, le nombre des lois nouvelles votes en une
DQQpH V[tait] accru de 35 % et celui des dcrets de 20 % et que cette
(1) /eWDWHQ)UDQFH : servir une nation ouverte sur le monde , Rapport de la mission sur les responsabilits
HWORUJDQLVDWLRQGHOeWDWPDLSS 28-29.

19

VLWXDWLRQ Q[tait] pas uniquement imputable la complexit croissante de


Oenvironnement socio-conomique , mais aussi un travers dans la conduite
GHOeWDWTXLWHQGWURSVRXYHQWjMX[WDSRVHUGHVWH[WHVQRXYHDX[SOXW{WTXjWLUHU
parti et, le cas chant, enrichir une construction raisonne et mthodique du
systme de normes , la mission conduite par M. Jean Picq a suggr G imposer
TXH WRXW SURMHW GH ORL IDVVH OREMHW GXQH pWXGH GLPSDFW SUpDODEOH [qui]
SRUWHUDLW VXU OHQYLURQQHPHQW MXULGLTXH WH[WHV H[LVWDQWV RX HQ SURMHW DX SODQ
national et international), sur les consquences budgtaires et sur les cots induits
SRXUODVRFLpWpHWSRXUOpFRQRPLH (1).
&HWWHSUpFRQLVDWLRQQDpWpTXHSDUWLHOOHPHQWVXLYLHSDUOHVJRXYHUQHPHQWV
VXFFHVVLIV TXL QRQW SDV pULJp OpODERUDWLRQ GXQH pWXGH GLPSDFW SUpDODEOH HQ
obligation de nature constitutionnelle, mais seulement en ardente obligation
rsultant de circulaires et dpourvues de vritable sanction.
ii. Les circulaires du Premier ministre des 21 novembre 1995 et
26 janvier 1998
/pODERUDWLRQGXQHpWXGHGLPSDFWSUpDODEOHSRXUOHVSURMHWVGHORLHWGH
dFUHW HQ &RQVHLO GeWDW D GDERUG IDLW OREMHW GXQH H[SpULPHQWDWLRQ HQ
application de la circulaire du Premier ministre du 21 novembre 1995. Soucieux
G endiguer la prolifration des textes lgislatifs et rglementaires qui rend
DXMRXUGKXL OH GURLW REVFur, instable et, finalement, injuste , M. Alain Jupp,
alors Premier ministre, a demand aux membres de son gouvernement
GH[SpULPHQWHU j FRPSWHU GX er janvier 1996 pour les projets de loi et du
1er juillet 1996 pour les principaux projets de dcret, unH pWXGH GLPSDFW
comportant au moins une analyse prcise :
GHV DYDQWDJHV DWWHQGXV GHV WH[WHV DSSRUWDQW OD GpPRQVWUDWLRQ TXDX
UHJDUGGHOpWDWGXGURLWHWGHODVLWXDWLRQGHIDLWH[LVWDQWVHWGHOeurs insuffisances,
les objectifs viss ne peuvent tre aWWHLQWV SDU GDXWUHV YRLHV TXH OpGLFWLRQ GH
nouvelles normes juridiques ;
des incidences, directes ou indirectes, court et moyen terme, sur
OHPSORL QRWDPPHQW j SDUWLU GX ELODQ GH ODSSOLFDWLRQ GH PHVXUHV VHPEODEOHV j
OpWUDQJHU GH WUDYDX[ GH PRGpOLVDWLRQ pFRQRPLTXH GHQTXrWHV TXDOLWDWLYHV RX
HQFRUHGpWXGHVGHUHQWDELOLWpVRFLR-conomique ;
GHVLQFLGHQFHVILQDQFLqUHVVXUOHEXGJHWGHOeWDWGHODQQpHHQFRXUVHW
le cas chant, sur ceux des quatre annes suivantes, ainsi que sur les budgets des
collectivits territoriales ;
GHV LQFLGHQFHV VXU OD SURWHFWLRQ GH OHQYLURQQHPHQW HW VXU GDXWUHV
intrts gnraux ;
des incidences en termes de formalits administratives ;
(1) Idem.

20

des raisons pour lesquelles le texte est, ou non, rendu applicable


outre-mer HW VLO HVW DSSOLFDEOH OHV FRQGLWLRQV GH FHWWH DSSOLFDWLRQ DGDSWDWLRQ
respect des procdures consultatives, etc.) ;
GHV FRQVpTXHQFHV HQ WHUPHV GH FRPSOH[LWp GH ORUGRQQDQFHPHQW
juridique le Premier ministre souhaitant alors que tout projet de texte [soit]
GRUpQDYDQW DFFRPSDJQp GH SURSRVLWLRQV GDEURJDWLRQ GH GLVSRVLWLRQV DX PRLQV
quivalentes en termes de niveau de norme et de volume et que, lorsque des
PRGLILFDWLRQV PXOWLSOHV GXQ WH[WH LQLWLDO DERXWLVVHQW j XQH SUpVHQWDWLRQ
fragmente des dispositions en vigueur rendant celles-ci illisibles, un texte
FRQVROLGpVRLWGDQVWRXWHODPHVXUHGXSRVVLEOHMRLQWjOpWXGHGLPSDFW
/HPDQTXHPHQWDX[GLUHFWLYHVIL[pHVSDUOHFKHIGX*RXYHUQHPHQWQDYDLW
GDXWUHVDQFWLRQTXH la possibilit :
pour le cabinet du Premier ministre, de reporter une runion
LQWHUPLQLVWpULHOOHFRQVDFUpHjOH[DPHQGXQSURMHWGHWH[WH VDXIXUJHQFHGPHQW
justifie) ;
pour le secrtaire gnral du Gouvernement, de surseoir la
WUDQVPLVVLRQDX&RQVHLOGeWDWGXQSURMHt de loi ou de dcret et la signature ou
ODSXEOLFDWLRQGXQGpFUHW ;
SRXU OH &RQVHLO GeWDW GDMRXUQHU OH[DPHQ GXQ SURMHW GH ORL RX GH
dcret.
8Q ELODQ GH OH[SpULPHQWDWLRQ GpFLGpH SDU 0 Alain Jupp ayant montr
ORSSRUWXQLWp GH OD SpUHQQLVHU 0. Lionel Jospin, devenu Premier ministre, a
adress aux membres de son gouvernement, le 26 janvier 1998, une circulaire
UHODWLYHjOpWXGHGLPSDFWGHVSURMHWVGHORLHWGHGpFUHWHQ&RQVHLOGeWDW
Conformment cette circulaire, tous les projets de loi GRUGRQQDQFH HW
GHGpFUHWHQ&RQVHLOGeWDWGHYDLHQWjFRPSWHUGXer fvrier 1998, tre assortis
GXQH pYDOXDWLRQ a priori de leurs effets administratifs, juridiques, sociaux,
conomiques et budgtaires.
Toutefois, les projets de loi de finances et de financement de la scurit
sociale taient soumis une valuation allge, tandis que les projets de loi
GKDELOLWDWLRQpWDLHQWGLVSHQVpVGHWRXWHpWXGHGLPSDFWSUpDODEOHWRXWFRPPHOHV
SURMHWV GH ORL SRUWDQW UDWLILFDWLRQ GRUGRQQDQFHV VDXI VLOV FRPSortaient des
dispositions venant modifier celles des ordonnances).
Prcisant que OH GHJUp GH GpWDLO HW OD ILQHVVH GH ODQDO\VH GH OpWXGH
GLPSDFW[devaient] rWUHSURSRUWLRQQHOVjOLPSRUWDQFHGHVPHVXUHVSURSRVpHVHWj
leurs consquences sur la socit, OpFRQRPLH HW ODGPLQLVWUDWLRQ , la circulaire
du 26 janvier 1998 DUHSULVSRXUOHVVHQWLHOODPpWKRGRORJLHGHVpWXGHVGLPSDFW
propose par la circulaire du 21 novembre 1995, en y ajoutant de nouvelles
exigences :

21

ODQDO\VH GHV HIIHWV PLFURpFRQRPLTXHV et macroconomiques des


mesures proposes avec un chiffrage permettant de prendre en compte le cot
induit par les projets de textes et les formalits nouvelles, spcialement pour les
entreprises ;
une mise en perspective pluriannuelle des charges ou des conomies
envisages ;
ODSUpVHQWDWLRQGXQELODQFRWV-avantages ;
OLQGLFDWLRQGHODOLVWHGHVPRGLILFDWLRQVLQWHUYHQXHVGHSXLVGL[DQVVXU
XQWH[WHORUVTXHFHGHUQLHUIDLWOREMHWGHGLVSRVLWLRQVPRGLILFDWLYHVPXOWLSOHV
Rappelant que OpWXGHGLPSDFW [devait] tre un document vivant et que
son contenu devait tre progressivement enrichi et adapt au fur et mesure de
OpYROXWLRQ GX WH[WH ORUV GHV GLYHUVHV SKDVHV GH VD SUpSDUDWLRQ , le Premier
ministre a recommand aux membres du GouYHUQHPHQW GDVVRFLHU j VRQ
pODERUDWLRQQRQVHXOHPHQWOHVVHUYLFHVGLQVSHFWLRQGHFRQWU{OHGHSURVSHFWLYHHW
Gvaluation de leur propre ministre, mais aussi les services territoriaux
RSpUDWLRQQHOV TXL VRQW OH SOXV VRXYHQW FKDUJpV GH OD PLVH HQ XYUH Ges textes,
ainsi que OHVFDSDFLWpVGH[SHUWLVHGDXWUHVPLQLVWqUHVTXHOHOHXU Ainsi labore,
OpWXGH GLPSDFW DYDLW YRFDWLRQ j rWUH WUDQVPLVH DX[ RUJDQLVPHV GRQW OD
consultation tait obligatoire DLQVLTXDX3DUOHPHQW
Cependant, le non-respect des recommandations du Premier ministre ne
IDLVDLW OREMHW GDXFXQH DXWUH VDQFWLRQ TXH OD SRVVLELOLWp SRXU OH FDELQHW GH FH
GHUQLHU HW SRXU OH VHFUpWDULDW JpQpUDO GX *RXYHUQHPHQW GH UHIXVHU OH[DPHQ
LQWHUPLQLVWpULHO GXQ SURMHW GH WH[WH et encore, sous rservH GH FH TXLO QH
VDJLVVDLWSDVGXQ cas exceptionnel dment justifi par une extrme urgence .
Il a fallu quatorze ans pour que soit mise HQXYUHODUHFRPPDQGDWLRQGX
rapport Picq WHQGDQW j IDLUH GH OpODERUDWLRQ GXQH pWXGH GLPSDFW XQH YpULWDEOH
obligation, passible de sanctions prvues par la Constitution, et non une simple
facult laisse la discrtion du Gouvernement.
b. Depuis la rforme constitutionnelle du 23 juillet 2008 OpODERUDWLRQ
GXQH pWXGH GLPSDFW HVW XQH REOLJDWLRQ constitutionnelle dont le
non-respect Qa cependant pas encore t sanctionn par le Conseil
constitutionnel.
Suivant la proposition n 25 du comit de rflexion et de proposition sur la
modernisation et le rquilibrage des institutions de la V e Rpublique (plus connu
sous le nom de comit Balladur ), le Parlement a adopt, le 23 juillet 2008, la
loi constitutionnelle n 2008-724 GRQW ODUWLFOH  D LQWURGXLW j ODUWLFOH  GH OD
Constitution un alina 3 prvoyant que la prsentation des projets de loi dposs
GHYDQWOAssemble nationale ou le Snat rpond aux conditions fixes par une loi

22

organique , laquelle dispose que OHV SURMHWV GH ORL IRQW OREMHW GXQH pWXGH
GLPSDFW (1).
i. La Constitution et la loi organique du 15 avril 2009 contraignent le
Gouvernement assortir de nombreux SURMHWV GH ORL GXQH pWXGH
GLPSDFW.
/D &RQVWLWXWLRQ QH IDLW SDV H[SOLFLWHPHQW UpIpUHQFH j OD QRWLRQ GpWXGH
GLPSDFW&HVWjODORLRUJDQLTXHGXDYULOTXLOHVWUHYHQXGHSUpFLVHUTXH
les projets de loi GHYDLHQW rWUH DVVRUWLV GH GRFXPHQWV UHQGDQW FRPSWH GH OpWXGH
GLPSDFWORUVGHOHXUWUDQVPLVVLRQDX&RQVHLOGeWDWHWGHOHXUGpS{WVXUOHEXUHDX
GH OD SUHPLqUH DVVHPEOpH VDLVLH /DUWLFOH  GH FHWWH ORL RUJDQLTXH SUpYRLW TXH
OpWXGH GLPSDFW GRLW FRPSUHQGUH XQH pWXGH GRSWLRQV GpILQLVVDnt les objectifs
poursuivis par le projet de loi, recensant les options possibles en dehors de
Ointervention de rgles de droit nouvelles et exposant les motifs du recours une
nouvelle lgislation. Ce mme article 8 dispoVH TXH ODGLWH pWXGH GLPSDFW GRLW
comporter neuf rubriques exposant avec prcision :
ODUWLFXODWLRQGXSURMHWGHORLDYHFOHGURLWHXURSpHQHQYLJXHXURXHQ
FRXUVGpODERUDWLRQHWVRQLPSDFWVXUORUGUHMXULGLTXHLQWHUQH
OpWDW GDSSOLFDWLRQ GX GUoit sur le territoire national dans le ou les
domaines viss par le projet de loi ;
OHV PRGDOLWpV GDSSOLFDWLRQ GDQV OH WHPSV GHV GLVSRVLWLRQV HQYLVDJpHV
les textes lgislatifs et rglementaires abroger et les mesures transitoires
proposes ;
les coQGLWLRQV GDSSOLFDWLRQ GHV GLVSRVLWLRQV HQYLVDJpHV GDQV OHV
collectivits >GRXWUH-mer], en Nouvelle-Caldonie et dans les Terres australes et
antarctiques franaises, en justifiant, le cas chant, les adaptations proposes et
ODEVHQFHGDSSOLFDWLRQGHVdispositions certaines de ces collectivits ;
OpYDOXDWLRQ GHV FRQVpTXHQFHV pFRQRPLTXHV ILQDQFLqUHV VRFLDOHV HW
environnementales, ainsi que des cots et bnfices financiers attendus des
GLVSRVLWLRQVHQYLVDJpHVSRXUFKDTXHFDWpJRULHGDGPLQLVWUDWLRQs publiques et de
personnes physiques et morales intresses, en indiquant la mthode de calcul
retenue ;
OpYDOXDWLRQ GHV FRQVpTXHQFHV GHV GLVSRVLWLRQV HQYLVDJpHV VXU OHPSORL
public ;
les consultations qui ont t menes avant la saisine du Conseil deWDW ;
VLO\DOLHXOHVVXLWHVGRQQpHVSDUOH*RXYHUQHPHQWjODYLVGX&RQVHLO
conomique, social et environnemental ;
(1) Article 8 de la loi organique n 2009-403 du 15 avril 2009 relaWLYHjOapplication des articles 34-1, 39 et
44 de la Constitution.

23

ODOLVWHSUpYLVLRQQHOOHGHVWH[WHVGDSSOLFDWLRQQpFHVVDLUHV.
5DSSHORQVTXHGDQVODYHUVLRQTXHQDYDLHQWDGRSWpHOHVGHX[DVVHmbles,
ODUWLFOH  GH OD ORL RUJDQLTXH GX  DYULO  IDLVDLW pJDOHPHQW REOLJDWLRQ DX
*RXYHUQHPHQW GLQGLTXHU GDQV OpWXGH GLPSDFW MRLQWH DX SURMHW GH ORL OHV
orientations principales et le dlai prvisionnel de publication des textes
GDSSOLFDWLRQ ncessaires. Toutefois, le Conseil constitutionnel a censur ce
PHPEUH GH SKUDVH HVWLPDQW TXHQ WDQW TXLO FRPSRUWDLW injonction au
*RXYHUQHPHQWGLQIRUPHUOH3DUOHPHQWVXUOHVRULHQWDWLRQVSULQFLSDOHVHWOHGpODL
prvisionnel de publication des disSRVLWLRQV UpJOHPHQWDLUHV TXLO GHYDLW prendre
GDQVOH[HUFLFHGHODFRPSpWHQFHH[FOXVLYHTXLO tient des articles 13 et 21 de la
Constitution, il mconnaissait le principe de sparation des comptences du
pouvoir lgislatif et du pouvoir rglementaire, et que, ds lors, il tait contraire
la Constitution (1). Cet tat de la jurisprudence constitutionnelle parat condamner
WRXWH LQLWLDWLYH WHQGDQW j SHUPHWWUH DX 3DUOHPHQW GHxiger la communication des
SURMHWVGHGpFUHWVGDSSOLFDWLRQORUVGHOH[DPHQGHVprojets de loi.
/D PLVVLRQ VRXOLJQH HQ RXWUH TXH OREOLJDWLRQ GpODERUDWLRQ GXQH pWXGH
GLPSDFWUpSRQGDQW DX[ SUHVFULSWLRQVGH ODUWLFOH GH OD ORLGX DYULO QH
concerne que certains projets de loi (au demeurant, les plus nombreux) :
projets de loi ordinaire ;
projets de loi organique ;
projets de loi de programmation autres que ceux relatifs aux finances
publiques.
Seules certaines dispositions des projets de loi de finances et de
ILQDQFHPHQWGHODVpFXULWpVRFLDOHGRLYHQWIDLUHOREMHWGXQHpWXGHGLPSDFW
6DJLVVDQWGHVSURMHWVGHORLGHILQDQFHVLQLWLDOHHWUHFWLILFDWLYHOHVDUWLFOHV
51 et 53 de la loi organique n 2001-692 du 1er aot 2001 relative aux lois de
finances ( LOLF  VRXPHWWHQW j OREOLJDWLRQ GpYDOXDWLRQ SUpDODEOH WRXV les
articles fiscaux figurant en premire ou seconde partie de la loi de finances, les
dispositions de la premire partie de la loi de finances relatives aux autres
UHVVRXUFHVGHOeWDWGqVORUVTXHOOHVDIIHFWHQWOpTXLOLEUHEXGJpWDLUHDLQVLTXHOHV
dispositions de la seconde partie de la loi de finances qui relvent du domaine
facultatif et partag de ce type de lois (2)$XFXQHREOLJDWLRQGpYDOXDWLRQSUpDODEOH
QHVWSUpYXHSRXUOHVGLVSRVLWLRQVUHOHYDQWGXGRPDLQHREOLJDWRLUHHWH[FOXVLIGHV
lois de fiQDQFHV QRWDPPHQWOHVFRQGLWLRQVJpQpUDOHVGHOpTXLOLEUHEXGJpWDLUHRX
les autorisations de plafonds), ni pour celles relevant du domaine facultatif et
exclusif de ces lois.

(1) Conseil constitutionnel, dcision n 2009-579 DC du 9 avril 2009, considrant n 16.


(2) Article 34, II, 7 de la loi organique n 2001-692 du 1er aot 2001 relative aux lois de finances ( LOLF ).

24

4XDQW DX[ SURMHWV GH ORL GH ILQDQFHPHQW GH OD VpFXULWp VRFLDOH ODUWLFOH
LO 111-GXFRGHGHODVpFXULWpVRFLDOHQLPSRVHGpWXGHGLPSDFWSUpDODEOHTXH
pour ce qui concerne les dispositions relevant du domaine facultatif et partag de
ces lois (1).
Les projets de loi GKDELOLWDWLRQ prendre des ordonnances et les
projets de loi tendDQWjDXWRULVHUODUDWLILFDWLRQRXODSSUREDWLRQGXQWUDLWp
RXDFFRUGLQWHUQDWLRQDOVRQWVRXPLVjXQHpWXGHGLPSDFWDOOpJpH (2).
Enfin, un certain nombre de projets de loi sont dispenss de toute
pWXGHGLPSDFW :
projets de rvision constitutionnelle ;
projets de loi prorogeant des tats de crise ;
projets de loi de programmation des finances publiques ;
projets de loi de rglement (3) ;
SURMHWV GH ORL GH UDWLILFDWLRQ GXQH RUGRQQDQFH j PRLQV TXLOV QH
comportent des dispositions nouvelles allant au-GHOj GH OD UHFWLILFDWLRQ GHUUHXUV
PDWpULHOOHVGDQVOHWH[WHGHORUGRQQDQFHRXGDMXVWHPHQWVGHFRKpUHQFHMXULGLTXH
A fortioriVRQWpJDOHPHQWGLVSHQVpVGHWRXWHpWXGHGLPSDFW :
OHV SURMHWV GRUGRQQDQFHV prises sur le fondement des articles 38 et
74-1 de la Constitution ;
les propositions de loi ;
les amendements GRULJLQHJRXYHUQHPHQWDOHRXSDUOHPHQWDLUH
6LOHVWYUDLTXHOREOLJDWLRQGpODERUHUXQHpWXGHGLPSDFWDpWppFDUWpHRX
allge pour un certain nombre de textes, LO QHQ UHVWH SDV PRLQV TXH VRQ
inscription dans la Constitution a contribu diffuser au sein des administrations
XQH FXOWXUH HW XQH GLVFLSOLQH GH OpYDOXDWLRQ SUpDODEOH GDXWDQW SOXV TXH
contrairement ce qui ressortait des circulaires des 21 novembre 1995 et
(1) Article LO 111-3, V, du code de la scurit sociale.
(2) (Q DSSOLFDWLRQ GX GHUQLHU DOLQpD GH ODUWLFOH  GH OD ORL RUJDQLTXH GX  DYULO  les projets de loi
WHQGDQW j DXWRULVHU OD UDWLILFDWLRQ RX ODSSUREDWLRQ GXQ WUDLWp RX accord international doivent tre
accompagns de documents prcisant les objectifs poursuivis par les traits ou accords, estimant leurs
consquences conomiques, financires, sociales et environnementales, analysant leurs effets sur Oordre
juridique frDQoDLVHWSUpVHQWDQWOKLVWRULTXHGHVQpJRFLDWLRQVOtat des signatures et des ratifications, ainsi
que, le cas chant, les rserves ou dclarations interprtatives exprimes par la France .
(3) Il faut cependant noter que les projets de loi de rglement doivent tre assortis de nombreux documents en
DSSOLFDWLRQGHODUWLFOHGHOD/2/)SDUPLOHVTXHOVOHVDQQH[HVH[SOLFDWLYHVprsentant les recettes et les
dpeQVHV HIIHFWLYHV GX EXGJHW GH Oetat ainsi que le montant dfinitif des crdits ouverts et des dpenses
constates, par programme ou par dotation, OHV UDSSRUWV DQQXHOV GH SHUIRUPDQFHV RX HQFRUH Oavis du
Haut Conseil des finances publiques.

25

26 janvier 1998, une sanction particulirement lourde est prvue en cas de


manquement grave. En effet, le Parlement a introduit HQjODUWLFOHGHOD
Constitution, un alina 4 prvoyant que les projets de loi ne peuvent tre inscrits
ORUGUHGXMRXUVLOD&RQIpUHQFHGHVSUpVLGHQWVGHODSUHPLqUHDVVHPEOpHVDLVLH
constate que les rgles fixes par la loi organique sont mconnues HWTX en cas
de dsaccord entre la Confrence des prsidents et le Gouvernement, le prsident
GH ODVVHPble intresse ou le Premier ministre peut saisir le Conseil
constitutionnel qui statue dans un dlai de huit jours (1).
ii. La Confrence des prsidents GHO$VVHPEOpHQDWLRQDOHQDMDPDLVXVp
GH OD SRVVLELOLWp TXL OXL HVW UHFRQQXH GH VRSSRVHU j OLQVFULption
ORUGUHGXMRXUGHO$VVHPEOpHQDWLRQDOHGXQSURMHWGHORLGRQWOpWXGH
GLPSDFWprsente de graves insuffisances.
Jusque WUqVUpFHPPHQWDXFXQHGHVGHX[DVVHPEOpHVQDYDLWIDLWXVDJHGH
ODSRVVLELOLWpUHFRQQXHjVD&RQIpUHQFHGHVSUpVLGHQWVGHVRSSRVHUjOLQVFULSWLRQ
GXQSURMHWGHORLjVRQRUGUHGXMRXU
Le 26 juin dernier, la Confrence des prsidents du Snat a, pour la
premire fois, dcid de retirer de son ordre du jour un projet de loi au motif que
VRQ pWXGH GLPSDFW SUpVHQWDLW j VHV \Hux, de graves lacunes au regard des
H[LJHQFHVGHODUWLFOHGHODORLRUJDQLTXHGXDYULO
Si le Snat a ainsi sanctionn ce qui lui paraissait tre un manquement
JUDYH j OREOLJDWLRQ FRQVWLWXWLRQQHOOH GpODERUDWLRQ GXQH pWXGH GLPSDFW OH
Conseil constitutionnel, saisi la suite du dsaccord du Premier ministre avec ce
FRQVWDWV\HVWOXLUHIXVp,ODHVWLPpTXHQOHVSqFHOHSURMHWGH loi relatif la
dlimitation des rgions, aux lections rgionales et dpartementales et modifiant
le calendrier lectoral, pWDLWDVVRUWLGXQHpWXGHGLPSDFWTXL conformment au
GHX[LqPHDOLQpDGHODUWLFOHGHODORLRUJDQLTXHGXDYULO [comprenait]
des dveloppements relatifs diffrentes options possibles sur les dlimitations
des rgions, les lections rgionales et dpartementales et la dure des mandats
des membres des conseils rgionaux et des conseils dpartementaux , qui
expos[ait] les raisons des choix oprs par le Gouvernement et en prsent[ ait]
les consquences prvisibles , qui rpond[ait] celles des autres prescriptions
GHODUWLFOHGHODORLRUJDQLTXHGXDYULOTXLWURXY[ai]ent effectivement
VDSSOLTXHUFRPSWHWHQXGHOREMHWGHVGLVSRVLWLRQVGXSURMHWGHORLHQFDXVH . Et
OH &RQVHLO GDMRXWHU TXLO QH VDXUait en particulier tre fait grief cette tude
GLPSDFWGHQHSDVFRPSRUWHUGHGpYHORSSHPHQWVVXUOpYROXWLRQGXQRPEUHGHV
emplois publics ds lors que le Gouvernement ne mentionn[ait] pas la
modification de ce nombre dans les objectifs poursuivis par ce projet de loi et
TXLOQpWDLW HQRXWUHSDVpWDEOLTXLOD[vait] t soumis des consultations dans
GHVFRQGLWLRQVTXLDXUDLHQWGrWUHH[SRVpHVGDQVOpWXGHGLPSDFW (2).
(1) ,OFRQYLHQWGHVRXOLJQHUTXHFHWWHSRVVLELOLWpGHUHIXVGLQVFULSWLRQGXQSURMHWGHORLjORUGUHGX MRXUGXQH
assemble ne concerne ni les projets de loi de finances ni les projets de loi de financement de la scurit
sociale.
(2) Conseil constitutionnel, dcision n 2014-12 FNR du 1er juillet 2014, considrant n 6.

26

 FH MRXU OH &RQVHLO FRQVWLWXWLRQQHO QD GRQF MDPDLV FRQVWDWp


GLQVXIILVDQFHV JUDYHV GXQH pWXGH GLPSDFW DX UHJDUG GHV H[LJHQFHV GH OD ORL
organique du 15 avril 2009.
Pour sa part, OD &RQIpUHQFH GHV SUpVLGHQWV GH O$VVHPEOpH QDWLRQDOH QD
MDPDLV UHFRXUX j OD SRVVLELOLWp TXL OXL HVW SRXUWDQW RXYHUWH GH VRSSRVHU j
OLQVFULSWLRQ j ORUGUH GX MRXU GXQ SURMHW GH ORL GRQW OpWXGH GLPSDFW SUpVHQWH
GLPSRUWDQWHVODFXQHV
Votre rapporteur note cependant que notre assemble a commenc de
VHPSDUHUSOHLQHPHQWGHVHQMHX[OLpVjODTXDOLWpGHVpWXGHVGLPSDFWMRLQWHVDX[
projets de loi puisque celle-FL D IDLW OREMHW GH dbats en Confrence des
prsidents plusieurs reprises depuis la XIIIe lgislature. Tel fut notamment le
FDVjORFFDVLRQGHOH[DPHQGX SURMHWGHORLUHODWLIjOLPPLJUDWLRQen avril 2010,
ou encore, rcemment, sur le pURMHW GH ORL JDUDQWLVVDQW ODYHQLU HW OD MXVWLFH GX
systme de retraites dont OpWXGH GLPSDFW a t juge conforme aux exigences
organiques.
3RXU SHUPHWWUH j OD &RQIpUHQFH GHV SUpVLGHQWV GH[HUFHU HQ DPRQW
des dbats en commission, un contrle rigoureux de la qualit des tudes
GLPSDFW TXL VRQW WUDQVPLVHV SDU OH *RXYHUQHPHQW l$VVHPEOpH QDWLRQDOH
VHVW GRWpH GRXWLOV. &HVW DLQVL TXH depuis 2009 ODUWLFOH -5 du Rglement
confie au FRPLWp GpYDOXDWLRQ HW GH FRQWU{OH &(&  OD PLVVLRQ GDSSRUWHU VRQ
H[SHUWLVHVXUOHVpWXGHVGLPSDFWTXLDFFRPSDJQHQWOHVSURMHWVGHORLGpSRVpV par
OH*RXYHUQHPHQWORUVTXLOHVWVDLVLGXQHGHPDQGHHQFHVHQVGXSUpVLGHQWGHOD
commission laquelle un projet de loi a t renvoy, notamment afin de
GpWHUPLQHU VL FHV pWXGHV VDWLVIRQW DX[ H[LJHQFHV SUpYXHV j ODUWLFOH  GH OD ORL
organique du 15 avril 2009.
/RUJDQLVDWLRQFRQFUqWHGHOH[DPHQGHVpWXGHVGLPSDFWYDULHQWVHORQ
les commissions permanentes. Toutefois, ds novembre 2009, la demande de
ODQFLHQ 3UpVLGHQW GH O$VVHPEOpH QDWLRQDOH 0 %HUQDUG $FFR\HU GHV GpSXWpV
PHPEUHVGXFRPLWpGpYDOXDWLRQHWGHFRQWU{OH &(& 00&ODXGH*RDVJXHQHW
Jean Mallot, ont, dans un rapport, formul des recommandations afin
GKDUPRQLVHU OHV SURFpGXUHV GH[DPHQ GHV pWXGHV GLPSDFW HQWUH OHV GLIIpUHQWHV
commissions permanentes (1).
 WLWUH GH[HPSOH, lors de son audition, notre collgue Jean-Luc
:DUVPDQQDDLQVLLQGLTXpTXHORUVTXLOpWDLWSUpVLGHQWGHODFRPPLVVLRQ des Lois,
il avait interpell plusieurs reprises des ministres pour leur faire remarquer telle
RX WHOOH ODFXQH GDQV XQH pWXGH GLPSDFW HW OHXU GHPDQGHU HQ FRQVpTXHQFH GHV
LQIRUPDWLRQV FRPSOpPHQWDLUHV VDQV WRXWHIRLV UHFRXULU j O arme atomique de
ODrticle 39, alina 4, de la Constitution.

(1) 5DSSRUWGLQIRUPDWLRQQ 2094 IDLWDXQRPGXFRPLWpGpYDOXDWLRQHWGHFRQWU{OHGHVSROLWLTXHVSXEOLTXHV


VXU OHV FULWqUHV GH FRQWU{OH GHV pWXGHV GLPSDFW DFFRPSDJQDQW OHV SURMHWV GH ORL SDU 00 Claude
Goasguen et Jean Mallot, dputs.

27

6LOpYDOXDWLRQSUpDODEOHGHOLPSDFWGHVSURMHWVGHORLQDpWpHQFRUHpWp
sanctionne ni par le Conseil constitutionnel ni par la Confrence des prsidents
de notre assemble, LO HVW QpDQPRLQV VDWLVIDLVDQW TXHOOH UHOqYH GpVRUPDLV GXQH
obligation constitutionnelle.
2QQH SHXW HQ GLUH DXWDQW GH OpYDOXDWLRQ GH OLPSDFW GHV SURMHWV GDFWHV
rglementaires. En effet, aucun texte gnral ne vient rendre obligatoire la
SURGXFWLRQGXQHpWXGHGLPSDFWSRXUFHVWH[WHV&elle-ci QHVWXQHREOLJDWLRQTXH
pour les ordonnances, dcrets et arrts relatifs aux entreprises et aux collectivits
territoriales (1).
/DUWLFOH5 1213-27 du code gnral des collectivits territoriales prcise
en effet que les projets de textes rglementaires qui crent ou modifient des
normes applicables aux collectivits territoriales et leurs tablissements publics
HW TXL VRQWGRQF VRXPLV j ODYLVGX &RQVHLO QDWLRQDO GpYDOXDWLRQGHVQRUPHV (2),
VRQWDFFRPSDJQpVGXQUDSSRUWGHSUpVHQWDWLRQHW GXQHILFKHGLPSDFWIDLVDQW
DSSDUDvWUHOHVLQFLGHQFHVWHFKQLTXHVHWOHVLQFLGHQFHVILQDQFLqUHVTXHOOHVTXHOOHV
soient, des mesures proposes pour les collectivits territoriales .
/HFRQVHLOQDWLRQDOGpYDOXDWLRQGHVQRUPHV
applicables aux collectivits territoriales
'HSXLV OD SUpFpGHQWH OpJLVODWXUH OHV JRXYHUQHPHQWV VXFFHVVLIV VDSSXLHQW HQ PDWLqUH GH
normes applicables aux collectivits territoriales, sur une commission consultative
GpYDOXDWLRQGHVQRUPHV &&(1 FUppHDXVHLQGXFRPLWpGHVILQDQces locales (CFL) par la
loi de finances rectificative n 2007-1824 du 25 dcembre 2007.
La CCEN, prside par M. Alain Lambert, ancien ministre, prsident du conseil gnral de
O2UQH pWDLW FKDUJpH GpPHWWUH XQ DYLV VXU OLPSDFW ILQDQFLHU GHV PHVXUHV UpJlementaires
crant ou modifiant des normes caractre obligatoire concernant les collectivits
territoriales et leurs tablissements DLQVL TXH VXU OLPSDFW WHFKQLTXH HW ILQDQFLHU GHV
propositions de textes europens sur les collectivits territoriales et leurs tablissements. Le
*RXYHUQHPHQW SRXYDLW pJDOHPHQW OD FRQVXOWHU VXU OHV SURMHWV GH ORL RX GDPHQGHPHQW
concernant les collectivits locales.
/H*RXYHUQHPHQWDHQWHQGXpULJHUOD&&(1HQPpGLDWHXUGHODQRUPHHQWUHOeWDWHWOHV
collectivits terriWRULDOHV JUkFH j XQ pODUJLVVHPHQW GH VHV FRPSpWHQFHV TXL D GDLOOHXUV pWp
prconis par MM. Alain Lambert et Jean Claude Boulard dans le rapport sur La lutte
FRQWUHOLQIODWLRQQRUPDWLYHTXLOVRQWUHPLVDX3UHPLHUPLQLVWUHOHPDUV
La CCEN a t amene dployer encore davantage ses activits en se transformant en
FRQVHLOQDWLRQDOGpYDOXDWLRQGHVQRUPHVDSSOLFDEOHVDX[FROOHFWLYLWpVWHUULWRULDOHVHWjOHXUV
tablissements publics (CNEN).
(QHIIHWjOLVVXHGHVeWDWVJpQpUDX[GHODGpPRFUDtie territoriale organiss les 4 et 5 octobre
2012, le prsident du Snat, M. Jean-Pierre Bel, a confi au prsident de la commission des
(1) 2Q QRWHUD TXHQ RXWUH HQ DSSOLFDWLRQ GH ODrticle 2 du dcret n 2006-672 du 8 juin 2006 relatif la
cration, la composition et au fonctionnement de commissions administratives caractre consultatif,
WRXW SURMHW GH GpFUHW FUpDQW RX UHQRXYHODQW XQH WHOOH FRPPLVVLRQ GRLW rWUH DFFRPSDJQp GXQH ptude
GLPSDFW permettant notamment de vrifier que la mission impartie la commission rpond une
QpFHVVLWpHWQHVWSDVVXVFHSWLEOHGrWUHDVVXUpHSDUXQHFRPPLVVLRQH[LVWDQWH .
(2) Article L. 1212-2 du code gnral des collectivits territoriales.

28

Lois du Snat, M. Jean-Pierre Sueur, et la prsidente de la dlgation snatoriale aux


collectivits territoriales et la dcentralisation, Mme Jacqueline Gourault, la mission de
proposer des mesures en matire de rgulation des normes. Ces snateurs ont dpos le 12
novembre 2012 au Snat une proposition de loi visant crer une Haute autorit charge du
contrle et GHOpYDOXDWLRQGHVQRUPHVDSSOLFDEOHVDX[FROOHFWLYLWpVORFDOHV
Cette proposition de loi est devenue la loi n 2013-921 du 17 octobre 2013 portant cration
GXQ FRQVHLO QDWLRQDO GpYDOXDWLRQ GHV QRUPHV &1(1  TXL SRXUUD rWUH VDLVL GH WH[WHV SOXV
nombreux que ceux qui taient soumis la CCEN et qui pourra proposer la modification ou
ODEURJDWLRQGHWH[WHV
ODVXLWHGHOpOHFWLRQGHVUHSUpVHQWDQWVGHVUpJLRQVGHVGpSDUWHPHQWVGHVFRPPXQHVHWGHV
tablissements publics de coopration intercommunale fiscalit propre au Conseil national
GpYDOXDWLRQGHVQRUPHV &1(1 FHGHUQLHUDpWpLQVWDOOpOHMXLOOHWGHUQLHU

La circulaire du Premier ministre du 17 fvrier 2011 relative la


simplification des normes concernant les entreprises et les collectivits
WHUULWRULDOHV IRXUQLW XQ PRGqOH GH ILFKH GLPSDFW VXU OHV FROOHFWLYLWpV WHUULWRULDOHV
qui impose de prciser notamment :
OLQVHUWLRQGHODQRUPHHQYLVDJpHGDQVOHQYLURQQHPHQWMXULGLTXH ;
les consultations dj intervenues ou programmes ;
les collectivits territoriales et/ou groupements de collectivits
concerns ;
OHVWLPDWLRQWRWDOHGHOLPSDFWILQDQFLHUGHODPHVXUHVDUpSDUWLWLRQHQWUH
les collectivits territoriales et/ou leurs groupements ;
OHVWLPDWLRQGHVFRWVGLUHFWVHWLQGXLWVUDpports au calendrier de mise
HQXYUHGHODPHVXUHDLQVLTXHGHVpFRQRPLHVpYHQWXHOOHVJpQpUpHV ;
OH[SOLFDWLRQ PpWKRGRORJLTXH GH OHVWLPDWLRQ GH FHV FRWV HWRX
conomies (1).
&HVW FHWWH PrPH FLUFXODLUH GX  IpYULHU  TXL REOLJH OHV
administratioQV j DVVRUWLU OHV SURMHWV GDFWHV UpJOHPHQWDLUHV FRQFHUQDQW OHV
HQWUHSULVHVGXQHILFKHGLPSDFWSUpVHQWDQW :
un bilan cots/avantages de la mesure pour les entreprises ;
OHVPRGDOLWpVGHQWUpHHQYLJXHXUGXGLVSRVLWLIHQYLVDJp ;
ODQDO\VH GpWDLOOpH des impacts prvisibles de la mesure pour chaque
FDWpJRULHGHQWUHSULVHVFRQFHUQpHV 73(30((7,HWJUDQGHVHQWUHSULVHV DYHF
une estimation aussi prcise possible de leur nombre ;

(1) 9RLUOHPRGqOHGHILFKHGLPSDFWHQDQQH[HQ 3.

29

OHVWLPDWLRQ GHV FRWV GH OD SKDVH GH GpSORLHPHQW LQYHVWLVVHPHQWV GH
PLVH HQ FRQIRUPLWp PRGLILFDWLRQ GX V\VWqPH GLQIRUPDWLRQ GH OHQWUHSULVH
formation initiale des salaris, etc.) et des cots rcurrents (implications
organisationnelles, charges administratives annuelles, etc.), rapports au calendrier
GHPLVHHQXYUHGe la mesure ;
GHVSUpFLVLRQVVXUODPpWKRGHGpODERUDWLRQGHVHVWLPDWLRQVGHVFRWVHW
des conomies (avec les hypothses et/ou conventions de calcul retenues) ;
les incidences en termes de concurrence, de comptitivit et de risques
de dlocalisation GHQWUHSULVHV IUDQoDLVHV DLQVL TXH OHV FRWV SRWHQWLHOV SRXU OHV
administrations et les usagers (1).
Sous la prcdente lgislature, conformment aux circulaires du Premier
ministre des 17 fvrier et 7 juillet 2011, ces fiches GLPSDFW VXU OHV FROOHFWLYLWs
territoriales et sur les entreprises devaient tre soumises au commissaire la
simplification, M. Rmi Bouchez. Plac auprs du secrtaire gnral du
Gouvernement, ce dernier pWDLWFKDUJpGDSSUpFLHUVLODQDO\VHGLPSDFWDYDLWpWp
conduite de manire satisfaisante afin OH FDV pFKpDQW GLQYLWHU OH PLQLVWqUH j
ORULJLQHGXSURMHWjODFRPSOpWHURXjSRXUVXLYUHODFRQVXOWDWLRQ GHVHQWUHSULVHV
VXVFHSWLEOHV GrWUH DIIHFWpHV QRWDPPHQW  YRLUH VL QpFHVVDLUH GH VRXPHWWUH DX
cabinet du Premier ministre la question du bien-IRQGpGHODGRSWLRQGX projet de
texte rglementaire.
'DQV VRQ UDSSRUW GDFWLYLWp UHPLV DX 3UHPLHU PLQLVWUH HQ PDUV  (2),
M. Rmi Bouchez a indiqu que, sur les quelque 700 projets de textes
UpJOHPHQWDLUHV TXLO D pWp DPHQp j H[DPLQHU entre fvrier 2011 et fvrier 2012,
dans un dlai moyen de 37 jours calendaires, il avait mis un avis favorable dans
97,6 % des cas. Seuls 2,4 % des projets de texte soit une quinzaine de projets de
texte ont reu un avis dfavorable pour des raisons de forme, de fond ou de
GLIILFXOWpVTXDQWDX[PRGDOLWpVGHQWUpHHQYLJXHXU
Lors de son audition, M. Rmi Bouchez a prcis que le plus souvent, les
projets [ayant reu un avis dfavorable] ont t retravaills et finalement publis
HWTXLOQHVHVRXYHQDLW TXHGXQFDVROHWH[WHDpWpWRWDOHPHQWDEDQGRQQp,O
VDJLVVDLW GXQ SURMHW YLVDQW j UHEDSWLVHU OH OLYUHW GH GpYHORSSHPHQW GXUDEOH
/''  OLYUHW GH GpYHORSSHPHQW GXUDEOH LQGXVWULHO /'',  GH PDQLqUH j
signaler que les fonds rglements centraliss taient orients vers le secteur
industriel .
6LO D UHJUHWWp GDQV VRQ UDSSRUW GDFWLYLWp TXH FHUWDLQHV DGPLQLVWUDWLRQV
ODLHQWSDUIRLVVROOLFLWpWURSWDUGLYHPHQWGDQVOHSURFHVVXVGpODERUDWLRQGHVWH[WHV
UpJOHPHQWDLUHV TXH FHUWDLQHV ILFKHV GLPSDFW DLHQW pWp WURS OpJqUHV HW TXH OH
modle de calcul des charges administratives ( OSCAR ) soit sous-exploit par
(1) Idem.
(2) Ce rapport est consultable au lien suivant : http://www.ladocumentationfrancaise.fr/var/storage/rapportspublics/124000199/0000.pdf

30

OHVPLQLVWqUHVODQFLHQFRPPLVVDLUHjODVLPSOLILFDWLRQ dont la fonction auprs


du secrtaire gnral du Gouvernement a t prennise avec la cration, en
janvieU  GXQ SRVWH GHGLUHFWHXU a soulign que la teneur des travaux
[accomplis] permet[tait] GDIILUPHU VDQV KpVLWDWLRQ TXH OLQWHUYHQWLRQ GX
commissaire la simplification rehausse nettement le degr de prcautions prises
GDQVVRQHQVHPEOHSDUODGPLQLVWUDWLRQGDQVOpODERUDWLRQGHVQRUPHVFRQFHUQDQW
les collectivits territoriales ou les entreprises (1) TXH OH[DPHQ FRQWUDGLFWRLUH
TXLVpWDLWQRXp entre le ministre porteur GXQSURMHWGHWH[WHUpJOHPHQWDLUHet le
commissaire la simplification avait conduit un approfondissement de la
rflexion initiale qui a souvent permis de ILDELOLVHUOHVWLPDWLRQGHVFKDUJHVRXGHV
conomies affrentes un projet et que le contrle que le commissaire la
simplification a opr sur le respect des rgles relatives aux dates communes
GHQWUpHHQYLJXHXU (2) avait concouru garantir, essentiellement au bnfice des
entreprises, une meilleure lisibilit du droit.
Ce constat reflte les progrs considrables (mais perfectibles) qui, en
OHVSDFH GH FLQT DQV RQW pWp DFFRPSOLV SDU OHV DGPLQLVWUDWLRQV HQ PDWLqUH
GpYDOXDWLRQex ante GHOLPSDFWGHVQRUPHV
2. /D FXOWXUH GH OpYDOXDWLRQ GH OLPSDFW FRPPHQFH j VH GpYHORSSHU Du
sein des administrations.

Afin de satisfaire aux exigences de la loi organique du 15 avril 2009, les


administrations ont dvelopp des outils mthodologiques tels que le guide de
lgistique TXL FRPSRUWH XQ YROHW WUqV IRXUQL VXU OHV pWXGHV GLPSDFW et le
PDQXHO GDLGH DX FDOFXO GH OLPSDFW ILQDQFLHU GH OD UpJOHPHQWDWLRQ qui dcrit
ORXWLO GH VLPXODWLRQ GH OD FKDUJH DGPLQLVWUDWLYH GH OD UpJOHPHQWDWLRQ
( OSCAR )&HVRXWLOVFRQWULEXHQWjILDELOLVHUOpYDOXDWLRQSUpDODEOHGHOLPSDFW
des normes, laquelle les nombreuses consultations obligatoires et facultatives
apportent un clairage utile.
a. La mpWKRGRORJLHGpODERUDWLRQGHVpWXGHVGLPSDFWest dtaille dans le
guide de lgistique tabli par le secrtariat gnral du Gouvernement
Le secrtariat gnral du Gouvernement (SGG) a tabli un guide de
lgistique trs complet qui est accessible tout un chacun sur le site Internet
Lgifrance (3) HWTXLFRQVDFUHGLPSRUWDQWVGpYHORSSHPHQWVjODPpWKRGRORJLHGHV
pWXGHVGLPSDFW
'HPEOpH FH JXLGH SUpFLVH TXH OpWXGH GLPSDFW ne saurait se
comprendre ni comme un exercice formel de justification a posteriori GXQH
solution prdtermine, ni comme une apprciation technocratique de
ORSSRUWXQLWpGXQHUpIRUPHTXLYLHQGUDLWVHVXEVWLWXHUjODGpFLVLRQSROLWLque. Il
(1) Rmi Bouchez, 3UHPLHUUDSSRUWGDFWLYLWpGXFRPPLVVDLUHjODVLPSOLILFDWLRQremis au Premier ministre en
mars 2012, p. 23.
(2) Mcanisme dit DCEV et PLVHQXYUHSDUXQHFLUFXODLUHdu Premier ministre du 23 mai 2011.
(3) Ce guide est consultable au lien suivant : http://www.legifrance.gouv.fr/Droit-francais/Guide-de-legistique

31

VDJLW DX FRQWUDLUH GXQH PpWKRGH GHVWLQpH j pFODLUHU OHV FKRL[ SRVVLEOHV HQ
DSSRUWDQW DX *RXYHUQHPHQW HW DX 3DUOHPHQW OHV pOpPHQWV GDSSUpFLDWLRQ
pertinents .
Le guide de lgistique dcrit dans un premier temps les diffrentes
SKDVHVGpODERUDWLRQGHOpWXGHGLPSDFW, la premire phase tant consacre la
FRQIHFWLRQGXQFDKLHUGHVFKDUJHVSDUOH6**HWOHVVHUYLFHVFRQFHUQpVDXSOXV
tard lorsque le texte est inscrit au programme semestriel du travail
gouvernemental. Ce cahier des charges prsente le schma retenu pour la
SUpSDUDWLRQGHOpWXGHGLPSDFW FRQVWLWXWLRQGXQJURXSHGHWUDYDLOPLQLVWpULHORX
LQWHUPLQLVWpULHO PLVVLRQ FRQILpH j XQ FRUSV GLQVSHFWLRQ UHFRXUV j XQH
personnalit qualifie indpendante ou une quipe de recherche universitaire,
etc.). Il recense les informations dj disponibles dans divers rapports ou
documents statistiques, indique les contributions qui seront ncessaires de la part
GRUJDQLVPHVH[WpULHXUVDLQVLTXHGDXWUHVPLQLVWqUHVTXHFHOXLTXLSRUWHOHSURMHW
dHWH[WHHWSURSRVHXQFDOHQGULHUSUpYLVLRQQHOGHUpDOLVDWLRQGHOpWXGHGLPSDFW
Une SUHPLqUH YHUVLRQ GH OpWXGH GLPSDFW est rdige par le ministre
SRUWHXU GX SURMHW GH WH[WH DYHF ODSSXL PpWKRGRORJLTXH GX 6** HW SRXU FH TXL
FRQFHUQH OHV PHVXUHV GDdaptation au droit europen, du secrtariat gnral des
Affaires europennes (SGAE). Cette version initiale est adresse au SGG qui
OH[DPLQHjODXQHGHVH[LJHQFHVGHOD loi organique du 15 avril 2009, du cahier
des charges, et des guides mthodologiques arrts au niveau interministriel. Le
cas chant, le SGG peut inviter le ministre porteur modifier et/ou complter le
document qui est ensuite communiqu, pour observations, aux autres ministres.
Une VHFRQGH YHUVLRQ GH OpWXGH GLPSDFW est labore au regard des
ventuelles rserves des autres ministres et des ventuels carts dans les
FKLIIUDJHV /HV GLYHUJHQFHV GDQDO\VHV SHUVLVWDQWHV j OLVVXH GH FHWWH SKDVH
interservices , qui doit en principe intervenir avant la tenue des premires
runions interministrielles sur le projet de loi, sont portes la connaissance du
cabinet du Premier ministre.
Conformment la circulaire du Premier ministre du 15 avril 2009 relative
j OD PLVH HQ XYUH GH OD UpYLVLRQ FRQVWLWXWLRQQHOOH GX  MXLOOHW  Optude
GLPSDFW DLQVL DPHQGpH QHVW WUDQVPLVH DX &RQVHLO GeWDW DYHF OH SURMHW GH ORL
FRQFHUQp TXDYHFODYDOGXFDELQHWGX3UHPLHUPLQLVWUHHWGX6** ces derniers
SRXYDQWVXUVHRLUjFHWWHWUDQVPLVVLRQVLOVMXJHQWOHGRFXPHQWLQVXIILVDQW
Le guide de lgistique invite enfin les ministres prciser ou complter
OpWXGH GLPSDFW HQ IRQFWLRQ GHV REVHUYDWLRQV GX &RQVHLO GeWDW autant que
possible avant la tenue de son assemble gnrale et, en toute hypothse, avant la
prsentation du texte en conseil des ministres - conseil lors duquel la version
GpILQLWLYH GH OpWXGH GLPSDFW est remise au Prsident de la Rpublique et aux
membres du Gouvernement pour tre ensuite jointe au projet de loi adopt par le
conseil et dpos sur le bureau de la premire assemble saisie.

32

Dans un second temps, le guide de lgistique fournit des prcisions sur


OHFRQWHQXGHVpWXGHVGLPSDFW, que compltent des lignes directrices mises la
GLVSRVLWLRQV GHV DGPLQLVWUDWLRQV FHQWUDOHV VXU OH[WUDQHW GH OD TXDOLWp HW GH OD
simplification du droit ( 1 ) ainsi que des instructions diffuses par voie de
circulaires (2).
/HJXLGHLQVLVWHQRWDPPHQWVXUOHVRLQjDSSRUWHUjOpWXGHGRSWLRQV car
WURSVRXYHQWODFLUFRQVWDQFHTXXQHUpIRUPHDpWpDQQRQFpHRXVLPSOHPHQWTXH
la matire se trouve dj abondamment couverte par des textes conduit ne plus
HQYLVDJHU GDXWUH YRLH TXH OLQWURGXFWLRQ GH SUHVFULSWLRQV QRUPDWLYHV SOXV
dtailles encore pour rgir la question. Or, dans de nombreux cas, la solution la
mieux adapte reposerait sur une combinaison de quelques dispositions, mais
DXVVL VXU GDXWUHV PRGHV GLQWHUYHQWLRQ  LQVWUXPHQWV FRQWUDFWXHOV GRFXPHQWV
GRULHQWDWLRQ FKDUWHV GH ERQQHV SUDWLTXHV UpIpUHQWLHOV LQVWUXFWLRQV GH VHUYLFH
FRPSRUWDQW GHV SRVVLELOLWpV GDGDSWDWLRQ DX[ VLWXDWions particulires, >@
renforcement des moyens de suivi et de contrle, modulation des sanctions,
dveloppement de techniques de mdiation .
Pour ce qui est de la quantification des cots et bnfices financiers
DWWHQGXV GXQH UpIRUPH SRXU FKDTXH FDWpJRULH GDGPLQLVWUDWLRQV SXEOLTXHV HW GH
personnes physiques et morales intresses (parmi lesquelles figurent notamment
les entreprises), le guide de lgistique renvoie ORXWLOGHVLPXODWLRQGHODFKDUJH
administrative de la rglementation ( OSCAR ). Mis DX SRLQW SDU ODQFLHQQH
GLUHFWLRQ JpQpUDOH GH OD PRGHUQLVDWLRQ GH OeWDW '*0( , cet outil est dcrit en
GpWDLOGDQVOHPDQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ
que le SGG a mis disposition des administrations.
b. Un mDQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ
a t tabli par le secrtariat gnral du Gouvernement
6L OD SOXSDUW GHV SD\V HXURSpHQV RQW FKRLVL GDGRSWHU XQH PpWKRGH
commune de quantification des charges administratives connue sous le nom de
standard cost model ou SCM , la France a dvelopp sous propre outil de
simulation de la charge administrative de la rglementation ( OSCAR ) qui a
ODYDQWDJHGrWUHSOXVFRPSOHWTXHOHPRGqOH SCM GDSUqVOHVLQWHUORFXWHXUV
allemands que la missiRQ D SX UHQFRQWUHU PDLV TXL D OLQFRQYpQLHQW GH UHQGUH
difficiles les comparaisons des valuations des administrations franaises avec
celles des autres administrations europennes.

(1) Cet extranet est accessible au lien suivant : http://extraqual.pm.ader.gouv.fr/index.html


(2) Voir notamment les circulaires :
- n 5598/SG du Premier ministre du 23 aot 2012 relative la prise en compte dans la prparation des textes
OpJLVODWLIVHWUpJOHPHQWDLUHVGHOHXULPSDFWHQWHUPHVGpJDOLWpHQWUHOHVIHPPHVHWOHVKRPPHV ;
- n 5602/SG du Premier ministre du 4 septembre 2012 relative la prise en compte du handicap dans les
projets de loi.

33

i. Description du modle des cots standards ( standard cost model )


Dveloppe par les Nerlandais dans les annes 1990, la mthode des
cots standards UHSRVH VXU OLGHQWLILFDWLRQ GHV WkFKHV TXH GRLW DFFRPSOLU XQH
HQWUHSULVH SRXU UHVSHFWHU OHV REOLJDWLRQV GpFRXODQW GH ODSSOLFDWLRQ GXQH
rglementation, la dtermination de leur priodicit et du nombre de personnes qui
V\ FRQVDFUHQW FH TXL SHUPHW GH Gpfinir un cot pour chaque acte (P) qui est
HQVXLWH PXOWLSOLp SDU OH QRPEUH GDFWHV HW GHQWUHSULVHV 4  Cela permet de
calculer le cot annuel escompt des nouvelles rglementations et de faire des
projections sur cinq dix ans.
Legislation ou rglementation
Obligation lgale dcoulant de la lgislation ou de la rglementation
Actions de mise en conformit
Temps consacr
priodicit

cot (pour les entreprises)

P = cot / temps consacr

nombre GHQWUHSULVHV concernes

Q= Total GDFWLRQV dans ODQQpH

Charges rglementaires = P X Q

Cette mthode de quantification des charges administratives est dsormais


utilise par les services de la Commission europenne ( 1 ), ainsi que par le
Royaume-Uni (2)O$OOHPDJQH (3) et de nombreux autres pays europens.
La mission a pu constater que le modle des cots standards tait
FULWLTXp HQ $OOHPDJQH SRXU VRQ FDUDFWqUH ODFXQDLUH 6LO D ODYDQWDJH de rendre
FRPSWH SUpFLVpPHQW GHV FRWV SXUHPHQW WHFKQLTXHV GXQH UpIRUPH
(indpendamment de ses cots de fonctionnemHQW LOQLQWqJUHTXXQHSDUWLHGHV
FKDUJHV DGPLQLVWUDWLYHV UpVXOWDQW UpHOOHPHQW GXQH UpIRUPH FHOOH OLpHV DX[
formalits et autres obligatLRQVGLQIRUPDWLRQjDFFRPSOLU
&HVW OD UDLVRQ SRXU ODTXHOOH OHV 1pHUODQGDLV RQW FKRLVL GH FRPSOpWHU OH
modle des cots standards  TXL SHUPHW GpYDOXHU OHV FRWV SURSUHV GXQH
rglementation, par un second modle de quantification : CAR ( Costdriven Approach to Regulatory burden ), qui SHUPHWGDSSUpKHQGHUOHVFRWVde
(1) Les lignes directrices ( Impact Assessment Guidelines ) GHV pWXGHV GLPSDFW GH OD &RPPLVVLRQ
europenne
sont
consultables
au
lien
suivant :
http://ec.europa.eu/smartregulation/impact/commission_guidelines/commission_guidelines_en.htm
(2) 9RLUOHVLQGLFDWLRQVIRXUQLHVGDQVOHPDQXHOPpWKRGRORJLTXHGpODERUDWLRQGHVpWXGHVGLPSDFWpWDEOLSDU
le EXUHDX GX PLQLVWqUH GH OeFRQRPLH GH OLQQRYDWLRQ HW GHV FRPSpWHQFHV ( BIS ) charg de
ODPpOLRUDWLRQ GH OD UpJOHPHQWDWLRQ  Better Regulation Executive - BRE), qui est consultable au lien
suivant : https://www.gov.uk/government/publications/better-regulation-framework-manual
(3) En Allemagne, le recours la mthode des cots standards pour la mesure des charges administratives
est une REOLJDWLRQOpJDOHTXLUpVXOWHGHODUWLFOHDOLQpDGHODORLdu 14 aot 2006 qui a cr le conseil
national de contrle des normes ( NKR ).

34

toutes les rglementations confondues pour une HQWUHSULVH GXQ VHFWHXU GRQQp
Cette mthode consiste, pour un secteur donn, examiner la comptabilit de ses
entreprises pour valuer les origines de ses dpenses et dterminer ainsi, parmi ses
cots, ceux qui relvent de la rglementation. Cette mthode permet de saisir
OpYROXWLRQ GX SRLGV GHV FKDUJHV UpJOHPHQWDLUHV GDQV OHV FRWV JpQpUDX[ GH
OHQWUHSULVH
De leur ct, nos voisins belges, qui dfinissent les charges
administratives comme les cots lis aux tches administratives que doivent
raliser les entreprises, les citoyens ou les associations afin de respecter leurs
REOLJDWLRQV GLQIRUPDWLRQ OpJDOHVHQYHUVOHVDXWRULWpVPrPHVLOVH[pFXWHQWGpMj
ces tches sans obligation lgale (1), ont adopt une mthode de quantification
des charges administratives qui, tout en tant base sur le modle des cots
standards  VHQ distingue quelque peu, car elle prend en compte les menues
dpenses consenties par les entreprises et les citoyens afin de respecter leurs
obligations administratives.

(1) 5DSSRUWGXEXUHDXGHPHVXUHGHO$JHQFHSRXUODVLPSOLILFDWLRQDGPLQLVWUDWLYH $6$ S

35

Cette mthode, baptise test Kafka , se prsente ainsi :


M THODE BELGE DE QUANTI FI CATI ON DES CHARGES ADM I NI STRATI VES
( TEST KAFKA )

$ILQ GpYDOXHU OHV FKDUJHV DGPLQLVWUDWLYHV QRXV XWLOLVRQV OH PRGqOH GH
mesure Kafka et les paramtres suivants :
Le temps = T TEMPS
Le tarif horaire = PTARI F HORAI RE
Les menues dpenses = PM ENUES DPENSES
La taille du groupe cible = QNOMBRE
Le temps = FFRQUENCE
Charges administratives (CA) =
[(T TEMPS X PTARIF HORAIRE) + PM ENUES DPENSES] X (QNOMBRE X FFRQUENCE)

T TEMPS

PTARI F HORAI RE

PM ENUES DPENSES

Combien de
temps faut-il
une entreprise
ou un citoyen
pour accomplir
une formalit
spcifique ?

Quel est le tarif


horaire de la
personne qui
accomplit ces
formalits ?

Quelles sont les


dpenses
consenties par
OHQWUHSULVHRXOH
citoyen afin de
respecter ses
obligations
administratives ?

QNOMBRE X
FFRQUENCE

Quelle est la
taille du groupe
cible tenu ces
formalits et
combien de fois
par an doiventils les
accomplir ?

6RXUFH5DSSRUWGXEXUHDXGHPHVXUHGHO$gence pour la simplification administrative, p. 12.

&HWWHPpWKRGHHVWPLVHHQXYUHGHIDoRQV\VWpPDWLTXHGHSXLVGDWH
compter de laquelle toute la rglementation fdrale belge a vu son impact
ILQDQFLHUPHVXUpGqVORUVTXHOOHDSRXUVHVGHVWLQDWDLUHVHWSRXUODGPLQLVWUDWLRQ
une incidence financire suprieure ou gale cinq euros. En de, le cot de
ODQDO\VHVHUDLWVXSpULHXUDX[EpQpILFHVTXLSRXUUDLHQWHQrWUHUHWLUpV
Refusant GHPHVXUHUOpYROXWLRQGHVFKDUJHVDGPLQLVWUDWLYHVDXQRPEUHGH
pages du Moniteur belge (quivalent de notre Journal Officiel), comme le fait

36

depuis longtemps la presse belge, dans la mesure o ce journal officiel comporte


non seulement des textes normatifs mais aussi de nombreux arrts de nomination,
et dans la mesure o une lgislation concise peut parfois engendrer davantage de
FKDUJHV DGPLQLVWUDWLYHV TXXQH OpJLVODWLRQ GpWDLOOpH O$JHQFH EHOJH SRXU OD
simplification administrative (ASA) VHVW GRWpH GXQ EXUHDX GH PHVXUH GHV
charges administratives ( bureau Kafka ) qui utilise le test Kafka , comme
tous les autres organismes belges (ministres et administrations centrales,
collectivits locales, entreprises, etc.).
Le recours au test Kafka SHUPHW GH PHVXUHU OpYROXWLRQ DQQXHOOH et
pluriannuelle des charges administratives, ministre par ministre (1).
En Allemagne, le bureau fdral des statistiques ( Destatis ) a dvelopp
un indice des cots de la bureaucratie ( BrokratieKostenI ndex - BKI ), qui
permet de mesurer le cot des charges administratives et qui est mis jour chaque
mois et publi sur le site Internet du bureau fdral des statistiques (2). Il offre un
DSHUoX GH OpYROXWLRQ JOREDOH GHV FKDUJHV SHVDQW VXU OHV HQWUHSULVHV HW OHV
particuliers en rfrence une base initiale (100) calcule au 1 er janvier 2012 et
FRUUHVSRQGDQWjPLOOLDUGVGHXURV/LQGLFHHVWFDOFXOpHQIRQFWLRQGHSOXVLHXUV
lments : les tches requises, le temps moyen et la frquence.
Lors du dplacement de la mission Berlin, le 12 fvrier dernier,
Mme Ulrike Beland, responsable de la coordination des positions conomiques et
de la dbureaucratisation la Chambre alOHPDQGHGHFRPPHUFHHWGLQGXVWULH
',+. DVDOXpOHFKRL[IDLWSDUOD)UDQFHGDGopter, avec le modle OSCAR ,
une mthode de calcul des charges administratives fonde sur le vcu des
entreprises et pas seulement sur les formalits et procdures administratives,
FRPPHOHVWOH modle des cots standards .
ii. Description du modle OSCAR
Afin de fournir une valuation aussi fiable et prcise que possible des
charges administratives susceptibles de rsulter pour les entreprises et les
particuliers des SURMHWVGHORLHWGDFWHVUpJOHPHQWDLUHVOH6**DpWDEOLXQPDQXHO
GDLGH DX FDOFXO GH OLPSDFW ILQDQFLHU GH OD UpJOHPHQWDWLRQ TXL ORQJ GXQH
WUHQWDLQH GH SDJHV D SRXU ILQDOLWp G uniformiser les mthodes de calcul de
manire rendre plus efficace et SOXVLQWHOOLJLEOHOHVWLPDWLRQGHVLPSDFWVGXQH
norme nouvelle .
&HPDQXHOSUpVHQWHORXWLOGHsimulation de la charge administrative de la
rglementation ( OSCAR  TXL SUHQG OD IRUPH GXQ WDEOHXU ([FHO permettant
GHVWLPHU SRXU FLQT FDWpJRULHV GDFWeurs potentiellement concerns (entreprises,

(1) Voir les tableaux n 1 et n 2 figurant en annexe n 4.


(2) Voir le tableau n 3 figurant en annexe n 4, ainsi que le lien suivant :
https://www.destatis.de/DE/ZahlenFakten/Indikatoren/Buerokratiekosten/Ergebnisse/Buerokratiekostenindex/B
uerokratiekostenindex.html

37

SDUWLFXOLHUV FROOHFWLYLWpV WHUULWRULDOHV VHUYLFHV GH OeWDW HW DXWUHV RUJDQLVPHV


FKDUJpVGXQHPLVVLRQGHVHUYLFHSXEOLF :
les charges nouvelles correspondant aux dpenses supplmentaires
dcoulant de la mise en place de la nouvelle norme, et, parmi ces charges, non
VHXOHPHQW OHV GpSHQVHV GLQYHVWLVVHPHQW HW GH PLVH HQ FRQIRUPLWp SULVHV HQ
compte dans le modle des cots standards ), mais aussi les dpenses
GLQWHUYHQWLRQ FHVW--dire les subventions et sommes verses des tiers) et les
dpenses de fonctionnement ;
OHV JDLQV HW pFRQRPLHV GpFRXODQW GH OD VXSSUHVVLRQ GXQH QRUPH RX GH
ODGRSWLRQGXQHUqJOHQRXYHOOHSOXVIDYRUDEOH
/H WDEOHDX GHVWLPDWLRQ GHV FKDUJHV pYDOXH OHV FRWV DQQXHOV GXQH
rglementation sur une priode de trois ans, prolongeable si cela apparat
pertinent. Deux types de charges sont pris en compte :
OHV FKDUJHV GDGDSWDWLRQ SRQFWXHOOHV TXL DFFRPSDJQHQW OHQWUpH HQ
vigueur de la rglementation ou la priode de transition eWTXLQRQWSDVYRFDWLRQj
VHUpSpWHU H[HPSOHDFKDWXQLTXHGXQpWK\ORWHVWSDUXQSDUWLFXOLHU ;
les charges rcurrentes qui sont rptes chaque anne, et
ventuellement plusieurs fois par an, pour tre en conformit avec la
rglementation (exemple : visites mdicales semestrielles) (1).
Le calcul des cots de la rglementation pour la premire anne
GDSSOLFDWLRQSUHQGDLQVLHQFRQVLGpUDWLRQjODIRLVOHVFKDUJHVGDGDSWDWLRQHWOHV
charges rcurrentes acquitter. Le calcul des cots de la rglementation pour les
annes suivantes ne prend gnralement en compte que des charges rcurrentes (2).
3RXU FH TXL HVW GH OpYDOXDWLRQ GHV UHYHQXV RX SURGXLWV VRQW SULV HQ
compte la fois les prestations financires ou en nature, les aides financires et
ODFFURLVVHPHQW GX FKLIIUH GDIIDLUHV. En ce qui concerne les conomies, les
administrations sont en principe tenues de chiffrer les conomies la fois
GLQYHVWLVVHPHQWGLQWHUYHQWLRQ VXSSUHVVLRQRXUpGXFWLRQGXQHSUHVWDWLRQYHUVpH
par une administration ou un organisme public) et de fonctionnement.
7DQW SRXU OpYDOXDWLRQ GHV GpSHQVHV GLQYHVWLVVHPHQW TXH SRXU FHOOH GHV
dpenses de fonctionnement, les administrations sont invites se rfrer des
bases de calcul fixes :

(1) &HVFKDUJHVGRLYHQWHQSULQFLSHIDLUHOREMHWGXQFKLIIUDJHWUqVSUpFLV3DUH[HPSOHSRXUOHVWLPDWLRQGX
FRWGHVREOLJDWLRQVGHIRUPDWLRQGHVDODULpVRXGDJHQWVOHVDGPLQLVWUDWLRQVVRQWLQYLWpHVjFDOFXOHUQRQ
seulement le nombre de VDODULpVRXGDJHQWVFRQFHUQpVSRXUFKDTXHHQWLWpOHQRPEUHGHQWLWpVFRQFHUQpHV
HWODIUpTXHQFHDQQXHOOHGHVIRUPDWLRQVPDLVDXVVLOHFRWGHVIRUPDWLRQVGLPLQXpGDLGHVpYHQWXHOOHVOHV
frais annexes de transport, de logement, de restauration et le salDLUH YHUVp DX VDODULpj ODJHQW HQ
formation.
(2) Voir le tableau n 1 figurant en annexe n 5.

38

VRLW SDU O,QVWLWXW QDWLRQDO GH la statistique et des tudes conomiques


(INSEE) ( 1 ) (XURVWDW OOrganisation de coopration et de dveloppement
conomiques (OCDE), la Banque mondiale, la Banque de France, ou encore le
Fonds montaires international (FMI) ;
soit par la mthode des cots standards (2) ;
VRLW SDU GDXWUHV conventions de calcul adoptes par nos voisins, TXLOV
soient belges (3) ou allemands (4).
Si elle ne leur est pas parfaitement identique, la mthode franaise de
TXDQWLILFDWLRQ GHV FKDUJHV DGPLQLVWUDWLYHV QHQ HVt pas moins fortement
inspire des conventions de calcul desdites charges qui sont adoptes au
niveau international, et particulirement chez nos voisins europens.
c. Les consultations facultatives et obligatoires sont largement pratiques.
Les tudes et ficKHVGLPSDFWSURGXLWHVSDUOHVDGPLQLVWUDWLRQVWURXYHQWXQ
pFODLUDJHXWLOHQRQVHXOHPHQWGDQVOHVHVWLPDWLRQVTXDQWLWDWLYHVTXHVWVXVFHSWLEOH
de fournir OSCAR PDLVDXVVLGDQVOHVDSSUpFLDWLRQVTXDOLWDWLYHVTXDSSRUWHQW
les nombreux organismes consults titre obligatoire ou facultatif.
EQ DSSOLFDWLRQ GXQH GLVSRVLWLRQ FRQVWLWXWLRQQHOOH RUJDQLTXH RX
lgislative, la transmission de certains projets GHORLDX&RQVHLOGeWDWHVWen effet
parfois soumise la consultation obligatoire de certains organismes qui
FRQWULEXHQW SDU OHXUV DYLV j RSWLPLVHU OD TXDOLWp GXQ WH[WH DYDQW VRQ GpS{W DX
Parlement. /DFWXHOOH PDMRULWp HVW GDLOOHXUV soucieuse de valoriser ces
(1)  WLWUH GH[HPSOH SRXU OH FDOFXO GHV FKDUJHV DGPLQLVWUDWLYHV SHVDQW VXU OHV SDUWLFXOLHUV OD PpWKRGH
franaise de quantification repose sur la multiplication suivante :
Temps ncessaire (en heures) pour se renseigner, runir les documents requis, remplir les formulaires, dposer
VRQ GRVVLHU OH FRPSOpWHU HW UHWLUHU OD GpFLVLRQ RX OH GRFXPHQW IDLVDQW OREMHW GH OD GHPDQGH 28 WHPSV
OLEpUpSDUODVXSSUHVVLRQGXQHREOLJDWLRQ
x nombre de particuliers concerns
[VDODLUHPR\HQKRUDLUHQHW SDUKHXUH WHOTXpWDEOLSDUO,16(( jVDYRLUHXURVKHXUH
(2) WLWUHGH[HPSOHSRXUOHVWLPDWLRQGHOLPSXWDWLRQIRUIDLWDLUHGHIUDLVJpQpUDX[ ORFDWLRQGHVEkWLPHQWV
lectricit, tlphone, connexion Internet, etc.), le tableur fourni aux administrations applique
automatiquement une majoration de 25 %, conformment aux recommandations du standard cost
model .
(3) 3RXU OHVWLPDWLRQ GX FRW OLp j ODFFRPSOLVVHPHQW GREOLJDWLRns rglementaires, les administrations
IUDQoDLVHV VRQW LQYLWpHV j VLQVSLUHU GHV HVWLPDWLRQV IDLWHV SDU O$JHQFH EHOJH SRXU OD VLPSOLILFDWLRQ
administrative (ASA). Voir le tableau n 3 figurant en annexe n 5.
(4) 3RXU OHVWLPDWLRQ GH OD GXUpH QpFHVVDLUH j ODFFRPSOLVVHPHQW GREOLJDWLRQV UpJOHPHQWDLUHV OHV
DGPLQLVWUDWLRQV IUDQoDLVHV VRQW LQYLWpHV j VLQVSLUHU GHV GXUpHV DSSUR[LPDWLYHV SRXU OD UpDOLVDWLRQ GH
WkFKHV DGPLQLVWUDWLYHV TXL RQW pWp FDOFXOpHV SDU QRV YRLVLQV DOOHPDQGV HW TXL ILJXUHQW GDQV OpGLWion
GRFWREUHGHV /LJQHVGLUHFWULFHVSRXUOLGHQWLILFDWLRQHWODSUpVHQWDWLRQGHVFRWVGHFRQIRUPLWpGDQV
les projets de loi du gouvernement fdral allemand , qui a t tablie par la Chancellerie fdrale, le
Conseil national de contrle des normes et le Bureau fdral des statistiques ( Destatis ) et qui est
consultable en langue anglaise au lien suivant :
http://www.bundesregierung.de/Content/DE/_Anlagen/Buerokratieabbau/2013-01-02erfuellungsaufwand.pdf?__blob=publicationFile&v=2
Voir le tableau n 4 figurant en annexe n 5.

39

FRQVXOWDWLRQVSUpDODEOHV&HVWODUDLVRQSRXUODTXHOOHODFRPPLVVLRQGHV/Ris de
O$VVHPEOpH QDWLRQDOH D DGRSWp OH  QRYHPEUH  XQH SURSRVLWLRQ GH ORL
organique tendant joindre les avis rHQGXVSDUOHFRQVHLOQDWLRQDOGvaluation des
normes aux projets de loi relatifs aux collectivits territoriales et leurs
groupements.
Dans son rapport sur cette proposition de loi organique, notre collgue
Olivier Dussopt D FRQVWDWp TXLO pWDLW DXMRXUGKXL H[WUrPHPHQW GLIILFLOH
GpWDEOLU XQH OLVWH H[KDXVWLYH HW DFWXDOLVpH GH WRXWHV OHV FRQVXOWDWLRQV
obligatoires prvues par la loi organique ou la loi, tant celles-ci sont
nombreuses et imposes par des textes pars. Chaque dpartement ministriel
semblant plutt se satisfaire de son propre recensement (1), notre collgue a
procd un recensement non exhaustif TXL D SHUPLV GLGHQWLfier au moins 65
instances devant tre consultes par le Gouvernement sur les projets de loi
DYDQWOHXUWUDQVPLVVLRQDX&RQVHLOGeWDW (2). &HVWGLUHVLODGpFLVLRQSXEOLTXH
GHYUDLWHQSULQFLSHrWUHpFODLUpHORUVTXXQSURMHWGHORLRXGHGpFUHWHVWH[DPLQ en
conseil des ministres.
Pourtant, ODUpDOLWpGXSURFHVVXVGpODERUDWLRQGHVpWXGHVGLPSDFWHVW
SDUIRLV ELHQ GLIIpUHQWH GX PRGqOH LGpDO TXHQ GpFULW OH JXLGH GH OpJLVWLTXH
tabli par le SGG. Ce guide indique lui-PrPHTXHQFDVGXUJHQFH FHTXLQHVW
pDV UDUH  OpWXGH GLPSDFW SHXW rWUH pODERUpH FRQFRPLWDPPHQW DX SURMHW GH ORL
GRUGRQQDQFHGHGpFUHWRXGDUUrWp
Alors que ce guide prcise que OH&RQVHLOGeWDWHVWDPHQpjSRUWHUXQH
DSSUpFLDWLRQGpWDLOOpHVXUOpWXGHGLPSDFW , M. Jean-Marc Sauv, vice-prsident
GX &RQVHLO GeWDW D LQGLTXp ORUV GH VRQ DXGLWLRQ TXH OH &RQVHLO FRQVDFUH un
temps rel mais insuffisant  DX[ pWXGHV GLPSDFW ORUVTXH OH[DPHQ GXQ WH[WH
HVWPDUTXpGXVFHDXGHOXUJHQFHIl a expliqu que ORUVTXHOH&RQVHLOGeWDWne
GLVSRVHFRPPHFHIXWQRWDPPHQWOHFDVHQHWHQTXHGXQGpODLPR\HQ
de vingt-quatre ou vingt-KXLW MRXUV SRXU OH[DPHQ GHV SURMHWV GH ORL LO SDUH DX
plus press : il vrifie la conformit du projet de loi la Constitution et le
FRUULJHVil y a lieu , au droit europen et aux engagements internationaux de la
France, et amliore, au besoin, sa cohrence interne et sa clart, ce qui est dj
beaucoup .
Par ailleurs, dDQVVRQUDSSRUWGDFWLYLWpGHPDUVFRPPHORUVGHVRQ
DXGLWLRQ ODQFLHQ FRPPLVVDLUH j OD VLPSOLILFDWLRQ 0 Rmi Bouchez, a port un
jugement svre sur le modle de quantification des charges
administratives OSCAR  TXLO D GpFULW FRPPH un outil ancien, qui avait de

(1) Rapport n 1579 fait au nom de la commission des Lois sur la proposition de loi organique n 1405,
adopte par le Snat aprs engagement de la procdure acclre, tendant joindre les avis rendus par le
FRQVHLOQDWLRQDOGpYDOXDWLRQGHVQRUPHVDX[SURMHWs de loi relatifs aux collectivits territoriales et leurs
groupements, par le dput Olivier Dussopt, p. 28.
(2) Le tableau des consultations pralables obligatoires tabli par notre collgue Olivier Dussopt dans son
rapport n 1579 est reproduit en annexe n 6.

40

graves dfauts et que les administrations, exception faite du ministre des


)LQDQFHVQHVpWDLHQWSDVFRPSOqWHPHQWDSSURSULp (1).
/D GLVWDQFH HQWUH OD WKpRULH HW OD SUDWLTXH H[SOLTXH TXLO \ DLW encore en
PDWLqUHGpYDOXDWLRQex ante GHOLPSDFWGHVQRUPHVune marge de progrs que la
PLVVLRQSUpFRQLVHGH[SORLWHU
3. /pYDOXDWLRQ ex ante GH OLPSDFW GHV QRUPHV HVW HQFRUH ingale et
structurellement oriente.

a. De nombreuses critiques pointent la partialit et les insuffisances des


tudes GLPSDFW
Tout au long des travaux de la mission a t dnonc le manque structurel
GREMHFWLYLWpGHVpWXGHVGLPSDFWTXLWLHQWjFHTXHOpWXGHGLPSDFWpODERUpHSDU
OH PLQLVWqUH SRUWHXU GXQ SURMHW GH ORL QHVW SDV VRXPLVH DX UHJDUG FULWLTXH GXQ
organiVPHH[WHUQHSUpVHQWDQWWRXWHVOHVJDUDQWLHVGLPSDUWLDOLWp
Le
VHFUpWDLUH GeWDW aux
Relations
avec
le
Parlement,
M. Jean-Marie Le *XHQ D H[SOLTXp GHYDQW OD PLVVLRQ TXH OpWXGH GLPSDFW est
SDUIRLV pWDEOLH QRQ SDV DYDQW OHQJDJHPHQW GH OD UpIRUPH PDLV alors que des
annonces ont dj t faites et que des concertations ont dj t menes , que
TXHOTXHVRLWOHGRPDLQHVLORQLQWHUURJHXQPLQLVWqUHVXUODSHUWLQHQFHGXQH
ORLDORUVTXLODGpMjGRQQpVXLWHjODGHPDQGHGXPLQLVWUHGHIDLUHFHWWHORi, il est
YUDLVHPEODEOH TXH ODGPLQLVWUDWLRQ FRQILUPHUD j VRQ PLQLVWUH TXDSUqV PUH
rflexion, elle juge cette loi trs opportune  TX en termes de fonctionnement
des organisations et de sociologie des administrations, il y a l un vritable conflit
Gintrts [car] LOHVWHQHIIHWSHXSUREDEOHTXXQPLQLVWqUHVHGpMXJHHQGpFLGDQW
DSUqVXQWUDYDLOLQWHQVHTXLOQ\DILQDOHPHQWSDVOLHXGHOpJLIpUHU . Et M. JeanMarie Le Guen de conclure : lHVpWXGHVGLPSDFWVRQWGRQFGDQVFHUWDLQVFDV
dtournHVGHOHXUEXWSUHPLHUDXOLHXGrWUHXQHDLGHjODGpFLVLRQHOOHVVRQWXQ
RXWLOGDXWRMXVWLILFDWLRQ .
Le constat de la qualit variable GHVpWXGHVGLPSDFWTXDpJDOHPHQWIDLW
OHVHFUpWDLUHGeWDWDXSUqVGX3UHPLHUPLQLVWUHFKDUJpGHOD5pIRUPHGHOeWDWHW
de la simplification, M. Thierry Mandon (2), est corrobor par les critiques que le
&RQVHLOGeWDWpPHWFKDTXHDQQpHGHSXLVGDQVVRQUDSSRUWDQQXHO, au sujet
GHODWHQHXUGHFHUWDLQHVpWXGHVGLPSDFW.
Alertant tous les ans le Gouvernement sur la dgradation continue des
conditions dans lesquelles il est saisi (3) OH &RQVHLO GeWDW D LQGLTXp GDQV VRQ
(1) Audition de M. Rmi Bouchez, ancien commissaire la simplification, le 20 fvrier 2014. Voir le
compte-rendu en annexe n 16. Adde : Rmi Bouchez, 3UHPLHU UDSSRUW GDFWLYLWp GX FRPPLVVDLUH j OD
simplification, remis au Premier ministre en mars 2012, p. 29.
(2) Interview de M. Thierry Mandon, secrtaire detat j OD 5pIRUPH GH Oetat et la simplification, sur
BFM Business le 26 juin 2014, au sujet du rle du Conseil de la simplification pour les entreprises. Cet
entretien est consultable au lien suivant : http://discours.vie-publique.fr/notices/143001435.html
(3) &RQVHLOGeWDW5DSSRUWSXEOLFS 86.

41

UDSSRUW SXEOLF SRXU ODQQpH  TXDX VXMHW GH OD UpIRUPH GH OD WD[H
professionnelle (1), il avait HVWLPpTXHQODEVHQFHGHWRXWpOpPHQWSUpVHQWDQWOHV
consquences financires pour les collectivits territoriales de la rforme de la
taxe professionnelle, les diffrentes options possibles ainsi que les mrites de
ORSWLRQ UHODWLYH j ODIIHFWDWLRQ GHV Lmpts locaux aux diffrentes catgories de
FROOHFWLYLWpV WHUULWRULDOHV UHWHQXH SDU OH SURMHW GH ORL OpYDOXDWLRQ SUpDODEOH
produite par le Gouvernement ne satisfaisait pas aux exigences de la loi
organique en ce TXL FRQFHUQH OD UXEULTXH valuation des consquences
conomiques, financires, sociales et environnementales, ainsi que des cots et
bnfices financiers attendus des dispositions envisages pour chaque catgorie
GDGPLQLVWUDWLRQVSXEOLTXHVHWGHSHUVRQQHVSK\VLTXHVHWPRUDOHVLQWpUHVVpHVHQ
indiquant la PpWKRGH GH FDOFXO UHWHQXH, alors que la production de cette
pYDOXDWLRQ VLPSRVDLW FRPSWH WHQX GH OREMHW GHV GLVSRVLWLRQV HQ FDXVH &RPSWH
WHQX GHV FRQGLWLRQV GH VD VDLVLQH OH &RQVHLO GeWDW D [alors] demand au
Gouvernement que, en tout tat de FDXVH OH 3DUOHPHQW SXLVVH GLVSRVHU GXQH
pWXGHGLPSDFWUpSRQGDQWDX[H[LJHQFHVGHODORLRUJDQLTXHDXSOXVWDUGOHMRXU
du dpt du projet sur le EXUHDXGHO$VVHPEOpHQDWLRQDOH (2) .
'DQV VRQ UDSSRUW SXEOLF SRXU ODQQpH  WRXW HQ VRXOLJQDQW XQH
WUDQVPLVVLRQSOXVV\VWpPDWLTXHGHVpWXGHVGLPSDFWjORFFDVLRQGXGpS{WLQLWLDO
des projets de texte et une amlioration de la qualit de ces tudes, plus
FRPSOqWHVSOXVpWD\pHVHWSOXVFRQIRUPHVjOREMHFWLIGpYDOXDWLRQSUpDODEOHH[LJp
par la loi organique  OH &RQVHLO GeWDW D pWp DPHQp j LQGLTXHU DX
Gouvernement :
TXHOpWXGHGLPSDFWDFFRPSDJQDQWOHSURMHWGHORLUHODWLIjODUpSDUWLWLRQ
GHV FRQWHQWLHX[ HW j ODOOqJHPHQW GH FHUWDLQes procdures juridictionnelles ( 3 )
pourrait tre utilement complte avant son dpt devant le Parlement ;
TXH OpWXGH GLPSDFW DFFRPSDJQDQW OH SURMHW GH ORL SRUWDQW UpIRUPH GHV
retraites (4) devait tre complte avant son dpt devant le Parlement ;
TXH OpWXGH GLPSDFW DFFRPSDJQDQW OH SURMHW GH ORL relatif la garde
vue
ne rpond[ait] pas, sur des points importants, aux exigences rsultant de
ODUWLFOHGHODORLRUJDQLTXH (6).
(5)

'DQV VRQ UDSSRUWSXEOLF SRXU ODQQpH  OH &RQVHLO GeWDW D UHOHYpTXH
mme si des progrs notables [taient] mettre au crdit des administrations, la
TXDOLWp GHV pWXGHV GLPSDFW RX VDJLVVDQW GHV ORLV GH ILQDQFHV GHV pYDOXDWLRQV
pralables [devait] encore tre sensiblement amliore (7) , notamment parce que
(1) Loi n 2009-1673 du 30 dcembre 2009 de finances pour 2010.
(2) &RQVHLOGeWDW5DSSRUWSXEOLFS 99.
(3) Devenu la loi n 2011-1862 du 13 dcembre 2011.
(4) Devenu la loi n 2010-1330 du 9 novembre 2010.
(5) Devenu la loi n 2011-392 du 14 avril 2011.
(6) &RQVHLOGeWDW5DSSRUWSXEOLFSS 96-97.
(7) &RQVHLOGeWDW5DSSRUWSXEOLFS 135.

42

les ministres ne suivaient pas avec tRXWH ODWWHQWLRQ UHTXLVH OHV LQVWUXFWLRQV
rsultant de la circulaire du Premier ministre du 7 juillet 2011 relative la qualit
GX GURLW TXL FRPPDQGH GpODERUHU XQH ILFKH VXU ODSSOLFDWLRQ GX WH[WH GDQV OH
temps, une autre sur son application outre-mer, un tableau de concordance entre le
GURLWGHO8QLRQHXURSpHQQHOHGURLWQDWLRQDOHWHQILQOHWH[WHFRQVROLGpLVVXGHV
modifications envisages.
6XUSOXVLHXUVSDJHVOH&RQVHLOGeWDWIRXUQLWGDQVVRQUDSSRUWSXEOLFSRXU
ODQQpH  GHV H[HPSOHV GLQVXIILVDQFHV UHOHYpHV GDQV OHV pWXGHV GLPSDFW
jointes aux projets de loi ordinaire (1), aux projets de loi de finances (2) et aux
projets de loi de programmation (3) ou caractre exprimental (4).
(QDXVVLOH&RQVHLOGeWDWDFRQVDFUpSOXVLHXUVSDJHVGH son rapport
SXEOLFjOH[SRVpGHVODFXQHVFRQVWDWpHVGDQVGLYHUVHVpWXGHVGLPSDFW (5) au sujet
GHVTXHOOHVLODUDSSHOpTXHOOHVQpWDLHQW pas un simple exercice formel , mais
TXHOOHVFRQFRXUDLHQWDXFRQWUDLUH justifier la porte et le bien-fond juridique
de la mesure envisage (6).
Comme M. Jean-0DUF 6DXYp OD H[SOLTXp GHYDQW OD PLVVLRQ LO QHVW
nullement exclu que >OH&RQVHLOGeWDW@ puisse rejeter le projet de texte dont il est
saisi, en raison du caractre totalement lacunaire ou indigent GH OpWXGH
GLPSDFW SUpFLVDQWWRXWHIRLVTX jFHMRXUFHFDVGHILJXUHQHV[tait] prsent
TXXQH IRLV GqV  DYHF OHV GLVSRVLWLRQV GXQ SURMHW GH ORL GH UDWLILFDWLRQ GH
ORUGRQQDQFH UHODWLYH j FHUWDLQHV LQVWDOODWLRQV FODVVpHV SRXU OD SURWHFWLRn de
OHQYLURQQHPHQW (7). Le Conseil GeWDWavait alors donn un avis favorable au seul

(1) ,O VDJLVVDLW QRWDPPHQW GX SURMHW GH ORL UHODWLI j OD GpRQWRORJLH HWj OD SUpYHQWLRQ GHVFRQIOLWV GLQWpUrWV
GDQVODYLHSXEOLTXHHWGXQSURMHWGHORLSRUWDQWGLYHUVHVGLVSRVLWLRQVGDGDSWDWLRQGDQVOHGRPDLQHGHOD
MXVWLFH HQ DSSOLFDWLRQ GX GURLW GH OUnion europenne et des engagements internationaux de la France
(devenu la loi n 2013-711 du 5 aot 2013).
(2) ,OVDJLVVDLWGHGHX[SURMHWVGHORLGHILQDQFHVUHFWLILFDWLYHSRXUHWGXSURMHWGHORLGHILQDQFHVSRXU
2012 (devenu la loi n 2011-1977 du 28 dcembre 2011).
(3) ,OVDJLVVDLWGXSURMHWGHORLGHSURJUDPPDWLRQUHODWLIjOH[pFXWLRQGHVSHLQHV GHYHQXODORLQ 2012-409
du 27 mars 2012).
(4) ,OVDJLVVDLWGXSURMHWGHORLUHODWLIjODSDUWLFLSDWLRQGHVFLWR\HQVDXIRQFWLRQQHPHQWGHODMXVtice pnale et
au jugement des mineurs (devenu la loi n 2011-939 du 10 aot 2011).
(5) ,OVDJLVVDLWGHODORLQ 2012-1509 du 29 dcembre 2012 de finances pour 2013 ainsi que des projets de
loi :
- SRUWDQW GLYHUVHV GLVSRVLWLRQV HQ PDWLqUH GLQIUDVWUXFWXres et de services de transport (devenu la loi
n 2013-431 du 28 mai 2013) ;
- portant rforme bancaire et financire (devenu la loi n 2013-672 du 26 juillet 2013 de sparation et de
rgulation des activits bancaires) ;
- SRUWDQW GLYHUVHV GLVSRVLWLRQV GDGDSWDWLRQ GH OD OpJLVODWLRQ DX GURLW GH O8QLRQ HXURSpHQQH HQ PDWLqUH
conomique et financire (devenu la loi n 2013-100 du 28 janvier 2013) ;
- DXWRULVDQW OD UDWLILFDWLRQ GX WUDLWp VXU OD VWDELOLWp OD FRRUGLQDWLRQ HW OD JRXYHUQDQFH DX VHLQ GH O8QLRQ
conomique et montaire (devenu la loi n 2012-1171 du 22 octobre 2012) ;
- portant cration du contrat de gnration (devenu la loi n 2013-185 du 1er mars 2013).
(6) &RQVHLOGeWDW5DSSRUWSXEOLFS 181.
(7) Ordonnance n 2009-663 du 11 juin 2009 UHODWLYH j OHQUHJLVWUHPHQW GH FHUWDLQHV LQVWDOODWLRQV FODVVpHV
SRXUODSURWHFWLRQGHOHQYLURQQHPHQW

43

DUWLFOHGHUDWLILFDWLRQUHMHWDQWWRXWHVOHVDXWUHVGLVSRVLWLRQVTXLQpWDLHQWDVVRUWLHV
GDXFXQHpWXGHGLPSDFW
Lors de la table ronde runissant des universitaires laquelle il a particip,
M. Bertrand du Marais FRQVHLOOHU GeWDW et professeur de droit public
O8QLYHUVLWp 3DULV 2XHVW 1DQWHUUH-La Dfense), D H[SOLTXp j OD PLVVLRQ TXLO
menait avec ses tudiants, depuis septembre 2009, une analyse des tudes
GLPSDFW destine DERXWLU j XQ FODVVHPHQW GX W\SH *DXOW HW 0LOODX GHV
pWXGHVGLPSDFWGHODSOXVFRPSOqWHODSOXVOLVLEOHHWODSOXVSHUWLQHQWHMXVTXjOD
moins satisfaisante .
2UOH[DPHQGXQpFKDQWLOORQGXQHTXDUDQWDLQHGpWXGHVGLmpact a conduit
M. Bertrand du Marais dresser un constat non pas dsabus, mais mitig sur la
TXDOLWp HW OH FRQWHQX GHV pWXGHV GLPSDFW  MXVTXLFL SURGXLWHV SDU OHV
administrations. Il a cit plusieurs exemples, dont ceux :
GH OpWXGH GLPSDFW DFFRPpagnant le projet de loi de programmation
militaire pour 2014-2019 ( 1 ), marque, selon lui, par ODEVHQFH WRWDOH
GLQIRUPDWLRQVSRXUTXatre des critres fixs par la loi organique du 15 avril 2009,
SDUPL OHVTXHOV OpYDOXDWLRQ GHV FRQVpTXHQFHV HQYLURQQHPHQWales, la prsentation
GHVSRVVLELOLWpVDXWUHVTXHORSWLRQOpJLVODWLYHODQDO\VHTXDQWLWDWLYHHWOH[SRVpGH
la mthode de calcul ;
GH OpWXGH GLPSDFW jointe au projet de loi de sparation et de rgulation
GHVDFWLYLWpVEDQFDLUHVROpYDOXDWLRQGHVFRQVpTXHQFHVILQDQFLqUHVQpWDLWIDLWH
pour aucun des titres du texte, une exception prs. ,OQ\DYDLWQLTXDQWLILFDWLRQ
ni indication de la mthode de calcul retenue ;
GH OpWXGH GLPSDFW GX SURMHW GH ORL UHODWLI DX *UDQG 3DULV ( 2 ) : les
incidences budgtaires y taient certes examines, mais aucune mthode de calcul
QpWDLWLQGLTXpH .
La mission partage le point de vue de M. Bertrand du Marais, pour qui les
pWXGHV GLPSDFW VH FDUDFWpULVHQW SDU XQH JUDQGH GLYHUVLWp HW XQH LQpJDOLWp GH
cRQWHQXV 1RPEUH GHQWUH HOOHV QH VDWLVIRQW SDV PrPH IRUPHOOHPHQW DX[
REOLJDWLRQVGHODORLRUJDQLTXH(QSDUWLFXOLHUODPpWKRGHGHFDOFXOUHWHQXHQHVW
quasiment jamais indique VRXYHQW SRXU OD VLPSOH HW ERQQH UDLVRQ TXLO Q\ D
SDV GpYDOXDWLRQ TXDQWifie des impacts des dispositions que le Gouvernement
SURSRVHDX3DUOHPHQWGDGRSWHU .
La norme gagnerait en qualit si les dbats parlementaires consacraient
GDYDQWDJH GH WHPSV j XQ H[DPHQ DSSURIRQGL GHV pWXGHV GLPSDFW GRQW OHV
assembles se saisissent encore trop peu.

(1) Devenu la loi n 2013-1168 du 18 dcembre 2013 relative la programmation militaire pour les annes
2014 2019 et portant diverses dispositions concernant la dfense et la scurit nationale.
(2) Devenu la loi n 2010-597 du 3 juin 2010.

44

b. Des tudes dont le Parlement se saisit encore trop peu


/DSODFHTXHQRWUHDVVHPEOpHDFFRUGHjODTXDOLWpGHVpWXGHVGLPSDFWlors
des dbats en commission et en sance publique est encore trop faible.
(OOH WHQG WRXWHIRLV j VDFFURvWUH FRPPH ORQW PRQWUp SRXU QH FLWHU TXH
deux exemples, les dbats ayant eu lieu en 2010 en commission des Affaires
VRFLDOHV DXWRXU GH OpYDOXDWLRQ GH OLPSDFW ILQDQFLHU GX SURMHW GH ORL GH UpIRUPH
des retraites (1 ) ou, plus rcemment, les dbats en commission des Lois et en
VpDQFH SXEOLTXH DXWRXU GH OpYDOXDWLRQ GHV FRQVpTXHQFHV VRFLDOHV ILQDQFLqUHV HW
juridiques du projet de loi ouvrant le mariage aux couples de personnes de mme
sexe (2) .
/HGHJUpGHODWWHQWLRQTXHOHVSDUOHPHQWDLUHVSRUWHjODTXDOLWpGHV tudes
GLPSDFW HVW UHIOpWp SDU OLQYRFDWLRQ GH FHW DUJXPHQW en aval des dbats,
ODSSXLGHVVDLVLQHVGX&RQVHLOFRQVWLWXWLRQQHOVXUOHIRQGHPHQWGHODUWLFOH
de la Constitution, dans le cadre du contrle de constitutionnalit a priori.
2U GHSXLV Oentre en vigueur, le 1er septembre 2009, de la loi organique
GXDYULOOH[LVWHQFHHWODTXDOLWpGHVpWXGHVGLPSDFWQRQWpWpLQYRTXpHV
TXj ODSSXL GH KXLW VDLVLQHV UHODWLYHV j GHV SURMHWV GH ORL RUGLQDLUH (3), dont six
depuis le dbut de la prsente lgislature, tandis que les conditions procdurales
GX FRQWU{OH GH OD TXDOLWp GHV pWXGHV GLPSDFW SDU OD &RQIpUHQFH GHV SUpVLGHQWV

(1) Devenu la loi n 2010-1330 du 9 novembre 2010 portant rforme des retraites. Voir notamment le
compte-rendu n 70 de la sance de la commission des Affaires sociales du mardi 20 juillet 2010, qui est
consultable au lien suivant : http://www.assemblee-nationale.fr/13/cr-soc/09-10/c0910070.asp
(2) Devenu la loi n 2013-404 du 17 mai 2013. Voir notamment le compte-rendu intgral de la premire sance
du samedi 2 fvrier 2013, qui est consultable au lien suivant : http://www.assembleenationale.fr/14/cri/2012-2013/20130127.asp
(3) ,OVDJLWGHVVDLVLQHVUHODWLYHV :
- la loi n 2010-145 du 16 fvrier 2010 organisant la concomitance des renouvellements des conseils
gnraux et des conseils rgionaux (Conseil constitutionnel, dcision n 2010-603 DC du 11 fvrier 2010,
considrants n 3 5) ;
- la loi n 2010-1563 du 16 dcembre 2010 de rforme des collectivits territoriales (Conseil constitutionnel,
dcision n 2010-618 DC du 9 dcembre 2010, considrants n 4, n 7 et n 8) ;
- la loi n 2013-403 du 17 mai 2013 relative llection des conseillers dpartementaux, des conseillers
municipaux et des conseillers communautaires, et modifiant le calendrier lectoral (Conseil constitutionnel,
dcision n 2013-667 DC du 16 mai 2013, considrants n2 n 4) ;
- la loi n 2013-404 du 17 mai 2013 ouvrant le mariage aux couples de personnes de mme sexe (Conseil
constitutionnel, dcision n 2013-669 DC du 17 mai 2013, considrants n 2 n 4) ;
- la loi n 2014-40 du  MDQYLHU  JDUDQWLVVDQW Oavenir et la justice du systme de retraites (Conseil
constitutionnel, dcision n 2013-683 DC du 16 janvier 2014, considrants n 2 n 6) ;
- la loi n 2014-58 du 27 janYLHUGHPRGHUQLVDWLRQGHOacWLRQSXEOLTXHWHUULWRULDOHHWGaffirmation des
mtropoles (Conseil constitutionnel, dcision n 2013-687 DC du 23 janvier 2014, considrants ns 7, 9, 11,
12, 14 16 et 48) ;
- la loi n 2014-344 du 17 mars 2014 relative la consommation (Conseil constitutionnel, dcision
n 2014-690 DC du 13 mars 2014, considrants n 45 n 48) ;
- la loi n 2014- GX  PDUV  SRXU Oaccs au logement et un urbanisme rnov (Conseil
constitutionnel, dcision n 2014-691 DC du 20 mars 2014, considrants n 49 n 53).

45

QRQW pWp LQYRTXpHV TXj ODSSXL GH GHX[ VDLVLQHV UHODWLYHV j GHV SURMHWV GH ORL
ordinaire (1).
Ces donnes suggrent que les parlementaires commencent VDSSURSULHU
OHVHQMHX[OLpVjOvaluation ex ante GHOLPSDFWGHVQRUPHVTXLOVVRQWDSSHOpVj
YRWHUPDLVTXLOVSRXUUDLHQWDOOHUHQFRUHSOXVORLQGDQVFHVHQV
/RSLQLRQ SXEOLTXH QH VHPEOH SDV GDYDQWDJH VrWUH HPSDUpH des
SRWHQWLDOLWpV TXRIIUHOH 5qJOHPHQWGH O$VVHPEOpH QDWLRQDOH SRXU ODVVRFLHU j OD
UpIOH[LRQ GHV GpSXWpV VXU OpYDOXDWLRQ SUpDODEOH GH OLPSDFW GHV WH[WHV GH ORL
/DUWLFOHGX5qJOHPHQWGHQRWUHDVVHPEOpHSUpYRLWHQHIIHWTXH les documents
qui renGHQW FRPSWH GH OpWXGH GLPSDFW UpDOLVpH VXU XQ SURMHW GH ORL VRXPLV HQ
SUHPLHUOLHXjO$VVHPEOpH >@ sont mis disposition par voie lectronique, afin
de recueillir toutes les observations qui peuvent tre formules . Nos concitoyens
SHXYHQW GRQF GpSRVHU VXU OH VLWH ,QWHUQHW GH O$VVHPEOpH QDWLRQDOH OHXUV
REVHUYDWLRQVVXUOpWXGHGLPSDFWMRLQWHjXQSURMHWGHORL&HVFRQWULEXWLRQVVRQW
ensuite transmises au(x) dput(s) nomm(s) rapporteur(s) du projet de loi et leur
V\QWKqVH SHXW HQ DSSOLFDWLRQ GH ODUWLFOH  DOLQpD  GX 5qJOHPHQW GH QRWUH
assemble, tre annexe DXUDSSRUWSUpVHQWpjODFRPPLVVLRQFKDUJpHGHOH[DPHQ
dudit projet de loi. Au 30 aot dernier, on dnombrait 36 projets de loi dont les
pWXGHVGLPSDFWSRXYDLHQWGRQQHUOLHXDXGpS{WGREVHUYDWLRQVSDUOHSXEOLF
Or cette facult demeure extrmement peu utilise au regard des
QRPEUHX[SURMHWVGHORLH[DPLQpVSDUO$VVHPEOpHQDWLRQDOH'HSXLVVHXOV
quelques textes ont suscit des contributions de la part de nos concitoyens, parmi
lesquels la loi GX  MXLQ  UHODWLYH j OLPPLJUDWLRQ j OLQWpJUDWLRQ HW j OD
nationalit (194 contributions) et la loi du 17 mai 2013 ouvrant le mariage aux
couples de personnes de mme sexe (431 contributions la date du dbut de
OH[DPHQ GX WH[WH HQ FRPPLVVLRQ GHV /RLV GRQW VHXOHPHQW  SRUWDLHQW VXU OD
TXDOLWpGHOpWXGHGLPSDFWDFFRPSDJQDQWOHSURMHWGHORLHWQRQVXUOHFRQWHQXGX
WH[WHVRXPLVjO$VVHPEOpHQDWLRQDOH 
c. Des tudes dont le contenu pourrait tre enrichi
/DSSURSULDWLRQHQFRUHLPSDUIDLWHGHODGpPDUFKHGHOpYDOXDWLRQ ex ante
SHXWrWUHFRQVWDWpHQRQVHXOHPHQWFKH]OHVSDUOHPHQWDLUHVHWDXVHLQGHORSLQLRQ
SXEOLTXH PDLV DXVVL DX VHLQ GHV DGPLQLVWUDWLRQV 'H ODYHX PrPH GX VHFUpWDLUH
gnral du Gouvernement, M. Serge Lasvignes, OHVpWXGHVGLPSDFWUHVVHPEOHQW
GDYDQWDJH j OKHXUH DFWXHOOH j XQ H[SRVp GHV PRWLIV HQULFKL TXDX PRGqOH GH
O2UJDQLVDWLRQ GH FRRSpUDWLRQ HW GH GpYHORSSHPHQW pFRQRPLTXH 2&'(  SRXU
ODTXHOOHOpWXGHGLPSDFWVHUWjDjuster le dispositif qui sera retenu .

(1) ,OVDJLWGHVVDLVLQHVUHODWLYHV :
- la loi n 2011- GX  MXLQ  UHODWLYH j OLPPLJUDWLRQ j Ointgration et la nationalit (Conseil
constitutionnel, dcision n 2011-631 DC du 9 juin 2011, considrants n 2 n 4) ;
- la loi n 2014- GX  MDQYLHU  JDUDQWLVVDQW ODYHQLU HW OD MXVWLFH GX V\VWqPH GH UHWUDLWHV &RQVHLO
constitutionnel, dcision n 2013-683 DC du 16 janvier 2014, considrants n 2 n 6).

46

Il est en effet apparu au gr des travaux de la mission que les tudes


GLPSDFWSRXYDLHQWYRLUOHXUWHQHXUHQULFKLHjSOXVLHXUVpJDUGV
i. Rendre obligatoire, pour les textes lgislatifs, la ralisation de tests
entrHSULVHVFROOHFWLYLWpVORFDOHVHWXVDJHUVGHODGPLQLVWUDWLRQ
Lors du FRPLWpLQWHUPLQLVWpULHOSRXUODPRGHUQLVDWLRQGHODFWLRQSXEOLTXH
du 18 dcembre 2012, il a t dcid de soumettre certains SURMHWV GDFWHV
rglementaires concernant les entreprises qui, depuis 2011, doivent par ailleurs
IDLUH OREMHW GXQH ILFKH GLPSDFW un test PME permettant GpYDOXHU
GLUHFWHPHQW DYHF OHV HQWUHSULVHV OHV FRQVpTXHQFHV GXQH UpJOHPHQWDWLRQ HW G\
apporter des modifications afin de faciliter son application (1).
0LVH HQ XYUH SDU OHV GLUHFWLRQV UpJLRQDOHV GHV HQWUHSULVHV GH OD
FRQFXUUHQFH GH OD FRQVRPPDWLRQ GX WUDYDLO HW GH OHPSORL ',5(&&7(  FHWWH
mthode de consultation innovante vise dterminer spcifiquement les
consquences concrtes et la complexit de nouvelles mesures forts enjeux
DXSUqVGXQpFKDQWLOORQUpGXLWGXQHTXLQ]DLQHGH73(30(HW(7,6XUODEDVH
des remarques et des alternatives avances par les entreprises, des amendements
peuvent tre apports la mesure.
Expriment dbut 2013 VXUOHVGpFUHWVGDSSOLFDWLRQUHODWLIVjODEDQTXH
SXEOLTXH GLQYHVWLVVHPHQW %3,  OH test PME a permis, par la suite, de
simplifier SOXVLHXUV SURMHWV GDFWHV UpJOHPHQWDLUHV FRPPH le projet de dcret
relatif la signaltique commune de tri.
Lors de son audition par la mission, M. Nicolas Conso, chef du service
innovation et services aux usagers au Secrtariat gnral pour la modernisation de
O
DFWLRQ SXEOLTXH 6*0$3  D VRXOLJQp TXH OHV pWXGHV GLPSDFW pWDLHQW
KDELWXHOOHPHQW FHQWUpHV VXU Ovaluation quantitative et que FH TXLO
FRQYLHQGUDLWGDSSURIRQGLUFHVWOpYDOXDWLRQTXDOLWDWLYHjVDYRLUOLPSDFWGHOD
IXWXUHQRUPHVXUORUJDQLVDWLRQGHVHQWUHSULVHV &HVWODUDLVRQGrWUHGX test
PME qui, ralis une dizaine de reprises GHSXLVGpEXWHVWPLVHQXYUH
selon une mthode dsormais rode .
Selon M. Nicolas conso, chacun des tests qui ont t mens par exemple
sur les obligations en matire de tri, sur la scurit des transporteurs de fonds ou
sur les indications gographiques du type Laguiole D SHUPLV GREVHUYHU GHV
lments qualitatifs que la simple valuation thorique ne faisait pas ressortir : il
DDLQVLpWpSRVVLEOHGDIILQHUOHVSURMHWVGHWH[WHVUpJOHPHQWDLUHVHWGHSUpYRLUOD
mise en place ds le dbut GHPHVXUHVGDFFRPSDJQHPHQWSHUPHWWDQWGDWWHLQGUH
les objectifs assigns. Ces tests ayant commenc de faire leurs preuves, il serait
dsormais possible de les rendre plus systmatiques et plus obligatoires dans le
FDGUH GHV pWXGHV GLPSDFW FHVW SUpYX , voire de les tendre aux textes
lgislatifs .
(1) Cette dcision a t acte par la circulaire n 5630/SG du Premier ministre du 9 janvier 2013 relative la
PRGHUQLVDWLRQGHODFWLRQSXEOLTXH

47

/D PLVVLRQ HVWLPH TXLO Q\ D SDV OLHX GH UpVHUYHU FHWWH GpPDUFKH
GpYDOXDWLRQ DXMRXUGKXL IDFXOWDWLYH aux seuls SURMHWV GDFWHV UpJOHPHQWDLUHV
concernant les entreprises, mais que, bien au contraire, la ralisation de tests
semblables devait tre entreprise, titre obligatoire, SRXU OHQVHPEOH GHV SURMHWV
GH ORL TXLOV DIIHFWHQW OHV HQWUHSULVHV OHV FROOHFWLYLWpV WHUULWRULDOHV RX OHV
SDUWLFXOLHUVXVDJHUVGHODGPLQLVWUDWLRQ
&HVWODUDLVRQSRXUlaquelle la mission prconise de rendre obligatoire,
pour les textes lgislatifs, HW VHORQ OREMHW GH OD UpIRUPH HQYLVDJpH la
UpDOLVDWLRQGXQ test entreprises (ce type de test ne devant pas concerner
OHVVHXOHV30( HWRXGXQ test collectivits territoriales HWRXGXQ test
XVDJHUVGHODGPLQLVWUDWLRQ .
Ces tests gagneraient jVHQRXUULUGHVFRQWULEXWLRQVTXXQFHUWDLQQRPEUH
de parlementaires, comme notre collgue Ccile Untermaier, peuvent recueillir
dans le cadre des ateliers lgislatifs citoyens  TXLOV RUJDQLVHQW GDQV OHXU
circonscription ( 1 ) 9RWUH UDSSRUWHXU VRXOLJQH OLQWpUrW TXH GH WHOOHV LQLWLDWLYHV
peuvent prsenter pour rinventer la politique en associant plus activement nos
concitoyens aux discussions des projets et propositions de loi. Les remarques
formules dans le cadre de ces ateliers participatifs aussi bien par des particuliers,
des associations, que des syndicats, des administrations ou des FKHIVGentreprises
VRQW HQ HIIHW VXVFHSWLEOHV GDSSRUWHU XQ pFODLUDJH IRUW XWLOH VXU OHV implications
concrtes des dispositifs dont la rforme est envisage.
ii. $PpOLRUHU OpYDOXDWLRQ GHV FRWV HW EpQpILFHV pFRQRPLTXHV DLQVL TXH
des consquences socitales des mesures envisages
M. 1LFRODV &RQVR QHVW SDV OD VHXOH SHUVRQQH HQWHQGXH SDU OD mission
DYRLU SRLQWp OHV ODFXQHV GHV pWXGHV GLPSDFW HQ PDWLqUH GpYDOXDWLRQ GHV
FRQVpTXHQFHVpFRQRPLTXHV0%HUWUDQGGX0DUDLVFRQVHLOOHUGeWDWHWSURIHVVHXU
GHGURLWSXEOLFjO8QLYHUVLWp3DULV2XHVW 1DQWHUUH-/D'pIHQVH FLWDQWOH[HPSOH
des dispositions lgislatives sur la scurit des ascenseurs, a soulign, lors de son
audition, que F[tait] XQHFKRVHGpYDOXHUOHFRWILQDQFLHUGHODUpIHFWLRQGHV
ascenseurs pour les syndicats de coproprit et les bailleurs sociaux , mais que
FHQ [tait] une autre de raliser une vritable analyse conomique, qui aurait
SHUPLV GH UHPDUTXHU TXH pWDQW GRQQp TXLO QH[LVWH TXH GHX[ RX WURLV
DVFHQVRULVWHV VXU OH PDUFKp OH ULVTXH pWDLW JUDQG GXQH SDUW TXH OHV FRWV
H[SORVHQWGDXWUHSDUWTXHORIIUHQHSuisse pas rpondre la demande ! .
Le secrtaire gnral du Gouvernement lui-mme, M. Serge Lasvignes, a
fait part la mission de ce que si des efforts ont t raliss en matire de
quantification, la dimension conomique demeure insuffisante et doit tre
amliore .

(1) Sur les ateliers lgislatifs citoyens , voir la contribution de notre collgue Ccile Untermaier, annexe
au prsent rapport.

48

9RWUHUDSSRUWHXUQHFLWHUDTXXQH[HPSOH : FHOXLGHOpWXGHGLPSDFWMRLQWH
DXSURMHWGHORLUHODWLIjOpFRQRPLHVRFLDOHHWVROLGDLUHGHYHQXODORLQ 2014-856
du 31 juillet 2014 &HWWH pWXGH VLWXDLW OLPSDFW GX SURMHW GH ORL HQ WHUPes de
FUpDWLRQVGHPSORLV GDQV OHVHFWHXUGHV DVVRFLDWLRQVGHVFRRSpUDWLYHV jpFKpDQFH
de quatre cinq ans, dans une fourchette allant de 100 000 200 000 soit une
valuation allant du simple au double (1).
Au-del des consquences conomiques, ce sont les consquences
sociales et socitales qui apparaissent parfois mal values dans les tudes
GLPSDFW. Il apparat par exemple pour le moins surprenant que la partie de
OpWXGH GLPSDFW FRQVDFUpH j ODUWLFOH  GX SURMHW GH ORL de financement de la
scurit sociale pour 2014 (devenu la loi n 2013-1203 du 23 dcembre 2013), qui
SURSRVDLW GKDUPRQLVHU OHV UqJOHV GH SUpOqYHPHQW DSSOLFDEOHV DX[ SURGXLWV GH
SODFHPHQW HW GH PHWWUH ILQ j ODSSOLFDWLRQ GHV taux historiques pour des
SURGXLWV GpSDUJQH SULVpV Ges classes moyennes et populaires, indiquait, dans la
rubrique impacts sociaux : sans objet . La vive raction des petits
pargnants qui a conduit le Gouvernement renoncer aligner par le haut la
ILVFDOLWp GHV SODQV GpSDUJQH HQ DFWLRQV 3($  GHV SODQV GpSDUJQH-logement
(PEL) et des produits GDVVXUDQFH-YLH HW GpSDUJQH VDODULDOH D PRQWUp TXH OD
UpIRUPHHQYLVDJpHpWDLWORLQGrWUHGpQXpHde telles consquences, contrairement
ce que VXJJpUDLWOpWXGHGLPSDFW
/D PLVVLRQ UHFRPPDQGH GRQF GDPpOLRUHU OpYDOXDWLon des
consquences conomiques, sociales et socitales des mesures envisages.
iii. Fournir une analyse et une justification approfondies des mesures
WUDQVLWRLUHVHWGHVGDWHVGHQWUpHHQYLJXHXUUHWHQXHV
Si le guide de lgistique tabli par le SGG recommande bien de rflchir
SUpFLVpPHQW ORUV GH OpODERUDWLRQ GXQH pWXGH GLPSDFW j OD GpWHUPLQDWLRQ GHV
FRQGLWLRQVGDSSOLFDWLRQGDQVOHWHPSVGXQHUpIRUPH entre en vigueur diffre
pour assurer aux entreprises ou aux particuliers une prvisibilit suffisante et
adapter leurs choix en temps utile, dispositions transitoires permettant de garantir
une scurit juridique pour les situations constitues ou procdures en cours,
DQDO\VH GH OLPSDFW GH OD UpWURDFWLYLWp OH FDV pFKpDQW GH FHUWaines dispositions
lgislatives ), force est de constater que cela reste parfois XQYXSLHX
9RWUHUDSSRUWHXU HQ YHXW SRXU SUHXYH Ovaluation dfectueuse de la date
GHQWUpH HQ YLJXHXU GX GLVSRVLWLI GX compte personnel de prvention de la
pnibilit, prvu par la loi n 2014-GXMDQYLHUJDUDQWLVVDQWODYHQLUHW
la justice du systme de retraites.
Faute GXQH pWXGH GLPSDFW SUpFLVH HW FRPSOqWH SHUPHWWDQW GpYDOXHU OH
WUDYDLOQpFHVVDLUHSRXUpODERUHUXQWHOFRPSWHTXLVRLWVLPSOHGXWLOLVDWLRQSour les
salaris comme pour les entreprises, le Premier ministre a d annoncer, le
1er MXLOOHWGHUQLHUOHUHSRUWSDUWLHOjGHOHQWUpHHQYLJXHXUGHFHGLVSRVLWLITXL
(1) eWXGHGLPSDFWMRLQWHDXSURMHWGHORLUHODWLIjOpFRQRPLHVRFLDOHHWVROLGDLUHMXLOOHWS 21 et p. 26.

49

tait fixe par la loi prcite au 1er janvier 2015. Ce report partiel a pu susciter des
dceptions la hauteur des grandes esprances que la loi du 20 janvier 2014 avait
suscites.
,O HVW GRQF HVVHQWLHO TXH OHV pWXGHV GLPSDFW QH VH FRQWHQWHQW SDV
GLQGLTXHUOHVGDWHVGHQWUpHHQYLJXHXUHWOHVpYHQWXHOOHVPHVXUHVWUDQVLWRLUHV
sans les justifier par une analyse approfondie.
Or, ce sujet, le vice-SUpVLGHQWGX&RQVHLOGeWDW, M. Jean-Marc Sauv, a
H[SOLTXp j OD PLVVLRQ TXH VL OHV PHPEUHV GX &RQVHLO GeWDW pWDLHQW trs
attentifs aux mesures transitoires aussi bien sur les textes rglementaires que sur
OHV SURMHWV GH ORL LOV QDYDLHQW jamais t saisis, [s]D FRQQDLVVDQFH GpWXGHV
GLPSDFWjFHSRLQWSUpFLVHVTXHOOHVSHUPHWWUDLHQW par exemple sur le compte de
prvention de la pnibilit GpFODLUHUXWLOHPHQWODUpIOH[LRQGX*Ruvernement .
iv. ,QWpJUHU OH[LJHQFH GH TXDQWLILFDWLRQ GHV FKDUJHV DGPLQLVWUDWLYHV
supprimes en contrepartie et hauteur des charges administratives
cres ( one-in, one-out  DXMRXUGKXL FLUFRQVFULWH DX[ WH[WHV
rglementaires
Depuis le 1er septembre 2013, en application de la circulaire du Premier
ministre n 6* GX  MXLOOHW  HVW PLV HQ XYUH XQ JHO GH OD
rglementation, YLVDQWjVXSSULPHUXQHQRUPHH[LVWDQWHSRXUWRXWHFUpDWLRQGXQH
nouvelle norme. En vertu de ce moratoire un pour un qui concerne tous les
SURMHWV GDFWHV UpJOHPHQWDLUHV j OH[FHSWLRQ notable de ceux pris en application
GXQH QRUPH VXSpULHXUH ORL RX GLUHFWLYH HXURSpHQQH  WRXW SURMHW GH WH[WH
rglementaire nouveau crant des charges pour les entreprises, les collectivits
WHUULWRULDOHV RX OH SXEOLF QHVW DGRSWp TXH VLO VDFFRPSDJQH j WLWUH GH gage ,
GXQHVXSSUHVVLRQGHPHVXUHVH[LVWDQWHVHQJHQGUDQWGHVFKDUJHVpTXLYDOHQWHV
Le Gouvernement a ainsi introduit en droit franais la pratique britannique
du one-in, one-out qui, instaure au Royaume-Uni en septembre 2010 et
applique partir du 1er MDQYLHUFRPPDQGHTXDXFXQHQRUPHOpJLVODWLYHRX
rglementaire impliquant de nouvelles charges pour les entreprises ne puisse tre
adopt sans que ne soit supprime une norme gnrant des charges quivalentes
(en termes de cot de mise en conformit et non uniquement de charges
DGPLQLVWUDWLYHV  j OH[FHSWLRQ GHV SURMHWV GH WH[WHV UHODWLIV j OD ILVFDOLWp RX SULV
SRXUODWUDQVSRVLWLRQGXQHGLUHFWLYHHXURSpHQQH
Au 31 dcembre 2012, la rgle du one-in, one-out , aurait permis, selon
le gouvernement britannique, de rduire les charges annuelles pesant sur les
HQWUHSULVHVGHPLOOLRQVGHOLYUHVVWHUOLQJVRLWHQYLURQPLOOLRQVGHXURV
Face ce succs, le gouvernement britannique a tendu son initiative et la
rgle est devenue, depuis le 1er janvier 2013, celle du one-in, two-out : les
charges administratives rsultant pour les entreprises de la cration de nouvelles
normes doivent tre compenses par la suppression de normes existantes
HQJHQGUDQW OH GRXEOH GH FKDUJHV /LPSDFW DWWHQGX GH FHWWH QRXYHOOH PHVXUH

50

GHYUDLWSRUWHUODOOqJHPHQWGHFKDUJHVSHVDQWVXUOHVHQWUHSULVHV 919 millions de


OLYUHVVWHUOLQJVRLWHQYLURQPLOOLDUGGHXURV
Le bureau du minisWqUHGHOeFRQRPLHGHOLQQRYDWLRQHWGHV comptences
FKDUJp GH ODPpOLRUDWLRQGH OD UpJOHPHQWDWLRQ Better Regulation Executive BRE ) MRXH XQ U{OH HVVHQWLHO GDQV OD PLVH HQ Xvre du programme one-in,
two-out , car cHVWOXLTXLWRXVOHVVL[mois, publie un rapport dressant le bilan de
ODYDQFHPHQW du programme et tablissant un classement des ministres (1).
(Q )UDQFH GDSUqV OHV LQIRUPDWLRQV TXD SX REWHQLU YRWUH UDSSRUWHXU OD
PLVH HQ XYUH GX PRUDWRLUH  XQ SRXU XQ  HQ PDWLqUH rglementaire depuis le
1er VHSWHPEUH  D SHUPLV MXVTXj DXMRXUGKXL GDOOpJHU GH  PLOOLRQV
GHXURV OHV FKDUJHV DGPLQLVWUDWLYHV SHVDQW VXU OHV HQWUHSULVHV OHV FROOHFWLYLWpV
territoriales ou le public. Le chiffrage des charges supprimes et des charges
nouvellement cres a permis de faire ressortir que seuls 14 % des textes
rglementaires ceux qui ont les plus forts impacts (suprieurs 10 millions
GHXURVHQYDOHXUDEVROXH  reprsentaient plus de 80 GHOHQVHPEOHGHVFRWV
ou gains constats pour les entreprises, soit environ 50 textes rglementaires
depuis le 1er septembre 2013. Ce chiffrage a galement permis de noter que
OHVVHQWLHO GH OD SURGXFWLRQ QRUPDWLYH pPDQDLW GH WURLV S{OHV PLQLVWpULHOV :
OeFRQRPLHHWOHV)LQDQFHVO(QYLURQQHPHnt et le Logement, les Affaires sociales
et le Travail.
&RQYDLQFXHGHVYHUWXVGHOH[HPSOHEULWDQQLTXHODmission considre
que le principe GXQHFRPSHQVDWLRQGH nouvelles charges par la suppression
GHFKDUJHVH[LVWDQWHVGXQQLYHDXpTXLYDOHQWQHGRLWSDV tre circonscrit aux
VHXOVSURMHWVGDFWHVUpJOHPHQWDLUHVPDLVTXLOGRLWFRPPHDX5R\DXPH-Uni,
tre tendu aux projets de loi.
 FHW HIIHW OH OpJLVODWHXU SRXUUDLW LQWURGXLUH j ODUWLFOH  GH OD ORL
organique du 15 avril 2009, qui indique les diffrentes rubriques devant tre
UHQVHLJQpHVGDQVOHFDGUHGXQHpWXGHGLPSDFWXQHUXEULTXHVXSSOpPHQWDLUH
exigeant une quantification aussi prcise que possible des charges
administratives supprimes en contrepartie et hauteur des charges
administratives cres.

(1) Voir, en annexe n 7, les tableaux tablis par le bureau BRE dans le cadre du programme one-in,
two-out . Les derniers rapports semestriels du BRE sont en outre consultables aux liens suivants :
- rapport de juillet 2013 pour le premier semestre de ODQQpHSUpFpGHQWH
https://www.gov.uk/government/publications/one-in-two-out-sixth-statement-of-new-regulation-july-todecember-2013 ;
- UDSSRUWGHGpFHPEUHSRXUOHVHFRQGVHPHVWUHGHODQQpHSUpFpGHQWH
https://www.gov.uk/government/publications/bis-sixth-statement-of-new-regulation-regulations-covering-julyto-december-2013
- UDSSRUWGHMXLOOHWSRXUOHSUHPLHUVHPHVWUHGHODQQpHSUpFpGHQWH :
https://www.gov.uk/government/publications/bis-eighth-statement-of-new-regulation-regulations-coveringjuly-to-december-2014

51

Selon M. Oliver Letwin, VHFUpWDLUH GeWDW auprs du Premier ministre


britannique, charg de la politique rglementaire, que la mission a pu rencontrer
ORUV GH VRQ GpSODFHPHQW j /RQGUHV Fest cette discipline qui a permis de
provoquer outre-Manche un profond changement de culture normative au sein des
administrations, car elles RQWpWpFRQWUDLQWHVGHVLQWHUURJHUDYHFVLQFpULWpVXUOHV
QRUPHV TXHOOHV DOODLHQW GHYRLU VXSSULPHU SRXU FRPSHQVHU OD FKDUJH
DGPLQLVWUDWLYH HQJHQGUpH SDU FHOOHV TXHOOHV FUpDLHQW 2U OLGHQWLILFDWLRQ GHV
normes supprimer suppose la quantification des charges administratives rsultant
des normes existantes travail qui, MXVTXDORUV tait trs peu effectu par les
administrations.
v. Mieux identifier les critres sur lesquels se IRQGHUDOpYDOXDWLRQex post
des mesures
1RWUH SD\V JDJQHUDLW j VLQVSLUHU QRQ VHXOHPHQW GHV SUDWLTXHV
britanniques, mais aussi des pratiques allemandes. Les ministres fdraux
DOOHPDQGVRQWHQHIIHWSULVSRXUKDELWXGHGHIL[HUGDQVOpWXGHGLPSDFWpODEore
ex anteOHVFULWqUHVGpYDOXDWLRQex post des normes envisages.
Depuis le 1er janvier 2013, le principe a t retenu outre-Rhin que les
normes une fois adoptes seraient soumises :
une premire valuation ex post par le bureau fdral des statistiques
( Destatis ) aprs les deux premires annes de leur mise en application ;
une seconde valuation ex post, ralise cette fois par le ministre
porteur du texte de loi, dans un dlai maximal de cinq ans.
Cette seconde valuation, plus complte que la premire, devrait tre
effectue DX UHJDUG GHV FULWqUHV GpYDOXDWLRQ SUpDODEOHPHQW GpILQLV GDQV OpWXGH
GLPSDFWex ante et prendre en compte, au-del des seules charges administratives,
OHIILFDFLWp GH OD UpJOHPHQWDWLRQ OH UDSSRUW FRWV DYDQtages, les consquences
SRVLWLYHV RX QpJDWLYHV  QRQ DQWLFLSpHV ODFFHSWDWLRQ GH OD UpJOHPHQWDWLRQ SDU
ceux qui elle incombe, et les possibilits de rduire les charges administratives
sans modifier les principes.
'DSUqV OH FKHI GX bureau charg de la simplification la Chancellerie
fdrale ( Better Regulation Unit - BRU), M. Stephan Naundorf, cette pratique
peut contribuer un vritable changement de culture normative, dans la mesure o
elle contraint les ministres porteurs des projets de textes identifier en amont,
GqV OD SUpSDUDWLRQ GXQH PHVXUH OHV FULWqUHV GH VD UpXVVLWH HW j HIIHFWXHU XQH
comparaison entre les critres dfinis ex ante et les rsultats chiffrs obtenus
ex post.
Le guide de lgistique tabli par le SGG rappelle aux adminisWUDWLRQVTXLO
HVW LQGLVSHQVDEOH GH FRQFHYRLU OpWXGH GLPSDFW GDQV XQH RSWLTXH GpYDOXDWLRQ
ex post du dispositif, quelques annes plus tard . Il leur recommande, en
FRQVpTXHQFHGHVDWWDFKHU dans la mesure du possible faire le dpart entre un
objectif final et plusieurs objectifs intermdiaires, dterminer un ou plusieurs

52

indicateurs qui permettront de mesurer, mme indirectement, si ces objectifs ont


pWp DWWHLQWV HW j SUpVHQWHU OD QDWXUH GX GLVSRVLWLI GpYDOXDWLRQ ex post
envisager . Toutefois, IRUFHHVWGHFRQVWDWHUTXHODUWLFOHGHODORLRUJDQLTXHGX
DYULOQHIDLWSDVGHOLQGLFDWLRQGHVFULWqUHVprcis GpYDOXDWLRQex post une
UXEULTXHREOLJDWRLUHGHVpWXGHVGLPSDFW Ce texte se contente de prvoir que les
GRFXPHQWVGpYDOXDWLRn ex ante dfinissent les objectifs poursuivis par le projet
de loi .
La mission recommande donc de faire de la dtermination des
LQGLFDWHXUV VXU OHVTXHOV VH IRQGHUD OpYDOXDWLRQ ex post des normes une
UXEULTXHjSDUWHQWLqUHGHVpWXGHVGLPSDFWTXHOHVDGPLQLVWUDWLRQVGHYront
imprativement renseigner.
Proposition n 1 (QULFKLUOHFRQWHQXGHVpWXGHVGLPSDFW
0LHX[UHQVHLJQHUOHVpWXGHVGLPSDFW :
en rendant obligatoire, pour les WH[WHV OpJLVODWLIV OD UpDOLVDWLRQ GXQ  WHVW
HQWUHSULVHV DXMRXUGKXLIDFXOWDWLIHWFLUFRQVFULWDX[WH[WHVUpJOHPHQWDLUHV DLQVL
que de tests collectivits locales et XVDJHUVGHODGPLQLVWUDWLRQ ;
HQ DPpOLRUDQW OpYDOXDWLRQ GHV FRWV HW EpQpIices conomiques ainsi que des
consquences socitales des mesures envisages ;
HQ IRXUQLVVDQW XQH DQDO\VH HW XQH MXVWLILFDWLRQ DSSURIRQGLHV j ODSSXL GHV
PHVXUHVWUDQVLWRLUHVHWGHVGDWHVGHQWUpHHQYLJXHXUUHWHQXHV ;
HQ \ LQWpJUDQW OH[LJHQFH GH TXDntification des charges administratives
supprimes en contrepartie et hauteur des charges administratives cres ( onein, one-out ) ;
HW HQ \ LQWURGXLVDQW OHV FULWqUHV VXU OHVTXHOV VH IRQGHUD OpYDOXDWLRQ H[ SRVW GH
ces mesures.
B. /e/$%25$7,21 '(6 e78'(6 ',03$&7 CHEZ CERTAINS DE NOS
VOISINS : UN PROCESSUS PLAC SOUS LE CONTR/( '81
ORGANISME CONSULTATIF EXTERNE ET INDPENDANT

La mission a constat en se rendant chez certains de nos voisins, et


notamment au Royaume-Uni et en Allemagne, que la qualit GHVpWXGHVGLPSDFW
enregistrait de trs nets progrs ds lors que le SURFHVVXV GpODERUDWLRQ de ces
dernires FHVVDLW GrWUH SXUHPHQW LQWHUQH DX[ DGPLQLVWUDWLRQV SURGXFWULFHV des
textes lgislatifs et rglementaires.

53

1. Aller plus loin que le modle europeQ GH O Impact Assessment


Board  TXL GLVWLQJXH ORUJDQH FKDUJp GH OpODERUDWLRQ GH OpWXGH
GLPSDFW GH FHOXL FKDUJp GH OpYDOXDWLRQ GH VD TXDOLWp VDQV UHFXHLOOLU
XQSRLQWGHYXHH[WpULHXUjFHOXLGHODGPLQLVWUDWLRQ

a. La Commission europenne et le Parlement europen VHIIRUFHQW


GREMHFWLYHUOHSURFHVVXVGHSURGXFWLRQGHVpWXGHVGLPSDFW
i. /HFRPLWpGDQDO\VHGLPSDFWGHOD&RPPLVVLRQHXURSpHQQH
(QjOLQLWLDWLYHGX3UpVLGHQW-RVp0DQXHO%DUURVROD&RPPLVVLRQ
europenne a cr au sein de ses services un bureau ( Impact Assessment Board
- IAB FKDUJpFRQWU{OHUODTXDOLWpGHVpWXGHVGLPSDFWSURGXLWHVSDUOHVDXWUHV
services de la Commission europenne sur les projets de texte dont ils sont
porteurs.
/HVVHUYLFHVGHOD&RPPLVVLRQHXURSpHQQHjOLQLWLDWLYHGXQSURMHWGH
texte sont donc DXVVL FHX[ TXL VRQW FKDUJpV GH OpODERUDWLRQ GH OpWXGH
GLPSDFWUHODWLYHjFHSURMHWSi, initialement, il a t fait appel des consultants
extrieurs pour raliser lpWXGHGLPSDFWFHWWHVROXWLRQDGpVRUPDLVpWppFDUWpH
Les services SRUWHXUV GXQ WH[WH sont tenus de respecter des lignes
directrices (1) qui rgissent le contenu des tudes GLPSDFW HW LPSRVHQW TXHOOHV
comportent :
la description du besoin auquel il est propos de rpondre ;
XQH pWXGH GRSWLRQ DYHF OH FDV pFKpDQW OLQGLFDWLRQ GHV PRWLIV SRXU
lesquels le recours une simple recommandation ( soft law ) a t rejet ;
les consultations ralises et leur teneur ;
les faons dont les remarques formules lors des consultations ont t
SULVHVHQFRPSWHSDUOHVVHUYLFHVjORULJLQHGXSURMHWGHWH[WH ;
le cas chant, les raisons pour lesquelles les prconisations formules
lors des consultations ont t cartes ;
les raisons pour lesquelles les trs petites entreprises (TPE) ne peuvent
pas tre exemptes de la nouvelle rglementation envisage.
/ I AB H[DPLQH OHQVHPEOH GHV SURMHWV GpWXGHV GLPSDFWHW H[LJH
des services de la Commission europenne porteurs des projets de textes des
explications dtailles sur tous les points figurant dans le cahier des charges
GHVpWXGHVGLPSDFW.

(1) Ces lignes directrices ( Impact Assessment Guidelines  SRXU OpODERUDWLRQ GHV pWXGHV GLPSDFW VRQW
consultables au lien suivant :
http://ec.europa.eu/smart-regulation/impact/commission_guidelines/commission_guidelines_en.htm.

54

Il les interroge notamment sur le cot estim du projet de texte pour les
administrations et les entreprises des tats membres, en exigeant les lments les
plus FKLIIUpVHWOHVSOXVSUpFLVSRVVLEOHVHQSDUWLFXOLHUHQWHUPHVGHPSORL
/H[DPHQGHODTXDOLWpGHOpWXGHGLPSDFWSDUO IAB prend la forme
de :
runions tous les quinze jours avec les services porteurs du projet de
texte (ces runions ne pouvanWVHWHQLUVLPRLQVGHPHPEUHVGHO IAB sans
compter son Prsident sont prsents et si les directions comptentes en matire
GHQWUHSULVHV GHQYLURQQHPHQW HW GDIIDLUHV VRFLDOHV QH Vont pas du tout
reprsentes) ;
questionnaires de 4 5 pages auxquels les services porteurs du projet de
texte sont tenus de rpondre sous quelques semaines.
Ces changes durent WDQWTXHO IAB QHVWSDVFRQYDLQFXGHGRQQHUXQ
avis positif au projet de texte envisag. (QPR\HQQHODUpDOLVDWLRQGXQHpWXGH
GLPSDFWVXUXQSURMHWGHWH[WHGXUHHQWUHXQDQHWGHPLHWGHX[DQV
7RXWHIRLV O I AB QD SDV GH GURLW GH YHWR 6L OD &RPPLVVLRQ
HXURSpHQQHWLHQWjXQSURMHWGHWH[WHPDOJUpODYLVQpJDWLIGHO I AB , alors
le projet de texte lui est transmis afin TXHOOH ODFFHSWH IRUPHOOHPHQW
&HSHQGDQWODYLVQpJDWLIGHO I AB est, dans cette hypothse, publi.
Il faut nanmoins noter que, depuis 2010, sauf volont contraire du
Prsident de la Commission europenne, aucun projet de texte ayant reu un avis
nJDWLIGHO IAB QHVWVRXPLVjOD&RPPLVVLRQ
Une fois que la Commission europenne a accept le projet de texte,
OpWXGH GLPSDFW HVWSXEOLpH HWPLVH HQ OLJQH (1). Souvent volumineuse, celle-ci
est dsormais rsume, depuis quelques mois, dans une synthse de deux pages
prsente au dbut du document. 8QH V\QWKqVH GH ODYLV GH O I AB (jadis de
GL[ SDJHV HQ PR\HQQH HW GpVRUPDLV GHQYLURQ GHX[ SDJHV  HVW pJDOHPHQW
publie. /DYLV GH O IAB accompagne le projet de texte europen
correspondant tout au long du processus lgislatif.
8Q SURMHW HVW HQYLVDJp TXL FRQVLVWHUDLW j SHUPHWWUH j O IAB de
rpondre publiquement aux diffrentes remarques formules par les citoyens de
O8QLRQ HXURSpHQQH VXU OHV pWXGHV GLPSDFW PLVHV HQ OLJQH / IAB pouvant
difficilement rpondre chaque personne, ses rponses pourraient tre
thmatiques.

(1) 6XU OD SODFH GH O IAB  GDQV OH SURFHVVXV GpODERUDWLRQ GHV pWXGHV GLPSDFW GH OD &RPPLVVLRQ
europenne et sur les statistiques relatives ses activits, voir les documents figurant en annexe n 8.

55

ii. /XQLWpGpYDOXDWLRQex ante GHOLPSDFWGX3DUOHPHQWHXURSpHQ


Depuis que le Parlement europen est pleinement devenu colgislateur ,
en vertu du Trait de Lisbonne du 13 dcembre 2007, il tmoigne un fort intrt
SRXUOpYDOXDWLRQex ante et ex post. ce titre, il a demand ce que tout projet
GDFWHOpJLVODWLIVRLWDFFRPSDJQpGXQHpWXGHGLPSDFW
Le 18 avril 2011, la dpute allemande Angelika Niebler a publi un
UDSSRUWVXUODJDUDQWLHGHOLQGpSHQGDQFHGHVpWXGHVGLPSDFW (1), qui prconisait la
FUpDWLRQGHVWUXFWXUHVGDQDO\VHGLPSDFWDXVHLQ mme du Parlement.
ODVXLWHGHFHUDSSRUWXQHGLUHFWLRQGHODQDO\VHGLPSDFWDpWpFUppHHQ
janvier 2012. Dsormais, cette direction a pris le nom de direction de
OpYDOXDWLRQ GH OLPSDFW HW GH OD YDOHXU DMRXWpH HXURSpHQQH au sein de la
direction gnrale des services de recherche parlementaire.
Depuis septembre 2012, la demande du secrtaire gnral du
ParlemenWHXURSpHQOHVVHUYLFHVGHOXQLWpGpYDOXDWLRQ ex ante procdent
XQ FRQWU{OH GH WRXWHV OHV pWXGHV GLPSDFW WUDQVPLVHV SDU OD &RPPLVVLRQ
europenne, ce qui reprsente environ six tudes par mois. Ce contrle prend
OD IRUPH GXQH QRWH GXQH GL]DLQH GH SDges comportant des analyses
prliminaires et produite en quelques jours (une semaine au maximum) ( 2 ).
/DQDO\VH GLPSDFW j ODTXHOOH SURFqGHQW OHV VHUYLFHV GH OXQLWp GpYDOXDWLRQ ex
ante FRPSOqWHOHFRQWU{OHGHTXDOLWpHIIHFWXpSDUO IAB , en apportant un regard
neuf sur le projet de texte europen.
Si un ou plusieurs parlementaires le demandentOHVVHUYLFHVGHOXQLWp
GpYDOXDWLRQex ante peuvent produire une note plus dtaille, voire procder
jXQHpWXGHGLPSDFWFRPSOpPHQWDLUH
I l peut arriver que le Parlement europen choisisse de faire ou refaire
LQWpJUDOHPHQW XQH pWXGH GLPSDFW Rcemment, il a ainsi dcid de raliser
LQWpJUDOHPHQW XQH pWXGH GLPSDFW VXU XQH SURSRVLWLRQ PRGLILDQW OD GLUHFWLYH
relative au miel de faon rtablir le pollen comme composant du miel. La
&RPPLVVLRQHXURSpHQQHQDYDLWHQHIIHWSDVMXJpQpFHVVDLUHGHUpDOLVHUXQHpWXGH
GLPSDFWVXUFHWWHSURSRVLWLRQGHPRGLILFDWLRQGHODGLUHFWLYHUHODWLYHDXPLHOGDQV
ODPHVXUHRHOOHDYDLWSURGXLWXQHWHOOHpWXGHORUVGHOpODERration de la directive
LQLWLDOHTXLOVDJLVVDLWGHPRGLILHU2U la distinction, labore entre-temps par la
&RXU GH MXVWLFH GH O8QLRQ HXURSpHQQH (3), entre les notions de composant et
G ingrdient rendait ncessaire, aux yeux du Parlement, une nouvelle tude
GLPSDFW
(1) Ce rapport peut tre consult au lien suivant : http://www.europarl.europa.eu/sides/getDoc.do?pubRef= //EP//TEXT+REPORT+A7-2011-0159+0+DOC+XML+V0//FR&language=fr.
(2) Ces premires valuations sont consultables au lien suivant :
http://www.europarl.europa.eu/thinktank/fr/documents.html?word= &documentType=STUDIES&id= &body=I
MPA&dateStart= &dateEnd= &action=submit
(3) CJUE, 6 septembre 2011, Karl Heinz Bablok et autres contre Freistaat Bayern (affaire n C-442/09).

56

6LOHVXMHWV\SUrWHOpWXGHGLPSDFWFRPSOpPHQWDLUHRXVXEVWLWXWLYH
SHXW rWUH HIIHFWXpH SDU OHV VHUYLFHV GH OXQLWp GpYDOXDWLRQ ex ante, qui
disposent alors de six mois, en moyenne, pour la raliser.
Globalement, les services de OXQLWp GpYDOXDWLRQ ex ante dtectent
UDUHPHQWGHJUDYHVODFXQHVGDQVOHVpWXGHVGLPSDFWTXLOHXUVRQWWUDQVPLVHV,OV
notent cependant que ces tudes comportent rarement des donnes sur les charges
DGPLQLVWUDWLYHVDXQLYHDXGHO8QLRQHWHQFRUHPRLQVeWDWSDUeWDW
b. PDLVcelui-ci reste interne aux services des institutions europennes.
Le bureau de la Commission europenne charge de contrler la
TXDOLWp GHV pWXGHV GLPSDFW I AB ) est compos de neuf fonctionnaires
europens, dont un prsident (secrtaire gnral adjoint de la Commission
europenne) et huit directeurs issus des services de la Commission europenne et
devant reprsenter au moins les directions comptentes dans le domaine de
OHQYLURQQHPHQWGHVHQWUHSULVHVHWGHVDIIDLUHVVRFLDOHVCes fonctionnaires sont
dsigns par le Prsident de la Commission europenne pour un mandat de
deux ans et sont directement responsables devant lui. Ils agissent en leur nom
SURSUH HW QRQ HQ WDQW TXH UHSUpVHQWDQWV GH OHXU VHUYLFH GDIIHFWDWLRQ ,OV
VDEVWLHQQHQW GLQWHUYHQLU GDQV OHV GpEDWV FKDTXH IRLV TXDSSDUDvW XQ FRQIOLW
GLQWpUrWV
6LOWUDYDLOOHGHIDoRQLPSDUWLDOHDXFXQWH[WHQHJDUDQWLWDXMRXUGKXL
IRUPHOOHPHQW OLQGpSHQGDQFH GH O I AB . Cette indpendance rsulte
seulement de pratiques administratives.
Nos interlocuteurs allemands ont indiqu TXLOV souhaiteraient
dvelopper leur niveau un processus de contrH[SHUWLVH VL FH GHUQLHU QHVW
pas instaur au niveau europen. Selon eux, la Chancelire, Mme Angela
Merkel, YHUUDLWGXQERQLOODFRQVWLWXWLRQGXQFRPLWpTui soit plus indpendant
TXHODFWXHO IAB .
4XDQW j OXQLWp GpYDOXDWLRQ ex ante du Parlement europen, elle
procde PRLQVjXQHDQDO\VHGHIRQGTXjXQFRQWU{OHGXUHVSHFWGHVOLJQHV
GLUHFWULFHV HQ PDWLqUH GDQDO\VH GLPSDFW HQ VDVVXUDQW SDU H[HPSOH que la
&RPPLVVLRQ QD SDV GHPEOpH SULYLOpJLp WHOOH RSWLRQ SOXW{W TXH WHOOH DXWUH VDQV
HIIHFWXHUXQHYpULWDEOHpWXGHGRSWLRQRXHQFRUHTXHOD&RPPLVVLRQQDSDVRPLV
telle ou telle partie prenante incontournable dans le cadre de ses consultations. Par
exHPSOHDXVXMHWGXQrcent projet de texte europen sur la traduction certifie,
OHV VHUYLFHV GX 3DUOHPHQW HXURSpHQ RQW FRQVWDWp TXH OD &RPPLVVLRQ QDYDLW SDV
consult les traducteurs.
3DU DLOOHXUV OXQLWp GpYDOXDWLRQ ex ante GX 3DUOHPHQW HXURSpHQ QD Sas
toujours toute la capacit technique requise pour contrexpertiser les valuations
fournies par les services de la Commission europenne. Pass un certain degr
de technicit OpWXGH GLPSDFW FRPSOpPHQWDLUH RX VXEVWLWXWLYH HVW FRQILpH j
des consultants et experts extrieurs au Parlement.

57

Cette pratique rvle la QpFHVVLWpGH[WHUQDOLVHUOHFRQWU{OHGHODTXDOLWp


GHVpWXGHVGLPSDFWVLORQVRXKDLWHTXHFHOXL-ci ne se limite pas un examen
purement formel&HVWFHTXRQWFRPSULVQRVYRLsins britannique et allemand
TXL RQW FKRLVL GH VRXPHWWUH OpWXGH GLPSDFW SURGXLWH SDU ODGPLQLVWUDWLRQ j
ODQDO\VHFULWLTXHHWLPSDUWLDOHGHUHSUpVHQWDQWVGHODVRFLpWpFLYLOH
2. 6LQVSLUHU Ges modles britannique et allemand qui confient des
SHUVRQQDOLWpV H[WpULHXUHV j ODGPLQLVWUDWLRQ OH VRLQ GH VH SURQRQFHU
VXUODTXDOLWpGHOpWXGHGLPSDFW

En Europe, cinq pays se sont GRWpV GRUJDQLVPHV FRQVXOWDWLIV


indpendants pour contrler la qualiWpGHVpWXGHVGLPSDFWSURGXLWHVSDUOHV
administrations,OVDJLW :
des Pays-Bas, qui ont cr un bureau de la charge administrative
(ACTAL) ;
du Royaume-Uni, qui a institu un comit de la politique de la
rglementation ( Regulatory Policy Committee - RPC) ;
GHOAllemagne, qui a mis en place un conseil national de contrle des
normes ( Normenkontrollrat - NKR) ;
de la Rpublique tchque, qui a cr EXUHDXGpWXGHGHOLPSDFWGHOD
rglementation ( RIAB ) ;
de la Sude, qui a institu un FRQVHLOGDPpOLRUDWLRQGHODUpJOHPHQWDWLRQ
( Regelradet ).
/I slande et la Norvge sont elles aussi en train de mettre en place des
FRPLWpVLQGpSHQGDQWVFKDUJpVGHOpYDOXDWLRQGHODTXDOLWpGHVpWXGHVGLPSDFW
a. Le comit britannique de la politique de la rglementation ( RPC )
i. Cration et composition
Le Regulatory Policy Committee (ou RPC ) a t cr en 2009
pour valuer de faon totalement indpendante la qualit (sincrit des
estimations, des donnes...) GHVpWXGHVGLPSDFWSURposes par les services des
ministres porteurs de projets de textes (lgislatifs et rglementaires).
%pQpILFLDQW GXQ ILQDQFHPHQW GH    SDU DQ VRLW    HW
LQVWDOOp GDQV OHV ORFDX[ GX PLQLVWqUH GH OeFRQRPLH GH OLQQRYDWLRQ HW GHV
comptences ( Department for Business, Innovation & Skills - BIS), il est
FRPSRVp GH KXLW PHPEUHV QRPPpV SDU OH 3UHPLHU PLQLVWUH DX WHUPH GXQ
processus de recrutement public et transparent (appel candidatures,
slection par les fonctionnaires composant le secrtariat, proposition de
nomination faite au Premier ministre).

58

Les membres du RPC sont issus de la socit civile : syndicalistes,


conomistes, entrepreneurs, employs de la chambre de commerce britannique,
VSpFLDOLVWHVGHODXGLWHWF
Les membres de ce comit conservent des activits professionnelles
parallles HW QH FRQVDFUHQW FKDFXQ TXXQ MRXU GH OHXU VHPDLQH DX WUDYDLO GX
RPC -XVTXHQLOVQpWDLHQWSDVUpPXQpUpVSRXUOHXUDFWLYLWpDXVHLQGX
RPC .
&HFRPLWpVDSSXLHVXUXQsecrtariat de quinze fonctionnaires qui sont
dtachs de diffrents ministres pour une dure de trois quatre ans pour
travailler temps plein pour le RPC et dont la plupart ont un profil
GpFRQRPLVWH.
ii. Rle du RPC  GDQV OH SURFHVVXV EULWDQQLTXH GpODboration des
pWXGHVGLPSDFW
Le RPC examine, en dehors de toute considration partisane, la
TXDOLWpGHVpWXGHVGLPSDFWpODERUpHVSDUOHVVHUYLFHVGHVPLQLVWqUHVSRUWHXUV
de projets de textes.
/HV PLQLVWqUHV pODERUHQW XQH pWXGH GLPSDFW OH FDV pFKpDQW DYHF ODSSXL
PpWKRGRORJLTXH HW WHFKQLTXH GX EXUHDX GX PLQLVWqUH GH OeFRQRPLH GH
OLQQRYDWLRQ HW GHV FRPSpWHQFHV FKDUJp GH ODPpOLoration de la rglementation
( Better Regulation Executive - BRE) (1).
'HSXLV OpWp  SRXU FHUWDLQHV PHVXUHV VDQV LPSDFW ORXUG OHV
PLQLVWqUHVSHXYHQWSURGXLUHGHVpWXGHVGLPSDFWDOOpJpHVTXLVRQWVRXPLVHVjXQH
procdure de contrle acclre. Cette procdure est notamment utilise pour les
(1) &RPSRVp GXQH FLQTXDQWDLQH GH SHUVRQQHV HW EpQpILFLDQW GXQ EXGJHW DQQXHO GHQYLURQ  PLOOLRQV GH
OLYUHVVWHUOLQJ VRLWHQYLURQPLOOLRQVGHXURV OHBRE HVWXQHXQLWpGHVRXWLHQjODPLVHHQXYUH
GHV SURJUDPPHV GDPpOLRUDWLRQ GH OD UpJOHPHQWDWLRQ TXL VH FRQFHQWUH VXU OpYDOXDWLRQ ex ante.
Formellement cr il y a XQHGL]DLQHGDQQpHVOHBRE DFRPPHQFpGrWUHFRQVWLWXpGHIDoRQLQIRUPHOOH
en 1992, sous le gouvernement de M. John Major.
Initialement rattach aux services du Premier ministre ( Cabinet Office ), ce service est plac depuis
2009 auprs du minisWqUH GH OeFRQRPLH GH OLQQRYDWLRQ HW GHV FRPSpWHQFHV %,6  DILQ GH UHJURXSHU
auprs de ce ministre toutes les structures qui travaillaient sur les questions lies aux entreprises. Malgr
ce rattachement, le BRE a une vocation interministrielle et travaille aux cts des ministres et
UpGDFWHXUVGHVSURMHWVGHWH[WHSRXUOHXUDVVXUHUXQHDVVLVWDQFHSUDWLTXHDXVXMHWGHOpFKDQJHGHERQQHV
pratiques ou des alternatives la rglementation notamment.
&HVW FH VHUYLFH TXL D GpILQL OHV UqJOHV GpODERUDWLRQ GHV pWXGHV GLPSDFW HW TXL DSSRUWH XQ VRXWLHQ
PpWKRGRORJLTXH HW WHFKQLTXH DX[ PLQLVWqUHV SRUWHXUV GH SURMHWV GH WH[WHV ORUVTXLOV pODERUHQW GH WHOOHV
tudes.
&KDTXH PLQLVWqUH GLVSRVH GXQH XQLWp GDPpOLRUDWLRQ GH OD UpJOHPHQWDWLRQ FRPSRVpH GH WURLV j six
SHUVRQQHV (W DX VHLQ GH FKDTXH PLQLVWqUH XQ VHFUpWDLUH GeWDW FKDUJp GH OD JRXYHUQDQFH QRUPDWLYH HVW
identifi.
&HVW pJDOHPHQW YHUV FH VHUYLFH TXH OH RPC  SHXW VH WRXUQHU ORUVTXLO UHQFRQWUH GHV GLIILFXOWpV
mthodologiques ou techniques au cours GHOH[DPHQGHODTXDOLWpGXQHpWXGHGLPSDFW
&HVWXQHXQLWpFHQWUDOHLQIOXHQWHHWG\QDPLTXHTXLGLVSRVHGXQUpVHDXHWGHUHVVRXUFHVLPSRUWDQWHVHWTXL
regroupe les lments essentiels du mieux lgifrer   VRXWLHQ DX[ DQDO\VHV GLPSDFW DX SURJUDPme
one-in, two-out RXHQFRUHjOXWLOLVDWLRQGDOWHUQDWLYHVjODUpJOHPHQWDWLRQ

59

mesures de simplification approuves dans le cadre du programme de rduction du


stock normatif ( Red Tape Challenge  HW SRXU WRXWH PHVXUH GRQW OLQFLGHQFH
financire est infrieure 1 million de livres sterling (soit environ 1,2 millions
GHXURV 
Ils la transmettent ensuite au RPC , avant de procder aux ventuelles
consultations obligatoires ou facultatives.
8QH IRLV TXH OpWXGH GLPSDFW OXL HVW WUDQVPLVH OH RPC dispose
GXQGpODLDOODQWGHMRXUV HQFDVGHSURFpGXUHDFFpOpUpH jMRXUV HQFDV
de procdure classique  SRXU DQDO\VHU OpWXGH GLPSDFW. En moyenne, le
RPC H[DPLQHOHVpWXGHVGLPSDFWGDQVXQGpODLGHMRXUVRXYUDEOHV
Lors de cet examen, le RPC VDWWDFKHjYpULILHUTXHOH*RXYHUQHPHQWD
envisag toutes les options possibles, en particulier celles qui sont non normatives
( soft law : recommandations, rfrentiels, guides de bonnes pratiques, etc.) et
pour raliser des estimations chiffres fiables des cots et des avantages attendus
du projet de texte. Le RPC contrle notamment le respect du principe one-in,
two-out (1) et de la prohibition des surtranspositions des directives europennes
TXLQLUDLHQWSDVGDQVXQVHQVIDYRUDEOHDX[HQWUHSULVHVEULWDQQLTXHV
/H[DPHQ GH OpWXGH GLPSDFW HVW HIIHFWXp SDU GHX[ IRQFWLRQQDLUHV
(dont au moins un conomiste) sans recours des consultants extrieurs. Ils
travaillent uniquement sur la base des documents transmis par le Gouvernement et
examinent leur conformit au regard des exigences mthodologiques relatives aux
pWXGHV GLPSDFW WHOOHV TXH GpILQLes dans le rfrentiel tabli par le BRE et
appel Better regulation framework manual (2).
&HV GHX[ IRQFWLRQQDLUHV WUDQVPHWWHQW OHXU SURSRVLWLRQ GDYLV DX
membre du comit charg du dossier, lequel se forge sa propre opinion et
transmet sa SURSRVLWLRQGDYLVjOHQVHPEOHGHVPHPEUHVGXFRPLWp
Le RPC met un avis class par couleur :
vert VL OpWXGH GLPSDFW HVW HQ WRXV SRLQWV VDWLVIDLVDQWH RX VL HOOH QH
comporte que des lacunes mineures ;
orange si elle doit tre complte et/ou modifie ;
(1) Le RPC GpWHUPLQHVLOHSURMHWGHWH[WHFUpHGHVFKDUJHVDGPLQLVWUDWLYHV GDQVTXHOFDVFHVWXQin )
RX VLO HQ VXSSULPH GDQV TXHO FDV FHVW XQ  out ). Il vrifie que le poids de la charge administrative
cre ou supprime a bien t calcul conformment aux principes mthodologiques communment
adopts. Le prsident du RPC 00LFKDHO*LEERQVDIDLWYDORLUOXWLOLWpGXQUHJDUGLQGpSHQGDQWVXU
le chifIUDJH IDLW SDU OH *RXYHUQHPHQW GH FH TXLO SUpVHQWH FRPPH GHV FUpDWLRQV RX GHV VXSSUHVVLRQV GH
charges administratives, car les ministres ont, selon lui, tendance surestimer les suppressions de charges
( OUTs ). Cette vrification a permis au RPC GHVWLPHUjHQYLURQPLOOLRQVGHOLYUHVVWHUOLQJ VRLW
HQYLURQPLOOLRQVGHXURV ODGLIIpUHQFHHQWUHODUpGXFWLRQGHODFKDUJHDGPLQLVWUDWLYHDQQRQFpHSDUOH
Gouvernement (qui prtend avoir rduit cette charge de 836 millions de livres sterling entre 2011 et 2013,
grce au one-in, one-out ) et la rduction relle de cette charge depuis 2011.
(2) Ce manuel mthodologique est consultable au lien suivant :
https://www.gov.uk/government/publications/better-regulation-framework-manual.

60

rouge si elle est trs insuffisante et doit tre intgralement refaite.


Si le projet de texte ne satisfait pas la rgle du one-in, two-out ODYLV
du RPC est automatiquement ngatif.
Cet avis est transmis aux ministres porteurs des projets de texte et
DXWHXUV GHV pWXGHV GLPSDFW (Q FDV GDYLV RUDQJH LOV SHXYHQW GpFLGHU GH
PRGLILHURXFRPSOpWHUOpWXGHGLPSDFWMXVTXjFHTXHOH RPC donne un avis
YHUW SOXVLHXUVQDYHWWHVSHXYHQWDLQVLDYRLUOLHX (QFDVGDYLVURXJHLOVSHXYHQW
dFLGHUGHUHIDLUHLQWpJUDOHPHQWOpWXGHGLPSDFWRXGHUHQRQFHUjOHXUSURMHWGH
texte ou de passer outre.
Le RPC QD SDVGH GURLW GHYHWR  OH*RXYHUQHPHQW SHXWIDLUH OH
choix politique de passer outre un avis ngatif, mais dans cette hypothse,
ODYis ngatif du RPC HVW SXEOLp QRQ VHXOHPHQW OH VHQV GH ODYLV PDLV
DXVVL OHQVHPEOH GHV PRWLIV  HW OH Gouvernement doit assumer les
consquences politiques et mdiatiques de son choix. En pratique, tout
ministre renonce prsenter un projet de texte qui QDXUDLWSDVUHFXHLOOLXQ
feu vert du RPC .
5pFHPPHQWGDQV OH FDGUHGXQ SURMHW GH ORL YLVDQW j PHWWUH HQ SODFH XQ
nouveau rgime de retraites, le Gouvernement britannique a procd des
consultations sans avoir pralablemeQW UHFXHLOOL ODYLV GX RPC VXU OpWXGH
GLPSDFW'qVORUVTXHOHVSDUWHQDLUHVVRFLDX[DYDLHQWUHoXODFRQVXOWDWLRQLOpWDLW
trop tard pour saisir le RPC . Ce dernier a donc mis un avis rouge (ngatif)
qui a t publi en intgralit dans la une du Financial Times (1), ce qui a plong le
*RXYHUQHPHQW GDQV OHPEDUUDV SHQGDQW SOXVLHXUV VHPDLQHV /H PLQLVWUH SRUWHXU
du projet de loi a alors demand rencontrer le Prsident du RPC devant qui il
D UHFRQQX TXLO QDXUDLW SDV G YDOLGHU OpWXGH Gimpact assortissant le projet de
loi. Le ministre a alors demand au RPC de lui transmettre ses
recommandations pour que le projet de loi envisag satisfasse aux exigences du
comit.
En 2012, le RPC DH[DPLQppWXGHVGimpact (contre 579 en 2011).
81 % de ces analyses ont t juges conformes aux exigences mthodologiques.
Le plus souvent, les reproches adresss aux ministres par le RPC portent sur
le manque de clart des bases de calcul, ODEVHQFH GH[SOLFDWLRQ FRPSOqWH VXU OD
faon dont le cot net annuel de la mesure envisage pour les entreprises a t
estim, ODEVHQFHGHSULVHHQFRPSWHGHVFRWVGHIDPLOLDULVDWLRQDYHFODQRXYHOOH
PHVXUHHWGHPLVHHQXYre de dispositifs transitoires, ou encore OLQVXIILVDQFHGH
OpYDOXDWLRQGHOLPSDct pour les petites et trs petites entreprises.
(Q MXLQ  OH PLQLVWUH FKDUJp GH OeFRQRPLH GH OLQQRYDWLRQ HW GHV
FRPSpWHQFHV D DQQRQFp OD FUpDWLRQ DX VHLQ GHV pWXGHV GLPSDFW GXQ LQGLFDWHXU
(1) Cet avis est fourni en annexe n 9 et consultable au lien suivant :
https://www.gov.uk/government/uploads/system/uploads/attachment_data/file/267611/RPC13-DWP1950_Charges_in_Qualifying_Pension_Schemes__05.12.2013_.pdf

61

spcifique pour les petites et trs petites entreprises ( Small and Micro Business
Assessment - SaMBA). Dans ce cadre, le RPC HVW FKDUJp GH VDVVXUHU TXH
toutes les solutions ont t envisages pour attnuer tout impact disproportionn
GXQSURMHWGHWH[WHVXUOHVSHWLWHVHWWUqVSHWLWHVHQWUHprises. Le principe est que les
petites et trs petites entreprises sont exemptes des nouvelles rglementations.
/H[FHSWLRQ HVW TXHOOHV SHXYHQW rWUH FRQFHUQpHV SDU OD QRXYHOOH UpJOHPHQWDWLRQ
PDLV TXHOOHV EpQpILFLHQW DORUV GDGDSWDWLRQV HW GH GpODLV SOXV ORQJV SRXr
ODSSOLTXHU j PRLQGUH FRW &H GLVSRVLWLI QD WRXWHIRLV SDV HQFRUH pWp PLV HQ
XYUH
(Q MXLOOHW  OH PLQLVWUH FKDUJpGH OeFRQRPLH GH OLQQRYDWLRQ HW GHV
FRPSpWHQFHVDDQQRQFpTXHPrPHOHVSURGXFWHXUVGHQRUPHVTXLQLQWHUYLHQQHQW
pas dans le domaine conomique (les rgulateurs non-conomiques ), parmi
lesquels certaines autorits administratives indpendantes, allaient devoir produire
XQHpWXGHGHOLPSDFWTXHOHXUVQRXYHOOHVUpJOHPHQWDWLRQVRXOHVPRGLILFDWLRQVGH
leurs rglementations existantes peuvent avoir indirectement sur les entreprises.
Ces rgulateurs non-conomiques sont tenus de communiquer leur tude
GLPSDFW DX[ HQWUHSULVHV FRQFHUQpHV GH VH FRQFHUWHU DYHF HOOHV HW VL SRVVLEOH
parvenir un accord avec elles avant la modification de la rglementation. Si les
HQWUHSULVHVVXVFHSWLEOHVGrWUHDIIHFWpHVSDUODQRXYHOOHUpJOHPHQWDWLRQFRQVLGqUHQW
TXH OpWXGH GLPSDct ralise par le rgulateur non-conomique est
VXEVWDQWLHOOHPHQWHUURQpHHWTXHOOHVQHSHXYHQWGRQFSDUYHQir un accord avec
ledit rgulateur, alors elles peuvent saisir le RPC SRXU TXLO FRQWU{OH OpWXGH
GLPSDFWpODERUpHSDUOHUpJXODWHXUHWIRUPXOHXQDYLVHQWRXWHLQGpSHQGDQFH&H
GLVSRVLWLIQDtoutefois SDVHQFRUHpWpPLVHQXYUH
Le RPC a tabli un classement des ministres selon la qualit des
pWXGHV GLPSDFW TXLOV OXL WUDQVPHWWHQW FH TXL SHUPHW GH IDLUH SUHVVLRQ VXU
les administrations centrales et de les mobiliser (1). Le constat est que ce sont
toujours les mmes ministres qui produisent OHVPHLOOHXUVpWXGHVGLPSDFWHW
TXH OD TXDOLWp GXQH pWXGH GLPSDFW HVW GDXWDQW SOXV JUDQGH TXH OHV
ministres travaillent en troite association avec les entreprises.
8QH IRLV UHWRXUQpH DX[ PLQLVWqUHV DYHF ODYLV Gu RPC  OpWXGH
GLPSDFWHVWWUDQVPise au comit gouvernemental charg de la rduction de
la rglementation ( Reducing Regulation ministerial Committee - RRC).
Ce FRPLWpHVWFRPSRVpGXQHGL]DLQHGHPHPEUHVGX*RXYHUQHPHQWPLQLVWUHV GH
OeFRQRPLHQRWDPPHQW HWVHFUpWDLUHVGeWDW,ODt cr en 2008 pour piloter le
programme de rglementation du gouvernement. Toutes les mesures qui
LPSOLTXHQW OD FUpDWLRQ RX OD VXSSUHVVLRQ GXQH QRUPH OXL VRQW VRXPLVHV SRXU
autorisation. Ce comit prend, dans un dlai moyen de six jours, la dcision
poOLWLTXHGDGRSWHURXQRQOHSURMHWGHWH[WHHQVDSSX\DQWVXUODYLVGX RPC
HWVXUOH[SHUWLVHdu BRE .

(1) Voir les documents figurant en annexe n 9.

Le rle du RPC dans le processus britannique GDGRSWLRQGHVSURMHWVGHWH[WHV

Le RPC examine sous 10 30 jours


OHVpWXGHVGLPSDFWHWOHXUDWWULEXHXQH
couleur :
- rouge : non-conforme aux exigences
mthodologiques
- orange ou vert : partiellement ou
totalement conforme aux exigences
mthodologiques

Les services des ministres adressent


au RP& OHV pWXGHV GLPSDFW SRXU
examen approfondi

Le RPC adresse ses avis


aux ministres

62

/HV PLQLVWqUHV SUpSDUHQW DYHF ODSSXL


mthodologique et technique du
bureau Better Regulation Executive
%5(  OHV pWXGHV GLPSDFW HW OHV
VRXPHWWHQWDX53&DYDQWTXHOOHVQH
soient
prsentes
au
Comit
interministriel de rduction de la
rglementation (RRC) pour adoption

/HV pWXGHV GLPSDFW YLVpHV SDU OH 53& VRQW


transmises au RRC pour validation dans un
dlai de 6 jours

Le RRC rend sa dcision finale sur la


mise en XYUHGHVUpJOHPHQWDWLRQV

63

Selon M . Oliver Letwin, VHFUpWDLUHGeWDWDXSUqVGX3UHPLHUPLQLVWUH


britannique, charg de la politique rglementaire, OpYDOXDWLRQLQGpSHQGDQWH
GHV pWXGHV GLPSDFW SDU XQ FRPLWp FRPSRVp GH UHSUpVHQWDQWV GH OD VRFLpWp
FLYLOH D pWp OXQ GHV IDFWHXUV GpFLVLIV GX SURIRQG FKDQJHPHQW GH FXOWXUH
QRUPDWLYHTXLVHVWRSpUpDX5R\DXPH-Uni.
Ce constat est partag par OH PLQLVWUH Gtat allemand charg de la
simplification, M . Helge Braun, que la mission a pu entendre et pour lequel le
FRQWU{OHGHOpYDOXDWLRQGHVUpIRUPHVSDUXQHLQVWLWXWLRQLQGpSHQGDQWHa permis en
Allemagne de vaincre les ventuelles rsistances des ministres en matire de
simplification et GpYDOXDWLRQex ante GHOLPSDFWGHVQRUPHV
b. Le conseil allemand de contrle des normes
i. Cration et composition
Le conseil national de contrle des normes ( Normenkontrollrat - NKR)
a t cr en 2006jOLQLWLDWLYHGXParlement allemand, pour valuer de faon
WRWDOHPHQW LQGpSHQGDQWH OD TXDOLWp GHV pWXGHV GLPSDFW pODERUpHV SDU OHV
services des ministres porteurs de projets de textes lgislatifs et
rglementaires.
%pQpILFLDQWGXQILQDQFHPHQWDQQXHOGHHWpWDEli Berlin, il est
compos de dix membres bnvoles nomms pour cinq ans par la
Chancellerie, sur proposition de la Prsidence de la Rpublique.
Ses membres sont issus de la socit civile et choisis de faon
UHSUpVHQWHUOHPRQGHGHOHQWUHSULVHOHPRnde associatif ou encore le monde
universitaire. Actuellement, le NKR compte entre autres un lu local, un
SURIHVVHXUGpFRQRPLHXQHDYRFDWHVSpFLDOLVWHGXGURLWGHOHQYLURQQHPHQWHWXQ
fonctionnaire ayant des fonctions comparables celles du prfet de rgion.
/LQGpSHQGDQFHGHVPHPEUHVGX NKR tient :
leur profil (ils ne peuvent appartenir ni au Gouvernement, ni au
Parlement) ;
la dure de leur mandat (5 ans, soit un an de plus que la dure du
mandat des parlementaires et des ministres, qui est de 4 ans) ;
au choix fait de promouvoir le pluralisme en son sein avec la dsignation
GXQSUpVLGHQWHWGXQYLFH-prsident de sensibilit politiques diffrentes (qui sont
respectivement M. Johannes Ludewig, ancien prsident de la socit nationale des
chemins de fer allemands, est plutt proche des dmocrates-chrtiens , tandis
que M. Wolf-Michael Catenhausen est un ancien dput et un ancien ministre
social-dmocrate).

64

Chaque membre du NKR suit un ou deux ministres et donne son avis


sur les textes labors par ceux-ci. Les avis sont pris la majorit, gnralement
lors de runions hebdomadaires.
&H FRPLWp VDSSXLH VXU XQ secrtariat de quinze fonctionnaires, dont
deux secrtaires administratifs et treize experts qui se spcialisent chacun dans
un secteur. Ces experts sont des fonctionnaires dtachs de diffrents
ministres pour une priode de 3 4 ans et ayant surtout un profil de juriste
RXGpFRQRPLVWH.
ii. Rle du NKR GDQVOHSURFHVVXVDOOHPDQGGpODERUDWLRQGHVpWXGHV
GLPSDFW
Le NKR examine, en dehors de toute considration partisane, la
TXDOLWpGHVpWXGHVGLPSDFWpODERUpHVSDUOHVVHUYLFHVGHVPLQLVWqUHVIpGpUDX[
porteurs de projets de textes. Son travail vise permettre au dcideur (Parlement
ou Gouvernement) de connatre les LPSOLFDWLRQV GHV GpFLVLRQV TXLO HVW DPHQp j
SUHQGUH GH IDoRQ j FH TXLOV OHV SUHQQHQW HQ FRQQDLVVDQFH GH FDXVH HW TXLO HQ
assume ensuite toutes les consquences.
$YHFODSSXLPpWKRGRORJLTXHGHEXUHDXGHOD&KDQFHOOHULHIpGpUDOHFKDUJp
de la simplification ou Better Regulation Unit (BRU) ( 1 ), les ministres
IpGpUDX[ pODERUHQW XQH pWXGH GLPSDFW GRQW LOV VRXPHWWHQW OH SURMHW DX NKR
avant sa finalisation. 6LO VDJLWGXQSURMHWGHORLOH NKR exige que lui soit
WUDQVPLV QRQ VHXOHPHQW OH SURMHW GpWXGH GLPSDFW PDLV DXVVL OHV pYHQWXHOV
SURMHWVGHGpFUHWVGDSSOLFDWLRQ 6LOVDJLWGXQSURMHWGHORLGKDELOLWDWLRQj
lgifrer par ordonnances, le NKR exige que lui soient fournis non
VHXOHPHQWOHSURMHWGpWXGHGLPSDFWPDLVDXVVLOHVSURMHWVGRUGRQQDQFHV
(1) Le BRU FRQVWLWXHOXQLWpJRXYHUQHPHQWDOHFKDUJpHGHODPLVHHQXYUHRSpUDWLRQQHOOHGXSURJUDPPH
de rduction de la bureaucratie ( Brokratieaabau ) qui a t engag par le Gouvernement allemand
et dont le pilotage a t confi, le 17 dcHPEUH  j 0 +HOJH %UDXQ PLQLVWUH GeWDW DXSUqV GH OD
&KDQFHOLqUH 0 +HOJH %UDXQ D HVVHQWLHOOHPHQW SRXU WkFKH GLPSXOVHU HW GH FRRUGRQQHU DX QLYHDX
interministriel les initiatives prises en matire de rduction du stock et du flux normatif. Pour ce faire, il
VDSSXLHVXUXQFRPLWpGHVHFUpWDLUHVGeWDWSRXUODUpGXFWLRQGHODEXUHDXFUDWLHDXVHLQGXTXHOFKDTXH
ministre dsigne entre trois et cinq reprsentants. Ce comit est un organe moteur au sein du
gouvernement fdral et se runit six huiWIRLVSDUDQ,OQDSDVGHEXGJHWRIILFLHO
Le BRU  FRQVHLOOH OH PLQLVWUH GeWDW FKDUJp GH OD VLPSOLILFDWLRQ DLQVL TXH OHV DXWUHV PLQLVWUHV HW LO
VRXWLHQW ODFWLRQ GX FRPLWp GHV VHFUpWDLUHV GeWDW SRXU OD UpGXFWLRQ GH OD EXUHDXFUDWLH GDQV VRQ U{OH GH
pilotage.
'pSRXUYX GH EXGJHW RIILFLHO PDLV DYHF GHV GpSHQVHV DQQXHOOHV GHQYLURQ    OH  BRU est
compos de douze chargs de mission, dont six ont un poste permanent au sein de la Chancellerie fdrale.
Chaque ministre dispose par ailleurs GXQHFHOOXOHGRQWODWDLOOHYDULHVHORQVRQLPSRUWDQFH GHX[jWURLV
SHUVRQQHVHQJpQpUDO HWTXLHVWFKDUJpHGHODVLPSOLILFDWLRQHWGHODPpOLRUDWLRQGHODUpJOHPHQWDWLRQGDQV
son champ de comptences.
Le BRU se runit chaque semaine avec le ministrHGeWDWFKDUJpGHODVLPSOLILFDWLRQSRXUDVVXUHUXQ
VXLYLGXSURJUDPPHGHUpGXFWLRQGHODEXUHDXFUDWLH&HVWOXLTXLWRXVOHVWURLVjTXDWUHPRLVRUJDQLVHGHV
UHQFRQWUHVLQWHUPLQLVWpULHOOHVSRXUIDLUHSDUWDX[PLQLVWqUHVGHSURSRVLWLRQV TXLOQHSHXWpas leur imposer
cependant) et pour assurer le suivi des initiatives en cours.
'H PrPH TXDX 5R\DXPH-Uni, le bureau Better Regulation Executive (BRE) apporte un soutien
PpWKRGRORJLTXHHWWHFKQLTXHDX[PLQLVWqUHVORUVGHOpODERUDWLRQGHVpWXGHVGLPSDFWGHPrPHOHBRU
FRQWU{OHODPpWKRGHGDQDO\VHGLPSDFWHWGHFDOFXOGHVFRWVUHWHQXHSDUOHVPLQLVWqUHVIpGpUDX[

65

8QH IRLV TXH OH SURMHW GpWXGH GLPSDFW OXL HVW WUDQVPLV OH NKR
procde son examen en troite collaboration avec les ministres fdraux. Ce
contrle externe et indpendant se concentre sur :
le respect des 37 indicateurs qui doivent tre obligatoirement renseigns
GDQVXQHpWXGHGLPSDFWHQYHUWXGXQUqJOHPHQWIpGpUDO
ODVLQFpULWpGHOpYDOXDWLRQGHVFRWVVXVFHSWLEOHVGHUpVXOWHUGXSUojet de
texte ;
OpWXGHGHVGLIIpUHQWHVRSWLRQVHQYLVDJHDEOHV le NKR se rservant
le GURLW GLPSRVHU DX[ PLQLVWqUHV IpGpUDX[ GH SUpVHQWHU GHV VROXWLRQV
alternatives au recours la loi ou au rglement pour atteindre les objectifs
poursuivis.
Pour sDVVXUHU GH OD ILDELOLWp GHV HVWLPDWLRQV GHV FRWV GHV QRUPHV
envisages qui lui sont soumises par les ministres, le NKR  VHVW YX
reconnatre par la loi le droit de solliciter le bureau fdral des
statistiques ( Destatis ). Ce bureau, quivalent alOHPDQG GH O,QVWLWXW QDWLRQDO
de la statistique et des tudes conomiques (INSEE), est un organisme public qui
est reconnu par tous pour son srieux et son impartialit et qui est tenu par la loi
GDVVLVWHUen toute neutralit le Gouvernement fdral, le Parlement et le NKR
GDQV OHXU WUDYDLO GpYDOXDWLRQ HQ OHXU IRXUQLVVDQW OHV donnes chiffres
ncessaires (1).
$X VHLQ GX EXUHDX IpGpUDO GHV VWDWLVWLTXHV XQH pTXLSH GXQH FHQWDLQH GH
SHUVRQQHVVHFRQVDFUHjSOHLQWHPSVjOpYDOXDWLRQFKLIIUpHGHOLPSDct des projets
de textes dont elle fait chaque anne un rapport au Parlement. Depuis 2006, le
EXUHDX IpGpUDO GHV VWDWLVWLTXHV GLVSRVH GXQH EDVH GH GRQQpHV TXL UpXQLW
OHQVHPEOHGHVLQIRUPDWLRQVVXUOLPSDFWGHVSURMHWVGHUpJOHPHQWDWLRQ(WGHSXLV
2011, cette base de donnes comprend galement de manire plus prcise et
dtaille les cots des charges administratives pour les particuliers et les
HQWUHSULVHV&HWWHEDVHHVWSXEOLTXHHWSHUPHWXQHUHFKHUFKHSDUW\SHGXVDJHUSDU
obligation et par secteur. Plus de 10 000 charges administratives sont ainsi
mesures dans les bases de donnes de ce bureau. Elles ont t identifies grce
des enqutes conduites auprs des usagers et des entreprises.
Initialement, le NKR  QH[DPLQDLW TXH OHV FKDUJHV DGPLQLVWUatives
UpVXOWDQWGREOLJDWLRQVGLQIRUPDWLRQFUppHVSDUGHVSURMHWVGHORL,OVDSSX\DLWj
cette fin sur le modle des cots standards ( standard cost model ). Depuis
2010, le NKR value tous les cots de tous les projets de textes lgislatifs ou
rglementaires manant des ministres fdraux, et pas seulement les cots lis
ODFUpDWLRQGREOLJDWLRQVGLQIRUPDWLRQHQRSpUDQWXQHGLVWLQFWLRQHQWUHOHVFRWV
SRXU OHV HQWUHSULVHV SRXU OHV FLWR\HQV HW SRXU OHV DGPLQLVWUDWLRQV DLQVL TXXQH
distinction entre les cots de mise en conformit et les cots de fonctionnement (2).
(1) Article 8 de la loi du 14 aot 2006 portant cration du NKR .
(2) Une rglementation peut en effet induire des cots de mise en conformit : par exemple, la rglementation
UHODWLYHjODUpGXFWLRQGHVJD]jHIIHWGHVHUUHHQJHQGUHGHVFRWVEXUHDXFUDWLTXHVOLpVjORbligation
IDLWHDX[HQWUHSULVHVGLQIRUPHUOHVDXWRULWpVVXUOHYROXPHGHJD]pPLVPDLVDXVVLGHV FRWVGHPLVHHQ

66

Concrtement, le NKR vrifie si les valuations chiffres des


ministres fdraux respectent les rgles mthodologiques et techniques dfinies
par le bureau fdral des statistiques.
Le NKR participe un travail de prparation des textes qui est
SOXV FRQILGHQWLHO HW SOXV LQWHUQH j ODGPLQLVWUDWLRQ TXH QH OHVW OH WUDYDLO GX
Regulatory Policy Committee (RPC) au Royaume-Uni.
En effet, le NKR rend un avis final au terme de sa concertation
avec les ministres fdraux sans procder la moindre consultation
publique. Le NKR QHIDLWSDVGHFRPPHQWDLUHVSXEOLFVVXUOHSURMHWGpWXGH
GLPSDFW HW GH WH[WH  OHV VXJJHVWLRQV GDPpOLRUDWLRQ TXLO IDLW DX[ VHUYLFHV GHV
ministres fdraux avant de rendre un avis dfinitif sont totalement
confidentielles. La consultation publique des parties prenantes (notamment des
IpGpUDWLRQVGHPSOR\HXUVHWGHVDODULpVTXLGRLYHQWREOLJDWRLUHPHQWrWUHFRQVXOWpHV
VXUFHUWDLQVWH[WHV QLQWHUYLHQWTXHQ aval de la saisine du NKR .
Depuis 2007, il est en effet presque toujours demand aux fdrations
GHPSOR\HXUV HW GH VDODULpV GH SUHQGUH SRVLWLRQ VXU OHV pYDOXDWLRQV FKLIIUpHV GHV
UpIRUPHV  VL HOOHV QpPHWWHQW SDV GDYLV j FH VWDGH OH Gouvernement estime
TXHOOHVQRQWSDVjIRUPXOHUGHJULHIVHQVXLWH
La seule hypothse dans laquelle le travail du NKR acquiert une
FHUWDLQHSXEOLFLWpHVWFHOOHROHVWLPDWLRQGXFRWGXQSURMHWGHWH[WHIDLWHSDUOHV
ministres fdraux diffre significativement de celle faite par les parties
prenantes (notamment les fdrations patronales). Dans ce cas, le NKR
procde une valuation. cet gard, les reprsentants de fdrations patronales
allemandes que la mission a pu rencontrer ont indiqup TXLOV HQWUHWHQDLHQW GH
bonnes relations avec le NKR qui prend en compte les remarques et
propositions des entreprises.
Le NKR QDSDVGHGURLWGHYHWRXQPLQLVWqUHSHXWIDLUHOHFKRL[
politique de passer outre un avis ngatif du NKR , mais dans la mesure o
ODYLVQpJDWLIGX NKR est publi, le ministre concern doit alors assumer
les consquences politiques et mdiatiques de son choix et justifier sa position.
/D&KDQFHOOHULHIpGpUDOHH[LJHGDLOOHXUVTXHOHPLQLVWUHGRQWOHSURMHWDUHu un
avis ngatif fasse une rponse crite au NKR .
8QH IRLV UHWRXUQp DX[ PLQLVWqUHV DYHF ODYLV ILQDO GX NKR , qui est
rendu dans un dlai moyen de trois semaines (et parfois sous 15 jours), le projet
GpWXGHGLPSDFWHVWILQDOLVpHWWUDQVPLVDX*Ruvernement qui, au vu de ce projet,
GH ODYLV GX NKR et, le cas chant, de la rponse du ministre concern au
NKR IDLWOHFKRL[SROLWLTXHGHPHWWUHHQXYUHRXQRQODPHVXUHHQYLVDJpH

FRQIRUPLWpHWGHIRQFWLRQQHPHQWUpVXOWDQWQRWDPPHQWGHODFTXLVLWLRQHWGHOHQWUHWLHQGHILOWUHVjPrPHGH
rduire les missions.

67

,O IDXW WRXWHIRLVQRWHU TXH ODFWXHOOH Chancelire, Mme Angela Merkel, a


dcid que, sous son Gouvernement, tout projet de loi qui aurait reu un avis
ngatif du NKR ne serait pas prsent au Parlement.
/DYLV GX NKR  QHVW SXEOLp TXH ORUVTXH OH SURMHW GH WH[WH HVW
DGRSWpSDUOH&RQVHLOGHVPLQLVWUHVHWVLOVDJLWGXQSURMHWGHORLLOHVWDORUV
MRLQWDXWH[WHHWjOpWXGHGLPSDFWDGUHVVpVDX3DUOHPHQW$ILQGHIDFLOLWHUOD
OHFWXUH DX[ SDUOHPHQWDLUHV HW DX SXEOLF OpWXGH GLPSDFW FRPPH ODYLV GX
NKR sont synthtiss de faon ne pas dpasser une deux pages.
Depuis 2010, si elles ont des doutes sur une valuation, les
FRPPLVVLRQV VDLVLHV GXQ SURMHW GH ORL SHXYHQW FRQYRTXHU OHV PHPEUHV GX
NKR SRXUTXLOVVH[SULPHQWGHYDQWHOOHVHWH[SOLFLWHQWOHXUDYLVTXLVRXV
la prcdente lgislature, a toujours t suivi.
Lors de son entretien avec la mission, le chef du BRU M. Stephan
Naundorf, a soulign que les parlementaires allemands examinaient de prs les
pWXGHV GLPSDFW HW OHV pYDOXDWLRQV FKLIIUpHV TXHOOHV FRQWLHQQHQW ,O D FLWp
OH[HPSOHUpFHQWGXQSURMHWGHORLVXUODWUDQVSDUHQFHGXSUL[GHOHVVHQFHDXVXMHW
GXTXHO OH PLQLVWUH GH OeFRQRPLH DYDLW YRXOX SDVVHU RXWUH ODYLV QpJDWLI GX
NKR (1). Ce dernier avait estim environ 9 PLOOLRQV GHXURV OH FRW GX
projet de loi (80 millions dHXURV j OD FKDUJH GHV VWDWLRQV-service qui allaient se
YRLULPSRVHUGHQRXYHOOHVREOLJDWLRQVGLQIRUPDWLRQHWPLOOLRQVGHXURVSRXUOD
mise en place du dispositif de transparence lui-mme). Ces donnes chiffres
avaient t publies sur un site Internet ouvert tous. Sceptique face au bilan
cots/avantages, le Parlement a mis des rserves qui ont conduit le ministre de
OeFRQRPLHjUHQRQFHUjVRQSURMHWGHORL'DSUqV06WHSKDQ1DXQGRUIdepuis
la cration du NKR , la ligne de conflits potentieOV  VHVW GpSODFpH HW
oppose moins les partis politiques entre eux (sociaux-dmocrates et
conservateurs) que le Parlement et le Gouvernement.
Les reprsentants du NKR ont toutefois prcis que leur audition
par les commissions parlementaires tait rare : GXQHSDUWSDUFHTXHVHORQ son
prsident, M. Johannes Ludewig, seule la moiti des projets de lois en moyenne
cre des charges administratives, et seule une partie de ceux-ci engendrent des
FRWV FRQVpTXHQWV HW GDXWUH SDUW SDUFH TXH le fait majoritaire dissuade ces
commissions de remettre en cause les estimations fournies par le
Gouvernement quHOOHVVRXWLHQQHQWHQPDMRULWp
En moyenne, prs de 350 avis sont formuls chaque anne et transmis au
Parlement. Le NKR HVWLPHTXHGHVFRWVGLPSact des projets de texte
sont dsormais connus avant la prise de dcision.

(1) Cet avis est consultable au lien suivant :


http://www.normenkontrollrat.bund.de/Webs/NKR/Content/DE/Artikel_u_Textbausteine/stellungnahme_mtsg_
2.html?nn=826450

Le rle du NKR dans le processus allemand GDGRSWLRQGHVSURMHWVGHWH[WHV


Le NKR examine dans un dlai
moyen de trois semaines les projets
GpWXGHVGLPSDFWHQVH
concertantavec les services des
ministres et en leur suggrant des
amliorations de faon confidentielle.
Ensuite, il met un avis positif ou
ngatif.

Les services des ministres adressent


DX 1.5 OHV SURMHWV GpWXGHV GLPSDFW
pour examen approfondi

Le NKR adresse ses avis


aux ministres

2
68

Les ministres laborent des projets


GpWXGHVGLPSDFWHWOHVVRXPHWWHQWDX
NKR avant qXHOOHV QH VRLHQW
soumises la consultation publique
(des partenaires sociaux notamment)
et prsentes au Conseil des ministres
pour adoption

/HV pWXGHV GLPSDFW YLVpHV SDU OH 1.5 HW


ODYLV GH FH GHUQLHU VRQW WUDQVPLV DX &RQVHLO
des ministres

Le Conseil des ministres rend sa


dcision finale sur la miVH HQ XYUH
des normes envisages.

69

Les quatre facteurs du changement de culture normative


au Royaume-Uni et en Allemagne
1 /pYDOXDWLRQ LQGpSHQGDQWH GHV pWXGHV GLPSDFW SDU XQ FRPLWp FRPSRVp GH
reprsentants de la socit civile ;
2 /H GpYHORSSHPHQW GXQH H[SHUWLVH WHFKQLTXH SRXVVpH DX VHLQ GXQ S{OH GH
contrexpertise ;
3/DGpILQLWLRQGXQHPpWKRGRORJLHFODLUHHWSDUWDJpHSRXUOpYDOXDWLRQGHOLPSDFW
4 Un pilotage gouvernemental resserr et fond sur une importante coordination
interministrielle.

0pWKRGRORJLHGHOpYDOXDWLRQGHOLPSDFWHWGHSXLVODQRPLQDWLRQDXSUqV
GX3UHPLHUPLQLVWUHGXQVHFUpWDLUHGeWat charg de la simplification : notre pays
dispose dj de deux des quatre facteurs du changement de culture normative
constat au Royaume-8QLHWHQ$OOHPDJQH,OQHOXLUHVWHSOXVTXjVHGRWHUGXQ
PpFDQLVPH GpYDOXDWLRQ LQGpSHQGDQWH GHV pWXGHV GLPSDFW SDU XQ FRQVHLO
compos de reprsentants de la socit civile appuys par un ple de
contrexpertise technique.
C. PISTES
POUR
UN
NOUVEAU
CADRE
INSTITUTIONNEL
'e/$%25$7,21 '(6 e78'(6 ',03$&7 MIEUX MME DE
GARANTIR LEUR QUALIT.

Suivant les modles britannique et allemand, ainsi que les


recommandations de ERQ QRPEUH GHV SHUVRQQHV TXHOOH D HQWHQGXHV la mission
QHQWHQG SDV UHPHWWUH HQ FDXVH OH SULQFLSH VHORQ OHTXHO OpODERUDWLRQ GHV
pWXGHVGLPSDFWGRLWrWUHFRQILpHDX[PLQLVWqUHVSRUWHXUVGHVSURMHWVGHWH[WHV
lgislatifs ou rglementaires &RPPH OD LQGLTXp GHYDQW OD PLVVLRQ 0 5pPL
%RXFKH]DQFLHQFRPPLVVDLUHjODVLPSOLILFDWLRQOpYDOXDWLRQex ante GHOLPSDFW
des normes relve GXQHGpPDUFKHGXQTXHVWLRQQHPHQWTXLGRLWDFFRPSDJQHU
le processus du dbut en se demandant si la rdaction du texte est opportune
MXVTXj OD ILQ  HOOH HVW LQWLPHPHQW OLpH DX SURFHVVXV GH FRQFHUWDWLRQ HW GH
consultation pralable , or seul le ministre porteur du texte peut conduire les
processus en parallle et les faire interagir .
En revanche, coPPH OD IDLW UHPDUTXHU 0 Rmi Bouchez, il est vrai
TXLO SHXW PDQTXHU QRWDPPHQW SRXU OHV WH[WHV j IRUW HQMHX XQ PpFDQLVPH GH
validation extrieure. Le Secrtariat gnral du Gouvernement et le Conseil
GeWDW H[HUFHQW XQ FRQWU{OH PDLV LOV QRQW SDV OD capacit de procder une
FRQWUH[SHUWLVHLOVDJLWVXUWRXWSRXUHX[GHVDVVXUHUTXHWRXWHVOHVUXEULTXHVGH
OpWXGHGLPSDFWRQWpWpUHQVHLJQpHV .
&est la raison pour laquelle, dans un souci de transparence de la
dcision publique, la mission prconise la FUpDWLRQ GXQH DXWRULWp
administrative indpendante qui serait charge de contrexpertiser les tudes
GLPSDFWDVVRUWLVVDQWWRXWWH[WHOpJLVODWLIRXUpJOHPHQWDLUHTXLOFRQFHUQHRX
non les entreprises.

70

Le vice-SUpVLGHQWGX&RQVHLOGeWDW0 Jean-Marc Sauv, a estim, lors de


son audition, TX HQ DPRQW GH OD GpOLEpUDWLRQ GX &RQVHLO GeWDW OD SUpVHQFH
GXQH FDSDFLWp GH[SHUWLVH HQ FH GRPDLQH SDU H[HPSOH DXSUqV GX VHFUpWDULDW
gnral du Gouvernement, serait nanmoins trs utile : elle pourrait associer des
personnes issues du secteur public, de la socit civile et du secteur priv ; la
GpOLEpUDWLRQ GX &RQVHLO GeWDW VHQ WURXYHUDLW HQULFKLH . M. Jean-Marc Sauv a
cependant mis des rticences quant jOLGpHGHFUpHUXQHQRXYHOOHDXtorit ddie
cette mission.
7RXWHIRLV FRQYDLQFXH GH OLQWpUrW TXLO \ DXUDLW j DVVRFLHU O,QVWLWXW
national de la statistique et des tudes conomiques (INSEE) ce ple de
contrexpertise, sur le modle allemand, la mission a convenu avec le directeur
JpQpUDO GH O,16EE, M. Jean-Luc TaverniHU TXH OLQGpSHQGDQFH GH FH S{OH GH
contre-pYDOXDWLRQpWDLWXQHFRQGLWLRQGHODSDUWLFLSDWLRQGHVH[SHUWVGHO,16((j
ses travaux et que cette indpendance devait tre inscrite dans la loi.
(Q HIIHW FRPPH OD UDSSHOp 0 Jean-Luc Tavernier lors de son audition,
O,16(( HVW XQH DGPLQLVWUDWLRQ FHQWUDOH FRPPH XQH DXWUH  HOOH QHVW SDV
indpendante en droit ELHQ TXHOOH OH VRLW HQ SUDWLTXH , de sorte que, pour
DVVRFLHUVHVH[SHUWVjXQRUJDQLVPHFKDUJpGHOpYDOXDWLRQGHODTXDOLW des tudes
GLPSDFW SURGXLWHV SDU OHV PLQLVWqUHV il faudrait concevoir un systme de
gouvernance qui lui garantisse une indpendance relative , de la mme faon
TXHQ $OOHPDJQH 'HVWDWLV WUDYDLOOH VRXV OH FRQWU{OH GXQH DXWRULWp
administrative, le 1.5GRQWOLQGpSHQGDQFHSDUUDSSRUWDX[SRXYRLUVOpJLVODWLIHW
H[pFXWLI HVW JDUDQWLH SDU OD ORL 6XLYDQW FHW H[HPSOH OLQGpSHQGDQFH GH
ODGPLQLVWUDWLRQ IUDQoDLVH FKDUJpH GH FHWWH PLVVLRQ SRXUUDLW SURFpGHU GH
OLQGpSHQGDQFH GH ODXWRULWp DGPLQLVWUDWLYH VRXV ODXWRULWp GH ODTXHOOH HOOH
agirait .
&HVW OD UDLVRQ SRXU ODTXHOOH la mission prconise de confrer un
ancrage lgislatif, voire organique, une autorit indpendante qui,
compose de reprsentants de la socit civile, serait FKDUJpH GpYDOXHU OD
TXDOLWpGHVpWXGHVGLPSDFWHQVDSSX\DQWVXUGHVH[SHUWVLVVXVGHVVHFWHXUV
SULYpHWSXEOLFQRWDPPHQWGHVXQLYHUVLWpVGHO,16((GHVDGPLQLVWUDWLRQV
pFRQRPLTXHVGHVFRUSVGLQVSHFWLRQHWGHVFRQWU{OHVJpQpUDX[
Sur les modles britannique et allemand, la contrexpertise mene par
ODXWRULWp LQGpSHQGDQWH VHUD consigne dans un avis qui sera rendu public
lors de la prsentation en conseil des ministres des projets de loi ou de dcret
et qui accordera une importance toute particulire jOpYROXWLRQHVWLPpHGHV
charges administratives rsultant de la mesure envisage (1).
/D PLVVLRQ QHQWHQGDQW SDV IDLUH pFKDSSHU VHV SURSRVLWLRQV j OH[LJHQFH
GpYDOXDWLRQGRQWHOOHORXHOHVYHUWXVHOOHSURSRVHGHsoumettre ce dispositif de
contre-valuDWLRQ HW GH YDOLGDWLRQ GHV pWXGHV GLPSDFW j XQH pYDOXDWLRQ DX
WHUPHGXQGpODLGHGHX[DQVjFRPSWHUGHVDPLVHHQXYUH
(1) Voir le schma p. 73.

71

Proposition n 2 &RQWUH[SHUWLVHUOHVpWXGHVGLPSDFW
&RQILHU OpYDOXDWLRQ GH OD TXDOLWp GHV pWXGHV GLPSDFW j XQ RUJDQLVPH
indpendant :
compos de reprsentants de la socit civile ;
FKDUJp HQ VDSSX\DQW VXU GHV H[SHUWV LVVXV GHV VHFWHXUV SULYp HW SXEOLF
QRWDPPHQW GHV XQLYHUVLWpV GH O,16(( GHV DGPLQLVWUDWLRQV pFRQRPLTXHV GHV
FRUSV GLQVSHFWLRQ HW GHV FRQWU{OHV JpQpraux, de rendre un avis public prenant
QRWDPPHQWHQFRPSWHOpYROXWLRQHVWLPpHGHVFKDUJHVDGPLQLVWUDWLYHVUpVXOWDQWGH
la mesure envisage ;
ODYLV VXU OHV pWXGHV GLPSDFW DVVRUWLVVDQW OHV SURMHWV GH ORL pWDQW UHQGX SXEOLF
lors de la prsentation de ces derniers en conseil des ministres ;
SUpYRLUXQHpYDOXDWLRQGHFHGLVSRVLWLIGHYDOLGDWLRQGHVpWXGHVGLPSDFWGDQV
XQGpODLGHGHX[DQVjFRPSWHUGHVDPLVHHQXYUH
Votre rapporteur souligne TXHFRPPHORQWPRQWUpOHVH[HPSOHVEHOJHHW
allemand, la cRQGLWLRQ GH OREMHFWLYLWp GXUHJDUGTXL HVW DWWHQGXH GH ORUJDQLVPH
de contrexpertise rside dans une indpendance statutaire garantie par la loi.
1. Confrer j ODXWRULWp de contrexpertise un ancrage organique et
lgislatif, sur les modles belge et allemand

Lors du dplacement de la mission Bruxelles, le 16 janvier 2014,


M. (UZLQ 'HSXH GLUHFWHXU JpQpUDO GH O$JHQFH SRXU OD VLPSOLILFDWLRQ
DGPLQLVWUDWLYH $6$ DVRXOLJQpTXHOXQHGHVSULQFLSDOHVIRUFHVGHcette agence
consistait dans son ancrage lgislatif, qui lui reconnat un droit de proposer des
modifications lgislatives et rglementaires et qui lui assure une certaine stabilit
dans le temps.
/$JHQFHEHOJHSRXUOD VLPSOLILFDWLRQ DGPLQLVWUDWLYHD en effet t cre
par une loi-programme pour la promotion de OHQWUHSULVH LQGpSHQGDQWH GX
10 fvrier 1998 TXL OD rattache DX 3UHPLHU PLQLVWUH SRXU OXL SHUPHWWUH GDYRLU
une comptence interministrielle.
Cette loi-programme TXLIL[HOHVPLVVLRQVHWOHVSRXYRLUVGHO$6A (article
41) a t complte par un arrt royal du 23 dcembre 1998 qui dfinit la
FRPSRVLWLRQGHVRQFRPLWpGRULHQWDWLRQ PHPEUHV VRQIRQFWLRQQHPHQWDLQVL
que la composition de son secrtariat (14 fonctionnaires). Cet arrt royal prcise
expliciWHPHQW TXH OHV IRQFWLRQQDLUHV GX VHFUpWDULDW GH O$6$ exercent leurs
missions en toute indpendance par rapport leur dpartement ou service
GRULJLQH
De la mme faon, en Allemagne, la loi du 14 aot 2006 qui a cr le
conseil national de contrle des normes ( NKR ) prvoit ds le premier alina de
son article 1er que ce conseil travaille en toute indpendance. Cette loi dfinit par

72

ailleurs les missions du NKR (article 1er), sa composition et son


organisation (article 3), ses pouvoirs (articles 4 et 5) et ses devoirs (article 6).
6DJLVVDQWGHODFRPSRVLWLRQGX NKR , la loi du 14 aot 2006 dispose
expressment que, durant la dure de leur mandat, les membres du NKR ne
peuvent exercer un mandat lgislatif ni tre employs par une autorit publique
IpGpUDOHRXIpGpUpHQLPrPHVHWURXYHUHQUHODWLRQGHVXERUGLQDWLRQRXGDIIDLUHV
avec les assembles parlementaires ou les autorits publiques prcites (article 3,
alina 3). La loi du 14 aot 2006 ajoute que les membres du secrtariat du
NKR QHUHoRLYHQWGLQVWUXFWLRQVTXHGHVPHPEUHVGX NKR et ne peuvent,
durant leur affectation auprs de ce dernier, se voir confier, temps complet ou
PrPH SDUWLHO GHV PLVVLRQV D\DQW XQ OLHQGLUHFW RX LQGLUHFW DYHF ODGPLQLVWUDWLRQ
GHOeWDWIpGpUDORXGes tats fdrs.
/HV H[LJHQFHV GLQGpSHQGDQFH TXL GRLYHQW SUpVLGHU j OD FRPSRVLWLRQ DX
IRQFWLRQQHPHQW HW j ODFFRPSOLVVHPHQW GHV PLVVLRQV GH ODXWRULWp LQGpSHQGDQWH
charge de contrH[SHUWLVHUOHVpWXGHVGLPSDFW impliquent que cette autorit soit
cre par la loi.
Qui plus est, dans la mesure o cette autorit indpendante serait appele
MRXHU XQ U{OH GpFLVLI GDQV OH SURFHVVXVGpODERUDWLRQGHV pWXGHVGLPSDFWTXL HVW
rgi par la loi organique du 15 avril 2009, sa cration requerrait aussi (et tout le
moins) une modification de cette loi organique.
2. Clarifier en consquence la rpartition des tches entre ODXWRULWp GH
contrexpertise GXQH SDUW HW GDXWUH SDUW OH FRQVHLO GH OD
VLPSOLILFDWLRQ SRXU OHV HQWUHSULVHV HW OH FRQVHLO QDWLRQDO GpYDOXDWLRn
des normes applicables aux collectivits territoriales

Interpelle par les rserves exprimes par M. Jean-Marc Sauv,


vice-SUpVLGHQWGX&RQVHLOGeWDW (1), et par M. Didier Migaud, Premier prsident de
la Cour de comptes (2)ODPLVVLRQVHVWEHDXFRXSLQWHUURJpHVXUORSSRUWXQLWpTXLO
\DXUDLWjFUpHUXQHQRXYHOOHDXWRULWpFKDUJpHGHOpYDOXDWLRQDORUVTXH[LVWHQWGpMj
le conseil de la simplification pour les entreprises ou encore le conseil national
GpYDOXDWLRQGHVQRUPHVDSSOLFDEOHVDX[FROOHFWLYLWpVterritoriales.
Conseil de la simplification pour les entreprises
Ds le 23 octobre 2013, le Prsident de la Rpublique a confi M. Guillaume Poitrinal,
FKHIGHQWUHSULVHHWj07KLHUU\0DQGRQDORUVGpSXWpOHVRLQGHGUHVVHUUpJXOLqUHPHQWXQ
bilan SXEOLFGHODPLVHHQXYUHGHVPHVXUHVGHVLPSOLILFDWLRQDXSURILWGHVHQWUHSULVHV
Par le dcret n 2014 11 du 8 janvier 2014, le Premier ministre a institu auprs de lui, pour
une dure de trois ans, un Conseil de la simplification pour les entreprises dont la prsidence

(1) Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDW le 22 mai 2014. Voir le compte-rendu


en annexe n 16.
(2) Audition de M. Didier Migaud, Premier prsident de la Cour des comptes, le 30 avril 2014. Voir le
compte-rendu en annexe n 16.

73

a t confie conjointement MM. Guillaume Poitrinal et Thierry Mandon, auquel M.


Laurent Grandguillaume, dput, a dsormais succd.
&RPSRVp GpOXV GH[SHUWV HW GH SHUVRQQDOLWpV LQGpSHQGDQWHV LVVXHV GHV HQWUHSULVHV HW GHV
administrations, tous dsigns par arrt du Premier ministre (1), ce conseil est charg de
proposer au Gouvernement les orientations stratgiques de la politique de simplification
OpJDUGGHVHQWUHSULVHVHWQRWDPPHQW
GDVVXUHU OH GLDORJXH DYHF OH PRQGH conomique et de contribuer la participation des
HQWUHSULVHVjODFRQFHSWLRQHWjODPLVHHQXYUHGHVPHVXUHVGHVLPSOLILFDWLRQ
de proposer au Gouvernement des axes prioritaires de simplification et de le conseiller sur
toute solution innovante ou mesure nouvelle de nature lgislative, rglementaire ou
administrative qui lui paratrait devoir tre retenue ;
de suivre les ralisations du programme de simplification pour les entreprises et
OpYDOXDWLRQGHVHVUpVXOWDWV
de contribuer faire connatre les rsultats obtenus auprs des entreprises, des
organisations professionnelles et du grand public (2).
6DSSX\DQW VXU OHV VHUYLFHV GX 3UHPLHU PLQLVWUH FH FRQVHLO D PLV HQ SODFH XQH PpWKRGH
LQQRYDQWHFHQWUDQW ODFRQFHSWLRQHW ODPLVHHQXYUHGHV mesures de simplification sur les
besoins des entreprises identifis non seulement par les administrations mais aussi et surtout
par les acteurs conomiques eux-mmes.
Pour construire les mesures de simplification avec les entrepreneurs, un site participatif a t
cr : faire-simple.gouv.fr (3) 6LPSOH GXWLOLVDWLRQ FH VLWH SHUPHW HQ WURLV  FOLFV  GH
dposer des propositions de simplification destines enrichir les programmes engags par
OH *RXYHUQHPHQW RX GHQ VRXWHQLU GDXWUHV 'HV FDPSDJQHV GH consultation sont
rgulirement organises.
Paralllement, des groupes de travail ont t constitus avec les parties prenantes
(entreprises, lus, organisations professionnelles et consulaires, experts, administrations
FHQWUDOHVHW GpFRQFHQWUpHV SRXU Hxpertiser les propositions formules sur le site fairesimple.gouv.fr ainsi que les recommandations faites par les entreprises.
$XERXWGHWURLVPRLVGHWUDYDLOGDQVOHFDGUHGDWHOLHUVFROODERUDWLIVDVVRFLDQWHQWUHSULVHVHW
administrations et structuUpVDXWRXUGHVPRPHQWVFOpVGHODYLHGXQHHQWUHSULVHOH&RQVHLO
de la simplification pour les entreprises a publi, le 14 avril dernier, une premire srie de 50
propositions, valides par le Prsident de la Rpublique, applicables soit immdiatement soit,
pour la plupart, au 31 dcembre 2014 (4) et reprises, pour la quasi-WRWDOLWpGHQWUHHOOHVTXLRQW
une nature lgislative, dans le projet de loi relatif la simplification de la vie des entreprises,
DGRSWpHQSUHPLqUHOHFWXUHSDUO$VVHPEOpHQDWLRQDOH le 22 juillet dernier.

Aprs rflexion, la mission prconise de confier la contrexpertise des


pWXGHV GLPSDFW HW GH OHXU PpWKRGRORJLH j XQH DXWRULWp administrative
(1) Voir les arrts du Premier ministre des 20 janvier et 28 fvrier 2014 portant nominations au conseil de la
simplification pour les entreprises.
(2) Dcret n 2014-11 du 8 janvier 2014 instituant le conseil de la simplification pour les entreprises,
article 2.
(3) Ce site est consultable au lien suivant : http://www.faire-simple.gouv.fr/.
(4) Le dossier des 50 mesures de simplification prsentes le 14 avril 2014 est consultable sur le site du
Conseil de la simplification pour les entreprises ( http://www.simplifier-entreprise.fr/ ) au lien suivant :
http://www.simplifier-entreprise.fr/wp-content/uploads/2014/04/DP_50-mesures-de-simplification-pour-lesentreprises.pdf

74

indpendante qui serait charge de se concentrer sur la rationalisation du flux


normatif, HW GRQW OHV WUDYDX[ GpYDOXDWLRQ j YRFDWLRQ JpQpUDOH VDUWLFXOHUDLHQW
DYHFOH[SHUWLVHVHFWRULHOOH du conseil de la simplification pour les entreprises et
du FRQVHLO QDWLRQDO GpYDOXDWLRQ GHV QRUPHV DSSOLFDEOHV aux collectivits
territoriales.
La crpDWLRQ GXQH DXWRULWp LQGpSHQGDQWH VSpFLILTXHPHQW GpGLpH j OD
contre-pYDOXDWLRQGHVpWXGHVGLPSDFWHWDXWUDLWHPHQWGX flux normatif est, du
reste, la solution retenue par les cinq pays europens qui se sont dots
GRUJDQLVPHVFRQVXOWDWLIVSRXUFRQWU{OHUODTXDOLWpGHVpWXGHVGLPSDFW
La cration de cette autorit indpendante ne complexifierait pas notre
dispositif institutionnel GqVORUVTXDXUDpWpFODLUHPHQWpWDEOLXQSDUWDJHGHVWkFKHV
entre elle et les organismes existants.
Quoique devant bien sr tre dote des ressources ncessaires en termes de
personnel et de moyens techniques et financiers de contrexpertise, cette autorit
administrative indpendante ne constituera pas pour autant une structure lourde,
car, conue sur le modle britannique du RPC et sur le modle allemand du
NKR HOOHQHFRPSWHUDTXXQHGL]DLQHGHUHSUpVHQWDQWVGHODVRFLpWpFLYLOH
qui, comme en Allemagne, pourront tre des bnvoles , pauls par une
TXLQ]DLQH GH[SHUWV &HX[ GH FHV H[SHUWV TXL DSSDUWLHQQHQW DX secteur public
VWDWLVWLFLHQV GH O,16(( XQLYHUVLWDLUHV PHPEUHV GHV DGPLQLVWUDWLRQV
pFRQRPLTXHV GHV FRUSV GLQVSHFWLRQ HW GHV FRQWU{OHV JpQpUDX[  SRXUURQW rWUH
DIIHFWpV DXSUqV GH ODXWRULWp administrative indpendante dans le cadre de
mobilits qui implLTXHURQW SRXU OeWDW XQ UHGpSORLHPHQW GH VHV FDSDFLWpV
GH[SHUWLVHDXMRXUGKXLpSDUSLOOpHVVDQVFRWVXSSOpPHQWDLUH
Conue pour tre une structure lgre, cette autorit administrative
indpendante pourra tre ractive et rendre ses avis rapidement, sous 7 21 jours,
sur le modle de du RPC britannique et du NKR allemand.

Le rle de la future autorit de contrexpertise dans OHSURFHVVXVGDGRSWLRQGHVSURMHWVGHWH[WHV

Les services des ministres adressent


ODXWRULWp GH OD VLPSOLILFDWLRQ OHV SURMHWV
GpWXGHVGLPSDFWSRXUXQHFRQWUHxpertise

1
/DXWRULWp GH OD VLPSOLILFDWLRQ
adresse ses avis aux ministres

/autorit de contrexpertise
examine sous 7 21 jours
OHVpWXGHVGLPSDFWHWOHXU
attribue une couleur :
- rouge : non-conforme aux
exigences mthodologiques
- orange: partiellement conforme
aux exigences mthodologiques
- vert : totalement conforme aux
exigences mthodologiques

/DXWRULWp GH FRQWUH[SHUWLVH


pYDOXHOpWXGHGLPSDFWVXUOD
proposition de loi ou
ODPHQGHPHQW substantiel
transmis

/HV pWXGHV GLPSDFW YLVpHV SDU ODXWRULWp


GH OD VLPSOLILFDWLRQ HW ODYLV GH FHWWH
dernire sont transmis au Conseil des
ministres

/DXWRULWp GH FRQWUH[SHUWLVH DGUHVVH


VRQDYLVjODVVHPEOpHFRQFHUQpH

Le Conseil des ministres rend sa


GpFLVLRQILQDOHVXUODPLVHHQXYUH
des projets de loi ou de dcret

/DVVHPEOpHSDUOHPHQWDLUHYRWHVXUODSURSRVLWLRQ
GHORLRXODPHQGHPHQWVXEVWDQWLHO

75

Les ministres laborent des projets


GpWXGHV GLPSDFW HW OHV VRXPHttent
ODXWRULWpGHFRQWUH[SHUWLVHDYDQW TXHOOHVQH
soient prsentes au Conseil des ministres
pour adoption

OLQLWLDWLYH
de son
Prsident,
ODVVHPEOpH
parlementaire
VDLVLWODXWRULWp
administrative
indpendante
pour la
contrexpertise
GXQHpWXGH
GLPSDFWVXU
une
proposition de
loi ou sur un
amendement
qualifi de
substantiel
par la
commission
comptente au
fond (vote la
majorit
simple)

77

II. 5(1'5(/e9$/8$7,21EX ANTE DE LA NORME PLUS SYSTMATIQUE

Si, comme cela a t rappel plus haut, de nombreux textes lgislatifs et


UpJOHPHQWDLUHV VRQW GpVRUPDLV VRXPLV j OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW
SUpDODEOHLOQHQGHPHXUHSDVPRLQVTXXQHSDUWLHQRQQpJOLJHDEOHGHVWH[WHVTXH
nous votons ou ratifions en est encore dispense. &HVW QRWDPPHQW OH FDV GHV
propositions de loi ainsi que des ordonnances qui ne concernent ni les entreprises
ni les collectivits territoriales.
A. LE CARACTRE FACULTA7,) '(6 e78'(6 ',03ACT POUR LES
PROPOSITIONS DE LOI ET POUR LES ORDONNANCES.

/DUWLFOHDOLQpDGHOD&RQVWLWXWLRQQHVRXPHWDX[Fonditions fixes
SDU OD ORL RUJDQLTXH GX  DYULO  UHODWLYH DX[ pWXGHV GLPSDFW TXH OD
prsentation des projets de loi. Aussi bien la Constitution que la loi organique du
15 DYULOH[HPSWHQWOHVSURSRVLWLRQVGHORLGHWRXWHpWXGHGimpact pralable.
3DUDLOOHXUVVLODUWLFOHGHODORLRUJDQLTXHGXDYULOimpose une
pWXGHGLPSDFWDOOpJpHSRXUOHVSURMHWVGHORLGKDELOLWDWLRQjSUHQGUHGHVPHVXUHV
OpJLVODWLYHVSDUYRLHGordonnances, les ordonnances elles-mmes, dans la mesure
o elles reYrWHQW MXVTXj OHXU UDWLILFDWLRQ XQ FDUDFWqUH UpJOHPHQWDLUH VRQW
GLVSHQVpHV GH WRXWH pWXGH GLPSDFW SUpDODEOH VDXI VL HOOHV FRQFHUQHQW OHV
entreprises ou les collectivits territoriales. Dans cette hypothse, elles relvent en
HIIHW GHV SURMHWV GDFWHV Uglementaires pour lesquels la circulaire du Premier
PLQLVWUHGXIpYULHUH[LJHODSURGXFWLRQGXQHILFKHGLPSDFW
1. /D UpDOLVDWLRQ GXQH pWXGH GLPSDct pour les propositions de loi Qest
pas une obligation

6LGDQVOHVLOHQFHGHODUWLFOHGHOD&RQVWLWXWLRQHWGHODORLRUJDQLTXH
GXDYULOODUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVSURSRVLWLRQVGHORL
QHVW TXXQH IDFXOWp YRWUH UDSSRUWHXU UDSSHOOH TXH GHSXLV OD UpYLVLRQ
constitutionnelle du 23 juillet 2008, les propositions de loi peuvent tre soumises
SRXU DYLV DX &RQVHLO GeWDW 2U FHWWH FRQVXOWDWLRQ SDUDvW GH QDWXUH j HQULFKLU
OpYDOXDWLRQex ante GHOLPSDFWGHVSURSRVLWLRQVGHORLVDQVWRXWHIRLVVHVXEVWLWXHU
jXQHpWXGHGLPSDFWHQERQQH et due forme.
a. Les propositions de loi QRQW SDV j rWUH DVVRUWLHV GpWXGHV GLPSDFW
PDLVSHXYHQWrWUHVRXPLVHVSRXUDYLVDX&RQVHLOGeWDW.
/H GHUQLHU DOLQpD GH ODUWLFOH  GH OD &RQVWLWXWLRQ GLVSRVH TXH le
SUpVLGHQWGXQHDVVHPEOpHSHXWVRXPHWWUHSRXUDYLVDX&RQVHLOGeWDWDYDQWVRQ
H[DPHQHQFRPPLVVLRQXQHSURSRVLWLRQGHORLGpSRVpHSDUOXQGHVPHPEUHVGH
FHWWHDVVHPEOpHVDXIVLFHGHUQLHUV\RSSRVH .

78

&RPPH OD UDSSHOp ORUV GH VRQ DXGLWLRQ OH YLFH-prsident du Conseil
GeWDW 0 Jean-Marc SauYp FHWWH IDFXOWp GH VDLVLQH GX &RQVHLO GeWDW QHVW SDV
totalement nouvelle : sous la III e Rpublique, le Parlement pouvait saisir le
&RQVHLOGeWDWGHGHPDQGHVGDYLVVXUOHVWH[WHVGRULJLQHSDUOHPHQWDLUHPDLVLO
QHODIDLWTXXQHVHXOHIRLVHQVRL[DQWH-cinq ans .
5HVWDXUpHHQFHWWHIDFXOWpGHVDLVLQHGX&RQVHLOGeWDWSRXUDYLVIDLt
GHSXLVORUVOREMHWGXQHXWLOLVDWLRQFURLVVDQWHSXLVTXH :
OHSUpVLGHQWGHO$VVHPEOpHQDWLRQDOH\DUHFRXUXSRXUSURSRVLWLRQV
de loi dont 9 ont t examines par notre Assemble (7 sous la prcdente
OpJLVODWXUHHWVRXVODFWXHOOHOpJLVODWXUH ;
le Prsident du Snat en a fait usage pour 6 propositions de loi dont une
seule a t examine par la Haute assemble.
'H ODYLV GH 0 Jean-Marc Sauv, FHVW SHX DX UHJDUG GH OLQLWLDWLYH
parlementaire, mais significatif au regard des sujets concerns ; aussi
considrons-nous ce dbut comme intressant. On pourrait dvelopper cette
consultation, sans doute, mais le constituant a fait preuve de sagesse en la
VRXPHWWDQWjXQDFFRUGHQWUHOHSUpVLGHQWGHODVVHPEOpHSDUOHPHQWDLUHFRQFHUQpH
HWODXWHXUGHOa proposition de loi .
En application du GHUQLHU DOLQpD GH Oarticle 39 de la Constitution, la
WUDQVPLVVLRQGXQHSURSRVLWLRQGHORLDX&RQVHLOGeWDWUHTXLHUW en effet ODFFRUG
de son auteur. Au sein de notre Assemble, la pratique, depuis la prcdente
lgislature, a t de rserver cette transmission aux propositions de loi dont le
contenu est stabilis et qui ont vocation tre inscrites jORUGUHGXMRXUdans
un dlai qui ne peut tre infrieur deux mois, de faon laisser DX&RQVHLOGeWDW
un temps GH[DPHQUDLVRQQDEOH
6HXOV ODXWHXU GH OD SURSRVLWLRQ GH ORL HW OH SUpVLGHQW GH ODVVHPEOpH
FRQFHUQpH VRQW GHVWLQDWDLUHV GH ODYLV GX &RQVHLO GeWDW, auquel le premier peut
DFFRUGHU OD SXEOLFLWp TXLO VRXKDLWH Toutefois, FRPPH OD H[SOLTXp GHYDQW la
mission notre collgue Jean-Luc Warsmann, ancien prsident de la commission
des Lois et auteur de quatre lois de simplification du droit, dont deux avaient t
WUDQVPLVHVSRXU DYLVDX &RQVHLOGeWDW OXVDJH DX VHLQ GHQRWUH $VVHPEOpHYHXW
TXHODXWHXUGHODSURSRVLWLRQGHORLSXEOLHOHVH[WUDLWVGHODYLVGX&RQVHLOGeWDW
sur les seules GLVSRVLWLRQVGHVRQWH[WHTXLOHQWHQGPDLQWHQLU ; libre lui de ne
pas publier les extraits de cet avis sur les dispositions dont il propose lui-mme la
suppression.
Ce dernier DGDLOOHXUVVRXOLJQpOLQWpUrW de cette procdure de consultation
GX &RQVHLO GeWDW VXU OHV SURSRVLWLRQV GH ORL GpFODUDQW QHQ SHQVHU que du
bien . Selon lui, elle constitue un grand progrs , dans la mesure o elle a
permis de mettre galit le Parlement et le Gouvernement et a offert aux
parlementaires la possibilit de VDGUHVVHU DX[ FRQVHLOOHUV GeWDW SRXU SODLGHU
leur cause , pour, le cas chant, faire voluer leur avis.

79

De son ct, la Haute juridiction a expliqu que les modalits pratiques


GH[DPHQ GH FHV SURSRVLWLRQV GH ORL WpPRLJQHQW GDQV XQ FDGUH GpVRUPDLV ELHQ
tabli, de la qualit des relations entre les deux assembles parlementaires et le
&RQVHLOGeWDW (1).
b. Un exemple de proposition de loi adopte la suitHGXQHpYDOXDWLRQ.
7RXW HQ VRXOLJQDQW TXH OD VDLVLQH GX &RQVHLO GeWDW SRXU DYLV VXU GHV
propositions de loi appeles tre adoptes et promulgues contribue
LQGpQLDEOHPHQWjODPpOLRUDWLRQGHODTXDOLWpde ces textes, dans la mesure o elle
favorise une ODUJHFRQIURQWDWLRQGHSRLQWVGHYXHHWGH[SHUWLVHVVXUGHVVXEWLOLWpV
UpGDFWLRQQHOOHV TXL VRQW GXQH JUDQGH WHFKQLFLWp HW TXL SHXYHQW DYoir une
LPSRUWDQFH FRQVLGpUDEOH YRWUH UDSSRUWHXU UHPDUTXH TXH FHWWH VDLVLQH QHVW
QXOOHPHQWH[FOXVLYHGDXWUHVERQQHVSUDWLTXHVHQPDWLqUHGpYDOXDWLRQSUpDODEOH
 FHW pJDUGYRWUH UDSSRUWHXU WLHQW j FLWHU OH[HPSOH de la proposition de
loi de MM. Christian Eckert, Bruno Le Roux et plusieurs de leurs collgues
relative DX[ FRPSWHV EDQFDLUHV LQDFWLIV HW DX[ FRQWUDWV GDssurance-vie en
dshrence, devenue la loi n 2014-617 du 13 juin 2014.
&HWWH ORL D pWp OH IUXLW GXQ WUDYDLO GH UpIOH[LRQ, particulirement
approfondiHWORQJGHSOXVGXQDQ auquel ont particip la Cour des comptes, le
&RQVHLOGeWDWHWOHVVHUYLFHVDdministratifs en charge de ces questions et auquel
les organismes reprsentatifs des diffrentes parties prenantes ont galement
apport une contribution essentielle.
UN EXEM PLE DE BONNES PRATI QUES EN M ATI RE
'e9$/8$7,21EX ANTE '(/,03$&7'(6352326,7,2NS DE LOI :
LA LOI N 2014-617 DU 13 JUI N 2014 RELATI VE AUX COM PTES BANCAI RES
,1$&7,)6(7$8;&2175$76'$6685$1&(-VI E EN DSHRENCE
(extrait du rapport n 1765 de M. Christian Eckert, rapporteur gnral de la commission des
Finances, sur la proposition de loi n 1546 relative aux comptes bancaires inactifs et aux
FRQWUDWVGDVVXUDQFH-vie en dshrence, pp. 17-18)
En dcembre 2012, la commission des Finances a demand la Cour des comptes,
VXUOHIRQGHPHQWGXGHODUWLFOHGHODORLRUJDQLTXHUelative aux lois de finances, une
enqute sur la question des avoirs en dshrence.
Le 17 juillet 2013, la Cour des comptes a prsent les conclusions de ce travail
devant la commission des Finances en prsence des reprsentants de la Fdration franaise
GHVVRFLpWpVGDVVXUDQFH ))6$ HWGHOD)pGpUDWLRQEDQFDLUHIUDQoDLVH )%) 6RQUDSSRUW
qui dmontre notamment la ncessit de modifier la loi pour assurer la protection des
pargnants, a t publi en annH[H DX UDSSRUW GLQIRUPDWLRQ Q 1292 prsent par le
rapporteur gnral M. Christian Eckert, le 19 juillet 2013 au nom de la commission des
Finances.
Le rapporteur gnral a ensuite engag sans dlai une consultation des diverses
SDUWLHV SUHQDQWHV VXU OD EDVH GXQH SUHPLqUH YHUVLRQ GH OD SURSRVLWLRQ Ge loi, envoye

(1) &RQVHLOGeWDW5DSSRUWSXEOLFS 133.

80

OHQVHPEOHGHVVHUYLFHVHWRUJDQLVPHVPHQWLRQQpVHQDQQH[HGXSUpVHQWUDSSRUWOHVTXHOVRQW
pu prsenter leurs observations par crit au dbut du mois de septembre 2013.
Sur la base de cette consultation et en lien troit avec la Direction gnrale du Trsor,
le rapporteur gnral a dpos la prsente proposition de loi, co-signe par M. Bruno
Le 5RX[HWSDUOHQVHPEOHGHVPHPEUHVGXJURXSHVRFLDOLVWHUpSXEOLFDLQHWFLWR\HQVXUOH
EXUHDXGHO$VVHPEOpHQDWLRQDOHOHQRYHPEUH
La proposition de loi tend instaurer un rgime juridique entirement nouveau
applicable aux comptes bancaires inactifs et complter en profondeur le rgime existant
DSSOLFDEOHDX[FRQWUDWVGDVVXUDQFH-YLHHQGpVKpUHQFH/HGLVSRVLWLIQHVWSDVVDQVLQFLGHQFe
sur des droits et liberts constitutionnellement protgs, en particulier la libert contractuelle,
ODOLEHUWpGHQWUHSUHQGUHHWOHGURLWGHSURSULpWp
&HVW SRXUTXRL OH EHVRLQ GXQH H[SHUWLVH MXULGLTXH FRPSOpPHQWDLUH VHVW IDLW MRXU
conduisant le rapporteur gnral auteur de la proposition de loi demander au Prsident de
O$VVHPEOpHQDWLRQDOH0&ODXGH%DUWRORQHGHELHQYRXORLUVDLVLUOH&RQVHLOGeWDWVXUOH
IRQGHPHQWGXGHUQLHUDOLQpDGHODUWLFOHGHOD&RQVWLWXWLRQ
/H&RQVHLOGeWDWUpXQLHQ section des finances le 14 janvier 2014, puis en assemble
JpQpUDOH OH  MDQYLHU  QD UHOHYp DXFXQH GLVSRVLWLRQ FRQWUDLUH j OD &RQVWLWXWLRQ HW D
suggr des amliorations de nature assurer le caractre oprationnel du dispositif et en
parfaire la rdaction.
/H WUDYDLO GpODERUDWLRQ GH OD QRUPH SUpDODEOHPHQW j OHQJDJHPHQW GH OH[DPHQ
SDUOHPHQWDLUHGXWH[WHDXUDDLQVLGXUpJOREDOHPHQWSOXVGXQDQHWDXUDLPSOLTXpOHQVHPEOH
des institutions, services administratifs et organismes professionnels suVFHSWLEOHVGDSSRUWHU
leur pierre la conception de ce nouveau cadre lgislatif.

&HW H[HPSOH LOOXVWUH OD IDLVDELOLWp GXQH pYDOXDWLRQ ex ante GH OLPSDFW
GXQH SURSRVLWLRQ GH ORL SRXU SHX TXH ORQ VHQ GRQQH OH WHPSV 'H WHOOHV
valuations devraient auVVL VLPSRVHU SRXU OHV RUGRQQDQFHV GRQW OD PDMRULWp HVW
H[RQpUpHGHWRXWHREOLJDWLRQGpWXGHGLPSDFW
2. /D UpDOLVDWLRQGXQHpWXGH GLPSDFWHVWpJDOHPHQW XQH IDFXOWp SRXU la
majorit des ordonnances.

$ORUV TXH OH 3DUOHPHQW VHQ UHPHW IUpTXHPPHQW DX *RXYHUQement pour
ODGRSWLRQGHPHVXUHVOpJLVODWLYHVSDUYRLHGRUGRQQDQFHVDXFXQHREOLJDWLRQQHVW
IDLWH j OH[pFXWLI GpYDOXHU ex ante OLPSDFW GHV RUGRQQDQFHV TXLO VRXPHW j OD
ratification des assembles, ds lors que celles-FL QHQWUHQW SDV GDQV OH FKDPS
Gapplication de la circulaire du Premier ministre du 17 fvrier 2011 relative la
simplification des normes concernant les entreprises et les collectivits
territoriales.
a. 6L OHV SURMHWV GH ORL GKDELOLWDWLRQ j SUHQGUH GHV PHVXUHV OpJLVODWLYHV
par ordonnancHGRLYHQWrWUHDVVRUWLVGXQHpWXGHGLPSDFWDXFRQWHQX
allg...
/DUWLFOH  GH OD ORL RUJDQLTXH GX  DYULO  GLVSHQVH OHV pWXGHV
GLPSDFW DVVRUWLVVDQW OHV SURMHWV GH ORL GKDELOLWDWLRQ GXQH SDUWLH GHV UXEULTXHV

81

devant tre renseignes dans le cas o elles accompagnent des projets de loi
ordinaire.
(Q HIIHW FH WH[WH SUpYRLW TXH FHV pWXGHV GLPSDFW SHXYHQW DYRLU XQ
contenu limit aux documents viss aux deuxime septime alinas et
ODYDQW-GHUQLHUDOLQpDGHODUWLFOH de la mme loi organiqXHFHVW--dire :
jOpWXGHGRSWLRQV ;
jODGHVFULSWLRQGHOLPSDFWGHODUpIRUPHVXUORUGUHMXULGLTXHLQWHUQHHW
de son articulation avec le droit europen ;
jOpWDWGDSSOLFDWLRQGXGURLWVXU le territoire national dans les domaines
concerns ;
DX[ FRQGLWLRQV Gapplication des dispositions envisages dans les
collectivits GRXWUH-mer, en Nouvelle-Caldonie et dans les Terres australes et
antarctiques franaises, avec, le cas chant, la justification des adaptations
proposes et GH ODEVHQFH Gapplication des dispositions certaines de ces
collectivits ;
OH FDV pFKpDQW DX[ VXLWHV GRQQpHV SDU OH *RXYHUQHPHQW j Oavis du
Conseil conomique, social et environnemental.
6LO HVW YUDL TXH OHV SURMHWV GH ORL GKDELOLWDWLRQ GRQQHQW ELHQ OLHX j
OpODERUDWLRQ GpWXGHV GLPSDFW IRUFH HVW GH FRQVWDWHU TXH OHXU FRQWHQX HVW WUqV
DOOpJpFHTXLDSSDUDvWGDXWDQWSOXVGpOLFDWTXHOHVRUGRQQDQFHVelles-mmes sont
GLVSHQVpHV GH WRXWH pYDOXDWLRQ SUpDODEOH ORUVTXHOOHV QH FRQFHUQHQW QL OHV
entreprises ni les collectivits territoriales.
b. OHVRUGRQQDQFHVelles-mmes ne sont soumises aucune obligation
GpYDOXDWLRQ GH OHXU LPSDFW ORUVTXHOOHV QH FRQFHUQHQW QL OHV
entreprises ni les collectivits territoriales.
La mission a t particulirement sensible aux remarques de
M. Bernard Pcheur, SUpVLGHQWGHODVHFWLRQGHODGPLQLVWUDWLRQ GX&RQVHLOGeWDW
TXLDPLVHQH[HUJXHOH[LVWHQFHGXQ trou noir GDQVOHGLVSRVLWLIGpYDOXDWLRQ
ex ante GH OLPSDFW GHV QRUPHV HQ YLJXHXU GHSXLV  : sauf concerner les
entreprises et les collectivits territoriales et tre alors assorties de fiches
GLPSDFW OHV RUGRQQDQFHV VRQW DXMRXUGKXL GLVSHQVpHV GH WRXWH pWXGH GLPSDFW
&RPPH OD QRWp 0 Bernard Pcheur, FHVW Oj XQ DQJOH PRUW TXL PpULWHUDLW
GrWUHFRXYHUW (1).
'DQV OD PHVXUH R OpWXGH GLPSDFW MRLQWH DX SURMHW GH ORL GKDELOLWDWLRQ
QDSDV j FRPSRUWHUGH ELODQ FRWVDYDQWDJHV QL GpYDOXDWLRQ GHV LQFLGHQFHV VXU
OHPSORLSXEOLFQLGHOLVWHVGHVWH[WHVGDSSOLFDWLRQHWGDQVODPHVXUHRDXFXQH
(1) Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDWOHPDL9RLUOHFRPSWH-rendu
en annexe n 16.

82

pWXGHGLPSDFWQHVWREOLJDWRLUHSRXUOHSURMHWGHORLGHUDWLILFDWLRQjPRLQVTXLO
ne comporte des dispositions nouvelles, allant au-GHOjGHODUHFWLILFDWLRQGerreurs
PDWpULHOOHVGDQVOHWH[WHGHORUGRQQDQFHRXGajustements de cohrence juridique,
FHVW WRXW OH SURFHVVXV GpODERUDWLRQ GH QRPEUHXVHV QRUPHV UpVXOWDQW
GRUGRQQDQFHV TXL HVW DXMRXUGKXL H[RQpUp GH WRXWH REOLJDWLRQ GpYDOXDWLRQ
pralable.
Convaincue, comme M. 1LFRODV0ROIHVVLVTX LOQ\DSDVGHUDLVRQTXH
la procdure >GpWXGHGLPSDFW@ne soit pas VLPLODLUHTXHOOHTXHVRLWORULJLQHGH
la disposition lgislative (1)ODPLVVLRQSURSRVHGRQFGpWHQGUHDX[SURSRVLWLRQV
GH ORL HW DX[ RUGRQQDQFHV OREOLJDWLRQ GpWXGH GLPSDFW DXMRXUGKXL FLUFRQVFULWH
DX[SURMHWVGHORLHWjFHUWDLQVSURMHWVGDFWHVUpglementaires.
B. TENDRE AUX PROPOSITIONS DE LOI ET AUX ORDONNANCES
/2%/,*$7,21 'e9$/8$7,21 '( /,03$&7 $8-285'+8,
CANTONNE AUX PROJETS DE LOI ET CERTAINS PROJETS
'$&7(65e*/(0(17$,5ES.

Il est apparu, au gr des travaux de la mission, que le constat tait


ODUJHPHQWSDUWDJpVHORQOHTXHOODEVHQFHGpWXGHGLPSDFWVXUOHVSURSRVLWLRQVGH
loi constituait une lacune majeure. Aussi bien le secrtaire gnral du
Gouvernement, M. Serge Lasvignes, que le Premier prsident de la Cour des
comptes, M. Didier Migaud, et que le vice-SUpVLGHQW GX &RQVHLO GeWDW
M. Jean-Marc Sauv, en ont convenu.
La mission propose donc de rendre obligatoire pour les propositions
de loi la rDOLVDWLRQGXQHpWXGHGLPSDFW.
1. 5HQGUH REOLJDWRLUH OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW SRXU les
propositions de loi

Rappelant que OREOLJDWLRQGHSURGXLUHGHVpWXGHVGLPSDFWQHVLPSRVH


SDV HQ OpWDW DFWXHO GX GURLW FRQVWLWXWLRQQHO DX[ SURSRVLWLRQV GH ORL , et
TX OpYLGHQFH ODEVHQFH GpWXGH GLPSDFW VXU OHV SURSRVLWLRQV GH ORL HVW une
lacune , M. Jean-Marc Sauv a fait valoir auprs de la mission que ODYLV GX
&RQVHLO GeWDW ORUVTXLO HVW VDLVL GXQ WH[WH GH FHWWH QDWXUH HQ TXDOLWp GH
FRQVHLOOHU GX 3DUOHPHQW VHUDLW GDXWDQW SOXV pFODLUp TXLO GLVSRVHUDLW
GpYDOXDWLRQVSUpDODEOHs .
Il serait donc utile non seulement aux parlementaires, mais aussi au
&RQVHLO GeWDW OXL-PrPH ORUVTXLO HVt sollicit pour mettre un avis, que les
SURSRVLWLRQV GH ORL VRLHQW DVVRUWLHV GpWXGHV GLPSDFW GRQW RQ FRPSUHQG GHV
propos de M. Jean-Marc SauYpTXHOOHVDXUDLHQWYRFDWLRQjrWUHFRPSOpPHQWDLUHV
GHODYLVGHOD+DXWHMXULGLFWLRQ
(1) Audition de M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II Panthon-Assas, membre
du Club des juristes, le 10 avril 2014. Voir le compte-rendu en annexe n 16.

83

Le vice-SUpVLGHQWGX&RQVHLOGeWDWDSUpFLVpTXDXYXGHVHVUHVVRXUFHV
OH &RQVHLO GeWDW QpWDLW SDV HQ PHVXUH GH UpDOLVHU OXL-PrPH XQH pWXGH GLPSDFW
sur une proposition de loi tude dont, au demeurant, la ralisation incombe en
SULQFLSHjODXWHXUGXWH[WH
De son ct, tout en convenant de la ncessit de soumettre les
SURSRVLWLRQV GH ORL j GHV pWXGHV GLPSDFW SUpDODEOHV REOLJDWRLUHV OH 3UHPLHU
prsident de la Cour des comptes, M. Didier 0LJDXG D FRQYHQX GH FH TXDX
regard de ses moyens, LOVHUDLWSOXVGLIILFLOHDX3DUOHPHQWGHOHVSURGXLUHTXDX
Gouvernement (1).
,OHVWYUDLTXjPR\HQVhumains FRQVWDQWVODSURGXFWLRQGpWXGHVGLPSDFW
sur les propositions de loi serait impossible pour les assembles, FRPPH OD
rappel notre collgue David Assouline, prsident de la commission snatoriale
SRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLV (2).
$ILQ GH SDOOLHU OLQVXIILVDQFH GHV PR\HQV GX 3DUOHPHQW le secrtaire
gnral du Gouvernement, M.Serge Lasvignes, lui aussi favorable la cration
GXQHREOLJDWLRQGpYDOXDWLRQSUpDODEOHGHOLPSDFWGHVSURSRVLWLRQVGHORLOHVSOXV
complexes, a suggr TXH GDQV OH FDGUH GXQ FRQYHQWLRQQHPHQW DYHF OHV
DGPLQLVWUDWLRQVGHOH[pFXWLIOH3DUOHPHQWGLVSRVHGXQGURLWGDFFqVjOH[SHUWLVH
GH OH[pFXWLI DYHF GHV JDUDQWLHV VXIILVDQWHV QRWDPPHQW ORUVTXLO VDJLW GXQH
SURSRVLWLRQGHORLGHORSSRVLWLRQ (3).
&HVW DXVVL OD VXJJHVWLRQ GH 0 Jean-0DUF 6DXYp TXL D LQGLTXp TX une
fois rappel le principe de sparation des pouvoirs, donc des services du
3DUOHPHQWHWGX*RXYHUQHPHQWLOQHVWSDVLQWHUGLWGHQYLVDJHUXQHFRRSpUDWLRQ
TXL SHUPHWWUDLW DX 3DUOHPHQW GH VROOLFLWHU OHV PR\HQV GH[SHUWLVH GH
OH[pFXWLI (4).
La mission HVWLPH TXLO IDXW H[SORUHU OD SLVWH GXQH FRRSpUDWLRQ DX VHLQ
GXQ S{OH GH[SHUWLVH FRQVWLWXp GDQV OH FDGUH GXQ FRQYHQWLRQQHPHQW HQWUH
OH[pFXWLI HW OHV GHX[DVVHPEOpHV, FRPPH FHOOH GXQ LPSRUWDQW UHQIRrcement des
moyens du Parlement.
/pYDOXDWLRQ GH OLPSDFW GXQH SURSRVLWLRQ GH ORL ainsi ralise pourrait
rWUH VRXPLVH DYHF ODFFRUG GH VRQ DXWHXU HW j OD GHPDQGH GX SUpVLGHQW GH
ODVVHPEOpHFRQFHUQpHjOH[DPHQ de ODXWRULWpLQGpSHQGDQWHGHcontrexpertise.

(1) Audition de M. Didier Migaud, Premier prsident de la Cour des comptes, le 30 avril 2014. Voir le
compte-rendu en annexe n 16.
(2) $XGLWLRQGH0'DYLG$VVRXOLQHSUpVLGHQWGHODFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQ
de lois, le 5 juin 2014. Voir le compte-rendu en annexe n 16.
(3) Audition de M. Serge Lasvignes, secrtaire gnral du Gouvernement, et de M. Thierry-Xavier Girardot,
directeur, adjoint au secrtaire gnral du Gouvernement, le 19 fvrier 2014. Voir le compte-rendu en
annexe n 16.
(4) Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDWOHPDL9RLUOHFRPSWH-rendu
en annexe n 16.

84

Au-del des modalits pratiques de la ralisatioQGHVpWXGHVGLPSDFWTXL


pourront tre prcises, la mission approuve OHSULQFLSHPrPHGHODFUpDWLRQGXQH
REOLJDWLRQ GH SURGXLUH GHV pWXGHV GLPSDFW VXU des propositions de loi, compte
WHQX GH OD SDUW FURLVVDQWH GH OLQLWLDWLYH SDUOHPHQWDLUH GDQV OD SURduction
lgislative.
Votre rapporteur rappelle en effet que :
sous la XIe lgislature, 144 des 497 WH[WHV DGRSWpV SDU O$VVHPEOpH
nationale taient des propositions de loi (soit prs de 29 % des textes adopts) ;
sous la XIIe lgislature, ce pourcentage a baiss 12,7 % (60 des 471
WH[WHVDGRSWpVSDUO$VVHPEOpHQDWLRQDOHD\DQWpWpGHVSURSRVLWLRQVGHORL ;
sous la XIIIe lgislature, ce pourcentage a connu une hausse, puisque
17,7  VRLW   GHV  WH[WHV DGRSWpV SDU O$VVHPEOpH QDWLRQDOH pWDLHQW des
propositions de loi ;
sous la XIVe OpJLVODWXUH MXVTXDXPDL ce pourcentage a connu
une nouvelle hausse, puisque 21 % (soit 35) des 166 textes adopts par
O$VVHPEOpHQDWLRQDOHpWDLHQWGHVSURSRVLWLRQVGHORL (1).
Proposition n 3 6RXPHWWUHOHVSURSRVLWLRQVGHORLjXQHpWXGHGLPSDFW
Rendre obligatoire la ralisation GXQHpWXGHGLPSDFWVXUOHVSURSRVLWLRQVGH
ORL LQVFULWHV j ORUGUH GX MRXU cette tude pouvant, le cas chant, tre
complte par un avis du &RQVHLO GeWDW VDLVL j FHW HIIHW VHORQ OHV PRGDOLWpV
actuellement prvues par la Constitution.
Si une telle proposition ncessite sans doute une rvision constitutionnelle,
GDQVODPHVXUHRHOOHLPSOLTXHXQHPRGLILFDWLRQGHODUWLFOHGHOD&RQVWLWXWLRQ,
ce ne semble pas tre le cas de celle qui consiste rendre obligatoire la ralisation
GXQHpWXGHGLPSDFWVXUOHQVHPEOHGHVSURMHWVGRUGRQQDQFHV
2. 5HQGUH REOLJDWRLUH OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW SRXU OHV
ordonnances

Si la mission convient avec le SUpVLGHQWGHODVHFWLRQGHODGPLQLVWUDWLRQ


GX &RQVHLO GeWDW, M. BerQDUG 3rFKHXU TX LPSRVHU OpODERUDWLRQ GXQH pWXGH
GLPSDFW FRPSOqWH DX VWDGH GX SURMHW GH ORL GKDELOLWDWLRQ DXUDLW XQ HIIHW
bloquant et constituerait une contrainte pour le Gouvernement, alors mme
TXHOHUHFRXUVjFHWWHSURFpGXUHVXSSRVHTXLODEHVRLQGHPDUJHVGHPDQXYUH
et que ses partis ne sont pas encore arrts (2) , elle estime en revanche que le

(1) Voir les graphiques figurant en annexe n 10.


(2) Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDWOHPDL9RLUOHFRPSWH-rendu
en annexe n 16.

85

FRQWHQXREOLJDWRLUHGHOpWXGHGLPSDFWDVVRUWLVVDQWXQSURMHWGHORLGKDELOLWDWLRQ
SRXUUDLWrWUHPRLQVDOOpJpTXLOQHOHVWDXMRXUGKXL
Surtout, ODPLVVLRQFRQVLGqUHTXXQHpWXGHGLPSDFWH[KDXVWLYHGHYUDLW
rWUH LPSRVpH DX VWDGH GX SURMHW GRUGRQQDQFH TXLO FRQFHUQH RX QRQ OHV
entreprises et les collectivits territoriales.
 FHW HIIHW VLO QDSSDUDvW SDV QpFHVVDLUH GH PRGLILHU ODUWLFOH  GH OD
Constitution, la mission prconise en revanche de complter la loi organique du 15
DYULOUHODWLYHjODSSOLFDWLRQGHVDUWLFOHV-1, 39 et 44 de la Constitution, et
notamPHQW VRQ DUWLFOH  GH IDoRQ j VXERUGRQQHU OD GLVSHQVH GpWXGH GLPSDFW
dont bnficient, dans le silence actuel du texte, les projets de loi de ratification
des ordonnances, la condition que des tudes GLPSDFW FRPSOqWHs aient t
produites ORUVGHOH[DPHQSDUOH&RQVHLOGtat des projets GRUGRQQDQFHs (1).
Proposition n 4 6RXPHWWUHOHVRUGRQQDQFHVjXQHpWXGHGLPSDFW
([LJHUTXHOHVSURMHWVGHORLGKDELOLWDWLRQVRLHQWDVVRUWLVGXQHpWXGHGLPSDFW
SOXVFRPSOqWH HWQRQDOOpJpHFRPPHFHVWOHFDVDXMRXUGKXL ;
5HQGUHREOLJDWRLUHODUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXUOHVRUGRQQDQFHV
Subordonner en consquencHODGLVSHQVHGpWXGHGLPSDFWSRXUOHVSURMHWVGHORL
GH UDWLILFDWLRQ GHV RUGRQQDQFHV j OD FRQGLWLRQ TXXQH pWXGH GLPSDFW DLW pWp
SURGXLWHjORFFDVLRQGHOH[DPHQSDUOH&RQVHLOGeWDWGXSURMHWGRUGRQQDQFH
En cohrence avec cette proposition qui appelle confrer un caractre
JpQpUDOHWREOLJDWRLUHjOpYDOXDWLRQex ante GHOLPSDFWGHVSURMHWVGRUGRQQDQFHV
YRWUH UDSSRUWHXU VDOXH OLQLWLDWLYH SULVH SDU OH *RXYHUQHPHQW GpGLFWHU GHV
RUGRQQDQFHVTXLGXQHFHUWDLQHIDoRQRUJDQLVHQWXQHpWXGHGLPSDFt grandeur
nature WRXWHQpWDQWOLPLWpHGDQVOHWHPSVHWGDQVOHVSDFHHQPHWWDQWHQSODFH
des exprimentations dont elles ont par ailleurs consolid les effets juridiques.
C. $0e/,25(5 /e9$/8$7,ON
EX
ANTE
'( /,03$&7
DVELOPPANT LE RECOU56/(;3eRIMENTATION.

(1

LDUWLFOH -1 de la Constitution dispose que la loi et le rglement


peuvent comporter, pour un objet et une dure limits, des dispositions
caractre exprimental .
/HUHFRXUVjOH[SpULPHQWDWLRQSHUPHWGpYDOXHUODTXDOLWpRSpUDWLRQQHOle
GXQH OpJLVODWLRQ GDQV XQ FDGUH VSDWLDO HW WHPSRUHO FLUFRQVFULW DYDQW GHQ
HQYLVDJHUODSpUHQQLVDWLRQHWOH[WHQVLRQjOHQVHPEOHGXWHUULWRLUH. Par exemple, la
loi n 2011-939 du 10 aot 2011 sur la participation des citoyens au
(1) En ce sens aussi : Mme Maryvonne de Saint Pulgent, prsidente de la section du rapport et des tudes du
&RQVHLOGeWDW9RLUOHFRPSWH-rendu en annexe n GHODXGLWLRQGH0 Jean-Marc Sauv, vice-prsident
GX&RQVHLOGeWDWOHPDL

86

fonctionnement de la justice pnale et le jugement des mineurs, qui a institu des


citoyens assesseurs au sein du tribunal correctionnel et de la chambre des appels
correctionnels, prvoyait que deux citoyens, dont les noms taient tirs au sort sur
les listes lectorales, devaient dsormais siger aux cts de trois magistrats au
VHLQGHFHVMXULGLFWLRQVORUVTXLOVDJLVVDLWGHMXJHUGHVSHUVRQQHVDFFXVpHVGDQV
GHV DIIDLUHV GH YROV DYHF YLROHQFH GDJUHVVLRQV VH[XHOOHV GH GHVWUXFWLRQ HW GH
dgradation de biens dangereuses pour les personnes. Cette exprimentation,
ODQFpHGDQVOHVUHVVRUWVGHVFRXUVGDSSHOGH7RXORXVHHW'LMRQDIDLWOREMHWGXQH
valuation, remise la garde des Sceaux le 28 fvrier 2013, qui a conclu la faible
efficacit du dispositif, jug lourd et coteux. Celui-ci a donc t abandonn au
printemps 2013.
Lors de son audition, M. Nicolas Conso, chef du service innovation et
services aux usagers au secrtariat gnral pour la modHUQLVDWLRQ GH ODFWLRQ
publique, a expliqu que, de son point de vue, il conviendrait, sur des sujets
compliqus, dont il est difficile de mesurer ex ante toutes les consquences, de
GpYHORSSHU GDQV XQ FDGUH GpURJDWRLUH OD FDSDFLWp GH[SpULPHQWDWLRQ GXQH
nouvelle mesure en boucle courte, avec une valuation au bout de six mois ou un
an . En effet, selon lui, OHV pWXGHV GLPSDFW ex ante portant sur de grandes
UpIRUPHV DWWHLJQHQW WUqV YLWH OHXUV OLPLWHV VL HOOHV QRQW SDV VXEL OpSUHXYH GX
terrain . 2U OH[HUFLFH GXQ GURLW j OHUUHXU qui autoriserait le test Gune
rforme avant son adoption dfinLWLYH HW VD JpQpUDOLVDWLRQ SHUPHWWUDLW GDSUqV
M. Nicolas Conso, GH[SpULPHQWHUGHVPHVXUHVSOXVDXGDFLHXVHVHWGHOpJLIpUHU
HQ WRXWH FRQQDLVVDQFH GH FDXVH OH OpJLVODWHXU SRXYDQW VDSSX\HU VXU OHV
enseignements du terrain .
Votre rapporteur est lui aussi convaincu des vertus que
OH[SpULPHQWDWLRQ SHXW DYRLU SRXU ILDELOLVHU OpYDOXDWLRQ ex ante GH OLPSDFW
des normes en en testant les effets concrets.
cet gard, il DSSURXYH OH *RXYHUQHPHQW GDYRLU FRQoX GHV
expriPHQWDWLRQVTXLJDUDQWLVVHQWDX[SHUVRQQHVFRQFHUQpHVORSSRVDELOLWpGH
OHXUV HIIHWV DX[ WLHUV HW j ODGPLQLVWUDWLRQ j OLQVWDU GH FH TXH SUpYRLW
ORUGRQQDQFH  Q 2014-3 GX  PDUV  UHODWLYH j OH[SpULPHQWDWLRQ GXQ
certificat de projet, prise sur le fondement de la loi n 2014-1 du 2 janvier 2014
habilitant le Gouvernement simplifier et scuriser la vie des entreprises.
/DUWLFOHGHFHWWHORLDHQHIIHW innov en habilitant le Gouvernement
dfinir un cadre juridique spcifique pour exprimenter localement, pour les
SURMHWVGDFWLYLWppFRQRPLTXHODGpOLYUDQFHDX[SRUWHXUVGHSURMHWGXQGRFXPHQW
dnomm certificat de projet qui comporte :
un engaJHPHQW GH OeWDW VXU OD SURFpGXUH GLQVWUXFWLRQ GH OD GHPDQGH
GDXWRULVDWLRQV UpJLHV SDU OHV GLVSRVLWLRQV GX FRGH GH OHQYLURQQHPHQW GX FRGH
IRUHVWLHU HW GX FRGH GH OXUEDQLVPH DYHF QRWDPPHQW OLQGLFDWLRQ GHV UpJLPHV
dcisions et procdures auxquels le projet envisag est soumis, la mention des
autres rgimes et procdures dont le projet est susceptible de relever, la

87

GHVFULSWLRQ GHV SULQFLSDOHV pWDSHV GH OLQVWUXFWLRQ DLQVL TXH GHV FRQGLtions de
recevabilit et de rgularit du dossier) ;
un engagemenW GH OeWDW VXU OH GpODL GLQVWUXFWLRQ GHV DXWRULVDWLRQV
sollicites ;
une garantie du maintien en vigueur, pendant une dure dtermine (de
dix-huit mois), des dispositions lgislatives et rglementaires dterminant les
conditions de dlivrance des autorisations sollicites (ou gel des normes ) ;
XQH JDUDQWLH GRSSRVDELOLWp j ODGPLQLVWUDWLRQ HW DX[ WLHUV GHV GURLWV
acquis par le ptitionnaire sur le fondement du certificat de projet.
&HW\SHGH[SpULPHQWDWLRQVGRLWrWUHencourag, dans la mesure o il
DVVRFLH ORSWLPLVDWLRQ GH OD VpFXULWp MXULGLTXH SRXU OHV SHUVRQQHV TXL
H[SpULPHQWHQW OD QRUPH j ODIILQHPHQW GH OpYDOXDWLRQ GH OLPSDFW GH OD
QRUPH H[SpULPHQWpH &HVW OD UDLVRQ SRXU ODTXHOOH OD PLVVLRQ DSSHOOH j VRQ
dveloppement.
Proposition n 5 'pYHORSSHU OH UHFRXUV j OH[SpULPHQWDWLRQ avant la
gnralisation de certains dispositifs lgislatifs le cas chant en consolidant les
effets juridiques de ces exprimentations.

88

DEUXIME PARTIE : MIEUX LABORER LA NORME AU COURS DE


LA PROCDURE LGISLATIVE
/DPpOLRUDWLRQGHODTXDOLWpGHODORLSDUORSWLPLVDWLRQGHOpYDOXDWLRQGH
VRQ LPSDFW QH VDUUrWH SDV DX[ SRUWHV GX 3DUOHPHQW : ODQDO\VH GH OLPSDFW GHV
QRUPHV GRLW DFFRPSDJQHU WRXW OHXU SURFHVVXV GDGRSWLRQ FH TXL DSSHOOH GHV
amnagements la procdure lgislative actuelle.
I. 'e9(/233(5 /e9$/8$7,21 '( /,03$&7 $8 &OURS
PROCDURE LGISLATIVE

DE

LA

(Q PHQDQW VHV WUDYDX[ OD PLVVLRQ D DFTXLV OD FRQYLFWLRQ TXH OpWXGH
GLPSDFW GHYDLW rWUH DX FXU GHV GpEDWV SDUOHPHQWDLUHV /RUJDQLVDWLRQ
systmDWLTXHHQFRPPLVVLRQGXQpFKDQJHQRXUULHWpWD\pVXUODTXDOLWpGHOpWXGH
GLPSDFWJDJQHUDLWjFHTXHOHVSDUOHPHQWDLUHVGLVSRVHQWSRXUFHIDLUHGHODSDUWLH
GH ODYLV GX &RQVHLO GeWDW SRUWDQW VXU OHV pWXGHV GLPSDFW TXL VRQW DXMRXUGKXL
jointes aux projets de loi, ainsi que sur celles qui, conformment aux
prconisations de la mission, seraient jointes aux propositions de loi dans
OK\SRWKqVHROHVVHFWLRQVDGPLQLVWUDWLYHVGHOD+DXWHMXULGLFWLRQVHUDLHQWVDLVLHV
de ces dernires.
Les parlementaireVQHGHYDQWSDVVHGLVSHQVHUGpYDOXHUOLPSDFWGH leurs
SURSUHVLQLWLDWLYHVOREOLJDWLRQGXQHpYDOXDWLRQSUpDODEOHGHYUDrWUHpWHQGXHDX[
amendements substantiels  TXL DIIHFWHQW OpTXLOLEUH GXQ SURMHW RX GXQH
proposition de loi.
A. EN AMONT DES DBATS PARLEMENTAIRES, RENDRE PUBLIQUE LA
PARTIE DE /$9,6 '8 &216(,/ 'TAT SUR /(6 e78'(6 ',03$&7
ASSORTISSANT LES TEXTES DE LOI.

'XSRLQWGHYXHODPLVVLRQOHVpWXGHVGLPSDFWIHURQWOREMHWGXQGpEDW
GDXWDQWSOXVULFKHHWIUXFWXHX[TXHOH3DUOHPHQWGLVSRVHUDGHODSDUWLHGHODYLVGX
&RQVHLOGeWDWVXUOHVSURMHWVGHORLTXLOHXUHVWFRQVDFUpH
2UHQDSSOLFDWLRQGHODUWLFOH I, 1 de la loi n 78-753 du 17 juillet 1978
portant diverses mesures damOLRUDWLRQ GHV UHODWLRQV HQWUH Oadministration et le
puEOLF HW GLYHUVHV GLVSRVLWLRQV Gordre administratif, social et fiscal, les avis du
&RQVHLO GeWDW ne sont pas communicables . Par ailleurs, des dispositions
lgislatives et rglementaires du code de justice administrative suggrent
implicitement que ODYLVGX&RQVHLOGeWDWVXUOHVSURMHWV HWSURSRVLWLRQV GHORL
est confidentiel (1).
(1) /DUWLFOH/ 112-6 du code de justice administrative dispose que les avis du &RQVHLOGeWDWVXUOHVSURMHWVHW
propositions de lois du pays de la Nouvelle-Caldonie sont transmis au prsident du gouvernement, au
prsident du congrs, au haut-commissaire et au Conseil constitutionnel  (W ODUWLFOH 5 123-4 du mme
code prcise que OHVDYLVGX&RQVHLOGeWDWVXUOHVSURMHWVHWSURSRVLWLRQVGHORLVGXSD\VVRQWDGUHVVpVDX[
DXWRULWpV PHQWLRQQpHV DX GHUQLHU DOLQpD GH ODUWLFOH  GH OD ORL RUJDQLTXH [ n 99-209 du 19 mars 1999

89

Sensible la fois aux arguments des nombreuses personnes entendues qui


RQW VXJJpUp GH UHQGUH SXEOLTXH OLQWpJUDOLWp GH ODYLV GX &RQVHLO GeWDW VXU OHV
SURMHWV HW SURSRVLWLRQV GH ORL HW DX[ UpVHUYHV TXRQW pPLVHV plusieurs autres
personnes face aux consqXHQFHVTXXQHWHOOHPHVXUHSRXUUDLWDYRLUVXUODWHQHXU
GH FHW DYLV DLQVL TXH VXU OHV UHODWLRQV HQWUH OH *RXYHUQHPHQW HW OLQVWLWXWLRQ
charge de le conseiller, la mission a choisi de privilgier une voie intermdiaire
en prconisant de ne rendre publique TXH OD SDUWLH GH ODYLV GX &RQVHLO GeWDW
UHODWLYHjODTXDOLWpGHOpWXGHGLPSDFWTXLOXLHVWVRXPLVH
1. 8QHFRQILGHQWLDOLWpSUHVTXXQDQLPHPHQWFULWLTXpH

/HVFULWLTXHVUHODWLYHVjODFRQILGHQWLDOLWpGHVDYLVGX&RQVHLOGeWDWVXUOHV
projets et propositions de loi sont anciennes.
'DQVOHUDSSRUWTXLODUHPLVDX3UpVLGHQWGHOD5pSXEOLTXHOHRFWREUH
2007, le comit de rflexion et de proposition sur la modernisation et le
rquilibrage des institutions de la Ve Rpublique avait prconis de rendre
SXEOLFV OHV DYLV GX &RQVHLO GeWDW VXU OHV SURMHWV GH ORL SURSRVLWLRQ Q 27),
estimant TXLOVHUDLWXWLOHjODTXDOLWpGXWUDYDLOOpJLVODWLITXHOHVDYLVpPis par le
&RQVHLOG(WDWVXUOHVSURMHWVGHORLGRQWLOHVWVDLVLHQDSSOLFDWLRQGHODUWLFOH
de la Constitution soient rendus publics et que soit ainsi mis un terme aux
UXPHXUVTXLHQWRXUHQWFHVDYLVGRQWODSXEOLFDWLRQQHVWDXWRULVpHDXFDVSDU cas,
par le GouvernemeQWTXjODILQGHFKDTXHDQQpH (1).
Bon nombre des personnes entendues par la mission ont fait valoir que la
FRQILGHQWLDOLWpTXLHQWRXUHDXMRXUGKXLOHVDYLVGX &RQVHLOGeWDWVXUOHVSURMHWVde
loi nuisait la qualit du dbat parlementaire. Le prsident du conseil national
GpYDOXDWLRn des normes, M. Alain Lambert a dclar inadmissible que les avis
GX &RQVHLO GeWDW QH Voient pas transmis au Parlement . De son point de vue,
uQHGpPRFUDWLHQHSHXWVHVDWLVIDLUHGXQGpVpTXLOLEUHGHFHWWHQDWXUHGDXWDQW
TXHOHFRQVHLOGHOH[pFutif est aussi une juridiction , car tout se passe comme si
OH 3DUOHPHQW GHYDLW OpJLIpUHU HQ IRQFWLRQ GXQ DYLV DXTXHO LO QD SDV DFFqV ,
WDQGLV TXHQ PDWLqUH UpJOHPHQWDLUH FHVW OD PrPH LQVWLWution qui conseille
OH[pFXWLIHWTXLGDQVVDIRUPDWLRQMXULGLFWLRQQHOOHVHSURQRQFHVXUODFRQIRUPLWp
des dispositions la Constitution . /DFRQILGHQWLDOLWpGHVDYLVGX&RQVHLOGeWDW
serait, selon M. Alain Lambert, la marque GXQHGpPRFUDWLHDSSUR[imative .
Partageant le souci de rendre le processus de la dcision publique le plus
transparent possible, la mission a cependant t alerte sur les effets indirects et
relative la Nouvelle-Caldonie] DLQVL TXDX 3UHPLHU PLQLVWUH DX PLQLVWUH FKDUJp GH ORXWUH-mer et aux
autres ministres intresss .
6DJLVVDQW GHV SURMHWV HW SURSRVLWLRQV GH ORL HQ JpQpUDO ODUWLFOH 5 123-11 du code de justice
administrative ajoute que le secrtaire de chaque section ou commission certifie les expditions des avis
mis par cette formation et les notifie aux administrations intresses et que les avis mis sur des
SURSRVLWLRQVGHORLVRQWQRWLILpVDXSUpVLGHQWGHODVVHPEOpHTXLDVDLVLOH&RQVHLOGeWDW .
(1) Une Ve Rpublique plus dmocratique, Rapport du comit de rflexion et de proposition sur la
modernisation et le rquilibrage des institutions de la Ve Rpublique, p. 40.

90

SRWHQWLHOOHPHQWQRFLIVTXHSRXUUDLWHQJHQGUHUODSXEOLFLWpGHOLQWpJUDOLWpGHVDYLV
GX&RQVHLOGeWDW
Le Premier prsident de la Cour des comptes, M. Didier Migaud, a fait
UHPDUTXHUTXXQHSXEOLFLWpV\VWpPDWLTXHGHVDYLVGX&RQVHLOGeWDWVXUOHVSURMHWV
de loi pourrait avoir des effets pervers et notamment conduire le Conseil
UHWHQLUGHVDUJXPHQWVRXjV\SUHQGUHGLIIpUHPPHQW GHVRUWHTXLOQHVHUDLWSDV
certain que la production normative y gagne en efficacit et en transparence .
Notre collgue Jean-Luc Warsmann a soulign pour sa part que, sLORQ
veut que le Conseil deWDWMRXHVRQU{OHGHFRQVHLOOHUDXSUqVGX*RXYHUQHPHQWLO
faut que le Gouvernement se sente libre quand il sollicite son avis et que ce ne
VHUDLWSDVOHFDVVLRQOREOLgeait rendre cet avis public .
Enfin, OH VHFUpWDLUH GeWDW DXSUqV GX 3UHPLHU ministre, charg des
Relations avec le Parlement, M. Jean-Marie Le Guen, a estim que la publicit de
ses avis aurait pour consquence GHIDLUHpYROXHUOHU{OHGX&RQVHLOGeWDWGDQV
XQ VHQV TXL ODSSDUHQWHUDLW j FHOXL GX &RQVHLO FRQVWLWXWLRQQHO DORUV que sa
fonction reste de conseiller le Gouvernement et que le rle de cette institution
QHVW SDV GH FHQVXUHU le Gouvernement et de fournir des armes certains
parlementaires .
La mission note cependant TXH GDSUqV OHV UpSRQVHV Tui lui ont t
fournies par neuf des dix 3DUOHPHQWV HXURSpHQV TXHOOH D LQWHUURJpV SDU
OLQWHUPpGLDLUH GX &HQWre europen de recherche et de documentation
parlementaires (CERDP), FLQT GHV GL[ SD\V FRQFHUQpV VRQW GRWpV GXQ &RQVHLO
GeWDW RX GXQH LQVWLWXWLRQ pTXLYDOHQWH HW TXe, parmi ces cinq pays, trois ont
RUJDQLVp OD SXEOLFLWp GHV DYLV GH FH &RQVHLO GeWDW RX GH FHWWH LQVWLWXWLRQ VXU OHV
SURMHWVRXSURSRVLWLRQVGHORL(Q%HOJLTXHHWHQ6XqGHODYLVGX&RQVHLOGeWDW
RX GH OLQVWLWXWLRQ pTXLYDOHQWH &RQVHLO VXpGRLV GH OpJLslation) est rendu
intgralement et immdiatement public. Aux Pays-%DV ODYLV GX &RQVHLO GeWDW
QHVWrendu public TXDSUqVTXHOH*RXYHUQHPHQWRXODXWHXUGHODSURSRVLWLRQGH
loi ont t mis en mesure GHUpSRQGUHjXQSURMHWGDYLV,OQ\DTXHQ(VSDJne et
HQ 1RUYqJH TXH ODYLV GHV LQVWLWXWLRQV pTXLYDOHQWHV DX &RQVHLO GeWDW UHVWH
confidentiel.
Au regard des pratiques adoptes par nos voisins, la mission estime
TXLO QHVW SDV LQFRQFHYDEOH TXH OHV DYLV GX &RQVHLO GeWDW EpQpILFLHQW GXQ
certain degr dHSXEOLFLWpTXLjGpIDXWGrWUHWRWDOHSRXUUDLWjWRXWOHPRLQV
tre partielle.
2. Une ncessaire publicit

8Q FHUWDLQ FRQVHQVXV VHVW GpJDJp SDUPL SOXVLHXUV GHV SHUVRQQHV


HQWHQGXHVSDUODPLVVLRQDXWRXUGHOLGpHGorganiser une publicit partielle des
DYLVGX&RQVHLOGtat, qui pourrait tre limite la seule partie de ces avis
SRUWDQW VXU OD TXDOLWp GHV pWXGHV GLPSDFW MRLQWHV DX[ SURMHWV GH ORL HW

91

FRQIRUPpPHQWDX[YX[GHODPLVVLRQDX[SURSRVLWLRQVGHORL et aux projets


GRUGRQQDQFH).
Tout en rappelant que la publication des avis du Conseil sur les projets
GH ORL GRUGRQQDQFH RX GH GpFUHW HVW XQH TXHVWLRQ pPLQHPPHQW SROLWLTXH et
TX HOOH UHOqYH GH ODSSUpFLDWLRQ GX *RXYHUQHPHQW HW GX 3DUOHPHQW , le
vice-prsident du ConseiO GeWDW 0 Jean-Marc Sauv, a, comme le secrtaire
gnral du Gouvernement, M. Serge Lasvignes, et le Premier prsident de la Cour
des comptes, M. Didier Migaud, VRXOLJQpOLQWpUrWGune publication partielle des
DYLV GX &RQVHLO GeWDW FDQWRQQpH j ODSSUpFLDWLRQ TXH FH dernier porte sur les
pWXGHVGLPSDFWMRLQWHVDX[SURMHWVGHORL
Interrog sur ce point, OH VHFUpWDLUH GeWDW DXSUqV GX 3UHPLHU PLQLVWUH
charg des Relations avec le Parlement, M. Jean-Marie Le Guen, a une nouvelle
fois fait part de ses rticences, estimant que si une assemble soulevait tous les
SUREOqPHVOLpVDX[pWXGHVGLPSDFWDXFXQHORLQHYHUUDLWSOXVOHMRXU (1).
&HW DUJXPHQW QD SDV FRQYDLQFX OD PLVVLRQ TXL MXJH DX FRQWUDLUH utile,
GXQHSDUWGpWDEOLUXQHGLVWLQFWLRQQHWWHHQWUHODSDUWLHGHODYLVGX&RQVHLOGeWDW
portant sur le dispositif GXQ SURMHW GH ORL, et la partie de cet avis portant sur
OpWXGH GLPSDFW TXL OXL HVW MRLQWH HW GDXWUH SDUW GRUJDQLVHU OD SXEOLFDWLRQ GH
FHWWHVHFRQGHSDUWLHGHODYLV
Une telle publicit impliquera sans doute une modification de la loi du
17 juillet 1978 prcite ainsi que de dispositions lgislatives et rglementaires du
code de justice administrative.
Cette solution intermdiaire entre la confidentialit actuelle, qui ne
satisfait que le Gouvernement, et la publicit intgrale, qui pourrait nuire la
TXDOLWpGHODYLVparat tre un compromis satisfaisant de nature clairer le dbat
SDUOHPHQWDLUH VXU OD FRPSOpWXGH HW OH FDUDFWqUH VXIILVDQW GHV pWXGHV GLPSDFW
soumises aux assembles.
Proposition n 6 5HQGUHSXEOLTXHODSDUWLHGHODYLVGX&RQVHLOGeWDWUHODWLYH
DX[pWXGHVGLPSDFW assortissant les projets (et, le cas chant, les propositions) de
ORLDLQVLTXHOHVSURMHWVGRUGRQQDQFHHWODMRLQGUHjFHVpWXGHV
B. LORS DES DBATS PARLEMENTAIRES, RENFORCER LE CONTRLE
DU PARLEMENT SUR LA QUALIT DES TUDES D,03$&7

/DSXEOLFDWLRQGHODSDUWLHGHODYLVGX&RQVHLOGeWDWWUDLWDQWGHODTXDOLWp
GHVpWXGHVGLPSDFWMRLQWHVDX[SURMHWV HW, le cas chant, aux propositions) de loi
contribuera nourrir le dbat parlementaire que la mission recommande de
recentrer sur ces tudes, DYDQWOH[DPHQGHVDUWLFOHVHWGHVDPHQGHPHQWV.

(1) Audition de M. Jean-Marie Le Guen, sHFUpWDLUHGeWDWDX[5HODWLRQVDYHFOH3DUOHPHQWDXSUqVGX3Uemier


ministre, le 9 juillet 2014. Voir le compte rendu en annexe n 16.

92

/D PLVVLRQ D H[SORUp SOXVLHXUV SLVWHV SRXU DPpOLRUHU ODVVRFLDWLRQ Ges


SDUOHPHQWDLUHV DX SURFHVVXV GpYDOXDWLRQ ex ante des consquences des textes
TXLOVVRQWDSSHOpVjYRWHU
7RXW GDERUG DLQVL TXH OD VXJJpUp ORUV GH VRQ DXGLWLRQ QRWUH FROOqJXH
David Assouline, prsident de la commission snatoriale pour le contrle de
ODSSOLFDWLRQ GHV ORLV RQ SRXUUDLW LPDJLQHU TXH GHV GRFXPHQWV GpYDOXDWLRQ
D\DQW VHUYL j OH[pFXWLI SRXU HQJDJHU OD UpGDFWLRQ GX WH[WH VRLHQW WUDQVPLV [aux
parlementaires] le plus tt possible, avant le dpt du projet de loi . Cette
proposition, qui VXSSRVHUDLW TXH OH GpS{W GXQ SURMHW GH ORL VXU OH EXUHDX GXQH
DVVHPEOpH SDUOHPHQWDLUH VRLW GLVVRFLp GH FHOXL GH VRQ pWXGH GLPSDFW HW TXL
QpFHVVLWHUDLWGRQFYUDLVHPEODEOHPHQWXQHPRGLILFDWLRQGHODUpGDFWLRQGHODUWLFOH
39 de la Constitution, aurait lDYDQWDJH GH PHWWUH OpYDOXDWLRQ ex ante de la
UpIRUPHHQYLVDJpHDXFXUGHVGpEDWVPDLVDXVVLOLQFRQYpQLHQWVRLWGHQJDJHUOD
GLVFXVVLRQ VXU OD EDVH GXQ GRFXPHQW GpYDOXDWLRQ TXL QH FRUUHVSRQGUD SDV
ncessairement la version finale du projet de loi, VRLW GLQWHUGLUH DX
*RXYHUQHPHQW GH IDLUH pYROXHU OD UpGDFWLRQ GH VRQSURMHW GH ORL XQH IRLV OpWXGH
GLPSDFWGpSRVpHFHVW--GLUHSRWHQWLHOOHPHQWELHQHQDPRQWGHOH[DPHQGXWH[WH
en Conseil des ministres.
&HVWODUDLVRQSRXUODTXHOOHODPLVVLRQVHVWensuite intresse une autre
SLVWHFHOOHFRQVLVWDQWjVXEVWLWXHUjODGLVFXVVLRQJpQpUDOHXQGpEDWGRULHQWDWLRQ
SUpDODEOH j OH[DPHQ GX WH[WH HQ FRPPLVVLRQ &H GpEDW GRULHQWDWLRQ TXL
VDSSXLHUDLWVXUOpWXGHGLPSDFWDXUDLWOLHXHQVpDQFHSXEOLTXHDYDQWOH[DPHQGX
WH[WHHQFRPPLVVLRQHWSHUPHWWUDLWDX[GLYHUJHQFHVSROLWLTXHVGHVH[SULPHUVXU
O esprit et les principaux enjeux de la rforme envisage, de faon rserver la
suite de la discussion un examen plus dtaill et plus technique du projet ou de la
proposition de loi.
Votre rapporteur note que, GDSUqV OHV UpSRQVHV TXL OXL RQW pWp IRXUQLHV
par neuf des dix Parlements europens que la mission a interrogs par
OLQWHUPpGLDLUH GX &HQWUH HXURSpHQ GH UHFKHUFKH HW GH GRFXPHQWDWLRQ
parlementaires (CERDP), cette organisation de la discussion des textes lgislatifs
en deux phases, la premire plus politique et la seconde plus technique
(pour reprendre la formule utilise par M. Alain Lambert lors de son audition), est
courante chez nos voisins.
$LQVL HQ $OOHPDJQH OH %XQGHVWDJ SURFqGH j XQ GpEDW GRULHQWDWLRQ HQ
VpDQFH SXEOLTXH DYDQW OH[DPHQ GHV WH[WHV HQ FRPPLVVLRQ $X 'DQHPDUN OH
Folketing commence la discussion du texte en sance publique par un dbat
GRULHQWDWLRQ SUpDODEOH DYDQW Gexaminer, au moins deux jours aprs, les
amendements gouvernementaux et parlementaires.
(Q (VSDJQH OH &RQJUqV GHV GpSXWpV HQJDJH OH[DPHQ GHV WH[WHV SDU XQ
GpEDW GRULHQWDWLRQ HQ VpDQFH SXEOLTXH DX FRXUV GXTXHO VRQW GLVFXWpV OH FDV
pFKpDQW GpYHQWXHOV DPHQGHPHQWV GRUGUH JpQpUDO TXL FRQWHVWHQW OHVSULW RX
ORSSRUWXQLWp GX WH[WH HW TXL QH SHXYHQW rWUH GpSRVpV TXH SDU GHV JURXSHV

93

SROLWLTXHV &H QHVW TXDSUqV FH GpEDW GRULHQWDWLRQ SUpDODEOH TXD OLHX OH[DPHQ
des textes en commission, au cours duquel une instance collgiale appele
ponencia et compose de reprsentants de tous les groupes politiques, dsigns
la proportionnelle, est charge, dans un dlai de 15 jours, de rdiger un rapport et
de proposer des amendements. cet examen en commission succde un second
examen en sance publique pour lequel seuls sont recevables les amendements
GRUGUH WHFKQLTXH RX de compromis , qui ont t pralablement dposs et
rejets en commission, tant prcis que le Gouvernement HVSDJQRO QD pas le
droit de dposer des amendements sur le texte issu des travaux de la commission
(ou dictamen ).
Enfin, au Royaume-8QLDSUqVOpFRXOHPHQWGXQFHUWDLQGpODL DXPRLQV
GHX[VHPDLQHVjOD&KDPEUHGHV/RUGV VXLYDQWODQQRQFHHQVpDQFHSXEOLTXHGH
la discussion SURFKDLQH GXQ WH[WH FHOOH-ci commence par un dbat, toujours en
sance publique, sur le principe et les grandes orientations de la rforme, qui
SUpFqGH OH[DPHQ GX projet ou de la proposition de loi en commission, auquel
succde un second examen en sanFH SXEOLTXH GDERUG GX UDSSRUW HW GX WH[WH
DGRSWp SDU OD FRPPLVVLRQ SXLV GHV VHXOV DUWLFOHV IDLVDQW OREMHW GDPHQGHPHQWV
JRXYHUQHPHQWDX[ RX SDUOHPHQWDLUHV TXL QRQW SDV GpMj pWp H[DPLQpV HQ
commission.
$X UHJDUG GHV SUDWLTXHV DGRSWpHV GDQV GDXWUHV 3DUOements europens, il
Q\ DXUDLW GRQF ULHQ GH[WUDYDJDQW j PRGLILHU QRWUH SURFpGXUH OpJLVODWLYH SRXU \
LQWURGXLUHXQGpEDWGRULHQWDWLRQTXLVXVFHSWLEOHGHVHQRXUULUGHOpWXGHGLPSDFW
HW GDERUGHU VHV TXDOLWpV HW VHV GpIDXWV VHUDLW SUpDODEOH j OH[DPHQ du texte en
commission et aurait vocation se substituer une discussion gnrale qui
VDSSDUHQWH DXMRXUGKXL GDYDQWDJH j XQH VXFFHVVLRQ GH PRQRORJXHV TXj XQ
vritable dbat de fond.
9RWUHUDSSRUWHXUUDSSHOOHTXjODVXLWHGHODUpYLVLRQFRQVWLWXWLRQQHlle du
 MXLOOHW  OH 6pQDW DYDLW SULV OLQLWLDWLYH GH PRGLILHU VRQ 5qJOHPHQW SRXU
SHUPHWWUHjVD&RQIpUHQFHGHVSUpVLGHQWVGHGpFLGHUGHORUJDQLVDWLRQGXQGpEDW
GRULHQWDWLRQHQVpDQFHSXEOLTXHVXUXQSURMHWRXXQHSURSRVLWLRQGHORL (1).
Cependant, le Conseil constitutionnel a jug cette initiative contraire la
Constitution, estimant TXHQYHUWXGHODUWLFOHGHOD&RQVWLWXWLRQOHVSURMHWV
HW SURSRVLWLRQV GH ORL VRQW HQYR\pV SRXU H[DPHQ j OXQH GHV FRPPLVVLRQV
permanentes ou, dfaut, une commission spcialement dsigne cet effet,
TXDX[WHUPHVGXSUHPLHUDOLQpDGHODUWLFOHODGLVFXVVLRQGHVSURMHWVHWGHV
propositions de loi porte, en sance, sur le texte adopt par la commission saisie
HQ DSSOLFDWLRQ GH ODUWLFOH  RX j GpIDXW VXU OH WH[WH GRQW ODVVHPEOpH D pWp
VDLVLH [et] que ces dispositions excluent que soit organis sur le projet de texte

(1) Article 15 de la Rsolution du 2 juin 2009 tendant modifier le Rglement GX6pQDWSRXUPHWWUHHQXYUH


la rvision constitutionnelle, conforter le pluralisme snatorial et rnover les mthodes de travail du Snat.

94

GpSRVpRXWUDQVPLVXQGpEDWGRULHQWDWLRQHQVpDQFHSXEOLTXHDYDQWVRQH[DPHQ
par la commission laquelle ce texte a t renvoy (1) .
/RUJDQLVDWLRQGXQGpEDWGRULHQWDWLRQSUpDODEOHTXLVHUDLWVDQVGRXWHOD
VROXWLRQODSOXVHIILFDFHSRXUUHFHQWUHUOHVGpEDWVSDUOHPHQWDLUHVVXUOpYDOXDWLRQ
ex ante des projets et propositions de loi, ncessiterait donc une modification des
articles 42 et 43 de la Constitution.
Sans attendre FHWWH UpYLVLRQ FRQVWLWXWLRQQHOOH XQ DXWUH PR\HQGDWWHLQGUH
rapidement cet objectif pourrait FRQVLVWHUjPRGLILHUOH5qJOHPHQWGHO$VVHPEOpH
QDWLRQDOH HW QRWDPPHQW VRQ DUWLFOH  SRXU SUpYRLU Oorganisation systmatique
GXQ GpEDW HQ FRPPLVVLRQ VXU OD TXDOLWp GHV pWXGHV GLPSDFW DFFRPSDJQDQW les
textes lgislatifs.
Ce dbat pourrait tre impuls par la FUpDWLRQGXQHREOLJDWLRQSRXUOH
UDSSRUWHXUGHODFRPPLVVLRQVDLVLHDXIRQGGXQtexte, de prsenter, dans son
LQWHUYHQWLRQ OLPLQDLUH ORUV GH OH[DPHQ HQ FRPPLVVLRQ OHV DSSRUWV HW OHV
pYHQWXHOOHV LQVXIILVDQFHV GH OpWXGH GLPSDFW MRLQWH DX SURMHW RX j OD
SURSRVLWLRQ GH ORL 8Q GpEDW VXU OpWXGH GLPSDFW SRXUUDLW DLQVL VHQJDJHU
DYDQWOH[DPHQGHVDrticles et des amendements.
&RPPH OD VRXOLJQp QRWUH FROOqJXH -HDQ-Luc Warsmann lors de son
audition, le dbat dmocratique y gagnerait , car cela nous permettrait de
GpSDVVHU ODIIURQWHPHQW XQ SHX FDULFDWXUDO HQWUH OD PDMRULWp HW ORSSRVLWLRQ HW
obliJHUDLWjDYRLUXQGpEDWVXUOHUDSSRUWTXDOLWp-SUL[GHODPHVXUH . En effet,
LO QH IDXW SDV SHUGUH GH YXH TXHQ PDWLqUH GH mieux lgifrer , ODGYHUVDLUH
QHVWSDVODGURLWHRXODJDXFKHPDLVODPDFKLQHDGPLQLVWUDWLYH HWTXHOLQWpUrW
des tudes GLPSDFWWLHQWQHVWSUpFLVpPHQW pas de provoquer une confrontation
HQWUH OD GURLWH HW OD JDXFKH PDLV GDPHQHU OH[pFXWLI j IDLUH pWDW GX rapport
qualit-SUL[GHODPRGLILFDWLRQOpJLVODWLYHTXLOSURSRVHHWVXUWRXWjGpPRQWUHU
en quoi la solution quLOSUpFRQLVHHVWODPHLOOHXUH .
La formalisation de cette obligation nouvelle faite aux rapporteurs des
commissions saisies au fond des projets et propositions de loi ncessiterait sans
GRXWHXQHPRGLILFDWLRQGHODUWLFOHGX5qJOHPHQWGHQRWUH$VVHPEOe, qui rgit
ORUJDQLVDWLRQGHVWUDYDX[OpJLVODWLIVHQFRPPLVVLRQ
Proposition n 7 Renforcer le contrle du Parlement sur la qualit des tudes
GLPSDFW
$X VWDGH GH OH[DPHQ HQ FRPPLVVLRQ SUpYRLU GDQV OLQWHUYHQWLRQ OLPLQDLUH GX
rapporteur de la commission saisie au fond, une prsentation systmatique de
OpWXGH GLPSDFW VXU OH SURMHW GH WH[WH DYDQW OH[DPHQ GHV DUWLFOHV HW GHV
amendements.

(1) Conseil constitutionnel, dcision n 2009-582 DC du 25 juin 2009, considrant n 18.

95

Cette proposition, qui vise permettre aux parlementaires de mieux


VDVVXUHU TXH OH *RXYHUQHPHQW VHVW FRQIRUPp j OD GLVFLSOLQH GH OpYDOXDWLRQ
SUpDODEOH GRLW rWUH FRPSOpWpH SDU OD PLVH HQ XYUH GXQ GLVSRVLWLI GHVWLQp j
VDVVXUHU TXH OHV SDUOHPHQWDLUHV VDXWR-disciplinent en soumettant leurs propres
initiatives (et tout particulirement les amendements TXLOs adoptent) une tude
GLPSDFW
C. e7(1'5( /2%/,*$7,21 'e9$/8$7,21
AMENDEMENTS SUBSTANTIELS

'(

/,0PACT

AUX

/DUpDOLVDWLRQGXQHpWXGHGLPSDFWVpULHXVHHWH[KDXVWLYHsur un projet ou
XQH SURSRVLWLRQ GH ORL QH VHUD GDXFXQH XWLOLWp WDQW TXXQ DPHQGHPHQW
gouvernemental ou parlementaire pourra, au cours de la procdure lgislative, sans
IDLUH OREMHW GH OD PRLQGUH pYDOXDtion ERXOHYHUVHU OpTXLOLEUH GX SURMHW RX GH OD
proposition de loi en question.
&RPPH OD H[SOLTXp GHYDQW OD PLVVLRQ OH SUpVLGHQW GX &RQVHLO
conomique, social et environnemental, M. Jean-Paul Delevoye, si OpWXGH
GLPSDFWYLVHjrWUHXQpOpPHQWGHVWDELOLVDWLRQGXQWH[WHGHORLYRXVQHSRXUUH]
pas faiUHOpFRQRPLHGXQHUpIOH[LRQVXUOHGURLWGHGpSRVHUGHVDPHQGHPHQWVGH
GHUQLqUHPLQXWHj OLQFLGHQFH SDUIRLV FRQVLGpUDEOH en matire fiscale, certains
peuvent dnaturer totalement un dispositif .
Les Parlements europen, allemand et nerlandais soumettent
UpJXOLqUHPHQWjXQHpWXGHGLPSDFWOHVDPHQGHPHQWV substantiels dposs au
FRXUV GH OD SURFpGXUH OpJLVODWLYH HW OD SRVVLELOLWp GH UpDOLVHU XQH pWXGH GLPSDFW
sur des amendements est prvue, depuis 2009, par notre Rglement. Il QD
cependant jamais t fait usage de cette possibilit DORUV TXH VRXV ODFWXHOOH
lgislature comme sous les prcdentes, les exemples ne manquent pas
GDPHQGHPHQWVSDUOHPHQWDLUHVHWJRXYHUQHPHQWDX[TXLRQWDIIHFWpSURIRQGpPHQW
OpTXLOLEUHGXQSURMHWRXGXQHSURSRVLWLRn de loi.
1. /D UpDOLVDWLRQ GXQH pWXGH GLPSDFW SRXU OHV DPHQGHPHQWV HVW XQH
IDFXOWpTXLQDMDPDLVpWpH[HUFpH

a. Le RglHPHQWGHO$VVHPEOpHQDWLRQDOHpermet au comLWpGpYDOXDWLRQ
et de contrle GH UpDOLVHU OpYDOXDWLRQ SUpDODEOH GH FHUWDLQV
amendements.
La rsolution n 292 du 27 mai 2009, adopte dans le prolongement de la
UpYLVLRQ FRQVWLWXWLRQQHOOH GX  MXLOOHW  D FRQGXLW j OLQWURGXFWLRQ GDQV OH
5qJOHPHQW GH O$VVHPEOpH QDWLRQDOH GXQ DUWLFOH - TXL SUpYRLW TX un
DPHQGHPHQWIDLWOREMHWGXQH valuation pralable :
1 la demande du prsident ou du rapporteur de la commission saisie au
IRQGVDJLVVDQWGXQDPHQGHPHQWGHODFRPPLVVLRQ

96

  OD GHPDQGH GH ODXWHXU GH ODPHQGHPHQW HW DYHF ODFFRUG GX
prsident de la commission saisie au fond, VDJLVVDQW GXQ DPHQGHPHQW GpSRVp
par un dput .
/DUWLFOH -6 du mme Rglement confie cette valuation pralable au
FRPLWpGvaluation et de contrle des politiques publiques (CEC).
7RXWHIRLVSDUVRXFLGHSUpYHQLUGpYHQWXHOOHVPDQXYUHVGREVWUXFWLRQOH
Rglement de notre Assemble a prvu, outre le filtre du prsident de la
commission saisie au fond, une neutralisation des consquences procdurales lies
jODEVHQFHGpYDOXDWLRQSUpDODEOHGXQDPHQGHPHQWSXLVTXHOHGHUQLHUDOLQpDGH
ODUWLFOH -1 dispose que OH GpIDXW GH UpDOLVDWLRQ GLPSUHVVLRQ RX GH
GLVWULEXWLRQGune valuation pralable sur un amendement ne peut faire obstacle
sa discussion en sance publique .
b. Aucune saisine du CEC dans le cadre des articles 98-1 et 146-6 du
RgOHPHQWGHO$VVHPEOpHQDWLRQDOH
'DSUqV OHV LQIRUPDWLRQV TXD SX UHFXHLOOLU OD PLVVLRQ OH FRPLWp
GpYDOXDWLRQ HW GH FRQWU{OH GHV SROLWLTXHV QD MDPDLV pWp VDLVL pour procder
OpYDOXDWLRQ SUpDODEOH GXQ DPHQGHPHQW HVVHQWLHOOHPHQW SRXU GHV UDLVRQV OLpHV
aux contraintes temporelles dans lesquelles est enserr OH[DPHQ GHV WH[WHV HQ
commission et en sance publique (1).
Votre rapporteur note par ailleurs que, compte tenu de sa composition (2),
le &(& QHVW SDV QpFHVVDLUHPHQW OH PLHX[ SODFp SRXU SURFpGHU DX PLHX[ HQ
quelques jours, et, le plus souvent, en quelques heures, la dsignation de
rapporteurs HW j OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW FRPSOqWH HW SUpFLVH TXH OHV
commissions saisies au fond sont peut-rWUHPLHX[jPrPHGHIIHFWXHUDXUHJDUG
GHOHXUFRQQDLVVDQFHGXWH[WHGLVFXWpHWGHOH[SHUWLVHTXHOOHVRQWDFTXLVHDXJUp
de leurs travaux lgislatifs et de contrle, sur les sujets traits par le texte en
question.
&HVW DXVVL OH SRLQW GH YXH GX SUpVLGHQW GX FRQVHLO QDWLRQDO GpYDOXDWLRQ
des normes, M. Alain Lambert, ancien snateur et ancien ministre dlgu au
Budget, qui, expliquant devant la mission TXHQ WDQW TXH UDSSRUWHXU JpQpUDO GX
Budget ou prsident de la commission des Finances du Snat, il avait parfois t
(1) Rappelons que, pour leur dpt en commission comme en sance publique, les amendements du
Gouvernement et de la commission saisie au fond ne sont soumis aucun dlai de dpt, tandis que les
amendements des dputs doivent avoir t dposs (sauf dcision contraire du prsident de la commission
ou de la Confrence des prsidents) au plus tard 17 heures le troisime jour ouvrable prcdant la date
de dbut de la discussion du texte en commission ou en sance publique (articles 86 et 99 du Rglement de
O$VVHPEOpHQDWLRQDOH 
(2) (QDSSOLFDWLRQGHOarticle 146-GX5qJOHPHQWGHO$VVHPEOpHQDWionale, le CEC est compos de :
- PHPEUHVGHGURLW 3UpVLGHQWGHO$VVHPEOpHQDWLRQDOHTXLOHSUpVLGHSUpVLGHQWVGHVJURXSHVSUpVLGHQts
des commissions permanentes ; rapporteur gnral de la commission des Finances ; prsident de la
commission des Affaires europennes ; premier vice-SUpVLGHQWGHO2IILFHSDUOHPHQWDLUHGpYDOXDWLRQGHVFKRL[
scientifiques et technologiques ; prsidente de la Dlgation parlementaire aux droits des femmes et l'galit
des chances entre les hommes et les femmes) ;
- 16 membres dsigns par leur groupe.

97

confront des amendements SUpSDUpVSDUOH[pFXWLIPDLVSDUIRLVSUpVHQWpVSDU


des parlementaires, qui tendaient changer dans des proportions inquitantes
ORUJDQLVDWLRQ GXQ UpJLPH ILVFDO . Selon lui, en prsence de ces amendements
substantiels , LO Q\ D SDV GDXWUH VROXWLRQ TXH GH ODLVVHU j OD FRPPLVVLRQ
saisie au fond le soin de les apprcier , car elle seule aurait la lgitimit pour
DSSUpFLHUOHFDUDFWqUHVXEVWDQWLHOGXQDPHQGHPHQW .
Votre rapporteur UHJUHWWHTXLOQDLWMDPDLVpWpSURFpGpjOpYDOXDWLRQ
SUpDODEOHGDPHQGHPHQWV substantiels , car il aurait souvent t fort utile
de disposer GXQH pYDOXDWLRQ GDPHQGHPHQWV GRQW OLPSDFW VHVW UpYpOp
particulirement lourd en termes budgtaires, conomiques et/ou sociaux.
9RWUH UDSSRUWHXU QH FLWHUD TXH GHX[ H[HPSOHV OXQ HPSUXQWp j OD
SUpFpGHQWHOpJLVODWXUHHWODXWUH ODFWXHOOH.
(;(03/(6'81(e9$/8$7,2135e$/$%/(,168)),6$17(
DES AM ENDEM ENTS AUX PROJETS DE LOI DE FI NANCES
Le 18 dcembre 2009, lorV GH OH[DPHQ GX SURMHW GH ORL GH ILQDQFHV SRXU  TXL HVW
devenu la loi n 2009-1673 du 30 dcembre 2009 et qui a supprim la taxe professionnelle
pour lui substituer une contribution conomique territoriale (CET) fonde sur la cotisation
foncire des entreprises (CFE) et sur la cotisation sur la valeur ajoute des entreprises
(CVAE), le Gouvernement a dpos 50 amendements sur le texte adopt le mme jour par la
commission mixte paritaire, dont 32 portaient sur les taxes appeles remplacer la taxe
professionnelle. Sur ces amendements, dont certains opraient des modifications lourdes du
texte adopt par les dputs et snateurs (pour ce qui tait notamment des modalits de
calcul de la compensation financire bnficiant aux collectivits territoriales en 2010 ou
HQFRUHGHVUqJOHVGHSODIRQQHPHQWGHODYDOHXUDMRXWpHHQIRQFWLRQGXFKLIIUHGDIIDLUHVGHV
entreprises), le Gouvernement a en outre eu recours la procdure du vote bloqu,
demandant ainsi aux parlementaires de se prononcer par un vote unique sur une cinquantaine
GDPHQGHPHQWVTXLOV QDYDLHQWSDVHXOHWHPSVGH[DPLQHUDXIRQG et dont la trs grande
majorit comportait un expos sommaire TXLQpWDLW long que de quelques lignes seulement.
Les rgles de rpartition et de prquation du produit de la CVAE entre les collectivits
WHUULWRULDOHV IL[pHV SDU OD ORL GH ILQDQFHV SRXU  RQW SDU OD VXLWH IDLW OREMHW GH
modifications apportes par de nouveaux amendements dpourvus GpYDOXDWLRQ SUpDODEOH.
Lors de la nouvelle lecture du projet de loi de finances pour 2013, devenu la loi n 20121509 du 29 dcembre 2012 ODQFLHQ UDSSRUWHXU JpQpUDO GH OD FRPPLVVLRQ GHV )LQDQFHV
M. &KULVWLDQ(FNHUWGpVRUPDLVVHFUpWDLUHGetat au Budget, auprs du ministre des Finances
et des Comptes publics, a ainsi d donner un avis de sagesse un amendement n 341 du
Gouvernement qui, dpos dix minutes avant son examen et dpourvu de simulation,
proposait de modifier les rgles de contribution au fonds de prquation de la CVAE alloue
aux dpartements ( 1 ). La veille, face de multiples amendements proposant de rviser
plusieurs dispositifs de prquation financire entre collectivits territoriales (en matire de
CVAE et de droits de mutation titre onreux - DMTO), M. Christian Eckert avait expliqu
TX il serait plus sage de laisser un peu de temps au travail parlementaire et aux
associations spcialises, avant de modifier de faon rgulire et, selon [lui], trop frquente

(1) Voir le compte-rendu intgral de la sance unique du vendredi 14 dcembre 2012, qui est consultable au
lien suivant : http://www.assemblee-nationale.fr/14/cri/2012-2013/20130099.asp

98

ces diffrents fonds de prquation  VLQWHUURJHDQW VXU ORSSRUWXQLWp GH GLVSRVHU de


simulations financires (1).
/H[DPHQ GX SURMHW GH ORL GH ILQDQFHV SRXU  D IRXUQL XQH DXWUH LOOXVWUDWLRQ GHV
FRQVpTXHQFHV QpIDVWHV GH ODEVHQFH GpYDOXDWLRQ SUpDODEOH pour des amendements aux
consquences aussi lourdes que celles des amendements qui sont rests dans les mmoires
VRXVOHQRPGDPHQGHPHQWV pigeons . Face aux mouvements de mcontentement sur les
UpVHDX[VRFLDX[TXDYDLWVXVFLWpODUWLFOH 6 de la version initiale du projet de loi de finances
SRXU  TXL SURSRVDLW GLPSRVHU DX EDUqPH SURJUHVVLI GH OLPS{W VXU OH UHYHQX HW QRQ
plus de faon forfaitaire) les gains nets de cession de valeurs mobilires ralises par des
particuliers, afin de rapprocher la fiscalit des revenus du capital de celle des revenus du
travail, le Gouvernement a dpos, le 18 octobre 2012, un amendement qui oprait une
refonte complte du dispositif HWGRQWOLPSDFWILQDQFLHUVHFKLIIUDLWHQFHQWDLQHVGHPLOOLRQV
GHXURV HQYLURQ  millions de manque gagner, qui devaient tre compenss par la
reconduction SRXUGHX[DQVGHODPDMRUDWLRQH[FHSWLRQQHOOHGHOLPS{WVXUOHVVRFLpWpVGSDU
les grandes entreprises).
5pDPpQDJHDQWOHVFRQGLWLRQVGDSSOLFDWLRQHWGHQWUpHHQYLJXHXUGHOLPSRVLWLRQGHVSOXVYDOXHVPRELOLqUHVDXEDUqPHGHOLPS{WVXUOHUHYHQXFHW amendement tout la fois crait un
UpJLPHGpURJDWRLUHSRXUODFDWpJRULHGHVFUpDWHXUVGHQWUHSULVHV PDLQWHQDLWOLPSRVLWLRQDX
taux forfaitaire pour les plus-values mobilires ralises en 2012, majorait les taux des
abattements applicables, rduisait les dures de dtention et assouplissait les conditions
GDSSOLFDWLRQ GX UHSRUW GLPSRVLWLRQ HQ FDV GH UpLQYHVWLVVHPHQW GHV SOXV-values dans des
entreprises.
Long de sept pages, cet amendement tait dpourvu GpYDOXDWLRQSUpDODEOH HWVDSSX\DLWVXU
un exposp VRPPDLUH GXQH YLQJWDLQH GH OLJQHV En consquence, M. Thierry Mandon,
GpVRUPDLVVHFUpWDLUHGeWDWDXSUqVGX3UHPLHUPLQLVWUHFKDUJpGHOD5pIRUPHGHOeWDWHWGH
ODVLPSOLILFDWLRQDGHPDQGpHQVpDQFHSXEOLTXHTX un travail trs prcis [soit] men par
XQ JURXSH GH VXLYL VXU OLPSDFW GH FHW DUWLFOH VXU OHV 30( GH FURLVVDQFH DILQ OH PRPHQW
YHQXGHQWLUHUOHVHQVHLJQHPHQWV (2).
3UHXYHTXHOH*RXYHUQHPHQWQHVWSDVOHVHXOconcern ODQQpHVXLYDQWHORUVGHOH[DPHQ
du projet de loi de finances pour 2014, devenu la loi n 2013-1278 du 29 dcembre 2013, ce
sont deux amendements du rapporteur gnral de la commission des Finances,
M. Christian Eckert, TXL VDSSX\DQW FKDFXQ VXU XQ H[SRVp VRPPDLUH GH TXHlques lignes
VHXOHPHQW RSpUDLW GLPSRUWDQWV DPpQDJHPHQWV DX UpJLPH GLPSRVLWLRQ GHV SOXV-values de
FHVVLRQ GH YDOHXUV PRELOLqUHV HQ VXSSULPDQW OH GLVSRVLWLI GH UHSRUW GLPSRVLWLRQ HQ FDV GH
rinvestissement des plus-YDOXHV HW HQ LQWHUGLVDQW OH FXPXO GH Oabattement major pour
GXUpH GH GpWHQWLRQ DYHF OD UpGXFWLRQ GLPS{W Madelin qui bnficie aux personnes
investissant dans une entreprise non cote.

4XHOOH TXH VRLW OD PDMRULWp TXLO VDJLVVH GDPHQGHPHQWV


gouvernementaux ou parlementaires, ODGRSWLRQ GDPHQGHPHQWV DX[
consquences financires, conomiques et sociales aussi lourdes, sans tude
GLPSDFW, QDSSDUDvW SDV GH ERQQH PpWKRGH  FHW pJDUG notre Assemble
gagneraiW j VLQVSLUHU GHV ERQQHV SUDWLTXHV DGRSWpHV SDU QRV YRLVLQV
europens.
(1) Voir le compte-rendu intgrale de la premire sance du jeudi 13 dcembre 2012, qui est consultable au
lien suivant : http://www.assemblee-nationale.fr/14/cri/2012-2013/20130096.asp
(2) Voir le compte-rendu intgral de la deuxime sance du jeudi 13 dcembre 2012, qui est consultable au
lien suivant : http://www.assemblee-nationale.fr/14/cri/2012-2013/20130097.asp#INTER_5

99

2. De bonnes pratiques ont pourtant t adoptes au niveau europen en


PDWLqUHGpYDOXDWLRQGHOLPSDFWGHVDPHQGHPHQWV

a. Les pratiques du Parlement europen


/RUVTXLO OH MXJH DSSURSULp HW QpFHVVDLUH DX SURFHVVXV OpJLVODWLI OH
Parlement europen procde j OpYDOXDWLRQ ex ante GH OLPSDFW
G amendements substantiels VDQVTXHFHODQDIIHFWHVDFDSDFLWpGDGRSWHU
ces amendements.
I l incombe chaque commission du Parlement europen saisie au
IRQG GXQH SURSRVLWLRQ GH OD &RPPLVVLRQ HXURSpHQQH GH GpWHUPLQHU FH TXH
recoXYUH OD QRWLRQ G amendement substantiel . En effet, dans ses
RULHQWDWLRQV LQGLFDWLYHV SRXU OH WUDLWHPHQW GHV DQDO\VHV GLPSDFW OH &RQVHLO QH
donne pas de dfinition gnrique des amendements substantiels . La notion
rpond difficilement une dfinition a prioriPDLVUHOqYHGXQHGpFLVLRQDXFDV
par cas.
Il appartient donc la commission parlementaire saisie au fond de
GpWHUPLQHUVLXQRXGHVDPHQGHPHQWVGpSRVpVHQVRQVHLQSHQGDQWOH[DPHQGXQH
proposition de la Commission europenne revtent un caractre substantiel et,
VL FHVW OH FDV VLO HVW RSSRUWXQ GH OHV VRXPHWWUH j XQH DQDO\VH GLPSDFW /HV
FULWqUHVGHODQDO\VHGLPSDFWVXUOHVDPHQGHPHQWVVXEVWDQWLHOVVRQWDUUrWpVDXFDV
par cas par la commission saisie au fond.
Sur proposition du rapporteur, du prsident de la commission saisie
DX IRQG RX GXQ PHPEUH GH ODGLWH FRPPLVVLRQ VH[SULPDQW DX QRP GH VRQ
groupe, les coordinateurs dsigns par les groupes politiques au sein de ladite
commission, en lien avec le rapporteur, dcident de demander une analyse
GLPSDFW VXr un ou plusieurs amendements substantiels . Cette dcision
GRLWEpQpILFLHUGXQODUJHVRXWLHQSROLWLTXH
Les commissions saisies pour avis (dites commissions associes )
peuvent, dans les mmes conditions, procder des aQDO\VHV GLPSDFW VXU OHV
amendements substantiels relevant de leur champ de comptence, dans la
mesure o cela est compatible avec le calendrier des travaux, tel que convenu avec
ODFRPPLVVLRQFRPSpWHQWHDXIRQGHQDSSOLFDWLRQGHODUWLFOHGX5qJOHPent du
Parlement europen.
LRUVTXH OD PDWLqUH UHYrW XQH LPSRUWDQFH PDMHXUH TXHOOH UHOqYH GH
PDQLqUH LQVpSDUDEOH GH OD FRPSpWHQFH GH SOXVLHXUV FRPPLVVLRQV HW TXHQ
FRQVpTXHQFHOD&RQIpUHQFHGHVSUpVLGHQWVDGpFLGpHQDSSOLFDWLRQGHODUWLFOH
du Rglement du Parlement europen, que la proposition de la Commission sera
examine dans le cadre de runions conjointes de commissions, les dcisions
UHODWLYHV j OD UpDOLVDWLRQ GDQDO\VHV GLPSDFW VXU GHV DPHQGHPHQWV VXEVWDQWLHOV
sont prises conjointement par les commissions concernes.

100

/HVDQDO\VHVGLPSDFWVXUGHV amendements substantiels peuvent tre


menes chaque tape de la procdure lgislative, en tenant compte des
contraintes de temps propres chaque lecture, et sous rserve de ne pas retarder
indment le processus lgislatif.
/DQDO\VHGHOLPSDFWGHV amendements substantiels est cense ne
pas retarder le processus lgislatif. Cette analyse est rendue possible par les
dlais relativement longs de la procdure lgislative europenne (si on les
FRPSDUHj FHX[GH OD SURFpGXUH OpJLVODWLYH IUDQoDLVH   HQWUH OH[DPHQ GXQ
WH[WH HQ FRPPLVVLRQ HW VRQ H[DPHQ HQ VpDQFH SOpQLqUH LO VpFRXOH DX
minimum deux trois mois, et souvent encore davantage de temps.
3DUIRLV OD GDWH GH[DPHQ GXQ WH[WH HQ FRPPLVsion est fixe en
fonction du dlai impos par le contrat-cadre conclu avec des consultants
H[WHUQHVSRXUOpYDOXDWLRQGHOLPSDFWGXQDPHQGHPHQW substantiel .
En pratique, ODFRPPLVVLRQVDLVLHDXIRQGVHIIRUFHle plus souvent de
dterminer les amendements substantiels VXVFHSWLEOHV GH IDLUH OREMHW
GXQHDQDO\VHGLPSDFWDYDQWOHXUDGRSWLRQHQFRPPLVVLRQ
&HSHQGDQW HOOH SHXW FRQVLGpUHU SOXV DSSURSULp GHQWUHSUHQGUH ODQalyse
GLPSDFW SRVWpULHXUHPHQW VRLW DYDQW OH[DPHQ HQ VpDQFH SOpQLqUH VL FHOD est
SRVVLEOHQRWDPPHQWGDQVOHFDGUHGXQHSURFpGure avec commissions associes,
soit la suite du vote en sance plnire.
/DFFRUGLQWHULQVWLWXWLRQQHO0LHX[OpJLIpUHU conclu le 9 octobre 2003
par le Parlement europen, le Conseil et la Commission prvoit que lorsque la
SURFpGXUH GH FRGpFLVLRQ HVW GDSSOLFDWLRQ OH 3DUOHPHQW HXURSpHQ HW OH &RQVHLO
SRXUURQW pJDOHPHQW IDLUH SURFpGHU j GHV DQDO\VHV GLPSDFW SUpDODEOHV j
ODGRSWLRQGXQDPHQdement substantiel, soit en premire lecture, soit au stade de
la conciliation .
ce jour, les commissions du Parlement europen ont fait procder des
DQDO\VHV GLPSDFW VXU GHV DPHQGHPHQWV VXEVWDQWLHOV HQ SUHPLqUH OHFWXUH HQ
deuxime lecture et au stade de la conciliation.
Dans un souci de neutralit, lDQDO\VH GLPSDFW GHV DPHQGHPHQWV
VXEVWDQWLHOVHVWWRXMRXUVFRQILpHjGHVH[SHUWVH[WHUQHVjOLQVWLWXWLRQ
La dcision de la commission saisie au fond de requrir une analyse
GLPSDFW VXU XQ RX GHV DPHQGHPHQWV VXEVWDQWLHOV HVW WUDQVPLVH j OXQLWp
GpYDOXDWLRQ GH OLPSDFW ex ante du Parlement europen qui se charge de
slectionner les experts externes conformment aux prescriptions de la lgislation
GHO8QLRQHXURSpHQQHVXUOHVPDUFKpVSXEOLFVHWGHOD rglementation interne du
Parlement europen en matire de passation de marchs, de faon assurer une
indpendance et une objectivit optimales des experts et une transparence
maximale de la procdure suivie pour leur slection.

101

'XQSRLQWGHYXHPpWKRGologique, les experts externes se fondent, si cela


DSSDUDvW DSSURSULp VXU OHV GRQQpHV GH ODQDO\VH GLPSDFW pODERUpH SDU OD
Commission europenne, comme point de dpart , et structurent, dans la
mesure du possible, leur analyse de manire faciliter la comparaison avec cette
dernire, sans pour autant dupliquer le travail de la Commission europenne.
La Commission met la disposition du Parlement europen et des experts
externes toute mthodologie spcifique utilise dans le cadre de la prparation
GXQHDQDO\VHGLPSDFWHWFRPPXQLTXHOHVGRQQpHVXWLOLVpHV
/HVDQDO\VHVGLPSDFWVXUOHVDPHQGHPHQWVVXEVWDQWLHOVVRQWUpGLJpHV
GDQVODODQJXHGHWUDYDLOODSOXVXVLWpHDXVHLQGHODFRPPLVVLRQjORULJLQHGHOD
demande. la demande des coordinateurs des groupes politiques, un rsum peut
tre traduit dans la langue du rapporteur et/ou dans les trois langues de travail les
plus usites de la commission.
/XQLWp GpYDOXDWLRQ ex ante du Parlement europen veille ce que les
DQDO\VHVGLPSDFWUpDOLVpHVSDr des experts externes soient conformes aux critres
de qualit du Parlement.
La ou les commissions parlementaires ayant demand une analyse
GLPSDFW VXU GHV DPHQGHPHQWV VXEVWDQWLHOV YHLOOHQW j LQIRUPHU OHV DXWUHV
FRPPLVVLRQV VXVFHSWLEOHV GrWUH LQWpUHVVpHs du droulement et des rsultats des
DQDO\VpHV GHPDQGpHV /H 3DUOHPHQW HXURSpHQ VHIIRUFH SDU DLOOHXUV GLQIRUPHU
rgulirement et en temps utile le Conseil et la Commission des travaux
GpYDOXDWLRQHQFRXUVVXUGHV amendements substantiels .
Sauf dcision contraire dment justifie de la commission saisie au fond,
OHVDQDO\VHVGLPSDFWPHQpHVVXUGHVDPHQGHPHQWVVXEVWDQWLHOVVRQWSXEOLpHV
sur le site Internet du Parlement europen.
La ralisatLRQGpWXGHVGLPSDFWVXUGHV amendements substantiels
HVW UpFHPPHQW VXUYHQXH DX VXMHW GDPHQGHPHQWV j OD SURSRVLWLRQ GH
rglement du Parlement europen et du Conseil relatif au recyclage des
QDYLUHV DLQVL TXj OD SURSRVLWLRQ GH GLUHFWLYH GX 3DUOHPHQW HXURSpHQ HW GX
Conseil sur la passation des marchs publics. Toutefois, GDSUqV OHV
indications fournies la mission lors de son dplacement Bruxelles, le
16 janvier 2014, seule XQH GL]DLQH GpWXGHV GLPSDFW SRUWDQW VXU GHV
amendements substantiels a t ralise depuis que cette procdure
GpYDOXDWLRQ a t cre en 2012.
b. Les pratiques des Parlements allemand et nerlandais
En Allemagne, le bureau fdral des statistiques ( Destatis ) est tenu
par la loi (1) Gapporter son expertise au Gouvernement et au Parlement pour
ODQDO\VHGHOLPSDFWGHOHXUVamendements.
(1) Article 8 de la loi du 14 aot 2006 portant cration du NKR .

102

Ce bureau fournit alors au Gouvernement et aux parlementaires qui le


VDLVLVVHQW GHV GRQQpHV FKLIIUpHV VXVFHSWLEOHV GH PLHX[ DSSUpKHQGHU OLPSDFW GHV
modifications lgislatives envisages.
Toutefois, la GLUHFWULFHHQFKDUJHGHORUJDQLVDWLRQHW de la modernisation
GH ODGPLQLVWUDWLRQ DX PLQLVWqUH IpGpUDO GH O,QWpULHXU Mme Beate Lohmann, a
prcis la mission, lors de son dplacement Berlin, que cette procdure
GpYDOXDWLRQ GH OLPSDFW GHV DPHQGHPHQWV WURXYDLW VD OLPLWH GDQV OHV GpODLV
de la procdure lgislative : le bureau fdral des statistiques peut difficilement
FKLIIUHU OLPSDFW GXQ DPHQGHPHQW GX MRXU DX OHQGHPDLQ QL UpSRQGUH j GHV
sollicitations en pleine nuit.
De leur ct, les Pays-%DV VH GRQW GRWpV GHSXLV  GXQ FRQVHLO
consultatif indpendant (ACTAL) qui, GDSUqV FH TXL D pWp LQGLTXp j OD
mission lors de son dplacement La Haye, rend, une dizaine de fois par an,
un avis sur les amendements substantiels proposs par des
parlementaires VRXV ODQJOH GHV FKDUJHV DGPLQLVWUDWLves. I l donne alors son
avis en quelques jours. De mme, si une proposition de loi est dpose et
SUpVHQWH GLPSRUWDQWV HQMHX[ HQ PDWLqUH GH FKDUJHV DGPLQLVWUDWLYHV HW
UpJOHPHQWDLUHV$&7$/FRQWDFWHVRQDXWHXUHWSURSRVHGHODFFRPSDJQHUGDQVVD
rflexion.
ACTAL QHVW UDWWDFKp j DXFXQ PLQLVWqUH HW ses membres, bien que
GpVLJQpV SDU OH *RXYHUQHPHQW EpQpILFLHQW GXQH WRWDOH LQGpSHQGDQFH WDQW j
OpJDUG GX *RXYHUQHPHQW TXj OpJDUG GX 3DUOHPHQW &H conseil est assist de
12 SHUVRQQHVHWVDSSXLHpJDOHPHQWVXUOHVUHPRQWpHVGLQIRUPDWLRQVGHODVRFLpWp
FLYLOH DLQVL TXH VXU XQ UpVHDX GH[SHUWV GpYHORSSp DX ILO GHV DQQpHV Il a vu ses
comptences voluer depuis 2000 : son mandat, initialement UpGXLW SXLVTXLO QH
portait que sur les charges administratives imposes aux entreprises et aux
administrations), VHVW pODUJL SRXU \ LQFOXUH OHV SDUWLFXOLHUV HW OHV SHUVRQQHV
travaillant dans la sphre publique ou semi-SXEOLTXH HW SRXU SDVVHU GH ODQDO\VH
GHV FKDUJHV DGPLQLVWUDWLYHV j OHQVHPEOH GHV FRWV UpJOHPHQWDLUHV 'e mme,
GXQHDQDO\VHH[FOXVLYHPHQWex anteLOHVWSDVVpjODUpDOLVDWLRQGpWXGHVex post.
6LODPLVVLRQQLJQRUHSDVTXHOHVVSpFLILFLWpVHWQRWDPPHQWOHVGpODLV
des procdures lgislatives europenne, allemande et nerlandaise rendent ces
SUDWLTXHVGpYDOXDWLRQex ante GHOLPSDFWGHVDPHQGHPHQWV substantiels
difficilement transposables telles quelles notre procdure lgislative,
dont les contraintes temporelles sont particulirement fortes, elle estime en
UHYDQFKH TXH QRWUH $VVHPEOpH JDJQHUDLW j VLQVSLUHU de ces exemples
trangers. Ils pourraient tre adapts aux exigences propres de notre procdure
OpJLVODWLYHSRXUDPpOLRUHUOpYDOXDWLRQSUpDODEOHGHVDPHQGHPHQWVSDUOHPHQWDLUHV
et gouvernementaux.

103

3. Adapter les exemples trangers la procdure lgislative franaise

Votre rapporteur est GDXWDQW SOXV FRQYDLQFX GH OD QpFHVVLWp GXQH tude
GLPSDFW VXU GHV DPHQGHPHQWV substantiels en cours de procdure lgislative
TXXQUpFHQWH[HPSOHHQDPRQWUpjODIRLVODIDLVDELOLWpHWOXWLOLWp Ovaluation,
en cours de procdure lgislative, des consquences de la dpnalisation du
stationQHPHQW DGRSWpH SDU YRLH GDPHQGHPHQW VpQDWRULDO ORUV GH Oa premire
lecture de la loi n 2014- GX  MDQYLHU  GH PRGHUQLVDWLRQ GH ODFWLRQ
publique territoriale HWGDIILUPDWLRQGHVPpWURSROHV
UN EXEM PLE DE BONNES PRATI QUES EN M ATI RE
'e9$/8$7,21EX ANTE '(/,03$&7'(6AM ENDEM ENTS :
/$57,&/('(/$/2,1 2014-58 DU 27 JANVI ER 2014 DE
02'(51,6$7,21'(/$&7,2138%/,48(7(55,725,$/((7
'$)),50$7,21'(60e75232/(6
Le 29 mai 2013, lors de la premire lecture du projet de loi de modernisation de
ODFWLRQSXEOLTXHWHUULWRULDOHHWGDIILUPDWLRQGHVPpWURSROHVOH6pQDWDDGRSWpjOLQLWLDWLYH
de M. Jean-Jacques Filleul, rapporteur de la commission du dveloppement durable, un
amendement prvoyant la dpnalisation et la dcentralisation du stationnement payant sur
voirie FHVW--GLUH OH VWDWLRQQHPHQW HQ ODEVHQFH RX HQ LQVXIILVDQFH GH SDLHPHQW GH OD
redevance pour stationnement sur la voie publique afin de lui substituer un service public
dcentralis, sur le modle de ce qui se pratique tant au Royaume-8QLTXHQ%HOJLTXHRXHQ
Espagne. Dans ce cadre, les collectivits comptentes en matire de voirie pourront imposer
OH SDLHPHQW GXQ forfait de post-stationnement D\DQW OH FDUDFWqUH GXQH UHGHYDQFH
GRFFXSDWLRQGXGRPDLQHSXEOLFSOXW{WTXH GXQHDPHQGH
Compte tenu des consquences financires et organisationnelles particulirement
lourdes de cet amendement, le Premier ministre a alors demand OLQVSHFWLRQJpQpUDOHGHV
services judiciaires (IGSJ), OLQVSHFWLRQJpQpUDOHGHODGPLQLVWUDWLon (IGA), OLQVSHFWLRQ
gnrale des finances (IGF) et au FRQVHLOJpQpUDO GHOHQYLURQQHPHQWHW GXGpYHORSSHPHQW
durable (CGEDD) de conduire XQH PLVVLRQ GpYDOXDWLRQ GHV FRQVpTXHQFHV GH OD
dpnalisation du stationnement, dont le rapport a t rendu public le 25 juillet 2013 (1).
$X YX GHV FRQFOXVLRQV GH FH UDSSRUW LO D pWp SRVVLEOH GDSSRUWHU GHV SUpFLVLRQV HW
DPpQDJHPHQWV DX GLVSRVLWLI UpVXOWDQW GH ODPHQGHPHQW DGRSWp HQ FRXUV GH SURFpGXUH
OpJLVODWLYHGDXWDQWTXH OH*RXYHUQHPHQW QDYDLWSDVHQJDJpOD procdure acclre. &HVW
DLQVL TXH FRQIRUPpPHQW DX[ UHFRPPDQGDWLRQV GH OD PLVVLRQ GpYDOXDWLRQ HW DX[ YX[
exprims par notre collgue Olivier Dussopt (2), rapporteur du projet de loi au nom de la
commission des Lois, un dlai de mise en place de 24 moLV D pWp SUpYX j OLQLWLDWLYH GH
M. Jean--DFTXHV)LOOHXO&HGpODLQpFHVVDLUH jOD UpXVVLWHGXSURMHW SHUPHWWUDGHQ DQDO\VHU
plus finement toutes les consquences financires.

&HW H[HPSOH PRQWUH TXH SRXU SHX TXH ORQ VHQ GRQQH OH WHPSV LO HVW
possible GH IDLUHpYROXHU HW GDFWXDOLVHU OpWXGH GH OLPSDFWGXQSURMHW RXGXQH

(1) 5DSSRUW GH OD PLVVLRQ GpYDOXDWLRQ GHV FRQVpTXHQFHV GH OD GpSpQDOLVDWLon du stationnement,
25 juillet 2013.
(2) Avis n 1435 fait au nom de la commission des Lois sur le projet de loi n 1395 de finances pour 2014,
t. XII, Relations avec les collectivits territoriales, par le dput Olivier Dussopt, p. 42.

104

proposition de loi au cours de la navette parlementaire et au gr des amendements


TXLYLHQQHQWOHQULFKLU
9RWUH UDSSRUWHXU UHFRQQDvW WRXWHIRLV TXH GH OD PrPH IDoRQ TXDX
Parlement HXURSpHQ ODQDO\VH GH OLPSDFW GHV amendements substantiels est
tenue de ne pas retarder le processus lgislatif LO IDXW VH JDUGHU GHQ IDLUH XQH
obligation susceptible de ralentir voire de bloquer la procdure lgislative.
9RWUH UDSSRUWHXU QRWH GDilleurs que, GDSUqV OHV UpSRQVHV TXL OXL RQW pWp
fournies par huit des dix Parlements europens que la mission a interrogs par
OLQWHUPpGLDLUH GX &HQWUH HXURSpHQ GH UHFKHUFKH HW GH GRFXPHQWDtion
SDUOHPHQWDLUHV &(5'3  OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW sur des
amendements substantiels  QHVW MDPDLV XQH REOLJDWLRQ FKH] QRV YRLVLQV (Q
Belgique, OH &RQVHLO GeWDW SHXW rWUH VDLVL SDU OH 3UpVLGHQW GH OD &KDPEUH GHV
reprsentants pour rendre un avis public sur tout amendement un projet ou une
propositLRQGHORLOH3UpVLGHQWpWDQWWHQXGHIDLUHGURLWjXQHGHPDQGHGDYLVGqV
lors que celle-ci est appuye soit par au moins cinquante dputs, soit par la
PDMRULWp GHV GpSXWpV GXQ JURXSH OLQJXLVWLTXH Au Royaume-Uni, un guide de
bonnes pratiques recommande XQ FRPSOpPHQW GpWXGH GLPSDFW HQ FDV GH
PRGLILFDWLRQV VLJQLILFDWLYHV GXQ WH[WH HQWUH VRQ GpS{W DX 3DUOHPHQW HW VRQ
adoption dfinitive. 0DLVOpODERUDWLRQGXQHpWXGHGLPSDFWVXUGHVDPHQGHPHQWV
substantiels reste une facult dans chacun des huit pays europens ayant
rpondu (Allemagne, Belgique, Danemark, Espagne, Pays-Bas, Portugal,
Royaume-Uni et Sude).
/D PLVVLRQ SURSRVH GRQF QRQ SDV GLPSRVHU OREOLJDWLRQ PDLV GH
UHFRQQDvWUH OD IDFXOWp DX SUpVLGHQW GH OD FRPPLVVLRQ VDLVLH DX IRQG GXQ
projet RX GXQH SURSRVLWLRQ GH ORL GH[LJHU OD UpDOLVDWLRQ GXQH pWXGH
GLPSDFWVXUOHVamendements qui seraient qualifis par ladite commission de
substantiels .
$ILQGHQHSDVSRUWHUXQHDWWHLQWHH[FHVVLYHDXGURLWGDPHQGHPHQWFHWWH
initiative pourrait WUHVRXPLVHjODFFRUGGHODXWHXUGHODPHQGHPHQWFRPPHOD
suggr notre collgue Jean-Luc Warsmann (1).
Par ailleurs, OD UpDOLVDWLRQ GH OpWXGH GLPSDFW HOOH-mme pourrait tre
confie :
VRLWGDQVOK\SRWKqVHRVLOVDJLUDLWGXQDPHQGHPHQW substantiel
GRULJLQH JRXYHUQHPHQWDOH DX[ VHUYLFHV TXH OH *RXYHUQHPHQW MXJHUD OHV SOXV
appropris ;
VRLW GqV ORUV TXH ODPHQGHPHQW  VXEVWDQWLHO  pPDQHUDLW GXQ
parlementaire, un ple dH[SHUWLVH, GDQV OH FDGUH G une coopration qui
permettraiW DX 3DUOHPHQW GH VROOLFLWHU OHV PR\HQV GH[SHUWLVH GH OH[pFXWLI ,
(1) Audition de M. Jean-Luc Warsmann, dput, ancien prsident de la commission des Lois, le 1er juillet
2014. Voir le compte rendu en annexe n 16.

105

FRPPHODVXJJpUpOHYLFH-SUpVLGHQWGX&RQVHLOGeWDW0-HDQ-Marc Sauv (1),


la condition que OHV PR\HQV Gexpertise propres au Parlement soient
significativement renforcs.
Cette proposition, qui impliqueUDLW VL FH QHVW XQH UpYLVLRQ
constitutionnelle, tout au moins une modification de la loi organique du 15 avril
2009, et notamment de son article 15 (2), ainsi que, le cas chant, des articles 98-1
et 146-6 du RgOHPHQW GH O$VVHPEOpH QDWLRQDOH VHUDLW GDXWDQW PLHX[ PLVH HQ
XYUH VL QRWUH $VVHPEOpH GLVSRVDLW GH GDYDQWDJH GH WHPSV HQWUH OH GpS{W HW
OH[DPHQ GHV DPHQGHPHQWV en particulier gouvernementaux, en commission
comme en sance publique.
Proposition n 8 Reconnatre au prsident de la commission saisie au fond le
droit GH[LJer la ralisation GXQHpWXGHGLPSDFWVXUOHVDPHQGHPHQWVTXDOLILpV
par ladite commission de substantiels .
II. AMNAGER LA PROCDURE LGISLATIVE POUR CONSOLIDER LA
QUALIT DE LA NORME

Pour reprendre la formule du prsident du Conseil conomique, social et


environnemental, M. Jean Paul Delevoye, rtablir la confiance dans le politique
et restaurer son crdit passe par une autre gestion du temps ( 3 ). &HVW
prcisment une nouvelle gestion du temps parlementaire que propose la mission
en prconisant de modifier les rgles rgissant le dpt des amendements
gouvernementaux, la procdure acclre et la discussion des textes budgtaires.
A. MIEUX ENCADRER
AMENDEMENTS.

LA

DISCUSSION

DES

TEXTES

ET

DES

1. Appliquer un dlai de dpt aux amendements du Gouvernement

(QOpWDWGXGURLWOHVDPHQGHPHQWVTXHGpSRVHOH*RXYHUQHPHQWORUVGH
OH[DPHQGHVWH[WHVHQFRPPLVVLRQHWHQVpDQFHSXEOLTXHQHVRQWVRXPLVjDXFXQ
dlai de dpt. (Q HIIHW ODUWLFOH  GH OD &RQVWitution prvoit que le droit
GDPHQGHPHQW GHV PHPEUHV GX 3DUOHPHQW HW GX *RXYHUQHPHQW VH[HUFH HQ
sance ou en commission selon les conditions fixes par les rglements des
assembles, dans le cadre dtermin par une loi organique 2UODUWLFOHGHOa
loi organique n 2009-403 du 15 avril 2009 UHODWLYH j ODSSOLFDWLRQ GHV DUWLFOHV
(1) Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDWOHPDL9RLUOHFRPSWH-rendu
en annexe n 16.
(2) Ce texte prvoit que les rglements des assembles peuvent dterminer les conditions dans lesquelles des
amendements des membres du Parlement, la demande de leur auteur, ou des amendements de la
FRPPLVVLRQ VDLVLH DX IRQG SHXYHQW IDLUH OREMHW G
XQH pYDOXDWLRQ SUpDODEOH FRPPXQLTXpH j ODVVHPEle
avant leur discussion en sance .
(3) Audition de M. Jean-Paul Delevoye, prsident du Conseil conomique, social et environnemental, le
15 mai 2014. Voir le compte-rendu en annexe n 16.

106

34-1, 39 et 44 de la Constitution dispose que, si les amendements des membres


GX 3DUOHPHQW FHVVHQW GrWUH UHFHYDEOHV DSUqV OH GpEXW GH OH[DPHQ GX WH[WH HQ
sance publique et si les rglements des assembles peuvent dterminer les
conditions dans lesquelles est fixe une date antrieure compter de laquelle ces
amendements ne sont plus recevables , DSUqV OH[SLUDWLRQ GH FHV GpODLV VRQW
seuls recevables les amendements dposs par le Gouvernement ou par la
commission saisie au fond .
(QFRQVpTXHQFHSRXUFHTXLFRQFHUQHOH[DPHQGHVWH[WHVHQFRPPLVVLRQ
ODUWLFOH  DOLQpD  GX 5qJOHPHQW GH O$VVHPEOpH QDWLRQDOH SUpFLVH TXH les
amendements autres que ceux du Gouvernement, du prsident et du rapporteur de
la commission et, le cas chant, des commissions saisies pour avis doivent tre
transmis par leurs auteurs au secrtariat de la commission au plus tard le
troisime jour ouvrable prcdant la date de dbut de lexamen du texte
17 heures, sauf dcision contraire du prsident de la commission .
(WSRXUFHTXLHVWGHOH[DPHQGHVWH[WHVHQVpDQFHSXEOLTXHODUWLFOH
DOLQpD  GX PrPH 5qJOHPHQW GLVSRVH TXDSUqV OH[SLUDWLRQ GX GpODL GH GpS{W
applicable aux amendements des dputs (17 heures, le troisime jour ouvrable
prcdant la date de dbut de la discussion du texte, sauf dcision contraire de la
Confrence des prsidents), sont seuls recevables les amendements dposs par
le Gouvernement ou la commission saisie au fond .
Comme notre collgue Jean-/XF :DUVPDQQ TXL D HVWLPp TXH FpWDLW
particulirement caricatural en matire fiscale , la mission trouve dsastreux
TXH ORQ SXLVVH GpSRVHU GHV DPHQGHPHQWV GH GHUQLqUH PLQXWH SRXU VH GLVSHQVHU
GXQHpWXGHGLPSDFW comme le permet notre lgislation (1).
/D PLVVLRQ D pWp SDUWLFXOLqUHPHQW PDUTXpH SDU OLQWHUYHQWLRQ GH ODQFLHQ
ministre dlgu au Budget, M. Alain Lambert, dsormais prsident du conseil
QDWLRQDOGpYDOXDWLRQGHVQRUPHVTXLDH[SOLTXplors de son audition avoir dj
vu des amendements apports tellement la dernire minute par un fonctionnaire
que cela revenait refuser au ministre >TXLO pWDLW@ GH OH OLUH DYDQW TXLO VRLW
appel . Selon lui, dans certains ministres, les directions gnrales ne se
SDUOHQWSDV$LQVLORUVTXXQDPHQGHPHQWHVWSURSRVpSDUODGLUHFWLRQGX7UpVRU
ses auteurs peuvent craindre que le ministre du Budget y voie une consquence
EXGJpWDLUHHWVRLWWHQWpGHQHOHGpIHQGUHTXHPROOHPHQW&HVWSRXUTXRLLOVne le
WUDQVPHWWHQWTXDXGHUQLHUPRPHQWQHODLVVDQWDXPLQLVWUHTXHODSRVVLELOLWpGHOH
SUpVHQWHU VDQV ODYRLU OX DXSDUDYDQW . Il a prcis que OH GpS{W GXQ
amendement la dernire minute peut aussi tre, pour le Gouvernement, un
PR\HQ GpYLWHU OH[DPHQ SDU OH &RQVHLO GeWDW , confirmant ainsi les propos du
professeur Nicolas Molfessis GDSUqVTXLLODUULYHTXH ODYRLHGHODPHQGHPHQW
[soit] LQVWUXPHQWDOLVpHSRXUIDLUHSDVVHUKRUVGHODYXHGX&RQVHLOGeWDWGHV
GLVSRVLWLRQVGRQWRQFUDLQWTXHOOHVSXLVVHQWIDLUHOREMHWGXQDYLVGpIDYRUDEOH .
(1) Audition de M. Jean-Luc Warsmann, dput, ancien prsident de la commission des Lois, le 1er juillet
2014. Voir le compte rendu en annexe n 16.

107

M. Alain Lambert a ajout TXLOOXLpWDLW GDLOOHXUVDUULYpGDQVXQHWHOOH


FLUFRQVWDQFHGH VRXIIOHU DX UDSSRUWHXUGHQH VXUWRXWSDVDGRSWHU ODPHQGHPHQW
en question, ou du moins de demander la rserve GHODUWLFOHFRQFHUQp (1).
Convaincue avec M. $ODLQ/DPEHUWTXLOIDXW discipliner la relation de
sance entre le Gouvernement et le Parlement et montrer que les parlementaires
ne sont pas des greffiers chargs de ratifier les dcisions des administrations
centrales , la mission FRQVLGqUHTXHOpYDOXDWLRQSUpDODEOHGHVFRQVpTXHQFHVGHV
DPHQGHPHQWVTXHOOHVRLWRXQRQIRUPDOLVpHGDQVXQHSURFpGXUHGpWXGHGLPSDFW
inspire des pratiques du Parlement europen, ne pourra tre oprationnelle et
fiable que si les amendements gouvernementaux sont soumis un dlai de dpt.
&HVW OD UDLVRQ SRXU ODTXHOOH la mission prconise de soumettre les
DPHQGHPHQWV JRXYHUQHPHQWDX[ j XQ GpODL GH GpS{W WDQW ORUV GH OH[DPHQ
des textes en commission que lors de leur examen en sance publique.
Proposition n 9 Soumettre les amendements du Gouvernement un dlai
de dpt.
&RQVFLHQWH GX GHJUp GH[LJHQFH TXH FRPSRUWH XQH WHOOH SURSRVLWLRQ j
OpJDUGGX*RXYHUQHPHQWODPLVVLRQHVWLPHFHSHQGDQWQpFHVVDLUHjODTXDOLWpGH
la SURGXFWLRQQRUPDWLYHTXHOexcutif se plie cette discipline. En effet, comme
OD UDSSHOp OH SURIHVVHXU 1LFRODV 0ROIHVVLV la loi de finances pour 2014 a
montr de faon symptomatique que les dispositions introduites par amendement
VH[SRVHQWdavantage une censure du Conseil constitutionnel .
Par ailleurs, votre rapporteur souligne que cet encadrement du droit
GDPHQGHPHQW GX *RXYHUQHPHQW HVW ORLQ GH FRQVWLWXHU XQH UHVWULFWLRQ DXVVL
radicale que celle adopte par plusieurs de nos voisins euURSpHQV 'DSUqV OHV
rponses fournies la mission par neuf des dix Parlements europens interrogs
SDU OLQWHUPpGLDLUH du Centre europen de recherche et de documentation
parlementaires (CERDP), en Allemagne, comme en Espagne et aux Pays-Bas, le
GouvernePHQWQDSDVOHdroit de dposer des amendements sur le texte issu des
travaux de la commission.
Qui plus est, le dlai de dpt qui pourrait tre appliqu aux
amendements gouvernementaux pourrait ne pas tre le mme que celui qui
HVW DXMRXUGKXL SUpYX j titre de principe pour les amendements
parlementaires (17 heures, le troisime jour ouvrable prcdant la date de dbut
de la discussion du texte en commission ou en sance publique).
+RVWLOH j OLGpH TXH OH GpODL GH GpS{W VRLW ULJRXUHXVHPHQW LGHQWLTXH SRur
les amendements gouvernementaux et parlementaires car, selon lui, le
Gouvernement, soumis de fortes pressions nationales, europennes et
(1) Audition de M. Alain Lambert, prsident du conseil national GpYDOXDWLRQGHVQRUPHV &&(1 HWDXWHXU
avec M Jean-Claude Boulard, du rapport de la mission de lutte FRQWUHOLQIODWLRQQRUPDWLYH PDUV , le
30 janvier 2014. Voir le compte-rendu en annexe n 16.

108

internationales , doit avoir les moyens de diriger le pays et doit donc pouvoir
prendre une initiative de GHUQLqUH PLQXWH j FRQGLWLRQ TXLO OD MXVWLILH notre
collgue Jean-/XF :DUVPDQQ D VXJJpUp ORUV GH VRQ DXGLWLRQ  G imposer une
pWXGHGLPSDFWHWHQFDVGHUHFRXUV >G@accorder un dlai de 24 heures telle ou
telle institution pour se prononcer sur cette tude , de sorte que cela obligerait
indirectement le Gouvernement respecter un certain dlai de dpt .
En toute hypothse, lDSSOLFDWLRQ GXQ GpODL GH GpS{W DX[ DPHQGHPHQWV
gouvernementaux impliquerait jWRXWOHPRLQVODPRGLILFDWLRQGHODUticle 13 de la
loi organique du 15 avril 2009 et des articles 86 et 99 du Rglement de
O$VVHPEOpH QDWLRQDOH DLQVL TXXQ DPpQDJHPHQW GH OD UpGDFWLRQ GH Oarticle
101 du mme Rglement, qui rgit la procdure de seconde dlibration.
Une meilleure gestion du temps parlementaire  FHVW DXVVL OH EXW GH OD
proposition que formule la mission au sujet de la procdure acclre.
2. Modifier la procdure acclre pour prserver un temps minimal
GH[DPHQSDUOHPHQWDLUH

&RPPHODQRWpOHYLFH-SUpVLGHQWGX&RQVHLOGeWat, M. Jean-Marc Sauv,


lors de son audition, le problme est que, dans notre pays, la production
normative, tous les niveaux de son laboration *RXYHUQHPHQW&RQVHLOGeWDW
et Parlement HVWPDUTXpHGXVFHDXGHOXUJHQFH .
Le Parlement ne compte plus les projets et propositions de loi pour
lesquels le Gouvernement engage la procdure acclre. Au 30 aot dernier,
notre Assemble avait dj examine en urgence 112 textes depuis le dbut de la
XIVe lgislature (84 projets de loi et 28 propositions de loi). Sous la
XIIIe lgislature, la procdure acclre fut engage pour 92 projets de loi et
23 propositions loi (soit 115 textes au total). Sous la XIIe lgislature, seuls
59 textes avaient t examins en urgence (tous des projets de loi) (1) soit prs de
GHX[IRLVPRLQVGHWH[WHVTXHQRWUH$VVHPEOpHQHQDH[DPLQpHQXUJHQFHGHSXLV
deux ans. En OHVSDFHGHWURLVOpJLVODWXUHVquelle que soit la majorit, le recours
ODSURFpGXUHDFFpOpUpHQDFHVVpGHFURvWUH
Pour tre parfois ncessaire, cette urgence est souvent excessive et
LQMXVWLILpH ORUVTXH SRXU UHSUHQGUH OHV PRWV HPSOR\pV SDU OH &RQVHLO GeWDW GDQV
VRQ UDSSRUW SXEOLF SRXU ODQQpH  OLPSRUWDQFH HW OD FRPSOH[LWp GH OD
UpIRUPH HQYLVDJpH QpFHVVLWHQW XQ H[DPHQ DSSURIRQGL RX ORUVTXH OXUgence
dclare est dmentie ultrieurement par le calendrier parlementaire ou par le
U\WKPHGHODSXEOLFDWLRQGXQWH[WHDXJournal officiel (2).
 FHW pJDUG OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ
des lois a fait tat, dans son RappRUWDQQXHOVXUODSSOLFDWLRQGHVORLV paru en juin
(1) 9RLU OH JUDSKLTXH PRQWUDQW OpYROXWLRQ GX QRPEUH GH SURFpGXUHV DFFpOpUpHV SDU VHVVLRQ GH OD ;, e la
XIVe OpJLVODWXUH MXVTXDXPDL ILJXUDQWHn annexe n 11.
(2) &RQVHLOGeWDW5DSSRUWSXEOLFS 94.

109

GHUQLHU G urgences gomtrie variable ( 1 ) constatant que la mise en


application des textes adopts VHORQODSURFpGXUHDFFpOpUpHQest en moyenne pas
plus rapide que celle des autres lois . Et notre collgue David Assouline de
VLQWHUURJHU : quoi bon imposer au Parlement des cadences rapides si
Ourgence invoque en amont bute, en aval, sur les dlais incompressibles ? La
UpDOLWp PRQWUH TXH OH[DPHQ GXQ SURMHW RX Gune proposition de loi selon la
SURFpGXUHDFFpOpUpHQest pas le gage de sa mise en application plus rapide aprs
promulgation (2).
'DQV VRQ UDSSRUW SXEOLF SRXU ODQQpH  OH &RQVHLO GeWDW fournit un
trs bon exemple illustrant la faon dont FHWWH XUJHQFH QRXUULW OLQIODWLRQ
normative/H&RQVHLOGeWDWH[SOLTXHHQHIIHWTXHVDLVLHQH[WUrPHXUJHQFHGHV
deux projets de dcret successifs portant relvement du plafond du Livret A (3) , au
SRLQW GH QDYRLU TXH TXDWUH MRXUV SRXU OHV H[DPLQHU DORUV TXLOV DYDLHQW pWp
annoncs loQJWHPSVDXSDUDYDQWHQFRQVHLOGHVPLQLVWUHV O diction de la norme
GDQV OXUJHQFH QD SDV SHUPLV SRXU FHV GHX[ GpFUHWV GH GpWHUPLQHU OHXU
DSSOLFDELOLWpXOWUDPDULQHGHVRUWHTXLODIDOOXpGLFWHUGHX[DXWUHVGpFUHWVjFHWWH
fin. Finalement, ce sont qXDWUH GpFUHWV TXL RQW pWp SULV DORUV TXXQ VHXO DXUDLW
suffi (4).
)DFHDXFRQVWDWGHODQRFLYLWpGHOXUJHQFHH[FHVVLYHVXUODTXDOLWpGH
la production normative, lD PLVVLRQ SUpFRQLVH GHQFDGUHU OD SURFpGXUH
DFFpOpUpHSRXUSUpVHUYHUXQWHPSVPLQLPDOGH[amen parlementaire. Comme
OD GLW GHYDQW OD PLVVLRQ QRWUH FROOqJXH 'DYLG $VVRXOLQH SUpVLGHQW GH OD
FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV le travail
OpJLVODWLISDUFHTXLOWLHQWFRPSWHGHFHUWDLQHVH[LJHQFHVGpPRFUDWLTXHVQe peut
SDVVDFFpOpUHUDX-del de certaines limites .
En vertu des articles 45 et 42 de la Constitution, le recours la procdure
acclre a deux consquences :
WRXWGDERUGLOSHUPHWGHUpXQLUXQHFRPPLVVLRQPL[WHSDULWDLUHFKDUJpH
de proposer un texte sur les dispositions restant en discussion aprs une seule
lecture dans chaque assemble alors que, dans le cadre de la procdure
OpJLVODWLYH RUGLQDLUH OD UpXQLRQ GXQH WHOOH FRPPLVVLRQ QHVW SRVVLEOH TXDSUqV
deux lectures dans chaque assemble ;
HQVXLWHLOSHUPHWGHVDIIUDQFKLUGHVGpODLVPLQLPDX[HQWUHOHGpS{WGXQ
texte et son examen en sance publique qui sont prvus, en premire lecture, dans
OH FDGUH GH OD SURFpGXUH OpJLVODWLYH RUGLQDLUH VL[ VHPDLQHV HQWUH OH GpS{W GXQ
texte et sa discussion en sance publique devant la premire assemble saisie ;
(1) 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ des lois, par le
snateur David Assouline, 17 juin 2014, p. 42.
(2) Ibidem, p. 8.
(3) ,OVDJLWGHVGpFUHWVQ 2012-1056 du 18 septembre 2012 et n 2012-1445 du 24 dcembre 2012.
(4) &RQVHLOGeWDW5DSSRUWSXEOLFS 178.

110

TXDWUH VHPDLQHV HQWUH OD WUDQVPLVVLRQ GXQ WH[WH HW VD GLVFXVVLRQ HQ VpDQFH
publique devant la seconde assemble saisie).
Si les Confrences des prsidents des deux assembles ont la facult de
VRSSRVHUFRQMRLQWHPHQWDXUHFRXUVjODSURFpGXUHDFFpOpUpHSRXUOH[DPHQGXQ
projet de loi ordinaire, le recours cette procdure est en revanche de droit
pour les projets de loi de finances et de financement de la scurit sociale ainsi
que pour les projets de loi relatifs aux tats de crise.
6DQVUHPHWWUHHQFDXVHFHSULQFLSHLOSRXUUDLWrWUHFRQFHYDEOHGDPpQDJHU
les rgles relatives la procdure acclre pour prserver un temps minimal
GH[DPHQ SDUOHPHQWDLUH 9RWUH UDSSRUWHXU QRWH TXH FHVW GDLOOHXUV FH TXL D pWp
SUpYXSRXUOHVORLVRUJDQLTXHVSXLVTXHQDSSOLFDWLRQGHODUWLFOHDOLQpDGHOD
Constitution, si la procdure acclre a t engage pour un projet ou une
proposition de loi organique, le texte ne peut tre soumis la dlibration de la
SUHPLqUHDVVHPEOpHVDLVLHDYDQWOH[SLUDWLRQGXQGpODLGHTXLQ]HMRXUVDSUqVVRQ
dpt .
Suivant cet exemple, on pourrait fort bien imaginer une modification des
dispositions constitutionnelles rgissant la procdure acclre de faon ce
que soient prservs des dlais minimaux (par exemple, de six ou trois semaines
HQWUHOHGpS{WGXQWH[WHHWVDGLVFXVVLRQGHYDQWODSUHPLqUHDVVHPEOpHVDLVLHHWGH
TXDWUHRXGHX[VHPDLQHVHQWUHODWUDQVPLVVLRQGXQWH[WHHWVDGLVFXVVLRQGHYDQWOD
seFRQGH DVVHPEOpH VDLVLH  QRQREVWDQW ODEVHQFH GH VHFRQGH OHFWXUH GDQV FKDTXH
assemble.
Proposition n 10 Modifier la procdure acclre pour prserver un dlai
PLQLPDOHQWUHOHGpS{WGXQWH[WHHWVDGLVFXVVLRQGHYDQWFKDTXHDVVHPEOpH
3. Repenser ORUJDQLVDWLRQ GHV GpEDWV EXGJpWDLUHV HQ OHV UHFHQWUDQW VXU
la loi de rglement.

&HVWWRXMRXUVOHVRXFLGXQHPHLOOHXUHJHVWLRQGXWHPSVSDUOHPHQWDLUHTXL
SUpVLGH j OD SURSRVLWLRQ TXH IDLW OD PLVVLRQ HQ PDWLqUH Gexamen des textes
budgtaires.
Comme le Premier prsident de la Cour des comptes, M. Didier Migaud,
votre rapporteur est tonn du contraste entre les semaines entires qui sont
FRQVDFUpHV j OH[DPHQ GH OD ORL GH ILQDQFHV LQLWLDOH pour la modification de
laquelle les parlementaires disposent au ILQDOGHIDLEOHVPDUJHVGHPDQXYUH et
OHVTXHOTXHVUDUHVKHXUHVTXLVRQWSUpYXHVSRXUOH[DPHQGHODORLGHUqJOHPHQW
DORUVTXHFRPPHODGLW0 Didier Migaud, FHVWVRXYHQWjSDUWLUGHOH[pFXWLRQ
GXQHORLGHILQDQFHVRXGXQHSROLWLTXHSXEOLTXHTXHORQSHXWVHUHQGUHFRPSWH
GH G\VIRQFWLRQQHPHQWV GH IDLOOHV RX GLQVXIILVDQFHV ( 1 ). Selon le Premier
prsident de la Cour des comptes, alors que dans tous les pays du monde, les
(1) Audition de M. Didier Migaud, Premier prsident de la Cour des comptes, le 30 avril 2014. Voir le
compte-rendu en annexe n 16.

111

SDUOHPHQWDLUHV FRQVDFUHQW EHDXFRXS SOXV GH WHPSV j OH[pFXWLRQ EXGJpWaire


TXDX[ ORLV GH ILQDQFHV LQLWLDOHV TXL VRQW GDLOOHXUV VRXYHQW GHV ORLV
GDIILFKDJH , HQ)UDQFHQRXVIDLVRQVOLQYHUVH .
Ce problme culturel (1) D pJDOHPHQW pWp SRLQWp SDU ODQFLHQ PLQLVWUH
dlgu au Budget, M. Alain Lambert, prsident du FRQVHLOQDWLRQDOGpYDOXDWLRQ
GHV QRUPHV TXL D GpFODUp QH SDV FRPSUHQGUH OHQWrWHPHQW GX 3DUOHPHQW j
consacrer trois semaines au projet de loi de finances, alors que pas une virgule
Q\ HVW FKDQJpH  /XL DXVVL HVW GDYLV TX il faudrait y consacrer trois jours,
contre trois semaines la loi de rglement (2).
La rpartition du temps parlementaire consacr aux dbats budgtaires
pourrait en effet tre plus quilibre et plus efficiente.
9RWUHUDSSRUWHXUDGDLOOHXUVIDLWGHVSURSRVLWLRQVHQFHVHQVDu Prsident
GH O$VVHPEOpH QDWLRQDOH 0 Claude Bartolone. En collaboration avec notre
collgue Franois Cornut-*HQWLOOH YRWUH UDSSRUWHXU D UHPLV ODQ SDVVp j
M. Claude Bartolone un rapport dcrivant plusieurs scnarios de rforme possibles
pour faire pURJUHVVHUOHWUDYDLOSDUOHPHQWDLUHGpYDOXDWLRQGHODFWLRQSXEOLTXH
jORFFDVLRQGHOH[DPHQGXSURMHWGHORLGHUqJOHPHQW (3).
&RPPHYRWUHUDSSRUWHXUODVRXOLJQpGDQVFHUDSSRUWOH[DPHQGHVFUpGLWV
budgtaires est source de frustrations pour les dputs : ODQDO\VHGHVGRFXPHQWV
budgtaires joints au projet de loi de finances (projets annuels de performances,
annexes gnrales et documents de politique transversale) se fait dans des dlais si
contraints que, parfois, les informations sont transmises aux dputs aprs la
GLVFXVVLRQHQFRPPLVVLRQ3DUDLOOHXUVOH[DPHQGHVFUpGLWVGHODVHFRQGHSDUWLH
GXSURMHWGHORLGHILQDQFHVWDQWHQFRPPLVVLRQVpODUJLHVTXHQVpDQFHSXEOLTXH
UHVVHPEOHSOXVjXQHVXFFHVVLRQGHPRQRORJXHVTXjXQYpULWDEOHGpEDWGe fond.
'HVRQF{WpOH[DPHQWUqVUDSLGHGXSURMHWGHORLGHUqJOHPHQWUHVWHXQ
exercice trs formel dans la mesure o le texte est peu amendable sur le fond
TXLQHSHUPHWSDVGDSSUpKHQGHUGHPDQLqUHHIILFLHQWHODPSOHXUGHVPRXYHPHQWV
de crdits cRQVWDWpVHQFRXUVGDQQpHQLOHVUpVXOWDWVGHOH[pFXWLRQEXGJpWDLUHDX
travers des rapports annuels de performances. Le dbat sur le projet de loi de
rglement ne mobilise gure les commissions permanentes autres que celle des
Finances : seuls le rapporteur gnral et les rapporteurs spciaux produisent un
rapport sur ce texte.
Face ce constat, votre rapporteur et notre collgue Franois
Cornut-*HQWLOOH RQW SURSRVp TXDWUH SLVWHV GH UpIRUPH VXVFHSWLEOHV GpULJHU
(1) Idem.
(2) Audition de M. Alain Lambert, prsident du conseil national GpYDOXDWLRQGHVQRUPHV &&(1 HWDXWHXU
avec M Jean-Claude Boulard, du UDSSRUWGHODPLVVLRQGHOXWWHFRQWUHOLQIODWLRQQRUPDWLYH PDUV , le
30 janvier 2014. Voir le compte-rendu en annexe n 16.
(3) La synthse de ce rapport est consultable au lien suivant : http://www.juanico.fr/wpcontent/uploads/2008/08/Projet-de-loi-de-r%C3%A9glement.pdf

112

OH[DPHQGX SURMHW GH ORL GH UqJOHPHQW HQ WHPSV IRUW GH OpYDOXDWLRQ GH ODFWLRQ
publique et des travaux entrepris pour la modernisation de celle-ci (1).
3DUPL OHV GLIIpUHQWHV RSWLRQV VRXPLVHV DX 3UpVLGHQW GH O$VVHPEOpH
QDWLRQDOH LO D pWp VXJJpUp GH FUpHU GHV PLVVLRQV GLQIRUPDWLRQ FRPPXQHV j la
commission des Finances et aux commissions permanentes comptentes
SDUDOOqOHPHQWjODUpDOLVDWLRQSDUOHUDSSRUWHXUJpQpUDOGXQUDSSRUWOpJLVODWLIHW
SDUOHVUDSSRUWHXUVVSpFLDX[GHQRWHVGpYDOXDWLRQ/H[DPHQGXSURMHWGHORLGH
rglement serait ainsi complt par un dbat, en sance publique, sur les rapports
GHV PLVVLRQV GLQIRUPDWLRQ FRPPXQHV ORUV GXQH VHPDLQH GH FRQWU{OH IL[pH j OD
ILQ GX PRLV GH MXLQ &H GpEDW VXU OHV UDSSRUWV GLQIRUPDWLRQ SURGXLWV SDU GHV
binmes associant dputs de la mDMRULWp HW GH ORSSRVLWLRQ DXUDLW ODYDQWDJH GH
confrer un contenu utile cette semaine de contrle.
Proposition n 11 5HSHQVHU ORUJDQLVDWLRQ GHV GpEDWV EXGJpWDLUHV de faon
IDLUH GH OD ORL GH UqJOHPHQW XQ PRPHQW IRUW GpYDOXDWLRQ QRWDPPHQW GH OD
PRGHUQLVDWLRQGHODFWLRQSXEOLTXH
B. ADOPTER UNE MTHODE DE TRANSPOSITION DES DIRECTIVES
EUROPENNES SUSCEPTIBLE DE LIMITER LES RISQUES DE
SURTRANSPOSITIONS INUTILES.

La rflexion mene par la mission sur la gestion du temps parlementaire


VHVW pWHQGXH DX WHPSV TXH QRV DVVHPEOpHV FRQVDFUHQW j OH[DPHQ GH WH[WHV
lgislatifs pris pour la transposition de directives europennes, et donc la
PpWKRGHMXVTXLFLUHWHQXHHQODPDWLqUH
Longtemps, QRWUH SD\V D pWp SRLQWp GX GRLJW SRXU OH UHWDUG TXLO DYDLW
accumul en matire de transposition des directives europennes. Si nos
SHUIRUPDQFHVUHVWHQWSHUIHFWLEOHVFHVFULWLTXHVQRQWSOXVOLHXGrWUHDXMRXUGKXL :
ainsi que le notait le secrtaire gnral du Gouvernement, M. Serge Lasvignes,
la France a ralis de JUDQGVSURJUqVHQWHUPHVTXDQWLWDWLIVOKHXUHDFWXHOOH
le dficit de transposition se situe entre 0,4 et 0,6 %, ce qui nous situe une bonne
place dans le palmars europen (2). 'DSUqVOHVLQIRUPDWLRQVTXHODPLVVLRQD
pu obtenir du secrtariat gnral des Affaires europennes (SGAE), le dficit de
transposition des directives europennes tait en effet de 0,6 % en 2013, contre
1 % en 2011.
Selon M. Serge Lasvignes, les administrations franaises sont dsormais
confrontes double dfi : celui Gviter les phnomnes de

(1) Voir le tableau de synthse de ces scnarios de rforme, figurant en annexe n 12.
(2) Audition de M. Serge Lasvignes, secrtaire gnral du Gouvernement, et de M. Thierry-Xavier Girardot,
directeur, adjoint au secrtaire gnral du Gouvernement, le 19 fvrier 2014. Voir le compte-rendu en
annexe n 16.

113

surtransposition (1) et celui de mieux DQWLFLSHU OLPSDFW GH OD Girective sur le
droit national. Ces deux enjeux sont lis car, souvent, le Gouvernement justifie les
PHVXUHVGHVXUWUDQVSRVLWLRQTXLOSURSRVHSDUXQLQWpUrWJpQpUDOTXLOQDSDVIDLW
(ou pas suffisamment fait) valoir et/ou identifi au moment des ngociations des
textes au niveau europen, de sorte que nos entreprises finissent par tre soumises
j GHV UqJOHVTXLSHXYHQW rWUH WRXW j IDLW OpJLWLPHV HW PrPH GRQQHU GH ODYDQFH j
notre conomie en anticipant les futures normes europennes, mais qui, en
attendant, nuisent leur comptitivit (2) .
&HVW SUpFLVpPHQW FH GRXEOH GpIL que la mission propose de relever en
IRUPXODQW GHV SURSRVLWLRQV SRXU SODFHU OpWXGH GLPSDFW GDYDQWDJH DX FXU GHV
ngociations et pour mieux contrler les surtranspositions.
1. La propension franaise transposer au-del de ce qui est utile et
ncessaire.

Une riche tude de M. Yves Bertoncini sur les normes europennes


publie en mai dernier a montr que, contrairement jFHTXHORQSUpWHQGVRXYHQW
seul un quart des directives transposes en France comporte une dimension
lgislative, contre trois quart une dimension purement rglementaire (3).
En effet, sur la priode 2000-2010, la proportion de directives
WUDQVSRVpHVDXPR\HQGDXPRLQVXQDFWHGHQDWXUHOpJLVODWLYHVHVWpWDEOLHj
23,8 % du nombre total de directives (soit 236 directives sur 993) (4).
&HODFRUUHVSRQGGDLOOHXUVDX[GRQQpHVIRXUQLHVGDQVOHGuide de bonnes
pratiques concernant la transposition des directives europennes tabli par le
secrtariat gnral des Affaires europennes (SGAE). Ce guide indique en effet
que les textes de transposition de nature lgislative concernent environ 20 % des
mesures de transposition (5) HWTX environ 80 % des dispositions des directives
sont transposes en France par voie rglementaire uniquement (6).
&HV SRXUFHQWDJHV QRQW SDV FRQQX GpYROXWLRQ Pajeure sur la priode
2010-'DSUqVOHVLQGLFDWLRQVWUDQVPLVHVjODPLVVLRQSDUOH6*$(HQ
(1) &HWHUPHGpVLJQHOHVPHVXUHVOpJLVODWLYHVHWUpJOHPHQWDLUHVQDWLRQDOHVTXLVRXVFRXYHUWGrWUHSULVHVSRXU
la transposition de directives europennes, vont au-del des exigences de ces dernires. Cette pratique est
connue en anglais sous le nom de gold-plating .
(2) Voir, en annexe n 16, le compte-UHQGX GH ODXGLWLRQ OH er juillet 2014, de notre collgue Jean-Luc
:DUVPDQQTXLVHVWH[SULPp ainsi : MDLWUDYDLOOpVXUGHVORLVGHVLPSOLILFDWLRQHWMDLUHPDUTXpTXHGDQV
le domaine agricole, nous tions systmatiquement en situation de surtransposition. Je pense, par exemple,
DX[ VHXLOV GDXWRULVDWLRQ SRXU OHV SRXODLOOHUV 6L FHV VHXLOV FRUUHVSRQGHQW j OLQWpUrW JpQpUDO SRXUTXRL OH
*RXYHUQHPHQW QLQWHUYLHQW-il pas lui-mme, au niveau europen, au moment de la ngociation des
directives plutt que de nous amener voter, au niveau franais, dans tel ou tel sens ? Dans ce cas, nous
nuisons notre comptitivit sans, en plus, en tre informs .
(3) Yves Bertoncini, /8(HWVHVQRUPHV : prison des peuples ou cages poules ? , Notre Europe, Institut
Jacques Delors, Policy paper n 112, 16 mai 2014, p. 1.
(4) Ibidem, p. 13. Voir le tableau n 1 figurant en annexe n 13.
(5) SGAE, Guide de bonnes pratiques concernant la transposition des directives europennes, p. 9.
(6) Ibidem, p. 11.

114

la France a notifi la Commission europenne 273 mesures de transposition,


dont 59 taient de nature lgislative.  WLWUH GH FRPSDUDLVRQ GDSUqV OHV
informations fournies la mission par trois des dix Parlements europens
LQWHUURJpV SDU OLQWHUPpGLDLUH GX Centre europen de recherche et de
documentation parlementaires (CERDP), le Danemark, le Royaume-Uni et la
Sude ont, en 2011, notifi respectivement 37, 25 et 86 mesures de transposition
de nature lgislative.
Dans la mesure o certaines lois franaises comportaient plusieurs articles
transposant plusieurs directives ou habilitant le Gouvernement lgifrer par voie
GRUGRQQDQFHV SRXU WUDQVSRVHU plusieurs directives, ce sont au final seulement 8
lois et 9 ordonnances qui, en 2011, ont t adoptes aux fins de transposition des
directives europennes. Autrement dit, seuls 6 % des 122 lois et 21 % des 42
ordonnances adoptes en France en 2011 transSRVDLHQW WRXW RX SDUWLH GXQH
directive europenne.
En 2012, la France a notifi la Commission europenne 191 mesures de
transposition, dont 23 taient de nature lgislative. DDSUqV OHV LQIRUPDWLRQV
fournies la mission par trois des dix Parlements europens interrogs par
OLQWHUPpGLDLUH GX CERDP, le Danemark, le Royaume-Uni et la Sude ont, en
2012, notifi respectivement 42, 23 et 61 mesures de transposition de nature
lgislative.
Seules 3 des 92 lois adoptes en France en 2012 transposaient des
directives (soit 3 % du nombre total de lois adoptes). Et seules 5 des 40
ordonnances adoptes en France en 2012 ont t prises pour la transposition de
directives (soit 13 GXQRPEUHWRWDOGRUGRQQDQFHVDGRSWpHV 
Enfin, en 2013, la France a notifi 176 mesures de transposition, dont
52 de nature lgislative. DDSUqV OHV LQIRUPDWLRQV IRXUQLHV j OD PLVVLRQ SDU WURLV
GHV GL[ 3DUOHPHQWV HXURSpHQV LQWHUURJpV SDU OLQWHUPpGLDLUH GX &(5'3 OH
Danemark, le Royaume-Uni et la Sude ont, en 2013, notifi respectivement 42,
33 et 67 mesures de transposition de nature lgislative.
En France, en 2013, 8 des 95 lois adoptes (soit environ 8 % du nombre
total de lois) et 3 des 25 ordonnances adoptes (soit 12 % du nombre total
GRUGRQQDQFHV WUDQVSRVDLHQWGHVGLUHFWLYHV
Au final, en France, sur les trois dernires annes, le rapport entre les
mesures lgislatives de transposition notifies et le nombre de lois et
ordonnances adoptes GDQV ODQQpH HVW GH  % en 2011, 17 % en 2012 et
15 % en 2013, soit 22 % en moyenne.
6il est vrai que OHXURSpDQLVDWLRQ GHV ORLV QDWLRQDOHV HVW LPSRUWDQWH
GDQVTXHOTXHVVHFWHXUV DJULFXOWXUHVHUYLFHVILQDQFLHUVHQYLURQQHPHQW HWWUqV

115

UpGXLWHGDQVGDXWUHV pGXFDWLRQSURWHFWLRQVRFLDOHORJHPHQWVpFXULWpHWF (1),


notre pays se situe nanmoins GDQVODPR\HQQHHXURSpHQQHFDUGDSUqV0 Yves
Bertoncini, toutes les tudes disponibles convergent vers une proportion de lois
QDWLRQDOHV GRULJLQH FRPPXQDXWDLUH RVFLOODQW HQWUH  % et un tiers selon les
pays (2) et plus prcisment entre 11,8 % en Finlande (ou encore 12,3 % aux
Pays-Bas) et 35 % en Espagne (3).
6L OLGpH VHORQ ODTXHOOH 80 % de nos lois viennent de Bruxelles
relve donc davantage du mythe que de la ralit, la tendance des pouvoirs
lgislatif et excutif franais transposer au-del de ce qui est utile et
ncessaire est, elle, bien relle.
Votre rapporteur ne citera que deux exemples, auxquels a GDLOOHXUV
remdi depuis une loi de simplification (4).
DEUX EXEM PLES DE SURTRANSPOSI TI ONS
Le dispositif de la directive 2005/60/CE du Parlement europen et du Conseil du 26 octobre
200UHODWLYHjODSUpYHQWLRQGHOutilisation du systme financier aux fins du blanchiment de
capitaux et du financement du terrorisme QDYDLWYRFDWLRQjVDSSOLTXHUSRXUOHVHFWHXUGHV
DVVXUDQFHV TXDX[ HQWUHSULVHV GDVVXUDQFH-YLH 2U OD )UDQFH D pWp OH VHXO SD\V GH O8QLRQ
HXURSpHQQH j HQ DYRLU pWHQGX ODSSOLFDWLRQ DX[ HQWUHSULVHV GDVVXUDQFH GH dommages. Ces
HQWUHSULVHV VH WURXYDLHQW GRQF GDQV OREOLJDWLRQ GDGRSWHU GHV PHVXUHV GH YLJLODQFH GqV
OHQWUpH HQ UHODWLRQ GDIIDLUHV DYHF OH FOLHQW DORUV PrPH TXH OHV DVVXUDQFHV GH GRPPDJHV
tant rgies par le principe indemnitaire, le risque de blanchiment pour ce type de garanties
ne peut tre dtect lors de la souscription du contrat, mais seulement lors de la phase de
UqJOHPHQW GX VLQLVWUH ,O D IDOOX TXH OHV SDUOHPHQWDLUHV VHPSDUHQW GX VXMHW SRXU TXH VRLW
instaur un rgime simplifi et adapt aux VSpFLILFLWpVGHODVVXUDQFHGHGRPPDJHVHQSKDVH
de souscription du contrat. Sans entamer en aucune faon le dispositif anti-blanchiment, ni
UHPHWWUHHQFDXVHOHVPHVXUHVGHYLJLODQFHSULVHVORUVGHODSKDVHGLQGHPQLVDWLRQTXLHVWOD
seule susceptible de donner lieu la dtection de fraudes motives par le blanchiment,
ODUWLFOH  GH OD ORL GX  PDUV  D OLEpUp TXHOTXH  000 entreprises franaises
GDVVXUDQFH GH GRPPDJHV dont la plupart sont de petite taille ou des professionnels
indpendants de procdures lourdes, complexes et inutiles au regard des objectifs de lutte
contre le blanchiment des capitaux (5).
/DUWLFOHGHODPrPHORLDUHOHYpGH 000 15 000 euros le seuil compter duquel les
PDUFKpVSXEOLFVGRLYHQWIDLUHOREMHWGXQHSURcdure formalise de publicit et de mise en
concurrence pralables. Le seuil de 4 000 HXURVMXVTXDORUVUHWHQXHQ)UDQFHSDUDLVVDLWWUqV
EDVDXUHJDUGGHODUpJOHPHQWDWLRQDSSOLFDEOHDXVHLQGHO8QLRQHXURSpHQQHOH[FHSWLRQ
de Chypre ou encore de la LLWXDQLHOLPPHQVH PDMRULWpGHVeWDWV PHPEUHVDYDLHQWUHWHQX

(1) <YHV%HUWRQFLQL/8(HWVHVQRUPHVSULVRQGHVSHXSOHVRXFDJHVjSRXOHV" Notre Europe, Institut


Jacques Delors, Policy paper n 112, 16 mai 2014, p. 1. Voir le tableau n 2 figurant en annexe n 13.
(2) Ibidem, p. 1.
(3) Voir le tableau n 3 figurant en annexe n 13.
(4) Loi n 2012- GX  PDUV  UHODWLYH j OD VLPSOLILFDWLRQ GX GURLW HW j ODOOpJHPHQt des dmarches
administratives.
(5) Rapport n 3787 fait au nom de la commissions de Lois sur la proposition de loi (n 3706) relative la
VLPSOLILFDWLRQ GX GURLW HW j ODOOqJHPHQW GHV GpPDUFKHV DGPLQLVWUDWLYHV SDU OH GpSXWp eWLHQQH %ODQF
pp. 288 et s.

116

des seuils sensiblement plus levs que le seuil franais de 4 000 euros : 14 000 euros en
Pologne, 15 000 euros en Roumanie, 40 000 ou 60  HXURV HQ $XWULFKH VHORQ TXLO
VDJLVVDLWGXVHFWHXU classique ou des secteurs spciaux ), 15 000 ou 100 000 euros en
)LQODQGH VHORQTXLOVDJLVVDLWGHVPDUFKpVGHIRXUQLWXUHVHWVHUYLFHVRXGHWUDYDX[  000
ou 40 HXURVHQ,WDOLH VHORQTXLOVDJLVVDLWGHVPDUFKpVGHIRXUQLWXUHVHWVHUYLFHV ou de
travaux). La Commission europenne elle-mme avait fix un seuil 10 000 euros pour la
passation de ses propres marchs. L encore, comme le notait notre collgue Jean-Luc
Warsmann devant la mission, il a fallu que lHV SDUOHPHQWDLUHV VLQYHVWLVVHQW Dvec tnacit
pour que le seuil compter duquel les marchs publics sont soumis une procdure de
publicit et de mise en concurrence pralables soit fix un niveau harmonis avec celui des
VHXLOVSUDWLTXpVSDUODSOXSDUWGHVSD\VPHPEUHVGHO8QLRQHXropenne. Ce relvement du
VHXLO UHSUpVHQWDLW XQ HQMHX pFRQRPLTXH LPSRUWDQW SRXU ODFFqV GHV SHWLWHV HW PR\HQQHV
entreprises la commande publique, qui reprsente chaque anne environ 150 milliards
GHXURV (1).

&HVGHX[H[HPSOHVLOOXVWUHQWODPSOHXUGHVLmplications conomiques que


peuvent avoir les surtranspositions inutiles des directives europennes. Nos
YRLVLQV DOOHPDQGV ORQW ELHQ FRPSULV HX[ TXL PHWWHQW SDUIRLV HQ XYUH XQH
mthode de transposition en deux temps susceptible de limiter les
surtranspositions.
2. La mthode de la transposition en deux temps (ou double
corbeille ).

/$OOHPDJQH D DGRSWp SRXU OD WUDQVSRVLWLRQ GH FHUWDLQHV GLUHFWLYHV XQH


mthode que la doctrine allemande, et plus prcisment le professeur Thomas
Dreier, a qualifi de double corbeille (2).
Cet auteur explique que, pour la transposition de la directive 2001/29/CE
GX 3DUOHPHQW HXURSpHQ HW GX &RQVHLO GX  PDL  VXU OKDUPRQLVDWLRQ GH
FHUWDLQV DVSHFWV GX GURLW GDXWHXU HW GHV GURLWV YRLVLQV GDQV OD VRFLpWp GH
OLQIRUPDWLRQ GLWH directive DADVSI ), le lgislateur allemand a t raliste
MXVTXj XQ FHUWDLQ SRLQW HW D WUDQVSRVp FH TXLO IDOODLW WUDQVSRVHU SRXU rWUH HQ
conformit avec la directive. Toutes les autres questions, destines rnover et
rformeU HQ SURIRQGHXU OH GURLW GDXWHXU HQ YXH GH Oadapter aux exigences du
QXPpULTXHHWGHVUpVHDX[RQWpWpUHSRUWpHVjFHTXRQDSSHOOHXQGHX[LqPHYROHW
RXHQFRUHXQHGHX[LqPHFRUEHLOOH.
Pour la premire corbeille , la stratgie choisie a t celle de
transposer la directive telle quelle. On a emprunt le langage de la directive l o
LOQ\DYDLWSDVHQFRUHGHGLVSRVLWLRQVSUpFLVHVGDQVODORLDOOHPDQGHQRWDPPHQW
HQFHTXLFRQFHUQHOHVPHVXUHVWHFKQLTXHVGHSURWHFWLRQHQGDXWUHVWHUPHV [on
retrouve], GDQVOHWH[WHDOOHPDQGWRXWHVOHVTXHVWLRQVGLQWHUSUpWDWLRQTXRQSHXW
se poser vis--vis du texte de la directive . Cette transposition verbatim ou
(1) Ibidem, pp. 416 et s.
(2) 7K'UHLHUSURIHVVHXUjO8QLYHUVLWpGH.DUOVUXKH/DVLWXDWLRQHQ$OOHPDJQHGH la transposition de la
GLUHFWLYH VXU OH GURLW GDXWHXU HW OHV GURLWV YRLVLQV GDQV OD VRFLpWp GH OLQIRUPDWLRQ  3URSULpWpV
intellectuelles, avril 2005, n 15, pp. 124 et s.

117

plat  D SHUPLV GLQWURGXLUH OD GLUHFWLYH GDQV ORUGUH LQWHUQH GDQV OHV GpODLV
impartis.
Pour la deuxime corbeille , un grand dbat a t organis, des groupes
de travail ont t mis en place et une douzaine de commissions ont t institues
pour traiter chacun des pans du droit allemand de la proprit intellectuelle
affects par la directive europenne : systme de rmunration pour copie prive,
copie prive numrique, situation des radiodiffuseurs, rforme du droit de prt,
etc. Des rapports ont t produits par ces commissions, sur le fondement desquels
un avant-projet de loi proposant une rforme globale de la matire a t prpar et
soumis la discussion, avant que ne soit arrt un projet de loi longuement discut
par le Parlement.
Dans sa thse de doctorat sur la Mthode de transposition des directives
communautaires : tude partir GH OH[HPSOH GX GURLW GDXWHXU HW GHV GURLWV
voisins (1), la professeure Clia =RO\QVNLSURSRVHGDGDSWHU OHSURFHVVXV OpJLVODWLI
IUDQoDLVGHWUDQVSRVLWLRQGHVGLUHFWLYHVHQVLQVSLUDQWGHOH[HPSOHDOOHPDQG et en
procdant en deux temps. Le premier temps serait consacr une transposition
verbatim GHV GLVSRVLWLRQV GHV GLUHFWLYHV D\DQW XQ REMHFWLI GKDUPRQLVDWLRQ
maximale. Pour la transposition des dispositions communautaires poursuivant
une harmonisation a maxima, i.e. dont le contenu normatif prcis te toute marge
GH PDQXYUH j OeWDW PHPEUH ORUV GH VD PLVH HQ XYUH , le professeur Clia
=RO\QVNLVXJJqUHTX aucune disposition substantielle ne [fasse] OREMHWGHGpEDW
LQWHUPLQLVWpULHO ORUV GH OD UpGDFWLRQ GH ODYDQW-projet de loi ni de dbat
parlemenWDLUH ORUV GH OH[DPHQ GX SURMHW GH ORL GHYDQW OH 3DUOHPHQW (2). Sans
IDLUH GH ORUGRQQDQFH OLQVWUXPHQW GH WUDQVSRVLWLRQ GH GURLW FRPPXQ ODXWHXU
souligne que celle-ci prsente un double intrt :
GXQH SDUW HOOH SHUPHW GDFFpOpUHU OH SURFHVVXV Ge transposition en
vitant les retards dus aux dbats parlementaires ;
GDXWUH SDUW ORUGRQQDQFH DVVXUH XQH SOHLQH DSSOLFDWLRQ GH OD
directive, et, partant, le respect des oEOLJDWLRQV FRPPXQDXWDLUHV GH Oetat
membre, en procdant une WUDQVSRVLWLRQ j SODW LH HQ UHSUHQDQW OH WH[WH
FRPPXQDXWDLUHHQOpWDW (3).
Le second temps serait dvolu une transposition toffe des dispositions
GHV GLUHFWLYHV D\DQW XQ REMHFWLI GKDUPRQLVDWLRQ PLQLPDOH Pour la transposition
des dispositions ralisant une harmonisation a minima, appelant un complment
normatif de la part des tats membres qui demeurent libres de dterminer les
PR\HQV OHV SOXV SHUWLQHQWV DILQ GH UpDOLVHU OREMHFWLI SUHVFULW SDU OD QRUPH
communautaire de nature tlologique ( 4 ), Mme Clia Zolynski prconise
(1) C. Zolynski, Mthode de transposition des directives communautaires : tude jSDUWLUGHOH[HPSOHGXGURLW
GDXWHXUHWGHVGURLWVYRLVLQV, 2007, d. Dalloz, coll. Nouvelle bibliothque de thses, pp. 328-340.
(2) Ibidem, p. 328.
(3) Ibidem, p. 331.
(4) Ibidem, p. 329.

118

TXXQHQRXYHOOHORLSURORQJHODSUHPLqUHDILQGHODFRPSOpWHU Les dispositions


GRQW OKDUPRQLVDWLRQ QHVW TXH IDFXOWDWLYH HW TXL IRQW OREMHW GH GpEDWV SHXYHQW
alors tre examines - tant prcis que ces dispositions sont bien souvent
FHOOHVVXUOHVTXHOOHVDXFXQDFFRUGQDSXrWUHWURXYpORUVGHODGRSWLRQGXWH[WH
communautaire (1).
En somme, les dispositions poursuivant une harmonisation a maxima
pourraient tre transposes par ordonnance. Au-del, on doit exclure ce mode de
WUDQVSRVLWLRQHQFHTXLFRQFHUQHOHVGLVSRVLWLRQVODLVVDQWXQHPDUJHGHPDQXYUH
jOeWDWPHPEUHSXLVTXLFLOHGpEDWSDUOHPHQWDLUHHVWDXWRULVpDILQGHGpWHUPLQHU
les moyens les plus pertinents pour complter la disposition communautaire et,
SDUWDQW HQ DVVXUHU VD PLVH HQ XYUH HQ GURLW LQWHUQH ,O HQ UpVXOWHUDLW XQ
dcoupage du texte selon la nature des dispositions transposer (2).
Si la mthode de transposition parfois en Allemagne, parat difficilement
applicable telle quelle la procdure lgislative franaise, elle pourrait en
revanche tre adapte et inspirer des bonnes pratiques tendant amliorer le
SURFHVVXV GDGRSWLRQ GHV GLUHFWLYHV HW j IDLUH HQ VRUWH TXH FH GHUQLHU OLPLWH
davantage les surtranspositions.
3. Pistes pour amliorer le processus de transposition des directives.

On pourrait en effet imaginer que la transposition des directives se


droule en deux temps :
le premieU SDVVHUDLW SDU OpODERUDWLRQ GXQ SURMHW GRUGRQQDQFH
DVVRUWLGXQHpWXGHGLPSDFWFRPplte et prcise ;
OH VHFRQG FRQVLVWHUDLW HQ XQ GpEDW SDUOHPHQWDLUH j ORFFDVLRQ GX
SURMHWGHORLGHUDWLILFDWLRQVXUOpWXGHGLPSDFWMRLQWHjORUGRQQDQFHHWVXU
ODSDUWLHGHODYLVGX&RQVHLOGeWDWUHODWLYHjFHWWHpWXGHGLPSDFWTXLDXUD
t rendue publique.
Un tel dispositif ne sera toutefois efficace que si une plus grande
DWWHQWLRQHVWDFFRUGpHjOpYDOXDWLRQGHOLPSDFWDXVWDGHGHVQpJRFLDWLRQVGHV
directives.
a. 3ODFHUOpWXGHGLPSDFWDXFXUGHVQpJRFLDWLRQVdes textes europens
et en analyser les implications au niveau national
/RUVTXHOD&RPPLVVLRQHXURSpHQQHHQYLVDJHOpODERUDWLRQGXQWH[WH
son secrtariat gnral commence par mettre en ligne une feuille de route
( roadmap plan ) de trois quatre pages indiquant :
qui est susceptible GrWUHFRQFHUQpSDUODUpIOH[LRQLQLWLpH ;
(1) Ibidem, p. 330.
(2) Ibidem, p. 339.

119

quel calendrier de consultations est envisag ;


quelle est la nature de la rforme envisage (rglement, directive,
UHFRPPDQGDWLRQ ;
quand le projet de texWHHVWVXVFHSWLEOHGrWUHILQDOLVp
ce stade, les services de la Commission europenne attendent des
UpDFWLRQV TXLOV MXJHQW WURS SHX QRPEUHXVHV HQ SDUWLFXOLHU GH OD SDUW GHV
Parlements nationaux (1). Ces derniers ne ragissent que dans le cadre du dlai de
KXLW VHPDLQHV FRQVDFUp j OH[DPHQ GH OD FRQformit au principe de subsidiarit
GXQSURMHWGHWH[WHHXURSpHQGpMjDGRSWpSDUOD&RPPLVVLRQHXURSpHQQH (2).
Les services de la Commission que la mission a pu rencontrer lors de son
GpSODFHPHQW j %UX[HOOHV OH  MDQYLHU  RQW H[SOLTXp TXLOV rflchissaient
aux moyens GDVVXUHUXQHSOXVJUDQGHSXEOLFLWpjFHWWHpWDSHGHOpODEoration des
QRUPHV HXURSpHQQHV HW GDPpOLRUHU OD SULVH HQ FRPSWH GH OpWXGH GLPSDFW DX
niveau du Conseil europen (3).
Quoique la circulaire du Premier ministre du 27 septembre 2004 relative
la procdure de transposition en droit interne des directives et dcisions-cadres
ngocies dans le cadre des institutions europennes prcise expressment que
OLPSDFWGHODFWHHQSUpSDUDWLRQVXUOHGURLWLQWHUQHGRLWrWUHDSSUpci le plus
HQDPRQWSRVVLEOHSRXUSHUPHWWUHjODIRLVGDUUrWHUOHVSRVLWLRQVGHQpJRFLDWLRQ
de la France en connaissance de cause et de prparer la transposition , le
secrtaire gnral du Gouvernement, M. Serge Lasvignes, a concd que les
administrations franaises devaient encore fournir des efforts pour mieux
(1) Sous la SUpVHQWHOpJLVODWXUHODFRPPLVVLRQGHV$IIDLUHVHXURSpHQQHVGHO$VVHPEOpHQDWLRQDOHDIRXUQLDX
moins une contribution dans le cadre des consultations de la Commission europenne. Cette contribution a
SULV OD IRUPH GXQ UDSSRUW GLQIRUPDWLRQ DGRSWp SDU OD &RPPLVVLRQ ,O VDJLW GX UDSSRUW GLQIRUPDWLRQ
n 1664 de M. Arnaud Leroy, sur la consultation de la Commission europenne relative aux dchets marins
(18 dcembre 2013).
(2) (Q )UDQFH OD SURFpGXUH GH[DPHQ GH OD FRQIRUPLWp DX SULQFLSH GH VXEVLGLDULWp GXQ SURMHW GH WH[WH
HXURSpHQHVWIL[pHSDUODUWLFOH-GHOD&RQVWLWXWLRQ&HWWHGLVSRVLWLRQSUpYRLWTXHO$VVHPEOpHQDWLRQDOH
RX OH 6pQDW SHXYHQW pPHWWUH XQ DYLV PRWLYp VXU OD FRQIRUPLWp GXQ SURMHW GDFWH OpJLVODWLI HXURSpHQ DX
principe de subsidiariWp /DYLV HVW DGUHVVp SDU OH SUpVLGHQW GH ODVVHPEOpH FRQFHUQpH DX[ SUpVLGHQWV GX
Parlement europen, du Conseil et de la Commission europenne. Le Gouvernement en est inform.
&KDTXHDVVHPEOpHSHXWIRUPHUXQUHFRXUVGHYDQWOD&RXUGHMXVWLFHGHO8QLRQHuropenne contre un acte
lgislatif europen pour violation du principe de subsidiarit. Ce recours est transmis la Cour de justice
GH O8QLRQ HXURSpHQQH SDU OH *RXYHUQHPHQW  FHV ILQV GHV UpVROXWLRQV SHXYHQW rWUH DGRSWpHV OH FDV
chant en dehors des VHVVLRQVVHORQGHVPRGDOLWpVGLQLWLDWLYHHWGHGLVFXVVLRQIL[pHVSDUOHUqJOHPHQWGH
chaque assemble. la demande de soixante dputs ou de soixante snateurs, le recours est de droit.
(3) Le Conseil europeQ GpVLJQH OH VRPPHW GHV FKHIV Gtat ou chefs de gouvernement des vingt-huit tats
PHPEUHV GH OUnioQ HXURSpHQQH VRXV OD WXWHOOH Gun SUpVLGHQW FKDUJp GH IDFLOLWHU Oapparition d'un
compromis. Au moins deux Conseils europens se droulent chaque anne (juillet et dcembre), la fin de
chaque prsidence tournante du Conseil des ministres europens.
/H&RQVHLOGHVPLQLVWUHVHXURSpHQV RX&RQVHLOGHO8QLRQHXURSpHQQH HVWORUJDQHLQVWLWXWLRQQHOH[pFXWLI,O
GpFLGHGHVDFWHVOpJLVODWLIVHWEXGJpWDLUHVDXVHLQGHO8QLRQHXURSpHQQH,OSDUWDJHVDFRmptence avec le
Parlement europen dans les domaines soumis la codcision. Ceux qui y sigent sont les ministres des
eWDWV PHPEUHV GH O8QLRQ HXURSpHQQH HQ OLHQ DYHF ORUGUH GX MRXU GH FKDTXH UpXQLRQ PLQLVWUHV GHV
finances, ou ministres de la sant, etF /H&RQVHLOGHO8QLRQHXURSpHQQHpODERUHOHSURMHWGHEXGJHWDYHF
OH3DUOHPHQWHWODGRSWHDYHFODFFRUGGHFHOXL-ci, mais dcide seul des recettes.

120

DQWLFLSHUOLPSDFWGHVGLUHFWLYHVDXQLYHDXQDWLRQDO (1). cet effet, le Guide de


bonnes pratiques concernant la transposition des directives europennes tabli
par le 6*$(LPSRVHOpODERUDWLRQGHILFKHVGLPSDFWVLPSOLILpHHWVWUDWpJLTXH (2).
3RXUWDQW GHV GLIILFXOWpV VXEVLVWHQW TXD UHOHYpHV ORUV GH VRQ DXGLWLRQ
M. Nick Malyshev, responsable de la division de la politique de la rglementation
de O2UJDQLVDWLRQSRXUODFRRSpUDWLRQHWOHGveloppement conomiques (OCDE).
&H GHUQLHU D HQ HIIHW LQGLTXp TXH GDSUqV OHV pWXGHV GH O2&'( VXU OH Mieux
lgifrer en Europe et en France (3), il y a souvent peu de rapports entre les
pWXGHVGLPSDFWPHQpHVDXQLYHDXGHOD&RPPLVVLRQHXURSpHQQHet ce qui merge
jODXWUHERXWGXSURFHVVXV (4).
Ce constat ne concerne pas que la France. La mission a pu constater au gr
de ses dplacements Bruxelles et Berlin, queGHODYLVGHQRVYRLVLQVEHOJHV
HWDOOHPDQGVFHVWOHVWDGHSUpFRFHGHVngociations des textes europens qui
constitue le maillon faible de la chane du mieux lgifrer au niveau des
institutions europennes.
Lors de son dplacement Berlin, le 12 fvrier 2014, la mission a
rencontr des reprsentants du conseil national de contrle des normes ( NKR )
qui ont exprim le souhait TXH OH &RQVHLO HXURSpHQ HW OH &RQVHLO GH O8QLRQ
HXURSpHQQHVHPSDUHQWGDYDQWDJHGHVHQMHX[OLpVjOLPSDFWGHVSURMHWVGHWH[WHV
TXLOVQpJRFLHQWOHSOXVHQDPRQWSRVVLEOHGHVQpJRFLDWLRQV Ils RQWIRUPpOHYX
que les ministres allemands et dputs allemands au Parlement europen
VRUJDQLVHQW PLHX[ HQ LQWHUQH SRXU H[DPLQHU OHV SURMHWV GDFWHV OpJLVODWLIV de la
&RPPLVVLRQHXURSpHQQHVRXVODQJOHGHOHXUVFRWVSRXUO$OOHPDJQH
De son ct, M . HHOJH %UDXQ PLQLVWUH GeWDW DXSUqV GH OD
&KDQFHOLqUHFKDUJpGHODVLPSOLILFDWLRQDLQVLVWpVXUOHIDLWTXLOpWDLWFUXFLDO
GLQWpJUHU XQH UpIOH[LRQ VXU OLPSDFW GHV SURMHWV GH WH[WH OH SOXV HQ DPRQW
possible de leur ngociation, au niveau du Conseil europen et du Conseil des
ministres europens /HV PLQLVWUHV FKHIV GH JRXYHUQHPHQWV HW FKHIV GeWDWV
HXURSpHQV GRLYHQW VHORQ OXL SODFHU OHV pWXGHV GLPSDFW ex ante DX FXU GH OHXUV
GpEDWVHWQpJRFLDWLRQVDILQGLQIOXHUOHSOXVW{WSRVVLEOHVXUOHVRULHQWDWLRns et le
contenu des projets de textes europens. ,O D VRXKDLWp TXXQH GLVFXVVLRQ
DSSURIRQGLH VXU FH VXMHW VRLW HQJDJpH DSUqV OHV pOHFWLRQV HXURSpHQQHV HW TXHOOH
VRLW ORFFDVLRQ GXQ WUDYDLO IUDQFR-DOOHPDQG YRLUH GXQH SULVH GH SRVLWLRQ
commune.
(1) Audition de M. Serge Lasvignes, secrtaire gnral du Gouvernement, et de M. Thierry-Xavier Girardot,
directeur, adjoint au secrtaire gnral du Gouvernement, le 19 fvrier 2014. Voir le compte-rendu en
annexe n 16.
(2) Voir les documents figurant en annexe n 14.
(3) /2&'(DHQHIIHWSXEOLpHQun rapport sur la rforme de la rglementation en France, et, en 2010,
un rapport sur le mieux lgifrer en France, qui a t produit GDQVOHFDGUHGXQYDVWHGHWUDYDLOGDQDO\VH
GHODSROLWLTXHUpJOHPHQWDLUHDGRSWpHGDQVSD\VPHPEUHVGHO8QLRQHXURSpenne.
Ce dernier rapport est consultable au lien suivant : http://www.oecd.org/france/45249654.pdf
(4) Audition GH UHSUpVHQWDQWV GH O2UJDQLVDWLRQ SRXU OD FRRSpUDWLRQ HW OH GpYeloppement conomiques
(OCDE), le 17 avril 2014. Voir le compte-rendu figurant en annexe n 16.

121

'DQV ODWWHQWH GXQH PHLOOHXUH DQWLFLSDWLRQ GHV LPSDFWV GH OD


rglementation europenne, les autorits allemandes ont cr un site
Internet, FRQVXOWDEOHSDUWRXVRVRQWLQGLTXpVOHVFRWVDX[TXHOVLOIDXWVDWWHQGUH
compte tenu des projets de textes europens en FRXUVGDGRSWLRQ Ce site Internet
est connu sous le nom de moniteur PME . Cet outil permet aux petites et
PR\HQQHV HQWUHSULVHV DOOHPDQGHV GDQWLFLSHU OHV HIIHWV GH OD UpJOHPHQWDWLRQ
europenne envisage et de transmettre leurs remarques de faon prcoce. Le
moniteur PME GRQQH XQH YXH GHQVHPEOH GHV LQLWLDWLYHV GX SURJUDPPH GH
travail de la Commission affectant les PME, ds la publication de ce programme
de travail, et pour toute la dure du cycle de travail. Le moniteur PME prend la
IRUPH GXQ WDEOHDX GXQH YLQJWDLQH GH SDJHV GDQV OHTXHO OHV SURSRVLWLRQV VRQW
regroupes par secteur (1). Les rglementations envisages au niveau europen sont
classes en fonction de leur importance pour les PME nationales, selon un systme
de feux tricolores.
Le dcalDJHTXLSHXWSDUIRLVrWUHFRQVWDWpHQWUHOLPSDFWGHVGLUHFWLYHV
HXURSpHQQHV WHO TXLO HVW pYDOXp SDU OD &RPPLVVLRQ HXURSpHQQH HW SDU OHV
QpJRFLDWHXUVHWOLPSDFWGHVPHVXUHVGHWUDQVSRVLWLRQWLHQWQRQVHXOHPHQWj
une anticipation insuffisante des consquences des textes au niveau national
lors de la phase de ngociation, mais aussi une rupture entre la phase de
ngociation et la phase de transposition&HVWGXPRLQVODQDO\VHGXVHFUpWDLUH
gnral du Gouvernement, M. Serge Lasvignes, qui a expliqu devant la mission
que MXVTXj LO \ D SHX OH VHUYLFH FKDUJp GH QpJRFLHU OD GLUHFWLYH j %UX[HOOHV
tait diffrent de celui qui tait charg de la transposer dans le droit national ,
de sorte que, trs vite, la mmoire de la ngociation pouvait se perdre, si bien
TXLO GHYHQDLW LPSRVVLEOH GH VH UDSSHOHU SRXUTXRL OD )UDQFH DYDLW HOOH-mme
GHPDQGp OLQVFULSWLRQ GH WHOOH RX WHOOH GLVSRVLWLRQ GDQV OD GLUHFWLYH . Tout en
soulignant que des progrs ont t raliss sur tous ces points , notamment la
faveur du rapprochement du SGG et du SGAE, M. Serge Lasvignes a fait tat de
la persistance de GLIILFXOWpV j REWHQLU GHV PLQLVWqUHV TXLOV pFKDQJHQW DYHF OH
6HFUpWDULDW JpQpUDO DX VXMHW GH OLPSDFW HIIHFWLI GXQ SURMHW HQ FRXUV GH
prparation ,ODDMRXWpTXil lui tait mme arriv de dcouvrir que des projets
de directives impliquaient une rvision de la Constitution, sans que
ODGPLQLVWUDWLRQFRQFHUQpHVHQVRLWUHQGXFRPSWH .
$LQVLTXHODLQGLTXpdevant la mission M. Nick MalyshevO2&'( aussi
a constat que de nombreux pays ont du mal ngocier la version finale des
directives au niveau du Conseil , notamment parce que les politiques chargs
des ngociations ne sont pas suffisamment en relation avec les personnes qui
seront responsables de la transposition. Lorsque la directive arrive dans le cadre
QDWLRQDO HOOH SURYRTXH VRXYHQW OD VXUSULVH VLJQH GXQH SUpSDUDWLRQ
insuffisante  3RXU \ UHPpGLHU O2&'( UHFRPPDQGH FRPPH OD mission, que
les tats membres utilisent davantage les pWXGHV GLPSDFW PHQpHV DX QLYHDX GH
O8QLRQ VXU OHV WH[WHV HXURSpHQV , car, alors que la Commission alloue des
(1) 9RLU OpGLWLRQ GDRW-septembre 2014 au lien suivant : http://www.bmwi.de/BMWi/Redaktion/PDF/E/eumittelstandsmonitor-sortiert,property=pdf,bereich=bmwi2012,sprache=de,rwb=true.pdf

122

PR\HQV FRQVLGpUDEOHV DX GpYHORSSHPHQW GH FHV WUDYDX[ QRXV QDYRQV SDV
OLPSUHVVLRQ TXH OHV SD\V VHQ VHUYHQW FRPPH SRLQW GDSSXL SRXU DQDO\VHr
OLPSDFWORFDOGHVGLUHFWLYHV .
8QH PHLOOHXUH DSSURSULDWLRQ GH OpWXGH GLPSDFW GH OD &RPPLVVLRQ
HXURSpHQQH HW FRUUpODWLYHPHQW XQH PHLOOHXUH DQWLFLSDWLRQ GH OLPSDFW GHV
textes ngocis au niveau national pourront contribuer limiter les
surtranspositions car les mesures que la France jugera les plus appropries
au regard de sa situation particulire seront alors dfendues au stade des
ngociations, et non plus imposes au stade de la transposition.
b. Mieux identifier les ventuelles surtranspositions
Il est vrai que le Guide de bonnes pratiques concernant la transposition
des directives europennes tabli par le SGAE recommande de lutter contre la
surtransposition en invitant les ministres carter toute mesure allant au-del de
FHTXLPSOLTXHVWULFWHPHQWODPLVHHQXYUHGHODGLUHFWLYHHWHQUDSSHODQWTXXQH
GLUHFWLYHQHGHYUDLWSDVrWUHORFFDVLRQGXQHUHPLVHHQFKDQWLHUGXGURLWQDWLRQDO
en dehors de ce qui est ncessaire pour la transposition.
Pourtant, en tant que dputs, nous sommes rgulirement interpells par
GHVSURIHVVLRQQHOVTXLUHPDUTXHQWTXHOHXUVFRQFXUUHQWVGDXWUHVSD\VGHO8QLRQ
HXURSpHQQHGLVSRVHQWGHPDUJHVGHPDQXYUHVXSpULHXUHVDX[OHXUV
Or, cet gard, lH 3DUOHPHQW QH GLVSRVH DXMRXUGKXL GDXFXQ RXWLO
SHUPHWWDQW GLGHQWLILer une surtransposition 2U FHVW GDXWDQW SOXV
SUREOpPDWLTXH TXH OD WUDQVSRVLWLRQ GHV GLUHFWLYHV HXURSpHQQHV VHIIHFWXH SDUIRLV
par appartement , le Gouvernement se contentant [pour reprendre la formule
de notre collgue Jean-Luc Warsmann] de rdiger TXHOTXHV DPHQGHPHQWV TXLO
FRQILH j FHUWDLQV GpSXWpV GH OD PDMRULWp ( 1 ), sans stratgie globale de
WUDQVSRVLWLRQ$LQVLTXHODGpFULWQRWUHFROOqJXH-HDQ-Luc Warsmann, la plupart
du temps, malheureusement, cela se passe ainsi : un collgue dpose un
amendement inspir par le Gouvernement et destin, par exemple, soumettre
OpWXGHGLPSDFWOHVSRXODLOOHUVGHSOXVGH 000 volailles ; le ministre se lve et
VH GpFODUH IDYRUDEOH /DPHQGHPHQW HVW GRQF YRWp ELHQ TXH OH 3DUOHPHQW QH
GLVSRVH GDXFXQ pOpPHQW GDSSUpFLDWLRQ HW TXH OHV SDUWLHV SUHQDQWHV
professionnelles ou autres QDLHQWSDVSXVH[SULPHUjVRQVXMHWSXLVTXLOVDJLW
GXQDPHQGHPHQWSDUOHPHQWDLUH .
/RUVTXHOOH VH IDLW SDU YRLH OpJLVODWLYH OD WUDQVSRVLWLRQ GXne directive
devrait, au contraire, rWUH ORFFDVLRQ SRXU OH 3DUOHPHQW GH WRLOHWWHU OH GURLW HW
GDEURJHU les anciennes dispositions de droit interne, ou du moins de dbattre de la
ncessit de les maintenir. &HODSHUPHWWUDLWGpYLWHUTXHQHVHFRQVWLWXHXQ millefeuille GREOLJDWLRQVjODIRLVHXURSpHQQHVHWQDWLRQDOHVTXLFRQWULEXHQWjSODFHU
notre pays en situation de surtransposition.
(1) Audition de M. Jean-Luc Warsmann, dput, ancien prsident de la commission des Lois, le 1er juillet
2014. Voir le compte rendu en annexe n 16.

123

/REMHFWLI GLGHQWLILFDWLRQ GHV VXUWUDQVSRVLWLRQV QHVW SDV KRUV GH


porte. Nos voisins y parviennent.  WLWUH GH[HPSOH Oe Royaume-Uni a
UpFHPPHQW GpSOR\pGLPSRUWDQWV moyens de lutte contre la surtransposition
des directives europennes. Outre le contrle des cas de surtransposition qui
est opr par le conseil consultatif indpendant charg de contrler la qualit
GHVpWXGHVGLPSDFW( Regulatory Policy Committee - RPC) et par le comit
gouvernemental charg de la rduction de la rglementation ( Reducing
Regulation ministerial Committee - RRC), des lignes directrices encadrent
strictement la transposition de la rglementation euURSpHQQH HW IRQW OREMHW GH
rapports quant leur application :
WRXWH VXUWUDQVSRVLWLRQ HVW LQWHUGLWH VDXI ORUVTXHOOH HVW IDYRUDEOH
aux entreprises britanniques et dment justifie (sur la priode juillet 2011dcembre 2012, des standards plus levs quHOHVH[LJHQFHVHXURSpHQQHVQont t
retenus que dans 14  GHV FDV VDQV TXH FHOD QLPSOLTXH GH FKDUJHV
supplmentaires) ;
le Gouvernement doit chercher autant que possible utiliser des
alternatives la rglementation (sur la priode juillet 2011-dcembre 2012, cela a
t fait dans 16 % des cas) ;
le Gouvernement doit transposer mot pour mot dans la mesure
du possible, sauf si cela engendre un risque de mauvaise comprhension ou de
mauvaise interprtation (sur la priode juillet 2011-dcembre 2012, cela a t
fait dans 72 % des cas) ;
OH *RXYHUQHPHQW GRLW VDVVXUHU TXH OHV PHVXUHV QHQWUHQW HQ
YLJXHXU TXj OD GDWH EXWRLU GpILQLH SDU OD &RPPLVVLRQ VDXI ORUVTXXQH
transposition anticipe profiterait aux entreprises (sur la priode juillet 2011dcembre 2012, 95 % des mesures sont entres en vigueur la date fixe par les
institutions europennes) ;
le Gouvernement doit introduire dans le texte de transposition une
clause de rvision quinquennale.
En Allemagne, le nouveau Gouvernement a dcid que, dsormais,
comme au Royaume-Uni, toute surtransposition serait interdite, sauf
ORUVTXHOOHVHUDLWIDYRUDEOHDX[HQWUHSULVHVDOOHPDQGHVHWGPHQWMXVWLILpH
En revanche, ce contrle ne concerne pas les rglements europens, qui
VRQWGDSSOLFDtion directe. Ayant constat que les charges administratives rsultant
des rglements pouvaient tre consquentes, le conseil national de contrle des
normes ( NKR  D GpFLGp GH PHWWUH HQ SODFH GLFL OD ILQ GH ODQQpH  XQ
SURFHVVXVGpYDOXDWLRQGHVGLtes charges.
Si nos voisins britanniques et allemands sont parvenus mettre en place
GHWHOOHVVWUDWpJLHVGHOXWWHFRQWUHOHVVXUWUDQVSRVLWLRQVLOQ\SDVGHUDLVRQTXHOD
)UDQFHQ\SDUYLHQQHSDV
De faon viter que les dbats parlementaires ne soienW ORFFDVLRQ
GDOOHU DX-del des exigences europennes, la mission recommande de

124

GpYHORSSHUODWUDQVSRVLWLRQGHVGLUHFWLYHVSDUYRLHGRUGonnances, la double
condition toutefois que :
ORUVGHOH[DPHQGXSURMHWGHORLGHUDWLILFDWLRQGHVRUGRQQDQFHVGH
WUDQVSRVLWLRQ OH 3DUOHPHQW GLVSRVH GHV pWXGHV GLPSDFW UpDOLVpHV VXU OHV
SURMHWV GRUGRQQDQFHV ainsi que GH OD SDUWLH GH ODYLV GX &RQVHLO GeWDW
SRUWDQWVXUODTXDOLWpGHFHVpWXGHVGLPSDFW ;
OHVpWXGHVGLPSDFWMRLQWHVDX[SURMHWVGRUGRQQDQFHVHWOa partie de
ODYLVGX&RQVHLOGeWDWTXL\HVWUHODWLYHLGHQWLILHQWFODLUHPHQWOHVpYHQWXHOOHV
surtranspositions qui devront par ailleurs tre dment justifies.
Cette proposition doit tre lue en lien avec les prcdentes propositions de
la mission qui viVHQWjUHQGUHREOLJDWRLUHODUpDOLVDWLRQGXQHpWXGHGLPSDFWSRXU
WRXVOHVSURMHWVGRUGRQQDQFHHWjUHQGUHSXEOLTXHODSDUWLHGHODYLVGX&RQVHLO
GeWDW VXU OHV pWXGHVGLPSDFW DVVRUWLVVDQWOHV SURMHWV HW SURSRVLWLRQVGH ORL DLQVL
TXHOHVSURMHWVGRUGonnance.
Proposition n 12 Modifier les modalits de ngociation et de transposition des
directives
3ODFHU OpWXGH GLPSDFW GH OD &RPPLVVLRQ HXURSpHQQH HW VHV LPSOLFDWLRQV DX
QLYHDXQDWLRQDO DXFXUGHVQpJRFLDWLRQVGHVGLUHFWLYHVHXURSpHQQHV ;
'pYHORSSHUODWUDQVSRVLWLRQGHVGLUHFWLYHVSDUYRLHGRUGRQQDQFHVHQH[LJHDQW :
TXHODYLVGX&RQVHLOGeWDWVXUOHSURMHWGRUGRQQDQFHGHWUDQVSRVLWLRQ
soit rendu public avant le dpt du projet de loi de ratification ;
HW TXH FHW DYLV DLQVL TXH OpWXGH GLPSDFW DVVRUWLVVDQW OH SURMHW
GRUGRQQDQFH LGHQWLILHQW OHV pYHQWXHOOHV surtranspositions , qui devront alors
tre soumises une obligation de motivation renforce.

125

TROISIME PARTIE : MIEUX VALUER LA NORME


EN AVAL DE SON ADOPTION
/DPpOLRUDWLRQ GH OD IDEULTXH GH OD ORL SDVVH SDU OD PLVH HQ SODFH GXQ
cercle vertueux GHOpYDOXDWLRQDXVHLQGXTXHOOpWXGHex post GHOLPSDFWSHXW
conduire envisager des modifications de la norme adopte modifications qui, si
elles trouvent une traduction lgislative, seront-elles-mmes soumises une
analyse ex ante de leur impact. Il existe en effet un lien troit et ncessaire entre
OpYDOXDWLRQex ante HWOpYDOXDWLRQex postTXLVHQRXUULVVHQWOXQHGHODXWUH
2UHQPDWLqUHGpYDOXDWLRn ex post, la mission a pu constater tout au long
de ses travaux que notre pays comptait de nombreux acteurs ainsi que de
nombreuses initiatives qui gagneraient sans doute tre organises de faon plus
mthodique.
I. CLARIFIER LE
PUBLIQUES

PAYSAGE

'( /e9$/8$7,21 '(6

POLITIQUES

&RXU GHV FRPSWHV FRPLWp GpYDOXDWLRQ HW GH FRQWU{OH &(&  PLVVLRQ
GpYDOXDWLRQHWGHFRQWU{OH 0(& FRPPLVVLRQSRXUOHFRQWU{OHGHODSSOLFDWLRQ
GHVORLVGLUHFWLRQVPLQLVWpULHOOHVGHODUHFKHUFKHGHVpWXGHVGHOpYDOXDWLRQGHOa
SURVSHFWLYH HWGHV VWDWLVWLTXHV ,O HVW DXMRXUGKXL H[WUrPHPHQWGLIILFLOH GH IDLUH
un recensement exhaustif des institutions, organes parlementaires ou services
PLQLVWpULHOVTXLLQWHUYLHQQHQWHQPDWLqUHGpYDOXDWLRQex post des normes, et, plus
largement, des politiques publiques, tant ceux-ci sont nombreux.
6L ORQ SHXW VH UpMRXLU GXQH WHOOH abondance, votre rapporteur estime
cependant que les multiples initiatives que prennent ces diffrents acteurs en
PDWLqUHGpYDOXDWLRQex post gagneraient, dans un VRXFLGHIILFDFLWpjrWUHPLHX[
coordonnes.
A. UNE VALUATION A POSTERIORI ABONDANTE MAIS PAS TOUJOURS
ORGANISE.

/pYDOXDWLRQ ex post des normes adoptes et des politiques publiques est


DXMRXUGKXLOHIDLWjODIRLV :
GX 3DUOHPHQW TXL VHVW GRWp HQ OD matire de nombreux organes et a
adopt des bonnes pratiques ;
GHVMXULGLFWLRQVMXGLFLDLUHVHWDGPLQLVWUDWLYHVHWGLQVWLWXWLRQVFRPPHOD
Cour des comptes ou le Conseil conomique, social et environnemental ;
GHOH[pFXWLITXLGLVSRVHGHQRPEUHX[FRUSVGLQVSHFWLRQVHFUpWDULDWVHW
FRPPLVVDULDWVJpQpUDX[HWDXWUHVGpSDUWHPHQWVPLQLVWpULHOVGpGLpVjOpYDOXDWLRQ

126

1. Ce que fait le Parlement

Outre les multiples rapports ponctuels que le Parlement demande au


*RXYHUQHPHQWVXUOHVVXMHWVOHVSOXVGLYHUVjORFFDVLRQGHOH[DPHQGHVWH[WHVGH
ORL HW GRQW OH QRPEUH D DYRLVLQp  VRXV OD SUpFpGHQWH OpJLVODWXUH GDSUqV OH
VHFUpWDLUHGeWDWDX[5HODWLRQVDYHFOH3DUOHPHQW0 Jean-Marie Le Guen (1), les
UDSSRUWV GDSSOLFDWLRQ GHV ORLV DGRSWpHV HW OHV UDSSRUWV Ginformation que
SURGXLVHQWOHVSDUOHPHQWDLUHVFRQWULEXHQWDXWUDYDLOGpYDOXDWLRQHWGHFRQWU{OHTXH
mnent les assembles et pour lequel elles se sont dots de nombreux organes.
a. /HVUDSSRUWVGDSSOLFDWLRQGHVORLVDGRSWpHV
Votre rapporteur tient UDSSHOHUTXHOH3DUOHPHQWVHVWIRUWHPHQWLQYHVWL
DXFRXUVGHVYLQJWGHUQLqUHVGDQVOpYDOXDWLRQGHODTXDOLWpRSpUDWLRQQHOOHGHVORLV
DGRSWpHV HW SURPXOJXpHV FH TXL VH WUDGXLW SDU XQH pYDOXDWLRQ GH OHIILFDFLWp GHV
SROLWLTXHVSXEOLTXHVPLVHVHQXYUHSDU ces lois. La rforme constitutionnelle du
MXLOOHWDGDLOOHXUVPRGLILpODUWLFOHGHOD&RQVWLWXWLRQSRXUUHFRQQDvWUH
H[SUHVVpPHQWDX3DUOHPHQWXQHPLVVLRQGpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHV
DHSXLVjOLVVXHGXQGpODLGHVL[PRLVVXLYDQWOHQWUpHHQYLJXHXU
GXQH ORL GRQW OD PLVH HQ XYUH ncessite la publication de textes de nature
rglementaire, un rapport sur la mise en application de cette loi doit tre prsent
la commission comptente. Ce rapport fait notamment tat des textes
rglementaires publis, ainsi que des dispositions de la loi concerne qui
QDXUDLHQWSDVIDLWOREMHWGHVWH[WHVGDSSOLFDWLRQQpFHVVDLUHV
DHSXLV  ODUWLFOH - GX 5qJOHPHQW GH O$VVHPEOpH QDWLRQDOH
prvoit que la rdaction de ce rapport est confLpH j GHX[ GpSXWpV GRQW OXQ
DSSDUWLHQWjXQJURXSHGRSSRVLWLRQHWSDUPLOHVTXHOVILJXUHGHGURLWOHUDSSRUWHXU
GXSURMHWRXGHODSURSRVLWLRQGHORLIDLVDQWOREMHWGXUDSSRUWGDSSOLFDWLRQ/HV
rapports sur la mise en application des lois peuvent donner lieu, en sance
publique, un dbat sans vote ou une sance de questions.
Ces rapports sur la mise en application des lois se nourrissent des
documents fournis par le Gouvernement, dont notre collgue David Assouline,
prsident de la commission snatRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLVD
MXJp TXLOV pWDLHQW de contenu trs ingal VDSSDUHQWDQW SDUIRLV j XQH VRUWH
GH[SRVp GHV PRWLIV , voire parfois mme pas transmis au Parlement, ce qui
H[SOLTXHTXHQRVFRPPLVVLRQVQXWLOLVHQWSDVSleinement ces outils dont il faudrait
pourtant faire un meilleur usage (2).
Votre rapporteur souligne en outre que les rapports des dputs et
snateurs sur la mise en application des lois se focalisent surtout sur la vrification
de ce que les dcrets dDSSOLFDWLRQGXQHORLRQWELHQpWpSULVHWOHFDVpFKpDQWVXU
(1) Audition de M. Jean-Marie Le Guen, VHFUpWDLUHGeWDWDX[5HODWLRQVDYHFOH3DUOHPHQWDXSUqVGX3UHPLHU
ministre, le 9 juillet 2014. Voir le compte-rendu en annexe n 16.
(2) Audition de M. 'DYLG$VVRXOLQHSUpVLGHQWGHODFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQ
des lois, le 5 juin 2014. Voir le compte-rendu en annexe n 16.

127

OHV UDLVRQV LQYRTXpHV SDU OH[pFXWLI SRXU MXVWLILHU XQ UHWDUG GDGRSWLRQ GH FHV
GpFUHWV /pYDOXDWLRQ ex post GH OLPSDFW GHV ORLV DGRSWpHV HW GHV SROLWLTXHV
SXEOLTXHV TXHOOHV FRQFRXUHQW j PHWWUH HQ XYUe relve davantage des rapports
SURGXLWVSDUOHVFRPPLVVLRQVGHQTXrWHHWOHVPLVVLRQVGLQIRUPDWLRQ
b. Les cRPPLVVLRQV GHQTXrWH PLVVLRQV GLQIRUPDWion des commissions
permanentes et PLVVLRQV GLQIRUPDWLRQ Ge la Confrence des
Prsidents
La miVVLRQDVVLJQpHDX[FRPPLVVLRQVGHQTXrWHUpJLHVSDUOHVDUWLFOHV
144-2 du Rglement GHO$VVHPEOpHQDWLRQDOHWHQGjpYROXHUGDQVOHVHQVGXQH
GpPDUFKHpYDOXDWLYHGHSROLWLTXHVSXEOLTXHVVHFWRULHOOHVDLQVLTXDSXOHPRQWUHU
sous la XIVe lgislaturH OD FRPPLVVLRQ GHQTXrWH VXU OH IRQFWLRQQHPHQW GHV
services de renseignement franais dans le suivi et la surveillance des mouvements
radicaux arms ou encore celle sur la situation de la sidrurgie et de la mtallurgie
franaises et europennes dans la crise conomique et financire et sur les
conditions de leur sauvegarde et de leur dveloppement.
Par ailleurs, depuis 1990, les articles 145 et suivants du Rglement de
O$VVHPEOpHQDWLRQDOHRIIUHnt aux commissions permanentes la possibilit de crer
des PLVVLRQV GLQIRUPDWLRQ WHPSRUDLUHV pYHQWXHOOHPHQW FRPPXQHV j SOXVLHXUV
commissions, pour valuer les conditions GDSSOLFDWLRQGXQHOpJLVODWLRQ.
Qui plus est, eQ DSSOLFDWLRQ GH ODUWLFOH  DOLQpD  GX 5qJOHPHQW OD
Confrence des prsidents peut elle aussi crer, sur proposition du Prsident de
O$VVHPEOpHQDWLRQDOHGHVPLVVLRQVGLQIRUPDWLRQ
c. /RIILFH SDUOHPHQWDLUH GpYDOXDWLRQ GHV FKRL[ VFLHQWLILTXes et
technologiques (OPECST) et les diverses dlgations parlementaires
Cr par la loi n 83-609 du  MXLOOHW  O2IILFH SDUOHPHQWDLUH
GpYDOXDWLRQGHVFKRL[VFLHQWLILTXHVHWWHFKQRORJLTXHV (OPECST) a pour mission,
aux termes de la loi, GLQIRUPHU OH 3DUOHPHQW GHV FRQVpTXHQFHV GHV FKRL[ GH
caractre scientifique et technologique afin, notamment, dpFODLUHU VHV
dcisions FHWHIIHWO23(&67 UHFXHLOOHGHVLQIRUPDWLRQVPHWHQXYUHGHV
SURJUDPPHVGpWXGHVHWSURFqGHjGHVpYDOXDWLRQV .
Compos de 18 snateurs et 18 dputs, cet organe est prsid
alternativement par un snateur et par un dput. Il est assist par un conseil
scientifique form de personnalits choisies en raison de leurs comptences. Il
SHXW rWUH VDLVL SDU OH %XUHDX GH OXQH GHV GHX[ DVVHPEOpHV SDU XQ SUpVLGHQW GH
groupe, par 60 dputs ou 40 snateurs ou par une commission.
/HV WUDYDX[ GH FHW RIILFH VHUYHQW OH SOXV VRXYHQW j OpWDEOLVVHPHQW GXQ
rapport pralable la rflexion lgislative. Cependant, diverses lois prvoient une
valuation ex post SDUO23(&67GHODPLVHHQXYUHGHWRXWRXSDUWLHGHOHXUV
dispositions, parmi lesquelles les lois de 1994, 2004 et 2011 relatives la

128

biothique (1), la loi de 2005 de programme fixant les orientations de la politique


nergtique (2), les lois de programme de 2006 relatives la recherche et la
gestion durable des matires et dchets radioactifs (3).
2XWUHO23(&67GLYHUVHVGpOpJDWLRQVDSSRUWHQWOHXUSLHUUHjOpYDOXDWLRQ
ex post des lois adoptes dans les domaines qui les concernent :
dpOpJDWLRQV DX[ GURLWV GHV IHPPHV HW j OpJDOLWp GHV FKDQFHV HQWUH OHV
hommes et les femmes cres dans les deux assembles par la loi n 99-585 du
12 juillet 1999 ;
dpOpJDWLRQ SDUOHPHQWDLUH DX UHQVHLJQHPHQW FRPPXQH j O$VVHPEOpH
nationale et au Snat et cre par la loi n 2007-1443 du 9 octobre 2007 ;
dlgation aux collectivits territoriales et la dcentralisation cre au
6pQDWSDUODUUrWpQ 2009-95 du Bureau du 7 avril 2009 ;
dlgation la prospective cre au Snat le 7 avril 2009 par
OInstruction gnrale du Bureau ;
dpOpJDWLRQ j O2XWUH-mer FUppH DX 6pQDW SDU ODUUrWp Q 2011-282 du
Bureau du 16 novembre 2011 ;
dlgation aux outre-PHU FUppH j O$VVHPEOpH QDWLRQDOH SDU OD
Confrence des Prsidents du 17 juillet 2012.
d. La mLVVLRQGpYDOXDWLRQHWGHFRQWU{OH 0(&
/D PLVVLRQ GpYDOXDWLRQ HW GH FRQWU{OH D pWp FUppHHQ  au sein de la
FRPPLVVLRQ GHV )LQDQFHV GH O$VVHPEOpH QDWLRQDOH j OD VXLWH GHV FRQFOXVLRQV
GXQ JURXSH GH WUDYDLO VXU OH FRQWU{OH SDUOHPHQWDLUH HW OHIILFDFLWp GH OD GpSHQVH
SXEOLTXH TXL IXW OLQLWLDWHXU GH OD ORL RUJDQLTXe relative aux lois de
finances (LOLF).
Forte de 18 membres dsigns parit entre majorit et opposition par les
groupes politiques, elle est co-prside par un dput de la majorit et par un
GpSXWp GH ORSSRVLWLRQ HW FRQGXLW GHV LQYHVWLJDWLRQV DSSURIRQGLHV VXU GHV
politiques publiques sectorielles.
Dote de pouvoirs tendus pour convoquer des tmoins et se faire
FRPPXQLTXHU WRXV GRFXPHQWV j OH[FHSWLRQ GH FHX[ FRXYHUWV SDU OH VHFUHW
PpGLFDOGHOLQVWUXFWLRQRXHQFRUHGHODGpIHQVHQDWLRQDOH OD0(&IRUPXOHGHV
propositions concrteV GDPpOLRUDWLRQ GHV SROLWLTXHV SXEOLTXHV TXL IRQW OREMHW
(1) ,OVDJLWGHVlois n 94-654 du 29 juillet 1994 UHODWLYHDXGRQHWjOXWLOLVDWLRQGHVpOpPHQWVHWSURGXLWVGX
FRUSV KXPDLQj ODVVLVWDQFH PpGLFDOH j OD SURFUpDtion et au diagnostic prnatal, n 2004-800 du 6 aot
2004 relative la biothique, et n 2011-814 du 7 juillet 2011 relative la biothique.
(2) Loi n 2005-781 du 13 juillet 2005.
(3) Loi n 2006-450 du 18 avril 2006 de programme pour la recherche ; loi n 2006-739 du 28 juin 2006 de
programme relative la gestion durable des matires et dchets radioactifs.

129

GXQ VXLYL HW SDUIRLV GH QRWLILFDWLRQV DX *RXYHUQHPHQW TXL HQ DSSOLFDWLRQ GH
ODUWLFOHGHOD/2/)HVWWHQXG\UpSRQGUHSDUpFULWGDQVXQGpODLGHGHX[PRLV
e. La mLVVLRQ GpYDOXDWLRQ HW GH contrle des lois de financement de la
scurit sociale (MECSS)
'HV PLVVLRQV GpYDOXDWLRQ HW GH FRQWU{OH GHV ORLV GH ILQDQFHPHQW GH OD
scurit sociale ont t mises en place en 2004 au sein des commissions des
$IIDLUHVVRFLDOHVGHO$VVHPEOpHQDWLRQDOHHt du Snat.
&RSUpVLGpHVSDUGHX[SDUOHPHQWDLUHVGHODPDMRULWpHWGHORSSRVLWLRQFHV
missions, dont la composition tend reproduire la configuration politique des
DVVHPEOpHV VRQW FKDUJpHV GpYDOXHU WRXWH TXHVWLRQ UHODWLYH DX[ ILQDQFHV GH OD
scurit sociale. Elles disposent pour ce faire de pouvoirs tendus qui sont fixs
aux articles L.O. 111-9, L.O. 111-9-1, L.O. 111-9-3 et L.O. 111-10 du code de la
scurit sociale (convocation de tmoins, contrles sur pices et sur place auprs
GDGPLQLVWUDWLRQVGHOeWDWHWGHVRUJDQLVPHVGHVpFXULWpVRFLDOHHWF 
Les MECSS publient des rapports et peuvent notifier au Gouvernement ou
un organisme de scurit sociale des observations auxquelles ces derniers sont
tenus de rpondre dans un dlai de deux mois.
f. Le cRPLWpGpYDOXDWLRQHWGHFRQWU{OH des politiques publiques (CEC)
ODVXLWHGHODFRQVpFUDWLRQFRQVWLWXWLRQQHOOHGHODIRQFWLRQGpYDOXDWLRQ
HWGHFRQWU{OHGX3DUOHPHQWODUpIRUPHGX5qJOHPHQWGHO$VVHPEOpHQDWLRQDOHGX
27 mai 2009 a conduit la cratLRQ GXQH LQVWDQFH GH FRQWU{OH RSpUDWLRQQHO : le
FRPLWpGpYDOXDWLRQHWGHFRQWU{OH &(& 
6RXVOpJLGHGX3UpVLGHQWGHO$VVHPEOpHQDWLRQDOHFHFRPLWpFRQGXLWGHV
valuations de politiques publiques transversales portant sur des domaines de
comptence pOXVODUJHVTXHFHX[GXQHFRPPLVVLRQSHUPDQHQWH DUWLFOH-3 du
Rglement) et peut, sur saisine du prsident de la commission laquelle un projet
GH ORL D pWp UHQYR\p DSSRUWHU VRQ H[SHUWLVH VXU OHV pWXGHV GLPSDFW TXL
accompagnent les projets de loi dposs par le Gouvernement (article 146-5 du
Rglement), notamment afin de dterminer si ces tudes satisfont aux exigences
SUpYXHVjODUWLFOHGHODORLRUJDQLTXHdu 15 avril 2009.
Le CEC peut galement formuler des propositions pour la dtermination
de ORUGUHGXMRXUGHODVHPDLQHUpVHUYpHSDUSULRULWpDXFRQWU{OHHWjOpYDOXDWLRQ
de la lgislation. Il peut HQ SDUWLFXOLHU SURSRVHU ORUJDQLVDWLRQ HQ VpDQFH
publique, de dbats sans vote ou de sances de questions portant sur les
conclusions de ses rapports ou sur celles des rapports des missions
GLQIRUPDWLRQ des commissions permanentes ou de la Confrence des prsidents
(article 146-7 du Rglement).
Votre rapporteur souligne que, GHSXLV ODFWXHOOH OpJLVODWXUH le CEC VHVW
efforc GpFODLUHU SDU VHV WUDYDX[ GpYDOXDWLRQ ex post ODQDO\VH ex ante de

130

OLPSDFWGHVSURMHWVGHORLGRQWQRWUH$VVHPEOpHHVWVDLVLH Par exemple, en vue de


OH[DPHQ SDU QRWUH $VVHPEOpH GX WH[WH TXL HVW GHYHQX OD ORL Q 2014-288 du 5
mars 2014 relative la formation professLRQQHOOH j Oemploi et la dmocratie
sociale OH &(& D PHQp SHQGDQW ODQQpH  XQH pYDOXDWLRQ GH ODGpTXDWLRQ
HQWUH ORIIUH HW OHV EHVRLQV GH IRUPDWLRQ SURIHVVLRQQHOOH TXL D FRQGXLW j OD
SXEOLFDWLRQGXQUDSSRUWGLQIRUPDWLRQHQMDQYLHU (1). Plus rcemment, dans
la perspective des dbats sur le projet de loi n 2188 relatif la transition
nergtique pour la croissance verte, le CEC a ralis une valuation du paquet
nergie-climat de 2008 en )UDQFH TXL D DERXWL j OD SXEOLFDWLRQ GXQ UDSSRUt
GLQIRUPDWLRQHQPDLGHUQLHU (2).
g. /DFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLV
,QVWLWXpHHQQRYHPEUHSDUODUWLFOH;bis GHO,QVWUXFWLRQJpQpUDOHGX
Bureau du Snat et compose de 39 membres, la commission snatoriale pour le
FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV HVW FKDUJpH GH YHLOOHU j OD PLVH HQ XYUH
effective des textes vots par le Parlement.
Bnficiant des prrogativeV GXQH FRPPLVVLRQ GHQTXrWH FHWWH
commission assure non seulement un suivi de la publication des dcrets
GDSSOLFDWLRQ PDLV DXVVL XQH pYDOXDWLRQ GH OD SHUWLQHQFH HW GH OHIILFDFLWp GHV
dispositifs adopts au regard de ce qui en tait attendu a priori.
En effet, cette commission tablit des rapports thmatiques sur certaines
lois portant sur des domaines disparates qui sont slectionnes dans le cadre
GXQ SURJUDPPH GH WUDYDLO DQQXHO GpILQL HQ FRRUGLQDWLRQ DYHF OHV JURXSHV
politiques et les commissions permanentes.
/D PLVH HQ XYUH GHV ORLV UHWHQXHV SRXU IDLUH OREMHW GH ELODQV
GpYDOXDWLRQ HVW H[DPLQpH SDU GHV UDSSRUWHXUV TXL WUDYDLOOHQW HQ ELQ{PHV GH
diffrentes sensibilits politiques, de manire assurer le pluralisme de leurs
analyses. Sous rserve des contraintes du calendrier parlementaire, chacun de ces
ELODQV IDLW OREMHW GXQ GpEDW GH FRQWU{OH HQ VpDQFH SXEOLTXH HQ SUpVHQFH GX
ministre responsable.
Pour la session 2013-2014, la commission snatoriale pour le contrle de
ODSSOLFDWLRQGHVORLs a FKRLVLGHIIHFWXHU VHSWELODQVGpYDOXDWLRQ portant sur :
la loi du 23 juillet 2010 relatives aux chambres de commerce et
GLQGXVWULH HQOLDLVRQDYHFODFRPPLssion des Affaires conomiques) ;

(1) 5DSSRUW GLQIRUPDWLRQ Q  VXU OpYDOXDWLRQ GH ODGpTXDWLRQ HQWUH ORIIUH HW OHV EHVRLQV GH IRUPDWLRQ
SURIHVVLRQQHOOHGpSRVpSDUOHFRPLWpGpYDOXDWLRQHWGHFRQWU{OHGHVSROLWLTXHVSXEOLTXHVHWSUpVHQWpSDU
les dputs Jeanine Dubi et Pierre Morange.
(2) 5DSSRUWGLQIRUPDWLon n VXUOpYDOXDWLRQGXSDTXHWpQHUJLH-climat de 2008 en France, dpos
SDUOHFRPLWpGpYDOXDWLRQHWGHFRQWU{OHGHVSROLWLTXHVSXEOLTXHVHWSUpVHQWpSDUOHVGpSXWpV-HDQ-Jacques
Guillet et Franois de Rugy.

131

la lRL GX  MXLOOHW  WHQGDQW j IDFLOLWHU OXWLOisation des rserves
militaires et civiles en cas de crise majeure ;
la loi du 1er aot 2008 sur les droits et obligations des demandeurs
GHPSORL ;
la loi du 28 octobre 2009 sur la parit de financement entre les coles
lmentaires accueillant des lves scolariss hors de leur commune de rsidence,
dite loi Carle ;
la loi du 24 janvier 2012 relative Voies navigables de France (en
liaison avec la commission du Dveloppement durable) ;
les dispositions lgislatives relatives aux pouvoirs de sanction des
rgulateurs financiers (en liaison avec la commission des Finances) ;
les dispositions lgislatives rcentes sur la lutte contre la prcarit dans
OD )RQFWLRQ SXEOLTXH HW OLQWpJUDWLRQ GHV FRQWUDFWXHOV HQ OLDLVRQ DYHF OD
commission des Lois).
Lors de son audition, le prsident de la commission snatoriale pour le
FRQWU{OHGHODSSOLFDWLRQGHVORLV0 David Assouline, a insist sur le fait que ces
ELODQV GpYDOXDWLRQ QH VH FRQWHQWDLHQW SDV GXQ UHFHQVHPHQW VWDWLVWLTXH GHV
PHVXUHV GDSSOLFDWLRQ PDLV FRPSRUWDLHQW XQH H[SHUWLVH SRXVVpH GH OLPSDFW GHV
QRUPHV FRQFHUQpHV ,O D H[SOLTXp TXH FHVW GDLOOHXUV OpYDOXDWLRQ SDU VD
commission de ODORLGXIpYULHUSRXUOpJDOLWpGHVGURLWVHWGHVFKDQFHVOD
participation et la citoyennet des personnes handicapes qui avait permis de
VRXOLJQHU QRWDPPHQW TXRQ QDUULYHUDLW SDV j SHUPHWWUH ODFFHVVLELOLWp GHV
personnes handicapes tous les lieux publics en 2015 et conduit le
*RXYHUQHPHQW j QRPPHU OXQH GH QRV UDSSRUWHXUHV SDUOHPHQWDLUH HQ mission
pour faire des recommandations lgislatives .
Comme la mission a pu le constater lors de son dplacement Bruxelles,
le 16 janvier 2014, nos voisins belges ont cr au sein de leur Parlement un organe
comparable la commission snatoriale pour lHFRQWU{OHGHODSSOLFDWLRQGHVORLV
En effet, une loi organique du 25 avril 2007 a cr un comit
parlementaire charg du suivi lgislatif, organe commun la Chambre des
reprsentants et au Snat de Belgique, et compos de 11 dputs et de
11 snateurs. Ce comit procde des valuations ex post de certains dispositifs
OpJLVODWLIV TXLO VpOHFWLRQQH DSUqV DYRLU LGHQWLILp OHV GLIILFXOWpV GDSSOLFDWLRQ GHV
auxquels ils se heurtent grce :
aux requtes dont tous les citoyens belges peuvent, depuis le 1 er mai
2013, saisir le Parlement (via un site Internet (1) ) ;
(1) Ce site est consultable au lien suivant : http://www.comitesuivilegislatif.be/indexF.html.
Ce systme des requtes a fait suite des initiatives populaires comme le G 1000 , groupe de mille
FLWR\HQV D\DQW SULV OLQLWLDWLYH GH GpOLEpUHU VXU OHV GLIIicults pratiques rencontres dans le cadre de
ODSSOLFDWLRQGHVQRUPHV YRLUKWWSZZZJRUJIUPDQLIHVWHSKS 
Peuvent introduire une requte : les personnes physiques, les personnes morales de droit priv ou public,
les services administratifs charJpV GH ODSSOLFDWLRQ GXQH ORL HW OHV DXWRULWpV SXEOLTXHV FKDUJpHV GH

132

aux rapports annuels de la Cour constitutionnelle et du ministre public


(procureur gnral prs la Cour de cassation et Collge des procureurs gnraux)
qui signalent aux commissions parlementaires et aux ministres comptents les
GLIILFXOWpV FRQFUqWHV UHQFRQWUpHV GDQV OH FDGUH GH ODSSOLFDWLRQ Ru de
OLQWHUSUpWDWLRQGHVORLV
En France aussi, les rapports annuels des juridictions judiciaires et
administratives contribuent jOpYDOXDWLRQex post GHOLPSDFWGHVWH[WHVYRWpVSDU
le Parlement.
2. Ce que font les juridictions

a. Les rapports de la Cour de cassation


La Cour de cassation participH GXQH FHUWDLQH IDoRQ j OpYDOXDWLRQ GHV
GLVSRVLWLIV DGRSWpV SDU VHV UDSSRUWV DQQXHOV /DUWLFOH 5 431-9 du code de
ORUJDQLVDWLRQMXGLFLDLUHUHODWLIDXIRQFWLRQQHPHQWGHOD&RXUGHFDVVDWLRQSUpFLVH
HQHIIHWTXil est fait rapport annuellement au prsident de la Rpublique et au
garde des sceaux, ministre de la justice, de la marche des procdures et de leurs
GpODLVGH[pFXWLRQ (WODUWLFOH5 431-10 du mme code ajoute que le premier
SUpVLGHQWHWOHSURFXUHXUJpQpUDOSHXYHQWDSSHOHUODWWHQWLRQGXJDUGHGHVVFHDX[
PLQLVWUH GH OD MXVWLFH VXU OHV FRQVWDWDWLRQV IDLWHV SDU OD &RXU j ORFFDVLRQ GH
OH[DPHQ des pourvois et lui faire part des amliorations qui leur paraissent de
nature remdier aux difficults constates .
cette occasion, la Haute juridiction prsente, dans la deuxime partie de
son rapport, des suggestions de modifications lgislatives ou rglementaires,
tandis que la troisime partie dudit rapport est consacre une tude, dsormais
unique depuis 2006, sur un thme particulier (la preuve en 2012, le risque en
OHGURLWGHVDYRLUHQ 
b. /HVUDSSRUWVGX&RQVHLOGeWDW
Le Conseil GeWDW FRQWULEXH OXL DXVVL j OpYDOXDWLRQ GHV SROLWLTXHV
SXEOLTXHVSDUOHUDSSRUWSXEOLFHWOpWXGHTXLOSURGXLWFKDTXHDQQpH
/H UDSSRUW DQQXHO TXH OH &RQVHLO GeWDW UHPHW DX 3UpVLGHQW GH OD
Rpublique est prpar par la section du rapport et des tudesVRXVODXWRULWpGH
VRQ SUpVLGHQW DVVLVWp GXQ UDSSRUWHXU JpQpUDO DYHF ODLGH GHV DXWUHV VHFWLRQV GX
&RQVHLO GeWDW ,O HQJDJH WRXWH OLQVWLWXWLRQ SXLVTXLO HVW DGRSWp SDU O$VVHPEOpH
gnrale.

FRQWU{OHU ODSSOLFDWLRQ GXQH ORL -XVTXDX GpEXW GH ODQQpH OH FRPLWp SDUOHPHQWDLUH FKDUJp GX VXLYL
OpJLVODWLIQDpWpVDLVLTXHGHQYLURQUHTXrWHVWRXWHVGpSRVpHVSDUGHVSHUVRQQHs physiques.
Pour tre recevable, la requte doit porter sur une loi en vigueur depuis au moins trois ans et tre assortie
GXQUpVXPpGXSRLQWGHYXHGHODGPLQLVWUDWLRQGHODORLHQFDXVH administration qui devra donc avoir
t pralablement interroge VXU OHV GLIILFXOWpV GDSSOLFDWLRQ OHV ODFXQHV LQFRKpUHQFHV HUUHXUV
contradictions, obsolescences ou ambiguts dnonces.

133

Ce rapport a un contenu triple : il fait le point des activits contentieuses et


DGPLQLVWUDWLYHVGX&RQVHLOGeWDWDXFRXUVGHODQQpHpFRXOpHDWWLUHODWWHQWLRQGHV
SRXYRLUVSXEOLFVVXUOHVGLIILFXOWpVUHQFRQWUpHVSDUOHVMXVWLFLDEOHVGDQVOH[pFXWLRQ
des dcisions des juridictions administratives et tudie une question de fond sur
lequel il propose des orientations de la pratique administrative voire des
modifications de dispositions lgislatives ou rglementaires. Ces tudes annuelles
ont par exemple port sur le droit souple en 2013, sur les agences en 2012 ( Les
agences, une nouvelle gestion publique ? ), sur les consultations en 2011
( Consulter autrement, participer effectivement VXUOHGURLWGHOHDXHQHW
sur le droit au/du logement en 2009.
/DUWLFOH / 112-3 du code de justice administrative prvoit en effet que
OH&RQVHLOGeWDWSHXWGHVDSURSUHLQLWLDWLYHDSSHOHUODWWHQWLRQGHVSRXYRLUV
SXEOLFVVXUOHVUpIRUPHVGRUGUHOpJLVODWLIUpJOHPHQWDLUHRXDGPLQLVWUDWLITXLOXL
SDUDLVVHQWFRQIRUPHVjOLQWpUrWJpQpUDO .
Par ailleurs, un certaiQQRPEUHGpWXGHVGHIRQGFRPPDQGpHVDX&RQVHLO
GeWDW SDU OH 3UHPLHU PLQLVWUH VRQW FRQGXLWHV SDU OD VHFWLRQ GX UDSSRUW HW GHV
pWXGHV 3DUWLFLSHQW j FHV pWXGHV GHV PHPEUHV GX &RQVHLO GeWDW DSSDUWHQDQW j
GDXWUHV VHFWLRQV PDLV DXVVL GHV SHUVRQQDOLWpV IUanaises ou trangres,
QDSSDUWHQDQW SDV DX &RQVHLO GeWDW &HVW DLQVL TXHQ  OH &RQVHLO GeWDW D
produit, la demande du Premier ministre, une tude sur le rescrit. Des tudes ont
pJDOHPHQW pWp UpDOLVpHV VXU OLQVWLWXWLRQ GXQ SDUTXHW HXURSpHQ HQ 2011, sur le
GpYHORSSHPHQWGHODPpGLDWLRQGDQVOHFDGUHGHO8QLRQ(XURSpHQQHHQVXU
la rvision des lois de biothique en 2009, ou encore sur le droit de premption
ainsi que sur les recours administratifs pralables obligatoires (RAPO) en 2008.
OLQVWDUGHODMXULGLFWLRQDGPLQLVWUDWLYHVXSUrPHODMXULGLFWLRQILQDQFLqUH
VXSUrPHFRQFRXUWjOpYDOXDWLRQex post des politiques publiques.
3. Ce que fait la Cour des comptes

La Cour des comptes est une juridiction indpendante laquelle


ODUWLFOH 47- GH OD &RQVWLWXWLRQ FRQILH OD PLVVLRQ GH VDVVXUHU GXERQ HPSORL GH
ODUJHQWSXEOLFHWGHQLQIRUPHUOHVFLWR\HQV/HVFRQWU{OHVHWOHVpYDOXDWLRQVGHOD
&RXUGHVFRPSWHVSRUWHQWVXUODUpJXODULWpOHIILFLHQFHHWOHIILFDFLWpGHOXVDJHGH
ODUJHQW SXEOLF (OOH SURFqGH j FH WLWUH j OH[DPHQ GHV FRPSWHV SXEOLFV HW j OD
FHUWLILFDWLRQGHVFRPSWHVGHOeWDWHWGHODVpFXULWpVRFLDOH
Des recommandations accompagnent les observations de la Cour dans tous
ses rapports publics. Ce sont des mesures concrtes pour remdier aux gaspillages
et pour faire progresser la gestion des services publics au meilleur cot. La Cour
VDVVXUHGHODPLVHHQXYUHGHVHVUHFRPPDQGDWLRQVHWGHVVXLWHVTXLOHXUVRQW
donnes.
La Cour des comptes se situe quidistance du Parlement et du
*RXYHUQHPHQW TXHOOH DVVLVWH OXQ HW ODXWUH /D UpIRUPH FRQVWLWXWLRQQHOOH GX

134

23 juillet DUHQIRUFpOLQWHUDFWLRQHQWUHOH3DUOHPHQWHWOD&RXUGHVFRPSWHV.
La loi constitutionnelle n 2008-724 de modernisation des institutions de la
Ve Rpublique a en effet introduit dans la Constitution un article 47-2 dont le
premier alina dispose que la Cour des comptes assiste le Parlement dans le
FRQWU{OH GH ODFWLRQ GX *RXYHUQHPHQW  HW TX elle assiste le Parlement et le
Gouvernement dans le cRQWU{OH GH OH[pFXWLRQ GHV ORLV GH ILQDQFHV HW GH
ODSSOLFDWLRQ GHV ORLV GH ILQDQFHPHQW GH OD VpFXULWp VRFLDOH DLQVL TXH GDQV
OpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHV .
En vertu de cette disposition, la Cour des comptes apporte son concours
aux travaux de lDPLVVLRQGpYDOXDWLRQHWGHFRQWU{OH 0(& PLVHHQSODFHDXVHLQ
GH OD FRPPLVVLRQ GHV )LQDQFHV GH O$VVHPEOpH QDWLRQDOH /D &RXU HVW FRQVXOWpH
SDUOD0(&SUpDODEOHPHQWDXFKRL[GHVWKqPHVGLQYHVWLJDWLRQTXLVHURQWUHWHQXV
et ses membres assistent aux runions de la MEC.
'H OD PrPH IDoRQ OHV PLVVLRQV GpYDOXDWLRQ HW GH FRQWU{OH GHV ORLV GH
financement de la scurit sociale (MECSS) cres en 2004 au sein des
FRPPLVVLRQVGHV$IIDLUHVVRFLDOHVGHO$VVHPEOpHQDWLRQDOHHWGX6pQDWSHXYHQW
VROOLFLWHUODSSXi de la Cour des comptes dont les membres peuvent participer aux
travaux des missions en question. La Cour procde en outre des enqutes sur les
organismes de scurit sociale soumis son contrle afin de transmettre ses
conclusions aux MECSS qui peuvenW HQ RXWUH FROODERUHU DYHF O,QVSHFWLRQ
gnrale des Affaires sociales (IGAS).
/D &RXU DVVLVWH HQILQ OH FRPLWp GpYDOXDWLRQ HW GH FRQWU{OH GHV
politiques (CEC) dans le cadre de deux valuations annuelles dont les thmes sont
UHWHQXVGXQFRPPXQDFFRUGHQWUe la Cour et le CEC.
4. Ce que fait le Conseil conomique, social et environnemental

Le conseil conomique, social et environnemental (CESE) est une


DVVHPEOpH FRQVXOWDWLYH GRQW OH[LVWHQFH HVW IL[pH SDU OD &RQVWLWXWLRQ WLWUH ;,
articles 69 71) et qui compte 233 membres reprsentant la vie conomique et
associative (salaris, entreprises industrielles et commerciales, professions
DJULFROHV DUWLVDQDOHV HW OLEpUDOHV DVVRFLDWLRQV HW IRQGDWLRQV XYUDQW QRWDPPHQW
dans le domaine de la protection de la nature HWGHOHQYLURQQHPHQW 
Par la reprsentation des principales activits conomiques, sociales et
environnementales, le CESE favorise la collaboration des diffrentes catgories
socioprofessionnelles entre elles et assure leur participation la dfinition et
OpYDOXation des politiques publiques.
Le CESE a vu ses comptences et missions largies la suite de la
rforme constitutionnelle du 23 juillet 2008 et de la loi organique n 2010-704 du
28 juin 2010. Parmi ses cinq missions figure celle de contriEXHUjOpYDOXDWLRQGHV
politiques publiques caractre conomique, social et environnemental. Pour

135

VDFTXLWWHU GH FHWWH PLVVLRQ OH &(6( VHVW GRWp HQ QRYHPEUH  GXQH
dlpJDWLRQjODSURVSHFWLYHHWjOvaluation des politiques publiques.
Cette valuDWLRQ SHXW SUHQGUH OD IRUPH GpWXGHV destines dresser un
premier bilan sur une thmatique sans pour autant donner lieu la formulation de
propositions. 7RXWHIRLVFHVpWXGHVSHXYHQWrWUHWUDQVIRUPpHVHQSURMHWVGDYLVTXL
dressent un bilan exhaustif du sujet trait et prsentent les propositions concrtes
que le CESE adresse aux dcideurs politiques.
Les diffrents rapports, avis et tudes produits par le CESE rsultent soit
GXQH saisine gouvernementale ou parlementaire, soit de sa propre initiative
(DXWRVDLVLQH  VRLW GXQH VDLVLQH SDU YRLH GH SpWLWLRQ SRUWDQW VXU toute question
caractre conomique, social et environnemental et signe par au moins
500 000 personnes majeures (de nationalit franaise ou rsidant rgulirement en
France).
5. Ce que font les services et les FRUSVGLQVSHFWLRQGHOH[pFXWLI

/H[pFXWLIGLVSRVHGHQRPEUHX[RXWLOVGpYDOXDWLRQex post. La plupart des


PLQLVWqUHVVRQWGRWpVGXQHGLUHFWLRQGHODUHFKHUFKHGHVpWXGHVGHOpYDOXDWLRQ
de la prospective et/ou des statistiques. &HVWQRWDPPHQWOHFDVSRXUOHVPLQLVWqUHV
GHOeFRQRPLHHWGHV)LQDQFHVGHV$IIDLUHVVRFLDOHVHWGHODVDQWpGX7UDYDLOGH
OD &XOWXUH GH OeGXFDWLRQ QDWLRQDOH RX HQFRUH GX /RJHPHQW  FHV GLUHFWLRQV
VDMRXWHQW :
OHFRQVHLOJpQpUDOGHOHQYLURQQHPHQW et du dveloppement durable, dont
ODXWRULWp HQYLURQQHPHQWDOH UHQG des avis sur la qualit des valuations
environnementales des plans, programmes et projets et sur les mesures de gestion
visant viter, attnuer ou compenser les impacts ;
ODJHQFH QDWLRQDOH GH OpYDOXDWLRQ GH OHQVHLJQHPHQW VXSpULHXU HW GH OD
recherche (AERES), autorit administrative indpendante cre en 2007,
notamment pour valuer les formations et les diplmes des tablissements
Genseignement suprieur.
a. /HVFRUSVGLQVSHFWLRQ
LeVFRUSVGLQVSHFWLRQGHOeWDWSDUWLFXOLqUHPHQWO,QVSHFWLRQJpQpUDOHGHV
)LQDQFHV ,*) O,QVSHFWLRQJpQpUDOHGHVDIIDLUHVVRFLDOHV ,*$6 HWO,QVSHFWLRQ
JpQpUDOHGHODGPLQLVWUDWLRQ ,*$ FRQWULEXHQWjOpYDOXDWLRQex post de la qualit
oprationnelle de la lgislation.
/,*) H[HUFH XQH PLVVLRQ JpQpUDOH GH FRQWU{OH GDXGLW GpWXGH GH
FRQVHLO HW GpYDOXDWLRQ HQ PDWLqUH DGPLQLVWUDWLYH pFRQRPLTXH HW ILQDQFLqUH 
F{Wp GH VRQ WUDYDLO GLQVSHFWLRQ TXL SHUPHW j OeWDW GH FRQWU{OHU OHIILFDFLWp
financiqUH GHV VHUYLFHV GpFRQFHQWUpV GHV PLQLVWqUHV VHV PLVVLRQV GpYDOXDWLRQ
visent porter une apprciation sur des organismes ou des dispositifs publics et
VXJJpUHU GHV DPpOLRUDWLRQV (OOHV VLQVFULYHQW QRWDPPHQW GDQV OH FDGUH GH OD

136

rvision gnrale des politiques publiques (RGPP), et dans le contexte de


OH[DPHQGHOHIILFLHQFHGHVGpSHQVHVILVFDOHV FKLIIUDJHGHVQRXYHDX[GLVSRVLWLIV
ILVFDX[pYDOXDWLRQHWSLORWDJHGHVSROLWLTXHVGHPSORLHWF 
/,*$6HVWOHVHUYLFHDGPLQLVWUDWLIGHFRQWU{OHGDXGLWHWGpYDOXDWLRQGHV
SROLWLTXHVVRFLDOHVSODFpVRXVODXWRULWpGXPLQLVWUHGHV$IIDLUHVVRFLDOHVHWGHOD
Sant ainsi que du mLQLVWUH GX 7UDYDLO GH O(PSORL GH OD )RUPDWLRQ
professionnelle HW GX 'LDORJXH VRFLDO (OOH DVVXUH GHV PLVVLRQV GLQVSHFWLRQ GHV
services ou organismes publics ou privs bnficiant de concours publics ou
financs par des cotisations obligatoires. Elle value galement les politiques
publiques menes dans ses domaines de comptence, et suggre des volutions
souhaitables. Ce service effectue environ 200 missions par an et a ralis
217 rapports en 2013.
/,*$ FRUSV GLQVSHFWLRQ GX PLQLVWUH GH O,QWpULHXU HVW FKDUJpH GH
missions GpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHVGDXGLWGHVHUYLFHHWGDSSXLHWGH
conseil. Elle a une vocation LQWHUPLQLVWpULHOOH HW LQWHUYLHQW VXU OHQVHPEOH GHV
FKDPSV GDFWLRQ SXEOLTXH HQ UpSRQVH DX[ GHPDQGHV GH 3UHPLHU PLQLVWUH RX GH
tout autre membre du Gouvernement. Elle est trs implique sur les sujets de la
UpIRUPHGHOeWDWGHVOLEHUWpVSXEOLTXHVGHOD scurit, des collectivits locales et
GHV WHUULWRLUHV (Q PR\HQQH SOXV GXQH FHQWDLQH GH PLVVLRQV HW GH UDSSRUWV VRQW
raliss chaque anne (111 en 2012, 115 en 2013).
Le Contrle gnral conomique et financier (CGEFi), cr par le dcret
n 55-733 du 26 PDLUHODWLIDXFRQWU{OHpFRQRPLTXHHWILQDQFLHUGHOeWDW, a
pour mission GRSWLPLVHU OD JHVWLRQ GH ODUJHQW SXEOLF ,O LQWHUYLHQW GDQV GHV
RUJDQLVPHV GDQV OHVTXHOV OeWDW SRVVqGH GHV LQWpUrWV PDMRULWDLUHV TXHO TXH
soit leur statut (entreprises, tablissements publics, GIP), ou qui relvent de la
FDWpJRULHGHVRSpUDWHXUVGHOeWDWDLQVLTXHGHVRUJDQLVPHVLQGpSHQGDQWVGHOeWDW
autoriss percevoir (ou bnficiaires) des taxes, redevances ou cotisations
caractre obligatoire. Il apprcie les risques, notamment financiers, et mesure la
performance GHVRUJDQLVPHVTXLOFRQWU{OHSRXUDOHUWHUOHVGLULJHDQWVHWHQUHQGUH
compte aux directions de tutelles et aux ministres. En parallle de sa mission de
FRQWU{OHFHWRUJDQHGLVSRVHGXQH capacit dDQDO\VHFRPSDUDWLYHGHV\QWKqVHHW
de prospective TXLOPHWDXVHUYLFHGHVPLQLVWUHVVRXVIRUPHGHQRWHVSpULRGLTXHV
GDOHUWHV GpWXGHV DSSURIRQGLHV VXU GHV VXMHWV GDFWXDOLWp GRUJDQLVDWLRQ GH
FROORTXHV RX GDWHOLHUV FH TXL FRQWULEXH j OD TXDOLWp GHV dcisions des pouvoirs
publics.
/,QVSHFWLRQ JpQpUDOH GHV VHUYLFHV MXGLFLDLUHV ,*6-  D pWp FUppH SDU
ORUGRQQDQFHGX dcembre 1958 relative au statut de la magistrature. Charge
GXQHPLVVLRQSHUPDQHQWHGLQVSHFWLRQVXUOHQVHPEOHGHVGLUHFWLRQVHW services
GXPLQLVWqUHGHOD-XVWLFHDLQVLTXHVXUOHVMXULGLFWLRQVGHORUGUHMXGLFLDLUHHWVXU
les personnes morales de droit public ou priv, dont les activits sont lies celles
GXPLQLVWqUHO,*6-HVWDXVVLFKDUJpHGXQHPLVVLRQGDSSUpFLDWLRQGHODFWLYLWp
du fonctionnement et de la performance de ces juridictions, services et
organismes. Elle met toutes les recommandations et observations utiles. Le

137

UDSSRUWDQQXHOGDFWLYLWpGHO,*6-UHWUDFHOHVVHQWLHOGHVPLVVLRQVGHFRQWU{OHGH
fonctionnement et prsente une synthse des principales prconisations.
/,*6-SHXWrWUHVDLVLHSDUOHJDUGHGHV6FHDX[ORUVTXHFHGHUQLHUVRXKDLWH
SRXYRLU GLVSRVHU GpOpPHQWV GDSSUpFLDWLRQ VXU OD QpFHVVLWp OD IDLVDELOLWp RX
OLPSDFW GXQH UpIRUPH  HQ OLHQ DYHF OHV politiques publiques du ministre de la
-XVWLFHHWGHV/LEHUWpV(OOHFRQGXLWDORUVVHVWUDYDX[HQH[pFXWLRQGXQHOHWWUHGH
PLVVLRQFRQMRLQWHPHQWDYHFGHVVHUYLFHVRXFRUSVGLQVSHFWLRQGDXWUHVPLQLVWqUHV
FRPPHO,*)O,*$RXO,*$6/,*6-WUDYDLOOHVelon une mthodologie proche
GHODXGLWVHVPLVVLRQVGHFRQWU{OHVDSSXLHQWVXUGHV rfrentiels labors en
IRQFWLRQGXQHDQDO\VHGHVULVTXHV
b. Le commissariat gnral la stratgie et la prospective
Cr par le dcret n 2013-333 du 22 avril 2013, et se substituant ainsi au
CeQWUH GDQDO\VH VWUDWpJLTXH OH Fommissariat gnral la stratgie et la
prospective (CGSP) apporte son concours au Gouvernement pour la dtermination
GHVJUDQGHVRULHQWDWLRQVGHODYHQLUGHODQDWLRQHWGHVREMHFWLIVjPoyen et long
termes de son dveloppement conomique, social, culturel et environnemental et
SDUWLFLSHjOpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHV
Le Commissariat gnral travaille en rseau avec huit organismes
comptences sectorielles : OH &RQVHLO GDQDO\VH pFRQRPLTXH OH &RQVHLO
GRULHQWDWLRQGHVUHWUDLWHVOH&RQVHLOGRULHQWDWLRQSRXUOHPSORLOH+DXW&RQVHLO
GH OD IDPLOOH OH +DXW &RQVHLO SRXU ODYHQLU GH ODVVXUDQFH PDODGLH OH +DXW
Conseil du financement de la protection sociale, lH&RQVHLOQDWLRQDOGHOLQGXVWULH
OH&HQWUHGpWXGHVSURVSHFWLYHVHWGLQIRUPDWLRQVLQWHUQDWLRQDOHV/Hcommissaire
en coordonne les travaux.
Celui-ci tablit un rapport annuel, remis au Prsident de la Rpublique et
au Premier ministre et transmis au Parlement. Ses rapports et avis sont rendus
publics.
'DQV OH FDGUH GH VD PLVVLRQ GpYDOXDWLRQ GHV SROLWLTXHV SXEOLTXHV OH
CGSP peut tre nomm responsable de comit de suivi de certaines rformes.
Un comit de suivi du CICE a ainsi t cr le 25 juillet 2013, et runit huit
partenaires sociaux reprsentatifs au niveau national interprofessionnel, les
reprsentants des administrations comptentes, ainsi que la Banque de France, le
&RPPLVVDULDW JpQpUDO j OLQYHVWLVVHPHQW O$JHQFH FHQWUDOH GHV RUJDQLVPHV GH
scurit sociale (ACOSS) et deux experts. Outre sa mission consistant effectuer
un suivi rgulier du dispositif et de ses effets, le rle du comit est de dfinir, dans
OD FRQFHUWDWLRQ OHV PRGDOLWpV GXQH pYDOXDWLRQ GX &,&( WUDQVSDUHQWH HW
indpendante.
c. /HVHFUpWDULDWJpQpUDOSRXUODPRGHUQLVDWLRQGHODFWLRQSXEOLTXH
&UppSDUXQGpFUHWGXRFWREUHHWSODFpVRXVODXWRULWpGX3UHPLHU
ministre, le secrtariat gnral pour la modHUQLVDWLRQ GH ODFWLRQ

138

publique (SGMAP) est mis disposition du ministre charg de la Rforme de


OeWDW
/H6*0$3UHJURXSHOHQVHPEOHGHVVHUYLFHVHQFKDUJHGHODSROLWLTXHGH
PRGHUQLVDWLRQ MXVTXDORUV GLVSHUVpV HW UpXQLW HQ VRQ VHLQ : la direction
LQWHUPLQLVWpULHOOH SRXU OD PRGHUQLVDWLRQ GH ODFWLRQ SXEOLTXH ',0$3 
ancieQQHPHQW GLUHFWLRQ JpQpUDOH j OD PRGHUQLVDWLRQ GH OeWDW  OD GLUHFWLRQ
LQWHUPLQLVWpULHOOH GHV V\VWqPHV GLQIRUPDWLRn et de communication de
OeWDW (DISIC) ; la mission charge de la mise disposition des donnes
publiques (Etalab).
/D ',0$3 DLGH j OpYDOXation des politiques publiques. Son service
valuation et appui aux administrations anime et coordonne les travaux
GpYDOXDWLRQHWDSSXLHOHVDGPLQLVWUDWLRQVGDQVOHXUs actions de modernisation. Il
accompagne en particulier les ministres dans la mise HQXYUHGHVFKDQWLHUVLVVXV
GXFRPLWpLQWHUPLQLVWpULHOGHPRGHUQLVDWLRQGHODFWLRQSXEOLTXH &,0$3 ,OOHV
aide identifier les leviers de modernisation ncessaires leurs transformations :
conduite du changement, optimisation des organisations, des processus, des
V\VWqPHVGLQIRUPDWLRQ
9RWUH UDSSRUWHXU QH VDWWDUGHUD SDV GDYDQWDJH VXU OD SUpVHQWDWLRQ GHV
innombrables comits, commissions, directions, inspections, commissariats et
secrtariats gnraux qui XYUHQWDXMRXUGKXLjOpYDOXDWLRQex post des textes que
QRXV YRWRQV HW GHV SROLWLTXHV SXEOLTXHV GDQV OHVTXHOOHV LOV VLQVqUHQW &HWWH
SUpVHQWDWLRQ TXL QH VH YHXW SDV H[KDXVWLYH PRQWUH DVVH] TXHQ OD PDWLqUH OHV
WUDYDX[ VRQW DERQGDQWV FH GRQW LO IDXW VH UpMRXLU WRXW HQ VLJQDODQW OLQWpUrW
quLO y aurait sans doute les coordonner davantage pour viter des doublons.
B. UNE VALUATION QUI GAGNERAIT TRE MIEUX COORDONNE.

&RPPH OD IRUW MXVWHPHQW UHPDUTXp ORUV GH VRQ DXGLWLRQ


M. David Assouline, prsident de la commission snatoriale pour le contrle de
ODSSOLFDWLRQ GHV ORLV les deux chambres se livrent parfois aux mmes
contrles HWODFWLRQPHQpHSDUODFRPPLVVLRQTXLOSUpVLGH rejoint celle de la
FRPPLVVLRQFKDUJpHGHOpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHVGHYRWUHDVVHPEOpH
le contrOHGHODSSOLFDWLRQGHODORLpWDQWLQGLVVRFLDEOHGHFHWWHpYDOXDWLRQ . Et
0'DYLG$VVRXOLQHGDMRXWHU : dans ODPHVXUHRORQDSHXGHPR\HQVDXWDQW
les rationaliser .
&HVW DXVVL OH SRLQW GH YXH GH YRWUH UDSSRUWHXU TXL HVWLPH TXLO VHUDLW
possible GH JDJQHU GX WHPSV HW GpFRQRPLVHU GHV PR\HQV VL OHV WUDYDX[
GpYDOXDWLRQFRQGXLWVSDUOHVGLYHUVRUJDQHVHWVHUYLFHVGX3DUOHPHQWGHOH[pFXWLI
et par des institutions comme la Cour des comptes ou le CESE taient mieux
coordonns.

139

M. David Assouline a sRXOLJQp TXDX 6pQDW OD FRPPLVVLRQ SRXU OH


FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV YHLOODLW j QH SDV SURFpGHU j GHV pYDOXDWLRQV
similaires dj conduites par une commission permanente.
4XDQG OD FRPPLVVLRQ SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV GpFLGH
Gtudier tel sujet ou telle loi, elle le fait en concertation avec la commission
comptente et son prsident, qui mobilise en gnral une personne de son quipe
administrative . 4XDQWDXUDSSRUWDQQXHOVXUODSSOLFDWLRQGHVORLVLOHVW ralis
partir de rapports pralablement tablis par chaque prsident de commission
permanente dans son domaine de comptences. Ceux-ci, qui sont quantitatifs et,
de plus en plus, qualitatifs, sont pralablement dbattus et adopts par la
commission concerne. La dconcentration du travail permet ainsi de rpartir
intelligemment la charge en tenant compte des comptences de chacun .
Une fois que les commissions permanentes et les diffrents organes
GpYDOXDWLRQ GH FKDTXH DVVHPEOpH SDUOHPHQWDLUH VH VHURQW FRQFHUWpV SRXU GpIinir
XQSURJUDPPH DQQXHO YRLUH SOXULDQQXHO GpYDOXDWLRQ RQ SRXUUDLW LPDJLQHU SRXU
reprendre la formule de M. David Assouline, TX il y ait une coordination
rgulire entre nos deux assembles sur le bilan des lois values, les rapports
raliss, le programme de travail . &HGHUQLHUDGDLOOHXUVVXJJpUpTXHFHWUDYDLO
GH FRRUGLQDWLRQ VHIIHFWXH HQWUH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH
ODSSOLFDWLRQ GHV ORLV HW OH FRPLWp GpYDOXDWLRQ HW GH FRQWU{OH GHV SROLWLTXHV
SXEOLTXHVGHO$VVHPEOpHQDWLRnale (1) .
Du point de vue de votre rapporteur, cet effort de coordination ne doit pas
tre entrepris par le Parlement uniquement. Il doit associer les institutions, telles
TXHOD&RXUGHVFRPSWHVRXOH&(6(DLQVLTXHOHVVHUYLFHVGHOH[pFXWLITXLVH
consacrent OpYDOXDWLRQex post.
Aussi est-FHODUDLVRQSRXUODTXHOOHYRWUHUDSSRUWHXUVXJJqUHORUJDQLVDWLRQ
GXQH FRQIpUHQFH GHV pYDOXDWHXUV FKDUJpH GH FRRUGRQQHU OHV GLYHUVHV LQLWLDWLYHV
SULVHVHQPDWLqUHGpYDOXDWLRQex post de faon viter des doublons, et donc une
SHUWHGHWHPSVGpQHUJLHHWGHPR\HQV

(1) 9RLU OH 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session
parlementaire 2012-2013, fait, DXQRPGHODFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHV
lois, par le snateur David Assouline, 17 juin 2014, p. 9 : Il a galement prconis une meilleure
FRRUGLQDWLRQ GH O$VVHPEOpH HW GX 6pQDW VXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV HW OpYDOXDWLRQ GHV
politiques publiques - QRWDPPHQW DYHF OH FRPLWp GpYDOXDWLRQ GHV SROLWLTXHV SXEOLTXHV GH O$VVHPEOpHSRXUpYLWHUOHVGRXEORQVPLHX[UpSDUWLUOHWUDYDLOGHFRQWU{OHHWIDYRULVHUOHSDUWDJHGH[SpULHQFH .

140

Proposition n 13 &ODULILHUOHSD\VDJHGHOpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHV
Organiser une confrence des valuateurs pour mieux coordonner les initiatives en
PDWLqUH GpYDOXDWLRQ H[ SRVW DXMRXUGKXL SULVHV SDU O$VVHPEOpH QDWLRQDOH OH
Snat, la Cour des comptes, le Conseil conomique, social et environnemental, les
FRUSVGLQVSHFWLRQRXDXWUHV ,*),*$6,*$,*6-&*(),6*0$3 
II. 5(1'5(/e9$/8$7,21EX POST DE LA NORME PLUS MTHODIQUE

0LHX[FRRUGRQQpHOpYDOXDWLRQex post de la norme gagnerait aussi tre


plus mthodique.
/D SURSRVLWLRQ IDLWH SDU OD PLVVLRQ GHQULFKLU OH FRQWHQX GHV pWXGHV
GLPSDFWex ante GHIDoRQjFHTXHOOHVLGHQWLILHQWPLHX[OHVLQGLFDWHXUVSUpFLVVXU
le fondemenW GHVTXHOV VH IRQGHUD OpYDOXDWLRQ ex post (proposition n 1) est de
nature rendre cette dernire plus mthodique.
(Q HIIHW FRPPH OD H[SOLTXp GHYDQW OD PLVVLRQ 0 'LGLHU 0LJDXG
Premier prsident de la Cour des comptes, pYDOXHUXQHUpIRUPHTXLQDSas t
FRQoXH GqV ORULJLQH GDQV OD SHUVSHFWLYH GrWUH XQ MRXU pYDOXpH HVW XQH WkFKH
lourde, difficile et souvent improductive. Il faut identifier les objectifs viss, qui ne
sont pas toujours clairement formuls, trouver les donnes quantitatives et
qualitatives permettant de voir si ces objectifs sont atteints et inciter les
administrations elles-PrPHVjpYDOXHUOLPSDFWGHVUqJOHVGRQWHOOHVRQWSURSRVp
ODGRSWLRQ&HODUHSUpVHQWHXQWUDYDLOLPSRUWDQWTXLQDERXWLWSDVWRXMRXUVIDXWH
de donnes dispoQLEOHV $XWUHPHQW GLW VL ORQ VH FRQWHQWH GH UHQIRUFHU
OpYDOXDWLRQex post, la Cour sera mme de livrer un nombre rduit de travaux.
6L DX FRQWUDLUH OH OpJLVODWHXU HW ODGPLQLVWUDWLRQ FRQoRLYHQW GHV GLVSRVLWLIV GH
qualit, qui identifient des objectifs clairs et prvoient la collecte de donnes afin
de vrifier dans quelle mesure ils sont atteints, la Cour sera en mesure de vous
livrer des valuations ex post plus utiles et plus nombreuses .
2XWUH FHW HQULFKLVVHPHQW GHV pWXGHV GLPSDFW ex ante TXD galement
prconis M. David Assouline, prsident de la commission snatoriale pour le
contrle dH ODSSOLFDWLRQ GHV ORLV, la mission propose de mieux organiser
OpYDOXDWLRQex post HQGpYHORSSDQWOLQVHUWLRQGDQVFHUWDLQHVORLVGHFODXVHVGH
rvision imposant un rexamen des dispositifs vots au bout de plusieurs annes
GH PLVH HQ XYUH HW HQ V\VWpPDWLVDQW OpODERUDWLRQ GH UDSSRUWV GpYDOXDWLRQ DX
WHUPHGXQGpODLGHWURLVDQVDSUqVOHQWUpHHQYLJXHXUGHVORLVDGRSWpHV
A. DVELOPPER /,16(57,21 '( &/$86ES
CERTAINS TYPES DE LOI.

DE

RVISION

DANS

Si le lgislateur franais a adopt depuis longtemps une pratique tendant


introduire, dans certains types de loi, des clauses de rvision, celle-ci ne parat pas
aussi contraignante que celle retenue chez nos voisins britanniques et allemands.

141

1. La pratique franaise des clauses de rvision

Les clauses de rvision ne sont pas inconnues du lgislateur franais, qui


en a fait usage dans certains types de loi, par exemple dans les lois de biothique.
(QHIIHWODUWLFOHGHODORLQ 94-654 du 29 juillet 1994 relative au don
HWjOXWLOLVDWLRQGHVpOpPHQWVHWSURGXLWVGXFRUSVKXPDLQjODVVLVWDQFHPpGLFDOH
la procration et au diagnostic prnatal dispose que ODSUpVHQWHORLIHUDOREMHW
apUqV pYDOXDWLRQ GH VRQ DSSOLFDWLRQ SDU O2IILFH SDUOHPHQWDLUH GpYDOXDWLRQ GHV
choix scientifiques et technologiques [OPECST] GXQ QRXYHO H[DPHQ SDU OH
Parlement dans un dlai maximum de cinq ans aprs son entre en vigueur .
Le fait est que ce nouvel exaPHQ QD SDV HX OLHX FLQT DQV PDLV GL[ DQV
DSUqVOHQWUpHHQYLJXHXUGHODORLGXMXLOOHWjORFFDVLRQGHVGpEDWVVXUOD
loi n 2004-800 du 6 aoW  UHODWLYH j OD ELRpWKLTXH /DUWLFOH  GH FHWWH
GHUQLqUH ORL SUpYRLW TXHOOH IHUD OREMHW GDQV XQ GpODL GH TXDWUH DQV GXQH
pYDOXDWLRQ GH VRQ DSSOLFDWLRQ SDU O23(&67 DLQVL TXH GXQ QRXYHO H[DPHQ
GHQVHPEOHSDUOH3DUOHPHQWGDQVXQGpODLPD[LPXPGHFLQTDQVDSUqVVRQHQWUpH
en vigueur .
8QH QRXYHOOH IRLV OH GpODL IL[p SDU OD ORL SRXU TXLO VRit procd sa
UpYLVLRQ QD SDV pWp UHVSHFWp SXLVTXH FH QHVW TXH VHSW DQV SOXV WDUG TXH OH
Parlement a t saisi de la loi n 2011-814 du 7 juillet 2011 relative la
ELRpWKLTXH /article 47 GH FHWWH ORL SUpYRLW TXHOOH IHUD OREMHW GDQV XQGpODL GH
sL[DQVGXQHpYDOXDWLRQGHVRQDSSOLFDWLRQSDUO23(&67HWTXHOOHVHUDVRXPLVH
un QRXYHO H[DPHQ GHQVHPEOH SDU OH 3DUOHPHQt dans un dlai maximal de
sept ans aprs son entre en vigueur - VRLWGLFL
9RWUHUDSSRUWHXUIRUPHOHYXTXHOHGpODLde rexamen fix par la clause
GH UpYLVLRQ VHUD FHWWH IRLV UHVSHFWp FDU MXVTXLFL OLUUpJXODULWp DYHF ODTXHOOH OH
3DUOHPHQWIUDQoDLVVDVWUHLQWjDSSOLTXHUOHVFODXVHVGHUpYLVLRQTXLODOXL-mme
votes contraste avec la discipline avec laquelle certains Parlements europens se
plient aux exigences rsultant de telles clauses.
2. Les pratiques britannique et allemande des clauses de rvision

a. Les clauses de rvision et de caducit au Royaume-Uni


Le Royaume-8QLQRSqUHSDVGHGLVWLQFWLRQHQWUHOHGRPDLQHGH la loi et
celui du rglement. En revanche, il opre une distinction entre la lgislation dite
primaire et la lgislation dite secondaire ou dlgue .
/D OpJLVODWLRQ SULPDLUH HVW FHOOH GRQW OLPSRUWDQFH HW OH FDUDFWqUH GH
JpQpUDOLWpVRQWWHOVTXHOle doit tre adopte par le Parlement sous forme de lois.
La lgislation secondaire ou dlgue est celle dont le degr de technicit
RXGHSUpFLVLRQHVWWHOTXHOOHSHXWrWUHpGLFWpHSDUOH*RXYHUQHPHQWLOVDJLWGHV
ordonnances et des actes rglementaires (dcrets, arrts, etc.).

142

La lgislation primaire, sauf si elle est relative la fiscalit, est dsormais


REOLJDWRLUHPHQWDVVRUWLHGXQHFODXVHGHUpYLVLRQ  review clause ) qui impose
son valuation ex post dans un dlai maximal de cinq ans compter de son entre
en vigueur.
La lgislation secondaire, sauf si elle a trait la fiscalit, est dsormais
REOLJDWRLUHPHQWDVVRUWLHGXQHFODXVHGHUpYLVLRQ  review clause ), qui impose
son valuation dans un dlai maximal de cinq ans compter de son entre en
YLJXHXUHWGXQHFODXVHGHFDGXFLWp  sunset clause TXLODSULYHGHIIHWVLOH
3DUOHPHQWQDSDVORFFDVLRQGHVHSURQRQFHUVXUVRQHIILFDFLWpDXWHUPHGXQGpODL
maximal de sept ans compter de son entre en vigueur. Les clauses de rvision et
GHFDGXFLWpIRUPHQWFHTXHORQDSSHOOHODsunset regulation .
b. Les clauses de rvision en Allemagne
Depuis le 1er janvier 2013, il existe en Allemagne une obligation
GLQWURGXLUH V\VWpPDWLTXHPHQW GDQV OHV WH[WHV GH ORL FUpDQW XQH FKDUJH
administrative suprieure un PLOOLRQ GHXURV GHV FODXVHV GH UpYLVLRQ LPSRVDQW
leur valuation ex post dans un dlai maximal de cinq ans compter de leur entre
en vigueur.
,ODpWpGpFLGpTXune premire valuation ex post serait ralise au bout de
deux annes par le bureau fdral des statistiques ( Destatis ), partir de la
comparaison des donnes fournies par les ministres dDQVOpWXGHGLPSDFWex ante
avec les donnes empiriques ex post.
De son ct, le ministre qui avait port le texte de loi est OLEUHGHIIHFWXHU
dans le dlai maximal de cinq ans, une valuation plus complte au regard des
FULWqUHVGpYDOXDWLRQSUpDODEOHPHQWGpILQLVGDQVOpWXGHGLPSDFWex ante.
/HV UDSSRUWV GpYDOXDWLRQ ex post labors par les ministres ne sont pas
publics. Ils ne sont pas adresss au Parlement, mais seulement au ministre
comptent, la Chancellerie fdrale et au conseil national de contrle des normes
( Normenkontrollrat - NKR).
/H V\VWqPH HVW HQFRUH WURS UpFHQW SRXU TXXQ ELODQ HQ VRLW WLUp PDLV OHV
reprsentants du NKR  TXH OD PLVVLRQ D SX UHQFRQWUHU RQW TXDOLILp ODYDQFpH
GKLVWRULTXH
/XQGHVIRQFWLRQQDLUHVGXbureau de la Chancellerie fdrale charg de la
simplification ( Better Regulation Unit - BRU), M. Lars Limon-Wittmann, a
SUpFLVp TXH OH IDLW TXH OH UDSSRUW GpYDOXDWLRQ ex post labor par le ministre
SRUWHXUGXWH[WHDXUHJDUGGHVFULWqUHVSUpDODEOHPHQWGpILQLVGDQVOpWXGHGLPSDFW
ex ante soit communiqu non seulement au ministre et la Chancellerie fdrale
mais aussi et surtout au NKR SHUPHWWDLWGHPSrFKHUTXHOpYDOuation ex post
VRLWIDLWHGHIDoRQELDLVpHWURSDEVWUDLWHRXSHXVpULHXVH/H[LVWHQFHGXQUHJDUG
H[WpULHXUVXUOHWUDYDLOGpYDOXDWLRQPHQpa posteriori (et pas seulement sur celui

143

men a priori SHUPHWGHIDLUHSUHVVLRQVXUOHVPLQLVWqUHVSRXUTXLOVSrivilgient


une approche constructive et pragmatique.
La mission a pu constater que le Royaume-8QL HW O$OOHPDJQH QpWDLHQW
SDV OHV VHXOV SD\V HXURSpHQV j UHFRXULU DX[ FODXVHV GH UpYLVLRQ 'DSUqV OHV
rponses fournies la mission par neuf des dix Parlements europens interrogs
SDU OLQWHUPpGLDLUH GX Centre europen de recherche et de documentation
parlementaires (CERDP), il semblerait :
que les Pays-Bas font une utilisation frquente des clauses de rvision ;
que la Belgique, la Norvge et le Danemark aient une pratique
occasionnelle de ce type de clauses le Danemark y ayant eu recours pour des lois
qui sont controverses RX GRQW OLPSDFW HVW LQFHUWDLQ FRPPH XQH ORL VXU OHV
responsabilits parentales de 2007 ou encore une loi sXUOpFRQRPLHGpQHUJie de
2013, dont les rexamens sont prvus respectivement en 2010 et 2015.
Un recours plus frquent aux clauses de rvision gagnerait tre complt
SDUODGpILQLWLRQGXQHPpWKRGHplus rigoureuse et plus V\VWpPDWLTXHGpYDOXDWLRQ
ex post des dispositifs adopts. Cette valuation irait plus loin que le simple
FRQWU{OH GH OD SXEOLFDWLRQ GHV GpFUHWV GDSSOLFDWLRQ contrle dont la mission a
FRQVWDWpTXLOSRXYDLWrWUHUHQIRUFp
B. ADOPTER UNE PRATIQUE TENDANT SYSTMATISER LA
JUSTIFICATION DES RETARDS EN MATIRE DE PUBLICATION DES
'e&5(76'$33/,&$7,2N.

6LO HVW YUDL TXH FRPPH OD VRXOLJQp devant la mission le secrtaire
gnral du Gouvernement, M. Serge Lasvignes, de nombreux progrs ont t
UpDOLVpV HQ PDWLqUH GH GpFUHWV GDSSOLFDWLRQ , puisque 82 % des dispositions
rglementaires exiges par les lois adoptes au cours de la premire anne de
ODFWXHOOH OpJLVODWXUH RQW pWp SULVHV   OD\DQW pWp HQ PRLQV GH VL[ PRLV , il
QHQ GHPHXUH SDV PRLQV TXH comme le montre le Rapport annuel sur
ODSSOLFDWLRQ des lois publi par le Snat en juin dernier (1), les efforts entrepris
PpULWHQWGrWUHSRXUVXLYLV
1. 'HQHWVHIIRUWV

Le 5DSSRUW DQQXHO VXU ODSSOLFDWLRQ GHV ORLV produit en juin dernier par
notre collgue David Assouline, montre que 90 % des lois promulgues durant la
session parlementaire 2012- DYDLHQW UHoX GHV PHVXUHV GDSSOLFDWLRQ HQ
SHUPHWWDQW OD PLVH HQ XYUH WRWDOH RX SDUWLHOOH (Q HIIHW VXU OHV  ORLV
promulgues au cours de cette session (hors lois de ratificaWLRQRXGDSSUREDWLRQ
GHWUDLWpVRXGDFFRUGVLQWHUQDWLRQDX[ DSSHODLHQWGHVPHVXUHVUpJOHPHQWDLUHV
(1) 5DSSRUW GLQIRUPDWLRQ n 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU OH
snateur David Assouline, 17 juin 2014.

144

GDSSOLFDWLRQ2USDUPLFHVORLVpWDLHQWGHYHQXHVWRWDOHPHQWDSSOLFDEOHVDX
31 mars 2014, 13 taient partiellement applicables la mme date et seulement
5 ORLV DWWHQGDLHQW HQFRUH GrWUH PLVHV HQ DSSOLFDWLRQ (1). Au total, seuls 10 % des
lois promulgues durant la session parlementaire 2012-2013 demeuraient
non appliques au 31 mars dernier.
Par ailleurs, selon cette mme source, sur les 310 mesures rglementaires
SULVHVSRXUODSSOLFDWLRQGHORLVSURPXOJXpHVDXFRXUVGHODVHVVLRQSDUOHPHQWDLUH
2012-2013, 174 ont t publies dans un dlai infrieur six mois, soit plus de
50 %, tandis que seulement 19 mesures (soit 6 %) ont souffert de dlais
anormalement longs GXQDQRXSOXV1RWUHFROOqJXH'DYLG$VVRXOLQHVRXOLJQH
que ces dlais de parution se rapprochent des objectifs fixs par la circulaire du
Premier ministre du 29 fvrier UHODWLYHjODSSOLFDWLRQGHVORLVTXLDVVLJQHj
tous les PLQLVWqUHVXQGpODLGHVL[PRLVSRXUSUHQGUHWRXVOHVGpFUHWVGDSSOLFDWLRQ
GXQHORLHWTXLLPSRVHOpWDEOLVVHPHQWGXn bilan VHPHVWULHOGHOapplication des
lois adress au Parlement, remis la presse et mis en ligne sur Internet.
Toutefois, en raisonnant non plus en nombre de lois, mais en nombre de
PHVXUHV LO DSSDUDvW TXH OH WDX[ GDSSOLFDWLRQ des mesures lgislatives
promulgues durant la session parlementaire 2012-2013 avoisine plutt 65 %.
&HSHQGDQW GDSUqV 0 David Assouline, ce taux reste sans commune
mesure DYHF OHV WDX[ WUqV IDLEOHV REVHUYpV MXVTXHQ -2010 (entre 10 % et
35 % seulement) (2).
Ce dernier a en effet indiqu lors de son audition que le taux de
SXEOLFDWLRQ GHV GpFUHWV GDSSOLFDWLRQ GHV ORLV GDQV OHV VL[ PRLV DSUqV OHXU
promulgation est pass de 10 % en 2003 environ 28 % en 2008-2009 et 20 % en
2009-2010, puis 64 % en 2010-2011 et 67 % en 2011-2012 (3).
Il y a eu en effet une prise de conscience en 2011  GDSUqV QRWUH
collgue David Assouline, qui a expliqu avoir WUDYDLOOp j OpSRTXH HQ ERQQH
intelligence avec le ministre charg des relations avec le Parlement, M. Patrick
Ollier, qui, en Conseil des ministres, appelait, par le biais de petites notes,
ODWWHQWLRQ GH VHV FROOqJXHV VXU OHV GpFUHWV HQ UHWDUG GRQW Fertains ne
ncessitaient pas moins de treize signatures. Ce volontarisme politique, appuy
par une mobilisation sans prcdent du secrtariat gnral du Gouvernement
(SGG), a t payant .
Si la mise en application des lois promulgues au cours de la
XIII lgislature a t plus laborieuse (4) HOOH HVW GpVRUPDLV SUHVTXDFKHYpH
'DSUqV QRWUH FROOqJXH 'DYLG $VVRXOLQH VXU OHV  ORLV DGRSWpHV VRXV FHWWH
e

(1) Ibidem, p. 27.


(2) Ibidem, p. 8.
(3) Voir le graphique figurant en annexe n 15.
(4) 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV par le
snateur David Assouline, 17 juin 2014, p. 36.

145

OpJLVODWXUHVRQWDXMRXUGKXLHQWLqUHPHQWDSSOLFDEOHVOHVRQWSDUWLHOOHPHQW
et 6 ne le sont SDV GX WRXW /H WDX[ GDSSOLFDWLRQ GHV ORLV DGRSWpHV VRXV OD
XIIIe OpJLVODWXUHVpWDEOLWGRQFjHQYLURQ %.
Ce bilan globalement satisfaisant doit cependant tre nuanc, car le
5DSSRUW DQQXHO VXU ODSSOLFDWLRQ GHV ORLV du Snat a rvl que la mise en
application des lois promulgues sous des lgislatures plus anciennes est
quasi-vgtative (1).
2. TXLPpULWHQWGrWUHSRXUVXLYLV

Tout en faisant remarquer que les nouvelles exigences en matire


GpWXGHGLPSDFWGHSUpSDUDWLRQUDLVRQQpHGHODUpJOHPentation, de consultations
et de tests interdisent de publier trs rapidHPHQW OHV GpFUHWV GDSSOLFDWLRQ et
qu un quilibre est trouver entre la maturation des nouvelles rglementations
HW OH VRXFL GDFFpOpUHU ODSSOLFDWLRQ GHV ORLV , le secrtaire gnral du
*RXYHUQHPHQW D FRQFpGp TX on peut faire encore mieux , car les
administrations centrales FHVW XQH GH OHXUV IDLEOHVVHV WUDGLWLRQQHOOHV >@
procdent de manire squentielle, consultant les uns aprs les autres diffrents
organismes, DYDQWGHVHWRXUQHUYHUVOH&RQVHLOGeWDWSXLVOH6HFUpWDULDWJpQpUDO
du Gouvernement, toute suspension de la dmarche impliquant souvent de revenir
jOpWDSHSUpFpGHQWH (2).
Outre le fait que les taux et dlais de mise en application des textes issus
GH Oinitiative parlementaire (propositions de loi et amendements) sont GDSUqV
notre collgue David Assouline, moins bons qXH FHX[ GHV WH[WHV Gorigine
gouvernementale, avec en outre un traitement moins favorable des textes manant
du SpQDWSDUUDSSRUWjFHX[GHOAssemble nationale (3), il apparat que le taux
de mise en appOLFDWLRQ GX stock ancien - Fest--dire des lois antrieures
2007 non encore appliques - YpJqWHHWQenregistre aucun progrs significatif par
rapport aux annes prcdentes. Cette situation, qui tient principalement aux
changements de priorLWpV SROLWLTXHV VXUYHQXV GDQV OLQWHUYDOOH DERXWLW j FH
TXune loi non mise en application rapidement risque fort, au bon de quelques
annes, de tomber aux oubliettes rglementaires. Cette sorte de premption de fait
au bout de quelques annes pose un problme de fond sur laquelle il conviendrait
GHVinterroger (4).
3UpFLVpPHQW OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ
GHV ORLV VHVW LQWHUURJpH DX FRXUV GH VD UpXQLRQ GX  MXLQ  VXU ODEVHQFH
(1) Ibidem, p. 38.
(2) Audition de M. Serge Lasvignes, secrtaire gnral du Gouvernement, et de M. Thierry-Xavier Girardot,
directeur, adjoint au secrtaire gnral du Gouvernement, le 19 fvrier 2014. Voir le compte-rendu en
annexe n 16.
(3) 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU OH
snateur David Assouline, 17 juin 2014, p. 8.
(4) Idem.

146

GDSSOLFDWLRQGHODUWLFOHGHODORLQ 2006-GXPDUVSRXUOgalit
des chances (1). Cette disposition a introduit dans le code du travail un article
L. 1221-7 prvoyant que dans les entrepriVHV GDX PRLQV FLQTXante salaris, les
informations demandes, sous quelque forme que ce soit, au candidat un emploi,
ayant pour seule finalit Gapprcier sa capacit occuper lemploi propos ou ses
aptitudes professionnelles, et communiques par crit par ledit candidat, ne
peuvent tre examines que dans des conditions prservant son anonymat. Cette
obligation du CV anonyme jOHPEDXFKHGHYDLWrWUHSUpFLVpHSDUGHVPHVXUHV
rglementaires, le mme article L. 1221-7 disposant que ses modalits
Gapplication sont dterPLQpHVSDUGpFUHWHQ&RQVHLOGetat.
Or, saisi de trois plaintes, OH &RQVHLO GeWDW D GpFLGp OH  MXLOOHW GHUQLHU
GRUGRQQHUDX*RXYHUQHPHQWGpGLFWHUFHGpFUHWGDQVXQGpODLGHVL[PRLV (2).
$SUqVDYRLUUDSSHOpTXHQDSSOLFDWLRQGHODUWLFOHGHOD&RQVWLWXWLRQOH3UHPLHU
ministre DVVXUH OH[pFXWLRQ GHV ORLV et exerce le pouvoir rglementaire
(sous rserve de la comptence confre au Prsident de la Rpublique par
ODUWLFOH  GH OD &RQVWLWXWLRQ  ce qui emporte non seulement le droit, mais
DXVVLOREOLJDWLRQGHSUHQGUHGDQVXQGpODLUDLVRQQDEOHOHVPHVXUHVTXLPSOLTXH
QpFHVVDLUHPHQW ODSSOLFDWLRQ GH OD ORL (3) et aprs avoir constat que les trois
SODLJQDQWVDYDLHQWXQLQWpUrWjGHPDQGHUODQQXODWLRQGHVGpFLVLRns implicites par
OHVTXHOOHV OH 3UHPLHU PLQLVWUH DYDLW UHIXVp GH SUHQGUH OH GpFUHW GDSSOLFDWLRQ HQ
cause, la Haute juridiction a jug que les dispositions lgislatives litigieuses ne
SRXYDLHQW HQ UDLVRQ GH OHXU JpQpUDOLWp UHFHYRLU DSSOLFDWLRQ VDQV TXXQ dcret
SUpFLVkWOpWHQGXHGHOREOLJDWLRQGDQRQ\PLVDWLRQHWOHVPRGDOLWpVFRQFUqWHVGHVD
PLVH HQ XYUH DX VHLQ GHV HQWUHSULVHV FRQFHUQpHV 3DUWDQW FHV GLVSRVLWLRQV ne
ODLVVHQWSDVjODOLEUHDSSUpFLDWLRQGX3UHPLHUPLQLVWUHOpGLFWLRQGXGpFUHWGRQW
HOOHV SUpYRLHQW OLQWHUYHQWLRQ  (Q FRQVpTXHQFH OH &RQVHLO GeWDW D HVWLPp
TX HQ GpSLW GHV GLIILFXOWpV UHQFRQWUpHV SDU ODGPLQLVWUDWLRQ GDQV OpODERUDWLRQ
de ce texte et en dpit de la dure ncessaire la conduite des exprimentations et
leur valuation, le dlai raisonnable au terme duquel le dcret aurait d tre
adopt a[vait] t dpass (4).
Cette rcente dcision montre que, dans la mesure o certaines lois ne
UHoRLYHQW SDV GH PHVXUHV GDSSOLFDWLRQ SOXV GH KXLW DQV DSUqV OHXU DGRSWLRQ il
existe encore une marge de progrs en matire de mise en application des lois.
,QWHUURJp VXU ORSSRUWXQLWp GH UHFRQQDvWUH DX[ SDUOHPHQWDLUHV XQ GURLW GH
VDLVLUOH&RQVHLOGeWDWHQFDVGHUHWDUGFRQVWDWpGDQVODPLVHHQDSSOLFDWLRQGHV
lois, indpendamPHQW GH OD FRQGLWLRQ GLQWpUrW j DJLU TXL HVW DXMRXUGKXL H[LJpH
SRXU GHPDQGHU ODQQXODWLRQ GH GpFLVLRQV LPSOLFLWHV UHIXVDQW OD SULVH GH PHVXUHV
GDSSOLFDWLRQnotre collgue David Assouline a expliqu ne pas croire TXHORQ
(1) Voir le compte-rendu de la sance de la commission au lien suivant :
http://www.senat.fr/compte-rendu-commissions/20140616/applois.html
(2) &RQVHLOGeWDWMXLOOHWUHTXrWHQ 345253.
(3) Idem.
(4) Idem.

147

puisse reconnatre aux parlementaires un droit de saisine des juridictions


DGPLQLVWUDWLYHVVRLWGDQVOHFDGUHGXQHDFWLRQHQPDQTXHPHQWTXDQGOHVGpFUHWV
GDSSOLFDWLRQQRQWSDVpWpSXEOLpVVRLWSRXUIRUPHUXQUHFRXUVFRQWUHHX[TXDQG
ils ne paraissent pas satisfaisants .
Il est YUDLTXHVDLVLGXQUHFRXUVWHQGDQWjODQQXODWLRQGXUHIXVLPSOLFLWH
GX3UHPLHUPLQLVWUHGpGLFWHUGLYHUVGpFUHWVGDSSOLFDWLRQGHODORLQ 2004-575 du
 MXLQ  SRXU OD FRQILDQFH GDQV OpFRQRPLH QXPpULTXH HW IRUPp SDU OH
snateur Jean-Louis Masson, qui se prvalait GHV TXDOLWpV GH FLWR\HQ GXVDJHU
GHV VHUYLFHV SXEOLFV GpOX HW GH SDUOHPHQWDLUH  OH &RQVHLO GeWDW D MXJp OH
23 novembre 2011, que ce dernier ne justifiait pas, s qualits, GXQ LQWpUrW OXL
donnant qualit pour former un recours pour excs de pouvoir contre le refus de
prendre ces dcrets  HW TXHQ FRQVpTXHQFH VHV FRQFOXVLRQV pWDLHQW
irrecevables (1).
/DGRFWULQHVHPEOHSDUWDJpHjODIRLVVXUORSSRUWXQLWpHWVXUODQDWXUHGX
vecteur normatif qui reconnatrait un parlementaire GHGLVSRVHUGXQHDFWLRQ lui
SHUPHWWDQW GH FRQWUDLQGUH OH *RXYHUQHPHQW j DGRSWHU OHV PHVXUHV GDSSOLFDWLRQ
GXQHORL&HUWDLQVRQWpPLVOLGpHTXXQHORLSRXUUDLWrWUHDGRSWpHTXLFRQIpUHUDLW
XQ LQWpUrW j DJLU GHYDQW OH &RQVHLO GeWDW j XQ FHUWDLQ QRPEUH de parlementaires
qui pourraient alors exercer un recours pour excs de pouvoir toutes les fois
TXLOV YLHQGUDLHQW j HVWLPHU TXH OH GpODL UDLVRQQDEOH SRXU SUHQGUH XQ GpFUHW
GDSSOLFDWLRQGXQHORLHVWGpSDVVpRXHQFRUHTXHOHGpFUHWDGRSWpHVWFRQWUDLUH
la volont du lgislateur (2)'DXWUHVVRXWLHQQHQWTXHOHOLWLJHGRLWVDQDO\VHUHQ
un conflit entre organes constitutionnels qui ne pourrait tre tranch que par
une cour constitutionnelle (3).
Sans entrer dans ces dbats doctrinaux, notre collgue David Assouline a
suggr TXjWRXWOHPRLQV ORUVTXXQGpFUHWQHVWSDVSXEOLp [en temps utile] ou
TXLO QHVW SDV FRQIRUPH j OD YRORQWp GX OpJLVODWHXU QRV FRPPLVVLRQV
SDUOHPHQWDLUHV SRXUUDLHQW MRXHU XQ U{OH GDOHUWH et que les semaines de
contU{OH YRLUH GLQLWLDWLYH SDUOHPHQWDLUH SRXUUDLHQW SHUPHWWUH GLQWHUSHOOHU OH
Gouvernement en la matire (4).
&HVW OD UDLVRQ SRXU ODTXHOOH la mission propose que notre Assemble
adopte une pratique tendant contraindre le Gouvernement justifier
(1) &RQVHLOGeWDWQRYHPEUHUHTXrWHQ 341258. Voir galement le commentaire qui en est fait par le
SURIHVVHXU3LHUUH%UXQHWjO$ctualit juridique du droit administratif (AJDA), 2012, n 14. Voir aussi les
conclusions de M. JHDQ 0DVVRW VXU ODUUrW G$VVHPEOpH GX &RQVHLO GeWDW GX  IpYULHU  Joxe et
Bollon (Revue franaise de droit administratif RFDA, 1987, p. 176 : reprsentant de la nation tout
entire, [ le parlementaire] IDLWSDUWLHGXQFHUFOHGLQWpUrWWURSYDste pour que son action ne se confonde pas
DYHFODFWLRQSRSXODLUH ) et celles de M. 'LGLHU&DVDVVXUODUUrWGX&RQVHLOGeWDWGXRFWREUH
Sueur et autres (RFDA, 2004, p. 1103).
(2) ric Sagalovitsch, 3RXUODUHFRQQDLVVDQFHGXQLQWpUrWj DJLUGX3DUOHPHQWGHYDQWOH&RQVHLOGeWDW ,
AJDA, 2008, p. 321.
(3) lise Carpentier, /LQWpUrWjDJLUGX3DUOHPHQWHWGHVSDUOHPHQWDLUHVGHYDQWOH&RQVHLOGeWDW , AJDA,
2008, p. 777.
(4) Audition de M. 'DYLG$VVRXOLQHSUpVLGHQWGHODFRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQ
des lois, le 5 juin 2014. Voir le compte-rendu en annexe n 16.

148

GHYDQWOHVFRPPLVVLRQVSDUOHPHQWDLUHVFRPSpWHQWHVODEVHQFHGHSXEOLFDWLRQ
GHV GpFUHWV GDSSOLFDWLRQ j OH[SLUDWLRQ GXQ FHUWDLQ GpODL HQWUH VL[ PRLV HW
un an) courant compter de la promulgation de la loi.
Proposition n 14  'pYHORSSHU OLQVHUWLRQ GDQs la loi de clauses de rvision et
UHQIRUFHUOHFRQWU{OHSDUOHPHQWDLUHVXUODSXEOLFDWLRQGHVGpFUHWVGDSSOLFDWLRQ
DpYHORSSHUOLQVHUWLRQGDQVFHUWDLQVW\SHVGHORLGHFODXVHVGHUpYLVLRQDPHQDQW
OH 3DUOHPHQW j GpEDWWUH GH OHIILFDFLWp GX GLVSRVLWLI DGRpt dans un certain dlai
aprs son entre en vigueur ;
& contraindre le Gouvernement justifier devant les commissions parlementaires
FRPSpWHQWHVODEVHQFHGHSXEOLFDWLRQGHVGpFUHWVGDSSOLFDWLRQjOH[SLUDWLRQGXQ
certain dlai (entre six mois et un an) courant compter de la promulgation de la
loi.
9RWUH UDSSRUWHXU QLJQRUH SDV TXH ODUWLFOH -7 du Rglement de
O$VVHPEOpHQDWLRQDOHSUpYRLWGRUHVHWGpMjTX jOLVVXHGXQGpODLGHVL[PRLV
VXLYDQW OHQWUpH HQ YLJXHXU GXQH ORL GRQW OD PLVH HQ uvre ncessite la
SXEOLFDWLRQGHWH[WHVGHQDWXUHUpJOHPHQWDLUHGHX[GpSXWpVGRQWOXQDSSDUWLHQW
jXQJURXSHGRSSRVLWLRQHWSDUPLOHVTXHOVILJXUHGHGURLWOHGpSXWpTXLHQDpWpOH
rapporteur, prsentent la commission comptente un rapport sur la mise en
application de cette loi . Ce rapport, qui peut donner lieu, en sance publique,
un dbat sans vote ou une sance de questions, doit faire tat des textes
UpJOHPHQWDLUHVSXEOLpVHWGHVFLUFXODLUHVpGLFWpHVSRXUODPLVHHQXYUHGHODGLWH
loi, ainVL TXH GH VHV GLVSRVLWLRQV TXL QDXUDLHQW SDV IDLW OREMHW GHV WH[WHV
GDSSOLFDWLRQ QpFHVVDLUHV 'DQV FHWWH GHUQLqUH K\SRWKqVH ODUWLFOH -7 du
Rglement ajoute que la commission entend alors une nouvelle fois ses
UDSSRUWHXUVjOLVVXHGXQQRXYHDXGpODi de six mois.
/DPLVVLRQHVWLPHTXLOIDXWDOOHUDX-GHOjGXQHVLPSOHSUpVHQWDWLRQGXQ
UDSSRUW GDSSOLFDWLRQ HQ FRPPLVVLRQ HW TXH QRWUH $VVHPEOpH GHYUDLW SUHQGUH
OKDELWXGH GH FRQYRTXHU le ministre concern devant la commission comptente
lorsque sont coQVWDWpVGHVGpODLVDQRUPDOHPHQWORQJVSRXUODGRSWLRQGHPHVXUHV
GDSSOLFDWLRQ
&H FRQWU{OH SOXV pWURLW GH OD SDUXWLRQ GHV GpFUHWV GDSSOLFDWLRQ GHYUD HQ
RXWUH VDFFRPSDJQHU GH OpODERUDWLRQ GH UDSSRUWV GpYDOXDWLRQ TXL QH VH
contenteront pas, comme nombre des DFWXHOVUDSSRUWVGDSSOLFDWLRQGHGUHVVHUOD
OLVWHGHVPHVXUHVGDSSOLFDWLRQSULVHVRXUHVWDQWjSUHQGUHPDLVTXLDQDO\VHURQW ex
post OLPSDFW GXQH ORL WURLV DQV DSUqV VRQ HQWUpH HQ YLJXHXU HW TXL VLQVFULURQW
GDQVXQSURJUDPPHGpYDOXDWLRQPLHXx ordonn.

149

C. MIEUX ORDONNER LES M,66,216'e9$/8$7,21 DU PARLEMENT

/D PLVVLRQ FRQVLGqUH TXH GDQV OH FDGUH GH VRQ WUDYDLO GpYDOXDWLRQ
ex postQRWUH$VVHPEOpHQHSHXWSOXVVHFRQWHQWHUGHVUDSSRUWVGDSSOLFDWLRQTXL
VRQWpODERUpVVXUOHIRQGHPHQWGHODUWLFle 145-7 du Rglement.
En effet, ces rapports se nourrissent largement des donnes transmises par
OH[pFXWLI HQ DSSOLFDWLRQ GH ODUWLFOH  GH OD ORL de simplification du droit
n 2004-GXGpFHPEUH&HWH[WHGLVSRVHTX jOLVVXHGXQGpODLGH
VL[PRLVVXLYDQWODGDWHGHQWUpHHQYLJXHXUGXQHORLOH*RXYHUQHPHQWSUpVHQWH
au Parlement un rapport sur la mise en application de cette loi et que ce
rapport mentionne les textes rglementaires publis et les circulaires dictes
pour la mise en XYUHGHODGLWHORLDLQVLTXHOHFDVpFKpDQWOHVGLVSRVLWLRQVGH
celle-FLTXLQRQWSDVIDLWOREMHWGHVWH[WHVGDSSOLFDWLRQQpFHVVDLUHVHWHQLQGLTXH
les motifs .
Or, force est de constater, avec notre collgue David Assouline, que
MXVTXj SUpVHQW OHV UDSSRUWV GH ODUWLFOH  VRQW HQFRUH ORLQ GDWWHLQGUH OD
TXDOLWp TXH OH 3DUOHPHQW VHUDLW HQ GURLW GHQ DWWHQGUH HW QH SHXYHQW SDV rWUH
H[SORLWpVFRPPHLOVJDJQHUDLHQWjOrWUHSOXVLHXUVIDFWHXUVVHPEODQWHQOLPLWHUHW
la connaissance effective, et le rendement rel (1). Parmi ces facteurs figurent le
retard avec lequel ces rapports dits GH ODUWLFOH  sont dposs par le
Gouvernement (2) DLQVLTXHOLQWpUrWLQpJDOYRLUHOLQFRPSOpWXGHGHVLQIRUPDWLRQV
contenues dans ces rapports.
Pour amliorHUVRQWUDYDLOGpYDOXDWLRQ ex post, notre Assemble ne peut
pas davantage compter sur les innombrables rapports ponctuels qui sont demands
DX*RXYHUQHPHQWGDQVOHFDGUHGHOH[DPHQGHSURMHWVRXGHSURSRVLWLRQVGHORL
'DSUqVOH5DSSRUWDQQXHOVXUODSSlication des lois du Snat, alors que 415 des
1797 lois rpertories dans la base de donnes Apleg depuis 1980 prvoient de
PDQLqUH VSpFLILTXH OD UHPLVH SDU OH *RXYHUQHPHQW GXQ RX SOXVLHXUV UDSSRUWV
DXWUHVTXHFHX[WUDQVPLVDXWLWUHGHODUWLFOHGHOD loi du 9 dcembre 2004 ou
HQ YHUWX GXQH REOLJDWLRQ OpJDOH JpQpUDOH  OH[pFXWLI QD GpSRVp XQ RX SOXVLHXUV
rapports que pour 263 lois ce qui porte un peu moins de 65 % le taux de remise
effective des rapports que le Parlement demande au Gouvernement (3).

(1) 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU OH
snateur David Assouline, 17 juin 2014, p. 47.
(2) M. 'DYLG $VVRXOLQHSUpVLGHQW GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODpplication des lois, a
relev que, sur les 30 lois qui ont t promulgues entre le 1er octobre 2012 et le 30 septembre 2013 et qui
QpFHVVLWDLHQW OD SXEOLFDWLRQ GH PHVXUHV UpJOHPHQWDLUHV GDSSOLFDWLRQ OHV FRPPLVVLRQV SHUPDQHQWHV GX
6pQDW QDYDLHQW FRPSWDEilis, au 9 avril 2014, que deux rapports transmis par le Gouvernement dans le
GpODLGHVL[PRLVUHTXLVSDUODUWLFOHGHODORLGXGpFHPEUH6XUOHVUDSSRUWVGpSRVpVGXUDQW
FHWWHSpULRGHDXWLWUHGHODUWLFOHOHVGpODLVGHWUDQVPLVVLRQVHsont chelonns entre 7 et 15 mois aprs
la promulgation de la loi.
(3) 5DSSRUW GLQIRUPDWLRQ Q 623 (session 2013-  VXU ODSSOLFDWLRQ GHV ORLV session parlementaire
2012- IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWion des lois, par le
snateur David Assouline, 17 juin 2014, p. 51.

150

Face ces chiffres, la commission snatoriale pour le contrle de


ODSSOLFDWLRQ GHV ORLV D VXJJpUp Gune part que les parlementaires demandent
moins de rapports ponctuels pouU HQ WLUHU XQ PHLOOHXU SDUWL Gautant que
beaucoup de rapports ponctuels sont la simple contrepartie du retrait dun
amenGHPHQWDXTXHOOH*RXYHUQHPHQWVoppose), [et] Gautre part que les rapports
[dits] GH Oarticle 67 soient effectivement GpSRVpV GDQV OHV VL[ PRLV HW TXils
comportent des indications prcises permettant de suivre plus efficacement la
SDUXWLRQGHVGpFUHWVGapplication attendus (1) .
Pour sa part, la mission a t sduite par la proposition faite par le
secrtaire gnral du Gouvernement, M. 6HUJH /DVYLJQHV GRUJDQLVHU GHV
rendez-YRXV WULHQQDX[ GpYDOXDWLon [qui] permettraient de faire le tri entre les
dispositifs qui fonctionnent et ceux qui devraient tre revus ( 2 ). cet effet,
ODQFLHQFRPPLVVDLUHjODVLPSOLILFDWLRQ0 Rmi Bouchez, a suggr de retenir
XQ VHJPHQW GX GURLW XQ DQJOH GDWWDTXH RX XQ FKDSLWUH GH FRGH GHQ IDLUH OD
UHYXH GH GpWDLO HW GHVVD\HU SDU OD FRQFHUWDWLRQ GH OH VLPSOLILHU HW GH
ODPpOLRUHU (3).
6LQVSLUDQWGHFHVUHFRPPDQGDWLRQV la mission propose de modifier le
5qJOHPHQW GH O$VVHPEOpH QDWLRQDOH GH IDoRQ j SUpYRLU OD Srsentation
V\VWpPDWLTXH GH UDSSRUWV GpYDOXDWLRQ qui ne se confondraient pas avec les
DFWXHOV UDSSRUWV GDSSOLFDWLRQ UpJLV SDU ODUWLFOH -7 dudit Rglement. Ces
UDSSRUWV FRQoXV VXU OH PRGqOH GHV ELODQV GpYDOXDWLRQ DX[TXHOV SURFqGH OD
commission snatRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV DQDO\VHUDLHQW
ex post OLPSDFWFRQFUHWORSpUDWLRQQDOLWpHWODGpTXDWLRQGHVPHVXUHVDGRSWpHVDX
regard des objectifs qui leur taient assigns et ce une fois coul un dlai de
trois ans compter de lHQWUpHHQYLJXHXUGHVGLVSRVLWLIVFRQFHUQpV
Afin de dresser un constat le plus objectif possible, la rdaction de ces
UDSSRUWVGHYUDLWrWUHFRQILpHjXQELQ{PHGHUDSSRUWHXUVGRQWOXQDSSDUWLHQGUDLWj
XQJURXSHGHODPDMRULWpHWODXWUHjXQJURXSHGRpposition.
$ILQ GpYLWHU OHV GRXEORQV entre commissions permanentes et autres
RUJDQHVGHO$VVHPEOpHQDWLRQDOH FRPPHOHFRPLWpGpYDOXDWLRQHWGHFRQWU{OH 
PDLV DXVVL HQWUH O$VVHPEOpH QDWLRQDOH HW OH 6pQDW HW SOXV SDUWLFXOLqUHPHQW OD
commission snatRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLV  , le choix des
GLVSRVLWLIVDQDO\VpVGDQVOHFDGUHGHVUDSSRUWVGpYDOXDWLRQGHYUDLWrWUHDUUrWp au
VHLQGXQSURJUDPPHDQQXHOYRLUHSOXULDQQXHOGpYDOXDWLRQGpILQLFRQMRLQWHPHQW
par les deux assembles parlementaires qui pourraient se rpartir les thmatiques
abordes.

(1) Ibidem, p. 9.
(2) Audition de M. Serge Lasvignes, secrtaire gnral du Gouvernement, et de M. Thierry-Xavier Girardot,
directeur, adjoint au secrtaire gnral du Gouvernement, le 19 fvrier 2014. Voir le compte-rendu en
annexe n 16.
(3) Audition de M. Rmi Bouchez, ancien commissaire la simplification, le 20 fvrier 2014. Voir le compterendu en annexe n 16.

151

Proposition n 15 Prvoir une valuation ex post plus mthodique


Indpendamment des rexamens exigs par des clauses de rvision, prvoir des
rendez-YRXVWULHQQDX[GpYDOXDWLRQGHORLVDGRptes et dfinir en consquence un
SURJUDPPH DQQXHO YRLUH SOXULDQQXHO GpYDOXDWLRQ GDQV OHV GHX[ DVVHPEOpHV
parlementaires, en rpartissant entre ces dernires les thmatiques abordes ;
 V\VWpPDWLVHU HQ FRQVpTXHQFH OpODERUDWLRQ GH UDSSRUWV GpYDOXDWLRQ (distincts
GHVDFWXHOVUDSSRUWVGDSSOLFDWLRQ GRQWODUpGDFWLRQVHUDLWFRQILpHWURLVDQVDSUqV
OHQWUpHHQYLJXHXUGXQHORLjXQELQ{PHGHUDSSRUWHXUVPDMRULWp-opposition.

152

CONCLUSION
/KHXUH HVW LPSRUWDQWH HW OH VXMHW VWUDWpJLTXH /D FRQWUDLQWH QRrmative
constituera-t-HOOH XQH HQWUDYH j ODYHQLU RX DX FRQWUDLUH SHUPHWWUD-t-elle de
librer les initiatives ?  &HVW HQ FHV WHUPHV que le prsident du Conseil
conomique, social et environnemental, M. Jean-Paul Delevoye, a rsum le dfi
TXHGRLWUHOHYHUOHQWUHSULVHGHVLPSOLILFDWLRQOpJLVODWLYH (1).
&RQVFLHQWH GH FH TXH OLQIODWLRQ QRUPDWLYH D FRQWLQXp MXVTXLFL GH
progresser malgr les GLVFRXUV YHUWXHX[ VXU OpODERUDWLRQ GH OD QRUPH (2), la
mission souhaite vivement que ses 15 propositions pour amliorer la fabrique de la
ORL QH VRQQHQW SDV FRPPH GHV YX[ SLHX[ FDU au moment o le discrdit
politique et syndical a atteint un niveau dangereux pour le systme dmocratique
lui-PrPH DX PRPHQW R ORQ SUHQG FRQVFLHQFH TXH OD FRPSOH[LWp HVW WHOOH TXH
VHXOV TXHOTXHV SULYLOpJLpV SHXYHQW HQ VXUPRQWHU OREVWDFOH VL QRXV Q\ SUHQRQV
JDUGH OH ULVTXH HVW TXH ORQ SHUGH FRQILDQFH GDQV OD IRUFH GX GURLW HW TXH ORQ
revendique le droit la force (3).
6L FRPPH OD LQGLTXp QRWUH FROOqJXH 'DYLG $VVRXOLQH SUpVLGHQW GH OD
FRPPLVVLRQVpQDWRULDOHSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLVFHUWDLQVPDLUHV
ne se sont pas reprsents lors des dernires lections municipales entre autres
SDUFH TXLOV DYDLHQW FKDTXH DQQpH j WHQLU FRPSWH GH SUqV GH  000 pages de
circulaires (4)FHVWTXHOLQIODWLRQQRUPDWLYHDDWWHLQWGDQVQRWUHSD\VXQQLYHDXWHO
TXHOOHPHQDFHODGpPRFUDWLH
Certes, cette inflation rsulte des demandes de la socit, des groupes de
pression, des associations, qui exigent souvent que nous lgifrions, mme dans le
dtail, sur certaines de leurs proccupations (5), mais le Parlement ne doit pas
pour autant perdre de vue ODQpFHVVLWpGHQUpJXOHUOHIOX['RODQpFHVVLWpTXH
les 15 propositions ambitieuses qui ont t formules GRQWODPLVVLRQQLJQRUH
SDV TXHOOHV QpFHVVLWHQW SRXU FHUWDLQHV GHV PRGLILFDWLRQV GH OD &RQVWLWXWLRQ ne
UHVWHQWSDVOHWWUHPRUWHHWTXLOVoit mis fin au dcalage entre les intentions et les
ralisations, entre les constats et les pratiques (6).

(1) Audition de M. Jean-Paul Delevoye, prsident du Conseil conomique, social et environnemental, le


15 mai 2014. Voir le compte-rendu en annexe n 16.
(2) Audition de M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II Panthon-Assas, membre
du Club des juristes, le 10 avril 2014. Voir le compte-rendu en annexe n 16.
(3) Audition de M. Jean-Paul Delevoye, prsident du Conseil conomique, social et environnemental, le
15 mai 2014. Voir le compte-rendu en annexe n 16.
(4) Audition de M. David Assouline, prsident de la commission snatoriale SRXUOHFRQWU{OHGHODSSOLFDWLRQ
des lois, le 5 juin 2014. Voir le compte-rendu en annexe n 16.
(5) Idem.
(6) Audition de M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II Panthon-Assas, membre
du Club des juristes, le 10 avril 2014. Voir le compte-rendu en annexe n 16.

153

EXAMEN DU RAPPORT EN MISSION

155

SYNTHSE DES PROPOSITIONS


M I EUX PRPARER LA NORM E
EN AM ONT DE LA PROCDURE LGI SLATI VE

Proposition n 1 Enrichir le contenu des pWXGHVGLPSDFW


0LHX[UHQVHLJQHUOHVpWXGHVGLPSDFW :
HQ UHQGDQW REOLJDWRLUH SRXU OHV WH[WHV OpJLVODWLIV OD UpDOLVDWLRQ GXQ  WHVW HQWUHSULVHV 
DXMRXUGKXL IDFXOWDWLI HW FLUFRQVFULW DX[ WH[WHV UpJOHPHQWDLUHV  DLQVL TXH GH WHVWV
collectivits locales et usagHUVGHODGPLQLVWUDWLRQ ;
HQDPpOLRUDQWOpYDOXDWLRQGHVFRWVHWEpQpILFHVpFRQRPLTXHVDLQVLTXHGHVFRQVpTXHQFHV
socitales des mesures envisages ;
HQ IRXUQLVVDQW XQH DQDO\VH HW XQH MXVWLILFDWLRQ DSSURIRQGLHV j ODSSXL GHV PHVXUHV
transitoires et GHVGDWHVGHQWUpHHQYLJXHXUUHWHQXHV ;
HQ \ LQWpJUDQW OH[LJHQFH GH TXDQWLILFDWLRQ GHV FKDUJHV DGPLQLVWUDWLYHV VXSSULPpHV HQ
contrepartie et hauteur des charges administratives cres ( one-in, one-out ) ;
et en y introduisant les critres sur leVTXHOVVHIRQGHUDOpYDOXDWLRQex post de ces mesures.
Proposition n 2 &RQWUH[SHUWLVHUOHVpWXGHVGLPSDFW
&RQILHUOpYDOXDWLRQGHODTXDOLWpGHVpWXGHVGLPSDFWjXQRUJDQLVPHLQGpSHQGDQW :
compos de reprsentants de la socit civile ;
charg, HQ VDSSX\DQW VXU GHV H[SHUWV LVVXV GHV VHFWHXUV SULYp HW SXEOLF QRWDPPHQW GHV
XQLYHUVLWpV GH O,16(( GHV DGPLQLVWUDWLRQV pFRQRPLTXHV GHV FRUSV GLQVSHFWLRQ HW GHV
FRQWU{OHV JpQpUDX[ GH UHQGUH XQ DYLV SXEOLF SUHQDQW QRWDPPHQW HQ FRPSWH OpYROXWLRQ
estime des charges administratives rsultant de la mesure envisage ;
ODYLV VXU OHV pWXGHV GLPSDFW DVVRUWLVVDQW OHV SURMHWV GH ORL pWDQW UHQGX SXEOLF ORUV GH OD
prsentation de ces derniers en conseil des ministres ;
& prvoir une valuation de ce disposLWLIGHYDOLGDWLRQGHVpWXGHVGLPSDFWGDQVXQGpODLGH
GHX[DQVjFRPSWHUGHVDPLVHHQXYUH

Proposition n 3 6RXPHWWUHOHVSURSRVLWLRQVGHORLjXQHpWXGHGLPSDFW
5HQGUH REOLJDWRLUH OD UpDOLVDWLRQ GXQH pWXGH GLPSDFW VXU OHV SURSRVLWLRQV GH ORL
iQVFULWHVjORUGUHGXMRXU cette tude pouvant, le cas chant, tre complte par un
DYLVGX&RQVHLOGeWDWVDLVLjFHWHIIHWVHORQOHVPRGDOLWpVDFWXHOOHPHQWSUpYXHVSDUOD
Constitution.

156

Proposition n 4 6RXPHWWUHOHVRUGRQQDQFHVjXQHpWXGHGLPSDFW
([LJHU TXH OHV SURMHWV GH ORL GKDELOLWDWLRQ VRLHQW DVVRUWLV GXQH pWXGH GLPSDFW SOXV
FRPSOqWH HWQRQDOOpJpHFRPPHFHVWOHFDVDXMRXUGKXL ;
Rendre obligatoire la ralisation GXQHpWXGHGLPSDFWSRXUOHVRUGRQQDQFHV
6XERUGRQQHU HQ FRQVpTXHQFH OD GLVSHQVH GpWXGH GLPSDFW SRXU OHV SURMHWV GH ORL GH
UDWLILFDWLRQ GHV RUGRQQDQFHV j OD FRQGLWLRQ TXXQH pWXGH GLPSDFW DLW pWp SURGXLWH j
ORFFDVLRQGHOH[DPHQSDUOH&RQVHLOGeWDWGXSURMHWGRUGRQQDQFH
Proposition n 5 'pYHORSSHU OH UHFRXUV j OH[SpULPHQWDWLRQ avant la gnralisation de
certains dispositifs lgislatifs le cas chant en consolidant les effets juridiques de ces
exprimentations.

M I EUX LABORER LA NORM E


AU COURS DE LA PROCDURE LGI SLATI VE
Proposition n 6 5HQGUH SXEOLTXH OD SDUWLH GH ODYLV GX &RQVHLO GeWDW relative aux
pWXGHVGLPSDFW assortissant les projets (et, le cas chant, les propositions) de loi ainsi que
OHVSURMHWVGRUGRQQDQFHHWODMRLQGUHjFHVpWXGHV

Proposition n 7 5HQIRUFHUOHFRQWU{OHGX3DUOHPHQWVXUODTXDOLWpGHVpWXGHVGLPSDFW
$XVWDGHGHOH[DPHQHQFRPPLVVLRQSUpYRLUGDQVOLQWHUYHQWLRQOLPLQDLUHGXUDSSRUWHXUGH
ODFRPPLVVLRQVDLVLHDXIRQGXQHSUpVHQWDWLRQV\VWpPDWLTXHGHOpWXGHGLPSDFWVXUOHSURMHW
GHWH[WHDYDQWOH[DPHQGHVDUWLFOHVHWGHVDPHQGHPHQWV
Proposition n 8 Reconnatre au prsident de la commission saisie au fond le
droit GH[LJHUODUpDOLVDWLRQGXQHpWXGHGLPSDFWVXUOHVDPHQGHPHQWVTXDOLILpVSDUODGLWH
commission de substantiels .
Proposition n 9 Soumettre les amendements du Gouvernement un dlai de dpt.

Proposition n 10 Modifier la procdure acclre pour prserver un dlai minimal


HQWUHOHGpS{WGXQWH[WHHWVDGLVFXVVLRQGHYDQWFKDTXHDVVHPEOpH

Proposition n 11 5HSHQVHUORUJDQLVDWLRQGHVGpEDWVEXGJpWDLUHV de faon faire de la


loi de rglHPHQW XQ PRPHQW IRUW GpYDOXDWLRQ QRWDPPHQW GH OD PRGHUQLVDWLRQ GH ODFWLRQ
publique.

157

Proposition n 12 Modifier les modalits de ngociation et de transposition des directives


3ODFHU OpWXGH GLPSDFW GH OD &RPPLVVLRQ HXURSpHQQH HW VHV LPSOLFDWLRQs au niveau
QDWLRQDO DXFXUGHVQpJRFLDWLRQVGHVGLUHFWLYHVHXURSpHQQHV ;
'pYHORSSHUODWUDQVSRVLWLRQGHVGLUHFWLYHVSDUYRLHGRUGRQQDQFHVHQH[LJHDQW :
TXHODYLVGX&RQVHLOGeWDWVXUOHSURMHWGRUGRQQDQFHGHWUDQVSRVLWLRQVRLWUHQGX
public avant le dpt du projet de loi de ratification ;
HW TXH FHW DYLV DLQVL TXH OpWXGH GLPSDFW DVVRUWLVVDQW OH SURMHW GRUGRQQDQFH
identifient les ventuelles surtranspositions , qui devront alors tre soumises une
obligation de motivation renforce.

M I EUX VALUER LA NORM E EN AVAL DE SON ADOPTI ON


Proposition n 13 &ODULILHUOHSD\VDJHGHOpYDOXDWLRQGHVSROLWLTXHVSXEOLTXHV
Organiser une confrence des valuateurs pour mieux coordonner les initiatives en matire
GpYDOXDWLRQ ex post DXMRXUGKXL SULVHV SDU O$VVHPEOpH QDWLRQDOH OH 6pQDW OD &RXU GHV
FRPSWHVOH&RQVHLOpFRQRPLTXHVRFLDOHWHQYLURQQHPHQWDOOHVFRUSVGLQVSHFWLRQRXDXWUHV
,*),*$6,*$,*6-&*(),6*0$3 

Proposition n 14 'pYHORSSHUOLQVHUWLRQGDQVODloi de clauses de rvision et renforcer le


FRQWU{OHSDUOHPHQWDLUHVXUODSXEOLFDWLRQGHVGpFUHWVGDSSOLFDWLRQ
DYHORSSHU OLQVHUWLRQ GDQV FHUWDLQV W\SHV GH ORL GH FODXVHV GH UpYLVLRQ DPHQDQW OH
3DUOHPHQWjGpEDWWUHGHOHIILFDFLWpGXGLVSRVLWLIDGRSWpdans un certain dlai aprs son entre
en vigueur ;
& contraindre le Gouvernement justifier devant les commissions parlementaires
FRPSpWHQWHV ODEVHQFH GH SXEOLFDWLRQ GHV GpFUHWV GDSSOLFDWLRQ j OH[SLUDWLRQ GXQ FHUWDLQ
dlai (entre six mois et un an) courant compter de la promulgation de la loi.

Proposition n 15 Prvoir une valuation ex post plus mthodique


Indpendamment des rexamens exigs par des clauses de rvision, prvoir des rendez-vous
WULHQQDX[ GpYDOXDWLRQ GH ORLV DGRSWpHV HW GpILQLr en consquence un programme annuel
YRLUHSOXULDQQXHOGpYDOXDWLRQGDQVOHVGHX[DVVHPEOpHVSDUOHPHQWDLUHVHQUpSDUWLVVDQWHQWUH
ces dernires les thmatiques abordes ;
V\VWpPDWLVHUHQFRQVpTXHQFHOpODERUDWLRQGHUDSSRUWVGpYDOXDWLRQ GLVWLQFWV GHV actuels
UDSSRUWV GDSSOLFDWLRQ  GRQW OD UpGDFWLRQ VHUDLW FRQILpH WURLV DQV DSUqV OHQWUpH HQ YLJXHXU
GXQHORLjXQELQ{PHGHUDSSRUWHXUVPDMRULWp-opposition.

159

CONTRIBUTIONS

I. CONTRIBUTION PRSENTe(3$50$8120DU *5283(

161

ANNEXES
Annexe n 1 : liste des personnes entendues ......................................................

162

Annexe n 2 : nombre moyen de lois adoptes par neufs parlements


europens au cours des dernires annes ............................................................

165

Annexe n 3 : modles GHILFKHVGLPSDFWGHVSURMHWVGDFWHVUpJOHPHQWDLUHV


relatifs aux entreprises et aux collectivits territoriales......................................

166

Annexe n 4 : mesure des charges administratives en Belgique et en


Allemagne ...........................................................................................................

175

Annexe n 5 : mesure des charges administrative en France .............................

178

Annexe n 6 : consultations pralables obligatoires sur les projets de loi ..........

181

Annexe n 7 : PLVH HQ XYUH GX SULQFLSH one-in, two-out au RoyaumeUni ......................................................................................................................

192

Annexe n 8 : OH&RPLWpGDQDO\VHGLPSDFW Impact assessment board ) de


la Commission europenne .................................................................................

194

Annexe n 9 : le conseil indpendant charg de contrler la qualit des tudes


GLPSDFW des administrations britanniques : regulatory policy committee
(RPC) ..................................................................................................................

196

Annexe n 10 : projets et propositions de loi examins et adopts de la XIe


la XIVe lgislature ..............................................................................................

201

Annexe n 11 : volution du nombre de procdures acclres de la XIe la


XIVe lgislature ..................................................................................................

203

Annexe n 12 : scnarios GH UpIRUPH SRVVLEOHV SRXU IDLUH GH OH[DPHQ GH OD
ORLGHUqJOHPHQWXQPRPHQWIRUWGpYDOXDWLRQGHODFWLRQSXEOLTXH ..................

205

Annexe n 13 : proportion des lois franaises prises pour la transposition des


directives europennes ........................................................................................

206

Annexe n 14 : outils mthodologiques pour la transposition des directives


europennes ........................................................................................................

208

Annexe n 15 : WDX[GDSSOLFDWLRQGHVORLVSURPXOJXpHV ...................................

213

Annexe n 16 : comptes rendus des auditions de la mission .............................

215

162

ANNEXE N 1 :
LISTE DES PERSONNES ENTENDUES
Jeudi 23 janvier 2014
x

Premire table ronde runissant des universitaires :

0PH*pUDOGLQH&KDYULHUSURIHVVHXUHGHGURLWjO8QLYHUVLWpGH3DULV, (PanthonSorbonne)

0 %HUWUDQG GX 0DUDLV FRQVHLOOHU GeWDW HW SURIHVVHXU GH GURLW SXEOLF j
O8QLYHUVLWp3DULV2XHVW 1DQWHUUH-La Dfense)

0 0LFKHO 9HUSHDX[ SURIHVVHXU GH GURLW j O8QLYHUVLWp GH 3DULV , 3DQWKpRQSorbonne)

Seconde table ronde runissant des universitaires :

0PH3DVFDOH'HXPLHUSURIHVVHXUHGHGURLWjO8QLYHUVLWp-HDQ0RXOLQ /\RQ,,,

0PH &pOLD =RO\QVNL SURIHVVHXUH GH GURLW j O8QLYHUVLWp GH 9HUVDLOOHV 6DLQWQuentin-en-Yvelines

003KLOLSSH6DVVLHUHW'RPLQLTXH/DQVR\DXWHXUVG8EX loi (Fayard, mars 2008)

Jeudi 30 janvier 2014


x

0$ODLQ/DPEHUWSUpVLGHQWGHODFRPPLVVLRQFRQVXOWDWLYHGpYDOXDWLRQGHVQRUPHV
(CCEN) et auteur, avec M Jean-Claude Boulard, du rapport de la mission de lutte
FRQWUHOLQIODWLRQQRUPDWLYH PDUV

M. BUXQR'RQGHURSURIHVVHXUGHGURLWjO8QLYHUVLWpGH3DULV,3DQWKpRQ-Sorbonne

M ercredi 19 fvrier 2014


x

Secrtariat gnral du Gouvernement

M. Serge Lasvignes, secrtaire gnral du Gouvernement

M. Thierry-Xavier Girardot, directeur, adjoint au secrtaire gnral du


Gouvernement

Jeudi 20 fvrier 2014


x

M. Rmi Bouchez, ancien commissaire la simplification

M. ric Dolig, snateur et auteur du rapport sur la simplification des normes


applicables aux collectivits locales (juin 2011)

163

Jeudi 10 avril 2014


x

M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II Panthon-Assas,


membre du Club des juristes

Jeudi 17 avril 2014


x

Organisation pour la coopration et le dveloppement conomiques (OCDE)

M. Nick Malyshev, responsable de la division de la politique de la rglementation

Mme Cline Kauffmann, responsable adjointe de la division de la politique de la


rglementation

M. Daniel Trnka, responsable du travail sur la simplification, division de la


politique de la rglementation

M ercredi 30 avril 2014


x

Cour des comptes

M. Didier Migaud, premier prsident

M. Henri Paul, prsident de chambre, rapporteur gnral

M. Simon Bertoux, conseiller rfrendaire, charg de mission.

6HFUpWDULDWJpQpUDOSRXUODPRGHUQLVDWLRQGHODFWLRQSXEOLTXH 6*0$3

M. Nicolas Conso, chef du service innovation et services aux usagers

Mme Chrystelle Naudan-Carastro, adjointe la directrice charge de la


simplification au Secrtariat gnral du Gouvernement

M. Grard Huot, mission simplification, responsable des relations avec les


entreprises

Jeudi 15 mai 2014


x

Secrtariat gnral des Affaires europennes (SGAE)

M. Philippe Lglise-Costa, secrtaire gnral

Mme Liza Bellulo conseillre juridique

Mme Vronique Fourquet adjointe la conseillre juridique

Mme Juliette Clavire, responsable du dpartement Parlement National, Parlement


europen, collectivits locales

Conseil conomique, social et environnemental (CESE)


M. Jean-Paul Delevoye, prsident
M. Christian Le Roux, directeur de Cabinet

164

M ouvement des Entreprises de France (M EDEF) :

M. Bernard Gaud, prsident du MEDEF Rhne-Alpes et prsident de la


commission Simplification du MEDEF ;

Mme Dorothe Pineau, directrice gnrale adjointe du MEDEF en charge du


dossier simplification ;

Mme Jolle Simon, directrice des affaires juridiques, rapporteure de la commission


Simplification du MEDEF

M. Matthieu Pimeda, charg de mission la direction des Affaires publiques

Jeudi 22 mai 2014


x

&RQVHLOGeWDW

M. Jean-Marc Sauv, vice-prsident

M. Bernard Pcheur, prsident dHODVHFWLRQGHODGPLQLVWUDWLRQ

Mme Maryvonne de Saint Pulgent, prsidente de la section du rapport et des tudes

I NSEE

M. Jean-Luc Tavernier, directeur gnral

M. Alain Bayet, secrtaire gnral

Jeudi 5 juin 2014


x

M. David Assouline, snateur, prsident de la commission snatoriale pour le contrle


GHODSSOLFDWLRQGHVORLV

M ardi 1er juillet 2014


x

M. Jean-Luc Warsmann, dput et ancien prsident de la commission des Lois

M ercredi 9 juillet 2014


x M. Jean-Marie Le Guen, sHFUpWDLUH GeWDW DXSUqV GX 3UHPLHU ministre, charg des
Relations avec le Parlement

165

ANNEXE N 2 :
NOMBRE MOYEN DE LOIS ADOPTES PAR NEUF PARLEMENTS
EUROPENS AU COURS DES DERNIRES ANNES

Pays

Nombre
de Nombre
de Nombre
de Nombre
de
lois adoptes lois adoptes lois adoptes lois adoptes
en 2010-2011 en 2011-2012 en 2012-2013 en 2013-2014

Allemagne

2009-2013 : 553 (soit, environ, 138 lois par an)

Belgique

Donne non
communique

181

211

278

Danemark

207

207

236

Donne non
communique

Espagne

52

25

France

108

10

90

98

Norvge

68

77

124

Donne non
communique

Pays-Bas

279

262

254

Donne non
communique

Portugal

57

93

92

Donne non
communique

38

28

Royaume-Uni

49

Donne non
communique

Donne non Donne non


communique communique

Source : rponses IRXUQLHV SDU KXLW GHV GL[ SDUOHPHQWV HXURSpHQV LQWHUURJpV SDU OD PLVVLRQ SDU OLQWHUPpGLDLUH GX &HQWUH
europen de recherche et de documentation parlementaires - CERDP.

166

ANNEXE N 3 :
02'/(6'(),&+(6'IMPACT DES PROJETS D$&7(6
RGLEMENTAIRES RELATIFS AUX ENTREPRISES ET AUX
COLLECTIVITS TERRITORIALES
(CIRCULAIRE DU 17 FVRIER 2011)

167

168

169

170

171

172

173

174

175

ANNEXE N 4 :
MESURE DES CHARGES ADMINISTRATIVES
EN BELGIQUE ET EN ALLEMAGNE
TABLEAU N 1. VOLUTI ON DES CHARGES ADM I NI STRATI VES EN BELGI QUE EN 2012
volution des charges administratives sur une base annuelle

I mpact montaire

I ntrieur

-

Affaires trangres

-

conomie, P.M .E., Classes moyennes et nergie


Finances

-
-

Technologie de l'I nformation et de la Communication (Fedict)

-

Justice

-

M obilit et Transport



Scurit sociale et I nstitutions publiques de scurit sociale

-

Sant publique, Scurit de la Chane alimentaire et Environnement

-

Emploi, Travail et Concertation sociale

-

Plusieurs domaines politiques concerns :


- Tlmarc
- Facturation lectronique
- Chque-repas lectronique

-
-
-

TOTAL

-

6RXUFH5DSSRUWGXEXUHDXGHPHVXUHGHO$6$S

176
TABLEAU N 2. VOLUTI ON CUM ULE DES CHARGES ADM I NI STRATI VES
EN BELGI QUE DEPUI S 2008
2008

2009

2010

2011

2012

TOTAL

-81 154

-1 066 739

-340 419

19 121 928

-309 130



-611 411

-611 411

conomie, PM E, Classes
moyennes et nergie

-28 687 512

-31 150 527

-20 225 142

-4 631 583

-1 174 410

-

Finances

-16 979 614

-73 526 862

-19 303 458 -45 813 246

-59 559 635

-

31 785

5 574

-124 402

-216 556

-303 599

-1 167 476

-1 418 247

-1 401

-19 502

-119 885

-4 166 511

-39 387 553

-14 783 055

-2 363 723

-8 062 771

1 517 477

-63 079 625

Personnel et Organisation

61 464

61 464

Scurit Sociale et
I nstitutions publiques de
scurit sociale

-7 163 802

18 933 832

-119 353 -16 252 177

-3 624 258

-8 225 758

Sant publique, Scurit


de la chane alimentaire
et environnement

-2 405 416

-121 188

-3 055 016

-1 892 131

-1 018 530

-8 492 281

2 942 732

2 223 244

-19 828 434

1 743 410

-16 672 106

-29 591 154

2 340 625

2 340 625

-9 978 573 

-172 173 442


-493 798
-6 231 187

-189 240 387

-66 671 372 -66 272 434

-260 686 871

-585 036 140

I ntrieur
Affaires trangres

Technologie de
l'I nformation et de la
Communication
Justice
M obilit et Transports

Emploi, travail et
Concertation sociale
I ntgration sociale, Lutte
contre la Pauvret et
conomie sociale
Plusieurs domaines
politiques concerns :
- facturation lectronique
- Tlmarc
- titres-repas lectroniques

-92 868 331

-98 537 132

Source : 5DSSRUWGXEXUHDXGHPHVXUHGHO$6$S44.

177

TABLEAU N 3. e92/87,21'(/,1',&E DES COTS DES CHARGES ADM I NI STRATI VES


EN ALLEM AGNE, DE JANVI ER 2012 JANVI ER 2014
Janvier 2012 = 100

Janvier

2012

2013

2014

100,00

100,28

100,32

Fvrier

100,29

M ars

100,25

Avril

100,26

M ai

100,27

100,30

Juin

100,30

100,30

Juillet

100,24

100,32

Aot

100,25

100,33

Septembre

100,21

100,32

Octobre

100,23

100,32

Novembre

100,25

100,31

Dcembre

100,27

100,31

y = Donnes inconnues.
= Indisponible.
Source : site Internet du bureau fdral des statistiques (Destatis)

178

ANNEXE N 5 :
MESURE DES CHARGES ADMINISTRATIVES EN FRANCE
TABLEAU N 'eVALUATI ON DES I M PACTS FI NANCI ERS GLOBAUX
Entreprises

Collectivits
territoriales
tat
et EPL
&KDUJHVGDGDSWDWLRQHWFKDUJHVUpFXUUHQWHV
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00
0,00

Particuliers

Autres
organismes
administratifs

Total

0,00
0,00
0,00

0,00
0,00
0,00

Anne 1
Anne 2
Anne 3
Moyenne
annuelle sur
3 ans

0,00
0,00
0,00
0,00

0,00

0,00

0,00

0,00

0,00

Anne 1
Anne 2
Anne 3
Moyenne
annuelle sur
3 ans
Impact net

0,00
0,00
0,00

0,00
0,00
0,00

conomies et gains
0,00
0,00
0,00

0,00
0,00
0,00

0,00
0,00
0,00

0,00
0,00
0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

0,00

Source : Secrtariat gnral du Gouvernement : 0DQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ, fvrier 2014.

TABLEAU N 'eVALUATI ON DES DPENSES ',19(67,66(0(17


I nvestissements
Terrains, constructions, installations techniques, matriels,
RXWLOODJHVDXWUHV
Investissements immatriels (ex : adaptation des SI, achat de
licences)
Fonctionnement
Achats, approvisionnements, petits quipements
tudes et prestations de services externes
Location
Estimation des salaires et traitements :
Temps de travail ou ETPT
Salaire moyen charg
1RPEUHGHQWUHSULVHVFRQFHUQpHV
Total des salaires et traitements
Imputation forfaitaire de frais gnraux
Cot total des salaires et traitements
Formation
)UDLVILQDQFLHUVHWSULPHVGDVVXUDQFHV
Communication
Autres ( prciser)

0,00
0,00
0,00

Source : Secrtariat gnral du Gouvernement : 0DQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ, fvrier 2014.

179

TABLEAU N 3. M THODE BELGE ET FRA1d$,6('(67,0$7,21DU COT LI


/$&&203/,66(0(17'2%/,*$7,2165e*/(0ENTAI RES
Tche administrative
Dplacement la mairie pour une carte d'identit
Dplacement la mairie pour une dclaration
Dplacement la mairie pour une dclaration
Dplacement la mairie pour un certificat ou une attestation
Dplacement au bureau de poste pour une lettre recommande (particulier)
Dplacement au bureau de poste pour une lettre recommande (employeur)
Dplacement au bureau de poste pour l'achat de timbres, timbres fiscaux...
Visite chez le mdecin
Dplacement la pharmacie
Frais de dplacement par kilomtre
Frais de parking (en moyenne)

Temps en minutes
avec dplacement
36
40
37
37
30
32
26
64
14
0
0

Couts/frais
en
2
2
2
2
2
2
2
7.34
0.70
0.28
0.16

Sans Dplacement
Copier ou imprimer des documents
Signer des documents
Poster des documents
Faxer des documents
Envoyer un document par mail
Faire un virement (lectronique)
Archiver des documents
Archiver des documents de manire lectronique
Recevoir une lettre

2
2
10
5
2
3
10
4
2

0
0
0
0
0
0
0
0
0

Source : Secrtariat gnral du Gouvernement : 0DQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ, fvrier 2014,


qui renvoie au Modle de mesure Kafka, guide pratique destin quantifier les charges administratives, Agence pour la
simplification administrative, Belgique.

180

TABLEAU N 4. M THODE ALLEM ANDE ET )5$1d$,6('(67,0$7,ON DE LA DURE


NCESSAI RE /$&&203/,66(0(17'2%/,*$7,2165e*/(0ENTAI RES
Pour les entreprises

Activit
Se familiariser avec une obligation d'information
Recueillir les donnes
Remplir les formulaires
Effectuer les calculs
Vrifier les donnes et calculs
Corriger les erreurs
Traiter les donnes
Transmettre et publier les donnes
Organiser des runions internes
Organiser des runions extrieures
Effectuer les paiements
Photocopier, classer, distribuer
Cooprer une inspection par les autorits publiques
Procder aux corrections la suite d'une inspection
Fournir des informations supplmentaires si ncessaire
Former

Facile
3 min
3 min
3 min
3 min
1 min
2 min
3 min
1 min
5 min
10 min
2 min
2 min
2 min
3 min
3 min
3 min

M odre

Complexe

15 min
15 min
7 min
20 min
5 min
10 min
15 min
2 min
30 min
60 min
8 min
5 min
30 min
90 min
15 min
35 min

120 min
120 min
30 min
120 min
45 min
60 min
120 min
10 min
480 min
480 min
30 min
15 min
140 min
90 min
120 min
480 min

Pour les particuliers

Activit
Se familiariser avec une obligation d'information
Obtenir des conseils
Rassembler et compiler des donnes
Traiter les informations et donnes
Remplir des formulaires
Rdiger des correspondances
Transmettre les informations aux autorits comptentes
Procder aux paiements
Photocopier, classer, distribuer
Cooprer une inspection par les autorits publiques
Fournir des informations supplmentaires si ncessaire

Facile
2 min
10 min
1 min
1 min
2 min
3 min
1 min
1 min
1 min
1 min
2 min

M odre

Complexe

5 min
30 min
3 min
5 min
5 min
5 min
2 min
2 min
3 min
15 min
5 min

20 min
79 min
20 min
54 min
25 min
13 min
5 min
3 min
6 min
60 min
15 min

Source : Secrtariat gnral du Gouvernement 0DQXHOGDLGHDXFDOFXOGHOLPSDFWILQDQFLHUGHODUpJOHPHQWDWLRQ, fvrier


2014, qui renvoie aux /LJQHVGLUHFWULFHVSRXUOLGHQWLILFDWLRQHWODSUpVHQWDWLRQGHVFRWVGHFRQIRUPLWpGDQVOHVSURMHWVGH
loi du gouvernement fdral allemand (Guidelines on the identification and presentation of compliance costs in legislative
proposals by the federal government, Federal Statistical Office, Federal Government, Nationaler Normenkontrollrat, juin
2011).

181

ANNEXE N 6 :
CONSULTATIONS PRALABLES OBLIGATOIRES
SUR LES PROJETS DE LOI

CHAM P DE LA CONSULTATI ON

I NSTANCE

OBLI GATOI RE

DLAI S ET
OBSERVATI ONS

BASE JURI DI QUE

CONSULTATI ONS PRVUES PAR LA CONSTI TUTI ON


&RQVHLOGeWDW

Conseil conomique,
social et
environnemental

Commission
indpendante prvue par
ODUWLFOHGHOD
Constitution

Assemble de la
Polynsie franaise

Obligatoirement saisi de tous les Article 39 de


projets de loi, avant leur adoption par Constitution
le Conseil des ministres et leur dpt
devant le Parlement (1).
Saisi par le Gouvernement, donne son
avis sur les projets de loi,
GRUGRQQDQFH RX GH dcret ainsi que
sur les propositions de lois qui lui sont
soumis.
Obligatoirement saisi pour avis, par le
Premier ministre, des projets de loi de
plan et des projets de loi de
programmation

caractre
conomique,
social
ou
environnemental.
Peut tre saisi pour avis, par le
Premier ministre, des projets de loi de
programmation
dfinissant
les
orientations
pluriannuelles
des
finances publiques, des projets de loi,
GRUGRQQDQFH RX GH GpFUHW DLQVL TXH
des propositions de loi entrant dans le
domaine de sa comptence.

Article 69 de la
Constitution
Ordonnance
n 58-1360 du 29
dcembre
1958
portant loi organique
relative au Conseil
conomique, social
et environnemental.

Se prononce par un avis public sur les Article 25 de


projets de texte et propositions de loi Constitution
dlimitant les circonscriptions pour
OpOHFWLRQGHVGpSXWpVRXPRGLILDQWOD
rpartition des siges de dputs ou de
snateurs.
Introduction,
modification
ou
suppression
de
dispositions
particulires la Polynsie franaise.
Autorisation
de
ratifier
ou
GDSSURXYHU
GHV
HQJDJHPHQWV
internationaux qui interviennent dans
les domaines de comptence de la
Polynsie franaise.

la

la

Article 74 de la Un mois (15 jours en


Constitution
FDVGXUJHQFH
Article 9 de la loi
organique
n 2004-192 du 27
fvrier 2004

(1) /HVDYLVUHQGXVSDUOH&RQVHLOGeWDWVXUXQSURMHWGHORLQHILJXUHQWSDVGDQVOHVGRFXPHQWVUHQGDQWFRPSWH
GHOpWXGHGLPSDFWHQDSSOLFDWLRQGXSUHPLHUDOLQpDGHODUWLFOHGHODORLRUJDQLTXH n 2009-403 du 15
DYULOUHODWLYHjODSSOLFDWLRQGHVDUWLFOHV-1, 39 et 44 de la Constitution.

182
CHAM P DE LA CONSULTATI ON

I NSTANCE

OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Conseil territorial de
Saint-Barthlemy

Introduction,
modification
ou
suppression
de
dispositions
particulires Saint-Barthlemy.
Autorisation
de
ratifier
ou
GDSSURXYHU
GHV
HQJDJHPHQWV
internationaux qui interviennent dans
les domaines de comptence de
Saint-Barthlemy.

Article 74 de la Un mois (15 jours en


Constitution
FDVGurgence)
Article L.O. 6213-3
du code gnral des
collectivits
territoriales

Conseil territorial de
Saint-M artin

Introduction,
modification
ou
suppression
de
dispositions
particulires Saint-Martin.
Autorisation
de
ratifier
ou
GDSSURXYHU
GHV
HQJDJHPHQWV
internationaux qui interviennent dans
les domaines de comptence de
Saint-Martin.

Article 74 de la Un mois (15 jours en


Constitution
FDVGXUJHQFH
Article L.O. 6313-3
du code gnral des
collectivits
territoriales

modification
ou
Conseil territorial de Introduction,
de
dispositions
Saint-Pierre-et-M iquelon suppression
particulires

Saint-Pierre-et-Miquelon.
Autorisation
de
ratifier
ou
GDSSURXYHU
GHV
HQJDJHPHQWV
internationaux qui interviennent dans
les domaines de comptence de
Saint-Pierre-et-Miquelon.

Article 74 de la Un mois (15 jours en


Constitution
FDVGXUJHQFH
Article L.O. 6413-3
du code gnral des
collectivits
territoriales

Introduction,
modification
ou
suppression
de
dispositions
particulires Wallis-et-Futuna.
Autorisation
de
ratifier
ou
GDSSURXYHU
des
engagements
internationaux qui interviennent dans
les domaines de comptence de
Wallis-et-Futuna.

Article 74 de la dlai raisonnable


Constitution
TXHOH&RQVHLOGeWDW
Nant (application estime un mois
des rgles dgages
par la jurisprudence
du
Conseil
constitutionnel dans
ODWWHQWH
GH
OLQWHUYHQWLRQ
GH
dispositions
organiques)

Conseil territorial de
Wallis-et-Futuna

CONSULTATI ONS PRVUES PAR LA LOI ORGANI QUE


Congrs de la
Nouvelle-Caldonie

Introduction,
modification
ou
suppression
de
dispositions
particulires la Nouvelle-Caldonie.
Autorisation
de
ratifier
ou
GDSSURXYHU
GHV
HQJDJHPHQWV
internationaux intervenant dans les
GRPDLQHV GH FRPSpWHQFH GH OeWDW HW
D\DQW YRFDWLRQ j VDSSOLTXHU HQ
Nouvelle-Caldonie.

Articles 89 et 90 de Un mois (15 jours en


la loi organique FDVGXUJHQFH
n 99-209 du 19
mars 1999

Dfenseur des droits

Peut tre consult par le Premier


ministre sur tout projet de loi
intervenant dans son champ de
comptence.

Loi
organique
n 2011-333 du 29
mars 2011 relative
au Dfenseur des
droits

183

I NSTANCE

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

organique Septembre
Haut conseil des finances Est saisi par le Gouvernement des Loi
prvisions macroconomiques et de n 2012-1403 du 17 chaque anne
publiques
OHVWLPDWLRQ GX SURGXLW LQWpULHXU EUXW dcembre 2012
potentiel sur lesquelles repose le
projet de loi de programmation des
finances publiques.
Est saisi par le Gouvernement des
prvisions macroconomiques sur
lesquelles reposent le projet de loi de
ILQDQFHVGH ODQQpHHWOHSURMHWGHORL
de financement de la scurit sociale
GHODQQpH
Rend un avis sur le ralisme des
prvisions macroconomiques du
Gouvernement en cas de dpt GXQ
projet de loi de finances rectificative
RX GXQ SURMHW GH ORL GH ILQDQFHPHQW
rectificative de la scurit sociale.

de

CONSULTATI ONS PRVUES PAR LA LOI


Conseils rgionaux des
UpJLRQVGRXWUH-mer

Sont consults sur les projets de loi,


GRUGRQQDQFH
RX
GH
GpFUHW
comportant
des
dispositions
GDGDSWDWLRQGXUpJLPHOpJLVODWLIHWGH
ORUJDQLVDWLRQ DGPLQLVWUDWLYH GH FHV
rgions.

Article L. 4433-3-1 Un mois (15 jours en


du code gnral des FDVGXUJHQFH
collectivits
territoriales

Conseil gnraux des


dpartements
GRXWUH-mer

Sont consults sur les projets de loi,


GRUGRQQDQFH
RX
GH
GpFUHW
comportant
des
dispositions
GDGDSWDWLRQGXUpJLPHOpJLVODWLIHWGH
ORUJDQLVDWLRQ DGPLQLVWUDWLYH de ces
dpartements.

Article L. 3444-1 du Un mois (15 jours en


code gnral des FDVGXUJHQFH
collectivits
territoriales

Assemble de Guyane

Est consulte sur les projets de loi,


GRUGRQQDQFH
RX
GH
GpFUHW
comportant
des
dispositions
GDGDSWDWLRQGXUpJime lgislatif et de
ORUJDQLVDWLRQ DGPLQLVWUDWLYH GH OD
collectivit territoriale de Guyane.

Article L. 7152-2 du Un mois (15 jours en


code gnral des FDVGXUJHQFH
collectivits
territoriales (1)

Assemble de
M artinique

Est consulte sur les projets de loi,


GRUGRQQDQFH
RX
GH
GpFUHW
comportant
des
dispositions
GDGDSWDWLRQGXUpJLPHOpJLVODWLIHWGH
ORUJDQLVDWLRQ DGPLQLVWUDWLYH GH OD
collectivit territoriale de Martinique.

Article L. 7252-2 du Un mois (15 jours en


code gnral des FDVGXUJHQFH
collectivits
territoriales (2)

(1) (QWUHHQYLJXHXUjFRPSWHUGHODSUHPLqUHUpXQLRQGHODVVHPEOpHGH*X\DQHVXLYDQWVDSUHPLqUHpOHFWLRQ
prvue en mars 2015 (article 21 de la loi n 2011-884 du 27 juillet 2011 modifie).
(2) (QWUH HQ YLJXHXU j FRPSWHU GH OD SUHPLqUH UpXQLRQ GH ODVVHPEOpH GH Martinique suivant sa premire
lection, prvue en mars 2015 (article 21 de la loi n 2011-884 du 27 juillet 2011 modifie).

184

I NSTANCE
Autorit de rgulation
des communications
lectroniques et des
postes

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

Est consulte sur les projets de loi ou


de rglement relatifs aux services
postaux.
Est consulte sur les projets de loi, de
dcret ou de rglement relatifs au
secteur
des
communications
lectroniques et participe leur mise
HQXYUH

BASE JURI DI QUE


Articles L. 5 et
L. 36-5 du code des
postes
et
des
communications
lectroniques

Agence franaise de lutte Est consulte sur tout projet de loi ou Article L. 232-5 du
de rglement relatif la lutte contre le code du sport
contre le dopage
dopage.
Autorit de rgulation
des jeux en ligne

Rend un avis sur tout projet de texte


relatif au secteur des jeux en ligne
soumis agrment que lui transmet le
Gouvernement.
Elle peut proposer au Gouvernement
les modifications lgislatives et
rglementaires qui lui paraissent
ncessaires la poursuite des objectifs
GHODSROLWLTXHGHVMHX[GDUJHQWHWGH
hasard.

Article 34 de la loi
n 2010-476 du 12
mai 2010 relative
ORXYHUWXUe la
concurrence et la
rgulation du secteur
GHV MHX[ GDUJHQW HW
de hasard en ligne

Conseil suprieur de
ODXGLRYLVXHO

Est consult sur les projets de loi et


GDFWHV UpJOHPHQWDLUHV UHODWLIV DX
secteur
de
la
communication
audiovisuelle.

Loi n 86-1067 du
30 septembre 1986
relative la libert
de communication

Commission nationale de Est consulte sur tout projet de loi ou


OLQIRUPDWLTXHHWGHV de dcret relatif la protection des
SHUVRQQHV j OpJDUG GHV WUDLWHPHQWV
liberts
automatiss.
Propose au Gouvernement les
mesures lgislatives de nature
adapter la protection des liberts et de
OD YLH SULYpH j OpYROXWLRQ GHV
techniques.

Loi n 78-17 du 6
janvier 1978 relative
l'informatique, aux
fichiers
et
aux
liberts

Est consult par le Gouvernement sur


Conseil national
GpYDOXDWLRQGHVQRUPHV OLPSDFW WHFKQLTXH HW ILQDQFLHU GHV
projets de loi crant ou modifiant des
normes applicables aux collectivits
territoriales et leurs tablissements
publics.

Article L. 1212-2 du
code gnral des
collectivits
territoriales

Consult sur les projets de loi relatifs


j ODLGH MXULGLFWLRQQHOOH j ODLGH j
ODFFqV DX GURLW HW DX[ DLGHV j
OLQWHUYHQWLRQ GH ODYRFDW SUpYXHV SDU
les dispositions de la troisime partie
de la loi du 10 juillet 1991.

Article 65 de la loi
n 91-647 du 10
juillet 1991
Article
133
du
dcret n 1266 du 19
dcembre 1991

Conseil national de
ODLGHMXULGLTXH

Conseil national des


oprations funraires

Consult sur les projets de textes Article L. 1241-1 du


relatifs la lgislation et la code gnral des
rglementation funraire.
collectivits
territoriales

Conseil national de
ORUGUHGHVDUFKLWHFWHV

Consult par les pouvoirs publics sur Article 25 de la loi


toutes les questions intressant la n 77-2 du 3 janvier
SURIHVVLRQ QRWDPPHQW ORUJDQLVDWLRQ 1977
GHOHQVHLJQHPHQWGHODUFKLWHFWXUH

DLAI S ET
OBSERVATI ONS

185

I NSTANCE

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Est consult sur la politique propose Article L. 232-1 du


Conseil national de
OHQVHLJQHPHQWVXSpULHXU par les pouvoirs publics pour assurer FRGHGHOpGXFDWLRQ
la
cohsion
des
formations
et de la recherche
suprieures dpendant du ministre
FKDUJpGHOHQVHLJQHPHQWVXSpULHXU
Conseil suprieur de
OpGXFDWLRQ

Est consult et peut donner son avis Article L. 231-1 du


VXU WRXWHV OHV TXHVWLRQV GLQWpUrW FRGHGHOpGXFDWLRQ
QDWLRQDO FRQFHUQDQW OHQVHLJQHPHQW
ou lpGXFDWLRQ TXHO TXH VRLW OH
dpartement ministriel intress.

Confrence nationale des Est consulte sur les projets de loi Article 44 de la loi
VHUYLFHVGLQFHQGLHHWGH UHODWLIVDX[PLVVLRQVjORUJDQLVDWLRQ n 2004-811 du 13
au fonctionnement ou au financement aot 2004
secours
GHVVHUYLFHVGLQFHQGLHHWGHVHFRXUV
Est consulte sur un projet de loi
ayant des incidences sur les missions,
ORUJDQLVDWLRQ OH IRQFWLRQQHPHQW RX
le financement de la brigade des
sapeurs-pompiers de Paris ou du
bataillon de marins-pompiers de
Marseille.
Conseil suprieur des
tribunaux administratifs
et des cours
DGPLQLVWUDWLYHVGDSSHO

Connat de toute question relative au Article L. 232-1 du


statut particulier du corps des code de la justice
tribunaux administratifs et cours administrative
DGPLQLVWUDWLYHVGDSSHO

Conseils
GDGPLQLVWUDWLRQGHV
caisses de scurit sociale
du rgime gnral

Sont saisis, pour avis et dans le cadre Article L. 200-3 du


de leurs comptences respectives, de code de la scurit
tout projet de mesure lgislative ayant sociale
GHV LQFLGHQFHV VXU OpTXLOLEUH
financier de la branche ou entrant
dans leur domaine de comptence et
notamment des projets de loi de
financement de la scurit sociale.

Le Gouvernement
transmet
au
Parlement les avis
rendus
sur
les
projets de loi.
Le Gouvernement
fait connatre dans
XQ GpODL GXQ PRLV
OHV VXLWHV TXLO
rserve
aux
propositions.
/DYLV GRLW rWUH
notifi au ministre
charg de la scurit
sociale dans le dlai
de vingt et un jours
compter de la date
de rception du
projet de mesure
lgislative.
Toutefois, en cas
GXUJHQFH GPHQW
invoque dans la
lettre de saisine, ce
dlai est rduit
onze jours.

186

I NSTANCE

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Commission nationale de &KDUJpH GpPHttre un avis sur les Article L. 2271-1 du


la ngociation collective SURMHWV GH ORL GRUGRQQDQFH HW GH code du travail
dcret relatifs aux rgles gnrales
portant sur les relations individuelles
et collectives du travail, notamment
celles concernant la ngociation
collective.
Conseil national de
OHPSORL

&KDUJpGpPHWWUHXQDYLV
Article L. 5112-1 du
1 6XUOHVSURMHWVGHORLGRUGRQQDQFH code du travail
HWGHGpFUHWUHODWLIVjOHPSORL

Conseil national de la
formation
professionnelle tout au
long de la vie

met un avis sur les projets de loi, en Article L. 6123-1 du


matire de formation professionnelle code du travail
initiale et continue.

&RQVHLOGHO8QLRQ
nationale des caisses
GDVVXUDQFHPDODGLH

Charg de rendre un avis motiv et Article L. 182-2 du


public sur les projets de loi relatifs code de la scurit
ODVVXUDQFHPDODGLH
sociale

Haut conseil de sant


publique

Est consult avant de fixer les rgles Article L. 1311-1 du


JpQpUDOHV GK\JLqQH HW WRXWHV DXWUHV code de la sant
mesures propres prserver la sant publique
GHOKRPPHQRWDPPHQWHQPDWLqre :
- de prvention des maladies
transmissibles ;
- de salubrit des habitations, des
agglomrations et de tous les milieux
GHYLHGHOKRPPH
- GDOLPHQWDWLRQ HQ HDX GHVWLQpH j OD
consommation humaine ;
- GH[HUFLFH GDFWLYLWpV QRQ VRXPLVHV
la lgislation sur les installations
classes pour la protection de
OHQYLURQQHPHQW
- GpYDFXDWLRQ GH WUDLWHPHQW
GpOLPLQDWLRQHWGXWLOLVDWLRQGHVHDX[
uses et des dchets ;
- de lutte contre les bruits de
voisinage
et
la
pollution
DWPRVSKpULTXHGRULJLQHGRPHVWLTXH
- de prparation, de distribution, de
transport et de conservation des
denres alimentaires.

Conseil de
OKRVSLWDOLVDWLRQ

Les
dcisions
relatives
au Article L. 162-21-2
financement des tablissements de du code de la
sant, la dtermination des objectifs scurit sociale
GH GpSHQVHV GDVVXUDQFH PDODGLH
UHODWLYHV DX[ IUDLV GKRVSLWDOLVDWLRQ
notamment celles portant sur les
lments mentionns aux articles
L. 162-22-3,
L. 162-22-10
et
L. 162-22-13, sont prises sur la
recommandation de ce conseil.

Lorsque la dcision
prise est diffrente
de
la
recommandation du
conseil, elle est
motive. En cas de
carence du conseil,
les
ministres
comptents
OLQIRUPHQW de la
dcision prise et le
conseil donne un
avis sur la dcision.

187

I NSTANCE
Comit consultatif de la
lgislation et de la
rglementation
financire

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

Saisi pour avis par le ministre charg Article L. 614-2 du Les


projets,
GH OpFRQRPLHGH WRXWSURMHWGHORLHW code montaire et intervenant dans les
de toute proposition de rglement ou financier
mmes domaines ne
de directive communautaires avant
peuvent tre adopts
son examen par le Conseil des
TXDSUqV ODYLV GX
Communauts europennes, traitant
Comit consultatif
de questions relatives au secteur de
de la lgislation et
ODVVXUDQFHDXVHFWHXUEDQFDLUHHWDX[
de la rglementation
HQWUHSULVHV
GLQYHVWLVVHPHQW
j
financires.
OH[FHSWLRQ GHV WH[WHV SRUWDQW VXU
Il ne peut tre pass
O$XWRULWp GHV marchs financiers ou
outre un avis
entrant dans les comptences de
dfavorable
du
celle-ci.
comit
sur
ces
SURMHWV TXDSUqV TXH
le ministre charg de
OpFRQRPLH
D
demand
une
deuxime
dlibration de ce
comit.

Autorit des marchs


financiers

Peut formuler des propositions de Loi n 2003-1109 du


modifications des lois et rglements 1er aot 2003
FRQFHUQDQW OLQIRUPDWLRQ GHV SRUWHXUV
GLQVWUXPHQWV ILQDQFLHUV HW GX SXEOLF
OHV PDUFKpV GLQVWUXPHQWV ILQDQFLHUV
et le statut des prestataires de services
GLQYHVWLVVHPHQW

Comit des normes


comptables

Est consult sur tout projet de norme Article 136 de la loi


de comptabilit gnrale applicable de
finances
certaines personnes.
n 2001-1275 du 28
dcembre 2001

Autorit des normes


comptables

Donne un avis sur toute disposition


lgislative ou rglementaire contenant
des mesures de nature comptable
applicables
aux
personnes
mentionnes dans cet article, labore
par les autorits nationales.

Conseil suprieur de la
mutualit

DLAI S ET
OBSERVATI ONS

Article
1er
de
ORUGRQQDQFH
n 2009-79 du 22
janvier 2009 crant
l'Autorit
des
normes comptables

Saisi pour avis par le ministre charg Article L. 411-1 du


de la mutualit sur tout projet de texte code de la mutualit
lgislatif ou rglementaire relatif au
fonctionnement des mutuelles, des
unions et des fdrations, ainsi que
sur tout projet de rglement ou
directive communautaire ayant le
mme objet avant son examen par le
Conseil
des
Communauts
europennes.

Conseil suprieur des Tout projet de modification du statut Article L. 212-16 du


chambres rgionales des dfini par le prsent code est soumis code des juridictions
pour avis au Conseil suprieur des financires
comptes
chambres rgionales des comptes.
Ce conseil est galement consult sur
toute
question
relative

ORUJDQLVDWLRQ DX IRQFWLRQQHPHQW RX


la comptence des chambres
rgionales.

188

I NSTANCE
Autorit de la
concurrence

Comit des finances


locales

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Peut
tre
consulte
par
les Article L. 62-1 du
commissions parlementaires sur les code de commerce
propositions de loi ainsi que sur toute
question concernant la concurrence.
Donne son avis sur toute question de
concurrence la demande du
Gouvernement.
Est consult sur tout projet de loi, tout
SURMHW
GDPHQGHPHQW
GX
Gouvernement caractre financier
concernant les collectivits locales.

Article L. 1211-3 du
code gnral des
collectivits
territoriales

Fournit au ministre charg de la sant Article L. 5311-2 du


Agence nationale de
scurit du mdicament OH[SHUWLVHTXLOXLHVWQpFHVVDLUHHQFH code de la sant
et des produits de sant qui concerne les produits susviss, publique
notamment pour en permettre le bon
usage ; elle participe la prparation
des textes lgislatifs et rglementaires.
Agence franaise de
scurit sanitaire des
aliments

)RXUQLW DX *RXYHUQHPHQW OH[SHUWLVH Article L. 1323-2 du


HWODSSXLVFLHQWLILTXHHWWHFKQLTXHTXL code de la sant
lui sont ncessaires, notamment pour publique
OpODERUDWLRQ HW OD PLVH HQ XYUH GHV
dispositions lgislatives des rgles
communautaires et des accords
internationaux relevant de son
domaine de comptence, et instruit,
SRXUVRQFRPSWHHWVRXVODXWRULWpGX
directeur gnral, OHVGRVVLHUVTXLOOXL
confie.

Conseil suprieur de la
fonction publique de
OeWDW

Est saisi :
Article 2 du dcret
1 Des projets de loi tendant n 82-450 du 28 mai
modifier les lois n 83-634 du 13 1982
juillet 1983 portant droits et
obligations des fonctionnaires et
n 84-16 du 11 janvier 1984 portant
dispositions statutaires relatives la
IRQFWLRQSXEOLTXHGHOeWDW
2 Des projets de loi relatifs la
VLWXDWLRQ GHV DJHQWV FLYLOV GH OeWDW
titulaires ou non ;
3 Des projets de loi, drogeant aux
lois du 13 juillet 1983 et du 11 janvier
1984 prcites, relatifs un ou
plusieurs corps de fonctionnaires de
OeWDW

Conseil suprieur de la
fonction militaire

Exprime son avis sur les questions de Article L. 4124-1 du


caractre gnral relatives la code de la dfense
condition et au statut des militaires.

Chaque anne, avant


le 31 juillet, les
comptes du dernier
exercice connu des
collectivits locales
sont prsents au
gouvernement ainsi
TXDX[ FRPPLVVLRQV
des Finances de
O$VVHPEOpH
nationale
et
du
Snat.

189
CHAM P DE LA CONSULTATI ON

I NSTANCE

OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Conseil suprieur de la
fonction publique
territoriale

Est saisi pour avis par le ministre Article 9 de la loi Le ministre charg
charg des collectivits territoriales n 84-53 du 26 des
collectivits
des projets de loi relatifs la fonction janvier 1984
territoriales peut, en
publique territoriale ainsi que des
tant que de besoin,
SURMHWV GRUGRQQDQFH SULV GDQV OHV
demander la runion
FRQGLWLRQVSUpYXHVjODUWLFOHGHOD
du Conseil suprieur
Constitution.
de
la
fonction
publique territoriale
dans un dlai de dix
jours.

Conseil suprieur de la
fonction publique
hospitalire

Est saisi pour avis des projets de loi Article 12 de la loi


de porte gnrale relatifs la n 86-33
du
9
situation
des
personnels
des janvier 1986
pWDEOLVVHPHQWV PHQWLRQQpV j ODUWLFOH
2 et des projets de statuts particuliers
des corps et emplois.

Conseil national de
OHQVHLJQHPHQWDJULFROH

Donne obligatoirement son avis sur Article L. 814-2 du


tout avant-projet de loi concernant code rural
OHQVHLJQHPHQWDJULFROH

Banque centrale
europenne

Est consulte par les autorits des Loi n 2008-125 du


tats membres au sujet de projets de 13 fvrier 2008
rglementation.
autorisant
la
ratification du trait
de Lisbonne
Articles 109 L,
paragraphe 2, et 109
F, paragraphe 6, du
Trait instituant la
Communaut
europenne, et de
ODUWLFOH  GH OD
dcision du conseil
93/717/CE

Commission europenne Les tats membres qui, en vertu de


ODUWLFOH  GX WUDLWp VRQW WHQXV GH
IDFLOLWHU ODFFRPSOLVVHPHQW GH VD
mission, doivent notifier leurs projets
dans le domaine des rglementations
techniques.

Loi n 2008-125 du
13 fvrier 2008
autorisant
la
ratification du trait
de Lisbonne
Directive du 28 mars
1983 prvoyant une
procdure
GLQIRUPDWLRQ GDQV
le domaine des
normes
et
rglementations
techniques
(83/189/CEE)

CONSULTATI ONS PRVUES PAR LE RGLEM ENT


&RQVHLOGDGPLQLVWUDWLRQ Est consult sur tout projet de texte Article 22 du dcret
SRUWDQW VXU ORUJDQLVDWLRQ HW OH n 2004-569 du 18
GXQpWDEOLVVHPHQW
fonctionnement du rgime et de juin 2004
public
OpWDEOLVVHPHQW

(Q FDV GXUJHQFH


GpFODUpH ODYLV HVW
rendu dans un dlai
de dix jours ouvrs
compter
de
la
saisine.

190

I NSTANCE

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

Dcret n 89-647 du
Commission suprieure Elle a pour mission de :
- recenser les textes lgislatifs et 12 septembre 1989
de codification
rglementaires applicables dans les
WHUULWRLUHV GRXWUH-mer, vrifier le
FKDPS GDSSOLFDWLRQ GHV WH[WHV j
codifier en ce qui concerne ces
mmes territoires
- adopter
et
transmettre
au
Gouvernement les projets de codes
labors dans les conditions dfinies
SDUODUWLFOHGHODORLQ 2000-321 du
12 avril 2000 ainsi que les projets qui
lui sont soumis tendant la refonte de
codes existants.
Elle peut galement tre consulte sur
les projets de textes modifiant des
codes existants.
Est consult par le ministre charg des Article 3 du dcret
Comit national des
pches maritimes et des pches maritimes et des cultures n 92-335 du 30
marines sur toute mesure nationale ou mars 1992
levages marins
communautaire concernant :
a) La prservation et la gestion des
ressources de pche ;
E  /HV FRQGLWLRQV GH[HUFLFH GH OD
pche professionnelle et des levages
PDULQV j OH[FOXVLRQ GHV TXHVWLRQV
relatives la rglementation du travail
et la fixation des salaires ;
c)
Le
fonctionnement
de
ORUJDQLVDWLRQLQWHUSURIHVVLRQQHOOHGHV
pches maritimes et des levages
marins.
Est consult sur les dispositions des Article R. 213-77 du
Comit technique
de
permanant des barrages projets de loi, relatifs la scurit de code
ces ouvrages, leur surveillance et OHQYLURQQHPHQW
leur contrle.
Conseil national de
OKDELWDW

Le ministre charg du logement peut Article R. 361-2 du


recueillir son avis sur toute question code
de
la
relative la politique du logement.
construction et de
OKDELWDWLRQ

Conseil suprieur des


administrations
parisiennes

Chaque section est galement saisie Dcret n 94-415 du


GHWRXWSURMHWPHQWLRQQpjODUWLFOH 24 mai 1994
relatif aux personnels qui relvent de
sa comptence.

Donne son avis sur les questions qui Dcret n 2009-64


Conseil gnral de
relvent
du
champ
de
ses du 16 janvier 2009
OpFRQRPLHGH
OLQGXVWULHGHOpQHUJLH comptences.
et des technologies
Conseil national du sport Est consult, la demande du ministre Article R. 142-2 du
charg des sports, sur tout projet de code des sports
loi ou de texte rglementaire relatif
aux activits physiques et sportives.

DLAI S ET
OBSERVATI ONS

191

I NSTANCE
Conseil suprieur de la
marine marchande

CHAM P DE LA CONSULTATI ON
OBLI GATOI RE

BASE JURI DI QUE

DLAI S ET
OBSERVATI ONS

Obligatoirement consult sur les Dcret n 2002-647 Son avis est rput
projets de loi relatifs la marine du 29 avril 2002
GRQQp VLO QH VHVW
marchande ou aux ports maritimes.
pas prononc dans le
GpODL GXQ PRLV j
compter de la date
de rception du
projet
par
le
prsident

Groupe interministriel Examine les projets de lois relatifs Article 2 du dcret


n 75-360 du 15 mai
permanent de la scurit la scurit routire.
1975
routire
M ission
interministrielle de
OHDX

Donne son avis sur tous les projets de Article R. 213-13 du


lois, portant en tout ou partie sur des code
de
TXHVWLRQV UHODWLYHV j OHDX pODERUpV OHQYLURQQHPHQW
par les diffrents ministres.
Examine galement les projets de
WH[WHV UHODWLIV j ORUJDQLVDWLRQ GHV
services dconcentrs de chaque
ministre dans le doPDLQH GH OHDX
DLQVL TXH OHV SURMHWV GLQVWUXFWLRQ GX
PLQLVWUH FKDUJp GH OHQYLURQQHPHQW
relatifs la coordination dans ce
domaine.

Conseil suprieur de la
prvention des risques
professionnels

Est consult sur :


Article R. 4641-2 du
2 Les projets de loi relatifs la code du travail
protection et la promotion de la
sant et de la scurit au travail dans
les tablissements mentionns aux
articles L. 4111-1 et L. 4111-3.

Conseil suprieur de la
SUXGKRmie

Est consult sur les projets de loi Article R. 1431-3 du


relatifs :
code du travail
1 $ OLQVWLWXWLRQ OD FRPSpWHQFH
ORUJDQLVDWLRQ HW OH IRQFWLRQQHPHQW
GHVFRQVHLOVGHSUXGKRPPHV
2 $ OpOHFWLRQ DX VWDWXW HW j OD
formation
des
conseillers
SUXGKRPPHV
3 A la procdure suivie devant les
FRQVHLOVGHSUXGKRPPHV

Conseil national de la
consommation

Rend un avis sur les projets ou Article D. 511-3 du


propositions de lois et rglements code
de
la
VXVFHSWLEOHVGDYRLUXQHLQFLGHQFHVXU consommation
la consommation.

192

ANNEXE N 7 :
0,6((1895('835,NCIPE ONE-IN, TWO-OUT
AU ROYAUME-UNI
Tableau n 0LVHHQXYUHGXSULQFLSH One-in, two-out par les ministres en 2013

Source : The Seventh Statement of New Regulation, Better Regulation Executive, dcembre 2013, p. 8.

193

Tableau n &ODVVHPHQWGHVPLQLVWqUHVSRXUODPLVHHQXYUHGXSULQFLSH One-in, twoout en 2013

Source : The Seventh Statement of New Regulation, Better Regulation Executive, dcembre 2013, p. 9.

Tableau n  %LODQ FXPXOp GH OD PLVH HQ XYUH GHV SULQFLSHV One-in, one-out puis
One-in, two-out de 2011 2013 (en millions de livres sterling)

Semestre 1

Semestre 2

Semestre 3

Semestre 4

Semestre 5

Semestre 6

Total dc.
2013

-3,288m

-211m

8m

2,524m

-210m

-17m

-1,193m

Source : The Seventh Statement of New Regulation, Better Regulation Executive, dcembre 2013, p. 4.

194

ANNEXE N 8 :
/(&20,7e'$1$/<6(',03$&7 IMPACT ASSESSMENT
BOARD ) DE LA COMMISSION EUROPENNE

PLACE DU COM I T '$1$/<6(',03$&7 I AB ) '$16/$3+$6(' I NI TI ATI VE DES


TEXTES EUROP(16 -8648/(85$DOPTI ON PAR LA COM M I SSI ON EUROPENNE)

3KDVHGLQLWLDWLYH : la procdure interne la Commission

I
d

Examen
analytique :
continuer?
Analyse

impact
ncessaire
?

Procdure
GDQDO\VH
GLPSDFW :
consultation,
collecte de
donnes,
analyse,
projet rapport

Comit
GDQDO\VH
GLPSDFW

Rexamen
de
ODQDO\VH
GLPSDFW
et

Consultation
interne
interservices

proposition

Collge
(approbation
politique)

p
u
b
l
i
e
r

laboration de la proposition

Feuille
de route

Demande
de consultation

Consultation :
rapport
sur les
conclusions

Proposition,
rapports
GDQDO\VH
GLPSDFW
avis du
comit

3KDVHGLQLWLDWLYH : les actions sont examines par les parties prenantes extrieures
Source 5DSSRUWGHO IAB , p. 8.

Phase
GDGRSWLRQ
de la
lgislation

195
STATI STI QUES RELATI VES AUX ACTI VI T6'(/ I AB DE 2007 2012

Source 5DSSRUWGHO,$%S 14.

196

ANNEXE N 9 :
LE CONSEIL INDPENDANT CHARG DE CONTRLER LA QUALIT
'(6e78'(6',03$&7DES ADMINISTRATIONS BRITANNIQUES :
REGULATORY POLICY COMMITTEE (RPC)
AVI S DU RPC SUR UN PROJET DE LOI DE RFORM E DES RETRAI TES

197

198

199

TABLEAU N 1. CLASSEM ENT DES M I NI S75(66(/21/$9,6eM I S PAR LE RPC


685/(6e78'(6',03ACT COM PLTES EXAM I NES DE JANVI ER JUI N 2013
DANS LE CADRE DE LA PROCDURE CLASSI QUE
Nombre
GpWXGH
GLPSDFW

Avis rouge

Avis orange

Avis vert

Degr de
conformit aux
objectifs fixs

2012

0LQLVWqUHGHOeQHUJLHHWGXFKDQJHPHQW
climatique

11

10

100 %

88 %

Agence nationale de la Sant et de la


scurit

100 %

93 %

Ministre de la Justice

100 %

76 %

Ministre du Budget

100 %

87 %

Ministre du Travail et des retraites

100 %

83 %

Ministre des transports

19

16

89 %

88 %

0LQLVWqUHGHO,QWpULHXU

83 %

68 %

Ministre de la Culture, des mdias et des


sports

78 %

82 %

0LQLVWqUHGHOeFRQRPLHGHOLQQRYDWLRQHW
des comptences

29

17

76 %

84 %

Ministre des Collectivits locales

66 %

76 %

Ministre de la Sant

50 %

68 %

0LQLVWqUHGHOeGXFDWLRQ

50 %

84 %

Ministre de O(QYLURQQHPHQWGH
ODOLPHQWDWLRQHWGHODJULFXOWXUH

38 %

84 %

105

21

18

66

80 %

81 %

Ministre (WXGHGLPSDFWFRPSOqWHV
2013 (janvier juin)

TOTAL

Source : Regulatory Policy Committee, Fit for Purpose Performance 2013, Impact Assessments, half year results January to
June 2013.

200

TABLEAU N 2. CLASSEM ENT DES M I NI S75(66(/21/$9,6eM I S PAR LE RPC


685/(6e78'(6',03ACT ALLGES EXAM I NES DE JANVI ER JUI N 2013
DANS LE CADRE DE LA PROCDURE ACCLRE
Degr de
Degr de
conformit aux conformit aux
objectifs fixs objectifs fixs
(2013)
(2012)

Ministre (WXGHGLPSDFWFRPSOqWHV
2013 (janvier juin)

tudes
GLPSDFW
allges

Avis rouge

Avis vert

0LQLVWqUHGHOeFRQRPLHGHOLQQRYDWLRQHW
des comptences

100 %

89 %

Ministre des Collectivits locales

100 %

100 %

Ministre du Travail et des retraites

100 %

75 %

Ministre de la Justice

100 %

87 %

2IILFHJRXYHUQHPHQWDOSRXUOeJDOLWp

100 %

N/A

Agence des Normes alimentaires

100 %

N/A

Ministre de la Sant

100 %

66 %

Services du Premier ministre

100 %

100 %

Ministre des transports

23

21

91 %

92 %

Ministre du Budget

89 %

100 %

0LQLVWqUHGHO,QWpULHXU

83 %

50 %

0LQLVWqUHGHOeQHUJLHHWGXFKDQJHPHQW
climatique

80 %

50 %

Ministre de la Culture, des mdias et des


sports

66 %

100 %

0LQLVWqUHGHOeGXFDWLRQ

50 %

83 %

0LQLVWqUHGHO(QYLURQQHPHQWGH
ODOLPHQWDWLRQHWGHODJULFXOWXUH

15

10

100 %

91 %

Ministre de la Dfense

0%

N/A

84

20

64

76 %

89 %

TOTAL

Source : Regulatory Policy Committee, Fit for Purpose Performance 2013, Regulatory Triage Assessments, half year results
January to June 2013.

201

ANNEXE N 10 :
PROJETS ET PROPOSITIONS DE LOI EXAMINS ET ADOPTS DE LA
XIE LA XIVE LGISLATURES
(du 1er octobre 1999 au 31 mai 2014)
PJL examins (hors PJL adopts (hors
conventions
conventions
internationales)
internationales)

PPL examines

PPL adoptes

01/10/1999-01/10/2000

37

37

50

43

02/10/2000-30/09/2001

25

25

40

38

01/10/2001-18/06/2002

17

17

23

21

19/06/2002-30/09/2002

01/10/2002-30/09/2003

39

39

23

18

01/10/2003-30/09/2004

34

34

14

01/10/2004-30/09/2005

35

35

15

12

01/10/2005-01/10/2006

33

33

17

12

02/10/2006-19/06/2007

30

29

14

10

20/06/2007-30/09/2007

01/10/2007-30/09/2008

42

42

21

14

01/10/2008-30/09/2009

32

32

19

11

01/10/2009-30/09/2010

35

35

38

22

01/10/2010-30/09/2011

43

43

43

24

01/10/2011-19/06/2012

19

19

33

19

26/06/2012-30/09/2012

01/10/2012- 30/09/2013

34

34

39

19

202

203

ANNEXE N 11 :
VOLUTION DU NOMBRE DE PROCDURES ACCLRES
DE LA XIE LA XIVE LGISLATURE
(DU 1

ER

OCTOBRE 1999 AU 31 MAI 2014)

Procdures acclres sur des


PJL

Procdures acclres sur des


PPL

01/10/1999-01/10/2000

02/10/2000-30/09/2001

20

01/10/2001-18/06/2002

19/06/2002-30/09/2002

01/10/2002-30/09/2003

10

01/10/2003-30/09/2004

13

01/10/2004-30/09/2005

01/10/2005-01/10/2006

12

02/10/2006-19/06/2007

14

20/06/2007-30/09/2007

01/10/2007-30/09/2008

01/10/2008-30/09/2009

30

01/10/2009-30/09/2010

20

01/10/2010-30/09/2011

14

01/10/2011-19/06/2012

16

10

26/06/2012-30/09/2012

01/10/2012-30/09/2013

37

01/10/2013-31/05/2014

25

12

40

Procdures acclres sur les PJL et les PPL de la XIe la XIVe


lgislature
37

35
30

30

25

25
20

20

20

10
5
0

13

12

10

3
0

Procdures acclres sur des PPL

16
12

10

7
44

14

9
5
2

204

15

14

Procdures acclres sur des PJL

205

ANNEXE N 12 :
SCNARIOS DE RFORME POSSIBLES
3285)$,5('(/(;$0EN DE LA LOI DE RGLEMENT
81020(17)257'e9$/8$7,21'(/$&7,21PUBLIQUE
(EXTRAIT DE LA SYNTHSE DU RAPPORT DE
MM. FRANOIS CORNUT-GENTILLE ET RGIS JUANICO
AU P5e6,'(17'(/$66(0%LE NATIONALE)

Procdure d'examen du
projet de loi de rglement
Option 1

Option 2

Option 3

Option 4

Calendrier

Avantages

renvoi la commission
examen en sance
des Finances avec rapport
dbut octobre
lgislatif du rapporteur
gnral et notes d'valuation
des rapporteurs spciaux

cration d'un temps fort


budgtaire alliant
valuation des dpenses
passes et examen des
dpenses venir en PLF

saisine pour avis des


commissions permanentes

mobilisation des
commissions permanentes

cration d'une commission


spciale avec rapport du
rapporteur gnral et
rapports d'valuation des
politiques publiques par
binmes de rapporteurs
(majorit/opposition /
finances/autre commissions)

dlais d'valuation
raisonnables
examen en sance rupture dans la
fin juin
procdure actuelle en
retirant la commission des
Finances sa prminence sur
la loi de rglement et en
associant des rapporteurs
des autres commissions

Inconvnients
calendrier d'examen du projet
de loi de rglement trop tardif
pour peser sur la prparation du
PLF par le gouvernement
absence de binmes
majorit/opposition
risque d'engorgement de la
commission des finances
l'automne
tous les rapporteurs spciaux
de la commission des finances
ne seraient pas membres de la
commission spciale ce qui la
priverait d'office de pouvoirs de
contrle sur certaines missions
et programmes

cration de binmes
majorit /opposition
renvoi la commission
examen du projet implication des
des Finances avec rapport
de loi de rglement commissions permanentes
lgislatif du rapporteur
en sance fin juin tout en prservant la
gnral du budget et notes
prminence de la
examen fin juin
d'valuation des rapporteurs
commission des finances
en commissions
spciaux
largies des
cration de binmes
cration de missions
rapports des
majorit / opposition
d'information communes
missions
(finances + commissions
d'information
permanentes comptentes) communes

dlais d'valuation contraints

renvoi la commission
des Finances avec rapport
lgislatif du rapporteur
gnral du budget et notes
d'valuation des rapporteurs
spciaux
cration de missions
d'information communes
(finances + commissions
permanentes comptentes)

suppose de modifier le
calendrier prvisionnel de
l'ordre du jour afin de dcaler la
semaine de contrle
(actuellement prvue du 10 au
14 juin) la fin juin
dlais d'valuation contraints

examen du projet
de loi de rglement
et dbat sur les
rapports des
missions
d'information
communes fin juin
en sance lors de la
semaine de
contrle

implication des
commissions permanentes
tout en prservant la
prminence de la
commission des finances
cration de binmes
majorit / opposition
exposition mdiatique et
solennit du fait des dbats
en sance
confre un contenu utile
la semaine de contrle

l'examen en commissions
largies des rapports
d'information ne permet pas une
exposition mdiatique et une
solennit politique forte
dlais d'valuation contraints

206

ANNEXE N 13 :
PROPORTION DES LOIS FRANAISES PRISES POUR LA
TRANSPOSITION DES DIRECTIVES EUROPENNES
(TABLEAUX EXTRAITS D(/e78'('(0 YVES BERTONCINI :
/8((76(61250(6 : PRISON DES PEUPLES OU CAGES POULES ? ,
NOTRE EUROPE, INSTITUT JACQUES DELORS, 16 MAI 2014)
TABLEAU N 1. NOM BRE ET NATURE M ATRI ELLE DES ACTES DE TRANSPOSI TI ON DES
DI RECTI VES COM M UNAUTAI RES EN FRANCE POUR LA PRI ODE 2000-2010

ACTES DE PORTE
LGI SLATI VE
7\SHVGDFWHV

ACTES DE PORTE
RGLEM ENTAI RE

DDADC(*)

Lois

Ordonnances

Dcrets

Arrts

Divers(**)

62

224

67

788

1356

34

1RPEUHGDFWHV

TOTAL

Total actes LEG/REGL

353

2178

3URSRUWLRQGDFWHV/(*5(*/

14 %

86 %

Nombre de directives concernes

236

757

993

Nombre de directives concernes/an

21,4

68,8

90,2

23,8 %

76,2 %

100

Proportion de directives/an

2531

(*) /HV''$&VRQWGHVORLVHWRUGRQQDQFHVSRUWDQWGLYHUVHVGLVSRVLWLRQVGDGDSWDWLRQDXGURLWFRPPXQDXWDLUH
(**) Les actes de porte rglementaires divers  FRUUHVSRQGHQW SDU H[HPSOH j GHV GpFLVLRQV GDXWRULWp DGPLQLVWUDWLYH
indpendante.
Source : Donnes SGAR, calculs Y. Bertoncini

TABLEAU N 2. I M PORTANCE RELATI VE DES FLUX NORM ATI FS COM M UNAUTAI RES
ET FRANAI S PAR SECTEUR POUR LA PRI ODE 1987-2006

SECTEURS

LOIS,
DIRECTIVES
ORDONNANCES,
ET
DCRETS,
RGLEMENTS
ARRTS

ACTES UE ET
FRANCE

% UE/TOTAL

Affaires trangres

8 9,6

340,2

429,8

20,8 %

Agriculture

798,4

1021,6

1820

43,9 %

Culture

397,8

397,8

0%

Dfense

0,9

534,4

535,3

0,2 %

cologie

19,75

434,9

454,65

4,3 %

423,65

1737,1

2160,75

19,6 %

1,7

827,1

828,8

0,2 %

Emploi et sant

14,45

1821,1

1835,55

0,8 %

I ntrieur et outre-mer

12,45

1207,7

1220,15

1%

1,05

689,7

690,75

0,2 %

21,75

1167, 2

1188,95

1,8 %

1383,7

10178,8

11562, 5

12 %

conomie
ducation, jeunesse et sports

Justice
Transports et quipement
Total global

Source : Yves Bertoncini, /LPSDFWGHVLQWHUYHQWLRQVGHO8(DXQLYHDXQDWLRQDORSFLW

207
TABLEAU N 3. PROPORTI ON DE LOI S D25,*,1((8523ENNE DANS 7 PAYS DE /8(
PAYS

PERI ODE

'(/2,6'25,*,1(
EUROPEENNE (UE)

Espagne

1986-2007

35

Luxembourg

1986-2006

28,8

Allemagne

1986-2005

28,7

Autriche

1992-2007

26

France

1986-2007

18,75

Pays-Bas

1981-2009

12,3

Finlande

1995-2009

11,8

Source : Donnes S. Brouard, O. Costa et T. Knig, The Europeanization of domestic legislatures, op. cit.

208

ANNEXE N 14 :
OUTILS MTHODOLOGIQUES
POUR LA TRANSPOSITION DES DIRECTIVES EUROPENNES
LE GUI DE DE BONNES PRATI QUES POUR LA TRANSPOSI TI ON DES
DI RECTI VES EUROPENNES
Pour laborer les mesures de transposition des directives europennes, un Guide de bonnes
pratiques concernant la transposition des directives europennes a t labor dans le
prolongement de la circulaire du Premier ministre (M . Jean-Pierre Raffarin) du
27 septembre 2004 relative la procdure de transposition en droit interne des directives et
dcisions-cadres ngocies dans le cadre des institutions europennes. Cette circulaire
UHFRPPDQGDLWGDSSUpFLHUOHSOXVHQDPRQWSRVVLEOHOLPSDFWGHODFWHHQSUpSDUDWLRQVXUOH
droit interne SRXUSHUPHWWUHjODIRLVGDUUrWHUOHVSRVLWLRQVGHQpJRFLDWLRQGHOa France
en connaissance de cause et de prparer la transposition . Selon cette circulaire, cet
HIIRUW GDQWLFLSDWLRQ GRLW VH PDWpULDOLVHU VRXV OD IRUPH GXQH pWXGH GLPSDFW devant tre
prise en compte dans le cadre de la ngociation.
1 Veille pr-transposition  DX VWDGH GH OpODERUDWLRQ GHV SURSRVLWLRQV GH WH[WHV
europens
La veille active sur les projets de la Commission est du ressort de chaque ministre, en lien
DYHF OD 5HSUpVHQWDWLRQ 3HUPDQHQWH GH OD )UDQFH DXSUqV GH O8QLRQ (XURSpHQQH 53  HW le
secrtariat gnral des Affaires europennes (SGAE). Les ministres tablissent des notes
de veille sur le fondement desquelles le SGAE rdige et met jour chances rgulires
un tableau de prospective rassemblant, par secteur, les projets de textes en cours
GpODERUDWLRQDXVHLQGHOD&RPPLVVLRQHXURSpHQQHHWmis la disposition des assembles
sur le site extranet du SGAE.
2 Au stade des ngociations des textes europens
'qVODSXEOLFDWLRQGXQHSURSRVLWLRQGHGLUHFWLYHXQH quipe projet est mise en place au
VHLQGX GHV PLQLVWqUH V FRQFHUQp V DILQGHQpYDOXHUOLPSDFW\FRPSULVGXSRLQWGHYXH
GHVDWUDQVSRVLWLRQ&HWWHpTXLSHSURMHWHVWRSpUDWLRQQHOOHMXVTXjODWUDQVSRVLWLRQGpILQLWLYH
du texte. Elle est responsable de la constitXWLRQGXQIRQGVGHGRVVLHUVXUODGLUHFWLYHTXL
pourra tre utile la conservation de la mmoire de la ngociation et de la
WUDQVSRVLWLRQ GX WH[WH HQ FDV GH PRELOLWp GHV SHUVRQQHV FRQVWLWXDQW OpTXLSH
initialement constitue.
$ILQ GDVVXUHU XQH continuit entre la ngociation et la transposition dans chacune des
assembles, le guide de bonnes pratiques suggre que VHORQ ORUJDQLVDWLRQ DX VHLQ GHV
assembles et des commissions :
un parlementaire se propose ou soit dsign par sa commission pour suivre la
ngociation du texte HQ OLHQ DYHF O quipe projet et le SGAE, et faciliter le choix du
vecteur de transposition le plus appropri ;
ce parlementaire soit ensuite dsign pour suivre le projet de loi de transposition ou
prsenter une proposition de loi sur le domaine couvert par la directive.
3URGXFWLRQGXQHILFKHGLPSDFWVLPSOLILp VRXVVHPDLQHV 
Le ministre chef de file rdige une ILFKH GLPSDFW VLPSOLILp qui contient une description
succincte de la proposition de directive et de son inVHUWLRQ GDQV OHQYLURQQHPHQW MXULGLTXH
QDWLRQDODLQVLTXXn avis sur le principe du texte.

209

&HWWH ILFKH GLPSDFW VLPSOLILpH HVW envoye aux assembles dans les trois semaines
suivant la transmission du texte par le Gouvernement aux assembles. Elle est mise en
OLJQH VXU OH[WUDQHW GX 6*$( et du SGG des fins de transparence et de diffusion de
OLQIRUPDWLRQDX[SULQFLSDX[DFWHXUVFRQFHUQpV
3URGXFWLRQGXQHILFKHGLPSDFWVWUDWpJLTXH VRXVPRLV
Dans les trois mois suivant la transmission de la proposition de directive par le
Gouvernement aux assembles, la ILFKHGLPSDFWVLPSOLILpH est FRPSOpWpHSDUO quipe
projet  SRXU GHYHQLU XQH YpULWDEOH DQDO\VH GLPSDFW DSSHOpH ILFKH GLPSDFW
stratgique . /H QLYHDX GH GpWDLO GH FHWWH DQDO\VH GLPSDFW HVW ODLVVp j ODSSUpFLDWLRQ
des services. Cette fiche est galement envoye aux assembles et mise en ligne sur
OH[WUDQHWGX6*$(
'pILQLWLRQGXQ plan de transposition
Une fois la directive adopte au niveau europen et publie au Journal Officiel de O8QLRQ
europenne, le ministre chef de file tablit un plan de transposition qui dfinit les
vhicules normatifs de transposition (identification des normes abroger, modifier ou
adopter), dterminer les consultations (obligatoires ou non) mener et propose des
FDOHQGULHUVGHUpGDFWLRQHWGDGRSWLRQ.
Pour les directives les plus importantes, dont le texte transposer est clairement identifi,
un projet ou une proposition de loi ddi(e)GRQWOREMHWSULQFLSDOHVWODWUDQVSRVLWLRQGH
cette directive, est rdig.
Pour les directives au contenu essentiellement technique devant tre transposes par voie
OpJLVODWLYH XQ SURMHW GH ORL SRUWDQW GLYHUVHV GLVSRVLWLRQV GDGDSWDWLRQ DX GURLW GH O8QLRQ
europenne ( DDADUE HVWGpSRVpDX3DUOHPHQWHQGpEXWGDnne calendaire. Ce projet
de loi est insr dans le schma prvisionnel du Gouvernement pour les assembles. Sous
rserve des chanciers lectoraux propres chaque assemble, la rpartition des
DDADUE  HQWUH O$VVHPEOpH QDWLRQDOH HW OH 6pQDW GHYUD rWre quilibre, avec
ventuellement deux DDADUE  HQ GpEXW GDQQpH UpSDUWLVVDQW OHV GRPDLQHV FRQFHUQpV
GH IDoRQ KRPRJqQH  OXQ SDVVDQW HQ SUHPLqUH OHFWXUH j O$VVHPEOpH QDWLRQDOH ODXWUH DX
Snat. En cas de projet ou de proposition de loi dont la transSRVLWLRQ QHVW SDV OREMHW
principal mais qui comporte des mesures de transposition, une distinction claire doit tre
RSpUpHGDQVOH[SRVpGHVPRWLIVGHFHTXLUHOqYHGHODWUDQVSRVLWLRQ
Un Groupe Haut Niveau (GHN), coprsid par le Secrtaire gnral du
Gouvernement et le Secrtaire gnral des Affaires europennes, se runit tous les trois
mois afin de traiter au fond des cas de transposition posant des difficults, soit au niveau
du choix du vecteur, soit au niveau du respect des chances de transposition. Il tire
galement un bilan trimestriel de la transposition par ministre, travers un bilan des
diffrents indicateurs labors tout au long du processus de ngociation et de transposition.
6 Veille post-transposition destine anticiper une ventuelle rvision des
directives
Un PpFDQLVPH GDOHUWH VXU OHV GLIILFXOWpV GDSSOLFDWLRQ GHV WH[WHV GH WUDQVSRVLWLRQ
( Centre SOLVIT France ) a t mis en place : il informe le ministre comptent en cas de
GLIILFXOWpVGDSSOLFDWLRQSRXUOHVHQWUHSrises ou les citoyens.
/H JXLGH GH ERQQHV SUDWLTXHV VXJJqUH TXDX 3DUOHPHQW GDQV OH UHVSHFW GX SULQFLSH
GDXWRQRPLH GHV DVVHPEOpHV OH PDQGDW GX UDSSRUWHXU GXQH SURSRVLWLRQ GH GLUHFWLYH
puis du vecteur lgislatif de transposition le cas chant, pourrait utilement tre tendu
pour les directives les plus importantes au suivi de leur excution en France, sur le
PRGqOHGHVUDSSRUWVGDSSOLFDWLRQGHVORLV.

210

Annexe 1 - Fiche dLPSDFWVLPSOLILpH ),6 

Acte europen propos

Base juridique et procdure GDGRSWLRQGHODFWH


-

Base juridique
ComppWHQFHH[FOXVLYHSDUWDJpHGDSSXLGHO8(
ProcpGXUHGDGRSWLRQGHODFWH SURFpGXUHOpJLVODWLYHRUGLQDLUHRXSURFpGXUHVSpFLDOH
Rgles de vote au Conseil

Responsabilit ministrielle
-

Ministre chef de file

Objet de la proposition dDFWH

Description du dispositif administratif et juridique propos

I nsertion dans lHQYLURQQHPHQWMXULGLTXH


-

Respect du principe de subsidiarit


Textes qui en droit franoDLVUpJLVVHQWODPDWLqUHFRQFHUQpHSDUODSURSRVLWLRQGDFWH

Avis sur le principe du texte

Autres observations

211

Annexe 2- Fiche dLPSDFWVWUDWpJLTXH(FI S 2)

Acte europen propos

Base juridique et procpGXUHGDGRSWLRQGHODFWH


-

Base juridique
ComppWHQFHH[FOXVLYHSDUWDJpHGDSSXLGHO8(
ProcpGXUHGDGRSWLRQ GHODFWH SURFpGXUHOpJLVODWLYHRUGLQDLUHRXSURFpGXUHVSpFLDOH
Rgles de vote au Conseil

Champ dDSSOLFDWLRQGHODFWH(espace conomique europen)

Responsabilit ministrielle
-

Ministre chef de file


Ministres concerns
Responsable quipe projet & nom GHVPHPEUHVGHOpTXLSH

Objet, description gpQpUDOHHWSULQFLSDX[HIIHWVDWWHQGXVGHODFWH


Rsum de la proposition, du dispositif administratif et juridique propos et des motivations de la
Commission europenne
I nsertion dans lHQYLURQQHPHQWMXULGLTXH
-

Respect du principe de subsidiarit


Tableau de concordance prcoce7 jIRXUQLUGDQVOHVPRLVVXLYDQWODGRSWLRQGHOD
proposition de directive par la Commission europenne
Le cas pFKpDQWDSSUpFLDWLRQGHVUHFRXUVDX[DFWHVGpOpJXpVRXDX[DFWHVGH[pFXWLRn et de
leur adquation/opportunit ( voir avec le correspondant comitologie du ministre)
Analyse en termes de droits fondamentaux
Avis du Conseil d(WDWVDLVLQHpYHQWXHOOHGDWHGHVDLVLQHUpVXPpGHODYLVUHQGX

Modle de tableau de concordance prcoce


Dispositions de la
proposition de
directive

(article par article)

Droit interne en
vigueur susceptible
drWUHPRGLILp
(citation de la disposition
concerne)

Premire estimation des


normes adopter en vue
de la transposition
(abrogation / modification de
dispositions existantes ; ajout de
dispositions nouvelles) (prciser la
nature juridique

Observations
relatives
jOLPSDFWGHOD
disposition du
projet
de directive

212

Consultations
-

Au niveau communautaire : consultations passes (+ contribution des autorits franaises,


le cas chant)
- Au niveau franais : obligatoires (avec chancier) et facultatives (CCEN, consultations
publiques)
Analyse
-

tude dLPSDFWHXURSpHQQH OHFDVpFKpDQW SULQFLSDX[pOpPHQWV


Contribution nationale jOpWXGHGLPSDFWHXURSpHQQHOHFDVpFKpDQW
tude dLPSDFWQDWLRQDOH
o Premiers pOpPHQWVGDQDO\VHGHVLPSDFWVEXGJpWDLUHVpFRQRPLTXHVHWILQDQFLHUV
sociaux, techniques ou administratifs de la proposition dDFWH
o Impact sur les collectivits locales
,PSDFWVXUORXWUH-mer et autres territoires spcifiques
>$QWLFLSHU HW DUWLFXOHU DYHF OD ILFKH GLPSDFW VXU OHV FROOHFWLYLWpV
territoriales telle que prvue dans la circulaire du Premier ministre du 17
fvrier 2011 sur la simplification des normes concernant les entreprises
et les collectivits territoriales].
o Impact sur les entreprises [Anticiper et articuler avec la fiche dLPSDFW VXU OHV
entreprises telle que prvue dans la circulaire du Premier ministre du 17 fvrier
2011 sur la simplification des normes concernant les entreprises et les
collectivits territoriales].

Position franaise sur la proposition


[ complter chaque grande tape du processus europen de ngociation, si pertinent : accord
en 1re lecture, le cas chant, accord en 2me lecture le cas chant, conciliation le cas chant]
Application et suivi des articles 88-4 et 88-6 de la Constitution sur ce projet dDFWH

Echancier de ngociation

Autres observations
Apprciation du dlai de transposition propos

213

ANNEXE N 15 :
7$8;'$33/,&$7,21'ES LOIS PROMULGUES
(EXTRAITS DU RAPPORT $118(/685/$33/,&$TION DES LOIS PUBLI EN JUIN 2014
PAR LA COMMISSION SNATORIALE POUR LE CO175/('(/$33/,&$7ION DES LOIS)
GRAPHI QUE DE L'VOLUTI ON DCENNALE DU POURCENTAGE DE M ESURES
RGLEM ENTAI RES PRI SES PAR RAPPORT AU NOM BRE DES M ESURES ATTENDUES

Source : 5DSSRUWGLQIRUPDWLRQQ VHVVLRQ- VXUODSSOLFDWLRQGHVORLV session parlementaire 2012 2013,


fait, au nom de la commission snDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU le snateur David Assouline,
17 juin 2014, p. 24.

NOM BRE DE M ESURES RGLEM ENTAI RES PRI SES PAR RAPPORT AU NOM BRE DES
M ESURES ATTENDUES

Anne
parlementaire

2003
2004

Pourcentage

14 %

2004
2005
16 %

2005
2006
30 %

2006
2007
32 %

2007
2008
24 %

2008
2009
27 %

2009
2010
20 %

2010
2011
64 %

2011
2012
66%

2012
2013
64 %

Source : 5DSSRUWGLQIRUPDWLRQQ VHVVLRQ- VXUODSSOLFDWLRQGHVORLV session parlementaire 2012 2013,


IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU le snateur David Assouline,
17 juin 2014, p. 24.

214
7$8;'$33/,&$7,21'(6/2,63285/$11e( PARLEM ENTAI RE 2012-2013

Nombre de lois (a) promulgues durant l'anne parlementaire

50

Taux de mise en application des lois de la XI V me lgislature(b)

88 %

Taux de mise en application des lois de l'anne parlementaire :


- en nombre de lois
- en nombre de mesures

90 %
64 %

- nombre de rapports demands


- pourcentage par rapports dposs

173
58 %

Rapports demands par le Parlement depuis 2004 (c)

Rythme de publication des rapports de l'article 67 (d)


- nombre de rapports attendus
- nombre de rapports prsents dans le dlai lgal

30
2

Source : 5DSSRUWGLQIRUPDWLRQQ VHVVLRQ- VXUODSSOLFDWLRQGHVORLV session parlementaire 2012 2013,


IDLW DX QRP GH OD FRPPLVVLRQ VpQDWRULDOH SRXU OH FRQWU{OH GH ODSSOLFDWLRQ GHV ORLV SDU le snateur David Assouline,
17 juin 2014, p. 23.

(a)

Hors lois de ratification ou d'approbation de conventions internationales


Priode du 20 juin 2012 au 9 avril 2014 - pourcentage en nombre de lois
(c)
Du 1er janvier 2004 au 30 dcembre 2013 - hors rapports de l'article 67
(d)
Rapports VXUODSXEOLFDWLRQGHVUqJOHPHQWVGDSSOLFDWLRQGHWRXWHQRXYHOOHORL
(b)

215

ANNEXE N 16 :
COMPTES-RENDUS DES AUDITIONS DE LA MISSION

Premire table ronde runissant des universitaires : Mme Graldine Chavrier,


SURIHVVHXUHGHGURLWjO8QLYHUVLWpGH3aris I (Panthon-Sorbonne) ; M. Bertrand
GX 0DUDLV FRQVHLOOHU GeWDW HW SURIHVVHXU GH GURLW SXEOLF j O8QLYHUVLWp 3DULV
Ouest (Nanterre-La Dfense) ; M. Michel Verpeaux, professeur de droit
O8QLYHUVLWpGH3DULV, 3DQWKpRQ-Sorbonne), le jeudi 23 janvier 2014. ......................

217

Seconde table ronde runissant des universitaires : Mme Pascale Deumier,


SURIHVVHXUHGHGURLWjO8QLYHUVLWp-HDQ0RXOLQ /\RQ,,, 0PH&pOLD=RO\QVNL
professeure de GURLW j O8QLYHUVLWp GH 9HUVDLOOHV 6DLQW-Quentin-en-Yvelines, le
jeudi 23 janvier 2014 ...................................................................................................

230

$XGLWLRQ GH 00 3KLOLSSH 6DVVLHU HW 'RPLQLTXH /DQVR\ DXWHXUV GUbu loi
(Fayard, mars 2008), le jeudi 23 janvier 2014. ...........................................................

240

Audition de M. Alain Lambert, prsident de la commission consultative


GpYDOXDWLRQ GHV QRUPHV &&(1  HW DXWHXU DYHF 0 -HDQ-Claude Boulard, du
UDSSRUWGHODPLVVLRQGHOXWWHFRQWUHOLQIODWLRQQRUPDWLYH PDUV , le jeudi 30
janvier 2014 .................................................................................................................

245

$XGLWLRQ GH 0 %UXQR 'RQGHUR SURIHVVHXU GH GURLW j O8QLYHUVLWp GH 3aris I
Panthon-Sorbonne, le jeudi 30 janvier 2014 .............................................................

253

Audition de M. Serge Lasvignes, Secrtaire gnral du Gouvernement et de M.


Thierry-Xavier Girardot, directeur, adjoint au Secrtaire gnral du
Gouvernement, le mercredi 19 fvrier 2014 ...............................................................

260

Audition de M. Rmi Bouchez, ancien commissaire la simplification, le jeudi 20


fvrier 2014 .................................................................................................................

270

Audition de M. ric Dolig, snateur et auteur du rapport sur la simplification des


normes applicables aux collectivits locales (juin 2011), le jeudi 20 fvrier 2014 ....

277

Audition de M. Nicolas Molfessis, professeur de droit priv l'Universit Paris II


Panthon-Assas, membre du Club des juristes, le jeudi 10 avril 2014 .......................

282

Audition GH UHSUpVHQWDQWV GH O2UJDQLVDWLRQ SRXU OD FRRSpUDWLRQ HW OH
dveloppement conomiques (OCDE) : M. Nick Malyshev, responsable de la
division de la politique de la rglementation ; Mme Cline Kauffmann,
responsable adjointe de la division de la politique de la rglementation ; M. Daniel
Trnka, responsable du travail sur la simplification, division de la politique de la
rglementation, le jeudi 17 avril 2014 .........................................................................

291

Audition de M. Didier Migaud, Premier prsident de la Cour des comptes, le


mercredi 30 avril 2014 ................................................................................................

297

216

Audition de M. Nicolas Conso, chef du service innovation et services aux usagers


DXVHFUpWDULDWJpQpUDOSRXUODPRGHUQLVDWLRQGHODFWLRQSXEOLTXH 6*0$3 et de
M. Grard Huot, responsable des relations avec les entreprises au sein de la
mission simplification le mercredi 30 avril 2014 .................................................

308

Audition de M. Philippe Lglise-Costa, secrtaire gnral des Affaires


europennes (SGAE), accompagn de Mmes Liza Bellulo, conseillre juridique,
Vronique Fourquet adjointe la conseillre juridique, Juliette Clavire,
responsable du dpartement Parlement National, Parlement europen, collectivits
locales, le jeudi 15 mai 2014 .......................................................................................

315

Audition de M. Jean-Paul Delevoye, prsident du Conseil conomique, social et


environnemental, accompagn de M. Christian Le Roux, directeur de cabinet, le
jeudi 15 mai 2014 ........................................................................................................

322

Audition de reprsentants du Mouvement des Entreprises de France (MEDEF) :


M. Bernard Gaud, prsident du MEDEF Rhne-Alpes et prsident de la
commission Simplification du MEDEF, Mmes Dorothe Pineau, directrice
gnrale adjointe du MEDEF en charge du dossier simplification et Jolle Simon,
directrice des affaires juridiques, rapporteure de la commission Simplification
du MEDEF, le jeudi 15 mai 2014 ...............................................................................

331

Audition de M. Jean-Marc Sauv, vice-SUpVLGHQWGX&RQVHLOGeWDWDFFRPSDJQp


GH 0 %HUQDUG 3rFKHXU SUpVLGHQW GH OD VHFWLRQ GH ODGPLQLVWUDWLRn, et de
Mme Maryvonne de Saint Pulgent, prsidente de la section du rapport et des
tudes, le jeudi 22 mai 2014 .......................................................................................

337

Audition de M. Jean-/XF7DYHUQLHUGLUHFWHXUJpQpUDOGHO,16((, le jeudi 22 mai


2014 .............................................................................................................................

348

Audition de M. David Assouline, snateur, prsident de la commission snatoriale


SRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLV, le jeudi 5 juin 2014 ...................................

355

Audition de M. Jean-Luc Warsmann, dput , le mardi 1er juillet 2014 ....................

362

Audition de M. Jean-Marie Le *XHQ 6HFUpWDLUH GeWDW DX[ 5HODWLRQV DYHF OH


Parlement, auprs du Premier ministre , le mercredi 9 juillet 2014 ...........................

372

217

Sance du jeudi 23 janvier 2014


/D PLVVLRQ GLQIRUPDWLRQ SURFqGH j ODXGLWLRQ VRXV IRUPH GH table ronde de :
Mme *pUDOGLQH &KDYULHU SURIHVVHXUH GH GURLW j O8QLYHUVLWp GH 3DULV , 3DQWKpRQSorbonne) ; 0 %HUWUDQG GX 0DUDLV FRQVHLOOHU GeWDW HW SURIHVVHXU GH GURLW SXEOLF j
O8QLYHUVLWp3DULV2XHVW 1DQWHUUH-La Dfense) ; M. Michel Verpeaux, professeur de droit
O8QLYHUVLWpGH3DULV, 3DQWKpRQ-Sorbonne).
M me la prsidente Laure de La Raudire. Madame, messieurs, je vous remercie
GHYRWUHSDUWLFLSDWLRQjFHWWHSUHPLqUHUpXQLRQGHQRWUHPLVVLRQGLQIRUPDWLRQTXHYDYRXV
prsenter son rapporteur, M. Thierry Mandon.
M . Thierry M andon, rapporteur. /D PLVVLRQ GLQIRUPDWLRQ VXU OD VLPSOLILFDWLRQ
lgislative a pour objet de rationaliser autant que possible le flux normatif, plutt que le
stock de dispositions rglementaires et lgislatives existantes, lequel est trait par ailleurs.
Toutefois, nous ne devrons pas hsiter passer outre cette distinction entre flux et stock si
cela se rvle ncessaire.
Nous rflchirons donc aux moyens de produire des textes moins nombreux, plus
OLVLEOHV SOXV HIILFDFHV HQ SULYLOpJLDQW OpYDOXDWLRQ ex ante OpYHQWXDOLWp GH VXSSULPHU GHV
textes en mme temps que nous en adoptRQV GH QRXYHDX[ OD SRVVLELOLWp GXQ droit de
regard  GX 3DUOHPHQW VXU OHV GpFUHWV GDSSOLFDWLRQ 1RXV pWXGLHURQV SOXV JpQpUDOHPHQW OD
procdure lgislative et la mthode de transposition des directives, et tout autre moyen de
simplifier une procdure dRQWQRXVPHVXURQVFKDTXHMRXUOHVDUFKDwVPHV-DLSRXUPDSDUW
le sentiment que les parlementaires, tous groupes politiques confondus, sont maintenant
mrs et prts cette volution.
1RXV HQWHQGURQV GDERUG HQ SDUWLFXOLHU DX VXMHW GHV GpFUHWV GDSSOLFDWion,
Mme &KDYULHUDXWHXUGHQRPEUHX[WH[WHVVXUOH[SpULPHQWDWLRQWHUULWRULDOHHWODGDSWDELOLWp
de la norme, dont Le Pouvoir normatif local, paru en aot 2011. Nous nous tournerons
ensuite vers M. du 0DUDLV TXL D pWXGLp ODWWUDFWLYLWp GX GURLW IUDQoDLV dans la comptition
conomique internationale, notamment dans une contribution au rapport public de 2006 du
&RQVHLOGeWDWVXUODVpFXULWpMXULGLTXHHWODFRPSOH[LWpGXGURLWRLOpYRTXHOpYDOXDWLRQex
ante de la rglementation dans le cadre des tudes GLPSDFW0 Verpeaux, enfin, auteur de
nombreux ouvrages de droit constitutionnel et de droit des collectivits territoriales, a t
membre du Comit pour la rforme des collectivits locales cr en 2008.
M me *pUDOGLQH &KDYULHU SURIHVVHXUH GH GURLW j Ouniversit de Paris I Panthon-Sorbonne. Madame la prsidente, mesdames et messieurs les dputs et membres
GH OD PLVVLRQ GLQIRUPDWLRQ YRXV DYH] UHoX OD QREOH PLVVLRQ GH UpIOpFKLU DX[ PR\HQV GH
VLPSOLILHUODORLHWYRXVPDYH]IDLWOH[WUrPHKRQQHXUGHPe demander de participer cette
table ronde afin de vous restituer le rsultat de mes recherches. Je vous en remercie
vivement.
-DLELHQQRWpTXHYRXVDYH]GpVLUpPHQWHQGUHVXUOHVOLHQVTXHSRXUUDLWHQWUHWHQLU
cette simplification avec la thmatique du pouvoir normatif local, laquelle peut effectivement
UHQYR\HUDX[GpFUHWVGDSSOLFDWLRQ
-HSUpFLVHUDLGDERUGTXLOQHSHXWpYLGHPPHQWrWUHTXHVWLRQGHFRQILHUXQSRXYRLU
OpJLVODWLIDX[FROOHFWLYLWpV(QHIIHWOXQLWpGHOeWDWFHVWOXQLWpGHODVRXYHrainet ; or la
VRXYHUDLQHWp FHVW OD ORL &HOOH-ci doit rester unique, de sorte que seule la procdure
GH[SpULPHQWDWLRQOpJLVODWLYHHVWVRXKDLWDEOH

218

La question se pose diffremment concernant le pouvoir rglementaire tatique,


deuxime dans la hirarchLHGHVQRUPHVHWTXL QHVWDXWRULVpjLPSRVHUGHVFKDUJHVHWGHV
REOLJDWLRQVDX[FROOHFWLYLWpVTXjFRQGLWLRQ G\DYRLUpWpKDELOLWpSDUOHOpJLVODWHXU /XQLWp
GHOeWDWVDFFRPPRGHGRQFGHOH[LVWHQFHGXQSRXYRLUUpJOHPHQWDLUHORFDO/DTXHVWLRQTXL
se pose est alors la suivante : pourriez-YRXV UHQYR\HU SRXU ODSSOLFDWLRQ GHV ORLV TXH YRXV
adoptez, au pouvoir rglementaire et quel intrt y trouveriez-vous ?
9RXV YRXV LQTXLpWH] OpJLWLPHPHQW GH OD OHQWHXU DYHF ODTXHOOH OH[pFXWLI DSSOLTXH
YRV ORLV GXQH SDUW HW GH ODGDSWDWLRQ GH FHV ORLV j OHXUV HQMHX[ GDXWUH SDUW 8QH ORL
applique tardivement, ou mal applique parce que mal adapte son contexte par le pouvoir
UpJOHPHQWDLUHSHXWrWUHXQHORLSHUGXHHQFHVHQVTXHOOHPDQTXHVHVREMHFWLIVLQLWLDXx.
/LQWpUrW GXQ UHQYRL GLUHFW GH OD ORL DX SRXYRLU UpJOHPHQWDLUH ORFDO VHUDLW GH
UHPpGLHUjFHWWHOHQWHXUHWGHSHUPHWWUHGDWWHLQGUHSOXVIDFLOHPHQWOHVREMHFWLIVSRXUVXLYLV
SXLVTXHFHVWDX[FROOHFWLYLWpVTXHYRXVFRQILHULH]DORUVOHVRLQGDGRSWHUFHrtaines modalits
GDSSOLFDWLRQGHVORLVTXLFRQFHUQHQWOH[HUFLFHGHOHXUVFRPSpWHQFHVFHVW--dire aux plus
motives, aux plus presses de voir appliquer la loi. Cette facult peut tre fonde sur un
principe constitutionnel mconnu : le principe de subsidiarit normative, proche du principe
GHSURSRUWLRQQDOLWpHWGRQWODPLVHHQXYUHORLQGHPHQDFHUOHSULQFLSHGpJDOLWpSRXUUDLW
DXFRQWUDLUHOHGpIHQGUH HQGRQQDQWFRUSVDXSULQFLSHGpJDOLWpSURSRUWLRQQHOOHPDWpULHOOH
&HWWH UHFKHUFKH GpJDOLWp PDWpULHOOH HW QRQ SOXV IRUPHOOH HVW GDLOOHXUV j ORULJLQH GHV
GHPDQGHVUpFHQWHVGDGDSWDELOLWpGXGURLW
Comment adapter le droit son contexte par application du principe de subsidiarit
normative ?
Le lgislateur dcentralise au nom du principe selon lequel on administre mieux de
SUqV HQ SUHQDQW HQ FRQVLGpUDWLRQ OHV SDUWLFXODULWpV GX WHUUDLQ 7RXWHIRLV ORUVTXLO UHQYRLH
V\VWpPDWLTXHPHQWDX3UHPLHUPLQLVWUHSRXUOH[pFXWLRQGHVORLVFRQFHUQDQWOHVFRPSpWHQFHV
GHV FROOHFWLYLWpV OHTXHO ODSSOLTXH GH IDoon trop dtaille et avec retard, ce centralisme
normatif contrevient au bnfice attendu de la dcentralisation : on administre de prs,
FHUWHVPDLVVDQVSRXYRLUWHQLUFRPSWHGHVVSpFLILFLWpVORFDOHV-XVTXLFLYRXVDYH]SRXUWDQW
toujours considr que OHUHQYRLDXSRXYRLUUpJOHPHQWDLUHGX3UHPLHUPLQLVWUHVLPSRVDLW
/H[pFXWLIFRQVFLHQWGHVHVIDLEOHVVHVDELHQWHQWpGHVHGLVFLSOLQHUOXL-mme, mais
sans succs. Il a ainsi prconis dans la circulaire du 7 juillet 2011 sur la qualit du droit que
chaque projet de norme nouvelle [ soit] soumis un examen de ncessit et de
proportionnalit aussi circonstanci que possible HW LO D pWp HQYLVDJp GLQVFULUH GDQV OH
SURMHW GH ORL GH PRGHUQLVDWLRQ GH ODFWLRQ SXEOLTXH WHUULWRULDOH TXH OH *RXYHUQHPHQW
adoSWHUDLW j ODYHQLU GHV PRGDOLWpV GDSSOLFDWLRQ SURSRUWLRQQpHV GHV ORLV FRQFHUQDQW OHV
collectivits.
Ce principe de proportionnalit postulait ncessairement le recours au rglement
local : la norme se limite ce qui est ncessaire pour atteindre les objectifs poursuivis,
UHQYR\DQWSRXUOHUHVWHjGDXWUHVDXWRULWpV ici les collectivits, mais pourquoi pas chaque
acteur concern dans son domaine, notamment les entreprises, qui seraient alors contraintes
GDWWHLQGUH FHUWDLQV REMHFWLIV PDLV VHORQ GHV PRGDlits dont le dtail ne leur serait pas
entirement impos ?
7RXWHIRLVFHSULQFLSHQDSDVpWpUHWHQXQRWDPPHQWSDUFHTXLOULVTXDLWGrWUHXQ
QLG j FRQWHQWLHX[ GX IDLW GLQWHUPLQDEOHV LQWHUURJDWLRQV VXU OH GHJUp GH GpWDLO GDQV OHTXHO
OeWDWSHXWHQWUHU(WFHVWKHXUHX[FDULODXUDLWDORUVLQFRPEpDXMXJHGHGpcider lui-mme
TXLGHODFROOHFWLYLWpRXGHOeWDWGHYDLWDGRSWHUWHOOHQRUPHVUHPHQWjSDUWLUGXQFRQWU{OH

219

PLQLPXP GDLOOHXUV DORUV TXH FHVW j YRXV OpJLVODWHXU GH WUDQFKHU (W YRXV SRXYH] YRXV
appuyer pour ce faire sur un principe constitutionnel de subsidiarit normative qui
VDSSDUHQWHHQGpILQLWLYHDXSULQFLSHGHSURSRUWLRQQDOLWp
En effet, alors que le projet de loi constitutionnelle de 2003 prvoyait initialement
TXHOHVFROOHFWLYLWpVDYDLHQWYRFDWLRQjH[HUFHUOHQVHPEOHGHVFRPSpWHQFHVTXL pouvaient le
PLHX[rWUHPLVHVHQXYUHjOHXUpFKHORQODUWLFOH 72 de la Constitution dispose finalement
que les collectivits ont vocation prendre les dcisions OHPRWQHVWSDVDQRGLQ pour
OHQVHPEOHGHFHVFRPSpWHQFHV/LQWHQWLRQGXFRQVWLWuant, sur laquelle se fonde le Conseil
FRQVWLWXWLRQQHO HVW FODLUH SXLVTXH ODPHQGHPHQW UppFULYDQW OH WH[WH HQ FHV WHUPHV D pWp
DGRSWp ,O UHYLHQW SDU FRQVpTXHQW DX OpJLVODWHXU GDSSOLTXHU FH SULQFLSH VRXV OH FRQWU{OH
certes minimum, du Conseil constitutionnel, et au pouvoir rglementaire de le respecter,
pJDOHPHQWVRXVOHFRQWU{OHSUREDEOHPHQWPLQLPXPGX&RQVHLOGeWDW
Pour chaque disposition concernant les comptences locales, le lgislateur doit donc
VLQWHUURJHU VXU OD QpFHVVLWp GH UHQYR\HU DX GpFUet ou au pouvoir rglementaire local
GDSSOLFDWLRQ 6D IHXLOOH GH URXWH HVW WUDFpH SDU OD GpFLVLRQ GX &RQVHLO FRQVWLWXWLRQQHO GX
17 janvier 2002 loi relative la Corse , aux termes de laquelle les articles 21 et 72 de la
Constitution permettent au lgislateur de confier une catgorie de collectivits
territoriales le soin de dfinir, dans la limite des comptences qui lui sont dvolues,
FHUWDLQHV PRGDOLWpV GDSSOLFDWLRQ GXQH ORL  >@ FHSHQGDQW OH SULQFLSH GH OLEUH
administration des collectivits territoriales ne saurait conduire ce que les conditions
HVVHQWLHOOHVGHPLVHHQXYUHGHVOLEHUWpVSXEOLTXHVHWSDUVXLWHOHQVHPEOHGHVJDUDQWLHV
que celles-ci comportent dpendent des dcisions de collectivits territoriales et, ainsi,
puissent ne pDVrWUHOHVPrPHVVXUOHQVHPEOHGXWHUULWRLUHGHOD5pSXEOLTXH .
$XWUHPHQW GLW OH 3UHPLHU PLQLVWUH UHVWH ODXWRULWp GH GURLW FRPPXQ HQ PDWLqUH
GH[pFXWLRQ GHV ORLV OH OpJLVODWHXU UHQYR\DQW DX[ FROOHFWLYLWpV ODSSOLFDWLRQ GHV ORLV GDQV
leurs seuls domaiQHV GH FRPSpWHQFH /H &RQVHLO GeWDW D\DQW DMRut dans un avis du
15 novembre 2012 que cette comptence normative accompagne ncessairement un transfert
GH FRPSpWHQFH OD FDSDFLWp GDSSOLTXHU FHUWDLQHV ORLV QH SRXYDQW rWUH FRQVLGpUpH HQ HOOHmme comme une comptence transfre une catgorie de collectivits.
/DUpVHUYHFRQFHUQDQWODIL[DWLRQGHVFRQGLWLRQVHVVHQWLHOOHVGHPLVHHQXYUHGHV
liberts publiques, formule ds 1985, limite le champ des possibles. On peut ainsi
considrer que confier aux colleFWLYLWpV OH VRLQ GDGRSWHU FHUWDLQHV PRGDOLWpV GDSSOLFDWLRQ
GH OD ORL VXU ODFFHVVLELOLWp GHV pWDEOLVVHPHQWV UHFHYDQW GX SXEOLF LPSOLTXHUDLW XQH
LQWHUYHQWLRQ GDQV OD GpILQLWLRQ GHV FRQGLWLRQV HVVHQWLHOOHV GH PLVH HQ XYUH GH OD OLEHUWp
GDOOHUHWYHQLU
CHWWHOLPLWHKDXWHVDFFRPSDJQHGXQHDXWUHUpVHUYHSXLVTXHOH&RQVHLOGpFLGHTXH
le lgislateur peut confier aux collectivits certaines  PRGDOLWpV GDSSOLFDWLRQ GHV ORLV
&HWWH OLPLWH YDJXH UHSRVHUD FHUWDLQHPHQW VXU OHV QpFHVVLWpV GLQWpUrW JpQpUDO ou sur le
SULQFLSHGpJDOLWpQRXV\UHYLHQGURQV imposant que la mesure soit la mme pour tous.
Il en rsulte que les collectivits peuvent intervenir un troisime niveau
GLQIOXHQFH FHOXL GRQW OD GpFHQWUDOLVDWLRQ D EHVRLQ 6RQ HIILFDFLWp D GpMj pWp Gmontre.
-XVTXHQDLQVLOHUpJLPHGHVDLGHVGLUHFWHVDX[HQWUHSULVHVpWDLWIL[pXQLIRUPpPHQWSDU
le Premier ministre ; partir de cette date, le lgislateur a dcid que les assembles
rgionales pourraient le fixer elles-mmes. Or qui peut nier que, pour russir
conomiquement, deux rgions aussi diffrentes que le Nord-Pas-de-Calais et Rhne-Alpes
doivent pouvoir mener des politiques distinctes ?

220

ce stade de ma dmonstration, vous devriez tre convaincus de la faisabilit


MXULGLTXH GH ORSpUDWLon, mais peut-tre pas de sa pertinence au regard de la dfense du
SULQFLSHFRQVWLWXWLRQQHOGpJDOLWp&HVWGDLOOHXUVODUDLVRQSRXUODTXHOOHRQHVWDXMRXUGKXL
SOXW{WWHQWpGLQYRTXHUOHSULQFLSHGDGDSWDELOLWp0DLVFHOXL-FLQHGLWULHQGHODXWHXUGHla
QRUPH/HSULQFLSHGHSURSRUWLRQQDOLWpVXSSRVHTXjXQPRPHQWGRQQpOeWDWODLVVHODSODFH
une autre autorit  ODGDSWDELOLWp HOOH SHXW GpSHQGUH GHV FROOHFWLYLWpV FHVW OH SRXYRLU
UpJOHPHQWDLUHORFDO GDGDSWDWLRQ pYRTXpSDUOH3UpVLGHQWGHOD5pSublique , mais aussi de
OeWDW OXL-mme, comme dans le cas des exprimentations, dont il dcide, charge telle ou
telle collectivit et sur les suites desquelles il se prononce seul.
'HFHSRLQWGHYXHODGDSWDELOLWpHVWUDVVXUDQWHFDUOeWDWHVWXQLILFDteur et garantit
OHUHVSHFWGXSULQFLSHGpJDOLWp4XHQHYRLW-on toutefois que cette unification, dans les autres
GRPDLQHVTXHOH[SpULPHQWDWLRQOpJLVODWLYHHVW galicide FDULQFDSDEOHGDGDSWHUOHGURLW
aux besoins de plus en plus divers des destinataires de la norme ? Le peuple est un, mais le
territoire est vari. Lorsque vous adoptez une loi sur la montagne ou sur le littoral, vous ne
EULVH]SDVOpJDOLWpSDUUHQRQFHPHQWjOXQLYHUVDOLVPHGHODORL : vous la rtablissez. Il en ira
de mme lorsque YRXV UHQYHUUH] DX[ FROOHFWLYLWpV ODSSOLFDWLRQ GH OD ORL GDQV OHV OLPLWHV
prcites.
&RPPHQWSRXYRLUORFDOHWSULQFLSHGpJDOLWpVHFRQMXJXHQW-ils "/H&RQVHLOGeWDWD
rappel dans son avis de 2012 que ODWWULEXWLRQSDUODORLGXQSRXYRLUUpJOHPHQWDLre aux
FROOHFWLYLWpVWHUULWRULDOHVQHVWSDVSDUHOOH-PrPHFRQWUDLUHDXSULQFLSHGpJDOLWp . vrai
GLUH SXLVTXH OHV FROOHFWLYLWpV QLQWHUYLHQQHQW TXj XQ WURLVLqPH QLYHDX GLPSRUWDQFH
ORUVTXHOOHVDSSOLTXHQWODORLOHSULQFLSHGpJDOLWpQHULVTXHSOXVYpULWDEOHPHQWGrWUHYLROp
(Q RXWUH LO H[LVWH XQH UDLVRQ GLQWpUrW JpQpUDO GH GpURJHU DX SULQFLSH GpJDOLWp :
ODPpOLRUDWLRQGHODFWLRQSXEOLTXHSDUODSULVHHQFRQVLGpUDWLRQGXFRQWH[WHGDSSOLFDWLRQGX
texte et, ainsi, des circonstances locales. Pour que la loi soit plus adapte son contexte
GDSSOLFDWLRQHWSOXVUDSLGHPHQWDSSOLTXpHLOIDXWSDUFRQVpTXHQWUHQYR\HUSOXVVRXYHQWDX
pouvoir rglementaire local des collectivits, sachant que les communes ne disposeront pas
pour en user de la mme ingnierie juridique que les dpartements ou les rgions, voire les
intercommunalits.
Pour toutes les autres lois, celles qui ne concernent pas les collectivits, vous
GLVSRVH] GXQ PR\HQ FRQVWLWXWLRQQHO GH FRQWUDLQGUH OH[pFXWLI j DGRSWHU UDSLGHPHQW GHV
dcUHWVGDSSOLFDWLRQ,OHVWEUXWDOPDLVSRXUUDLWGHFHIDLWPrPHREOLJHUOH*RXYHUQHPHQWj
DJLU /RUVTXXQH GLVSRVLWLRQ YRXV VHPEOH VL LPSRUWDQWH TXHOOH GRLW rWUH XUJHPPHQW
DSSOLTXpH YRXV SRXYH] HQ HIIHW SUpYRLU GDQV OD ORL TXHOOH GHYLHQGUD FDGXTXH VL HOOH QHVW
SDV DSSOLTXpH GDQV XQ GpODL GXQ DQ &HUWHV VL WHO QHVW SDV OH FDV HOOH SHUGUD
automatiquement sa valeur  PDLV OH[pFXWLI TXL FRQVDFUH WRXMRXUV EHDXFRXS GpQHUJLH j
faire adopter la loi ELHQSOXVTXjODIDLUHDSSOLTXHU , ne pourra sans doute se permettre de
OD ODLVVHU VpYDQRXLU VXUWRXW VDJLVVDQW GXQH GLVSRVLWLRQ LPSRUWDQWH /H SURFpGp HVW
FRQVWLWXWLRQQHOFDUODFRQWUDLQWHRXODVDQFWLRQQHSRUWHSDVVXUOH[pFXWLIPDLVVXUODORL
elle-PrPHSXLVTXHFHVWODGLVSRVLWLRQOpJLVODWLYe qui risque alors de tomber.
M . Bertrand du 0DUDLV FRQVHLOOHU GeWDW SURIHVVHXU GH GURLW SXEOLF j
OXQLYHUVLWp GH 3DULV 2XHVW-Nanterre-La Dfense. Madame la prsidente, monsieur le
rapporteur, mesdames et messieurs les dputs, je vous remercie sincrement de me donner
OHSULYLOqJHORFFDVLRQHWOHSODLVLUGHYRXVSUpVHQWHUDXMRXUGKXLGHVWUDYDX[HWDQDO\VHV
ainsi que quelques rsultats intermdiaires que je mne depuis plusieurs annes, en
SDUWLFXOLHUVXUOHVpWXGHVGLPSDFW
Je me permettrai de commencer par une petite page de publicit pour la filire droitpFRQRPLHGHOXQLYHUVLWp3DULV2XHVW-Nanterre. Unique en France, elle constitue un outil mis

221

la disposition de toutes les parties prenantes du processus normatif, dont les pouvoirs
publics et pourquoi pas ? le Parlement. Cette filire runit plus de 450 tudiants, de la
premire anne de licence au master GRQWXQ0GDQDO\VHpFRQRPLTXHGXGURLWRQRXV
IRUPRQV GH MHXQHV pWXGLDQWV PDLV DXVVL GHV FDGUHV GH ODGPLQLVWUDWLRQ HW GX VHFWHXr priv.
'DQVODQRXYHOOHQRPHQFODWXUHHQFRXUVGDGRSWLRQVRQLQWLWXOpGHYLHQGUD valuation de
OLPSDFWGXGURLW .
-DL GDXWUH SDUW OH SODLVLU GH SUpVLGHU XQH SHWLWH DVVRFLDWLRQ SDUD-universitaire
appele FIDES (Forum sur les institutions, le droit, OpFRQRPLHHWODVRFLpWp TXLVHIIRUFHGH
soutenir financirement la recherche dans ces disciplines, souvent oublie par les grands
programmes de financement, afin que les chercheurs ne rejoignent pas tous, sitt forms, les
pays anglo-saxons.
Je ne traiWHUDL GDQV PRQ LQWHUYHQWLRQ TXH GH OD TXHVWLRQ GH ODPpOLRUDWLRQ GH
OpYDOXDWLRQ ex ante SDU OHV pWXGHV GLPSDFW ; je profiterai ventuellement de la discussion
XOWpULHXUHSRXUpYRTXHUGHX[DXWUHVVXMHWVVXUOHVTXHOVMDLWUDYDLOOp OHVGpFUHWVGDSSOLFDWion
et la transposition des directives.
3RXUTXRL VH IRFDOLVHU VXU OHV pWXGHV GLPSDFW " 3DUFH TXHOOHV VRQW XQ PR\HQ QRQ
VHXOHPHQWGHUpJXOHUOHIOX[GHVWH[WHVHWGHQUDWLRQDOLVHUOHFRQWHQXPDLVDXVVLVLWDQWHVW
TXHOHVSDUWLHVSUHQDQWHVVHQVDLVLVVHQWGLQVWLOOHUGXGpEDWSXEOLFGDQVODSURFpGXUHJUkFH
paradoxalement jOH[SHUWLVH Je traiterai la question en trois temps MHGUHVVHUDLGDERUG
XQ FRQVWDW QRQ SDV GpVDEXVp PDLV PLWLJp VXU OD TXDOLWp HW OH FRQWHQX GHV pWXGHV GLPSDFW
prsentes jXVTXjSUpVHQW MHGRQQHUDLHQVXLWHGHVSLVWHVSRXUIDYRULVHUOXVDJHGHFHWRXWLO ;
et je terminerai par quelques propositions visant en amliorer le contenu.
0RQ FRQVWDW HVW WLUp GH ODQDO\VH GHV pWXGHV GLPSDFW TXH MH FRQGXLV DYHF PHV
tudiants depuis septembre 1RXVGLVSRVRQVDXMRXUGKXLGHTXDWUHDQVGHUHFXOHWGXQ
pFKDQWLOORQGXQHTXDUDQWDLQHGpWXGHVUHODWLYHPHQWUHSUpVHQWDWLISXLVTXLOUHFRXYUHSOXVGH
OD PRLWLp GHV WH[WHV GH ORL SRUWDQW GHV GLVSRVLWLRQV QRUPDWLYHV ,O VDJLW GXQH DQDO\se qui,
SRXU OLQVWDQW HVW TXDOLWDWLYH PDLV MH YRXV GRQQHUDL DXVVL TXHOTXHV pOpPHQWV TXDQWLWDWLIV ;
QRXV VRPPHV HQ WUDLQ GH FRQVWUXLUH GHV LQGLFDWHXUV QRWUH REMHFWLI pWDQW GDERXWLU j XQ
classement du type Gault et Millau  GHV pWXGHV GLPSDFW GH OD plus complte, la plus
OLVLEOHHWODSOXVSHUWLQHQWHMXVTXjODPRLQVVDWLVIDLVDQWH'HODUWLFOH 8 de la loi organique du
15 avril 2009, nous avons ainsi tir une liste de vingt critres, dont nous vrifions le degr de
UHVSHFW GH ODEVHQFH WRWDOH MXVTXj OREOLJDWLRQ HQWLqUHPHQW UHPSOLH HQ XWLOLVDQW GHV
catgories intermdiaires ; les rsultats sont reports dans un tableau rcapitulatif.
3DU H[HPSOH ODQDO\VH GH OpWXGH GLPSDFW GX SURMHW GH ORL GH SURJUDPPDWLRQ
militaire pour 2014-2019 fait apparatrH ODEVHQFH WRWDOH GH TXDWUH FULWqUHV SDUPL OHVTXHOV
OpYDOXDWLRQGHVFRQVpTXHQFHVHQYLURQQHPHQWDOHVODSUpVHQWDWLRQGHVSRVVLELOLWpVDXWUHVTXH
ORSWLRQOpJLVODWLYHODQDO\VHTXDQWLWDWLYHHWOH[SRVpGHODPpWKRGHGHFDOFXO
'HPrPHGDQVOpWXGHGLPSact du projet de loi de sparation et de rgulation des
DFWLYLWpV EDQFDLUHV OpYDOXDWLRQ GHV FRQVpTXHQFHV ILQDQFLqUHV QHVW IDLWH SRXU DXFXQ GHV
titres du texte, une exception prs LOQ\DQLTXDQWLILFDWLRQQLLQGLFDWLRQGHODPpWKRGHGH
calcul retenue.
Certaines personnes me prsentent comme un ayatollah de la quantification il
est vrai que je fus le seul utiliser le verbe quantifier dans le rapport public de 2006 du
&RQVHLOGeWDWTXHOHUDSSRUWHXU DHXODPDELOLWpGH FLWHU3RXUWDQW FRmment le disent nos
amis anglo-VD[RQVTXDQWLILHUFHVWGpMjGDQVXQHFHUWDLQHPHVXUHGpFLGHU FHVWHQWRXWFDV
fonder le dbat sur des lments objectifs et, en dfinitive, rendre possible la contradiction.

222

Notre analyse dbouche sur un constat mitig. /HVpWXGHVGLPSDFWVHFDUDFWpULVHQW


en effet vous vous en tes certainement aperus par une grande diversit et une ingalit
GHFRQWHQXV1RPEUHGHQWUHHOOHVQHVDWLVIRQWSDVPrPHIRUPHOOHPHQWDX[REOLJDWLRQVGH
la loi organique. En particulier, ODPpWKRGHGHFDOFXOUHWHQXHQHVWTXDVLPHQWMDPDLVLQGLTXpH
VRXYHQWSRXUODVLPSOHHWERQQHUDLVRQTXLOQ\DSDVGpYDOXDWLRQTXDQWLILpHGHVLPSDFWV
GHVGLVSRVLWLRQVTXHORQYRXVSURSRVHGDGRSWHU
Pour expliquer cette qualit ingale, nous avons formul deux hypothses.
/DSUHPLqUHHVWTXHODTXDOLWpGHOpWXGHGLPSDFWGpSHQGUDLWGHORIIUHGpWXGHVHQ
interne  OHV PLQLVWqUHV D\DQW XQH IRUWH FXOWXUH GH OpWXGH pFRQRPLTXH GH OD VWDWLVWLTXH GH
OH[SHUWLVHWHFKQLTXHSUpVHQWHUDLHQWGHVpWXGHVGLPSDFt plus satisfaisantes. Cette hypothse
HVWFHSHQGDQWIUDJLOLVpHSDUOHIDLWTXLOH[LVWHGHQRPEUHX[FRQWUH-H[HPSOHVFRPPHOpWXGH
GLPSDFWGXSURMHWGHORLUHODWLIDX*UDQG3DULV : les incidences budgtaires y taient certes
examines, mais aucune mthodHGHFDOFXOQpWDLWLQGLTXpH
Deuxime hypothse ODTXDOLWpGHOpWXGHGLPSDFWVHUDLWIRQFWLRQGHODVHQVLELOLWp
SROLWLTXH GX SURMHW GH ORL 1RXV DYRQV DLQVL pWp IUDSSpV SDU OD JUDQGH TXDOLWp GH OpWXGH
GLPSDFW GXSURMHW GHORL UHODWLIDX[UpVHDX[FRQVXODLUHVDXFRPPHUFHjODUWLVDQDW HW DX[
services. Il semblerait que, quand un texte est dbattu pied pied dans toutes les rgions et
dans toutes les grandes villes de France, les parties prenantes soient obliges de fonder leurs
arguments sur des donnpHVFKLIIUpHVHWVXUOHVUpVXOWDWVGH[SHUWLVHV
Nous avons galement not une utilisation ingale, mais croissante des tudes
GLPSDFW GDQV OHV GpEDWV SDUOHPHQWDLUHV &HWWH REVHUYDWLRQ VH IRQGH VXU XQH PpWKRGH
simple : je demande mes tudiants de passer en revue les travaux du Snat et de
O$VVHPEOpHQDWLRQDOHDILQGHFRPSWDELOLVHUOHQRPEUHGHIRLVROpWXGHGLPSDFWHVWFLWpH
&HUWDLQV SDUOHPHQWDLUHV IRQGHQW PrPH OHXUV DPHQGHPHQWV VXU OpWXGH GLPSDFW 7RXWHIRLV
celle-ci est gnralement conue comme XQHVRXUFHGLQIRUPDWLRQHWIDLWUDUHPHQWOREMHWGH
critiques ou de dbats.
6LO HVW PLWLJp QRWUH FRQVWDW QHVW FHSHQGDQW SDV GpVDEXVp &HUWHV LO H[LVWH XQ
risque TXHOpFODWGHODQRXYHDXWpD\DQWGLVSDUXODURXWLQHHWOHIRUPDOLVPHUHSUHQQHQWOH
dessus FH IXW GDLOOHXUV OH FDV ORUV GHV WHQWDWLYHV TXL RQW SUpFpGp OD UpIRUPH
FRQVWLWXWLRQQHOOH GH  &RPPH OD pFULW 6HUJH /DVYLJQHV VHFUpWDLUH JpQpUDO GX
Gouvernement, dans sa prface au *XLGHGpYDOXDWLRQGHOLPSDFWFRQFXUUHQWLHOGHSURMHWV
de textes normatifs : Les progrs en la matire ncessitent dure et tnacit . Pourtant, le
IDLWPrPHTXHO$XWRULWpGHODFRQFXUUHQFHDLWUpGLJpGHVDSURSUHLQLWLDWLYHXQWHOJXLGHHVW
extrmement encourageant ; cela montre que certains acteurs, notamment au sein des
SRXYRLUVSXEOLFVRQWFRPSULVOLQWpUrWTXLOSRXYDLW\DYRLUjIDLUHFHW\SHGHWUDYDX[
-H YDLV PDLQWHQDQW SUpVHQWHU TXHOTXHV SLVWHV SRXU IDYRULVHU OXVDJH GHV pWXGHV
GLPSDFW
3UHPLqUHPHQW LO VHUDLW ERQ GH GpYHORSSHU ODSSURFKH VHFWRULHOOH, par exemple en
SXEOLDQWVXLYDQWOH[HPSOHGHO$XWRULWpGHODFRQFXUUHQFHGHVJXLGHVSRXUOpYDOXDWLRQGH
OLPSDFW GHV SURMHWV GH WH[WHV HQ IRQFWLRQ GH SUREOpPDWLTXHV VRLW KRUL]RQWDOHV FRPPH
OpJDOLWp HQWUH OHV IHPPHV HW OHV KRPPHV VRLW YHUWLFDOHV FRPPH OpFRQRPLH VRFLDOH HW
solidaire  LO VDJLUDLW GH UpGLJHU GHV vade-mecum destination des diffrents intervenants
GDQV OH SURFHVVXV OpJLVODWLI SRXU OHXU SHUPHWWUH GLGHQWLILHU HW GH TXDQWLILHU OLPSDFW GHV
projets de loi sur tel ou tel secteur. Ces gXLGHVSRXUUDLHQWrWUHUpDOLVpVVRLWjOLQLWLDWLYHGX
seul Parlement, soit en commun avec les services du Gouvernement.

223

Deuximement, il convient de sensibiliser les parties prenantes. La difficult est


TXDXMRXUGKXLOpWXGHGLPSDFWQHVWUHQGXHSXEOLTXH TXDXPRPHQWGHODWUDQVPLVVLRQGX
projet de loi au Parlement  LO IDXGUDLW TXHOOH OH VRLW DYDQW OD VDLVLQH GX &RQVHLO GeWDW
FRPPHFHVWOHFDVSRXUOHVpWXGHVGLPSDFWHQYLURQQHPHQWDOHV
Troisimement, il faut inciter le politique se saisir de OpWXGH GLPSDFW (Q
Grande-Bretagne, celle-ci est le support des consultations et permet aux ministres
comptents FRPPHjORSSRVLWLRQGLQWHUYHQLUGDQVOHSURFHVVXVGpODERUDWLRQGXSURMHWGH
loi DORUV TXHQ )UDQFH FHOXL-FL UHVWH LQWHUQH j ODGPLQLVWUation. De mme, au niveau de
O8QLRQHXURSpHQQHOHVpWXGHVGLPSDFWVRQWSXEOLpHVORQJWHPSVDYDQWOHGpEXWGHOH[DPHQ
GXWH[WHFHTXLSHUPHWDX[SDUWLHVSUHQDQWHVGLQWHUYHQLUGDQVOHGpEDWSROLWLTXH
Pour finir, je formulerai quelques propositions en vXH GDPpOLRUHU OH FRQWHQX GHV
pWXGHVGLPSDFW
/DUWLFOH 8 de la loi organique du 15 avril 2009 prvoit une valuation des cots et
bnfices financiers attendus , mais pas des effets conomiques. Il serait important de
ODMRXWHU quoique la premire valuation soit rarement faite.
Prenons par exemple les dispositions lgislatives sur la scurit des ascenseurs :
FHVWXQHFKRVHGpYDOXHUOHFRWILQDQFLHUGHODUpIHFWLRQGHVDVFHQVHXUVSRXUOHVV\QGLFDWV
de coproprit et les bailleurs sociaux  FHQHst une autre de raliser une vritable analyse
pFRQRPLTXHTXLDXUDLWSHUPLVGHUHPDUTXHUTXHpWDQWGRQQpTXLOQH[LVWHTXHGHX[RXWURLV
DVFHQVRULVWHVVXUOHPDUFKpOHULVTXHpWDLWJUDQGGXQHSDUWTXHOHVFRWVH[SORVHQWGDXWUH
SDUWTXHORIIUHQHpuisse pas rpondre la demande !
/H FKDPS GHOpWXGHGLPSDFW SRVHXQDXWUHSUREOqPH1RXVHVVD\RQVGHFDOFXOHU
XQLQGLFHGHUHFRXYUHPHQW HQWUHFHTXL HVW WUDLWp GDQVOpWXGHHW OHVGLVSRVLWLRQV FRQWHQXHV
dans le texte de loi dfinitivement adopt. Il est vident que certains projets de loi subissent
des modifications significatives ; ainsi, le projet de loi de sparation et de rgulation des
activits bancaires est pass de 7 titres et 26 articles 12 titres et 86 articles, certaines
adjonctions portant sur des sujets majeurs, comme la lutte contre les drives financires ou
OHQFDGUHPHQWGHVFRQGLWLRQVGHPSUXQWGHVFROOHFWLYLWpVWHUULWRULDOHV
5HQGUH REOLJDWRLUH XQH pWXGH GLPSDFW GHV DPHQGHPHQWV VLJQLILFDWLIV VXSSRVHUDLW
une modification de la loi organique OH&RQVHLOFRQVWLWXWLRQQHOVHVWSURQRQFpGHIDoRQWUqV
claire sur ce point ; cela imposerait galement que le Parlement et/ou le Gouvernement se
GRWHQW GXQH FDSDFLWp GH[SHUWLVH LPPpGLDWH 8QH PHLOOHXUH VROXWLRQ VHUDLW TXH OH &RQVHLO
constitutioQQHO WLHQQHGDYDQWDJHFRPSWHGHODTXDOLWpGHOpWXGHGLPSDFWGDQVOHFDGUHGX
FRQWU{OH TXLO H[HUFH DX WLWUH GH ODUWLFOH 61 de la Constitution. Nous souffrons en France
GXQ ELDLV FXOWXUHO  RQ QH FRQVLGqUH SDV OHV TXHVWLRQV GpYDOXDWLRQ HW GH TXDQWLILFation
comme des lments substantiels de la procdure MXVTXjFHTXHFHODQRXVVRLWLPSRVpGH
OH[WpULHXU 6L MH FRPSUHQGV TXLO VRLW SROLWLTXHPHQW GLIILFLOH GH PHWWUH HQ XYUH OHV
mcanismes prvus par la loi constitutionnelle de 2008 et par la loi organique de 2009 en cas
de divergence entre la Confrence des prsidents et le Gouvernement, une sanction ex post
SDUOH&RQVHLOFRQVWLWXWLRQQHOSHUPHWWUDLWGLQVWDXUHUXQHFHUWDLQHGLVFLSOLQH
Le problme principal rside toutefois dans la capacit mme du Gouvernement
UpDOLVHUOHVpWXGHVGLPSDFW/DVROXWLRQSDVVHjPRQDYLVSDUGHX[LPSpUDWLIV/HSUHPLHUHVW
de parvenir une harmonisation des mthodes et du contenu mme des tudes  j OKHXUH
actuelle, la comptence en revient au Secrtariat gnral du Gouvernement ; pour ma part,
MpWDLVSOXW{WSDUWLVDQTXHFHVRLWOH&HQWUHGDQDO\VHVWUDWpJLTXHDXMRXUGKXLUHPSODFpSDUOH
Commissariat gnral la stratgie et la prospective, qui soit charg de la mise en forme

224

GHVpWXGHVGLPSDFW/DXWUHLPSpUDWLIHVWGHGpYHORSSHUODFDSDFLWpGH[SHUWLVHHQ)UDQFH
GROD page de publicit SDUODTXHOOHMDLFRPPHQFpPRQH[SRVp
M . 0LFKHO 9HUSHDX[ SURIHVVHXU GH GURLW j O8QLYHUVLWp GH 3DULV , 3DQWKpRQSorbonne. Mon propos sera sans doute plus gnral que celui de mes deux collgues, car je
QDLSDVUpIOpFKLDXWDQWTXHX[VXUOHVpWXGHVGLPSDFWHWOHSRXYRLUQRUPDWLIORFDO mme si
MHPLQWpUHVVHEHDXFRXSjFHVTXHVWLRQV
Je ne voudrais pas dcevoir le rapporteur, qui dclare sentir les esprits mrs
poXUODVLPSOLILFDWLRQPDLVLOVDJLWGXQHTXHVWLRQWUqVDQFLHQQHTXLUHPRQWHGXQHFHUWDLQH
faon la Rvolution franaise : dans les cahiers de dolances, on demandait dj des lois
SOXV VLPSOHV SOXV FODLUHV TXL VDSSOLTXHQW SDUWRXW GH PDQLqUH XQLIRUPH &HVW XQ WKqPH
rcurrent.
0rPHVLOHVWXQSHXIDFLOHGHFRPPHQFHUDLQVLMHFURLVGRQFTXLOIDXWIDLUHSUHXYH
GHPRGHVWLHHWPDQLHUOHVVROXWLRQVUDGLFDOHVDYHFSUXGHQFH1RXEOLRQVSDVTXHFHTXLHVW
FRPSOLTXp FHVW GDERUG OD VRFLpWp GDQV ODTXHOOH nous vivons  LO QHVW SDV FHUWDLQ TXH OH
GURLW SXLVVH UpVRXGUH GXQ FRXS GH EDJXHWWH PDJLTXH GHV TXHVWLRQV SDU HVVHQFH WUqV
complexes.
'DLOOHXUVFHTXLOIDXWYLVHUHVW-ce la simplification lgislative ou celle du droit ?
De ce point de vue, et malgr WRXWHODPLWLpTXHMDLSRXUPDFROOqJXH*pUDOGLQH&KDYULHUMH
QHVXLVSDVFHUWDLQTXDWWULEXHUXQSRXYRLUQRUPDWLIORFDODX[FROOHFWLYLWpVWHUULWRULDOHVIHUDLW
avancer les choses PrPHDYHFOHVJDUDQWLHVTXHOOHDSUpVHQWpHV-HSUpVLGHO$VVRFLDWLRQ
franaise de droit des collectivits locales : on peut donc difficilement voir en moi un
centralisateur ultrajacobin ; pourtant, je ne pense pas que la dcentralisation soit la solution
WRXW,OPHVHPEOHGDXWUHSDUWTXHODORLQHVWSDVODVHXOHVRXUFHde la complexit actuelle
HWFHQHVWSDVSDUFHTXHMHVXLVjO$VVHPEOpHQDWLRQDOHTXHMHGLVFHOD/H*RXYHUQHPHQWHW
les instances administratives ont eux aussi leur part de responsabilit.
-H[DPLQHUDLHQSUHPLHUOLHXOHVPR\HQVH[LVWDQWVSXLVMHQYisagerai les facteurs sur
lesquels il serait possible de jouer, avant de vous livrer quelques pistes de rflexion.
3RXUFRPPHQFHUQRXEOLRQVSDVTXHOHVDUWLFOHV 34 et 37 de la Constitution de 1958
avaient initialement pour objectif de simplifier, sinon le droit, du moins la rpartition des
comptences normatives : pour que les choses fonctionnent mieux, le Parlement ne devait
SDVVHSHUGUHGDQVOHVGpWDLOV2UFHQHVWSDVFHTXLVHVWSDVVp SRXUUHSUHQGUHOH[SUHVVLRQ
GXQpPLQHQWMXULVWHPDOKHXUHXVHPHnt dcd, sur ce point OD5pYROXWLRQQDSDVHXOLHX .
Peut-tre les juridictions ont-HOOHVXYUpHQFHVHQV : ainsi le Conseil constitutionnel, aprs
une timide tentative en 2005 pour dplacer le curseur entre la loi et le rglement dans une
direction SOXVFRQIRUPHjOHVSULWGHOD&RQVWLWXWLRQDPDLQWHQXHQXQHMXULVSUXGHQFH
qui autorise les drives en la matire.
Deuxime moyen ODMXULVSUXGHQFHD\DQWWUDLWjOREMHFWLIjYDOHXUFRQVWLWXWLRQQHOOH
GLQWHOOLJLELOLWp HW GDFFHVVLELOLWp GH OD ORL Malheureusement, le Conseil constitutionnel
manie cet outil avec une certaine prvention HQ WRXW FDV SDV DXWDQW TXRQ SRXUUDLW OH
souhaiter ; les censures de lois sur ce motif sont trs peu nombreuses. Il a fallu attendre 2005
et une loi de finances totalement incomprhensible, mme pour les spcialistes, pour que le
&RQVHLOFRQVWLWXWLRQQHOOXWLOLVH
Le processus de codification, lanc depuis la fin des annes 1980, a galement pour
objectif entre autres GHVLPSOLILHUVLQRQOHFRQWHQXGXPRLQVOapproche du droit.

225

Dernier moyen : la rvision constitutionnelle de 2008 et les nouveaux outils qui ont
pWpGRQQpVDX3DUOHPHQWDILQGHGpYHORSSHUVRQDFWLYLWpGHFRQWU{OHHW GDFFURvWUHVRQU{OH
dans le processus lgislatif. Ces outils sont-ils suffisants "/HELODQGHVpWXGHVGLPSDFWQHVW
gure satisfaisant LOVHWURXYHTXXQGHPHVGRFWRUDQWVWUDYDLOOHVXUOHVXMHWPrPHVLVRQ
approche est beaucoup moins quantifie que celle de M. du Marais. On nous les avait
SUpVHQWpHV FRPPH XQ PR\HQ UDGLFDO GDPpOiorer de la loi, mais pour un observateur
extrieur, comme je le suis, cela ne semble pas rvolutionner grand-chose ! L encore, le
&RQVHLOFRQVWLWXWLRQQHOQDMDPDLVpWpVDLVLVXUFHWWHTXHVWLRQPDLVODIDXWHHQLQFRPEHDX[
DFWHXUVSXEOLFVSXLVTXLOQHSHXWOrWUHTXHVLOH[LVWHXQGpVDFFRUGHQWUHOD&RQIpUHQFHGHV
prsidents et le Gouvernement FHTXLGXIDLWGHORUJDQLVDWLRQLQVWLWXWLRQQHOOHGHOD9me
5pSXEOLTXH QHVW MDPDLV OH FDV 0DOJUp WRXW OH &RQVHLO FRQVWLWXWLRQQHO HVW DSSHOp j VH
prononceULQGLUHFWHPHQWVXUOHVXMHWGDQVOHFDGUHGHOH[DPHQGHODSURFpGXUHOpJLVODWLYHDX
titre du contrle a priori GHVORLVRUGLQDLUHVPDLVMXVTXjSUpVHQWLOODWRXMRXUVIDLWDYHFXQH
trs grande prudence LOQDMDPDLVMXJpTXXQHpWXGHGLPSDFWQpWDit pas adapte.
mon avis, deux aspects sont prendre en considration dans la question de la
simplification lgislative : la quantit des lois et leur qualit.
2QGLWVRXYHQWTXLO\DXQWURSJUDQGQRPEUHGHORLV(VW-ce vrai ? On en compte
peu prs une centaine par an, dont une quarantaine se bornent autoriser la ratification
GHQJDJHPHQWVLQWHUQDWLRQDX[ : cela ne me semble pas excessif.
&H TXL IDLW SUREOqPH FH QHVW SDV OH QRPEUH GH ORLV HQ VRL PDLV OH[LVWHQFH GH
textes redondants, qui reviennent sans cesse sur le mme sujet. Le domaine de la procdure
pnale est particulirement riche GH[HPSOHVGHFHW\SH6XUFHSODQSHXW-tre les choses
pourraient-elles tre amliores. Toutefois, cela ne manquerait pas de soulever des difficults
politiques, car la situation actuelle rsulte en grande partie des alternances, la nouvelle
PDMRULWp FKHUFKDQW HQ JpQpUDO j FRUULJHU FH TXD IDLW OD SUpFpGHQWH &HVW OH MHX GH OD
dmocratie, mais il faut avoir conscience que cela a des effets quantitatifs.
Autre problme : la multiplication des textes de simplification du droit, qui ont
OHIIHW LQYHUVH GH FHOXL DQQRQFp 2Q \ WURXYH GH WRXW ! Les lois portant diverses
dispositions  QH[LVWHQW SOXV PDLV HOOHV RQW pWp UHPSODFpHV SDU FHV ORLV GLWHV de
simplification , qui ne valent pas mieux sur le plan de la clart et de la lisibilit.
Se pose aussi la question des niveaux de dcision, ce qui nous ramne au thme de
la dcentralisation MHQ\UHYLHQVSDV
Passons aux problmes relatifs la qualit de la loi, commencer par sa longueur.
Certains projets de loi subissent des modifications importantes entre leur dpt et leur
DGRSWLRQGpILQLWLYH'DXFXQVYRQWPrPHMXVTXjFRQVLGpUHUTXHODORLHVW dnature par
le Parlement, de nombreux amendements venant perturber OHWH[WHLQLWLDO3RXUWDQWFHVW
ELHQOHU{OHGHVSDUOHPHQWDLUHVTXHGDPHQGHUODORL6LRQOHOHXULQWHUGLVDLWon prsenterait
un texte HW OH &RQVHLO GeWDW ODGRSWHrait ; FH VHUDLW XQ UHWRXU j OpSRTXH GH 1DSROpRQ
Bonaparte !
La qualit rdactionnelle des lois est en revanche un vrai problme. Certes, le
&RQVHLOGeWDWHVWFHQVpIDLUHXQFRQWU{OHjOpWDSHGHODYDQW-projet de loi et la rvision de
2008 a ouvert la possibilit de lui soumettre pour avis galement les propositions de loi.
Mais cette nouvelle procdure est-elle trs utilise ? Est-ce que cela change quelque chose ?
On peut se demander si cet outil, qui a t strictement bord par le Constituant et la loi
ordinaire, est vritablement utile.

226

Enfin, il ne faut pas oublier quHODORLVHWURXYHjORULJLQHGXQHFDVFDGHGHWH[WHV


qui compliquent parfois les choses avec, dans les cas extrmes, des circulaires qui disent
autre chose que ce qui a t vot par le lgislateur !
6DJLVVDQWGHVSLVWHVjpWXGLHUMHGLVWLQJXHUDLODPRQWGHODYDO
En amont, il conviendrait de renforcer les moyens du Parlement : faut-il, cette fin,
FUpHU XQ QRXYHO RUJDQH SDUOHPHQWDLUH GpGLp j ODPpOLRUDWLRQ GH OD TXDOLWp GH OD ORL ? Cet
organe devra-t-il tre propre chacune des deux assembles lLQGpSHQGDQFH GHV GHX[
assembles est, je le rappelle, un principe constitutionnel RXPL[WHHWSDULWDLUHGXIDLWTXLO
VDJLWGXQWUDYDLOFROOHFWLIHWTXXQHDVVHPEOpHQHVDXUDLWHQODPDWLqUHLJQRUHUFHTXHIDLW
ODXWUH ?
Serait-il par ailleurs farfHOXGHQYLVDJHUODGRSWLRQGXQHORLRUJDQLTXHUHODWLYHDX[
lois ordinaires une LOLO sur le modle de la LOLF pour les lois de finances ? Cette
loi organique encadrerait le processus et le contenu de la loi ordinaire. Un tel projet
rencontrerait toXWHIRLV GHX[ GLIILFXOWpV 6RQ DGRSWLRQ GHYUDLW WRXW GDERUG UpVXOWHU GXQH
dmarche consensuelle, mais tel est, aprs tout, le cas de la loi organique relative aux lois de
ILQDQFHV DGRSWpHHQTXLDpWpOHIUXLWGXQFRQVHQVXV HQWUHGHX[DVVHPEOpHVDOors de
PDMRULWpVSROLWLTXHVRSSRVpHV(QVXLWHODGRSWLRQGXQHWHOOHORLRUJDQLTXHLPSOLTXHUDLWXQH
UpYLVLRQGHOD&RQVWLWXWLRQ-LJQRUHFRPPHQW OHVSDUOHPHQWDLUHVYLYHQWOD /2/) : celle-ci,
qui permet de censurer tout dbordement du cadre constitutionnel des lois de finances,
maintient ainsi leur unit.
(QDYDOLOFRQYLHQWGHGpWHUPLQHUOHVPHLOOHXUVPR\HQVSHUPHWWDQWGpYDOXHUODORL
HWGHQIDYRULVHUVRQDSSOLFDWLRQ
M me la prsidente Laure de La Raudire. Je suis toujours tonne du fait que les
pWXGHVGLPSDFWVRQWUpDOLVpHVSDUOHPLQLVWqUHFKDUJpGXWH[WH4XHOOHLQVWDQFHGHYUDLWrWUH
UHVSRQVDEOHGHVpWXGHVGLPSDFW ? Devraient-elles tre ralises par un service centralis du
Gouvernement ddi cette fin ? Ou mieux : ne devrait-il pas revenir au Parlement de se
charger GHOpWXGHGLPSDFWGXQWH[WHJRXYHUQHPHQWDO"
Par ailleurs, les amendements sont examins, en raison de leur ventuel impact
EXGJpWDLUHDXUHJDUGGHODUWLFOH 40 de la Constitution. Ne serait-LOSDVXWLOHGHQYLVDJHUXQ
dispositif du mme ordre pour juger de la recevabilit des amendements au titre de leur
qualit ?
M me Ccile Untermaier. Comme Mme la prsidente et moi-mme avons pu le
FRQVWDWHU j %UX[HOOHV DX SODQ HXURSpHQ OpWXGH GLPSDFW GRLW rWUH YDOLGpH DYDQW WRXWH
DGRSWLRQ GXQH GLUHFWLYH GH OD &RPPLVVLRQ /pWXGH HVW pJDOHPHQW FR-construite avec les
FLWR\HQV GDQV OH FDGUH GXQ IRUXP ,QWHUQHW 8Q WHO GLVSRVLWLI VHUDLW-il transposable au
Parlement franais ?
Par ailleurs, ne faudrait-il pas rendre obligatoires les WXGHVGLPSDFWVLQRQSRXUOHV
amendements, du moins pour les propositions de loi "7HOQHVWSDVOHFDVDXMRXUGKXLDORUV
mme que les propositions de loi sont nombreuses.
(QILQLOFRQYLHQGUDLWHQFHVWHPSVGHULJXHXUEXGJpWDLUHGLQFOXUHGDQVOHVpWXdes
GLPSDFW OpYDOXDWLRQ GH OD FKDUJH DGPLQLVWUDWLYH GH OpWXGH HOOH-mme. Ne faudrait-il pas
alors modifier la loi organique pour rendre ce critre obligatoire ?

227

M . Rgis Juanico. Madame Chavrier, avez-vous men des travaux sur la ralit du
principe de VXEVLGLDULWp IDFH DX[ QRUPHV pGLFWpHV SDU O(XURSH " /LQIODWLRQ GHV QRUPHV
europennes, qui constitue un vrai souci pour les collectivits territoriales, met mal
ODSSOLFDWLRQGXSULQFLSHGHVXEVLGLDULWpDX[SODQVQDWLRQDOHWLQIUDQDWLRQDO
Monsieur VeUSHDX[ O$VVHPEOpH QDWLRQDOH VHVW GRWpH GHSXLV  GXQ &RPLWp
GpYDOXDWLRQHWGHFRQWU{OHGHVSROLWLTXHVSXEOLTXHVTXLSURGXLWGHVUDSSRUWVGHWUqVJUDQGH
qualit. Cette valuation, ralise ex post, implique videmment un recul certain dans
ODSSOLFDtion des lois  FHUWHV WHO QHVW SDV OREMHW GHV WUDYDX[ GH OD SUpVHQWH PLVVLRQ
GLQIRUPDWLRQSDUOHPHQWDLUHPDLVQHFRQYLHQGUDLW-LOSDVGHVLQVSLUHUGXQWHORXWLOTXLHVW
bipartisan et donne entire satisfaction, en matire de simplification lgislative ?
9RXVDYH]pYRTXpOpYHQWXDOLWpGXQHORLRUJDQLTXHHQFDGUDQWOHVORLVRUGLQDLUHVVXU
le modle de la LOLF pour les lois de finances : nous devons auparavant faire le bilan de
ODSSOLFDWLRQ GH OD /2/) SURPXOJXpH HQ  (Q HIIHW LO H[LVWH XQ GpVpTXLOibre certain
HQWUHOHVWURLVPRLVTXHOH3DUOHPHQWFRQVDFUHHQWUHRFWREUHHWGpFHPEUHjODGRSWLRQGHOD
loi de finances initiale les intentions budgtaires et les quelques jours seulement dvolus,
la fin du mois de juin ou au dbut du mois de juillet, la loi de rglement qui porte sur
OH[pFXWLRQ HW GRQF OD vrit  EXGJpWDLUH GH ODQQpH DQWpULHXUH -H WLHQV pJDOHPHQW j
LQVLVWHU VXU OD IUDJLOLWp TXL SUpVLGH j OpODERUDWLRQ GH FHUWDLQV LQGLFDWHXUV GH SHUIRUPDQFH
FRQWHQXVGDQVOD /2/)&HVW SRXUquoi, je le rpte, il me parat ncessaire de raliser un
bilan qualitatif de son application.
M me Ccile Untermaier. Il conviendrait galement de renforcer la coordination
des textes  WURS VRXYHQW LO QH[LVWH DXFXQH FRKpUHQFH HQWUH FHX[ TXL VRQW GLVFXWs au
3DUOHPHQW 6L VDJLVVDQW GHV SURSRVLWLRQV GH ORLV LO UHYLHQW j O$VVHPEOpH QDWLRQDOH
GDVVXUHU FHWWH FRKpUHQFH VDJLVVDQW GHV SURMHWV GH ORL QHVW-FH SDV DX *RXYHUQHPHQW G\
veiller dans un cadre interministriel ?
M me la prsidente Laure de La Raudire. Mme Untermaier a raison : nous avons
WURS VRXYHQW OLPSUHVVLRQ TXH OH GpS{W GHV WH[WHV HQWUH OHV GHX[ DVVHPEOpHV QREpLW SOXV j
aucune logique interministrielle OHVSURMHWVVHFKHYDXFKHQWHQFRXUVGH[DPHQ
M . le rapporteur. La mission travaille sur la fabrique de la loi. Il conviendrait de
IDLUHOHSRLQWVXUODUpDOLVDWLRQGHVpWXGHVGLPSDFWHQ(XURSHQRWDPPHQWVXUOHVRUJDQLVPHV
chargs de les effectuer. Alors que des organismes indpendants sont parfois sollicits, en
France, elles sont ralises par les ministres concerns par le texte. Le secrtaire gnral du
*RXYHUQHPHQWPDFRQILpTXHFHX[-FL\WHQDLHQWFHTXLQHVWSDVVDQVSRVHUXQSUREOqPH
M me la prsidente Laure de La Raudire. 6XUWRXWHQODEVHQFHGHWRXWRUJDQHGH
validation de OpWXGHGLPSDFW
M . le rapporteur. /D &RQIpUHQFH GHV SUpVLGHQWV GH O$VVHPEOpH QDWLRQDOH D XQ
GURLWGHUHJDUGVXUOpWXGHGLPSDFW : en a-t-elle jamais us ? La Prsidente me GLWTXHRXL
,OIDXGUDLWUDSSHOHUDX[WLWXODLUHVGHFHGURLWTXLOVGRLYHQWOHxercer, car il est trs important
SRXU OD IDEULTXH GH OD ORL ,O FRQYLHQGUDLW pJDOHPHQW GLQVWDXUHU HQ DPRQW GX GpEDW VXU OH
projet de loi lui-PrPHXQYUDLGpEDWDXWRXUGHOpWXGHGLPSDFW&HW\SHGHGpEDWVHGpURXOHt-LOGDQVGDXWUHVSD\V ?
Je pense pDU DLOOHXUV TXH OHV pWXGHV GLPSDFW GHYUDLHQW rWUH UHQGXHV REOLJDWRLUHV
pour les propositions de loi comme elles le sont dj pour les projets de loi. Pourquoi faire
une diffrence en la matire entre les textes manant du Gouvernement et ceux qui sont
dposs par les parlementaires ?

228

(QILQSRXUTXRLOHVDYLVGX&RQVHLOGeWDWVXUOHVSURMHWVGHORLRQW-ils le statut de
GRFXPHQWV FRQILGHQWLHOV XQ VHFUHW TXH WRXW ODUW GHV MRXUQDOLVWHV FRQVLVWH GDLOOHXUV j
divulguer ? Quant aux parlementaires, pourquoi ne saisissent-ils pas davantage le Conseil
GeWDWVXUOHVSURSRVLWLRQVGHORLDORUVTXLOVHQRQWODSRVVLELOLWp ?
M . Bertrand du M arais. /DFRQIHFWLRQGHVpWXGHVGLPSDFWVRXIIUHHQ)UDQFHGXQ
biais culturel OH[SHUWLVHWHFKQLTXHDSSDUWLHQWWUDGLWLRQQHOOHPHQWDX[VHUYLFHVGHOH[pFXWLI
'DQV PD FRQWULEXWLRQ DXUDSSRUWGX&RQVHLOGeWDW MDL VXJJpUpGHUHFRXULUSRXUODQDO\VH
PLFURpFRQRPLTXH QRWDPPHQW GH OLPSDFW GHV SROLWLTXHV SXEOLTXHV j OD PrPH GpPDUFKH
que celle que le Premier ministre Raymond BarrH DYDLW HQWUHSULVH SRXU ODQDO\VH
macroconomique VRLWGRQQHUVRQLQGpSHQGDQFHjXQHVWUXFWXUHTXLDGpMjOH[SHUWLVHVRLW
crer ex nihilo GHVFHQWUHVGH[SHUWLVH
-DLSUpFRQLVpTXHOH[-&RPPLVVDULDWDXSODQVWUXFWXUHTXLGLVSRVHGXQHWUDGLWLRQ
GH[SHUWLVH HQFDGUH HW UpJOHPHQWH OHV pWXGHV GLPSDFW HW VRLW FKDUJp GX FRQWU{OH GH OHXU
qualit technique. Nous sommes en effet confronts au problme de la sanction inflige en
cas GDEVHQFH GpWXGHVGLPSDFWRXGHOHXU insuffisance , pour reprendre les termes de
OD MXULVSUXGHQFH GX &RQVHLO GeWDW VXU OHV pWXGHV GLPSDFW HQYLURQQHPHQWDOHV (Q GURLW
europen, le comit autonome adjoint la Commission europenne renvoie le projet de
GLUHFWLYH HQ FDV GpWXGHV GLPSDFW LQVXIILVDQWH : le manque, en France, GXQ WHO GHJUp GH
VDQFWLRQQHVWSDVVDQV SRVHUODTXHVWLRQTXL HVW PDMHXUHGXGpEDW SROLWLTXHDXVHLQ GHOD
&RQIpUHQFHGHVSUpVLGHQWVGHO$VVHPEOpHQDWLRQDOH
Le calcul du cot de la charge administrative figure dans la loi organique, qui
prvoit, lDUWLFOH OpYDOXDWLRQGHV cots et bnfices financiers attendus des dispositions
HQYLVDJpHV SRXU FKDTXH FDWpJRULH GDGPLQLVWUDWLRQV SXEOLTXHV  -DL SDUWLFLSp j OD
fabrication du modle comptable OSCAR qui mesure la charge administrative : il est utilis
par Bercy pour prparer les lois de simplification HW LO VHUDLW LQWpUHVVDQW GHQ SXEOLHU OHV
rsultats. Ce modle pourrait tre ouvert aux commissions du Parlement.
-HQHVXLVSDVIDYRUDEOHjOpODUJLVVHPHQWGHVpWXGHVGLPSDFWDX[SURSRVLWLRQVGH
lois HIIHFWXRQVGpMjGHVpWXGHVGLPSDFWFRPSOqWHVHWXWLOHVGDQVOHVGRPDLQHVUHTXLVSDUOD
ORL1RXEOLRQVSDVTXHOOHVUHSUpVHQWHQWXQpQRUPHSURJUqVSDUUDSSRUWjODIDoRQGRQWRQ
prparait les textes il y a dix ou quinze ans.
Enfin, le fait de rendre SXEOLTXHOpWXGHGLPSDFWHQDPRQWGHODVDLVLQHGX&RQVHLO
GeWDW SHUPHWWUDLW FRPPH DX 5R\DXPH-Uni, de faire de cette tude le lieu de la
consultation : le politique pourra alors se saisir de ce qui sera devenu un vrai instrument de
dbat dmocratique.
M me Graldine Chavrier. 6DJLVVDQW GX UHVSHFW GX SULQFLSH GH VXEVLGLDULWp OH
SURWRFROHHXURSpHQVXUODSSOLFDWLRQGXSULQFLSHGHVXEVLGLDULWpSUpYRLWTXHWRXWSURMHWGDFWH
lgislatif doit comporter une fiche contenant des lments circonstancis sur le respect du
principe de subsidiarit et de proportionnalit. Ce principe devrait tre retenu au niveau
UpJOHPHQWDLUH/HVSDUOHPHQWVQDWLRQDX[RQWGDLOOHXUVHQODPDWLqUHXQGURLWGHFRQWHVWDWLRQ
auquel, il est vrai, ils recourent rarement. En avril 2013, un eWDW VHVW SODLQW DXSUqV GH OD
&RXUGHMXVWLFHGHO8QLRQHXURSpHQQH &-8( GHODYLRODWLRQGXSULQFLSHGHVXEVLGLDULWpj
SURSRVGXQHDXWRULVDWLRQGHVXEVWDQFHFKLPLTXH
Quant au mot simplification  LO PH SDUDvW XQ SHX pWURLW /DGDSWDELOLWp TXL
rpRQG j OKHXUH DFWXHOOH j XQH GHPDQGH WUqV IRUWH HVW OH FRQWUDLUH GH OD VLPSOLILFDWLRQ
Faut-il faire plus simple et moins efficace ou plus efficace et moins simple ? Il est vident
que le dveloppement du pouvoir rglementaire local, en multipliant les actes normatifs,

229

WRXUQHOHGRVjODVLPSOLILFDWLRQ,OIDXWDOOHUYHUVOHIILFDFLWpPHV\HX[ODVLPSOLILFDWLRQ
VHUpVXPHjOLQWHOOLJLELOLWpGHODORLHWjVDSHUPDQHQFH(VW-il par exemple pertinent que la
clause de comptence gnrale ait t quasiment supprime en 2010 pour tre rinstaure en
dcembre 2013 puis de nouveau remise en cause en janvier 2014 ? Une loi doit avoir une
certaine permanence pour avoir une certaine solennit. Quant son efficacit, elle est
IRQFWLRQGHODYDOHXUGHVpWXGHVGLPSDFWHWGHODGDSWDELOLWpGHVWH[WHV
5DSSHORQV HQILQ TXH OD TXDOLWp GH OpYDOXDWLRQ GpSHQG GHV FULWqUHV UHWHQXV : vous
DYH]UDLVRQPDGDPHODSUpVLGHQWHOHIDLWTXHFHVRLWOHSRUWHXUGXSURMHWFHVW--dire celui
TXL OH GpVLUH TXL UpDOLVH OpWXGH GLPSDFW QHVW SDV WUqV VDLQ SXLVTXH OHV FULWqUHV TXLO
FKRLVLUDUHIOpWHURQWVRQGpVLU,OFRQYLHQWGRQFGHFRQILHUODUpDOLVDWLRQGHVpWXGHVGLPSDFW
VRLW DX 3DUOHPHQW VRLW FRPPH DX QLYHDX GH O8QLRQ HXURSpHQQH j GHV RUJDQLVPHV GH OD
socit civile ORXYHUWXUHjODVRFLpWpFLYLOHILJXUDLWGDLOOHXUVGDQVODFKDUWHGHGpRQWRORJLH
instaure par le Prsident de la Rpublique lors de son entre en fonction. Les critres choisis
GRLYHQWSRXYRLUIDLUHOREMHWGXQGpEDWHWrWUHFRQWHVWpVQRWDPPHQWDXWLWUHdes expriences
prives.
M . M ichel Verpeaux. /DGRSWLRQ GXQ DUWLFOH TXL VXU OH PRGqOH GH ODUWLFOH 40,
censurerait non pas la porte budgtaire mais la qualit des amendements, impliquerait une
modification de la Constitution puisque les amendements gouvernementaux y seraient
pJDOHPHQWVRXPLV/LGpHTXLHVWVpGXLVDQWHVHUDLWXQHDUPHORXUGH
Souhaitez-YRXV GRWHU OH &RPLWp GpYDOXDWLRQ HW GH FRQWU{OH GHV SROLWLTXHV
publiques GXQH FRPSpWHQFH SOXV WHFKQLFR-juridique ? Faut-il crer un comit parallle et
donc supplmentaire "&HVW PRLTXL YRXVSRVHODTXHVWLRQFDULO DSSDUWLHQW jO$VVHPEOpH
QDWLRQDOHGHQGpFLGHU
/HV pWXGHV GLPSDFW GHYUDLHQW DYRLU SRXU IRQFWLRQ GH SHUPHWWUH XQH PHLOOHXUH
FRRUGLQDWLRQ GHV WH[WHV GDXWDQW TXH WURS VRXYHQW ces tudes GRQQHQW DXMRXUGKXL
OLPSUHVVLRQ GrWUH OHV GRXEORQV GHV UDSSRUWV SDUOHPHQWDLUHV VXU OHV SURMHWV RX OHV
propositions de loi, rapports qui sont de grande qualit. On a voqu devant moi le recours
OH[WHUQDOLVDWLRQ : est-ce exact ?
M . Rgis Juanico. Le CoPLWpGpYDOXDWLRQHWGHFRQWU{OHSHXWH[WHUQDOLVHUFHUWDLQHV
tudes pour des rapporWVSRUWDQWVXUOpYDOXDWLRQGHV politiques transversales.
M . le rapporteur. 0RQVLHXU 9HUSHDX[ MH SHQVH j FHWWH FLWDWLRQ G(VFK\OH
dans Promthe enchan selon laquelle ne pas paratrHVDJHFHVWODYUDLHVDJHVVH. Tel est
OpWDWGHVSULWGHODPLVVLRQGLQIRUPDWLRQ
M me la prsidente Laure de La Raudire. Je vous remercie madame et messieurs
les professeurs.
*
*

230

/DPLVVLRQGLQIRUPDWLRQSURFqGHensuite jODXGLWLRQVRXVIRUPHGHtable ronde,


de : Mme 3DVFDOH 'HXPLHU SURIHVVHXUH GH GURLW j O8QLYHUVLWp -HDQ 0RXOin (Lyon III) ;
Mme &pOLD =RO\QVNL SURIHVVHXUH GH GURLW j O8QLYHUVLWp GH 9HUVDLOOHV
Saint-Quentin-en-Yvelines.
M me la prsidente Laure de La Raudire. 1RWUH PLVVLRQ GLQIRUPDWLRQ HQWHQG
davantage faire porter ses travaux sur une rationalisation du flux normatif que sur la
simplification du stock des normes lgislatives et rglementaires, dont se proccupe
GDLOOHXUV OH*RXYHUQHPHQW HQpWURLWHFollaboration avec notre rapporteur Thierry Mandon.
Pour parvenir la production de textes moins nombreux, plus lisibles et plus efficaces, nous
envisageons notamment de procder une meilleure valuation ex ante des textes au stade
de la ralisation de lpWXGH GLPSDFW GH VXSSULPHU GHV WH[WHV ORUVTXH GH QRXYHDX[ VRQW
adopts, suivant le principe britannique du one in, two out GRFWUR\HUDX3DUOHPHQWXQ
GURLW GH UHJDUG VXU OHV GpFUHWV GDSSOLFDWLRQ HW VXU OHV RUGRQQDQFHV GURLW TXL SRXUUDLW VH
concrtiser par un meilleur encadrement et une meilleure visibilit de leur calendrier
prvisionnel de publication, et enfin de modifier la mthode lgislative de transposition des
directives QRXVSRXUULRQVSDUH[HPSOHGLVSRVHUGXQDYLVGX&RQVHLOGeWDWGDQV les cas o
la directive est transpose par dfaut, sans durcissement dans le droit franais.
Aprs avoir effectu un dplacement Bruxelles, nous ouvrons nos travaux en
rencontrant des universitaires qui se sont penchs sur ces sujets. Nous accueillons donc Mme
3DVFDOH'HXPLHUSURIHVVHXUHGHGURLWjO8QLYHUVLWp-HDQ-Moulin (Lyon III), et Mme Clia
=RO\QVNL SURIHVVHXUH GH GURLW j O8QLYHUVLWp GH 9HUVDLOOHV 6DLQW-Quentin-en-Yvelines, que
QRXVUHPHUFLRQVGDYRLUUpSRQGXjQRWUHLQYLWDWLRQ
Madame Deumier, vous vous intressez depuis longtemps aux enjeux qui
SUpRFFXSHQW QRWUH PLVVLRQ GLQIRUPDWLRQ -H SHQVH DX[ UpIOH[LRQV TXH YRXV DYH] PHQpHV
dans le cadre de commentaires de dcisions du Conseil constitutionnel, sur les qualits de la
loi, sur sa normativit, sur son objet, en principe non rglementaire, et sur son obsolescence,
mais aussi vos travaux sur la simplification par la codification droit constant.
Madame Zolynski, vous avez en particulier rflchi sur la mthode de transposition
des directiveVHXURSpHQQHV9RXVrWHVODXWHXUHGXQHWKqVHGHGRFWRUDWVXUODTXHVWLRQTXL
VDSSXLH VXU OH[HPSOH GX GURLW GDXWHXU HW GHV GURLWV YRLVLQV SRXU SURSRVHU XQH QRXYHOOH
mthode de transposition.
-HYRXVFqGHjSUpVHQWODSDUROHSRXUXQH[SRVpOLPLQDLUHGune dizaine de minutes
chacune, afin de laisser place au dbat dans un second temps.
0PH3DVFDOH'HXPLHUSURIHVVHXUHGHGURLWjO8QLYHUVLWp-HDQ-M oulin (Lyon
I I I ). Je vous remercie de nous avoir invites voquer avec vous ce vaste projet de
simplification lgislative. Je ne suis cependant pas certaine que la rponse puisse venir de la
VFLHQFH GX GURLW /H GURLW SHXW GLUH FH TXLO QH IDXW SDV IDLUH PDLV LO QH SHXW SUHVFULUH
comment simplifier la loi ou rationaliser le flux normatif FHVW Oj XQ FKDQWLHr bien plus
vaste.
-pYRTXHUDLEULqYHPHQWODVLPSOLILFDWLRQOpJLVODWLYHHQJpQpUDODYDQWGDERUGHUWURLV
GHV WKqPHVTXHYRXVQRXVDYH]VXJJpUpVODLVVDQW OHTXDWULqPHjPDFROOqJXHGRQW FHVW OD
spcialit.
,O LPSRUWHGDYRLUXQH FRQFHSWLRQSUpFLVHGHFH TXHVW ODVLPSOLILFDWLRQOpJLVODWLYH
FRPPHGHVRQREMHFWLI0PHODSUpVLGHQWHDSUpFLVpTXLOVDJLVVDLWGHODUDWLRQDOLVDWLRQGX
IOX[HWQRQGHVDXWUHVYROHWVGHODVLPSOLILFDWLRQ-HQHSHX[TXDSSURXYHUFDUHQDQQRQoDQW

231

des mesures de simplification, on ne peut que dcevoir. En effet, les citoyens ne percevront
jamais la loi comme quelque chose de simple. Par consquent, toutes les mesures de
VLPSOLILFDWLRQGRQQHURQWOLPSUHVVLRQGDERXWLUjXQpFKHF : le ressenti ne sera jamais celui
GXQGURLWVLPSOHDORUVTXHOREMHFWLIGXQGURLWUDWLRQDOLVpELHQPDvWULVpHWELHQSHQVpSHXW
lui, tre atteint.
Il convient nanmoins de saluer tout ce qui a t fait en termes de simplification
dans les dix dernires annes. Les progrs sont considrables, et sans doute insuffisamment
YDORULVpV1RXVHQWHQGRQVWRXMRXUVOHGLVFRXUVWUDGLWLRQQHOVXUOLQIODWLRQOpJLVODWLYHFRPPH
VLOHVSURJUqVDFFRPSOLVQDYDLHQWSDVpWpLQWpJUpVGDQVODSHUFHSWLRQTXHQRXVDYRQVGHOD
loi. Il est temps, je crois, de valoriser LgifranFHOHVpFKpDQFLHUVGHGpFUHWVGDSSOLFDWLRQOD
FRGLILFDWLRQjGURLWFRQVWDQWRXHQFRUHOHVpWXGHVGLPSDFW
(QILQLOVHUDLWERQTXHODFWLRQGHVLPSOLILFDWLRQOpJLVODWLYHVDSSOLTXHVHVSURSUHV
prconisations FHOOHV TXHOOH HQWHQG DSSOLTXHU DX WUDLWHPent de la loi. Si beaucoup a t
UpDOLVp EHDXFRXS D DXVVL pWp SURSRVp pWXGLp RX UpIOpFKL /DFFXPXODWLRQ GHV UDSSRUWV
FLUFXODLUHVHWSURSRVLWLRQVGRQQHSDUIRLVOLPSUHVVLRQGHQHSDVWHQLUFRPSWHGHFHTXLDpWp
fait auparavant, et surtout de ngliger lHV UDLVRQV GH OpFKHF GH FHUWDLQHV SURSRVLWLRQV
$SSOLTXHUjODFWLRQGHVLPSOLILFDWLRQGHODORLVHVSURSUHVSUpFRQLVDWLRQVGHYUDLWFRPPHQFHU
par une valuation ex post, ne serait-ce que des propositions du rapport du prsident JeanLuc Warsmann sur la qualit et la simplification du droit publi en 2009. De mme, il faut
soumettre les nouvelles propositions une valuation ex ante.
-HQYLHQVDX[LQWHUURJDWLRQVTXHYRXVDYH]IRUPXOpHV
6DJLVVDQW GHV GpFUHWV GDSSOLFDWLRQ EHDXFRXS D GpMj pWp IDLW /pFKancier
disponible sur Lgifrance est trs utile pour les utilisateurs du droit que nous sommes. Le
WUDYDLOGHODFRPPLVVLRQGX6pQDWSRXUOHFRQWU{OHGHODSSOLFDWLRQGHVORLVDpJDOHPHQWSRUWp
GHV IUXLWV (Q UHYDQFKH OHV GLIILFXOWpV GDSSOLFDWLRQ GH la disposition qui prvoit que le
*RXYHUQHPHQWSUpVHQWHDX3DUOHPHQWXQUDSSRUWVXUODPLVHHQDSSOLFDWLRQGHODORLjOLVVXH
GHVVL[PRLVVXLYDQWVDGDWHGHQWUpHHQYLJXHXUPpULWHUDLHQWGrWUHpYDOXpHV
Est-LOSRVVLEOHDXOpJLVODWHXUGDOOHUSOXVORLQ "-HQHQVXLVSDVFHUWDLQHHXpJDUGj
la dcision rendue le 9 avril 2009 par le Conseil constitutionnel sur la loi organique relative
ODSSOLFDWLRQGHVDUWLFOHV-HWGHOD&RQVWLWXWLRQ&HWWHGHUQLqUHSUpYR\DLWTXRXWUH
OHV PHVXUHV GDSSOLFDWLRQ QpFHVVDLUHV OpWXGH GLPSDFW GHYDLW PHQWLRQQHU OHXU FRQWHQX
prvisionnel et leur dlai prvisionnel de publication, disposition qui a t censure au motif
TXHOOHPpFRQQDLVVDLWOHSULQFLSHGHVpSDUDWLRQGHVFRPSpWHQFHVGXSRXYRLUOpJLVODWLIHWGX
pouYRLU UpJOHPHQWDLUH &HWWH OLPLWH PH VHPEOH GLIILFLOH j FRQWRXUQHU (Q UHYDQFKH OpWXGH
GLPSDFW GRLW FRPSRUWHU XQH OLVWH GHV PHVXUHV GDSSOLFDWLRQ 6L OH 3DUOHPHQW VH VDLVLW GX
FRQWU{OHGHVpWXGHVGLPSDFWGHVSURMHWVGHORLSHXW-tre pourrait-il obtenir des explications
SOXV VXEVWDQWLHOOHV VXU FHV GpFUHWV GDSSOLFDWLRQ WRXW HQ UHVSHFWDQW OD VpSDUDWLRQ GHV
pouvoirs.
-HQ YLHQV DX[ DEURJDWLRQV GH WH[WHV 6HORQ PRL OD UqJOH EULWDQQLTXH GX one in,
two out est davantage une rgle de simplification pour OHV HQWUHSULVHV TXXQH UqJOH GH
gestion du flux normatif LOVDJLWGDYDQWDJHGHUDLVRQQHUHQWHUPHVGHFRWVHWGHFKDUJHV
SRXUXQHHQWUHSULVHTXHQWHUPHVGHQRPEUHGHQRUPHVH[LVWDQWHV
En revanche, la rgle du one in, one out existe aussi bien en droit britannique
TXHQ GURLW IUDQoDLV /RUV GXQ FROORTXH TXL VHVW WHQX DX 6pQDW HQ GpFHPEUH GHUQLHU OH
VHFUpWDLUHJpQpUDOGX*RXYHUQHPHQWDH[SOLTXpTXLOGHYDLWGpVRUPDLVVXLYUHFHWWHUqJOHSRXU
OpODERUDWLRQGHVGpFUHWV : chaque dcret ajoutant une nouvelle rgle doit en supprimer une

232

DQFLHQQH /D UqJOH QH VLJQLILH SDV TXH QLPSRUWH TXHO WH[WH GRLYH GLVSDUDvWUH ORUVTXXQ
QRXYHDXHVWSXEOLpPDLVTXLOIDXWVXSSULPHUXQHUqJOHGRQWOHFRWVRFLDOpFRQRPLTXHRX
juridique est quivalent. L encore, il sHUDLWXWLOHGHGLVSRVHUGXQELODQGHFHWWHH[SpULHQFH
Permettez-PRLGHIDLUHGHX[DXWUHVREVHUYDWLRQVHQFHTXLFRQFHUQHFHWWHLGpHGXQH
abrogation mcanique GHVWH[WHV4XHOVTXHVRLHQWOHVUpVXOWDWVGHOH[SpULPHQWDWLRQTXL
a t faite au Royaume-8QL QRXEOLRQV SDV TXH OH GURLW IUDQoDLV TXL IRUPH XQ V\VWqPH
complet et cohrent, est diffrent du droit britannique, o les textes sont davantage cibls sur
GHV FDV SUpFLV (Q )UDQFH ODEURJDWLRQ GXQ WH[WH SHXW GRQF DYRLU GHV HIIHWV VXU GDXWUHV
branFKHVGXGURLW1RXVGHYRQVJDUGHUjOHVSULWFHWWHGLIIpUHQFHFXOWXUHOOH
&HWWHLGpHGDEURJDWLRQHVWDXGHPHXUDQWXQYLHX[SURMHWTXLGDWHTXDVLPHQWGHOD
promulgation du code civil. Des abrogations en nombre ont eu lieu ces dernires annes dans
le cadrHGHVORLVGHVLPSOLILFDWLRQ/HULVTXHHVWGHFRPPHWWUHGHVPDODGUHVVHV&HVWDLQVL
TXHODUWLFOHGXFRGHGHFRPPHUFHDpWpDEURJpSDUHUUHXURXTXHVDQVODYLVGX&RQVHLO
GeWDW XQH SURSRVLWLRQ ORL GH VLPSOLILFDWLRQ DXUDLW SX UpWDEOLU OD SHLQH GHs fers sur les
navires  &HVW DLQVL HQFRUH TXH ORUGRQQDQFH GH OD PDULQH TXH OHV MXULGLFWLRQV IUDQoDLVHV
XWLOLVDLHQW HQFRUH UpJXOLqUHPHQW D pWp DEURJpH GDQV OH FDGUH GXQH FRGLILFDWLRQ j GURLW
FRQVWDQW%UHIODEURJDWLRQDXWRPDWLTXHSRVHSDUIRLVSOXVGHSUREOqPHVTXHOOHQHQUpVRXW
,OFRQYLHQWGRQFGHVDVVXUHUTXHOHVWH[WHVDQFLHQVRQWpWpSDVVpVHQUHYXHSRXUGpWHFWHUOHV
GLVSRVLWLRQV GHYHQXHV LQFRPSDWLEOHV RX GpVXqWHV ORUVTXRQ PRGLILH XQH PDWLqUH &HOD SHXW
SDVVHUSDUOpWXGHGLPSDFWSXLVTXHFHlle-ci est cense dresser cette liste.
'HV SURJUqV FRQVLGpUDEOHV RQW pWp DFFRPSOLV HQ PDWLqUH GpWXGHV GLPSDFW : la
TXDOLWpHWOHFRQWHQXGHFHVGHUQLqUHVQRQWSOXVULHQjYRLUDYHFOHVWHQWDWLYHVTXLDYDLHQWpWp
faites avant la rvision constitutionnellHGH,OHVWFHSHQGDQWXQSHXLQTXLpWDQWTXLODLW
fallu en passer par la contrainte pour que ces tudes deviennent une pratique : votre
SURJUDPPHGHVLPSOLILFDWLRQGHODORLQHVDXUDLWrWUHPLVHQXYUHXQLTXHPHQWSDUOHUHFRXUV
la modification de la rgle suprieure.
6L OH UpVXOWDW HVW Oj OHV pWXGHV GLPSDFW UHVWHQW SDUIRLV GpFHYDQWHV VXU OpWXGH
GRSWLRQVVLQWpUHVVDQWGDYDQWDJHDX[RSWLRQVGHIRQGTXDX[RSWLRQVQRUPDWLYHV savoir
la rponse la question : est-ce YUDLPHQWXQHORLTXLOIDut ? . Nombre de rapports rcents,
GRQWOpWXGHDQQXHOOHGX&RQVHLOGeWDWGHHVWLPHQWTXHFHWWHpWXGHGRSWLRQVGHYUDLW
GDYDQWDJHHQYLVDJHUOHUHFRXUVjXQGURLWVRXSOH-REVHUYHTXHQRXVQDXURQVSDVPRLQVGH
droit pour autant. Certes, nous aurons moins de lois, mais le droit sera plus instable, plus
ractif et plus difficile connatre. Le droit souple est tout le contraire de la simplification de
la loi FHVWODFRPSOH[LWpMXULGLTXHGDQVFHTXHOOHDGHSOXVFRQWHPSRUDLQ
Vous vous interrogez VXU ORSSRUWXQLWp GH UpDOLVHU XQH pWXGH GLPSDFW SRXU OHV
QRUPHV GRULJLQH SDUOHPHQWDLUH j VDYRLU OHV DPHQGHPHQWV HW OHV SURSRVLWLRQV GH ORL /H
SULQFLSHYDGHVRL6LOpWXGHGLPSDFWQpWDLWTXXQRXWLOGHFRQWU{OHGX*RXYHUQHPHQWSDU
le Parlement, ellH QH VHUDLW SDV DGDSWpH j OD QRUPH GRULJLQH SDUOHPHQWDLUH 0DLV GDQV OD
PHVXUHRHOOHQHVWSDVVHXOHPHQWXQRXWLOGHFRQWU{OHPDLVDXVVLXQRXWLOGHTXDOLWpGHOD
QRUPHLOQ\DSDVOLHXGHGLVWLQJXHUVHORQTXHODQRUPHHVWGRULJLQHJRXYHUQHPHQWDOHRu
SDUOHPHQWDLUH&HQHVHUDLWGDLOOHXUVSDVODSUHPLqUHIRLVTXXQRXWLOFRQVWLWXWLRQQHOSHQVp
dans une logique de sparation des pouvoirs serait ensuite utilis dans une logique de qualit
normative.
/D GLIILFXOWp HVW GRUGUH SUDWLTXH /H 5qJOHPHQW GH OAssemble nationale prvoit
FHWWHSRVVLELOLWpGHUpDOLVHUGHV pWXGHVGLPSDFW VXUGHVDPHQGHPHQWV ; tonnamment, il ne
dit rien des propositions de loi. Sans doute en raison du problme de temps qui se poserait
DORUV OH UDSSRUW GX FRPLWp GpYDOXDWLRQ HW Ge contrle (CEC) de 2009 ne se montre gure

233

HQWKRXVLDVWHjFHWWHLGpH,OHVWSOXVpWRQQDQWTXDSUqVDYRLUpWpDERUGpSDUOHSUHPLHUUDSSRUW
GX&(&OHVXMHWGLVSDUDLVVHHQVXLWHGHVHVSUpRFFXSDWLRQVjFHTXHMDLFUXYRLUDORUVPrPH
TXLO SUpFRQLVDLW XQ suivi et un nouveau rapport dans les six mois pour faire voluer les
FULWqUHVGHFRQWU{OHGHVpWXGHVGLPSDFW
&HVWGRQFXQSUREOqPHGRUJDQLVDWLRQPDWpULHOOH/HVPLVVLRQVGLQIRUPDWLRQIRQW
XQWUDYDLOpTXLYDOHQWjFHOXLGXQHpWXGHGLPSDFWPDLVOHXU caractre ponctuel fait obstacle
une spcialisation en la matire. Quant au CEC, il ne dispose sans doute pas de moyens
suffisants. Il semble donc prfrable de mettre en place une structure ad hoc, avec des
personnels statisticiens, conomistes, etc. spcialement recruts pour raliser ces tudes
GLPSDFW 'DQV OHQVHPEOH OHV RXWLOV H[LVWHQW ,O UHVWH j VHQ VDLVLU HW j WUDYDLOOHU VXU OHXU
application effective.
0PH &pOLD =RO\QVNL SURIHVVHXUH GH GURLW j O8QLYHUVLWp GH 9HUVDLOOHV SaintQuentin-en-Yvelines. -HYRXVUHPHUFLHGDYRLULQYLWpOHVXQLYHUVLWDLUHVTXHQRXVVRPPHVj
VH[SULPHUVXUXQVXMHWTXLQRXVSDVVLRQQHDXWDQWTXLOQRXVLQTXLqWHFHOXLGHODJHVWLRQGX
flux normatif.
Compte tenu des propos qui ont t tenus par ma collgue, je me concentrerai sur un
point spcifique : la transposition des directives europennes dans notre ordre juridique
LQWHUQH &HOD PH FRQGXLUD QpDQPRLQV j pYRTXHU GDXWUHV SRLQWV GDQV OD PHVXUH R FHWWH
transposition est un rvlateur de problmatiqXHVDFWXHOOHVTXHORQUHQFRQWUHjORFFDVLRQGH
la confection de la norme.
/DWUDQVSRVLWLRQHVWORSpUDWLRQSDUODTXHOOHOeWDWPHPEUHDGDSWHVRQGURLWQDWLRQDO
dans le dlai qui lui est imparti par la directive, afin de faire produire aux dispositions
communautaires leur plein effet dans son ordre interne. La France est tenue par une
REOLJDWLRQ GH WUDQVSRVLWLRQ FRQIRUPH GRQW OLQH[pFXWLRQ SHXW rWUH VDQFWLRQQpH ORXUGHPHQW
SDUOD&RXUGHMXVWLFHGHO8QLRQHXURSpHQQHHWTXLIDLWGpVRUPDLVOREMHWGXQFRQWrle du
Conseil constitutionnel.
/RSpUDWLRQ GH WUDQVSRVLWLRQ VRXOqYH SRXUWDQW GH QRPEUHXVHV GLIILFXOWpV HQ OLHQ
DYHF OH VXMHW TXL QRXV RFFXSH /HV GLIILFXOWpV DX QLYHDX HXURSpHQ UpVLGHQW GDERUG GDQV
ODQDO\VH TXL QHVW SDVWRXMRXUVpYLGHQWH du degr de libert laiss aux tats membres,
celui-FLSRXYDQWYDULHUGXQHGLUHFWLYHjODXWUHYRLUHDXVHLQPrPHGXQHGLUHFWLYHFHTXLD
XQH LQFLGHQFH VXU OpWHQGXH GHV GLVSRVLWLRQV j DGRSWHU (OOHV QDLVVHQW DXVVL GX FDUDFWqUH
pYROXWLIGHOKDUPRQLVDWLRQUpDOLVpHSDUODGLUHFWLYHTXLSHXWrWUHODFDXVHGHOLQWHPSpUDQFH
GH OD ORL &HWWH pYROXWLRQ SHXW GDERUG UpVXOWHU GH OpYROXWLRQ GHV GLUHFWLYHV HOOHV-mmes,
celles-FLpWDQWVRXPLVHVjXQHFODXVHGHUpYLVLRQTXLSDUWLFLSHGXSURFHVVXVGpYDOXDWLRQ ex
post, lHTXHORFFXSHXQHSODFHFHQWUDOHDXVHLQGXGURLWGHO8QLRQHXURSpHQQH(QHIIHWOHV
DXWRULWpVGHO8QLRQRUJDQLVHQWXQVXLYLGHOHIILFDFLWpGXWH[WHWRXWDXORQJGHVDYLHex ante
et ex postDILQGHJDUDQWLUODGpTXDWLRQGXWH[WHDX[EHVRLQVGHVSDUWLes prenantes.
Cette volution peut aussi rsulter de la jurisprudence de la Cour de justice de
O8QLRQ HXURSpHQQH dont les arrts ont un effet erga omnes. Ses dcisions doivent donc
rWUHSULVHVHQFRPSWHORUVGHODWUDQVSRVLWLRQGXWH[WHDXTXHOHOOHVVLQWqJUHQWjOLPDJHGHV
lois interprtatives. Mais la difficult vient surtout du fait que ces dcisions interviennent la
SOXSDUWGXWHPSVDSUqVODWUDQVSRVLWLRQGHODGLUHFWLYH6LQWpJUDQWDXWH[WHHOOHVYRQWDORUVOH
FRPSOpWHU UpDOLVHU XQH VRUWH GKDrmonisation prtorienne marche force, ce qui peut
remettre en cause a posteriori la bonne excution de notre obligation de transposition, donc
imposer une rforme de la loi de transposition. Il y a donc un travail de veille effectuer
pour garantir la WUDQVSRVLWLRQGHODGLUHFWLYHODTXHOOHQHVWSDVXQHRSpUDWLRQGpILQLWLYHPDLV
GLDFKURQLTXHTXLULVTXHGHQRXUULUOLQWHPSpUDQFHGHODORL

234

La transposition suscite galement des difficults au niveau du droit interne. Un


risque de sur-transposition a ainsi t observ et critiqu  QRWDPPHQW GDQV OpWXGH
DQQXHOOH GX &RQVHLO GeWDW GH  ,O D pWp VRXOLJQp TXH VL OD WUDQVSRVLWLRQ GRLW rWUH
complte, elle ne doit pas pour autant conduire adopter des mesures nationales
supplmentaires qui viendraienW DORXUGLU GDXWDQW QRWUH FKDUJH QRUPDWLYH VRXV SUpWH[WH GH
transposer la directive.
3OXV HQFRUH OD WUDQVSRVLWLRQ H[SUHVVH QHVW SDV H[LJpH ORUVTXHOOH HVW HQ TXHOTXH
VRUWH SUppWDEOLH FHVW--dire lorsque notre droit interne est dj conforme la directive,
notamment lorsque la solution nationale a inspir les autorits europennes nous en avons
de nombreux exemples. Ici, le recours la loi peut certainement tre limit.
Comment procder ? On peut appliquer un test de nouveaut la disposition
communautaire pour valuer la ncessit de modifier le droit national prexistant et dans
ODIILUPDWLYH dterminer la mesure de cette modification. La disposition devrait donc tre
VRXPLVH j XQ SULQFLSH GH QpFHVVLWp FHVW--GLUH QrWUH DGRSWpH TXH VL Hlle est impose par
notre obligation de transposition conforme, et uniquement dans cette mesure.
Au-del, on pourrait encourager une obligation de motivation renforce lors du
GpS{W GX SURMHW RX GH VRQ H[DPHQ ORUVTXH ORQ GpSDVVH FHWWH H[LJHQFH GH UHVSHFW de nos
REOLJDWLRQVFRPPXQDXWDLUHV&HVWODSURSRVLWLRQGXUDSSRUWGH00$ODLQ/DPEHUWHW-HDQ&ODXGH%RXODUGVXUODOXWWHFRQWUHOLQIODWLRQQRUPDWLYHTXLSHXWrWUHODUJHPHQWDSSURXYpH
/RSpUDWLRQ GH WUDQVSRVLWLRQ HVW GHV SOXV GpOLFDWHV ORUVTXLO VDJit de bien valuer
QRV REOLJDWLRQV FRPPXQDXWDLUHV SRXU V\ FRQIRUPHU 6XU FH SRLQW RQ D REVHUYp XQH YUDLH
prise de conscience ces dernires annes  OD )UDQFH QHVW SOXV OH cancre  GH O(XURSH
Mais dans le mme temps, on peut regretter que le processus de transposition connaisse les
PrPHV WUDYHUV TXH FHX[ TXL YLFLHQW OpODERUDWLRQ GHV ORLV &HVW WRXW QDWXUHO SXLVTXH
ORSpUDWLRQGHWUDQVSRVLWLRQFRPSRUWHGHX[YROHWV : un volet communautaire respecter nos
obligations communautaires de transposition conforme mais aussi un volet national. Cela
VLJQLILHTXHOLQWpJUDWLRQGHODGLUHFWLYHQHGRLWSDVUHPHWWUHHQFDXVHODFRKpUHQFHGHQRWUH
GURLW QDWLRQDO WDQW GXQ SRLQW GH YXH LQVWLWXWLRQQHO TXH GXQ SRLQW GH YXH VXEVWDQWLHO (Q
TXHOTXH VRUWH ORSpUDWLon de transposition doit elle aussi conduire respecter les
prescriptions du mieux lgifrer  &HVW j FHWWH GRXEOH FRQGLWLRQ TXH ORQ SHXW SURSRVHU
une mthode de transposition rationnelle.
&RPSWHWHQXGHOHQVHPEOHGHFHVGLIILFXOWpVHWGHFHVREMHFWLIVRQSHXWVLQWHUURJHU
sur les solutions prconiser pour parvenir cette gestion rationnelle du flux normatif lors
de la transposition des directives. Ces solutions ont t recherches de longue date, tant au
QLYHDX HXURSpHQ TXDX QLYHDX GH QRWUH GURit interne. Je citerai plus particulirement celle
TXDSUpFRQLVpHOH&RQVHLOGtat dans son tude de 2006, et qui pourrait tre la devise du
mieux transposer : anticiper, adapter et simplifier.
'DQV OD PHVXUH R YRWUH PLVVLRQ GLQIRUPDWLRQ SRUWH VXU la simplification
lgislative, sur la gestion du flux normatif, je me concentrerai sur une srie de questions
poses par la transposition ces gards.
Dans quelle mesure est-il ncessaire de recourir la loi pour transposer une
directive ? Si le recours jODORLHVWQpFHVVDLUHRXVRXKDLWDEOHFRPPHQWpYLWHUOHQIOXUHGHV
textes, ou encore leur instabilit ?
/HFKRL[GHOLQVWUXPHQWGHWUDQVSRVLWLRQSDUXQeWDW PHPEUHGpSHQGjODIRLVGX
UHVSHFWGXQSULQFLSHGHIIHFWLYLWpGXGURLWGHO8QLRQHXURSpHQQHHW du respect du principe

235

GDXWRQRPLH SURFpGXUDOH UHFRQQX DX[ eWDWV PHPEUHV &HOD UHYLHQW j GLUH TXH ODFWH GH
WUDQVSRVLWLRQGRLWSUHQGUHODPrPHIRUPHTXXQDFWHTXLVHUDLWDGRSWpHQGURLWLQWHUQHSRXU
atteindre le mme objectif. Il existe ici un paralllisPHGHVIRUPHVTXLVLPSRVHDX[DXWRULWpV
nationales en charge de la transposition.
Comment viter trop de lois ?
7RXWGDERUGFRPPHQWpYLWHUXQHHQIOXUHH[FHVVLYHGHODORL ",OIDXWpYLWHUODMRXW
inutile de dispositions aux projets de textes, notamment lorsque le lgislateur national est
tenu une harmonisation maximale FHVW--dire un copier-coller des dispositions
FRPPXQDXWDLUHV,OVDJLWGRQFGpYLWHUOD sur-transposition , peut-tre en recourant une
transposition plat je vais y revenir.
,O FRQYLHQW pJDOHPHQW GpYLWHU GH PXOWLSOHV UpIRUPHV GHV bgaiements
OpJLVODWLIV XQH FRQVWDQWH UHPLVH GH ORXYUDJH VXU OH PpWLHU /HV UpWLFHQFHV j WUDQVSRVHU
certaines dispositions europennes donnent parfois lieu des corrections en srie. Un
exemple rcent concerne les pratiques commerciales dloyales, dsormais sanctionnes par
le code de la consommation. La directive de 2005 a t transpose par la loi pour le
dveloppement de la concurrence au service des consommateurs, dite loi Chatel , par la
ORL GH PRGHUQLVDWLRQ GH OpFRQRPLH /0(  GX  aot 2008, par la loi de simplification et
GDPpOLRUDWLRQGHODTXDOLWpGXGURLWGX mai 2011, et le sera encore demain par le projet
de loi sur la consommation ou projet de loi Hamon . Cette harmonisation petits pas
IDYRULVHXQSKpQRPqQHGHQIOXUHGHODORL
Pour atteindre nos objectifs, il faut anticiper les difficults que suscitera la
transposition de la directive au regard de notre droit positif ds la ngociation des directives.
Nous devons repenser le traitement de la question europenne pour aller plus loin dans
ODGDSWDWLRQ GH QRV SURFpGXUHV DGPLQLVWUDWLYHV HW SDUOHPHQWDLUHV ,O IDXW HQ WRXW FDV pYLWHU
que des arbitrages soient rendus davantage sur un fondement politique que conformment au
respect du principe de primaut du droit communautaire. Certains moyens peuvent assurer
FHWWH SULPDXWp 2Q SHXW SDU H[HPSOH LPSRVHU XQH VRUWH GHIIHW FOLTXHW pFDUWDQW WRXWH
SURSRVLWLRQGHWH[WHFRQWUDLUHDXGURLWGHO8QLRQRXUHPHWWDQWHQFDXVHVon effet utile.
Au-del de cette procdure propre au droit interne, il faut amliorer le dialogue
entre la Commission europenne et le lgislateur national. Il existe dj des changes
informels, mais il faut aller plus avant dans ce dialogue, voire recommander une diffusion
plus large de communications ou de guidelines par la Commission, mme si son
LQWHUSUpWDWLRQGHVWH[WHVQHVWSDVDXWKHQWLTXH VHXOHOLQWHUSUpWDWLRQSDUOD&RXUGHMXVWLFH
GHO8QLRQHXURSpHQQHOHVW
Peut-on transposer en vitant la loi ? Comment le mieux lgifrer peut-il se
muer en moins lgifrer " ,O HVW GDERUG SRVVLEOH GHQFRXUDJHU OH UHFRXUV DX[
RUGRQQDQFHV TXL SHUPHW QRQ VHXOHPHQW GpYLWHU GH YLROHU OHV GpODLV GH WUDQVSRVLWLRQ qui
sont impratifs HQFDVGXUJHQFHPDLVDXVVLGpYLWHUGDMRXWHUGHVGLVSRVLWLRQVDXWH[WH
QRWDPPHQW VRXV OD SUHVVLRQ GHV JURXSHV GLQWpUrWV lors des dbats parlementaires, en
procdant une transposition plat . Dans la mesure o le copier-coller QH[LJHSDV
OLQWHUYHQWLRQGX Parlement sur le fond, on pourrait encourager ce recours. Toutefois, il ne
GRLW SDV rWUH JpQpUDOLVp QRWDPPHQW ORUVTXH OD WUDQVSRVLWLRQ GXQH GLUHFWLYH SHUPHW GH
rformer plus gnralement la matire. En matire de droit de la consommation, par
exemple, le WH[WHGHORLGHPHXUHOLQVWUXPHQWLGRLQHSRXUDVVXUHUODFRKpUHQFHGHQRWUHGURLW
interne.

236

6DQVSDVVHURXWUHODORLHQUHFRXUDQWHQEORFjORUGRQQDQFHRQSHXWDXVVLWHVWHUGHV
systmes de lgislation par tapes ou par strates successives. On peut ainsi rserver
ORUGRQQDQFH OHV GLVSRVLWLRQV TXL VRQW VRXPLVHV j XQ GHJUp GKDUPRQLVDWLRQ PD[LPDOH
SXLVTXH OH GpEDW SDUOHPHQWDLUH QHVW SDV SRVVLEOH HW j OD ORL pour laquelle le rle du
Parlement est fondamental les dispositions qui poursuivent une harmonisation minimale.
2Q SHXW pJDOHPHQW VLQVSLUHU GH OD PpWKRGH DOOHPDQGH GH OD double corbeille .
Deux lois viendraient ici se succder. Une premire, adopte rapidement, viserait satisfaire
nos obligations communautaires de transposition dans les dlais HOOHLQWpJUHUDLWOHQVHPEOH
GHV GLVSRVLWLRQV GKDUPRQLVDWLRQ PD[LPDOH 8QH VHFRQGH pODERUpH GDQV OD GXUpH DYHF XQ
dbat parlementaire nourri, permettrait de transposer les dispositions suivant une
harmonisation a minima tout en respectant la cohrence de notre droit interne.
Parmi les mthodes de transposition par tapes, on peut encore envisager de
recourir la loi au droit dur pour dfinir les seuls objectifs, puis au droit mou
SRXU GpWHUPLQHU OHV PR\HQV GDWWHLQGUH FHX[-ci. Ce sont les prescriptions de la
rglementation affte DXMRXUGKXLSU{QpHSDUOD&RPPLVVLRQHXURSpHQQHTXLFRQVWLWXH
pour certains le droit intelligent TXLSHUPHWGpYLWHUXQHLQVWDELOLWpGXWH[WH puisque les
normes techniques voluent avec le droit mou RX HQFRUH XQ WH[WH WURS EDYDUG &HVW
peut-rWUH GDQV FH PDLOODJH GHV GLIIpUHQWHV WH[WXUHV GH QRUPDWLYLWp TXLO IDXW GpVRUPDLV
rechercher une gestion du flux normatif plus rationnelle.
Pour conclure, il est possible de retenir une mthode idoine de transposition des
directives qui permette tout la fois de respecter nos obligations communautaires et
GDVVXUHUODFRKpUHQFHGHQRWUHRUGUHMXULGLTXH1pDQPRLQVLOIDXWSUHQGUHFRQVFLHQFHDYHF
le Professeur Jacques Chevallier, de la dimension mythique de ce mieux transposer et de
ce mieux lgifrer . La lutte contre les maux de notre production normative nationale ou
FRPPXQDXWDLUHUHSRVHHQHIIHWVXUXQHSDUWGLOOXVLRQSXLVTXHODORLQHVWSDVVHXOHPHQWXQ
instrument technique auquel on peut appliquer des mthodes rationnelles, mais aussi et
VXUWRXW OD WUDGXFWLRQ GHQMHX[ pFRQRPLTXHV SROLWLTXHV HW VRFLpWDX[ GRQW LO IDXW SUHQGUH OD
mesure. Que veut-on faire de la loi " &HVW XQH TXHVWLRQ j ODTXHOOH VHXO OH OpJLVODWHXU SHXW
rpondre ce qui ncessite parfois un certain courage.
M me Ccile Untermaier. 3RXU DPpOLRUHU OLQWHOOLJLELOLWp GH OD ORL HW GRQF VD
qualit, ne serait-il pas intressant de publier la suite du texte la liste des personnes
auditionnes et de signaler, le cas chant, les points de divergence majeurs ?
Par ailleurs, je suis frappe par le fait que les lois sont illisibles. Ne pourrait-on
OLPLWHUOHVUHQYRLVjGDXWUHVWH[WHVDILQGHUHQGUHOHXUOHFWXUHSOXVDJUpDEOH ? Voyez-vous
des obstacles cette suggestion ?
En ce qui concerne la transposition, je vous rejoins sur la ncessit de la
simplification. Le systme de la double corbeille , qui consiste transposer a minima tout
en se donnant le temps de mettre notre droit en cohrence, me semble intressant cet gard.
M me la prsidente Laure de La Raudire. Le rapporteur et moi-mme estimons
aussi que ce systme de la double corbeille pourrait constituer une piste intressante pour
faire voluer nos pratiques.
Je retiens par ailleurs GH YRWUH H[SRVp PDGDPH 'HXPLHU TXXQe plus grande
H[LJHQFH VXU OHV pWXGHV GLPSDFW QRXV SHUPHWWUDLW GH UpSRQGUH j ERQ QRPEUH GH QRV
interrogations.

237

M . Thierry M andon, rapporteur. 2XWUHOLGpHGHSUpFLVHUOHVGpODLVGHUpGDFWLRQ


GHVGpFUHWVGDSSOLFDWLRQGDQVOpWXGHGLPSDFW XQHDXWUHRSWLRQQRXVDpWpVXJJpUpH : elle
consisterait inclure dans chaque projet de loi un article additionnel disposant que la loi
deviendra caduque si OHV GpFUHWV GDSSOLFDWLRQ QH VRQW SDV SXEOLpV VRXV GRX]H RX GL[-huit
mois.
En ce qui concerne la double corbeille , quel est le dlai entre le premier et le
deuxime texte de loi "1\ D-t-LODXFXQ ULVTXHMXULGLTXHGDQVOLQWHUYDOOH "'DXWUHSDUWLO
PH VHPEODLW DYRLU HQWHQGX TXH FHUWDLQV SD\V IDLVDLHQW OH FKRL[ GXQH VHXOH corbeille .
Pouvez-vous me le confirmer ?
M me Pascale Deumier. 6DJLVVDQW GH OLQWHOOLJLELOLWp GH OD ORL PDGDPH
Untermaier, il me semble difficilement envisageable de publier la liste des personnes
auditionnes la suite du texte de la loi : cela risque de crer un doute sur la valeur juridique
GH FHV pOpPHQWV GLQIRUPDWLRQ QRWDPPHQW DX PRPHQW GH OLQWHUSUpWDWLRQ /D SUDWLTXH
actuelle savoir la mise en ligne de tous les documents qui accompagnent le projet,
QRWDPPHQW OpWXGH GLPSDFW VXU OHV VLWHV ,QWHUQHW GHV GHX[ $VVHPEOpHV est sans doute
prfrable. Cette mise disposition est indispensable jOKHXUHRORQSUDWLTXHGHSOXVHQ
plus la transparence, il est important de savoir quels intrts ont t entendus. Le rapport
GLQIRUPDWLRQ GH 00 &ODXGH *RDVJXHQ HW -HDQ 0DOORW VXU OHV FULWqUHV GH FRQWU{OH GHV
pWXGHVGLPSDFWUHOHYDLWGDLOOHXUVTXHFHVpWXGHVPHQWLRQQHQWVRXYHQWjSHLQHOHVSHUVRQQHV
qui ont t auditionneV HW OHV SRVLWLRQV TXHOOHV RQW GpIHQGXHV ,O FRQYLHQW GRQF GH
dvelopper davantage ces lments.
/D OLPLWDWLRQ GHV UHQYRLV j GDXWUHV WH[WHV ILJXUH GpMj SDUPL OHV SUpFRQLVDWLRQV GX
guide de lgistique. Le Conseil constitutionnel a dj censur un article GHORLDXPRWLITXLO
tait trop complexe : il faisait plusieurs pages et procdait presque exclusivement par
UHQYRLV&HWDUWLFOHTXLFRQFHUQDLWOHVQLFKHVILVFDOHVGLVSRVDLWTXHORQQHSRXYDLWGpSDVVHU
XQ FHUWDLQ SRXUFHQWDJH GDEDWWHPHQW HQ FXPXODQW Giffrentes niches fiscales. Il renvoyait
GRQFjFKDTXHWH[WHUHODWLIjFHVQLFKHV0DLVVLORQQHSHXWSURFpGHUSDUUHQYRLSRXUFHW\SH
GHGLVSRVLWLRQVFHODVLJQLILHTXHODUWLFOHGRLWUHSUHQGUHLQWpJUDOHPHQWFKDFXQGHVGLVSRVLWLIV
en question ce qui ne va pas sans poser problme.
M me la prsidente Laure de La Raudire. &HVWLFLTXXQDYLVGX&RQVHLOGeWDW
SRXUUDLW rWUH LQWpUHVVDQW (Q OpWDW DFWXHO GHV FKRVHV QRXV DXWUHV SDUOHPHQWDLUHV VRPPHV
REOLJpV GH IDLUH FRQILDQFH j OH[SRVp GHV PRWLIV 'LVSRVHU GH ODYLV GX &RQVHLO GeWDW
rendrait sans doute les articles du texte plus lisibles . Tout au moins, cela nous donnerait
GDYDQWDJHFRQILDQFHGDQVOH[SRVpGHVPRWLIV
M . le rapporteur. -HFURLVVDYRLUTXHFHWWHTXHVWLRQIDLWOREMHWGXQHTXHUHOOHGH
doctrine.
M me Pascale Deumier. /HVpWXGHVGLPSDFWVRQWOH point de contrle de tout ce
qui peut tre fait en matire de simplification lgislative. Tout ce qui vous intresse
H[SOLFDWLRQVDEURJDWLRQVGpFUHWVGDSSOLFDWLRQ est en effet cens y figurer. En outre, elles
peuvent maintenant tre contrles par les parlementaires. Non seulement elles permettent de
centraliser toutes les proccupations de qualit normative, mais elles constituent aussi un
PR\HQGHFRQWU{OH&HVWGRQFOHSRLQWGDQFrage le plus important.
4XDQWjOLGpHGHSUpYRLUXQHFDGXFLWpGHODORLVLOHVGpFUHWVGDSSOLFDWLRQQHVRQW
pas publis dans un certain dlai, elle rappelle une disposition de la loi de simplification de
2011 : toutes les dispositions de loi qui attendaiHQWOHXUVGpFUHWVGDSSOLFDWLRQGHSXLVSOXVGH
WURLVDQVHWSRXUOHVTXHOOHVOHVPLQLVWqUHVRQWFRQILUPpTXLOVQHOHVSUHQGUDLHQWSDVRQWpWp

238

DEURJpHV&HVWGRQFODORLTXLDGLVSDUXIDXWHGHGpFUHWVGDSSOLFDWLRQ'XSRLQWGHYXHGHOD
scurit juridique FHVW SUpIpUDEOH SRXU OH FLWR\HQ  LO HVW HQ HIIHW LQFRPSUpKHQVLEOH TXXQ
WH[WHGHORLTXLDpWpYRWpQHVRLWSDVDSSOLTXp(QUHYDQFKHFHODDOLQFRQYpQLHQWGHODLVVHU
HQWUHOHVPDLQVGHODXWHXUGHVGpFUHWVGDSSOLFDWLRQOHSRXYRLUGHGpFLGHUGXVRUWde la loi.
M . le rapporteur. ,OODGpMj
M me Pascale Deumier. Certes. Mais tant que la loi est l, il est tout de mme
FHQVpSUHQGUHOHVGpFUHWVGDSSOLFDWLRQ ODVDLVLQHGX&RQVHLOGeWDWSHXWGRQFFRQVWLWXHUXQ
moyen de pression. Si le texte de loi disSDUDvWLOQ\DSOXVGHSUHVVLRQSRVVLEOH donc plus
GREOLJDWLRQ
M me la prsidente Laure de La Raudire. On peut prvoir un dlai dans lequel
OHVGpSXWpVRXOHVVpQDWHXUVSRXUUDLHQWVDLVLUOH&RQVHLOGeWDWSRXUGHPDQGHUODSXEOLFDWLRQ
GHVGpFUHWVGDSplication SRXYRLUTXLOVXWLOLVHQWWUqVUDUHPHQW&HODUHQGUDLWODSURFpGXUH
complte.
3HUVRQQHOOHPHQW MDL HX GX PDO j IDLUH VXSSULPHU ODUWLFOH  GH OD ORL SRXU OD
FRQILDQFH GDQV OpFRQRPLH QXPpULTXH /&(1  adopte en 2004 dont le dcret
GDSSOLFDWLRQQDYDLWSDVpWpSULV-DLGQpJRFLHUDYHFOH*RXYHUQHPHQWSRXUREWHQLUTXLO
VHQUHPHWWHjODVDJHVVHGHO$VVHPEOpH ODGPLQLVWUDWLRQTXLHVWLPDLWTXHODGLVSRVLWLRQHQ
question pourrait peut-tre servir un jour, ne voulait pas la supprimer.
QuRL TXLO HQ VRLW MH VXLV GDFFRUG DYHF YRXV : nous devons garder le pouvoir de
VDLVLUOH&RQVHLOGeWDW
M me Clia Zolynski. En ce qui concerne la publication de la liste des personnes
HQWHQGXHV GDQVOHFDGUH GHOpODERUDWLRQGXQSURMHWGHORLQRXVSRXYons nous inspirer du
GURLWGHO8QLRQHXURSpHQQH : la Commission europenne publie en effet sur son site Internet
les rsultats de ses consultations ; on retrouve l la pratique du sourcing, trs en vogue dans
les contributions collaboratives sur Internet, qui participe du mcanisme de la dmocratie
SDUWLFLSDWLYH 2Q FRQQDvW DXVVL OHV ULVTXHV GLQVWUXPHQWDOLVDWLRQ HW GH JHVWLRQ VWDWLVWLTXH GH
FHVUpSRQVHV&HVWGRQFVRXVFHVUpVHUYHVTXHFHWH[HPSOHSHXWrWUHSULVHQFRPSWH
-HQ YLHQV DX[ GpODLV GH WUDQVSosition dfinitive et au mcanisme de la double
corbeille . Il semble en effet ncessaire de recourir une seule corbeille ou une seule
loi ORUVTXH OD GLUHFWLYH SRXUVXLW XQ REMHFWLI GKDUPRQLVDWLRQ PD[LPDOH 'DQV FH FDV
DXFXQH OLEHUWp QHVW ODisse aux tats membres on est presque plus proche du rglement
que de la directive. On a ici tout intrt transposer plat . La plupart des tats membres
RQW GDLOOHXUV UHFRXUV j FHWWH WUDQVSRVLWLRQ mcanique , qui vite des gesticulations
inutiles et une perte de temps.
En revanche, la double corbeille peut tre fort utile lorsque la directive poursuit
GDQVVRQHQVHPEOHXQREMHFWLIGKDUPRQLVDWLRQPLQLPDOH ne dfinissant que les objectifs
atteindre, laissant toute libert aux tats PHPEUHV TXDQW DX[ PR\HQV G\ SDUYHQLU ou
ORUVTXHOOH HVW binaire , certaines dispositions limitant strictement la libert des Etats
PHPEUHV HW GDXWUHV OHXU ODLVVDQW XQH JUDQGH PDUJH GH OLEHUWp (Q FH FDV RQ SRXUUDLW
commencer par transposer plat  WRXWHV OHV GLVSRVLWLRQV GKDUPRQLVDWLRQ PD[LPDOH
ventuellement en recourant aux ordonnances, puis transposer les objectifs fixs par la
directive TXLVLPSRVHQW&HX[-ci pourraient tre complts par la suite dans la deuxime
corbeille . Cela laisserait le temps de rflchir au meilleur moyen seconde loi ou recours
au droit mou de transposer. Cela permettrait de prendre en compte les ventuelles
LQWHUSUpWDWLRQVGHOD&RXUGHMXVWLFHGHO8QLRQHXURSpHQQH on pourrait mme solliciter une

239

iQWHUYHQWLRQSOXV UDSLGH GHVDSDUWVXUFHVTXHVWLRQVGLQWHUSUpWDWLRQYRLUHGHVDYLV VXUOHV


GLIILFXOWpV GLQWHUSUpWDWLRQ SUpJQDQWHV &HOD SHUPHWWUDLW DXVVL GH SUHQGUH HQ FRPSWH OHV
volutions de la technique. Je pense par exemple la transposition de la directive sur le
commerce lectronique qui date de 2000 par la loi LCEN que vous avez voque,
madame la prsidente. Les pratiques ayant beaucoup volu depuis cette date, nous sommes
en proie de vraies difficults. Une mise en cohrence a posteriori permettrait peut-tre
GDGDSWHU OHV SULQFLSHV GH OD GLUHFWLYH SRXU DWWHLQGUH DX PLHX[ OHV REMHFWLIV IL[pV &HVW FH
TXD IDLW O$OOHPDJQH DYHF OH V\VWqPH GH OD double corbeille . Elle a rform le droit
GDXWHXUHQGHX[WHPSVGDERUGHQWUDQVSRVDQWODGLUHFWLYHVXUOKDUPRQLVDWLRQGH
FHUWDLQVDVSHFWVGXGURLWGDXWHXUHWGHVGURLWVYRLVLQVGDQVODVRFLpWpGHOLQIRUPDWLRQSXLV
HQUpIRUPDQWOHGURLWGDXWHXU-HSRXUUDLYRXVIDLUHSDUYHQLUSOXVGHSUpFLVLRQVjFHVXMHWVL
vous le souhaitez.
Le ULVTXHGHGLVSDULWLRQH[LVWHELHQVUGDQVOLQWHUYDOOHPRQVLHXUOHUDSSRUWHXU,O
IDXW GRQF IDLUH SUHXYH GXQH YRORQWp SROLWLTXH IRUWH 0DLV QRXV GHYRQV DIILUPHU FHOOH-ci si
nous voulons la fois grer le flux normatif et assurer la cohrence de notre droit interne.
M . le rapporteur. Combien transposons-nous de directives chaque anne ?
M me la prsidente Laure de La Raudire. Beaucoup des textes que nous avons
adopts rcemment OH SURMHW GH ORL GDYHQLU SRXU ODJULFXOWXUH OH SURMHW GH ORL VXU OD
consommation comportaient des dispositions transposant des directives.
M me Clia Zolynski. En effet. Mais on peut aussi observer des wagons entiers
de transposition de directives par blocs.
M me Ccile Untermaier. Le rapporteur propose que la loi prvoie elle-mme
TXHOOH GHYLHQGUD FDGXTXH VL VHV GpFUHWV GDSSOLFDWLRQ QH VRQW SDV SULV GDQV XQ GpODL GH
douze ou dix-KXLWPRLV-HOHUHMRLQVVXUOREMHFWLI1pDQPRLQVMHFUDLQVTXHQRXVQHQRXV
tirions une balle dans le pied : dans cette hypothse, il suffirait en effet que le Gouvernement
UHIXVH GH SUHQGUH OHV GpFUHWV GDSSOLFDWLRQ SRXU TXH OD ORL GLVSDUDLVVH  OD UpIOH[LRQ MH
SHQVH TXH ODEURJDWLRQ GH OD ORL TXH OH OpJLVODWHXU D YRWpH QH SHXW rWUH DXWRPDWLTXH (Q
revanche, il faut pouvoir contraindre le pouvoir rglementaire  LO QHVW SDV QRUPDO TXLO
SXLVVH IDLUH REVWDFOH j ODSSOLFDWLRQ GH OD ORL 0LHX[ YDXW GRQF UHQIRUFHU QRWUH SRXYRLU GH
FRQWUDLQWH 3RXU PD SDUW MH VRXKDLWH TXH OHV GpFUHWV GDSSOLFDWLRQ VRLHQW SUpVHQWpV DYHF OH
projet de loi.
M . le rapporteur et M me la prsidente Laure de La Raudire. &H QHVW SDV
possible.
M me Pascale Deumier. Dans la mesure o le texte volue au cours de la
GLVFXVVLRQ SDUOHPHQWDLUH OHV GpFUHWV GDSSOLFDWLRQ QH SHXYHQW rWUH SUpSDUpV DYDQW TXLO QH
soit adopt.
M me Ccile Untermaier. Du moins pourrait-on avoir une ide de ce qui y figurera.
On ne peut tout renvoyer au dcret sans explication.
M me Clia Zolynski. Lors du travail de transposition, une rflexion est justement
mene dans les diffrents ministres et en interministriel sur les dispositions qui figureront
GDQVODORLHWVXUFHOOHVTXLUHOqYHURQWGXGpFUHW0rPHVLOHGpFUHWQHVWSDVSUpSDUpGDQVVRQ
LQWpJUDOLWpOHVVHQWLHOHVWGpMjSHQVp

240

M me la prsidente Laure de La Raudire. /pWXGH GLPSDFW SHXW IRXUnir des


lments.
M . le rapporteur. ,O \DGHVFDVGHVSqFH/DGLUHFWLYHHXURSpHQQHVXUOHVpWXGHV
GLPSDFW HQ PDWLqUH GH GURLW GH OXUEDQLVPH HVW OH[HPSOH GH FH TXRQ SHXW IDLUH GH SLUH
Kafka lui-mme est dpass : on a transpos la directive en y rajoutant des dispositions ; le
GpFUHW D IDLW GH PrPH HQ ODLVVDQW VXEVLVWHU XQH ODWLWXGH GLQWHUSUpWDWLRQ DX[ SUpIHWV ; et
PDLQWHQDQW O8QLRQ HXURSpHQQH VRXKDLWH OD UHYRLU  %UHI FHVW XQ FDSKDUQDP
Indniablement, il y a une rflexion conduire sur la mthode.
M me la prsidente Laure de La Raudire. Nous vous remercions pour cet
change trs intressant.
*
*

/D PLVVLRQ GLQIRUPDWLRQ SURFqGH enfin j ODXGLWLRQ de MM. Philippe Sassier et


'RPLQLTXH/DQVR\DXWHXUVGUbu loi (Fayard, mars 2008).
M me la prsidente Laure de La Raudire. Monsieur Sassier, monsieur Lansoy, je
YRXV UHPHUFLH GDYRLU DFFHSWp QRWUH LQYLWDWLRQ /D PLVVLRQ GLQIRUPDWLRQ VXU OD
simplification lgislative, que je prside, se concentre davantage sur le flux normatif que sur
le stock, OHTXHO IDLW SOXV SUpFLVpPHQW OREMHW GH OD PLVVLRQ FRQILpH SDU DLOOHXUV SDU OH
Prsident de la Rpublique notre rapporteur, M. Thierry Mandon.
Vous vous tes efforcs de faire prendre conscience aux politiques, aux institutions
HW DX[ FLWR\HQV GH OLQIODWLRQ QRUPDWLYH TXL VXVFLWH DXMRXUGKXL GH OD SDUW GHV GHUQLHUV XQ
rejet prjudiciable au fonctionnement de notre socit.
M . Philippe Sassier. -HVXLVSpWULGKXPLOLWpDSUqVDYRLUHQWHQGXOHVXQLYHUVLWDLUHV
qui nous prcdaient dcortiquer devant vous les problmes juridiques avec un soin
GKRUORJHU 6L OH FRDXWHXU GH QRWUH OLYUH Ubu loi, M. Dominique Lansoy, est professeur de
GURLWjOXQLYHUVLWpMHQHVXLVTXDQWjPRLQXOOHPHQWMXULVWHPDLVMRXUQDOLVWHpFRQRPLTXH
GDERUGDX[chos, puis au Figaro, Antenne 2 et France 2.
&HVWHQPHIIRUoDQWGHFRPSUHQGUHSRXUTXRLHWFRPPHQWGLVSDUDLVVDLHQWHQ)UDQFH
des activits conomiques commerces, restaurants, marachers, paysans, petits htels,
artisans et dprissaient des produits utiliss depuis des sicles comme les concombres et
les tomates, qui se voient imposer des formes et des couleurs par les rglements de Bruxelles
HQPrPHWHPSVTXpFODWDLHQWOHVVFDQGDOHVGXSRXOHWjODGLR[LQHRXGHODYDFKHIROOHTXH
PHVW YHQXH OLGpH GH FH OLYUH HW GH VRQ WLWUH -DL DORUV GHPDQGp j 'RPLQLTXH /DQVR\ GH
PpSDXOHUGDQVFHWWHUHFKHUFKH
&HOLYUHDYDLWXQHYRFDWLRQTXHOTXHSHXSDPSKOpWDLUHHWFHVWGDQVODPrPHYHLQH
TXHMHYDLVPH[SULPHUGHYDQWYRXV
7RXW OHVSULW GX OLYUH HVW SUpVHQW GpMj GDQV VRQ SUHPLer chapitre, qui expose les
GpPrOpV GX FRPWH 3DXO GH /D 3DQRXVH DYHF OHV DGPLQLVWUDWLRQV j SURSRV GXQ SHUPLV GH
construire demand pour son parc animalier de Thoiry, ouvert en 1968. M. de La Panouse,
qui a cr de nombreux emplois permanents et saisonniers, contribuant animer un village
dans une zone situe entre la grande banlieue parisienne et la campagne et donnant un lan
ODFWLYLWp WRXULVWLTXH GH FH YLOODJH QRXV D FRQILp TXXQ WHO SURMHW QH VHUDLW SOXV SRVVLEOH

241

DXMRXUGKXLFRPSWHWHQXGHVQRUPHV, rglements, directives, lois et textes divers qui se sont


DFFXPXOpVGHSXLVTXDUDQWHDQV,OQHVDJLWSDVOjGXQFDVXQLTXH
Voil quarante ans, le prsident Georges Pompidou dclarait en termes un peu crus,
GHYDQW ODYDODQFKH GH WH[WHV TXL FRPPHQoDLW j se dclencher : &HVVH] GHPPHUGHU OHV
Franais !  ,O QD SDV pWp HQWHQGX HW HQFRUH PRLQV pFRXWp /D PDFKLQH VHVW HPEDOOpH HW
GDQVWRXVOHVGRPDLQHVOHVORLVHWWH[WHVVHVRQWPXOWLSOLpVWDQWHQ)UDQFHTXHQ(XURSH
mesure que les pouvoirs publics et politiques se sont affaiblis et ont laiss
OREELHV JURXSHV GLQWpUrWV V\QGLFDWV HW JURXSXVFXOHV SUHQGUH OH SRXYRLU OHV ORLV VH VRQW
multiplies on lgifre parfois pour tenter de dissimuler une certaine faiblesse politique.
/LQIODWLRQ OpJLVODWLYH YD GH SDLU DYHF OLQIODWLRQ ILVFDOH HW DGPLQLVWUDWLYH /RLV QRUPHV
rglements, dcrets, interdictions, mais aussi impts, taxes, strates administratives, nombre
GH IRQFWLRQQDLUHV HW GpOXV la France bat des records europens en la matire sont les
LQJUpGLHQWV GXQ PrPH SUREOqPH  FHOXL GH OD FRPSOH[LILFDWLRQ GXQ eWDW GH SOXV HQ SOXV
obse et impotent.
Peu peu, la ve Rpublique se transforme je pse mes mots en rpublique
EDQDQLqUH HW FRUURPSXH ,O VXIILW SRXU VHQ FRQYDLQFUH GH OLUH OHV MRXUQaux ou French
Corruption, un livre rcent consacr ce qui se passe autour de Paris la complexit conduit
forcment la corruption. Nous sommes en train de dcouvrir que trop de loi tue la loi ,
comme WURS GLPS{W WXH OLPS{W . Le citoyen a progressivement perdu de sa libert,
FRPPH OD UpFHPPHQW QRWp OpFULYDLQ 0LFKHO +RXHOOHEHFT VpWRQQDQW j VRQ UHWRXU HQ
)UDQFHDSUqVXQORQJVpMRXUjOpWUDQJHUG\WURXYHUPRLQVGHOLEHUWpSRXUOHVFLWR\HQVTXLO
Q\HQDYDLWDYDQWVRQGpSDUW
Les activits conomiques aussi disparaissent peu peu, touffes par cette gangue
lgislative, normative, fiscale et administrative MHFURLVGDLOOHXUVPRQVLHXUOHUDSSRUWHXU
que YRXVQrWHV pas impliqu seulement dans la simplification lgislative, mais aussi dans la
rforme des collectivits territoriales. Il faut parcourir la France, traverser des villages et des
SHWLWHVYLOOHVSRXUVDLVLUODPSOHXUGXSUREOqPH(QSDVVDQWGH)UDQFHHQ$OOHPDJQHRQHVW
VDLVLGHFRQVWDWHUODFWLYLWpTXLUqJQHGHODXWUHF{WpGHla frontire par rapport notre pays,
o la mort gagne peu peu nos rgions FRPPHj/LJQLqUHVSHWLWHYLOOHGX&KHURMpWDLV
YRLFL TXHOTXHV MRXUV HW TXL PHXUW GRXFHPHQW HW FRPPH GDQV FRPELHQ GDXWUHV YLOOHV
encore !
Les gouvernements successifs ont ELHQFRPSULVOHPpFDQLVPHSHUYHUVTXLVHVWPLV
en route et, depuis des annes, annoncent une baisse des dpenses publiques, un contrle de
la dette, une baisse des impts, une simplification administrative et lgislative et, sous un
nom ou sous un autre, SURPHWWHQWXQFKRFGHFRPSpWLWLYLWpHWGHVLPSOLILFDWLRQ0DLVVLOV
ont compris ce mcanisme, ils ne le matrisent plus. Le dernier chapitre de notre livre,
intitul Bavard et Ptochet , renvoie dos dos Lionel Jospin et Jean-Pierre Raffarin, deux
premiers ministres successifs qui ont dit exactement la mme chose, promettant de relancer
ODFRPSpWLWLYLWpHWGHVLPSOLILHUODYLHGHV)UDQoDLVHWGHVHQWUHSULVHVHWTXLQRQWULHQIDLWQL
OXQQLODXWUH(QGL[DQVOD)UDQFHDSHUGXSUqVGXQPLOOLRQGemplois industriels.
La simplification des lois doit aller de pair avec celle des impts, des collectivits
ORFDOHVGHV DGPLQLVWUDWLRQVFRPLWpVFRPPLVVLRQV HW GLUHFWLRQV FHVW--GLUHGHOHQVHPEOH
des mcanismes permettant ou empchant de diriger la FrDQFH/HWLWUHGXQDUWLFOHSDUXGDQV
OH QXPpUR GKLHU GX Canard enchan, Hollande dans le maquis de la simplification ,
conviendrait aussi bien M. Chirac ou M. 6DUNR]\ &RPPH OREVHUYH OH Canard, les
normes et les lus font de la rsistance chacun est favorable ce que soit supprim le

242

FDQWRQ YRLVLQ PDLV SDV OH VLHQ ,O \ D GHV DQQpHV TXRQ SDUOH GH VLPSOLILHU OHV VWUDWHV GHV
collectivits locales.
Cette simplification, je le redis, ne se fera pas par une diminution du nombre de
textes de loi, de taxes, de fonctionnaires, de rgions, de dpartements, de commissions ou de
FRPLWpV 7KpRGXOH (OOH H[LJH SUREDEOHPHQW TXH OeWDW UHGpILQLVVH VRQ U{OH SDU UDSSRUW DX[
UpJLRQVHWjO(XURSH,OVDJLWOjGXQHUpIOH[LRQPDMHXUHSRXUIDLUHHQWUHUOD)UDQFH dans une
(XURSHTXLFKDQJHHWGDQVXQHPRQGLDOLVDWLRQTXRQQDUUrWHUDSDV
(LQVWHLQGLVDLWTXLO\DYDLWWURLVERPEHV : la bombe atomique, celle de la population
et celle de la pauvret. Deux de ces bombes nous clatent la figure  FHVW FHOD OD
mondialisation. On peut certes la modifier, car elle est parfois alle trop loin, mais il nous
IDXW HQWUHU GDQV XQ PRQGH TXL FRPSWH KXLW PLOOLDUGV GKRPPHV FRQWUH GHX[ PLOOLDUGV DX
dbut du sicle dernier et un milliard en 1800, et o la population de la planWH VDFFURvW
chaque anne de 80 PLOOLRQV GKRPPHV VXSSOpPHQWDLUHV 6L QRXV Q\ HQWURQV SDV QRXV
serons engloutis.
,O HVW SUpVRPSWXHX[ MHQ VXLV FRQVFLHQW GH YRXV GLUH TXH OeWDW GRLW SHQVHU j
UHGpILQLU VRQ U{OH PDLV MDL pWp MRXUQDOLVWH HW MDL WRXMRXUs aim dire ou crire ce que je
UHVVHQWDLV-pWDLVSD\pSRXUrWUHFXULHX[HWMHOHVXLVUHVWp FHVWODUDLVRQSRXUODTXHOOHMH
PH[SULPHDLQVLGHYDQWYRXVVXUXQWRQOpJqUHPHQWFDULFDWXUDOPDLVDXVVLDYHFFXUHWXQ
peu de colre.
On sent bien que nouVDUULYRQVjODILQGXQHpSRTXHjODILQGXQSURFHVVXVDYHF
ODUHFKHUFKHGXQHQRXYHOOHSROLWLTXHjJDXFKHFRPPHjGURLWHHWSDVVHXOHPHQWHQ)UDQFH
il suffit de penser la monte des rgions ou ce que nous observons au Royaume-Uni et en
Espagne. ,OHVWWHPSVQRQVHXOHPHQWGHFRPSUHQGUHOHVPpFDQLVPHVFRPPHORQWIDLWWRXV
OHVSUpVLGHQWVTXLVHVRQWVXFFpGpPDLVGDJLUVXUHX[
6L HOOH VLQVFULW GDQV XQ HQVHPEOH GH VLPSOLILFDWLRQV j RSpUHU GDQV WRXV OHV
domaines, la simplification lgislative peut probablement servir de guide et de boussole
FHWWH UpIOH[LRQ VXU OeWDW 4XL IDLW TXRL ? Qui dcide quoi ? Qui tranche ? Qui est
responsable ? On ne le sait plus vraiment. Le pouvoir a t balkanis ventil ,
parpill faon puzzle pour le dire la manire des Tontons flingueurs,OHVWjOeO\VpH
car tout y remonte, mais il est aussi parfois dans les communes les Franais y tiennent
beaucoup et leur dsamour pargne au moins leurs maires.
,O IDXW FHVVHUGHOpJLIpUHUVXUWRXWHWQLPSRUWHTXRL GHPSLOHUWH[WHVQDWLRQDX[HW
europens, de lgifrer pour rpondre une motion surgie au journal de 20 heures, pour
IODWWHU VRQ HJR HQ GRQQDQW VRQ QRP j XQH ORL RX SRXU IDLUH FURLUH DX[ FLWR\HQV TXH ORQ
VRFFXSHGHX[HWTXHORQJRXYHUQH
-HVSqUe que la fin des mandats multiples, dnoncs par de nombreux experts que
QRXV DYRQV UHQFRQWUpV FRPPH OXQH GHV FDXVHV GH OLQIODWLRQ OpJLVODWLYH HW GH OD PDXYDLVH
TXDOLWp GHV ORLV DLQVL TXH GH OHXU LQXWLOLWp SHUPHWWUD GDPpOLRUHU OH WUDYDLO OpJLVODWLI 6ans
doute faut-LODXVVLFRPPHFHODVHSUDWLTXHHQ)LQODQGHHWjOLQYHUVHGHODQWDJRQLVPHTXL
prvaut en France, institutionnaliser les liens et les changes entre lus nationaux et
europens.
/D VLPSOLILFDWLRQ GDQV WRXV OHV VHQV GX WHUPH QHVW SDV VHXlement un impratif
conomique, mais aussi un objectif politique majeur. La complexit et son cortge associant
la dette, le dficit, le chmage, une croissance bride et la corruption menacent non
VHXOHPHQWODYLHGHVFLWR\HQVHWODFWLYLWppFRQRPLTXHPDis aussi notre dmocratie FDUMHQ

243

ai la conviction  DXPrPHWLWUHTXHODGHWWHGpQRQFpHSDUODQFLHQPLQLVWUH$ODLQ /DPEHUW


dans son livre Dficits publics, la dmocratie en danger, la complexit des lois est un danger
pour notre dmocratie, et pas seulement en France.
M . Dominique Lansoy. Lorsque M. 3KLOLSSH6DVVLHUPDGHPDQGpVLODFRPSOH[LWp
HW OH[FqV GHV ORLV HW GHV QRUPHV TXLO REVHUYDLW GDQV OH GRPDLQH pFRQRPLTXH VH IDLVDLHQW
DXVVLVHQWLUGDQVOHVPpWLHUVGXGURLWMHOXLDLUpSRQGXTXLOHQDOOait bien de mme. Chez les
praticiens du droit, les magistrats tlphonent aux universitaires, les avocats aux magistrats
HWOHVPDJLVWUDWVDX[DYRFDWVHQTXrWHGpFODLUFLVVHPHQWVVXUGHVORLVTXLOVPDvWULVHQWPDO
&HVWDXSRLQWTXHQOHEkWRQQLHUde Paris, Me Yves Repiquet, a cr au sein du conseil
GH O2UGUH GH 3DULV XQ SRVWH GDYRFDW UpIpUHQW SRXU VXLYUH OpYROXWLRQ OpJLVODWLYH HW
normative, afin que les avocats YRLUHOHVPDJLVWUDWVPDLVMHQDLSUHVTXHSDVOHGURLWGHOH
dire trouvent un interlocuteur qui puisse les renseigner.
/DSUHPLqUHDOHUWHUHPRQWHjORUVTXHOH&RQVHLOGeWDWDDSSHOpODWWHQWLRQGX
lgislateur sur le nombre des lois et, surtout, sur leur qualit. La deuxime est venue en 2006,
alors que M. Renaud Denoix de Saint-Marc tait vice-SUpVLGHQW GX &RQVHLO GeWDW DYHF OH
rapport de Mme -RVVHOLQH GH &ODXVDGH UpTXLVLWRLUH IpURFH FRQWUH OLQIODWLRQ QRUPDWLYH /D
troisime alerte a t, en 200OHUDSSRUWGX&RQVHLOGeWDWGRQW0-HDQ-Marc Sauv est le
nouveau vice-prsident.
/HVUHSURFKHVIRUPXOpVVRQWWRXWGDERUGOHQRPEUHH[FHVVLIGHORLVHWGHQRUPHV
dcrets, circulaires, transcription de textes communautaires et production normative des
autorits administratives indpendantes , puis le fait que les lois soient mal crites et
EDYDUGHV SDUODQW GH FKRVHV HW GDXWUHV HW HQILQ TXHOOHV VRLHQW LQDSSOLFDEOHV : une tude
ralise par le Snat a montr que 24 % des lois votes dans les annes 1997-OpWDLHQW
totalement et 21 % partiellement, soit un total de 45 % ; pour les annes 2004-2005, selon le
&RQVHLO GeWDW OD SURSRUWLRQ pWDLW UHVSHFWLYHPHQW GH  % et de 27,1 %, soit un total de
62,5 % !
-HFRQFOXUDLHQUHYHQDQWjGHVSULQFLSHVVLPSOHV7RXWGDERUGOHOpJLVODWHXUQDSDV
jVRFFXSHUGHFKRVHVVDQVLPSRUWDQFH FHVWOjXQDGDJHGHGURLWURPDLQ : De minimis non
curat praetor. Ensuite, la loi ne peut que permettre, ordonner ou interdire pour reprendre
des termes employs en 1801 par Portalis dans son Discours prliminaire du premier projet
de code civil. Pour ce qui est, enfin, de la longueur des textes, je rappelle que, selon Edgar
)DXUHSUpVLGHQWGHO$VVHPEOpHQDWLRQDOHXQHERQQHORL devait faire une page et demie ce
TXL IXW GX UHVWH GpPHQWL HQ QRYHPEUH  SDU VD ORL GRULHQWDWLRQ GH OHQVHLJQHPHQW
VXSpULHXUTXLLQDXJXUDLWODVpULHGHVORLVGXQHFHQWDLQHGHSDJHV
M me Ccile Untermaier. Ces propos qui nous accablent ne font en mme temps
que renforcer notre dtermination changer les choses. Nous sommes convaincus de la
QpFHVVLWpGDPpOLRUHUOHWUDYDLOOpJLVODWLIHWGHQRWUHFDSDFLWpj\SDUYHQLU'XUHVWHFHWUDYDLO
ne mrite tout de mme pas une trop grande svrit. La loi suit en effet la complexification
du monde et nous avons dj voqu des orientations qui devraient nous rassurer.
9RXVDYH]VRXOLJQpjWUqVMXVWHWLWUHTXLOIDOODLWWHQLUFRPSWHjODIRLVGHVUpJLRQV
GH OD )UDQFH HW GH O(XURSH HW TXH OHV GpSXWpV QDWLRQaux et europens ne savaient pas
travailler ensemble. Il nous faut assurment travailler en amont de la directive et de la loi
IUDQoDLVH7RXWFHODHVWFHSHQGDQWORLQGrWUHKRUVGHQRWUHSRUWpHHWLOQ\DSDVOLHXGHFpGHU
la morosit en considrant quHQRXVVHULRQVLPSXLVVDQWV8QHpWXGHGLPSDFWWUqVVpULHXVH
SHUPHWWDQWGHIRQGHUODQpFHVVLWpHWOXWLOLWpGHODORLSHXWFRQWULEXHUjDPpOLRUHUODVLWXDWLRQ

244

,O IDXW DXVVL YRXV DYH] UDLVRQ DEDQGRQQHU VRQ HJR HQ HQWUDQW j O$VVHPEOpH
nationale, car la VDWLVIDFWLRQ GDWWDFKHU VRQ QRP j XQH ORL SHXW FRQWULEXHU j OLQIODWLRQ
lgislative.
M . Thierry M andon, rapporteur. Messieurs, je vous remercie de votre
tmoignage, mme dans sa vrit brutale : vous dites avec vos mots ce que nous avons lu
dans Le Monde GDYDQW-KLHU VXU ODFFDEODQWH GpILDQFH GHV )UDQoDLV IDFH j OpWDW GH OHXU
dmocratie.
Les choses bougent cependant et notre modeste mission entend contribuer ce
PRXYHPHQW /D YRORQWp GH UpDJLU FRQWUH OXQLYHUV ORXUG HW FRPSOH[H TXH YRXV GpFULYH]
transcende les clivages politiques et un consensus merge sur la ncessit de nous attaquer
OK\GUH HW VXU OH IDLW TXH QRXV SRXYRQV GDQV OD GXUpH \ SDUYHQLU VDQV TXH VHV WrWHV
repoussent.
Pouvez-vous prciser la source des donnes chiffres que vous avez cites ?
M . Dominique Lansoy. ,O VDJLW GHV WUDYDX[ GX &RQVHLO GeWDW HW GX 6pQDW
notamment des tableaux complmentaires des lois votes par le Snat dans les annes 19971998 et 2005-2006.
M me la prsidente Laure de La Raudire. Il devient clair, vous entendre, que la
VLPSOLILFDWLRQ OpJLVODWLYH QDXUD GH VHQV HW GH SRUWpH TXH VL HOOH VpWHQG j ELHQ GDXWUHV
domaines. Gauche et droite travaillent conjointement depuis des annes cette tche, mais
QRXVQDXURQVIDLWXQERQWUDYDLOTXHVLOHFLWR\HQFRQVWate des modifications concrtes dans
sa vie quotidienne. Tant que ce travail reste partiel, il revient vider des seaux pendant que
GDXWUHVVHUHPSOLVVHQW ou pomper comme les Shadoks !
M . Dominique Lansoy. Vous avez des armes pour contrler la loi, commencer
par celles que vous donnent les articles 34 et 37 de la Constitution.
On trouve parfois dans la loi des absurdits extraordinaires. M. Sassier a ainsi
UHOHYpTXXQHORLVXUODPRQWDJQHFRPPHQoDLWSDUDIILUPHUTXH la loi reconnat la montagne,
foUPXOH TXH OH &RQVHLO FRQVWLWXWLRQQHO WRXW HQ UHFRQQDLVVDQW VRQ LQXWLOLWp QDYDLW GX UHVWH
SDVOLHXGHFHQVXUHUFDUHOOHQpWDLWHQULHQLQFRQVWLWXWLRQQHOOH'DQVODPrPHYHLQHXQHORL
SUpFLVHTXHODSHUVRQQHGpVLUHXVHGREWHQLUFHUWDLQHDXWRULVDWLRQGRLWVDGUHVVHUjODXWRULWp
FRPSpWHQWHHWTXHVLFHWWHDXWRULWpVHGpFODUHLQFRPSpWHQWHHOOHGHYUDVDGUHVVHUjODXWRULWp
FRPSpWHQWH !
Le Parlement peut restreindre ces excs. Pratiquez donc, comme nos tudiants, la
contraction de texte : les choses en seront plus lumineuses.
M . Philippe Sassier. Les parlementaires doivent demander Bruxelles de changer
VHV SUDWLTXHV -HVSqUH TXH FH VHUD OH FDV DSUqV OH PDQGDW GH 0 %DUURVR FDU O(XURSH HVW
DXMRXUGKXL WURS ORLQ GHV FLWR\HQV /D SUHPLqUH VLPSOLILFDWLon devrait consister dans
ODSSOLFDWLRQ GX SULQFLSH GH VXEVLGLDULWp ,O QHVW SDV QRUPDO HQ HIIHW TXH OHV ORLV TXL
VDSSOLTXHQW j ODJULFXOWXUH VRLHQW OHV PrPHV GH OD 6LFLOH DX 'DQHPDUN HW TXH %UX[HOOHV
dcide de la courbure des concombres. Il faut clarifier des comptences respectives de
O(XURSH GH OeWDW HW GHV UpJLRQV 3RXU FH TXL FRQFHUQH OD YLH GHV FLWR\HQV LO IDXW
absolument, je le rpte, relancer la subsidiarit.
M me la prsidente Laure de La Raudire. Messieurs, je vous remercie.

245

Sance du jeudi 30 janvier 2014


/D PLVVLRQ GLQIRUPDWLRQ SURFqGH j ODXGLWLRQ de M. Alain Lambert, prsident de la
FRPPLVVLRQ FRQVXOWDWLYH GpYDOXDWLRQ GHV QRUPHV &&(1  HW DXWHXU DYHF 0 -HDQ-Claude
%RXODUGGXUDSSRUWGHODPLVVLRQGHOXWWHFRQWUHOLQIODWLRQQRUPDWLve (mars 2013).
M me la prsidente Laure de La Raudire. 0HUFL PRQVLHXU OH PLQLVWUH GDYRLU
DFFHSWp OLQYLWDWLRQ GH OD PLVVLRQ GLQIRUPDWLRQ VXU OD VLPSOLILFDWLRQ OpJLVODWLYH TXH MH
prside et dont Thierry Mandon par ailleurs coprsident du Conseil de la simplification
voulu par le Prsident de la Rpublique HVWOHUDSSRUWHXU3OXW{WTXjODVLPSOLILFDWLRQGX
VWRFNOpJLVODWLIQRWUHPLVVLRQVLQWpUHVVHjODUDWLRQDOLVDWLRQGXIOX[FHVW--dire aux moyens
de mieux lgifrer.
Nous avons commenc nos travaux par un dplacement Bruxelles, destin
REVHUYHU OHV SUDWLTXHV DX VHLQ GH OeWDW EHOJH DLQVL TXj OD &RPPLVVLRQ HXURSpHQQH 1RXV
nous rendrons ensuite Londres, puis Berlin et La Haye. Il nous semble en effet utile de
VLQVSLUHU GHV WUDYDX[ UpDOiss dans tous ces pays en matire de simplification et de
rationalisation du droit.
1RXVYRXVUHFHYRQVDXMRXUGKXLjSOXVLHXUVWLWUHV YRXVrWHVGDERUGODXWHXUDYHF
M. Jean-&ODXGH%RXODUGGXQUDSSRUWVXUODOXWWHFRQWUHOLQIODWLRQQRUPDWLYHTXHYRus avez
remis en mars 2013 au Premier ministre, et qui a reu un trs bon accueil dans les mdias et
OHVLQVWLWXWLRQV(QVXLWHYRXVSUpVLGH]OD&RPPLVVLRQFRQVXOWDWLYHGpYDOXDWLRQGHVQRUPHV
CCEN , appele voluer prochainement en Conseil national dpYDOXDWLRQGHVQRUPHV
Quelles sont vos propositions en matire de simplification lgislative ? Quels
conseils pouvez-YRXVQRXVGRQQHUVXUODIDoRQGHOHVPHWWUHHQXYUH ?
M . $ODLQ /DPEHUW SUpVLGHQW GH OD &RPPLVVLRQ FRQVXOWDWLYH GpYDOXDWLRQ GHV
normes (CCEN). -HVXLVXQSUDWLFLHQGXGURLWGHSXLVTXDUDQWHDQVSXLVTXHGDERUGMXULVWH
MDL pWp ORQJWHPSV SDUOHPHQWDLUH DYDQW GH SUpVLGHU OD &&(1 TXL VXUYHLOOH OHV UHODWLRQV
ILQDQFLqUHVHQWUHOeWDWHWOHVFROOHFWLYLWpVORFDOHV3RXUDXWDQWVXUFHWpWHUQHOVXMHWTXHVWOD
simplification lgislative, vous entendrez de meilleurs experts que moi. Je ne peux que vous
IDLUHSDUWGHVHQVHLJQHPHQWVTXHMDLWLUpVGHPRQH[SpULHQFHHWVLJQDOHUQRWDPPHQWFHUWDLQV
effets pervers que celle-FLPDSHUPLVGLGHQWLILHU
TRXWGDERUGLOIDXWLQVLVWHUVXUOHIDLWTXHODORLHQ)UDQFHHVWDYDQWWRXWGRULJLQH
JRXYHUQHPHQWDOH FH TXL VLJQLILH TXHOOH HVW pODERUpH SDU OHV DGPLQLVWUDWLRQV FHQWUDOHV
&HUWHVOH3DUOHPHQWHQDpJDOHPHQWOLQLWLDWLYHDYHFVHVSURSRVLWLRQVGHORL, mais la plupart
des textes adopts sont des projets de loi. Quant au rglement, il a pour seule source les
administrations centrales.
/H[DPHQGHVSURMHWVGHORLSDUOH3DUOHPHQWQHFKDQJHSDVIRQGDPHQWDOHPHQWQLOD
mthode de leur laboration ni ce que ORQSRXUUDLWDSSHOHUOHXU ligne rdactionnelle . Or
les administrations qui rdigent ces textes le font depuis un certain point de vue, la fois
FHQWUDO HW pOHYpSDUUDSSRUWjFHX[jTXL OHVORLVGRLYHQWVDSSOLTXHU HW PDUTXpSDUOH U{OH
TXHOOHVMRXHQWGDQVORUJDQLVDWLRQGHVSRXYRLUVSXEOLFV'HQRPEUHX[WH[WHVVRQWDLQVLpFULWV
HQ IRQFWLRQ GX FRQWU{OH TXL VHUD HIIHFWXp HQVXLWH HW QRQ SDV DYHF OLQWHQWLRQ GHQ UHQGUH
ODSSOLFDWLRQIDFLOH3RXUSDUOHUVLPSOHPHQWFHODVLJQLILHTXHOHVORLVQHVRQWSas labores
pour ceux qui elles sont destines.
Par ailleurs, les administrations ont gnralement une culture juridique trs faible,
pour ne pas dire indigente  OpTXLYDOHQW DFWXHO GXQ '(8* GH GURLW SDV GDYDQWDJH (OOHV

246

sont certes capables de UpGLJHU GHV WH[WHV GXQH KDXWH WHFKQLFLWp GDQV FHUWDLQV GRPDLQHV
VSpFLDOLVpV GX GURLW FRPPH OXUEDQLVPH RX OHQYLURQQHPHQW PDLV RQ WURXYH GDQV OHXUV
SURSRVLWLRQV GHV GLVSRVLWLRQV SRUWHXVHV GXQ JUDQG ULVTXH MXULGLTXH &HVW SRXUTXRL OHV
parlementaires auUDLHQW LQWpUrW j YpULILHU GXQ LO WUqV DWWHQWLI OH UHVSHFW GHV SULQFLSHV
JpQpUDX[GXGURLWGDQVOHVWH[WHVTXLOVH[DPLQHQW
Ainsi, la CCEN constate trs souvent des manquements la hirarchie des normes.
En particulier, les administrations centrales ont tendance mconnatre les articles 34 et 37
de la Constitution qui dlimitent les domaines respectifs de la loi et du rglement. Et le
3DUOHPHQWODLVVHSDVVHUFHUWDLQHVGHFHVHUUHXUV,OQHVWVDQVGRXWHSDVPpFRQWHQWGHSRXYRLU
ainsi pntrer subrepticement dans le domaine du rglement afin de mieux peser sur le
FRQWHQX GX GURLW SRVLWLI PDLV FH QHVW SDV GH ERQQH PpWKRGH : rdige avec un luxe de
dtails, la loi finit par tre difficile appliquer. En outre, le rapport de la commission saisie
au fond, le compte rendu des dbats et les exposs des motifs des amendements sont autant
GHPR\HQVSRXUOH3DUOHPHQWGHVDVVXUHUTXH VRQLQWHQWLRQVHUDUHVSHFWpHSDUOHSRXYRLU
rglementaire.
Les grands penseurs franais du droit, cits dans le monde entier comme
Montaigne, Montesquieu et Portalis ont tous soulign la grave erreur consistant vouloir
SUpYRLUGDQVODORLODGLYHUVLWpGHVVLWXDWLRQV/HUpVXOWDWGXQHWHOOHWHQWDWLRQHVWOHEORFDJH
OHVGLIILFXOWpVGDSSOLFDWLRQODFFHQWPLVVXUOHEDYDUGDJe au dtriment des grands principes
que la loi est suppose dfendre.
Le lgislateur gagnerait donc beaucoup lutter contre la confusion entre loi et
rglement. cet gard, je suis frapp de le voir si souvent renvoyer des dcrets en Conseil
GeWDW'Dns un tel cas de figure, le Conseil recommande trs vivement aux administrations
GLQFOXUH GDQV OHV GpFUHWV GDSSOLFDWLRQ OD WRWDOLWp GX GURLW DSSOLFDEOH FH TXL D SRXU HIIHW
GDXJPHQWHUGHIDoRQH[FHVVLYHODORQJXHXUGHVQRXYHDX[WH[WHVHWGHQULJLGLILHU le contenu.
La plupart du temps, des dcrets simples suffiraient. Le Parlement serait par ailleurs fond
UpFODPHUjOH[pFXWLIODWUDQVPLVVLRQGHVHVSURMHWVGHGpFUHWVGDSSOLFDWLRQDILQGHSRXYRLU
PHVXUHUOpYHQWXHOpFDUWHQWUHFHVGHUQLHUVHWOHVWH[WHVTXLOVFRQFHUQHQW
De mme, le lgislateur aurait intrt vrifier la ncessit de lgifrer, dans la
PHVXUH R OXVDJH GH OD ORL SHXW rWUH GpYR\p /D ORL HVW XQ DFWH GH VRXYHUDLQHWp HW GXQH
certaine faon, de majest ; elle perd beaucoup en crdibLOLWpORUVTXHOOHGHYLHQWXQDFWHGH
communication. Que penserait-RQ GXQ VRXYHUDLQ TXL VH PRQWUHUDLW EDYDUG LQFRQVWDQW
EURXLOORQ DPELJX VFKL]RSKUqQH HW QH WUDGXLUDLW MDPDLV GDQV OHV IDLWV OHV VROXWLRQV TXLO
propose ?
Il faut galement faire la chasse aux surtranspositions du droit europen, et
URPSUH DYHF OLGpH VHORQ ODTXHOOH OD WUDQVSRVLWLRQ SXUH HW VLPSOH HVW XQH PDUTXH GH
UHQRQFHPHQW j OD VRXYHUDLQHWp QDWLRQDOH &HVW DX FRQWUDLUH XQ VLJQH GH OXFLGLWp FDU FHOD
vite de remettre en cause la cRPSpWLWLYLWp IUDQoDLVH SDU UDSSRUW j FHOOH GDXWUHV SD\V ,O
PHVW DUULYp j SOXVLHXUV UHSULVHV GH PH UHQGUH j %UX[HOOHV SRXU GpQRQFHU DX QRP GHV
collectivits locales, les abus du droit europen. Souvent, dans de tels cas, on me montre les
modifications eIIHFWXpHV j OpFKHORQ QDWLRQDO HW RQ PH UpWRUTXH TXH OD )UDQFH HVW OXQ GHV
VHXOVSD\VjMXJHUQpFHVVDLUHGDMRXWHUXQHFRXFKHMXULGLTXHVXSSOpPHQWDLUHDX[GLUHFWLYHV,O
serait gnralement prfrable de se limiter en assurer la transposition pure et simple.
-H VXJJqUH pJDOHPHQW GH ELHQ LGHQWLILHU OREMHFWLI UHFKHUFKp SDU XQ SURMHW GH ORL
Celui-ci vise-t-il organiser les relations entre les citoyens, entre les entreprises et les
citoyens, entre les entreprises elles-PrPHVHQWUHOeWDWHWOHVFROOHFWLvits territoriales ? Au
fil de son examen, en effet, on tend y introduire des finalits complmentaires sans parler

247

des cavaliers lgislatifs DXULVTXHGRXEOLHUOREMHFWLISULQFLSDOHWGRQFGHOXLIDLUHSHUGUH


une partie de son efficacit.
Dans le FDVRXQHORLSDUDvWGLIILFLOHjDSSOLTXHUGHIDoRQXQLIRUPHVXUOHQVHPEOH
du territoire, il serait aussi souhaitable GHPHWWUHHQXYUHOH principe de proportionnalit. En
HIIHWVLFHSULQFLSHHVWFRQWHVWpHQ)UDQFHQRWDPPHQWVDJLVVDQWGHVUHODWLRQV HQWUHOeWDWHW
OHV FROOHFWLYLWpV WHUULWRULDOHV FHVW SDUFH TXH OH SUHPLHU YHXW FRQVHUYHU XQ PRQRSROH VXU OH
GURLWUpJLVVDQWOHVVHFRQGHV/HVDGPLQLVWUDWLRQVFHQWUDOHVQRQWMDPDLVDFFHSWpOHSULQFLSH
pos il y a soixante ans, de la libre administration des collectivits territoriales. Il serait
SRXUWDQW XWLOH GH SUpYRLU GDQV OD ORL TXH OHV PR\HQV GDSSOLFDWLRQ QH VHURQW SDV
disproportionns par rapport au but recherch.
,O FRQYLHQW SDU DLOOHXUV GpYLWHU OH[FHVVLYH SpQDOLVDWLRQ GX GURLW 6L OH GURLW pnal
suffisait faire reculer les voyous, les prisons seraient bien moins peuples ! En ralit, son
effet est surtout de ptrifier les honntes gens. Le risque est mme de susciter des
FRPSRUWHPHQWVGDXWR-assurance on le voit bien dans les domaines des marchs publics ou
GH OHQYLURQQHPHQW pouvant se rvler pnalisants SRXU OpFRQRPLH HW SRXU OLQLWLDWLYH
publique en gnral.
-H QH VDLV SDV FH TXH OHV PHPEUHV GH FHWWH PLVVLRQ GLQIRUPDWLRQ SHQVHQW GX
SULQFLSH GH SUpFDXWLRQ PDLV SRXU PD SDUW MHVWLPH TXH OD GpFLVLRQ GH OLQWURGXLUH GDQV OH
prambule de la Constitution a t prise un peu rapidement. Sans doute serait-il souhaitable
GDIILUPHU GH WHPSV HQ WHPSV GDQV ODSSDUHLO QRUPDWLI OH GURLW DX OLEUH FKRL[ HW PrPH OH
droit au risque, afin de temSpUHU ODSSOLFDWLRQ GX SULQFLSH GH SUpFDXWLRQ ORUVTXH ORQ HQ
attend des effets ngatifs.
Dans le cas des normes aux consquences techniques lourdes, je me demande si la
loi ne pourrait pas introduire un systme de rescrit comparable ce qui existe en matire
ILVFDOHGDXWDQWTXHOHVDUJXPHQWVFRQVWLWXWLRQQHOVLQYRTXpVSRXUV\RSSRVHUVHPEOHQWSHX
FRQYDLQFDQWV%HDXFRXSGDJHQWVpFRQRPLTXHVDSSUpFLHUDLHQWGHSRXYRLUIDLUHYDOLGHUOHXUV
schmas juridiques par les administrations concernes. Cela permettraLW GpYLWHU GHV
procdures excessives, des dlais prolongs et des surcots inutiles. Or seule la loi peut faire
une telle proposition LOQ\DDXFXQHVSRLUTXHOHVDGPLQLVWUDWLRQVHQSUHQQHQWOLQLWLDWLYH
(QFHTXLFRQFHUQHOHVpWXGHVGLPSDFWOHXUVLncrit serait mieux garantie si elles
IDLVDLHQWOREMHWGpYDOXDWLRQVex post. la CCEN, nous avons en effet constat, en ralisant
GH WHOOHV pYDOXDWLRQV TXHOOHV GpPRQWUDLHQW OH FDUDFWqUH QRQ SHUWLQHQW YRLU LQVLQFqUH GHV
valuations ex ante. Parler de moralisation serait excessif, mais pour discipliner la ralisation
GHVpWXGHVGLPSDFWLOVHUDLWVDQVGRXWHVRXKDLWDEOHGHSUpYRLUSDUSULQFLSHOHXUpYDOXDWLRQ
ex post, quand bien mme elle ne serait finalement pas systmatiquement ralise. -DLELHQ
FRQVFLHQFH TXH OH[SpULHQFH GH OD &&(1 TXL QH WUDLWH TXH GHV UHODWLRQV HQWUH OeWDW HW OHV
FROOHFWLYLWpVWHUULWRULDOHVQHFRUUHVSRQGTXjXQHWRXWHSHWLWHSDUWLHGXFKDPSGHYRVWUDYDX[
3RXU DXWDQW QRXV VRPPHV IUDSSpV SDU OLQYUDLVHPEODEOH UpVLVWDQFH Gont font preuve les
administrations centrales, qui ont voulu conserver le pouvoir que le lgislateur souhaitait
transfrer aux administrations dconcentres ou dcentralises. Alors que depuis les annes
1950, une mme volont politique est exprime en dpLWGHVDOWHUQDQFHVODVLWXDWLRQQDSDV
chang cet gard, ce qui pose un vrai problme de gouvernance. Je me rjouis de la volont
trs forte manifeste par le Gouvernement dans ce domaine, mais un suivi attentif sera
ncessaire pour vrifier que les administrations centrales obissent au pouvoir politique.
-H YRXV VXJJqUH DX SDVVDJH VL YRXV QH ODYH] SDV GpMj SUpYX GH UHQFRQWUHU
Mme &KDYULHUSURIHVVHXUHjOXQLYHUVLWp3DQWKpRQ-Sorbonne, une trs bonne spcialiste qui
a crit des choses trs intressantes au sujet du droit pouvant tre labor par les

248

administrations locales. Le droit rsiduel des administrations centrales rglementer dans les
QRPEUHX[ GRPDLQHV GHFRPSpWHQFHV TXH OeWDW D WUDQVIpUpV GHSXLV WUHQWH DQV PpULWHUDLW HQ
HIIHW GrWUH PLHX[ circonscrit. La situation actuelle, invraisemblable, a en effet des
consquences non seulement financires, mais aussi juridiques.
Enfin, dans notre pays, les administrations qui prescrivent ne payent pas le cot de
leurs prescriptions. Cela peut se comprendre quand ce cot est assum par des agents
conomiques privs FHVW DLQVL TXH IRQFWLRQQH OeWDW  PDLV PRLQV TXDQG LO OHVW SDU
GDXWUHVDGPLQLVWUDWLRQV,OIDXGUDLWGRQFLQWURGXLUHXQSULQFLSHGH prescripteur-payeur .
M me Ccile Untermaier. Vous dnoncez juste titre la confusion des domaines de
OD ORL HW GX UqJOHPHQW 0DLV HQ UHIXVDQW GHSXLV  GH VDQFWLRQQHU OLUUHVSHFW GHV
articles 34 et 37 de la Constitution, le Conseil constitutionnel ne participe-t-il pas cette
drive ? Ne devrait-il pas rappeler la rgle ?
,O HVW YUDL TXHOHVDGPLQLVWUDWLRQVQRQWSDVXQH FXOWXUHMXULGLTXHVXIILVDQWH-HQH
VXLV SDV VUH GDLOOHXUV TXLO HQ DLOOH DXWUHPHQW GHV SDUOHPHQWDLUHV HQWRXUpV GH OHXUV
collaborateurs, mais on pourrait difficilement le leur repURFKHU 4XRL TXLO HQ VRLW QRXV
sommes en situation de faiblesse par rapport une administration qui dispose de plus grands
PR\HQVGH[SHUWLVH&RPPHQWIDLUHSRXUpYLWHUTXHODORLQHVRLWEXUHDXFUDWLTXHHWFRPPHQW
VDVVXUHUTXHOOHVHUDDGDSWpHDX[SHUVRQQHVDX[TXHOOHVHOOHGRLWVDSSOLTXHU ? Comment les
citoyens pourraient-ils exprimer leurs observations sur une loi qui aura, ensuite, des
consquences dans leur vie quotidienne ?
M . Rgis Juanico. Nous avons auditionn la semaine dernire Mme Chavrier avec
ODTXHOOH QRXV DYRQV pYRTXp ODGDSWDWLRQ GH OD QRUPH et en particulier des directives
europennes aux niveaux local et rgional. Selon vous, il est prfrable dans la plupart des
FDVGRSWHUSRXUXQHWUDQVSRVLWLRQSXUHHWVLPSOHGHODGLUHFWLYH0DLV dans ce cas, comment
appliquer le principe fondamental de la subsidiarit "4XHOOHPDUJHGHPDQXYUHSHXWrWUH
ODLVVpHjOpFKHORQORFDOSRXUODSSOLFDWLRQGXQHGLUHFWLYH ?
8QHGHVSUpRFFXSDWLRQVFHQWUDOHVGHFHWWHPLVVLRQGLQIRUPDWLRQHVWGHVLPSOLILHU la
procdure lgislative. Avez-YRXV GHV VXJJHVWLRQV j IDLUH VXU OHV PR\HQV GDPpOLRUHU OHV
pWXGHV GLPSDFW GRQW OD TXDOLWp GH ODYLV XQDQLPH ODLVVH j GpVLUHU ? Comment rduire le
dcalage observ entre les valuations ex ante et ex post "(QWDQWTXDQcien parlementaire,
jugez-vous ncessaire de simplifier drastiquement la procdure lgislative et ses tapes
examen en commission, puis en sance plnire, navettes, etc. ?
(QILQYRXVrWHVDYHF'LGLHU0LJDXGOXQGHVSqUHVGHODORLRUJDQLTXHUHODWLYH aux
lois de finances (LOLF). Avez-YRXVHXORFFDVLRQGHQpYDOXHUODSSOLFDWLRQGHSXLV ?
Quelles amliorations seraient envisageables ? Nous sommes nombreux, au sein de la
commission des finances, penser que les projets de loi de rglement qui reprsentent
plutt la vrit budgtaire RFFXSHQW XQH SODFH WURS IDLEOH GDQV OH GpEDW DORUV TXH ORQ
consacre entre deux et trois mois par an la loi de finances initiale, qui ne contient pourtant
que des intentions. Quant aux indicateurs de performance, ne pourraient-ils pas tre
amliors ?
M . Alain Lambert. Le Gouvernement a le pouvoir, en sance publique, de
VRSSRVHUDX[DPHQGHPHQWVRXSURSRVLWLRQVGHORLTXLQHUHOqYHQWSDVGXGRPDLQHGHODORL
6DJLVVDQWGHODVpSDUDWLRQHQWUHODORLHWOHUqJOHPHnt, la position du Conseil constitutionnel
est donc peut-tre contestable, mais elle est claire LODHVWLPpTXLOQHOXLDSSDUWHQDLWSDVGH
faire une police que le Gouvernement ne fait pas lui-mme.

249

3RXUDXWDQWjOD&&(1QRXVWURXYRQVGRPPDJHTXLOVRLt fait si peu recours la


SURFpGXUH GH GpFODVVHPHQW SUpYXH SDU ODUWLFOH 37 de la Constitution. Celle-ci est pourtant
trs simple  LO VXIILW DX 3UHPLHU PLQLVWUH GHQYR\HU DX &RQVHLO FRQVWLWXWLRQQHO OD OLVWH GHV
mots, des paragraphes ou des fragments de texte lgislatif qui relvent du domaine
rglementaire pour que le Conseil, dans un dlai de quinze jours, en prononce le
GpFODVVHPHQW 'DQV FH FDV OH WH[WH UHVWH GDQV OD ORL PDLV LO QD SOXV TXXQH YDOHXU
UpJOHPHQWDLUH /H OpJLVODWHXU VKRQRUHUDLW GDLOOeurs signaler de lui-mme les cas dans
lesquels la loi a envahi le champ du rglement. En effet, faute de dclassement, une nouvelle
loi est ncessaire pour modifier le dispositif initial, ce qui est particulirement problmatique
dans le cas des normes techniques, lesquelles ont par nature vocation voluer. Il est insens
que la volont de tenir compte du progrs technologique puisse avoir pour consquence une
violation de la loi ! Le dclassement me semble donc la bonne voie pour procder au
toilettage  TXH OH &RQVHLO FRQVWLWXWLRQQHO UHIXVH GH IDLUH &HVW HQ WRXW FDV XQH VROXWLRQ
VRXYHQWPHLOOHXUHTXHFHOOHGHORUGRQQDQFH
(Q UHYDQFKH LO QHVW VDQV GRXWH SDV HQFRUH Qp FHOXL TXL FRQQDvW OH ERQ PR\HQ
GDGRSWHUGHVORLVPRLQVEXUHDXFUDWLTXHVHWGHPieux associer son laboration les citoyens
DX[TXHOVHOOHVGRLYHQWVDSSOLTXHU,OPHVHPEOHWRXWHIRLVTXHOHGURLWLVVXGHVJHQVVLPSOHV
HVW PHLOOHXU TXH FHOXL LVVX GH WHFKQLFLHQV 3UHQRQV OH[HPSOH GH ODUWLFOH GX  GX FRGH
civil, rdig en 1804, et qui dispose que les poux contribuent aux charges du mariage
SURSRUWLRQ GH OHXUV IDFXOWpV UHVSHFWLYHV $XMRXUGKXL FRPSWH WHQX GH ODFWXHOOH ligne
ditoriale du Parlement, la mme disposition serait rdige ainsi : Les poux
contribueront aux charges du mariage proportion de la moyenne de leurs revenus des cinq
dernires annes, pondrs par  HWF 2Q VHUDLW WHQWp GLQFOXUH XQ LGpDO DULWKPpWLTXH TXL
QHVWSDVUpDOLVWH-HOHUpSqWHOHVORLVpFULWHVGHPDQLqUHVLPSOHVRQWPHLOOHXUHVTXHOHVORLV
WURS WHFKQLFLHQQHV 'DLOOHXUV OHV GLVSRVLWLRQV GRUGUH UpJOHPHQWDLUH VRQW ELHQ VRXYHQW OHV
moins comprhensibles. Le problme est que la situation ne serait sans doute pas meilleure si
on associait plus troitement les lobbies GDLOOHXUVGpMjWUqVSUpVents jOpODERUDWLRQGHOD
loi.
M. Juanico a voqu le lien entre principe de subsidiarit et application des
directives europennes. La couche juridique nationale ajoute aux directives lors de leur
transposition en droit franais pourrait justement consister dire que les moyens employs
pour leur application doivent imprativement tre proportionns par rapport au but
recherch. Ce serait un premier pas vers un meilleur quilibre. Le droit communautaire
partage en effet avec le droit franais le dfauWGrWUHpFULWGHPDQLqUHWUqVWHFKQLFLHQQHDX
SRLQWGHQHSOXVODLVVHUGHSODFHjODSSOLFDWLRQGXSULQFLSHGHVXEVLGLDULWp qui est pourtant
un de ses principes fondamentaux, au mme titre que le principe de proportionnalit.
En ce qui concerne les tuGHVGLPSDFWMHOHUpSqWH : des tudes ex post permettront
GHQDPpOLRUHUODTXDOLWp
6DJLVVDQW GH OD SURFpGXUH SDUOHPHQWDLUH OD VROXWLRQ UHWHQXH ORUV GH OD UpIRUPH
constitutionnelle de 2008 ne me semble pas constituer un rel progrs. Je ne suis pas certain,
HQHIIHWTXHORQGLVFXWHPLHX[GXQWH[WHHQVpDQFHSXEOLTXHTXHQFRPPLVVLRQ0rPHVL
OHYRWHVROHQQHOQHSHXW VXUYHQLUTXHQVpDQFHSXEOLTXHODFRPPLVVLRQVDLVLHDXIRQG le
FDVpFKpDQWRXYHUWHjGDXWUHVGpSXWpV est peut-tre le meilleur lieu pour laborer le droit.
M me la prsidente Laure de La Raudire. Un tel argument va plutt dans le sens
de la rvision constitutionnelle de 2008.
M . Alain Lambert. &HTXLPHJrQHFHVWOHIDLWGHWUDYDLOOHUVXUOHWH[WHLVVXGHV
travaux de la commission plutt que sur la version initiale du projet de loi. Le risque est

250

TXXQ FRQIOLW VRXYUH HQWUH GHX[ ORJLTXHV  FHOOH GH ODXWHXU GX WH[WH LQLWLDO OH SRXYRLU
excutif, et celle du Parlement. On peut ainsi trouver dans certains textes des contradictions
coQVXEVWDQWLHOOHVDXPRGHGpODERUDWLRQGHODORL&HODpWDQWQpWDQWSOXVSDUOHPHQWDLUHMH
ne suis pas vraiment comptent pour donner un avis sur le sujet.
-HQYLHQVDXGpEDWVXUOHVILQDQFHVSXEOLTXHV-HQHYRLVSDVSRXUTXRLFRQWLQXHr
consacrer trois semaines au projet de loi de finances, alors que pas une virgule Q\ HVW
change&HODQDDXFXQVHQV (QRXWUHLOQHVXIILWSDVGHGLVFXWHUGHVILQDQFHVGHOeWDW : le
budget, les finances de la scurit sociale et celles des collectivits territoriales devraient tre
examins en mme temps. Il faudrait y consacrer trois jours, contre trois semaines la loi de
UqJOHPHQW (Q FH TXL FRQFHUQH OHV LQGLFDWHXUV OHV DXWHXUV GH OD /2/) QRQW MDPDLV
UHFRPPDQGpGHQDYRLUDXWDQWTXHFHX[TXLRQWpWpLQYHQWpVSDr Bercy. Il faut en diviser le
nombre par dix, en ne gardant que les plus robustes, ceux mme de procurer une vritable
LQIRUPDWLRQDX3DUOHPHQW3OXVJpQpUDOHPHQWODGRFWULQHGDSSOLFDWLRQGHOD/2/)GRLWrWUH
revue et simplifie de manire substantielle.
M me la prsidente Laure de La Raudire. -H WURXYH j OXVDJH TXH OH IDLW GH
GLVFXWHU HQ VpDQFH GX WH[WH DGRSWp SDU OD FRPPLVVLRQ HVW SOXW{W XQ JDJH GHIILFDFLWp (Q
RXWUH SRXVVHU MXVTXDX ERXW YRWUH UDLVRQQHPHQW OH[DPHQ GXQ WH[WH GRLW UHVSHFWHU la
logique de celui qui le produit , reviendrait supprimer le Snat et opter pour un rgime
PRQRFDPpUDO
9RXVDYH]pYRTXpODQpFHVVLWpGHWHPSpUHUODSSOLFDWLRQGXSULQFLSHGHSUpFDXWLRQ
Mais comment faire ? Faut-il le supprimer de la Constitution, ou au contraire inscrire dans
celle-ci un autre principe pour faire quilibre ? On observe en tout tat de cause que son
existence conduit le lgislateur se montrer extrmement prcautionneux, y compris
VDJLVVDQWGHVQRUPHVWHFKQLTXHV
Par ailleurs, comment mettre en place le principe de proportionnalit tout en
respectant la Constitution ?
M . Thierry M andon, rapporteur. /HVpWXGHVGLPSDFWERQQHVRXPDXYDLVHVVRQW
produites par ceux qui prsentent les textes et qui ont un intrt leur adoption. Or, au-del
PrPH GH OD TXDOLWp GH FHV pWXGHV FHVW OHXU SURIRQGHXU TXL ODLVVH j GpVLUHU  FHVW
SUDWLTXHPHQWXQSUREOqPHGRUGUHpSLVWpPRORJLTXH
'HOHXUF{WpOHVSURSRVLWLRQVGHORLQHIRQWSDVOREMHWGpWXGHVGLPSDFWSDVSOXV
GDLOOHXUVTXHOHV gros DPHQGHPHQWVFHX[GXQHLPSRUWDQFHVLJQLILFDWLYHPrPHVLFHWWH
LPSRUWDQFH HVW GLIILFLOH jpYDOXHU-HSHQVH jODPHQGHPHQW pigeons , sur un sujet qui a
SHUWXUEp SHQGDQW XQ DQ OpODERUDWLRQ GX SURMHW GH ORL VXU OH FRPPHUFH HW ODUWLVDQDW /H
Parlement ne devrait-LOSDVGDQVXQIXWXUSURFKHVHGRWHUGHVHVSURSUHVPR\HQVGDQDO\VH
HWGH[SHUWLVHDILQGHSURGXLUHVHVSURSUHVpWXGHVGLPSDFW ?
3DUDLOOHXUVOH*RXYHUQHPHQWGHPDQGHV\VWpPDWLTXHPHQWODYLVGX&RQVHLOGeWDW
VXU OHV WH[WHV TXLO pODERUH 2U QRXV QDYRQV SDV FRQQDLVVDQFH GX FRQWHQX GH FHV DYLV
autrement que par des fuites dans la presse. Si nous voulons amliorer la qualit de la loi, ne
serait-il pas utile que le Parlement en soit galement destinataire ?
Enfin, il serait peut-tre intressaQWjOLQVWDUGHFHTXLHVWSUDWLTXpGDQVFHUWDLQHV
FROOHFWLYLWpV ORFDOHV DX PRPHQW GX YRWH GX EXGJHW GRUJDQLVHU SUpDODEOHPHQW j OH[DPHQ
GXQWH[WHXQGpEDWGRULHQWDWLRQDXWRXUGHOpWXGHGLPSDFWTXLSHUPHWWUDLWGHVH[SULPHU
sur les questions de fond et de faire apparatre les divergences politiques, de faon rserver
la suite du dbat au travail proprement lgislatif.

251

M . Alain Lambert. En ce qui concerne le principe de prcaution, le Conseil


FRQVWLWXWLRQQHO QD MDPDLV YUDLPHQW FKHUFKp j YpULILHr son respect dans les textes adopts
GHSXLVVRQLQVFULSWLRQGDQVOHSUpDPEXOHGHQRWUH&RQVWLWXWLRQ(WFHVWIRUWVDJHGHVDSDUW
car il en est du principe de prcaution comme du quinquennat : il me parat difficile de
revenir en arrire sans que le dbDWVHQOLVH-HFLWHOHTXLQTXHQQDWSDUFHTXHMHFURLVTXHVRQ
DGRSWLRQ DLQVL TXH OLQYHUVLRQ GX FDOHQGULHU pOHFWRUDO D HQWUDvQp XQH PRGLILFDWLRQ GH QRV
institutions exposition du Prsident de la Rpublique, diminution du rle du Premier
ministre GXQHDPSOHXUTXHORQQDYDLWVDQVGRXWHSDVPHVXUpHORUVTXHODGpFLVLRQDpWp
prise. Il parat cependant politiquement difficile de corriger cette volution.
,O HQ HVW GH PrPH VDJLVVDQW GX SULQFLSH GH SUpFDXWLRQ : il serait sans doute sage,
GXQSRLQWGHYXHMXULGLTXHGHQVXSSULPHUODPHQWLRQGDQVOHSUpDPEXOHGHOD&RQVWLWXWLRQ
mais cela ne serait gure commode. Toutefois, dans la mesure o le Conseil constitutionnel
QHFRQVDFUHSDVVRQpQHUJLHjOHGpIHQGUHLOPHSDUDvWSRVVLEOHGDGRSWHUGHVGLVSRVLtions
qui, sans se dire explicitement contraires au principe de prcaution, pourraient cantonner
celui-ci dans un primtre le plus troit possible.
6DJLVVDQW GX SULQFLSH GH SURSRUWLRQQDOLWp OH &RQVHLO FRQVWLWXWLRQQHO comme
GDLOOHXUV OH &RQVHLO GeWDW D FODLUHPHQW DIILUPp OD SRVVLELOLWp GH OLQWURGXLUH GDQV OD ORL
FKDTXHIRLVTXLOSHXWHQIDFLOLWHUODSSOLFDWLRQ&HTXLQHVWSDVSRVVLEOHFHVWSDUH[HPSOH
DXGpWRXUGXQHORLRUJDQLTXHGDIILUPHUTXHFHSULQFLSHVDSSOLTXHjOHQVHPEOHGXGURLW Il
peut intervenir dans diffrents domaines juridiques tels que le droit du travail et bien sr le
droit pnal , mais pas en droit administratif  FHVW DLQVL TXH OHV DGPLQLVWUDWLRQV VH VRQW
protges.
,OHQYDGHVpWXGHVGLPSDFWFRPPHGHWRXWHVOHVSratiques nouvelles FHVWDYHFOH
WHPSVTXHORQSDUYLHQGUDjOHVDPpOLRUHUQRXYHDXMHPHIRQGHVXUOH[SpULHQFHFRQFUqWH
de la CCEN : chaque fois que nous avons annonc notre volont de raliser une valuation
ex post, nous avons constat une transIRUPDWLRQVXEVWDQWLHOOHGHVpWXGHVGLPSDFWFDUOHXUV
auteurs ont considr que leur crdibilit tait engage.
8QH TXHVWLRQ SOXV SURIRQGH HVW FHOOH GX GpVpTXLOLEUH GHV PR\HQV GH[SHUWLVH GX
3DUOHPHQWSDUUDSSRUWjFHX[GHOH[pFXWLI&HVWXQHGHVJUDQGHs faiblesses des institutions
de notre pays, lie son histoire centralise  OHV PR\HQV GH[SHUWLVH GH OH[pFXWLI VRQW
WRWDOHPHQWGLVSURSRUWLRQQpVSDUUDSSRUWjOXVDJHTXLOHQIDLWWDQGLVTXHFHX[GX3DUOHPHQW
sont plutt faibles. Il faudrait optimiser les ressources humaines de la puissance publique,
SDU H[HPSOH HQ D\DQW UHFRXUV DX[ FRUSV GLQVSHFWLRQ TXL VRQW GXQH JUDQGH TXDOLWp HW
H[FOXVLYHPHQWDXVHUYLFHGHOH[pFXWLI*UkFHjXQV\VWqPHGHPRELOLWpRQSRXUUDLWPHWWUHj
la disposition du ParlemeQW XQ FRUSV GH[SHUWLVH VLQRQ GLQVSHFWLRQ FRQVWLWXp GH FHV
inspecteurs GRQWFHUWDLQVVHQQXLHQWEHDXFRXS'DQVXQHGpPRFUDWLHTXLVHYHXWpTXLOLEUpH
o les pouvoirs excutif et lgislatif sont supposs jouer chacun leur rle, mais pas se
conduire en HQQHPLVXQHMXVWHUpSDUWLWLRQGHVPR\HQVGH[SHUWLVHFRQVWLWXHUDLWXQSURJUqV
6DJLVVDQW GHVDPHQGHPHQWV GLWV substantiels LOQ\DSDVGDXWUHVROXWLRQTXH
de laisser la commission saisie au fond le soin de les apprcier. En tant que rapporteur
gpQpUDO GX EXGJHW RX SUpVLGHQW GH OD &RPPLVVLRQ GHV ILQDQFHV MDL SDUIRLV YX DUULYHU GHV
DPHQGHPHQWV SUpSDUpV SDU OH[pFXWLI PDLV SDUIRLV SUpVHQWpV SDU GHV SDUOHPHQWDLUHV TXL
WHQGDLHQWjFKDQJHUGDQVGHVSURSRUWLRQVLQTXLpWDQWHVORUJDQLVDWLRQGXQUpJLPHILVFDO&HVW
en effet un sujet majeur, mais seule la commission saisie au fond aurait la lgitimit pour
DSSUpFLHUOHFDUDFWqUHVXEVWDQWLHOGXQDPHQGHPHQW
Quitte tre nouveau politiquement incorrect, je trouve inadmissible que les avis
du Conseil GeWDW QH VRLHQW SDV WUDQVPLV DX 3DUOHPHQW 2X DORUV LO IDXW TXH OH SRXYRLU

252

lgislatif dispose de son propre conseil XQFRQVHLOVRSSRVHUDLWjODXWUH ! Une dmocratie


QHSHXWVHVDWLVIDLUHGXQGpVpTXLOLEUHGHFHWWHQDWXUHGDXWDQWTXHOHFRQVHLOGHOH[pFXWLIHVW
DXVVLXQHMXULGLFWLRQ'HPrPHODTXHVWLRQGHODFUpDWLRQGXQFRQVHLOSRXUOHVFROOHFWLYLWpV
WHUULWRULDOHV YD ILQLU SDU VH SRVHU FDU FHVW VRXYHQW HQ VH SUpYDODQW GXQ DYLV GX &RQVHLO
GeWDWTXHOH[pFXWLIOHXULPSRVHGHVGLVSRVLWLRQVUpJOementaires. Et quand nous rclamons
FHWDYLVOH*RXYHUQHPHQWQRXVUpSRQGTXLOQDSDVOHGURLWGHOHWUDQVPHWWUH&HODQHSHXW
plus durer  7RXW VH SDVVH FRPPH VL OH 3DUOHPHQW GHYDLW OpJLIpUHU HQ IRQFWLRQ GXQ DYLV
DXTXHO LO QD SDV DFFqV (W VDJLVVDQW GX GURLW UpJOHPHQWDLUH FHVW OD PrPH LQVWLWXWLRQ TXL
FRQVHLOOHOH[pFXWLIHWTXLGDQVVDIRUPDWLRQMXULGLFWLRQQHOOHVHSURQRQFHVXUODFRQIRUPLWp
GHVGLVSRVLWLRQVjOD&RQVWLWXWLRQ7RXWFHODUHOqYHGXQHGpPRFUDWLHDSSUR[LPDWLYH
6DJLVVDQWGXGpEDWGorientation suggr par M. Mandon, un meilleur usage de la
discussion gnrale pourrait tre envisag. Celle-ci est en effet un moment plutt baroque
GX PRLQV HOOH OpWDLW DYDQW TXH MH TXLWWH OH 3DUOHPHQW  FHVW XQH VXFFHVVLRQ GH GLVFRXUV
mais certaiQHPHQW SDV XQH GLVFXVVLRQ (OOH GHYUDLW SRXUWDQW rWUH ORFFDVLRQ GpFKDQJHU VXU
OHVDVSHFWVOHVSOXVGpOLFDWVGXQWH[WHDILQTXHODGLVFXVVLRQVXUOHVDUWLFOHVVRLWXQHUpHOOH
discussion lgislative. La premire phase serait plus politique, la seconde plus technique. Il
faut donc amliorer la qualit de la discussion gnrale, quitte rduire les temps de parole
de chacun.
M . le rapporteur. Au fond, la vraie discussion gnrale a lieu lors des explications
de vote FHVWDYHFSHXW-tre les motions de procdure, le seul vritable moment o un dbat
SROLWLTXHpOHYpDOLHXVXUOHVHQMHX[GXQWH[WH0DLV ODGLVFXVVLRQJpQpUDOH \ FRPSULV VXU
GHV SURMHWV RX SURSRVLWLRQV GH ORL LPSRUWDQWV QHVW TXXQH VXFFHVVLRQ GH PRQRORJXHV :
chacun est concentr sur ce qXLOYDGLUHHWQRQVXUFHTXHGLWORUDWHXU(WHQFRPPLVVLRQOH
temps manque pour avoir un vritable dbat politique.
M me la prsidente Laure de La Raudire. 6DJLVVDQW GHV DPHQGHPHQWV TXL
tendent modifier structurellement un texte, la difficult HQDQDO\VHUOHVHQMHX[HVWGDXWDQW
plus grande que le Gouvernement, comme il en a le droit, les dpose parfois au dernier
moment. Cette facult qui lui est octroye a-t-elle un sens "3RXUPDSDUWHOOHPDWRXMRXUV
choque.
M . Rgis Juanico. Que pensez-vous, par ailleurs, de la suggestion de Thierry
0DQGRQ GH UHQIRUFHU OHV PR\HQV GH[SHUWLVH GpYROXV DX 3DUOHPHQW HW DX[ SDUOHPHQWDLUHV
eux-PrPHVSRXUDVVXUHUODTXDOLWpGXWUDYDLOGpODERUDWLRQGHODORLDLQVLTXHFHOOHGXVXLYL
et du contrle de son application ?
M . Alain Lambert. Soyons francs, madame la prsidente : le fait majoritaire, sous
la V 5pSXEOLTXH QHQWUDvQH SDV SRXU OH 3DUOHPHQW XQH REOLJDWLRQ GDGRSWHU WRXV OHV
DPHQGHPHQWVGX*RXYHUQHPHQW&HVWWRXWGHPrPHXQHFXULHXVHGpPRFUDWLHTXHODQtre,
RLOHVWMXJpGpOR\DOGHODSDUWGXQSDUOHPHQWDLUHGHODPDMRULWpGHUHMHWHUXQDPHQGHPHQW
du Gouvernement, quand bien mme celui-FLVHUDLWQRQSDVOHIUXLWGXQHYpULWDEOHLQWHQWLRQ
politique, mais la traduction de la volont des administrations centrales, motives par des
TXHVWLRQV WHFKQLTXHV TXL QH FRQFHUQHQW TXHOOHV 3RXUTXRL FKHUFKHU GHV VROXWLRQV
FRPSOLTXpHV DORUV TXLO VXIILUDLW j OD PDMRULWp GH QH SDV YRWHU FHV DPHQGHPHQWV ? Le fait
majoritaire est consubstantiel la Ve Rpublique. Mais TXDQG RQ \ DMRXWH OLQVWLWXWLRQ GX
TXLQTXHQQDWHWOLQYHUVLRQGXFDOHQGULHUFHVWILQDOHPHQWOH[LVWHQFHPrPHGX3DUOHPHQWTXL
est en jeu.
e

M . le rapporteur. &HVW MXVWHPHQW OD OLPLWH GH YRWUH UDLVRQQHPHQW : nous ne


sommes plus sous la Ve Rpublique, mais sous la Ve et demie ! Les dputs de la majorit
sont lus sous la photo du Prsident de la Rpublique ; leur lgitimit finit par ne procder

253

que de lui, ce qui entrave leur capacit politique. Cela changera peut-tre un jour mais
DXMRXUGKXLFHVWDLQVL
M me la prsidente Laure de La Raudire. Le problme du groupe majoritaire,
FHVWTXHIDFHjXQDPHQGHPHQWGpSRVpDXGHUQLHUPRPHQWLOQDSDVOHWHPSVGHQDQDO\VHU
OHFRQWHQXHWGRUJDQLVHUVDUpSRQVHDILQOHFDVpFKpDQWGHQpJRFLHUOHUHWUDLWGHFHUtaines
GLVSRVLWLRQVRXODGRSWLRQGHVRXV-amendements.
M . Alain Lambert. Le rapporteur a raison de souligner que la Ve Rpublique que
nous connaissons a perdu une grande partie de son esprit originel.
-DL VRXYHQW HX ORFFDVLRQ GH UpIOpFKLU DX SUREOqPH SRV par les amendements
GpSRVpV j OD GHUQLqUH PLQXWH -DL PrPH GpMj YX GHV DPHQGHPHQWV DSSRUWpV WHOOHPHQW j OD
GHUQLqUHPLQXWHSDUXQIRQFWLRQQDLUHTXHFHODUHYHQDLWjUHIXVHUDXPLQLVWUHTXHMpWDLVGHOH
OLUHDYDQWTXLOVRLWDSSHOp(QHIIHWGDQVFHUWDLns ministres, les directions gnrales ne se
SDUOHQWSDV$LQVLORUVTXXQDPHQGHPHQWHVWSURSRVpSDUODGLUHFWLRQGX7UpVRUVHVDXWHXUV
peuvent craindre que le ministre du Budget y voie une consquence budgtaire et soit tent
de ne le dfendre que mollHPHQW &HVW SRXUTXRL LOV QH OH WUDQVPHWWHQW TXDX GHUQLHU
PRPHQWQHODLVVDQWDXPLQLVWUHTXHODSRVVLELOLWpGHOHSUpVHQWHUVDQVODYRLUOXDXSDUDYDQW
,OPHVWGDLOOHXUVDUULYpGDQVXQHWHOOHFLUFRQVWDQFHGHVRXIIOHUDXUDSSRUWHXUGHQHVXUWRXW
pas aGRSWHU ODPHQGHPHQW HQ TXHVWLRQ RX GX PRLQV GH GHPDQGHU OD UpVHUYH GH ODUWLFOH
FRQFHUQp 6L ORQ YHXW pYLWHU GH YRWHU FRQWUH XQH SURSRVLWLRQ GX *RXYHUQHPHQW LO IDXW
utiliser toutes les ressources de la procdure pour discipliner la relation de sance entre le
Gouvernement et le Parlement et montrer que les parlementaires ne sont pas des greffiers
chargs de ratifier les dcisions des administrations centrales. Prcisons par ailleurs que le
GpS{W GXQ DPHQGHPHQW j OD GHUQLqUH PLQXWH SHXW DXVVL rWUH SRXU le Gouvernement, un
PR\HQ GpYLWHU OH[DPHQ SDU OH &RQVHLO GeWDW 4XRL TXLO HQ VRLW OLPSRUWDQW SRXU OD
commission saisie au fond, est de prvoir le temps ncessaire pour la discussion avec le
Gouvernement y compris, le cas chant, en ayant recours aux suspensions de sance.
6DJLVVDQWGHVPR\HQVDFFRUGpVDX3DUOHPHQWODVROXWLRQFRQVLVWDQWjOXLFRQVDFUHU
une partie des ressources humaines disponibles dans les inspections gnrales me parat
bonne. En revanche, il serait sans doute moins productif GDOORXHU j FKDTXH SDUOHPHQWDLUH
GHV PR\HQV VXSSOpPHQWDLUHV HQ UDLVRQ GH OHQJDJHPHQW LQpJDO GH FHV pOXV DX VHUYLFH GH
OpODERUDWLRQGHODORL,OVHUDLWSUpIpUDEOHGHUpVHUYHUFHVPR\HQVDX[FRPPLVVLRQV
M me la prsidente Laure de La Raudire. Merci, monsieur Lambert.
*
*

/D PLVVLRQ GLQIRUPDWLRQ SURFqGH ensuite j ODXGLWLRQ de M. Bruno Dondero,


SURIHVVHXUGHGURLWjO8QLYHUVLWpGH3DULV,3DQWKpRQ-Sorbonne.
M me la prsidente Laure de La Raudire. Nous sommes trs heureux de vous
accueillir, PRQVLHXU'RQGHURGDQVOHFDGUHGHQRWUHPLVVLRQGLQIRUPDWLRQGRQWOREMHWHVWOD
simplification lgislative, tant sur le plan de la procdure lgislative que sur celui des
normes. Notre travail est donc plutt ax sur le flux normatif, alors que le Conseil de la
simplification pour les entreprises, install par le Prsident de la Rpublique et coprsid par
notre rapporteur, M. 7KLHUU\0DQGRQVLQWpUHVVHUDGDYDQWDJHDXVWRFNGHVORLVH[LVWDQWHV

254

1RXV DYRQV FRPPHQFp QRV WUDYDX[ SDU XQ GpSODFHPHQW j OpWUDnger, en Belgique.
Nous nous rendrons Londres la semaine prochaine, Berlin la semaine suivante et La
Haye la fin du mois de mars. Certains pays ont dj conduit des travaux de rationalisation
du flux normatif, nous allons donc tudier leurs expriences. Nous avons galement procd
jGHVDXGLWLRQVGXQLYHUVLWDLUHVTXLVHVRQWLQWpUHVVpVDXVXMHWTXLQRXVSUpRFFXSH
3URIHVVHXU j OXQLYHUVLWp GH 3DULV , 3DQWKpRQ-Sorbonne, vous avez consacr un
FHUWDLQQRPEUHGDUWLFOHVjOLPSDFWTXRQWVXUOHGURLWGes socits des lois de simplification
telles celle du 22 PDUV  UHODWLYH j OD VLPSOLILFDWLRQ GX GURLW HW j ODOOpJHPHQW GHV
dmarches administratives ou celle du 2 janvier 2014, habilitant le Gouvernement
simplifier et scuriser la vie des entrepriseVQKpVLWDQWSDVjSDUOHUjFHSURSRVGH trouble
de la vision normative ou de rformite .
M . %UXQR 'RQGHUR SURIHVVHXU GH GURLW j O8QLYHUVLWp GH 3DULV , 3DQWKpRQSorbonne. -HYRXVUHPHUFLHGHOKRQQHXUTXHYRXVPHIDLWHVHQPLQYLWDQWjH[SRVHUGHvant
YRXV PD YLVLRQ GH OD VLPSOLILFDWLRQ OpJLVODWLYH &HVW HQ WDQW TXH VSpFLDOLVWH GX GURLW GHV
affaires, et non de la simplification lgislative en tant que telle VLWDQWHVWTXRQSHXWrWUHXQ
spcialiste dans un tel domaine TXHMHPH[SULPHUDL
Ce TXLPLQWpUHVVHFHVWOLPSDFWGHODORLHWSOXVJpQpUDOHPHQWGXGURLWVXUODYLH
GHV HQWUHSULVHV 2Q VH SURSRVH RUGLQDLUHPHQW GH VLPSOLILHU OH FDGUH UpJOHPHQWDLUH GXQH
HQWUHSULVH2UOLPSDFWGXGURLWVXUODYLHGXQHHQWUHSULVHQHVHUpGXLWSDVjFHOa. En effet,
OHVUHODWLRQVTXHOHQWUHSULVHHQWUHWLHQWDYHFGDXWUHVDFWHXUVVHVVDODULpVVHVDVVRFLpVRXVHV
DFWLRQQDLUHV VL HOOH HQ D VHV IRXUQLVVHXUV VHV FOLHQWV HW EHDXFRXS GDXWUHV DFWHXUV SULYpV
prsentent un aspect juridique, souvent contractuel. Chacune de ces relations peut en effet
rWUH VRXYHQW IRUPDOLVpH VRXV OD IRUPH GXQ FRQWUDW : contrat de travail, contrat de vente,
contrat de fourniture, contrat de socit. Chacune a ses spcificits. On peut, certes, tenter de
simplifier autant que possible la loi applicable chacune, mais cette tentative trouvera ses
limites  LO \ D XQ GHJUp GH FRPSOH[LWp LQpYLWDEOH VDXI j IDLUH SUHXYH GXQ simplisme
juridique .
(QRXWUHFHVUHODWLRQVQHUHOqYHQWSDVVHXOHPHQWGXQFDGUHSXUHPHQWOpJLVODWLIRX
rglementaire : la jurisprudence est une source importante du droit applicable aux
HQWUHSULVHV TXLO VDJLVVH GH OHXUV UHODWLRQV DYHF OHXUV VDODULpV RX GH FHOOHV TXHOOHV
entretiennent avec leurs clients, notamment les consommateurs, avec leurs associs ou leurs
IRXUQLVVHXUV 6LO HVW WRXMRXUV SRVVLEOH GH VLPSOLILHU OHV WH[WHV TXH IDLW-on de la
jurisprudence " (Q RXWUH VLPSOLILHU OHV WH[WHV UHYLHQW j DFFURvWUH OLPSRUWDQFH GH OD
MXULVSUXGHQFH DYHF WRXV OHV ULVTXHV TXH FHOD FRPSRUWH ,O QH VDJLW SDV GH Pettre en cause
OLQWHUYHQWLRQGHVMXJHVTXLIRQWXQWUDYDLOWUqVVpULHX[GDQVODWUqVJUDQGHPDMRULWpGHVFDVHW
GRQWODSSRUWHVWLQFRQWHVWDEOH5HVWHTXHODMXULVSUXGHQFHSRVHSUREOqPHHQWDQWTXHVRXUFH
GX GURLW TXL QHQ HVW SDV RIILFLHOOHPHQW XQH (OOe est difficile connatre, en raison du
QRPEUHFRQVLGpUDEOHGHGpFLVLRQVHWSDUFHTXHODUqJOHGXSUpFpGHQWQHVDSSOLTXHSDVGDQV
notre droit. quoi bon simplifier la loi, si la complexit est renvoye la jurisprudence ou
GDXWUHVFUpDWHXUVGHQRUPes, tels que les autorits administratives indpendantes ?
,OIDXGUDLWGDERUGVLQWHUURJHUVXUOHVUDLVRQVGHODFRPSOH[LWpHWGHOLQVWDELOLWpGH
notre droit. Les facteurs sont multiples OLQIOXHQFHGXGURLWHXURSpHQHWGXGURLWGpULYpTXL
QH[LVWDLW pas autrefois ; le rle important de la jurisprudence, dont le lgislateur doit tenir
compte OHVVRUGHODWHFKQLTXHRXHQFRUHODYRORQWpGHSURWpJHUOHFRQVRPPDWHXU7RXWFHOD
H[SOLTXH TXH OD ORL IUDQoDLVH VRLW DXMRXUGKXL FRPSOLTXpH (Q YRLFL XQ H[HPSOe, tir de
ODUWLFOH L. 225-44 du code de commerce et concernant la rmunration des administrateurs
des socits anonymes : Sous rserve des articles L. 225-21-1, L. 225-22, L. 225-23, L.
225-27 et L. 225-27-1, les administrateurs ne peuvent recevoir de la socit aucune

255

rmunration, permanente ou non, autre que celle prvue aux articles L. 225-45, L.225-46,
L.225-47 et L.225-53. . Pour lire un texte, il faut avoir ses dix doigts mobiliss car il
renvoie neuf articles diffrents, et si on veut le lire, il faut avoir plusieurs pages du code du
commerce sous les yeux. Toute clause statutaire contraire est rpute non crite et toute
dcision contraire est nulle . La sanction, au moins, est claire.
Peut-RQUpGXLUHODFRPSOH[LWpGHODORLTXLOVDJLVse des textes existants ou des lois
futures ? On a certes tent de le faire, notamment par les dernires grandes lois de
VLPSOLILFDWLRQ/HSUREOqPHFHVWTXHFHVWH[WHVVRQWWUqVGLIILFLOHVjVXLYUH$LQVLODORLGH
simplification du 22 mars 2012, dite loi Warsmann IV , est terrible pour les praticiens du
droit et je ne parle mme pas des entreprises ! DX[TXHOVLOPDUULYHGHODSUpVHQWHUORUV
de formations. Une bonne partie de ces grands vhicules lgislatifs ne relve pas de la
simplification. ,OVDJLWHQUpDOLWpGHORLV fourre-tout TXLjF{WpGHPHVXUHVGRQWOREMHFWLI
est bien de simplifier dans cette dernire loi, les dispositions les plus simplificatrices
taient celles qui permettaient aux PME de droger certaines rgles , comprennent des
GLVSRVLWLRQV TXL QRQW ULHQ j YRLU DYHF OD VLPSOLILFDWLRQ 'DQV OD ORL GX  janvier 2014
habilitant le Gouvernement simplifier et scuriser la vie des entreprises se trouvent ainsi
des dispositions sur les conventions rglementes ou la cession de parts sociales.
Surtout, ces deux textes introduisent de trs nombreuses modifications ponctuelles
GDQVOHGURLWGHVDIIDLUHVFHTXLHVWSDUWLFXOLqUHPHQWGDQJHUHX[,OPDDLQVLIDOOXSOXVLHXUV
aprs-midi de travail pour prendre connaissance de toutes les modifications introduites par la
dernire loi Warsmann  HW DORUV TXH MH PH VXLV OLPLWp j PRQ GRPDLQH GpWXGH 3DU
H[HPSOHODUWLFOH 17 de cette loi est ainsi rdig : Le chapitre III du titre II du livre II du
code de commerce est ainsi modifi /DUWLFOH/-26 est ainsi modifi : a) Le premier
alina est complt par une phrase ainsi rdige  6LODVVHPEOpHGHVDVVRFLpVQDSDVpWp
runie dans ce dlai, le ministre public ou toute personne intresse peut saisir le prsident
du WULEXQDOFRPSpWHQWVWDWXDQWHQUpIpUpDILQGHQMRLQGUHOHFDVpFKpDQWVRXVDVWUHLQWHDX[
grants de convoquer cette assemble ou de dsigner un mandataire pour y procder. ; b)
Au dbut du deuxime alina, les mots  cette fin, VRQWVXSSULPpV ; 2 A la premire
SKUDVHGXTXDWULqPHDOLQpDGHODUWLFOH/-27, le mot  quart HVWUHPSODFpGHX[IRLV
par le mot  dixime  ,OHVWSRVVLEOHTXXQHWHOOHPHVXUHVLPSOLILHTXHOTXHFKRVHPDLV
est-ce pour autant de la simplification ? En tout tat de cause, les lois de simplification
FKDQJHQWOpWDWGXGURLWFHTXLHVWHQVRLXQHFRPSOH[LWpVXSSOpPHQWDLUH4XRQVRLWMXJHRX
MXVWLFLDEOHLOIDXGUDSDUH[HPSOHGpWHUPLQHUODGDWHGHGpEXWGDSSOLFDWLRQGHODQRXYHOOH
rgle.
Des discours extrmes, QRWDPPHQW HQ SURYHQDQFH GH FHUWDLQV FKHIV GHQWUHSULVH
pourraient laisser penser que les entreprises pourraient se passer de droit. Or, si on peut
comprendre toute la contrainte que le droit reprsente pour une entreprise, il ne faut pas
FRQVLGpUHUTXLO HVWSRVVLEOHGHVHQSDVVHU/HIDLWTXLOHVWDXMRXUGKXLWUqVIDFLOHGDFFpGHU
DX[WH[WHVGHORLHWPrPHjOHVVHQWLHOGHODMXULVSUXGHQFH en trois clics sur un site tel que
/pJLIUDQFHYRXVDYH]DFFqVjQLPSRUWHTXHODUUrWGHOD&RXUGHFDVVDWLRQ QRXUULWOLOOXVLRQ
que la loi devrait tre trs simple. Il ne faut pas confondre accessibilit et simplicit. Notre
droit est compos de strates multiples : lois, rglements, dcisions des autorits
administratives indpendantes, jurisprudence. Si on est WURSVLPSOHRQULVTXHGrWUHLQMXVWH
HWXQWH[WHGXQIRUPDWWUqVFRXUW est parfois voque la bonne loi TXLVHUDLWGXQe page
et demie SHXWUHQYR\HUODFRPSOH[LWpjGDXWUHV
Le principe du one in, one out WRXWH FUpDWLRQ GXQH QRUPH QRXYHOOe doit
VDFFRPSDJQHU GH OD VXSSUHVVLRQ GXQH QRUPH H[LVWDQWH peut tre intressant si cela
signifie que toute nouvelle contrainte pour les entreprises doit tre compense par la

256

VXSSUHVVLRQ GXQH FRQWUDLQWH H[LVWDQWH 6L FHOD VLJQLILH HQ UHYDQFKH TXH ORQ QH GRLW SDV
DGRSWHUXQHORLVDQVHQVXSSULPHUXQHDXWUHFHODODLVVHSHQVHUTXXQIOX[QRUPDWLIFRQWLQX
laisse survivre des textes anciens, alors que souvent la loi nouvelle abroge, expressment ou
implicitement, la loi ancienne. Il est vrai, en revanche, que dans certaines hypothses, loi
nouvelle et loi ancienne peuvent coexister pendant un certain temps ORUVTXXQHORLQRXYHOOH
HQWUHHQYLJXHXUOHVFRQWUDWVFRQFOXVVRXVOHPSLUHGHODORLDQFLHQQHUHVWHQWUpJLVSDUFHWWH
dernire.
6LOIDXWFHUWHVVDWWDFKHUjVLPSOLILHUHWVWDELOLVHUOHGURLWGHVDIIDLUHVLOIDXWUHVWHU
conscient que son caractre complexe et changeant est le reflet invitable de la complexit et
GH OLQVWDELOLWp GH OD UpDOLWp TXLO GRLW DSSUpKHQGHU /H GURLW GHV SURFpGXUHV FROOHFtives, ou
droit des faillites, par exemple, est terriblement complexe et changeant. Ces dispositions,
runies dans le livre 9, GX FRGH GH FRPPHUFH VRQW HQ WUqV JUDQG QRPEUH HW OpYROXWLRQ
MXULVSUXGHQWLHOOHHVWSHUPDQHQWH2QSRXUUDLWLPDJLQHUUpGXLUHOHQsemble de ces textes une
GL]DLQHGDUWLFOHVSRVDQWGHVUqJOHVGHSULQFLSH SDUH[HPSOHOHSULQFLSHTXXQHHQWUHSULVH
HQ GLIILFXOWp SHXW GDQV FHUWDLQV FDV EpQpILFLHU GXQ PRUDWRLUH SRXU VHV FUpDQFHV 0DLV FH
serait alors au juge de rpondre aux questiRQVTXLQDXUDLHQWSDVWURXYpGHUpSRQVHGDQVOD
loi 4XHOOHVGLIILFXOWpVMXVWLILHQWODSSOLFDWLRQGXQPRUDWRLUH ? Tous les cranciers doiventils tre traits de la mme faon, ou les salaris ont-ils droit un traitement particulier ?
Certaines crances, telles les crances fiscales, ne devraient-HOOHV SDV UHOHYHU GXQ VWDWXW
particulier ? Que se passe-t-il si un repreneur se manifeste ? Le tribunal a-t-il son mot
dire ? UHFUpDQWDLQVLXQGLVSRVLWLISRXUDLGHUOHVHQWUHSULVHVHQGLIILFXOWp&HVWDLQVLTXHQ
voulant rduire la complexit, on risque de compliquer encore les choses.
M me la prsidente Laure de La Raudire. /HV FKHIV GHQWUHSULVH VH SODLJQHQW
VRXYHQW GH OH[WUrPH FRPSOH[LWp GH FHUWDLQHV SURFpGXUHV HW GX IDLW TXH FHUWDLQHV GH OHXUV
dcisions soient ainsi remises en cause pour des raisons de pure forme. Avez-vous des pistes
de solution dans ce domaine prcis ?
M me Ccile Untermaier. Il est vrai que les lois de simplification sont souvent les
PRLQVOLVLEOHV/DORLPRGLILDQWODUWLFOHGXQcode ne devrait-elle pas comporter le texte du
nouvel article redig dans son intgralit ?
Comment faire pour que la loi ne soit pas encombre de dispositions de nature
rglementaire, le Conseil constitutionnel ne se prononant pas sur ce point ? Une loi devrait
se limiter noncer des principes et renvoyer au dcret les cas particuliers.
M . Rgis Juanico. Vous avez mis en vidence la grande complexit du droit des
entreprises, notamment en raison du droit europen. Face cette complexit, les entreprises
ne sont pas gales : alors que les plus grandes disposent de conseillers juridiques ou de
directions des ressources humaines, les PME et les TPE de nos territoires sont dsarmes.
&RPPHQWSHUPHWWUHjQRVSHWLWHVHQWUHSULVHVGDIIURQWHUFHWWHFRPSOH[LWpMuridique ?
M . Thierry M andon, rapporteur. 9RXVQRXVDYH]H[SOLTXpTXHVLPSOLILHUFpWDLW
compliqu, et les rsultats modestes de toutes les tentatives de simplification qui se sont
succd depuis des dcennies vous donnent raison. Je suis persuad cependant que, fort de
YRWUH H[SpULHQFH YRXV QDXULH] DXFXQ PDO j QRXV SURSRVHU XQH GL]DLQH GH VLPSOLILFDWLRQV
utiles aux entreprises.
2XWUH TXHOOH HVW VRXUFH GLQpJDOLWpV HQWUH OHV HQWUHSULVHV OD FRPSOH[LWp GH QRWUH
droit pose un problme de comptitivit : un droit illisible et complexe gnre de la lenteur et
GH OLQVpFXULWp MXULGLTXH DORUV TXH OHV LQYHVWLVVHXUV RQW EHVRLQ GH UDSLGLWp HW GH VpFXULWp
juridique. Il y a donc un rel enjeu conomique derrire ces questions.

257

9RXVQDYH]SDVpYRTXpODTXHVWLRQGes contradictions qui peuvent exister entre la


ORLHWOHVGpFUHWVGDSSOLFDWLRQ(VW-ce un problme que vous rencontrez souvent dans votre
FKDPSGpWXGH ?
M . Bruno Dondero. On peut en effet juger notre droit excessivement formaliste,
madame la prsidente. La question de la forme peut cependant tre essentielle, en droit des
contrats par exemple. Il me semble que les problmes que vous voquez sont plutt lis aux
UHODWLRQV DYHF ODGPLQLVWUDWLRQ TXL SRXU FDULFDWXUHU UHIXVH WURS VRXYHQW GDFFXHLOOLU OHV
demandes des entreprises prsentant des irrgularits formelles. Il faudrait, tout en respectant
OHSULQFLSHGpJDOLWpTXHODFROODERUDWLRQGHODGPLQLVWUDWLRQVRLWOHSULQFLSHHWTXHFHOOH-ci
facilite, au contraire, les dmarches des entreprises.
Il est vrDLPDGDPH8QWHUPDLHUTXHOHVLPSOHUHQYRLjODUWLFOHPRGLILpUHQGODORL
assez peu lisible pour le justiciable ordinaire. Un avocat peut prendre le temps de se rfrer
DXWH[WHDQFLHQPDLVFHVWSOXVGLIILFLOHSRXUOHFKHIGXQH30(RXGXQH73(
Cela pose un question plus gnrale : comment tre inform de la nouvelle norme ?
Certes, il y a le Journal officielPDLVMHQHVXLVSDV FHUWDLQTXXQ FKHI GHQWUHSULVHSXLVVH
comme moi consulter tous les matins le sommaire du JO. Et je ne parle l que des textes de
loi, des ordonnances et des dcrets ou des arrts. Comment ce dirigeant pourra-t-il prendre
connaissance des dcisions jurisprudentielles qui modifient substantiellement
OHQYLURQQHPHQW MXULGLTXH GH VRQ HQWUHSULVH ? Il faudrait trouver les moyens de faire
FRQQDvWUHOHVQRXYHOOHVQRUPHVDX[LQWpUHVVpV8QFKHIGHQWUHSULVHQHSHXWSDVVXLYUHWRXWH
la littrature juridique et mme les avocats sont submergs par la multiplication des normes.
,OIDXWFRPPXQLTXHUVXUOpWDWGXGURLWHWVXUVRQpYROXWLRQ
M . Rgis Juanico. Faudrait-LOLQWpJUHUGDQVOHVpWXGHVGLPSDFWXQYROHWFRQVDFUpj
ODSSOLFDELOLWp GH OD ORL DX[ HQWUHSULVHV GH WRXWHV GLPHQVLRQV MXVTXj OD SOXV SHWLWH
QRWDPPHQWOHWHPSVDGPLQLVWUDWLITXHVDPLVHHQXYUHLQGXLW ?
M . Bruno Dondero. NuOQpWDQWFHQVpLJQRUHUODORLFKDFXQHVWSUpVXPpFRQQDvWUH
la loi qui lui est applicable. Il serait nanmoins utile de prvoir des mesures de pdagogie
SRXU DFFRPSDJQHU OD ORL QRXYHOOH &HOD D GDLOOHXUV pWp IDLW SRXU FHUWDLQHV UpIRUPHV
importantes. Mme pour un praticien du droit, une loi de porte gnrale comme la loi
Warsmann fourmille de chausse-WUDSHVVXVFHSWLEOHVGHQJDJHUVDUHVSRQVDELOLWpFLYLOHHW
professionnelle par ignorance des innombrables modifications de dtail introduites par ce
texte.
La question de la rpartition des comptences entre loi et rglement ou celle de la
FRQWUDGLFWLRQpYHQWXHOOHHQWUHODORLHWOHGpFUHWGDSSOLFDWLRQQHVRQWSDVGHVSUREOpPDWLTXHV
IRQGDPHQWDOHVGDQVPRQGRPDLQH,O HVWYUDLTXHQGURLWGHVDIIDLUHVEHDXcoup de normes
WHFKQLTXHVVRQWGpILQLHVSDUODORLDORUVTXHOOHVUHOqYHQWSOXW{WGXGpFUHW$LQVLHQPDWLqUH
GRUJDQLVDWLRQGHVHQWUHSULVHVRXGHVUHODWLRQVTXHOOHVHQWUHWLHQQHQWDYHFOHVDXWUHVDFWHXUV
ODORLDWHQGDQFHjGHVFHQGUHMXVTXDX[GpWDLOVles plus techniques et les plus pointus. Je ne
VDLV VLO IDXW ODWWULEXHU j XQ PDQTXH GH FRQILDQFH GDQV ODXWRULWp UpJOHPHQWDLUH RX j OD
volont de matriser tout le processus.
2QSHXWVpWRQQHUjOLQYHUVHTXHOHOpJLVODWHXUTXLQKpVLWHSDVjSUHQGUH brasle-corps les sujets les plus techniques, envisage de dlguer sa comptence au pouvoir
UpJOHPHQWDLUHVDJLVVDQWGHUpIRUPHVGHIRQGTXLPpULWHUDLHQWGHORQJVGpEDWVHWXQHFHUWDLQH
publicit. Je pense notamment la proposition de rforme par ordonnance du droit des
contrats, dont on parle depuis longtemps et qui concerne de nombreux domaines.

258

La codification est certes cense favoriser la simplification, mais on aboutit des


codes de dimension lphantesque, tels que le code du travail, le code de OHQYLURQQHPHQWRX
le code montaire et financier, et finalement on retrouve la complexit laquelle on voulait
pFKDSSHU  OLQYHUVH LO H[LVWH j F{Wp GH microcodes consacrs, par exemple, la
dontologie de tel ou tel mtier.
Le droit europen est videmment un facteur de complexit. Il est incontestable que
les PME-73(QHVRQWSDVpTXLSpHVSRXUVXLYUHOpYROXWLRQGXGURLWGpULYpHWVRQWLQFDSDEOHV
GDQWLFLSHU OHV FKDQJHPHQWV GH OpJLVODWLRQ 2Q SHXW FHSHQGDQW SUpYRLU GHV DPpQDJHPHQWV
spcifiques pour ces entreprises, dans la mesure o le droit europen le permet.
Vous me demandez, monsieur le rapporteur, des propositions de simplification.
7RXWMXULVWHDUHQFRQWUpGHVGLVSRVLWLRQVTXLODMXJpHVLQXWLOHPHQWFRPSOH[HVRXREVFXUHVHW
MDL HQ HIIHW EHDXFRXS GLGpHV HQ OD PDWLqUH 0DLV XQ DXWUH MXULVWH SRXUUDLW MXJHU TXH PHV
SURSRVLWLRQVOqVHQWWHOLQWpUrWRXWHOOHFDWpJRULHGHFLWR\HQV(QUpDOLWpODTXHVWLRQQHVWSDV
que technique : elle est aussi politique.
Je suis par ailleurs tout autant que vous sensible la question de la comptitivit du
droit. Il est vrai que notre droit des contrats, par exemple, est peu lisible pour des
investisseurs trangers : il relve de textes anciens, et la jurisprudence y joue un grand rle.
Il vaudrait mieux dispoVHU GXQ GURLW LPPpGLDWHPHQW DFFHVVLEOH HW OLVLEOH ,O IDXGUDLW
QRWDPPHQWTXHODORLLQWqJUHUpJXOLqUHPHQWODFTXLVMXULVSUXGHQWLHOFHTXLQDSUDWLTXHPHQW
jamais t fait dans cette matire. Il ne faut pas nier cependant la ncessit de la
jurisprudence, surtout quand le texte de la loi est simple.
M me la prsidente Laure de La Raudire. Ne faudrait-il pas amliorer le
SURFHVVXV GpYDOXDWLRQ GH OD ORL WURLV RX TXDWUH DQV DSUqV VRQ DGRSWLRQ SOXW{W TXH GH
multiplier les drogations dans des lois de simplification touchant de nombreux domaines ?
Cette valuation peut tre dlicate, pour des raisons politiques, quand il y a alternance. Mais,
au-GHOjGHVHQMHX[OLpVDX[FKDQJHPHQWVGHPDMRULWpTXHQSHQVH]-vous ?
M . Bruno Dondero. Il serait en effet intressant de vrifier si la loi est
effectivement applique. Les petites entreprises contreviennent systmatiquement certaines
GLVSRVLWLRQVOpJLVODWLYHVSDUFHTXHOOHVVRQWWURSGLIILFLOHVjDSSOLTXHU-DLFRQVFLHQFHGHFH
TXLOSHXW\DYRLUGHFKRTXDQWGDQVOHSULQFLSHGpYDOXHUODSSOLFDWLRQUpHOOHGHODORLPDLVLO
HVWLQFRQWHVWDEOHTXHFHUWDLQHVORLVVRQWLQDSSOLFDEOHV,OIDXGUDLWpYDOXHUODSSOLFDELOLWpGXQH
ORL QRQ VHXOHPHQW HQ DPRQW DX VWDGH GH OpWXGH GLPSDFW PDLV pJDOHPHQW a posteriori,
condiWLRQ GH GLVWLQJXHU VRLJQHXVHPHQW OH UHIXV GDSSOLFDWLRQ SRXU GHV PRWLIV SROLWLTXHV GH
celui qui dcoule de raisons techniques.
M me la prsidente Laure de La Raudire. Une telle valuation des dispositifs
vots, au regard notamment de la jurisprudence laquelle ils conduisent, serait bien
GLVWLQJXHUGXQHpYDOXDWLRQGHSROLWLTXHSXEOLTXH(OOHSRXUUDLWrWUHFRQILpHVRLWjODXWHXUGH
OpWXGHGLPSDFWVRLWDX[SDUOHPHQWDLUHV
M . Rgis Juanico. Il faudrait galement la distinguer du suivi des dcrets
GDSSlication, dj effectu par les parlementaires. Il faudrait un suivi supplmentaire, avec
SOXV GHUHFXO SDUUDSSRUWjODGDWHGDGRSWLRQGHODORLSRXUREVHUYHUFRPPH vit la loi
adopte.
M me Ccile Untermaier. On pourrait imaginer confier ce soin au rapporteur de la
ORLTXLVHVWSDUWLFXOLqUHPHQWLQYHVWLGDQVOHWUDYDLOOpJLVODWLI

259

M me la prsidente Laure de La Raudire. Je vous remercie, monsieur le


professeur, pour cette audition intressante.
M . Bruno Dondero. &HVTXHVWLRQVGDSSOLFDWLRQGHODORLsont essentielles pour les
professeurs de droit.

260

Sance du mercredi 19 fvrier 2014


/D PLVVLRQ GLQIRUPDWLRQ SURFqGH j ODXGLWLRQ de M. Serge Lasvignes, Secrtaire
gnral du Gouvernement et de M. Thierry-Xavier Girardot, directeur, adjoint au Secrtaire
gnral du Gouvernement.
M me la prsidente Laure de La Raudire. Monsieur le Secrtaire gnral,
PRQVLHXU OH 'LUHFWHXU OHV WUDYDX[ GH QRWUH PLVVLRQ GLQIRUPDWLRQ YLVHQW GDYDQWDJH XQH
rationalisation du flux normatif que la simplification du stock des normes lgislatives et
rglementaires dont se proccupe le Gouvernement, en troite collaboration avec M. Thierry
Mandon, dans le cadre du conseil de la simplification.
&HWWH PLVVLRQ GH O$VVHPEOpH QDWLRQDOH VXU OH mieux lgifrer , voulue par le
prsident Bartolone, rflchit aux moyens de provoquer un changement de culture
normative HQVLQVSLUDQWQRWDPPHQWGHVH[HPSOHVpWUDQJHUV
Nous nous sommes rendus la semaine dernire Berlin, o nous avons rencontr le
ministre charg de la simplification, M. Helge Braun, ainsi que des reprsentants du conseil
de contrle des normes (NKR).
La semaine prcdente, nous nous tions entretenus Londres avec le prsident du
FRPLWpLQGpSHQGDQWFKDUJpGHFRQWU{OHUODTXDOLWpGHVpWXGHVGLPSDFW Regulatory Policy
Committee (RPC) DLQVLTXDYHFGHVUHSUpVHQWDQWVGXBetter Regulation Executive (BRE).
Le mois dernier, nous avons effectu un dplacement Bruxelles pour y rencontrer
QRWDPPHQW GHV UHSUpVHQWDQWV GH O$JHQFH GH OD VLPSOLILFDWLRQ DGPLQLVWUDWLYH EHOJH HW GX
EXUHDXGHOD&RPPLVVLRQHXURSpHQQHFKDUJpGpYDOXHUODTXDOLWpGHVpWXGHVGLPSDFW
&HV H[HPSOHV pWUDQJHUV QRXUULVVHQW QRWUH UpIOH[LRQ VXU OLPSRUWDQFH GXQH
valuation ex ante REMHFWLYH HW LQGpSHQGDQWH HW GXQH pYDOXDWLRQ ex post mthodique.
OKHXUH DFtuelle, en effet, si la Cour des comptes value les politiques publiques et si
O$VVHPEOpH QDWLRQDOH FRQWU{OH OD PLVH HQ DSSOLFDWLRQ GHV ORLV LO QHVW SURFpGp j DXFXQH
valuation des lois votes.
cet gard, votre point de vue, monsieur le Secrtaire gnral, nous intresse au
SOXVKDXWSRLQWFDUYRXVMRXH]XQU{OHFOpGDQVODSURGXFWLRQGHVpWXGHVGLPSDFWTXLGHSXLV
la rvision constitutionnelle du 23 MXLOOHWHWOHQWUpHHQYLJXHXUGHODORLRUJDQLTXHGX
15 avril 2009, doivent obligatoirement accompagner les projets de loi dposs sur le bureau
des assembles. Nous serions heureux de connatre le regard que vous portez, avec le recul,
VXU OH SURFHVVXV GpODERUDWLRQ GHV pWXGHV GLPSDFW PLV HQ XYUH GHSXLV ELHQW{W FLQT DQV
1KpVLWH]SDVQRQSOXVjQous donner votre point de vue sur la qualit moyenne de celles-ci.
Nous souhaiterions galement que vous nous prsentiez le rle que vous pouvez
jouer en matire de gestion du flux rglementaire HQSDUWLFXOLHUGHSXLVTXDpWpPLVHQ
place, le 1er septembre 2013, le principe du one in, one out pour les textes de nature
rglementaire, conformment la circulaire du Premier ministre du 17 juillet 2013 relative
ODPLVHHQXYUHGXJHOGHODUpJOHPHQWDWLRQ4XHOOHVPHVXUHVDYH]-vous prises cette fin ?
Pourriez-YRXVSDUDLOOHXUVQRXVGRQQHUYRWUHDQDO\VHGHVFRQGLWLRQVGDSSOLFDWLRQ
GHVORLVWDQWVXUODGRSWLRQGHVGpFUHWVGDSSOLFDWLRQTXHVXUOHXUpYDOXDWLRQex post ?

261

Enfin, nous serions heureux de recueillir votre point de vue sur certains aspects de
OD SURFpGXUH GpODERUDWLRQ GHV QRUPHV HQ SDUWLFXOLHU VXU OD PpWKRGH GH WUDQVSRVLWLRQ GHV
directives europennes.
Je vous laisse donc la parole, monsieur le Secrtaire gnral, pour un expos
OLPLQDLUHGXQHTXLQ]DLQHGHPLQXWHVDYDQWTXHPHVFROOqgues et moi-mme ne vous posions
quelques questions.
M . Serge Lasvignes, secrtaire gnral du Gouvernement. Vaste programme ! Je
SRUWH VXU FHV VXMHWV XQH DSSUpFLDWLRQ GH FOLQLFLHQ RX GH PpGHFLQ GH FDPSDJQH HW QDL SDV
GRSLQLRQWUDQVYHUVDOHVXUOHSRLGVexcessif ou non, de la norme.
(QUHYDQFKHLOHVWYUDLTXHOpYDOXDWLRQHVWXQGHVSRLQWVIDLEOHVGHQRWUHV\VWqPH
/D)UDQFHQDSDVOD FXOWXUHGHOpYDOXDWLRQ GHV QRUPHV /HVGLYHUVHVH[SpULHQFHV
TXH MDL HVVD\p GH SURPRXYRLU HQ YXH GDPHQHU OHV organismes de rflexion stratgique
VLQWpUHVVHU j OpYDOXDWLRQ GH OD QRUPH MH SHQVH DX FHQWUH GDQDO\VH VWUDWpJLTXH TXL D
GLVSDUX RX j ODFWXHO FRPPLVVDULDW JpQpUDO j OD VWUDWpJLH HW j OD SURVSHFWLYH QRQW SDV
DERXWL -DL pJDOHPHQW HVVD\p GH FRQVWLWXHU XQ UpVHDX LQWHUPLQLVWpULHO GpYDOXDWHXUV : la
UpXQLRQ LQWHUPLQLVWpULHOOH VHVW SURQRQFpH WUqV IDYRUDEOHPHQW VXU OH SURMHW PDLV RQ QHVW
MDPDLVSDVVpjODFWH !
/HV DGPLQLVWUDWLRQV FHQWUDOHV QRQW SDV XQ GpVLU GpYDOXDWLRQ VSRQWDQp (OOHV
ressentenW YLWH OD GpPDUFKH GpYDOXDWLRQ FRPPH XQH FKDUJH LQGXH HW UHQkFOHQW j UpSRQGUH
aux demandes de Matignon cet gard.
Il a fallu en arriver, aprs plusieurs circulaires et quelques rapports, une rvision
de la Constitution pour obtenir en France des tudeV GLPSDFW KRQRUDEOHV 1RXV DYRQV G
ensuite faire preuve de tnacit, donner des instructions de mthode et faire des observations
VXUOHQLYHDXGHOpYDOXDWLRQSRXUDUULYHUjODVLWXDWLRQDFWXHOOHTXL HVW HQGHPL-teinte. En
effet, si tous les ministres RQW GpVRUPDLV FRPSULV TXLOV QH SRXYDLHQW SOXV pFKDSSHU j
OpWXGHGLPSDFWGHVSURMHWVGHORLHQUHYDQFKHODWWHQWLRQSRUWpHjFHOOH-ci est inversement
SURSRUWLRQQHOOHjODFKDUJHSROLWLTXHGXWH[WHOHVPHLOOHXUHVpWXGHVGLPSDFWSRUWDQWVRXYHQW
sur leVWH[WHVGpSRXUYXVGHWRXWHQMHXSROLWLTXH'DLOOHXUVOpWXGHGLPSDFWQDVHUYLTXXQH
VHXOHIRLVjGpFLGHUVLOIDOODLWRXQRQOpJLIpUHUVXUXQVXMHWGRQQpDORUVTXHWHOOHGHYUDLWrWUH
sa fonction premire  LO VDJLVVDLW GXQ WH[WH WHFKQLTXH OpWXGH GLPSDFW UpYpODQW TXH OHV
LQFRQYpQLHQWVGXQHQRXYHOOHOpJLVODWLRQOHPSRUWDLHQWVXUVHVDYDQWDJHV
/HV pWXGHV GLPSDFW UHVVHPEOHQW GDYDQWDJH j OKHXUH DFWXHOOH j XQ H[SRVp GHV
PRWLIV HQULFKL TXDX PRGqOH GH O2UJDQLVDWLRQ GH FRRSpUDWLRQ HW GH GpYHORSSHment
pFRQRPLTXH 2&'(  SRXU ODTXHOOH OpWXGH GLPSDFW VHUW j DMXVWHU OH GLVSRVLWLI TXL VHUD
UHWHQX7RXWHIRLVOHXUTXDOLWpYDULHHW QRXVREWHQRQVSDUIRLV GHERQQHV pWXGHVGLPSDFW \
compris sur des textes importants.
Il serait en revanche draisonnable de militer pour une approche scientiste de la
SURGXFWLRQOpJLVODWLYH8QHpWXGHGLPSDFWPrPHUHPDUTXDEOHQHSRXUUDMDPDLVGpFLGHUGH
OHQJDJHPHQWGXQHUpIRUPH : elle doit davantage servir amnager le dispositif retenu, voire
en modifier certaines dLVSRVLWLRQV WHFKQLTXHV ,O QH VDJLW SDV GH UpXQLU XQ DUpRSDJH
GH[SHUWVHQYXHGHGpWHUPLQHUvia OpWXGHGLPSDFWVLO\DOLHXGHUpIRUPHU
Quant nos instruments, si des efforts ont t raliss en matire de quantification,
la dimension conomique demeure insuffisante et doit tre amliore. Il faudrait galement
associer davantage les politiques ce travail, comme les Britanniques qui font venir le

262

PLQLVWUHSRUWHXUGXQSURMHWHWOXLIRQWPHVHPEOH-t-LOVLJQHUXQHDWWHVWDWLRQFHUWLILDQWTXLOD
pULVFRQQDLVVDQFHGHOpWXGHGLPSDFWHWTXLO\DELHQPDWLqUHjOpJLIpUHU&HWWHSUDWLTXHHVW
XQSHXIRUPHOOHPDLVWURSVRXYHQWHQ)UDQFHOH[HUFLFHSROLWLTXHGHODSUpSDUDWLRQGHODORL
HVWVpSDUpGHOH[HUFLFHDGPLQLVWUDWLIGHOpWXGHGLPSDFW
EnfinLOHVWQpFHVVDLUHGHUHFRXULUjODSUHVVLRQH[WpULHXUH/H&RQVHLOGeWDWMRXH
en partie ce rle puisque, aux termes de la rvision constitutionnelle, il doit disposer de
OpWXGH GLPSDFW SRXU UHQGUH VRQ DYLV VXU OH WH[WH HQ SUpSDUDWLRQ 2U OHV DGPLQLVWrations
centrales ont fini par comprendre que si elles drogeaient cette obligation, elles risquaient
GHVHKHXUWHUjODYLVGX&RQVHLOGeWDWTXLDFRPPHQFpjIDLUHGHVREVHUYDWLRQVSHUWLQHQWHV
VXUOHFRQWHQXGHVpWXGHVGLPSDFW1HVHUDLW-il pas possiEOHGHGHPDQGHUDX&RQVHLOGeWDW
GH UHQGUH XQ DYLV TXL VHUDLW UHQGX SXEOLF VXU OpWXGH GLPSDFW HOOH-mme ? Le Parlement
doit, lui aussi, porter ce regard extrieur critique  OHV LQLWLDWHXUV GH OpWXGH GLPSDFW RQW
parfois regrett que les dputs et lHV VpQDWHXUV QH VLQWpUHVVHQW SDV GDYDQWDJH DX[ pWXGHV
GLPSDFW
/D JHVWLRQ GHV IOX[ UpJOHPHQWDLUHV HVW DXMRXUGKXL PLHX[ PDvWULVpH TXH OD
SURGXFWLRQ OpJLVODWLYH 6L MH[FOXV OHV WH[WHV QpFHVVDLUHV j ODSSOLFDWLRQ GHV ORLV RX j OD
transposition des directives europennes, tous les autres textes rglementaires sont contrls
et valus. Les nouvelles charges doivent tre justifies, faute de quoi le texte est bloqu.
Depuis le 1er septembre dernier, la mise en application du systme du un pour un permet
GHTXDQWLILHUOLPSDFWGXQRXYHDXWH[WHVXUXQHDFWLYLWpOHPLQLVWqUHGHYDQWVXSSULPHUXQH
charge au moins comparable dans un autre domaine de la rglementation. Le solde est pour
OLQVWDQW SRVLWLI SXLVTXH OD VLPSOLILFDWLRQ GH OD FKDUJH UpJOHPHQWDLUH HVW suprieure son
accroissement.
'H QRPEUHX[ SURJUqV RQW pWp UpDOLVpV HQ PDWLqUH GH GpFUHWV GDSSOLFDWLRQ JUkFH j
notre tnacit : 82 % des dispositions rglementaires exiges par les lois adoptes au cours
GH OD SUHPLqUH DQQpH GH ODFWXHOOH OpJLVODWXUH Rnt t prises, 65  OD\DQW pWp HQ PRLQV GH
six PRLV&HVWXQSURJUqVUpHOPDLVRQSHXWIDLUHHQFRUHPLHX[,OHVWYUDLTXHOHVQRXYHOOHV
H[LJHQFHV HQ PDWLqUH GpWXGH GLPSDFW GH SUpSDUDWLRQ UDLVRQQpH GH OD UpJOHPHQWDWLRQ GH
consultations et de tests iQWHUGLVHQWGHSXEOLHUWUqVUDSLGHPHQWOHVGpFUHWVGDSSOLFDWLRQ8Q
quilibre est trouver entre la maturation des nouvelles rglementations et le souci
GDFFpOpUHUODSSOLFDWLRQGHVORLV'HSOXVOHVDGPLQLVWUDWLRQVFHQWUDOHV FHVWXQHGHOHXUV
faiblesses traditionnelles ne matrisent que mdiocrement les procdures : elles procdent
de manire squentielle, consultant les uns aprs les autres diffrents organismes, avant de se
WRXUQHUYHUVOH&RQVHLOGeWDWSXLVOH6HFUpWDULDWJpQpUDOGX*RXYHUQHPHQt, toute suspension
GHODGpPDUFKHLPSOLTXDQWVRXYHQWGHUHYHQLUjOpWDSHSUpFpGHQWH(OOHVGRLYHQWIRXUQLUXQ
effort en matire de matrise des procdures.
6DJLVVDQW GH OD WUDQVSRVLWLRQ GHV GLUHFWLYHV HXURSpHQQHV OD )UDQFH D UpDOLVp GH
grands progrs eQWHUPHVTXDQWLWDWLIVOKHXUHDFWXHOOHOHGpILFLWGHWUDQVSRVLWLRQVHVLWXH
entre 0,4 et 0,6 %, ce qui nous situe une bonne place dans le palmars europen. Notre
SUHPLHU VRXFL HVW GpYLWHU OHV SKpQRPqQHV GH VXUWUDQVSRVLWLRQ ; le second, situ en amont,
WLHQWjQRWUHGLIILFXOWpjDQWLFLSHUOLPSDFWGHODGLUHFWLYHVXUOHGURLWQDWLRQDO-XVTXjLO\D
peu, le service charg de ngocier la directive Bruxelles tait diffrent de celui qui tait
charg de la transposer dans le droit national. Trs vite aussi, la mmoire de la ngociation
SRXYDLWVHSHUGUHVLELHQTXLOGHYHQDLWLPSRVVLEOHGHVHUDSSHOHUSRXUTXRLOD)UDQFHDYDLW
elle-PrPHGHPDQGpOLQVFULSWLRQGHWHOOHRXWHOOHGLVSRVLWLRQGDQVODGLUHFWLYH6LGHVSURJUqV
ont t raliss sur tous ces points, nous rencontrons toujours des difficults obtenir des
PLQLVWqUHV TXLOV pFKDQJHQW DYHF OH 6HFUpWDULDW JpQpUDO DX VXMHW GH OLPSDFW HIIHFWLI GXQ
projet en cours de prparation. Il nous est mme arriv de dcouvrir que des projets de

263

directives imSOLTXDLHQWXQHUpYLVLRQGHOD&RQVWLWXWLRQVDQVTXHODGPLQLVWUDWLRQFRQFHUQpH
VHQ VRLW UHQGX FRPSWH ,O LPSRUWH GH IDYRULVHU OD GpPDUFKH LQWHUPLQLVWpULHOOH HW VXU FH
point, le rapprochement entre le Secrtariat gnral des affaires europennes et le Secrtariat
gnral du Gouvernement a permis de raliser des progrs.
6L HQ )UDQFH ODFFHVVLELOLWp GHV QRXYHOOHV QRUPHV HVW UHPDUTXDEOH JUkFH j OD
codification et Lgifrance, la scurit juridique est moins bien garantie. Le souci de
stabilit et de prvisibilit du droit est troitement li celui de la simplification : il convient
GH PLHX[ GpWHUPLQHU OLPSDFW HIIHFWLI GH OD QRUPH VXU OH SXEOLF TXHOOH YLVH /HV JUDQGHV
entreprises se plaignent moins de la complexit des textes lgislatifs que de la mutabilit et
GHOLPSUpYLVLELOLWpMXULGLTXHV2QSRXUUDLWUHPpGLHUjFHODHQUHFRXUDQWjOH[SpULPHQWDWLRQ
ou des dispositifs transitoires, pour faire en sorte que des projets en cours ne soient pas
affects par une nouvelle lgislation, plus que nous ne OHIDLVRQVjOKHXUHDFWXHOOH
M me Ccile Untermaier. Vous nous confirmez les progrs constants que nous
ralisons en matire de simplification et de qualit lgislatives.
-DLELHQQRWpOHVGLIILFXOWpVUHQFRQWUpHVSRXUREWHQLUGHVpWXGHVGLPSDFWGHTXDOit
HQUDLVRQGXSHXGLQWpUrWSRUWpjFHOOHV-ci par les politiques et des relations difficiles entre le
SROLWLTXH HW ODGPLQLVWUDWLI -DL DXVVL QRWp OXWLOLWp GXQH SUHVVLRQ H[WpULHXUH 'HV YR\DJHV
que la mission a raliss Berlin et Londres merge lLGpH GH FUpHU XQH DXWRULWp
LQGpSHQGDQWHFKDUJpHGpPHWWUHXQDYLVVXUODTXDOLWpGHOpWXGHGLPSDFW3OXVOHVWUDYDX[
GH OD PLVVLRQ DYDQFHQW SOXV MDL OD FRQYLFWLRQ TXH OpYDOXDWLRQ GH OpWXGH GLPSDFW
permettrait de garantir le mieux-tre de la loi et GDPpOLRUHUHQFRQVpTXHQFHODSSOLFDWLRQ
GHVWH[WHV4XHQSHQVH]-vous ? Cette autorit pourrait tre rattache au Premier ministre,
PRLQVTXHOOHQHVRLWLQGpSHQGDQWHFRPPHOHVWOH1.5j%HUOLQ
Vous avez galement relev la difficult que rencontreQWOHVeWDWVjpYDOXHUOLPSDFW
des directives et des rglements europens lors de leur transposition : comment les tats
pourraient-LOV rWUH PLHX[ DVVRFLpV DX[ pWXGHV GLPSDFW UpDOLVpHV DX SODQ HXURSpHQ DILQ
GDQWLFLSHUOHVHIIHWVGHVGLUHFWLYHVDXSODQQational avant mme leur transposition ?
M . Serge Lasvignes. -H QDL DXFXQH REMHFWLRQ GH SULQFLSH j OD FUpDWLRQ GXQH
commission indpendante. Ma seule proccupation MDL OX OHV FRPSWHV UHQGXV GHV
SUpFpGHQWHV DXGLWLRQV GH OD PLVVLRQ GLQIRUPDWLRQ HVW GpYLWHU OD FUpDWLRQ GXQH
DGPLQLVWUDWLRQ GH OH[SHUWLVH pFRQRPLTXH DSSOLTXpH DX[ pWXGHV GLPSDFW ,O QH VHUDLW QL
SHUWLQHQW QL UHQWDEOH GH FUpHU XQ VHUYLFH FKDUJp GHV pWXGHV GLPSDFW ,O IDXW DSSUHQGUH j
travailler avec les moyens dont nous disposons, qui sont importants. Les Allemands
UHFRXUHQWjXQHFHQWDLQHGHVWDWLVWLFLHQVDORUVTXHOD)UDQFHGLVSRVHGHO,QVWLWXWQDWLRQDOGH
la statistique et des tudes conomiques (Insee), qui travaille dans des conditions
GLPSDUWLDOLWpVFLHQWLILTXHUHFRQQXHVSDUWRXV. La structure envisage devra tre lgre.
On pourrait galement et profiter ainsi de la particularit franaise consistant
VRXPHWWUH OH[DPHQ GHV SURMHWV GH ORL DX &RQVHLO GeWDW donner ce dernier la mission
H[SOLFLWHGHGLUHVLOpWXGHGLPSDFWest suffisante ou non, le cas chant en auditionnant les
experts des administrations comptentes.
(QYXHGpYDOXHUOHVGLUHFWLYHVHXURSpHQQHVHQDPRQWQRXVDYRQVGHPDQGpTXHGHV
ILFKHV GLPSDFW QRXV VRLHQW IRXUQLHV DX GpEXW GH OD QpJRFLDWLRQ DILQ TXH OH Parlement
franais puisse prendre connaissance sans dlai des projets de Bruxelles. Le problme est
TXHFHVILFKHVGLPSDFWQHVRQWSDVWRXMRXUVWUDQVPLVHV

264

M . Thierry-Xavier Girardot, directeur, adjoint au secrtaire gnral du


Gouvernement. Des progrs RQW pWp UpDOLVpV 0DLV VL OD ILFKH GLPSDFW VLPSOLILpH HVW
transmise, elle demeure trop souvent superficielle. Pour tre plus efficace, le Secrtariat
gnral des affaires europennes, les diffrents ministres et la reprsentation permanente de
la France DXSUqVGHO8QLRQ HXURSpHQQHGRLYHQWLQWHUYHQLUDXFRXUVGHOpODERUDWLRQSDUOD
&RPPLVVLRQHXURSpHQQHGXSURMHWGHGLUHFWLYHFHVW--GLUHORUVTXHOOHSURFqGHHQFRUHjGHV
FRQVXOWDWLRQV HW SUpSDUH VHV SURSUHV pWXGHV GLPSDFW VXU VRQ SURMHW GH GLUHFWLYH ,l est
SRVVLEOHGHUHQIRUFHUOHIILFDFLWpGHQRWUHLQWHUYHQWLRQjFHVWDGH
M . Serge Lasvignes. (Q )UDQFH OD GLUHFWLYH QHVW SDV LQWURGXLWH SXUHPHQW HW
simplement dans le droit national GXIDLWGHOH[LVWHQFHGHGLIIpUHQWVFRGHVOHFRQWHQXGHOD
directiYH GRLW rWUH LQWpJUp DX GURLW QDWLRQDO DORUV TXDX 5R\DXPH-Uni, par exemple, la
GLUHFWLYH HQWUH HQ DSSOLFDWLRQ GqV TXHOOH HVW DSSURXYpH (W VLO HVW UHFRXUX j GHV QRWLRQV
juridiques ne correspondant pas au droit franais, la transposition devient plus dOLFDWH&HVW
pourquoi, en amont de la ngociation de la directive, une ngociation stratgique
interministrielle devrait porter sur les enjeux politique et juridique de la directive pour la
France.
M me Ccile Untermaier. /H &RQVHLO GeWDW SRXUUDLW GRQQHU XQ DYLV VXU OpWXGH
GLPSDFW FRPPH LO OH IDLW GpMj SRXU OHV SURMHWV GH ORL Considrez-vous toutefois que le
PLQLVWqUHTXLpODERUHXQSURMHWGHORLHVWOHPLHX[jPrPHGHUpDOLVHUOpWXGHGLPSDFW ? Une
autorit indpendante ne se justifierait-elle pas ?
M . Serge Lasvignes. ,O\DGHX[IDoRQVGHFRQFHYRLUODXWRULWpLQGpSHQGDQWH6RLW
HOOH YDOLGH OpWXGH GLPSDFW XQH IRLV TXH FHOOH-FL D pWp UpDOLVpH SDU GDXWUHV VRLW HOOH D OD
responsabilit de son laboration.
-HQHVXLVSDVIDYRUDEOHjFHTXHORQFRQILHODUpDOLVDWLRQGHOpWXGHGLPSDFWjXQH
DXWRULWpLQGpSHQGDQWHFDUOHVVHQWLHOGHVFRPSpWHQFHVVHVLWXHDXVHLQGHVPLQLVWqUHVGRQWOHV
SHUVRQQHOVFRQQDLVVHQWWUqVELHQOHXUVXMHW'HSOXVMHQDWWHQGVSDVGHOpWXGHGLPSDFWXQH
OXPLqUHWHOOHTXHOOHGHYUDLWrWUHOHIUXLWGXQWUDYDLODEVROXPHQWLPSDUWLDO/DGpPDUFKHGH
UpIRUPH OpJLVODWLYH UHVWH IRQFLqUHPHQW SROLWLTXH ,O QHVW GRQF SDV SRVVLEOH GHQ VFLQGHU
ODVSHFW VFLHQWLILTXH HW ODVSHFW SROLWLTXH /pWXGH GLPSDFW D VLPSOHPHQW SRXU IRQFWLRQ
GpYLter aux politiques de commettre des btises, surtout imprvues. Or, en raison de la
comptence de leurs diffrentes directions, les ministres sont capables de se plier une telle
discipline. Il suffit de prvoir une contrainte extrieure permettant de vULILHUTXHOH[HUFLFH
a t bien conduit.
M me la prsidente Laure de La Raudire. Je crois que vous avez raison,
monsieur le Secrtaire gnral.
/pYDOXDWLRQGRLWpJDOHPHQWSHUPHWWUHGHYpULILHUVLOHVREMHFWLIVIL[pVGDQVOpWXGH
GLPSDFWRQWpWpDWWHLQWV ou non.
M . Rgis Juanico. ,O QH VDJLW SDV HQ HIIHW GH FUpHU XQ PRQVWUH MXULGLTXH
interministriel, puisque nous disposons dj des outils ncessaires.
Au Royaume-8QLODVWUXFWXUHFKDUJpHGHFRQWU{OHUODTXDOLWpGHVpWXGHVGLPSDFW
Regulatory Policy Committee HVW OpJqUH SXLVTXHOOH QH FRPSWH TXXQH TXLQ]DLQH GH
fonctionnaires et huit membres indpendants, qui se runissent chaque semaine, en vue
GpYDOXHUODTXDOLWpGHOpWXGHGLPSDFWVDQVFKHUFKHUjODUHIDLUH(QFHTXLQRXVFRQFHUQH
un avis du &RQVHLOGeWDWUHQGXSXEOLFQRXVpFODLUHUDLWVDQVGRXWH : le lgislateur aimerait
GLVSRVHU DYDQW OH[DPHQ GHV SURMHWV HW SURSRVLWLRQV GH ORL GH GRQQpHV FRQVROLGpHV 6L XQ

265

JUDQGSURJUqVDpWpUpDOLVpGHSXLVQRXVQHQGHYRQVSDVPRLQVQRXVGRWHUGXQRXWLO
VXSSOpPHQWDLUHQRXVSHUPHWWDQWGHGLVSRVHUWUqVW{WGpWXGHVGHTXDOLWp
La mission souhaite galement dterminer les moyens pouvant amliorer la
UpGDFWLRQ OD FRPSUpKHQVLELOLWp HW ODFFHVVLELOLWp GHV ORLV Lgifrance fournissant dj un
gros travail en la matire. Les Britanniques ont cr une commission dont la fonction est de
FRQVHLOOHUHQDPRQWOHVUpGDFWHXUVGHODORLHQWHUPHVGLQWHOOLJLELOLWpHWGHFRQFLVLRQGXWH[WH
/HV ORLV IUDQoDLVHV VRQW WUDGLWLRQQHOOHPHQW EDYDUGHV $ORUV TXXQH ORL portugaise fait trois
pages et que les lois britanniques ne contiennent souvent que trois ou quatre articles, le projet
GH ORL IUDQoDLV UHODWLI j OpFRQRPLH VRFLDOH HW VROLGDLUH TXL VH YHXW XQ WH[WH IRQGDWHXU IDLW
GpMj FHQW SDJHV DORUV TXH QRXV QHQ VRPPHV TXj VD SUHPLqUH OHFWXUH j O$VVHPEOpH
nationale. Trop souvent aussi figurent dans nos textes des dispositions qui ne sont pas du
domaine de la loi mais appartiennent au domaine rglementaire.
Quels conseils pouvez-vous nous donner en matire de simplification lgislative ?
M . Serge Lasvignes. Je suis embarrass pour vous rpondre car je fais dj tout
mon possible en la matire.
$\DQWFRQVWDWpTXHOH&RQVHLOGeWDWOXLDXVVLVHODLVVHSDUIRLVIOpFKLUMDLGpFLGp
TXDYDQWGHSDVVHUGHYDQWOH&RQVHLOGeWDWWRXVOHVWH[WHVIHUDLHQWOREMHWGXQHUpXQLRQGH
UHOHFWXUH DX 6HFUpWDULDW JpQpUDO GX *RXYHUQHPHQW 6DJLVVDQW GX SURMHW GH ORL UHODWLI j
OpFRQRPLHVRFLDOHHWVROLGDLUHPHVpFKDQJHVVXUOHFDUDFWqUHOpJLVODWLIGHFHUWDLQHVPHVXUHV
avec les reprsentants du ministre concern ont t assez difficiles. En effet, outre les vraies
dispositions lgislatives, deux autres catgories de mesures sont trs reprsentes dans ce
texte : les mesures rglementaires et les dispositions normatives incertaines je pense
notamment la dfinition de la subvention, dont le statut normatif me laisse perplexe, mais
qui figure dans le texte la demande du secteur associatif.
M . Rgis Juanico. Et des collectivits locales, au nom de la scurit juridique.
M . Serge Lasvignes. Les relectures aboutissent un compromis : en change de
FHUWDLQHVFRQFHVVLRQVGXPLQLVWqUHMDFFHSWHGHODLVVHUILJXUHUFHUWDLQHVGLVSRVLWLRQVVDFKDQW
TXH MH QDL DXFXQ SRXYRLU GH GpFLVLRQ SROLWLTXH et que le ministre mcontent peut toujours
aller se plaindre auprs du Premier ministre. Je constate frquemment que les dispositions
VXSSULPpHV ORUV GH OD UHOHFWXUH UHSDUDLVVHQW SDU YRLH GDPHQGHPHQW PLQLVWpULHO RX
parlementaire. Cela dit, les dispositions qui me proccupent le plus ne sont pas tant celles
GRUGUHUpJOHPHQWDLUHTXHFHOOHVGRQWOHVWDWXWQRUPDWLIHVWLQFHUWDLQ : un juge risque de faire
GXQH GpFODUDWLRQ GH SULQFLSH XQH UqJOH GH GURLW FH TXL HVW LQTXLpWDQW (Q UHYDQFKH OHV
GLVSRVLWLRQV UpJOHPHQWDLUHV VL HOOHV GpYDORULVHQW ORXYUDJH OpJLVODWLI QRIIUHQW TXH SHX GH
danger en termes de scurit juridique.
M . Thierry M andon, rapporteur. Plusieurs critres permettent de dterminer la
qualit de la loi.
/HSUHPLHUYRXVYHQH]GHOpYRTXHUFHVWHQHIIHWODQDWXUHOpJLVODWLYHRXQRQGHV
dLVSRVLWLRQVDGRSWpHV/LGpDOVHUDLWGHOLPLWHUOHQWKRXVLDVPHOpJLVODWLITXLSHXWDYRLUSRXU
effet de rigidifier les modifications futures, seule une loi pouvant modifier une loi.
/H GHX[LqPH FHVW OD VROLGLWp MXULGLTXH GX WH[WH -H QH GLVSRVH SDV GH VWatistiques
SUpFLVHVVXUOHVFHQVXUHVGHVWH[WHVYRWpVSDUOH3DUOHPHQW-DLWRXWHIRLVOHVHQWLPHQWTXHOH
lgislateur a des progrs raliser. Est-il normal de se rjouir que 90 % de la loi de finances
pour 2014 aient pass le cap du Conseil constitutionnel ? mes yeux, la censure devrait

266

demeurer exceptionnelle. Quelles mesures devrions-nous prendre pour mieux garantir la


solidit juridique des textes que nous adoptons " /D SXEOLFLWp GHV DYLV GX &RQVHLO GeWDW
permettrait-HOOHG\SDUYHQLU ? Par ailleurs, serait-il possible de soumettre les propositions de
ORLYRLUHOHVDPHQGHPHQWVTXLSHXYHQWGpQDWXUHUOHVWH[WHVjGHVpWXGHVGLPSDFW ?
Troisime critre : prvoir un rendez-YRXVGpYDOXDWLRQWULHQQDORXTXLQTXHQQDOGH
la mise en application de certains textes. Une loi ne doit pas tre considre comme
ternelle.
6DJLVVDQWGHVpWXGHVGLPSDFWMHSDUWDJHYRWUHMXJHPHQWVXUOHFDUDFWqUHLQVXIILVDQW
GHOpYDOXDWLRQpFRQRPLTXHGHVWH[WHV/HVRXWLOVVWDWLVWLTXHVHWPpWKRGRORJLTXHVTXHQRXV
utilisons sont-ils adquats ? Nous sommes les seuls recourir la mthode franco-franaise :
Oscar outil de simulation de la charge administrative de la nouvelle rglementation.
Est-FH HQ UDLVRQ GHV VSpFLILFLWpV IUDQoDLVHV TXH QRXV DYRQV EDOD\p GXQ UHYHUV GH Pain le
Standard Cost Model TXLQHVWSDVXWLOLVpXQLTXHPHQWSDUOHV$QJOR-Saxons ?
(QILQ OH FRQWU{OH TXH YRV VHUYLFHV H[HUFHQW VXU OD TXDOLWp GHV pWXGHV GLPSDFW HVW
une vraie rvolution culturelle : quels moyens y consacrez-vous ? Quelle est la taille de vos
quipes ? Quelles pistes YRXV DYH] pYRTXp O,QVHH permettraient, en cette priode
budgtaire contrainte, de les toffer ? Vos quipes pourraient-elles alors tenir lieu de
VHFUpWDULDWGXQHpYHQWXHOOHLQVWDQFHLQGpSHQGDQWHTXLYDOLGHUDLWOHWUDYDil que vous lui auriez
prpar ?
M . Serge Lasvignes. 6DJLVVDQW GHYRWUHSUHPLHUSRLQWODPRLWLpGHVGLVSRVLWLRQV
de la loi de finances pour 2014 censures par le Conseil constitutionnel taient des cavaliers
et 80 UpVXOWDLHQWGDPHQGHPHQWV
Je ne dispoVHTXHGHGL[FKDUJpVGHPLVVLRQTXLFRXYUHQWOHQVHPEOHGHVPLQLVWqUHV
-H QDL GRQF SDV OHV PR\HQV GH PH SHQFKHU VXU FKDTXH DPHQGHPHQW GpSRVp VDJLVVDQW
VXUWRXW GX SURMHW GH ORL GH ILQDQFHV GRQW OH[DPHQ YD YLWH HW LQWHUYLHQW GDQV XQH SpULRGH
charge. Je rponds en revanche toutes les sollicitations.
M . le rapporteur. 'DXWDQWTXHYRXVDYH]GpMjYXSDVVHUXQJUDQGQRPEUHGHFHV
DPHQGHPHQWVHQDPRQWGHOH[DPHQGXWH[WHHQVpDQFHSXEOLTXH
M . Serge Lasvignes. &HVWYUDL
En revanche, le passage, dans la loi de financement de la scurit sociale, des taux
dits historiques jGHVWDX[DFWXDOLVpVSRXUOHFDOFXOGHVSUpOqYHPHQWVVXUODVVXUDQFH-vie
SUpVHQWDLW XQH UpHOOH IUDJLOLWp MXULGLTXH GRQW MDYDLV SUpYHQX OH *RXYHUQHPHQW ,O D
longuement hsit, puiV XQ pTXLOLEUH VHVW LQVWDXUp HQWUH OHV SUpRFFXSDWLRQV MXULGLTXHV
conomiques et politiques, et il a pris le risque de prsenter la mesure. Le Conseil
FRQVWLWXWLRQQHO QHODSDVFHQVXUpHPDLVD pPLVXQHUpVHUYH&HWWHPHVXUHYLVDLW GXUHVWHj
anticiper sur une volution jurisprudentielle probable du Conseil constit