Vous êtes sur la page 1sur 32

Attendance optional: :fclde`jkn\`^_j`efeÊgXg\ic\jjËZcXjj\jFEATURES, 6A

Jf]kYXccb\\gj =XjkÔcddXb`e^
`kj\p\fe]lkli\ Xk]\jk`mXc
NEWS, 3A
SPORTS, 1B

Kl\j[Xp
8gi`c(*#)'('

The Daily Illini


K_\`e[\g\e[\ekjkl[\eke\njgXg\iXkk_\Le`m\ij`kpf]@cc`ef`jj`eZ\(/.( nnn%;X`cp@cc`e`%Zfd
?`^_1/)ñ Cfn1,)ñ

Mfc%(*0@jjl\(*- s =I<<

EfkXYc\c\X[\ijg\XbjXkL@
Former secretary of labor sons employers have been hesitant
to resume hiring.
“Employers are concerned about
awards for her service and was
named among America’s newest
generation of leaders by Newsweek

addresses economic issues


uncertainties; uncertainties sur- magazine,” Jin said. “She was the
rounding health care, government longest serving secretary of labor
regulations and the possibility of since World War II and is a truly
higher taxes,” Chao said. great role model.”
9PD@:?8<CD8@FE< the point of view of a former sec- She also talked about China’s per- However, not everyone was so
JK8==NI@K<I retary of labor with very different ceived economic advantages. sure of Chao’s record. Mike Snid-
Elaine Chao, former secretary of policies from the current secretary “China’s competitiveness is not er, research field specialist for the
labor for the George W. Bush admin- (Hilda Solis),” he said. because of the low cost of labor, it Illinois State Water Survey at the
istration, spoke at the Illini Union “The current administration is is because of low taxes,” Chao said. University, said he was skeptical
to a group of approximately 50 stu- more pro-labor within the academ- “(In China) the cost of capital is of Chao.
dents Monday night. ic arena.” attractive to job creation.” “I am curious about the way the
At the lecture, held by the Illini Chao addressed the problem of America also lacks skilled work- event was advertised,” Snider said.
Union Board, Chao addressed the high job turnover in the American ers in important fields, Chao said. “She’s being held as a role model
current economic climate in the workforce. “There are not enough plumb- when in the case of the West Vir-
context of her life story as the fi rst “America is a diverse country ers, carpenters or electricians in ginia mining incident (in 2006), she
female Asian Pacific American cabi- with 150 million workers,” she said. the United States,” she said. “We fi red the investigators whose job it
net member. “The average worker, age 40, has are going to need 3.4 million health was to make sure safe business was
Before the event, Chichun Fang, held 10 jobs... Before the recession, care workers.” being done.”
graduate student, said he anticipat- the average 27-year-old had held 14 Yun Jin, freshman in business, Snider added that his views did AF8EE8D@IFNJB8K?<;8@CP@CC@E@
ed hearing Chao’s remarks. jobs already.” introduced Chao at the event. not necessarily reflect those held <cX`e\:_Xf#]fid\ij\Zi\kXipf]cXYfile[\ik_\9lj_
“I will be interested in hearing She discussed some of the rea- “Chao has received numerous by the University. X[d`e`jkiXk`fe#jg\XbjXkk_\@cc`e`Le`fefeDfe[Xp%

G8IK)F=8+$G8IKJ<I@<J1C@9<IK8I@8EG8IKP
JZ`\ek`jkjXkJljkX`eXYc\K\Z_efcf^p:\ek\infe[\i%%% <[`kfiËjefk\1JkXik`e^Dfe[XpXe[ile$

N?<I<KF:LK;FNEN8JK<6
e`e^k_ifl^_K_lij[Xp#K_\;X`cp@cc`e``j
gi`ek`e^Xj\i`\j]\Xkli`e^c\jj\i$befneXZ$
k`m\gfc`k`ZXc^iflgj`e:$L%Kf[XpËjjkfip
n`cc]fZljfek_\C`Y\ikXi`XeGXikp#n_fj\
d\dY\ijY\c`\m\k_\ZflekipnfibjY\jk
n`k_c`kkc\^fm\ied\ek`ek\im\ek`fe%

C`Y\ikXi`Xejcffb
]fijlggfikkf^\k
fe\c\Zk`feYXccfk
9PA8:BM<99<I attendance varies monthly.
JK8==NI@K<I Last month’s meeting featuring
Last Thursday, five Liber- a presentation on police stops
tarians gathered in the Urba- and searches was attended by
na Free Library’s auditori- about 35 people.
um to watch Drew Carey on Although the local party does
television. not have formal membership,
But they were not watching there are between 70 and 100
“The Price is Right” or reruns people on their mailing list,
of “The Drew Carey Show.” said Dianna Visek, chair of the
They were watching a documen- Champaign County Libertarian
tary about Cleveland’s unsta- Party and Urbana resident. In
ble economy that featured Car- Illinois, over 1,500 people are
ey. The group then discussed members of the Libertarian
the problem with government Party of Illinois, according to
intervening in the city’s urban its Web site, and over 250,000
renewal and related it to Urba- people are registered as Liber-
na and Champaign. tarians nationally, according to
This was the monthly meet- the national Libertarian Party’s
ing for members of the Cham- Web site.
paign County Libertarian Par- “We believe in economic free-
B<M@E:?8E>K?<;8@CP@CC@E@ ty, the local segment of a party dom and personal freedom, and
M`ef[GXk\c#Xm`j`k`e^Z_\d`ZXc\e^`e\\i]ifd@e[`X#nfibjfed\dYiXe\jlj\[Xkfe\f]k_\cXYjXkk_\@cc`ef`jJljkX`eXYc\K\Z_efcf^p:\ek\i%K_\ that strongly favors a free mar- we are strongly opposed to the
@JK:[\mfk\j`kjk`d\kfi\j\XiZ_`e^k_\Y\jknXpj]fik_\j\ZfdgXe`\jkfdXeX^\Xe[i\[lZ\k_\`inXjk\c\m\cj%Kfi\X[dfi\XYflkk_\@JK:#klie ket economy. first use of force,” Visek said.
kfGX^\-8% And while the meeting had
low attendance, members say J\\C@9<IK8I@8E#GX^\*8

:_XdgX`^ejZ_ffcjdXb\ LiYXeXi\[lZ\j\[lZXk`fe]le[`e^
fm\i)d`cc`feYl[^\kZlkj 9PB8K@<;LIB@E
JK8==NI@K<I
The Urbana Dis-
Mark Schultz.
An RIF is a notice of being
laid off from a government
“By law, the teachers and fac-
ulty have to know 60 days before
the end of school whether or not
9PD<C@JJ8<C<>8EK four teachers. son said an RIF may trict 116 School Board position with the potential to be they’re going to be hired back
JK8==NI@K<I “Every person or service also consider a teach- EldY\if]k\XZ_\ij of Education has immediately rehired if funding next year. We don’t know what
As K-12 school budgets are on that list has value to the er’s seniority. Y\`e^Zlk`e:_XdgX`^e approved $2,278,800 comes through. the state’s going to have until at
being cut statewide, the Cham- district,” said Beth Shepperd , “One of the direc- in budget cuts for the Schultz said they have to lay least June 30,” Schultz said.
paign Unit 4 Board of Educa- assistant superintendent for tors I know in a posi- 2010-2011 fiscal year. off people whose positions are Urbana school board Presi-
tion fi nalized over $2 million human resources. “The area tion that we eliminated The cuts range funded by grants until they dent John Dimit said Urbana
in budget cuts for fi scal year that is hit hardest is going to had been around long from extracirricular know how much the state will has not needed a budget cut this
2010-2011 in March. be administration because enough that the per- programs to full-time give. large in 10 years.
“Anytime we cut person- that is where the majority of son is also a tenured teacher positions. “If they can find grant money, “I’ve been through several
nel, it’s dramatic,” said school the cuts came.” teacher, so had rights “Each cut affects they’ll keep the position. The budget cuts, but I’ve never had
board President Dave Tomlin- Tomlinson added that every to go back and teach,” students in some way, school district tax dollars will to cut into the actual classroom
son. “It’s harder on the per- time cuts are made this time Tomlinson said. “They whether or not it’s cut- not pay for that position,” Schul- teachers.” Dimit said. “In times
sonnel themselves because of year, the RIF, or Reduction went back to teaching EldY\if]k\XZ_\ij ting a program like tz said. past, we’ve nibbled around the
losing your job through no in Force, notices are traumat- and ended up bumping Y\`e^Zlk`eLiYXeX third grade swim- He said 139 employees of edges. This time around, we’ve
fault of your own is difficult ic. An RIF notifies a teacher a new teacher out.” ming, or sending out the school district are being gone right for the heart of the
no matter what.” their employment is ending, Jori Kovarsky, senior in RIF (Reduction in Force) notic- forced under an RIF because matter and cut classroom
He said three directors although many are hired back Education and student teach- es, or laying off 139 faculty and they do not know if they will teachers.”
were cut, as well as a special the following year when state support personnel,“ said Urba- have enough money to keep
education administrator and funding is fi nalized. Tomlin- J\\:?8DG8@>E#GX^\*8 na school district Spokesman those positions. J\\LI98E8#GX^\*8

@EJ@;<   Gf c ` Z \  ) 8  s  : X c \ e [ X i  ) 8  s  F g ` e ` f e j  + 8  s  C\ k k \ i  + 8  s  : i f j j n f i [  , 8  s  :f d ` Z j  , 8  s  J Z `    K\ Z _  - 8  s  J g f i k j  ( 9  s  : c X j j ` ] ` \ [ j  + 9 $ - 9  s  J l [ f b l  - 9
)8 Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd

The Daily Illini GFC@:<

!"#$%&
West Stoughton Street on Sat-
,()<%>i\\eJk% :_XdgX`^e urday night.
:_XdgX`^e#@C-(/)' Q Criminal defacement of According to the police re-
)(.›**.›/*'' property and trespassing were port, the offender was arrest-

!%'()*
reported at the 800 block of ed on charges of possession of
:fgpi`^_kŸ)'('@cc`e`D\[`X:f%
North State Street on April 6. open liquor on public property
K_\;X`cp@cc`e``jk_\`e[\g\e[\ekjkl[\ek According to the police re- and public urination.
e\njX^\eZpXkk_\Le`m\ij`kpf]@cc`ef`j port, unknown offenders spray QA peeping tom was report-
XkLiYXeX$:_XdgX`^e%K_\e\njgXg\i`j painted the walls of the build- ed at the 100 block of North
glYc`j_\[Ypk_\@cc`e`D\[`X:f%K_\;X`cp
ing the victim owns. Gregory Drive on Monday
DAILY ILLINI CLASSIFIEDS 2010
@cc`e`[f\jefke\Z\jjXi`cpi\gi\j\ek#`en_fc\
fi`egXik#k_\m`\njf]k_\Le`m\ij`kpf] QCriminal damage to prop- morning.

}
@cc`ef`jX[d`e`jkiXk`fe#]XZlckpfijkl[\ekj% erty was reported at the 900 According to the police re-
} Showcase your apartment/house/studio 8cc@cc`e`D\[`X:f%Xe[&fi;X`cp@cc`e`
Xik`Zc\j#g_fkfjXe[^iXg_`ZjXi\k_\gifg\ikp
block of South Locust Street on
f]@cc`e`D\[`X:f%Xe[dXpefkY\i\gif[lZ\[ Sunday morning.
port, an unknown offender was
observed looking at the victim
online and in the pages of the Daily Illini figlYc`j_\[n`k_flkni`kk\eg\id`jj`fe]ifd According to the police re- through the bathroom window
k_\glYc`j_\i% port, an unknown offender as she was getting out of the
ONLINE FEATURES K_\;X`cp@cc`e``jXd\dY\if]K_\ damaged multiple cars parked shower.
8jjfZ`Xk\[Gi\jj%K_\8jjfZ`Xk\[Gi\jj`j
• Up to 3 Photos \ek`kc\[kfk_\lj\]fii\gif[lZk`fef]Xcc in the 800 to 1000 block of QA 36-year-old man was ar-
• Lengthy Description cfZXce\njgi`ek\[`ek_`je\njgXg\i% South Locust Street. rested at the 300 block of East
<[`kfi`eZ_`\] G_fkf\[`kfij QA 24-year-old man was ar- University Avenue on Monday
• Searchable database D\c`jjXJ`cm\iY\i^ N\jc\p=Xe\ rested at the 2000 block of morning.
• Ability to save to favorites or email to a friend )(.›**.$/*-, E\[DlcbX
North Mattis Avenue on Friday According to the police re-
\[`kfi7;X`cp@cc`e`%Zfd )(.›**.$/*++
DXeX^`e^\[`kfi g_fkf7;X`cp@cc`e`%Zfd morning. port, the offender was arrest-
PRINT/DAILY ILLINI FEATURES i\gfik`e^ Fg`e`fej\[`kfi According to the police re- ed on charges of driving under
• Easy to view checklist Format 8e[i\nDXcfe\p
)(.›**.$/*+*
IXZ_\cJdXcc
)(.›**.$/*--
port, the offender was stopped the influence of alcohol, driv-
• 24,000 copies distributed on and around campus d\ni`k`e^7;X`cp fg`e`fej7;X`cp@cc`e`%Zfd for improper lane usage when ing with a breath alcohol con-
• Respected as one of the best college newspapers in the country @cc`e`%Zfd
;\j`^e[\jb\[`kfi officials found him to be in pos- centration over the legal limit,
DXeX^`e^\[`kfim`jlXcj D`Z_\cc\Ifk_\`j\i session of drug paraphernalia. unsafe movement on the road-

SUBMIT YOURS TODAY AT


:_Xic\jKXeC`d )(.›**.$/*+,
)(.›**.$/*+* [\j`^e7[X`cp`cc`e`%Zfd
He was also charged with driv- way and causing an accident
d\m`jlXcj7
8jj`jkXek[\j`^e\[`kfi
ing with a suspended license. involving non-injury.
;X`cp@cc`e`%Zfd QTheft was reported at the
classifieds.dailyillini.com/apartments/sublets/submit E\nj\[`kfi
;XeepN\`cXe[k
200 block of West Beardsley
$20 for 2 weeks. If at the end of 2 weeks you have not rented your apartment, A`cc;`j`j
)(.›**.$/*,'
:fgpZ_`\]
O`O`K`Xe Avenue on April 6.
Le`m\ij`kp
ZfgpZ_`\]7[X`cp`cc`e`%Zfd
e\nj7;X`cp@cc`e`%Zfd According to the police re- QA 26-year-old man was ar-
you can extend it for an additional two weeks at no extra cost! ;Xpk`d\Xjj`^ed\ek 8jjk%ZfgpZ_`\]
port, an unknown offender rested at the intersection of
\[`kfi BXiX>`XZfYXqq`
<d`cp9XpZ` N\Ygif[lZ\i stole the steel siding off of a South Locust and Marshall
e\nj7;X`cp@cc`e`%Zfd DXibI`m\iX rental property. Streets on Wednesday night.
8jjk%e\nj\[`kfij )(.›**.$/*,* According to the police re-

!"#$%"&'("!")*+,,+-
n\Y\[`kfi7[X`cp`cc`e`%Zfd
port, the offender was arrested
JXdBXi^fc
EfiX@YiX_`d 8jjk%N\Ygif[lZ\i LiYXeX on an outstanding Champaign
Af\NXi[ Jk\m\C\je`\njb`
M`[\f\[`kfi QTwo 21-year-old men and city warrant.
=\Xkli\j\[`kfi
JXdNX^e\i Af_eGfkk\i one 20-year-old man were ar-
./0"12/034"155"62!7"89:1/;"2!1"7/"/<<5= )(.›**.$/*-0
]\Xkli\j7;X`cp@cc`e`%Zfd
[`m`[\f7[X`cp`cc`e`%Zfd
8[m\ik`j`e^jXc\j
rested at the 1000 block of :fdg`c\[YpGXpXcJ_lbcX
8jjk%]\Xkli\j\[`kfij dXeX^\i
!"#$%&'(%&$)*+"&,-'..(-'#/$01'"&'(2"3/,%-'"$'/'4%5*1'*0/105'"&'%605/+"%&/*'3%&7 :Xifcpe>`cY\ik
D\c`jjXD`Z_XcXb
$)*+"&,'8%3)$01'%&'"96*090&+"&,'$)66*:'32/"&'"965%;090&+<'=)5'0&,/,090&+$' Bi`jkpJ_Xlc`j )(.›**.$/*/)
jjd7@cc`e`D\[`X%Zfd :FII<:K@FEJ
/50'"&+05&/+"%&/*'1)0'+%'+20',*%#/*'&/+)50'%8'%)5'3*"0&+$>'%605/+"%&$<' Gi`ekjgfikj\[`kfi
8c\o@e`^l\q
Gif[lZk`fe[`i\Zkfi N_\eK_\;X`cp@cc`e`dXb\jXd`jkXb\#n\n`ccZfii\Zk`k`ek_`jgcXZ\%
)(.›**.$/*-* B`k;feX_l\ K_\;X`cp@cc`e`jki`m\j]fiXZZliXZp#jf`]pflj\\Xe\iifi`ek_\gXg\i#
?0'/50'*%%@"&,'8%5'0&+50650&0)5"/*79"&101'$0*87$+/5+05$'4"+2'2",2'15";0-'$+5%&,' jgfikj7;X`cp@cc`e`%Zfd :i\Xk`m\dXeX^\i
gc\Xj\ZfekXZk<[`kfi`e:_`\]D\c`jjXJ`cm\iY\i^Xk**.$/*-,%
B\cc`\9\Zb_Xd
/&/*:+"3/*'$@"**$'/&1'$%*"1'#)$"&0$$'/3)90&<''A%)'$2%)*1'0&B%:'4%5@"&,'2/&17 8jjk%jgfikj\[`kfij
K`d;`kdXe Gif[lZk`feXjj`jkXek
"&72/&1'4"+2'3*"0&+$'#03/)$0':%)'4"**'#0'"&'85%&+'%8'+20'3*"0&+'%&'C1/:'%&0>D''E8' B\m`eBXgcXe :Xik\i?\ei`Zbj
\RX·UHORRNLQJDWWKHELJ¿UPVEXWZDQWWRPDNH\RXUPDUNDQGKDYHDQ JXdXek_XB`\j\c <[`kfi`XcX[m`j\i K?<)(.%:FD:8C<E;8IG@:BJ
>iXg_`Zj\[`kfi D\c`e[XD`cc\i
LQÀXHQFHVHHZKDWDERXWLTXH¿UPOLNH*LEVRQKDVIRU\RX J_XeefeCXeZfi
[`^iXg_`Zj7[X`cp`cc`e`%Zfd
GlYc`j_\i
DXip:fip
Kf[Xp ;A
I\kifE`^_k
DFM@<J
K\Z_Jldd`k1Fg\e
!"#$%$"&'()*+(&, C@M<DLJ@:
8[m\ik`j`e^
0g%d%Xk:_\jk\iJki\\k# JZfi\
‡ %HZLOOLQJWRWUDYHOXSWR A\jj\Af_ejfeJfcf
@]pflnflc[c`b\kfgcXZ\XeX[#gc\Xj\
-*$-,:_\jk\iJk% .g%d%XkBiXee\ik
‡ +DYHD*3$RIRUKLJKHU 8Zfljk`Z
ZfekXZkfliX[m\ik`j`e^[\gXikd\ek% :\ek\i]fik_\
‡ +DYHD%XVLQHVV6XSSO\&KDLQ ()g%d%Xkk_\@cc`e` B8I8FB< G\i]fid`e^8ikj#,''J%
Q :cXjj`Ô\[X[j1)(. **.$/**.fi\$
%5'F&,"&005"&,'10,500 Le`fe#(+'(N%>i\\e GXlc=XY\i_fjkj;iX^fe >ff[n`e8m\
dX`c[`ZcXjj`Ô\[j7`cc`e`d\[`X%Zfd%
‡ +DYHGHPRQVWUDWHG Q ;`jgcXpX[j1)(. **.$/*/)fi\$dX`c Jk% BXiXfb\ K\Z_Jldd`k1MXi`Xk`fej
*0/105$2"6'$@"**$ [`X[jXc\j7`cc`e`d\[`X%Zfd% Dfi^XeGfn\ccØ 0g%d%XkK_\:cXib9Xi# M@@
‡ +DYHFRPSOHWHGDKLJK KiX[`k`feXcAXqq )'.N%:cXibJk% /g%d%XkBiXee\ik
TXDOLW\LQWHUQVKLS E`^_kjpjk\djkX]]]fikf[XpËjgXg\i
E`^_k\[`kfi1DXi`\N`cjfe
FiZ_\jkiX :>Gif[lZk`fejgi\j\ekj :\ek\i]fik_\
‡ %HHDJHUWROHDUQDQG G_fkfe`^_k\[`kfi1E\[DlcbX ,g%d%XkK_\@ifeGfjk# IfZbJkXiBXiXfb\ G\i]fid`e^8ikj#,''J%
/66*:'/&/*:+"3/*'$@"**$ :fgp\[`kfij1Bpc\9i`^^j#IX`jjXIfZ_X#A\jj`ZX ()'J%IXZ\Jk% ]\Xkli`e^;AJn`kZ_ >ff[n`e8m\%
E`Z_fcj#Jk\g_Xe`\BXdYX#Jk\g_Xe`\Kljj`e^#
;Xm`[?Xee\ij 0g%d%Xk9\ekc\pËjGlY#

!"#$ %
Cfi`9\cc
TM
;\j`^e\ij1DXi^l\i`k\;Xp#C`qBXcbfnjb`#@jXY\c .g%d%Xk8ifdX:X]\# +(0E%E\`cJk% JK8><
DfiXc\j#<d`cpClkp#8[i`\ee\?ffg`e^Xie\i ((/E%E\`cJk% IfZbjkXiBXiXfb\ Qff@dgifm7@e[`>f
@ccljkiXkfi1Jk\g_\e9XiXep
! " # " $ % ! % # & ' ( ) # * + ,& " # & *
N\Ygfjk\ij1AXZcpe9\[eXi#DXikpDXcfe\ :fie;\j\ikIXdYc\ij ('g%d%Xk=Xk:`kp9Xi >Xcc\ip
GX^\kiXejd`jj`fe1:_i`j=X`iÔ\c[ 0g%d%XkIfj\Yfnc >i`cc#,',J%:_\jkelk 0g%d%Xk@e[`>f
Visit us at www.gibsonconsulting.com/careers KXm\ie#Ck[%#('-E% Jk% >Xcc\ip`jcfZXk\[Xk0<%
G\i`f[`ZXcgfjkX^\gX`[Xk:_XdgX`^e#@C IXZ\Jk% Le`m\ij`kp8m\%
-(/)(%K_\;X`cp@cc`e``jglYc`j_\[Dfe[Xp C`jX:\i\qf FG<ED@:
k_ifl^_=i`[Xp[li`e^Le`m\ij`kpf]@cc`ef`j]Xcc 0g%d%XkD\dg_`jfe Fg\eD`ZE`^_k_fjk\[ 8IK<O?@9@K
Xe[jgi`e^j\d\jk\ij#Xe[Dfe[Xp#Kl\j[Xp#
N\[e\j[XpXe[=i`[Xp`ejldd\i%E\n DX`e#,,<%DX`eJk% YpD`b\@e^iXd D`Z_X\c=l\ijk
Jkl[\ek>l`[\Xe[N\cZfd\9XZb<[`k`feXi\ K_\G`XefDXe 01+,g%d%Xk:fnYfp /X%d%`ek_\ÔijkÕffi
glYc`j_\[`e8l^ljk%=`ijkZfgp`j]i\\2\XZ_ 0g%d%Xk:Xefgp:clY# Dfeb\p#-KXpcfiJk% _XccnXpjf]k_\LiYXeX
X[[`k`feXcZfgp`j,'Z\ekj%CfZXc#L%J%dX`c# .'/J%>ff[n`e8m\% :`kp9l`c[`e^#+''J
flk$f]$kfneXe[flk$f]$jkXk\iXk\jXmX`cXYc\
lgfei\hl\jk% M`e\#Jk%

1965 1979 Paddy Murphy 1949

1948 Spring Formal 1987 L.S.O.M. Formal 1967

  

   1965 Spring Formal

((%*+%.!/$,/!-+"5%.,-+0 /+**+0*!%/.-!/0-*/+/$!+-*!-+"
$%- *%!(%*((
(0)*%-+../$!+0*/-4.!* /$!%-.0,,+-/
* !./2%.$!.%*,0-.0%*#/$!
   * ,-+)%*!*!
1966 Paddy Murphy
!*&+4! 4/$!)!*+"5//$!*%1!-.%/4+"((%*+%..%*!


1993 Paddy Murphy

!*/(!)!*%*/!-!./! %*(!-*%*#)+-!+0/+*!+"/$!+0*/-4../-+*#!./*/%+*("-/!-*%/%!.
2%/$
4!-(!#4+"$+*+-(! !-.$%,* !3!((!*!-!!*+0-#!
/+1%.%/$//,222"!++'+),#!.%#)(,$,.%(+*((%*+%.!/
1979 Spring Formal +-222.!%(!/+)* +-+*//-%*. %-!/(4/*..!*!/

1978 Atrius Sachem 1985 Theta Dinner Exchange

2001 Paddy Murphy 1982 Paddy Murphy

1978 1993
*8 Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd

ÊAljk]fiEfnËgcXZ\jÔijk
@CC@EF@J9I@<=J
Jk\nXi[`e^<oZ\cc\eZ\
XeefleZ\ji\m`\n

Xkg`fe\\i`e^=`cd:fek\jk Stewarding Excellence at Illi-


nois is a review program that
will look at how the academic
enterprise is structured into the
work of colleges and schools.
Each team was assigned a dif- in front of his computer for hours According to a press release,
48-hour time limit ferent challenge, such as incor-
porating certain lines.
to complete editing the fi lm.
Elyne Tran, freshman in ACES,
a small group of people exter-
nal to the campus were asked to
tests students’ “When I saw the sign for the
contest, I knew that this would be
said she stopped to see Marsa-
glia’s team during its fi lming.
visit the campus for discussions
about this review.
film-making skills another chance for me to try my
skills at fi lmmaking,” said John
“It’s an interesting concept. It
provides an alternative way of
The group plans to meet with
the deans of the four college/
9P8C@:<:?8E> Marsaglia, freshman in Media expression for students,” Tran school units under review, the
JK8==NI@K<I who participated in the event. said. chair of the project’s team Tom
The Illini Union Board spon- “To be honest, I’m surprised it’s Monday evening, there was a Ulen , the Steering Committee
sored its fi rst annual 48-Hour taken so long for the University public screening of each film, and and Chancellor Easter.
Film Contest on Friday, April 9. to come up with a contest like judges gave each work scores If time permits, the group
Students on campus were encour- this.” “based on story, clarity of nar- will also meet with the Council
aged to participate in developing Because of the time limit, it rative, dialogue and cinematog- of Deans and the Senate Lead-
a five-minute fi lm within a 48- was difficult to meet their ide- raphy,” according to the board’s ership team.
hour timeframe. als for the fi lm, said Marsaglia, Web site. The top three teams The press release said the vis-
Distinctive challenges were who participated on a team with were given fi nancial rewards for it is meant to be consultative.
given to the teams on Friday eve- three others. their work. The group will not be asked
ning and their works were turned “I wasn’t sure if I would be able Sears said the program was a for formal recommendations
in at the Illini Union Sunday. The to produce a quality fi lm under success, as they received 15 reg- and will not be expected to pro-
winning films in order from first such time constraints, but if istration forms and 10 complet- duce a report.
to third were; “Just for Now,” you’re doing something you love, ed fi lms. People who agreed to attend
“Twilight Zone,” and “Eloise.” you’ll find a way to make it work,” “Events like this and other the review on May 3 include
The Illini Union has hosted Marsaglia said. student performing arts pro- Larry Faulkner, president of the
other artistically driven projects After deciding the story line, grams on campus allow students Houston Endowment, Edie Gold-
in the past, such as dancing and Marsaglia began casting avail- to express their creativity and enberg, professor at the Univer-
singing contests, but they wanted able actors, wrote the script and become more cultured,” Sears sity of Michigan and Jane Don-
this year’s project to be different, planned the filming schedule and said. aldson , founding partner of the
said Grace Sears, the Illini Union locations. Marsaglia said he agreed that Phillips Oppenheim Group.
Board Director of the Arts and “Living in a dorm, I didn’t have the competition benefited the
sophomore in Business.
“This year, we decided to show-
the luxury of using a home, kitch-
en or furniture, so I decided on an
community on campus.
“Creative differences are not
AFJ?L89<:BD8EK?<;8@CP@CC@E@
>iXZ\J\Xij#c\]k#jfg_fdfi\`e9lj`e\jj#Xe[:Xk_\i`e\?\`[b\#gif^iXd
K_i\\Le`m\ij`kpjkl[\ekj
case other forms of student art idea that would utilize our cam- only beneficial to filmmakers, but X[m`jfi]fik_\@cc`e`Le`fe#dXeX^\k_\gfgZfiedXb\iY\]fi\k_\jkXikf]k_\ i\Z\`m\gi\jk`^`flj
that are not as frequently exhib-
ited on campus,” Sears said.
pus” he said.
Finally, Marsaglia said he sat
to the entire community as well,”
he said.
@cc`e`Le`fe9fXi[Ëj=`ijk8eelXc+/?fli=`cd=\jk`mXc_\c[`ek_\@cc`e`Le`fe
9XcciffdDfe[Xp%K_\gif^iXdXnXi[\[k_i\\Ôcdjf]k_\('jlYd`kk\[%
jZ_fcXij_`gj
The prestigious Barry M.
Goldwater scholarship for the
LI98E8 Jeffries said current class siz-
es are around 20, but with the
been determined by July 1 like
it is supposed to. Sometimes, he C@9<IK8I@8E officials) are doing.”
Like other small parties in Illi-
2010-2011 academic year was
awarded to three University
=IFDG8><(8 cuts they may increase to 23. said, the verdict on the grant =IFDG8><(8 nois, the Libertarians are run- students.
“Classes will be a little larger; money is delayed until August ning into some obstacles while Kimberly Parker, junior in
He said the magnitude of the however, they will still be within or September. The opposition to the first use trying to get candidates on the Engineering, Maxie Schmidt ,
cuts are due to the lack of action the limits of the contract,” she “There’s not a state budget that of force, such as militaristic inva- November general election bal- sophomore in Engineering, and
in Springfield, and they need to said. tells us how much money we’re sion, police action, government- lot for statewide positions, such Kamil Stelmach, junior in LAS ,
get their budget house in order. Schultz said the 139 faculty going to be allocated next year,” run education and taxation, is as governor, treasurer and comp- were three of the 278 scholars
Gayle Jeffries, assistant super- under the RIFs will be laid off Jeffries said. “So naturally the what Visek called “the litmus troller. As a non-established par- selected from a fi eld of 1,111
intendent of human resources June 30, but the district should school districts have to operate test” to enter the Libertarian Par- ty, they must get 25,000 signa- students nominated by facul-
for the district, said 17 teachers know by July 1 if grant mon- on the reserves until they fi nd ty’s national convention. tures from registered voters by ty members based on academ-
were cut from next year’s bud- ey that could potentially help out what’s going to be available When discussing the documen- June 21. ic merit.
get: six from elementary schools, keep these positions will come for them.” tary at the meeting, Charles Nad- This week, party volunteers According to the University
six from middle schools and five through. However, Schultz said olski, vice chair of the organi- will be on campus collecting sig- News Bureau, the scholarship is
from high schools. grant money has not always zation and University almunus, natures from students and fac- given to sophomores and juniors
stressed the idea of a governmen- ulty in order to reach their goal from across the U.S. who plan
tal, hands-off approach to urban of 50,000 signatures - a num- to pursue a career in math, sci-

 ]ÔZ`Xcj
F
development, which ber Visek said ence or engineering.
he called “organ-
ic city planning.” ÈK_\ZXdglj gXikp will help them
if their signa-
Ki`Yle\]`c\jYXebilgkZp#
This is the hands- tures are chal-
_XjY\\e`eXe[flk ^`m\jlgfne\ij_`gkfX
kf[`jZljj
off approach the lenged by other
party takes with
most issues, such as f]\o`jk\eZ\j`eZ\
parties.
The College
^iflgf]c\e[\ij
its opposition to the Libertarians, a The Tribune Co. fi led a bank-
k_\Y\^`ee`e^f]
elZc\Xi
“War on Drugs” and registered stu- ruptcy reorganization plan on
its support of the dent organiza- Monday that would allow it to
right to carry con-
cealed weapons.
k_\j\d\jk\i%É tion, or RSO,
is the group at
keep its newspapers and broad-
cast stations while wiping out

j\Zli`kp
Although the par- 8K8E8JJK8EBFM# the University most of its debt, though two
ty does not support jfg_fdfi\`eC8J that represents groups of lenders vowed to
g ove r n me nt- r u n the party’s ide- unravel a pivotal part of the
social programs, als. The organi- proposal.
Visek said it is important to help zation’s fundraising chair, Ata- If the plan is approved, own-
the needy, which she argued is nas Stankov, sophomore in LAS, ership of the media company
9PIF9<IK9LIEJ better accomplished by private said its goal is to spread the ideas would go to a group of lenders,
K?<8JJF:@8K<;GI<JJ charities and philanthropists. of libertarianism throughout including JPMorgan Chase &
WASHINGTON — President Visek said the local party has campus. Co. and Angelo, Gordon & Co.
Barack Obama optimistically had various lives. The current However, he said the RSO is not Those lenders support the
opened a 47-nation nuclear sum- organization began about four closely affiliated with the Cham- plan and an underlying settle-
mit Monday, boosted by Ukraine’s years ago, she said, and after its paign County Libertarian Party. ment over allegations of fraud-
announcement that it will give founder moved out of town, Visek He said the campus organization ulent conduct in fi nancing the
up its weapons-grade uranium. took over the lead. has not been very active over the 2007 leveraged buyout that left
More sobering: The White House Members are involved in edu- past few months, which he attrib- the Tribune Co. mired in debt.
counterterror chief warned that cation – its monthly meetings uted to a lack of funding and the Tribune, which publishes
al-Qaida is vigorously pursuing on the second Tuesday of every absence of an assigned meeting the Los Angeles Times, Chi-
ingredients and expertise for a month are open to the public – room at the University. cago Tribune, The (Baltimore)
bomb. and activism to promote govern- “The (campus) party has been Sun and other daily newspapers
At the same time, Obama and mental transparency, she said, in and out of existence since and owns TV and radio stations,
Chinese President Hu Jintao “to make it easier for citizens to the beginning of the semester,” has described the settlement as
sought agreement on potential follow what they (governmental Stankov said. “global” and key to emerging
sanctions to discourage Iran’s :?8IC<J;?8I8G8BK?<8JJF:@8K<;GI<JJ from Chapter 11 bankruptcy
efforts to come up with its own Gi\j`[\ek9XiXZbFYXdX^i\\kjPlb`pX8dXef#;`i\Zkfi>\e\iXcf]k_\ protection.
nuclear weapon.
Ukraine’s decision dovetailed
@ek\ieXk`feXc8kfd`Z<e\i^p8^\eZp@8<8 #[li`e^k_\f]ÔZ`XcXii`mXcj]fi
k_\ElZc\XiJ\Zli`kpJldd`k`eNXj_`e^kfefeDfe[Xp% :?8DG8@>E many students.”
Tomlinson said the budget for
The plan fi led Monday incor-
porates elements of that deal,
with Obama’s goal of securing =IFDG8><(8 2011-2012 will still be undeter- which came together 16 months
all vulnerable nuclear materi- The talks are a centerpiece of share Obama’s urgency about mined until the summer. after the company fi led for
als worldwide within four years Obama’s broader agenda for rid- nuclear ingredients. er at Lincoln Trail Elementary “We certainly know what our Chapter 11 bankruptcy protec-
— an objective that the White ding the world of nuclear weap- “There is a great complacen- in Mahomet, said she was con- tax base is going to be, but it’s tion because it could not ful-
House hopes will be endorsed ons, a long-term process that he cy among policymakers around sidering applying for a teach- hard to say what the state aid ly repay debts totaling $12.7
by all summit countries at a says should include gradual dis- the world that terrorist groups ing position in Champaign, but will be,” Tomlinson said. “We’re billion.
closing session Tuesday, even if armament by the nuclear pow- couldn’t make a nuclear bomb,” has reconsidered due to budget like everyone else, we’re owed
the means to accomplish it are
unclear. The fear is that ter-
ers, stronger steps to head off
a nuclear arms race and more
said Matthew Bunn of Harvard. cuts.
In a detailed report on the chal-
several million dollars and if
“A lot of teachers have been the state budget picture doesn’t
G\fi`Xgfc`Z\j_ffk
rorists or a nation other than urgent action to lock down tons lenge of securing nuclear mate- RIFed and will get get any bet- \jZXg\[Ylcc
the major nuclear powers could of plutonium and highly enriched rials, Bunn said no one really rehired for next year,” ter, I would
obtain crucial ingredients and
inflict horrendous damage.
uranium that are the key building
blocks of atomic weapons.
knows the likelihood of nuclear Kovarsky said. “I’m
terrorism. “But the consequences moving back to Chi-
ÈK_\Xi\Xk_Xk`j_`k expect that
to increase.”
PEORIA, Ill. — Peoria police
shot and killed a bull on the
Before formally opening the
summit, Obama held a series of
According to Harvard’s Belfer
Center, there are about 3.5 mil-
of a terrorist nuclear blast would cago if there are no
be so catastrophic that even a openings in the near-
_Xi[\jk`j^f`e^kf Shepperd
said the cuts
city’s south side after it escaped
from the local stock yards.
one-on-one meetings with lead-
ers from China, Jordan, Ukraine,
lion pounds of highly enriched
uranium and half a million
small chance is enough to jus- by districts.”
tify urgent action to reduce the Tomlinson said one
Y\X[d`e`jkiXk`fe were kept
as far away
Police say the bull escaped
late Sunday morning and was
Armenia and Malaysia. Presiden-
tial aides billed the summit as the
pounds of bomb-grade plutoni-
um in the world. Combined, they
risk,” he wrote. “The heart of a of the biggest fund-
major city could be reduced to ing issues across the
Y\ZXlj\k_Xk`j fr om t he
classroom as
loose until it was shot early
Monday.
largest gathering of world lead-
ers hosted by an American presi-
could be used to build as many
as 200,0000 nuclear weapons, or
a smoldering radioactive ruin, state of Illinois is pre-
leaving tens to hundreds of thou- K or childhood fund- n_\i\k_\dXafi`kp possible.
She add-
Officers say they tracked the
bull for two hours before shoot-
dent since the 1945 conference in
San Francisco that founded the
about 8½ times the world’s cur-
rent total of 23,360 warheads.
sands of people dead.” ing, but Unit 4 will
Seeking to highlight the urgen- keep the programs f]k_\ZlkjZXd\%É ed that pro-
grams val-
ing it.
According to police, people
United Nations. Not all countries share cy of the threat posed by terror- despite fi na nci a l ued by the who work at the stock yards told
In a brief exchange with report- Obama’s view that the nuclear- ists in pursuit of a nuclear bomb, uncertainty. 9<K?J?<GG<I;# communi- them they had no way to catch
ers at the White House, Obama materials problem is a priority. John Brennan, the White House’s “Some of our posi- Xjj`jkXekjlg\i`ek\e[\ek]fi ty such as or control the bull.
said of the summit: “It’s impres- Some think the bigger empha- counterterrorism chief, told tions are dependent _ldXei\jfliZ\j ba nd a nd In February, a bull crashed
sive. I think it’s an indication of sis should be on disarmament, reporters that al-Qaida is active- on state grants – for strings and into a home on the north side
how deeply concerned everybody particularly by the United States ly in search of the key ingredi- example, our early childhood foreign language have been of Peoria.
should be with the possibilities and Russia, which despite recent ents for a bomb and the expertise center – and that is probably the preserved. It wasn’t clear at the time
of nuclear traffic, and I think reductions still possess 90 per- to assemble it. area where we have the greatest “Locally, our taxpayers are how the bull escaped from his
at the end of this we’re going to cent of the world’s nuclear arms. concern,” Shepperd said. “While doing everything they can, handler or where he escaped
see some very specific, concrete At a parallel unofficial confer- 8jjfZ`Xk\[Gi\jjni`k\ijAlc`\GXZ\ no school district is required they’ve been supporting the from.
actions that each nation is taking ence of more than 200 interna- Xe[8ee\>\XiXe`eNXj_`e^kfeXe[ to have an early childhood pro- schools, and we’d like to see
that will make the world a little tional nuclear experts, partici- <[`k_D%C\[\i\i`eE\nPfibZfeki`Y$ gram, we know that early inter- the state do their part,” Shep- =ifd;X`cp@cc`e`Xe[8jjfZ`Xk\[
bit safer.” pants said too many leaders don’t lk\[kfk_`ji\gfik% vention is key to the success of perd said. Gi\jji\gfikj%

Notice to Graduating Students


the217.com
Graduates participating in Commencement ceremonies are required to wear appropriate
academic attire. Graduates have until 11:59 p.m., April 19, to order regalia at

www.herffjones.com/Illinois
Notice to Graduating Students - or -
Stop by the Illini Union Bookstore during one of the following times:
Graduates participating in Commencement ceremonies are required to
wear appropriate academic attire. Graduates may order their cap & Tuesday, April 13 10:00 a.m. to 3:00 p.m.
Monday, April 19 10:00 a.m. to 3:00 p.m.
gown until 11:59 p.m., April 19 at
Campuswide ceremony tickets will be available at these on-campus ordering sessions
www.herffjones.com/Illinois Orders must be placed by April 19
+8
Kl\j[Xp
8gi`c(*#)'('
K_\;X`cp@cc`e`
nnn%;X`cp@cc`e`%Zfd
Opinions
<;@KFI@8C

:fdZXjk[\Z`j`fek_i\Xk\ej]i\\jg\\Z_
=
ree and open communication tential to destroy the closest thing if there is a blog you enjoy about speech is a censorship problem
K_\;X`cp@cc`e`<[`kfi`Xc9fXi[
is the cornerstone of a strong to a free, open and robust ground arts and culture in New York, and that must be taken into account
democracy. However, this for exchanging ideas – the Inter- Comcast happens to not like that when assessing Comcast’s inten- <[`kfi`Xcji\Õ\Zkk_\dXafi`kpfg`e`fef]
k_\YfXi[#n_`Z_Zfdgi`j\j1
freedom to exchange thoughts, net. particular blog, it can charge the tions with its services.
D\c`jjXJ`cm\iY\i^#\[`kfi$`e$Z_`\]28e[i\n
art and knowledge suffered a ma- This new ability may not seem owner of the blog thousands of The Internet is the closest thing
DXcfe\p#dXeX^`e^\[`kfii\gfik`e^2:_Xic\j
jor setback last week. to be such a serious change. Com- dollars to be accessed on its net- to a true marketplace of ideas KXeC`d#dXeX^`e^\[`kfim`jlXcj2A`cc;`j`j#e\nj
In a federal appeals court rul- cast is an independent company work. If the owner does not have that we have today. The barriers \[`kfi2IXZ_\cJdXcc#fg`e`fej\[`kfi2O`O`K`Xe#
ing April 6, Comcast and other in- that has the right to provide what thousands of dollars to spend, the to entry – the difficulties to get- ZfgpZ_`\]2<d`cp9XpZ`#[Xpk`d\Xjj`jkXek\[`kfi2
ternet service providers won the services it will to its custom- blog could cease to be seen on a ting your thoughts and ideas out DXibI`m\iX#N\Ygif[lZ\i2Af\NXi[#Xjj`jkXek
e\nj\[`kfi%
ability to “block or slow specific ers. However, Comcast now has computer connected to “Comcast and seen by the whole world – are
sites” and charge sites to deliver the power to slow, chill and even Internet.” very minimal.
their content faster. completely silence speech from The problem gets infinitely Access to the Internet should We hope if this case goes on to
We are appalled at this short anywhere in the world. worse if Comcast has an open po- continue to be like access to wa- the Supreme Court, that the deci-
term victory for Internet service Now, Comcast can legally litical agenda. Silencing politi- ter. There’s no premium city wa- sion will be overturned in the in-
providers. In an effort to increase charge certain sites to be seen cal speech from any party or only ter. It’s simply on tap every- terest of the Internet and its mil-
profits, Comcast now has the po- by its customers. For instance, favoring one type of political where. lions of users around the world.

GFC@K@:8C:8IKFFENFCM<IKFE#:8>C<:8IKFFEJ C<KK<IJKFK?<<;@KFI
I\jgfe[`e^kfZfclde`jk Russia is “sufficiently behind
:fcc\\eC`e[jXpËjXkkXZb the US” goes well beyond any
stretch of the imagination.
feXidjki\Xkp The second is that, according
to the treaty, “even if a coun-
I’m curious as to the sorts of try attacks using biological,
fact-checking that were used chemical, or any other weapon
when writing your column or attack mechanisms, the US
about the recent arms treaty. will be unable to use a nucle-
As I don’t have the space to ar weapon against it.” In fact
respond to your overall rea- the treaty instead states that, in
soning, I’ll instead look at two the event of biological weapons
patently incorrect statements threats, the US “reserves the
you made within your article. right to make any adjustment
The first deals with Russia to this policy.” Again, we find a
and the US reducing their weap- statement shown as fact, when
ons by 30 percent, and “since the reality is instead completely
Russia is sufficiently behind the opposite.
the US as far as weapons go, For statements such as these
of course they are the most to be presented in your article
thrilled about this new treaty.” indicates one of two things: 1.)
It confuses me how you came You have willingly misunder-
to this conclusion, as a sim- stood the new policy for the ben-
ple internet search for “nucle- efit of presenting your opinion,
ar weapons states” shows the or 2.) You simply didn’t bother
exact opposite. According to the to fully check and read up on
Federation of American Scien- what you were writing about.
tists, as of April 6th, the US has My guess would be the latter,
9,400 total warheads stockpiled, but neither of these possibilities
with 2,626 operational. Russia, should really be acceptable in
on the other hand, has approxi- any level of journalism...
mately 12,000 stockpiled, and A8D<J><8IP#
4,650 operational. To claim that j\e`fi`e<e^`e\\i`e^

9<KN<<EK?<C@E<J

K`d\kf^ifnlg#
JN<8K@EËK?<?8CCJKL==
jkfgkiXj_kXcb`e^
Jk\m\ejkfc\Xm\cXjk`e^c\^XZp D<>8E
>I8?8D
Fg`e`fej
Zfclde`jk
if it’s just easier these days to
know anything and everything
about each other. In the amount
of hours so many college kids
seem to spend looking at Susie
al misconduct, no partisan He’ll be tempted to appoint sion he will have made so far. Lou’s rad outfit Thursday night
wrangling. He was confirmed a guaranteed liberal, likely Not only was John Paul Ste- from the Facebook she posted

8
A8I<;?8CC unanimously, 98-0. This air born and bred in the upper vens a label-defying jurist fter a particularly intense 39 seconds ago, or numerically
Fg`e`fej of independence and non-par- echelons of the East Coast – appointed by a Republican first semester, I decided to rating sororities on College ACB
Zfclde`jk tisanship was carried on in a intellectual elite, definite- with a moderately conserva- try something a little dif- (the knockoff of the late Juicy
unique legacy that character- ly a graduate of multiple Ivy tive pre-Supreme Court judi- ferent this spring. Campus, a college gossip site), I
ized Stevens’ career. As Jus- League institutions. cial record, he became the Last semester, I spent most of think we could all do some pret-

@
s it really nerdy to say that tice Stevens leaves public ser- While I have nothing leader of the court’s liberal my time holding on for dear life, ty impressive things.
I have a favorite Supreme vice, we’re reminded that this against any of those classifi- wing – he is also the court’s and I wanted this one to feel I know it’s human nature to
Court Justice? It’s proba- independence and non-parti- cations, I hope that the Presi- only member without an Ivy more focused. I love nothing be curious about the people
bly not quite as nerdy as say- sanship are what the Supreme dent will reject that temp- League diploma (he’s an alum more than self-evaluation. Thus, around us. But attacking non-
ing that I can name all the Court and our country tation and find a of the University of Chicago “The Goal Poster” was born. present people verbally isn’t
members of the Jedi Coun- need the most. nominee and Northwestern), the only It’s an awkwardly large collage just a waste of time; it’s a scar
cil or every National League The departure who true Midwesterner, the only of the ten things I wanted to do on your own reputation. I was
strikeout leader since 1968, of Justice Ste- Justice with a record of mili- this semester, like keeping my gung ho to vote for gubernato-
but almost. Nerdy or not, for vens presents tary service and the only Chi- room cleaner (I’m organization- rial candidate Dan Hynes in
as long as I can remember, another oppor- cago Cubs fan on the current ally deficient), being better at the Democratic primaries ear-
my favorite Supreme Court tunity for court. returning phone calls (because lier this year... that is, until the
Justice has been John Paul President OK, the last one isn’t really I hate talking on the phone) and shameless insult-hurling began
Stevens. Obama to relevant, but the larger point getting into a sum- between him and opponent Pat
If they made Supreme Court shape the is clear: Yes, the Supreme mer journalism pro-
action figures, I’d buy Ste- Court is an inherently elit- gram at Georgetown
vens’. If legal celebrities were ist institution, but why (which my friends
like musicians, I’d have his should the President be so are probably going
poster up on my wall. If John quick to make it even to duct-tape my mouth
Paul Stevens was a pro ath- more so? closed if I don’t shut Quinn.
lete, I’d wear his jersey and We’re students up about). As the Bashing
buy his trading card. You at an egalitarian, semester is each other
get the picture. So you will public, only-mod- drawing to was perhaps
understand my disappoint- erately-elitist Mid- a close, I’ve supposed to win
ment when I recently learned western university. been think- the voting hearts
that John Paul Stevens will We can’t really claim ing about of Illinoisans, but
be retiring at the end of the John Paul Stevens as how far I think it’s safe
court’s present term. For a one of our own, but on I’ve come to say most of us
Supreme Court fanboy like the current court, he’s as on some of thought it was just
myself, it’s akin to The Bea- close as we’re going to get. these goals, embarrassing.
tles breaking up. Truly, it’s These nine individuals and how far Trash talk, from
the end of an era. are in charge of telling us I have to go where I stand now,
The reason for my devo- what the Constitution means with others. isn’t much more than
tion to Justice Stevens is not – shouldn’t Obama’s criteria Oddly a reflection of some-
because of his political lean- consist of more than a Har- enough, the one’s own feelings of
ings (ostensibly liberal, but vard law degree and a liberal hardest goal on inadequacy. Let’s face
frequently centrist) or the stance on abortion? there has been it—Hynes including a
President who appointed The Supreme Court will one of “Trashing clip of a former Chicago
him (Gerald Ford. Remem- lose a giant when Justice Ste- Trash Talk” (adorably placed mayor calling Quinn a “totally
ber him?). I’m a Stevens-ite vens steps down. His vote and upon the magazine cutout of and completely undisciplined
because of what he represents his voice will be gone, but his a dumpster). Now, I’ve never individual” in an ad didn’t make
on a court that has, during his legacy can still remain. been an intentionally malicious his own worth any greater.
nearly 35-year long tenure, Let’s hope that Presi- or gossipy person. But being Me talking about how terri-
changed markedly. dent Obama recog- almost halfway done with col- ble someone’s outfit is doesn’t
The process for nomi- nizes the inherent lege, I’m starting to realize how change the fact that I wore a
nating and confirming value of an intel- completely unattractive gossip Pink Power Ranger outfit for 3
Supreme Court nomi- lectual indepen- is to me. At this point, people weeks straight the summer of
nations was much dif- dent streak; our age have pretty much decid- 1995. So shouldn’t we find some-
ferent in 1975 than it forget race, ed to a) grow up and behave like thing better to do with our time?
is today. When Gerald religion, party adults, or b) act like they belong There’s a quote from an
Ford tapped Stevens to fill or pedigree, on As the World Turns. Sadly, I unknown author that goes,
the vacancy left by William court that’s the quality feel like most belong in the lat- “Great people talk about ideas.
O. Douglas, the debate in the in his image. that I want to see embodied in ter category. Average people talk about
Senate focused primarily on Indeed, molding the Obama’s next nominee to the To be fair, we’re living in a things. Small people talk about
his qualifications, intellect Supreme Court is one of embod- highest court in the land. place and time that seems to other people.” I don’t think I
and legal ability. a President’s best chances to ies the laud- Another Cubs fan wouldn’t thrive on this kind of behavior. I could put it a better way than
There were no “litmus make an enduring impact on able qualities that hurt, either. don’t know if people in our gen- that.
tests” on hot-button issues, the American political and Jus- tice Stevens always eration are just genuinely more
no accusations of person- cultural landscape. displayed. It’s the best deci- AXi\[`jXale`fi`eC8J% interested in other people, or D\^Xe`jXjfg_fdfi\`eD\[`X%

I\X[\iËjfg`e`fej1 K_\;X`cp@cc`e`i\j\im\jk_\i`^_kkf\[`kfii\a\ZkXepZfeki`Ylk`fej%C\kk\ijdljkY\c`d`k\[kf*''nfi[j%:feki`Ylk`fejdljkY\kpg\[Xe[`eZcl[\k_\Xlk_fiËjeXd\#X[[i\jjXe[g_fe\eldY\i%
Le`m\ij`kpjkl[\ekjdljk`eZcl[\k_\`ip\Xi`ejZ_ffcXe[Zfcc\^\%DX`c1Fg`e`fej#K_\;X`cp@cc`e`#,()<%>i\\eJk%#:_XdgX`^e#@C-(/)'%<$dX`c1fg`e`fej7[X`cp`cc`e`%Zfdn`k_k_\jlYa\ZkÈC\kk\ikfk_\<[`kfi%É
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'(' ,8
?FIFJ:FG<J E<NPFIBK@D<J:IFJJNFI;
1 2 3 4 5 6 7 8 9 10
Kf[XpËjY`ik_[Xp+&(*&(' 1;feËkj_p
XnXp]ifdpfli[\j`i\kfdXb\X[`]]\i$
11 12 13 14
\eZ\%=fZljfepflifYa\Zk`m\jXe[^f
X]k\ik_\d9fc[#gXjj`feXk\XZk`fenfibj
15 16
Y\kk\ik_Xeilk_c\jje\jj%PflËcc^X`ei\Zf^$
e`k`fe`]pflkXb\X]\nZ_XeZ\jk_`jp\Xi%
17 18
Kf^\kk_\X[mXekX^\#Z_\Zbk_\[XpËj
iXk`e^1('`jk_\\Xj`\jk[Xp#'k_\dfjk
19 20 21 22
Z_Xcc\e^`e^%
8i`\jDXiZ_)($8gi`c(0 1Kf[Xp`jX.%
23 24 25 26 27
8jlg\i$[\dXe[`e^`e[`m`[lXcnXekjkf
Zfekifcpfli\m\ipdfm\%K_`jc\Xm\jef
28 29
iffd]fiZi\Xk`m`kp%Aljk[fn_XkpflËi\
kfc[%Pfl^\kpflikliecXk\i%
30 31 32 33
KXlilj8gi`c)'$DXp)' 1Kf[Xp`jX.%
GXikf]pflnXekjkfY\`ek_\jgfkc`^_k#
34 35 36
jfXb`e^`ek_XkXggcXlj\%8efk_\igXikf]
pflaljknXekjZfekifc%GXZbX^\pfliXZk
37 38 39
n`k_\ek_lj`Xjd%
>\d`e`DXp)($Ale\)( 1Kf[Xp`jX.%
40 41 42 43 44 45
<Xj\`ekf^iflgXZk`m`k`\j%Pfli\ek_l$
j`XjdZXeZXiip\m\ekj]finXi[`]pfl
46 47
i\j\im\`k]fik_\i`^_kdfd\ek%8Zkc`b\
k_\i\Ëjefgi\jjli\%
48 49 50 51
:XeZ\iAle\))$Alcp)) 1Kf[Xp`jX-%
PfldXpnXekkfY\ilc\i]fiX[Xp%JkXik
52 53 54 55
n`k_pfligXike\iXe[[\dXe[jlggfik%
9\gi\gXi\[kf\`k_\ij_\ccflkj`^e`ÔZXek
56 57
ZXj_fii\m`j\pfli^fXc%
C\fAlcp)*$8l^%)) 1Kf[Xp`jX,%
58 59
:f$nfib\ijk_`ebkf[XpËjXccXYflkk_\d%
K_XkËj]leep%%%pflk_fl^_k`knXj]fipfl
;feËkkipkfZ_Xe^\k_\`i[`i\Zk`fe%K_Xk GLQQC<9PA<==I<PN<:?JC<I
B<M@E:?8E>K?<;8@CP@CC@E@
nflc[Y\]lk`c\%
B`j_fi\IXaX^fgXcXe#XjjfZ`Xk\[`i\Zkfi]fiXggc`\[i\j\XiZ_Xkk_\@cc`ef`jJljkX`eXYc\K\Z_efcf^p:\ek\i#\ogcX`ej M`i^f8l^%)*$J\gk%)) 1Kf[Xp`jX.%
8:IFJJ 52 :i\Xkfif]30$&35$ 25 ÈQfle[jÉ
_fneXkliXcf`cjXe[clYi`ZXekjZXeY\\okiXZk\[]ifdmXi`fljgcXekjXe[fi^Xe`ZdXkk\ik_Xknflc[efidXccpY\  1 K\cckXc\j`^e 8Zifjj 26 ;\g\e[fe
<dfk`feXc`ejg`iXk`fe^`m\jXglj_kfX
[`jZXi[\[XjnXjk\%IXaX^fgXcXeËj^iflg]fZlj\jfek_\i\cXk`fej_`gY\kn\\e\e\i^pXe[nXk\i% Zi\Xk`m\gifa\Zkk_Xk_X[jkXcc\[flk%9i`e^  7 Jk`Zb`efe\ËjVVV 56 =Xd`cpeXd\`e\Xicp 27 P\ccfnjkfe\ifXd\i
XjjfZ`Xk\j`ekfk_\d`okfX[[ÕXmfiXe[ 11 GX`[efXkk\ek`fekf m`fc`e$dXb`e^ 30 Ç

JLJK8@E89@C@KP Statue of Liberty also current-


ly uses it.
waste heat to run and it can be
done on a small or large scale,”
jg`Z\%
C`YiXJ\gk%)*$FZk%)) 1Kf[Xp`jX-%
13 Gifk\Zk`fe
15 N`k_23$8Zifjj#
]XdfljÈfg\e`e^Éc`e\
57 ÈFliD`jj9iffbjÉ
jkXif]1950jKM
58 C`b\knfg\Xj`eVVV
31 È@[`[eËkbefn@_X[`k
VVVÉ
32 BelZbc\_\X[VVV#GXlc
“Big places that use it are in Kishore said. PfldXp_Xm\XgifYc\d^\kk`e^Xccf]
=IFDG8><-8 pfli_fd\nfib[fe\fek`d\%8Zcfj\ 17 ?\XmpZfXkj 59 <dg_Xj`q\ N`eZ_\cc[lddpf]fc[
sensitive areas, like a water- Water from this process can
]i`\e[Yffjkjpflidfk`mXk`feYpgifm`[`e^ 18 I\jg\Zk]lcXZkj KM
“We’ve found out over the shed or national parks,” Lind- then be used to produce elec- 33 CXYVVV
Xi\nXi[% 19 IXgg\iVVVI`[X ;FNE
years that we can use vegetable sey said. tricity and other forms of ener- 34 8c\o;ffe\jYlipËj
JZfig`fFZk%)*$Efm%)( 1Kf[Xp`jX-% 20 JXpjÈE`Z\afYÉkf  1 K`epY`fcf^`ZXcZ_Xe$
oil lubricants (in certain vehicles) Another important sector of gy without using up more of our Pflig\ijlXj`m\kXc\ekjnfibY\Xlk`]lccp 23 J\\15$8Zifjj jZ_ffc#]fij_fik
e\c#Xj`ek_\b`[e\p
instead of traditional hydraulic the ISTC is led by Dr. Kishore small freshwater supply. efn%Fk_\ijdXpi\jgfe[e\^Xk`m\cpXk 28 È>`m\ek_\j`klXk`fe 35 CXnp\iËjXjj`^ed\ek
 2 8c`^e\[
fluids to reduce damage if there’s Rajagopalan, Associate Direc- Kishore is also working on Ôijk#YlkXj_fikZfem\ijXk`feXZ_`\m\j ¿É  3 NXk\idXegif[lZkj 36 J`cm\iZf`ef]XeZ`\ek
a spill,” Lindsey said. tor for Applied Research of the extracting oil from various e\Xi$kfkXcX^i\\d\ek% 29 8cY\ikfMF5gif[lZk  4 N\`i[ >i\\Z\
Fossil fuels take a long time to center. His group focuses on the renewable resources. Jatropha JX^`kkXi`ljEfm%))$;\Z%)( 1Kf[Xp`jX 30 N`k_35$8Zifjj#  5 VVV[f^:_`e\j\ 38 Fg\e$X`icfYY`\j
degrade, while vegetable oil is relationship between water and seeds, in particular, are a unique .%K_\i\ËjXY`^[`]]\i\eZ\Y\kn\\e[lkp jfliZ\f]15$&23$ 39 =`o#XjXYffk
Yi\\[
biodegradable, Lindsey said. In energy. source of oil, he said. Among its Xe[ZXg`klcXk`fekfk_\[\dXe[jf]fk_\ij% 8Zifjj 41 VVVYcXjk\i
 6 GcXp]lce\jj
the case of vegetable oil, when it “To produce electricity (ener- benefits, Jatropha seeds have a Pflid`jj`fe`jkf_Xe[c\k_\j`klXk`fe 32 Jlggfik]fiXe\Xif] 42 :cXjj`ZkXc\`e[XZkpc`Z
n`k_^iXZ\Xe[Ôide\jj%
 7 Efkjfjkfidp
spills, it will be eaten by micro- gy), you need a lot of water,” 40 percent oil content, and are Zfie  8 >ffm\iXe[fm\i#Xj _\oXd\k\i
:Xgi`Zfie;\Z%))$AXe%(0 1Kf[Xp`jX.%
organisms, as opposed to staying Kishore said. cheap to produce. His group even 34 ÈFcpdg`XÉXik`jk Xi^ld\ekj 43 Jfd\@iXhnXii\gfik$
KiXej]fidXk`fe`jX^ff[k_`e^%PflÔe[
around for awhile and harming Because of this, a lot of his used this seed in relief efforts 35 J\\30$8Zifjj  9 Jg\ccYfle[ \ij
k_XkpflËm\Y\\enXek`e^jfd\k_`e^e\n#
the environment. research involves finding ways in Haiti because the process is 37 9\c`\]jpjk\d 10 :`e\dXk`ZjZ\e\$ 44 :lYXVVVild_`^_$
Xe[efnpfl]\\cZi\Xk`m\\efl^_kfkXb\
A few companies are inter- to use salt water instead of fresh so cost efficient and the seed is fek_\Z_Xcc\e^\% 38 C`b\10#YlkefkO Z_Xe^\i YXccj
ested in using bio-lubricants, water to produce energy. At the native to Haiti. 8hlXi`ljAXe%)'$=\Y%(/ 1Kf[Xp`jX-% 40 15$&23$8ZifjjcfZX$ 11 :_\npZfe]\Zk`fe 45 Jkfi\#Xjjlggc`\j
k`fe 12 :XgkX`e:ffbcXe[]Xcc 48 Fi^%k_Xkgifdfk\j
while some already do, Lindsey ISTC, Kishore is developing a “The only problem is the by- >lXi[pflifnek`d\Xe[jgXZ\`efi[\i
kfdXo`d`q\XZZfdgc`j_d\ekjkf[Xp% 46 È<e^cXe[_Xk_cfe^ f]8gi`c1769 jl^Xic\jj^ld
said. Caterpillar, a company that desalination process that uses a product that’s left behind is a
I\jgfe[kfXZi\Xk`m\hl\jk`fe#k_\e^f Y\\edX[#Xe[jZXiiË[ 14 ?`jfi_\i1=i% 49 9cl\$jb`ee\[[\`kp
builds tractors, bulldozers and method called forward osmosis to toxic compound,” Kishore said. 50 AXZb\k]Xjk\e\i
YXZbkfpflifnenfib% VVVÉ1I`Z_dfe[`e 16 :fd\jlgj_fik#jXp
other industry motor-vehicles, remove salt from salt water. “We’re working on converting 51 Jl]Ôon`k_=i`^`[$
G`jZ\j=\Y%(0$DXiZ_)' 1Kf[Xp`jX ÈB`e^I`Z_Xi[@@@É 20 Jl^^\jk
is interested in using a bio-lubri- “Forward osmosis is advanta- it to be a consumable protein for ,%Pfl[feËk_Xm\k_\gfn\ikfdXb\Xe 47 Cfjkjfc[`\i#Yi`\Õp 53 ?fjg%_ffblgj
21 I\jkiX`ek
cant instead of oil. The company geous for three main reasons: it animals, and even people later,” \o\Zlk`m\[\Z`j`fekf[Xp%Pfl[f_Xm\k_\ 48 ?Xccgifm`[`e^\ek\i$ 54 8Zhl`i\
22 8dflekf]dfe\p
that built the elevators for the is a low pressure process, it uses he said. \e\i^pkfZXiipflkfi[\ij]ifdXYfm\%;f kX`ed\ek k_XkZXeY\iX`j\[6 55 IXlZfljcXl^_jpc$
k_`jZ_\\i]lccp%8Yfelj`jgfjj`Yc\% 51 È;\XiÉZfclde`jk 24 ÈN_Xkn`ccpflVVV6É cXYc\X

9I8@CC<
)''/Ki`Yle\D\[`XJ\im`Z\j@eZ%;`jki`Ylk\[Yp
Long-term goals include Allowing them opportunities to Be`^_kI`[[\i$Ki`Yle\@e]fidXk`feJ\im`Z\j% K_\Zifjjnfi[jfclk`fe`j`ek_\:cXjj`Ô\[j\Zk`fe%
commercializing the product be productive and independent
=IFDG8><-8 for school systems and home is really important.”
use and even using the idea to McDonagh also stressed D8I:F8E;D8IKP 9@CCP=FI<

on flat surfaces only. create interactive playground how important the project is
Another challenge is that Sch- equipment. even for those without visual
neider had no experience read- “People don’t realize when impairment.
ing Braille until this project. they see a child what their “We all experience some form
Schneider said she would like potential could be,” Schneider of disability, especially with
to have her foam prototypes con- said. age,” she said. “This is a very
verted into bronze sculptures by “So many people look at those exciting new way of approach-
the summer. who are blind in a specific way. ing design.”

?8IE;<E probably end up saying how


“embarazada” I feel for my
giving him a chance say it.
But I guess it’s their loss. By
=IFDG8><-8 lack of skill. Then, the person attending his lectures I learn
I’m talking to will presume something the textbook and
Contrary to the popular reac- to stare at what he believes PowerPoint cannot teach. I get ;FFE<J9LIP >8IIPKIL;<8L
tion we all take part in when to be my pregnant stomach. a perspective that goes beyond
laughing at what a “joke of a And that is just a whole mess dates and facts. He tells a sto-
class” these technologically of confusion for everyone ry through his lectures, and it
inclined classes may seem, in involved. is evident to me that the pres-
reality it shouldn’t be that fun- So where does convenience ence and passion with which he
ny. Because guess what? We’re interfere with actual learning? teaches has something more to
all paying for that “joke of a Here, right here. By forfeiting say than the PowerPoint slides
class.” Whether it is you per- their right to teach students he creates.
sonally or your parents, sooner face-to-face, professors who So, will the classroom
or later, we’re going to real- rely heavily on online-based become paperless? My final
ize the joke’s on us. For even coursework are giving us an reaction: I really hope not. For
though I love to joke around easy out for our education. And my sake and for yours. But
about how easy some of my even though we may not need the lack of incentive and the
classes have been, the fact of to know half of the stuff we fact that lectures tend to be
the matter is the only thing it are being taught in our general sparsely filled will continue. If
is helping is my GPA. education requirements, when we aren’t raising our grade by 9<8I;F ;8E;FL>?<IKP
For instance, I have come to we leave this place behind, it going to lecture (aside from a
the realization that I am not is not about that. It is about few I-clicker points here and
learning anything from tak- principality over probabili- there), then we need some oth-
ing Spanish 200. I memorize ty; retaining something rath- er benefit. Whether this comes
the vocabulary and skim the er than memorizing it. It’s a in the form of revealing a Brit-
stories, but the fact that I nev- double-edged argument, and I ish accent, or information we
er have to speak the language am taking a side — Professor can’t find between the pages
while taking this online class Liebersohn’s in fact. My His- of the textbook, it is clear that
is starting to strike me as a tory 142 professor is often dis- in order to keep the class-
bit problematic. Because God mayed and slightly saddened room alive, professors and stu-
knows, when the time comes by the lack of attendance at his dents must strike some kind of
to use the language to inter- lectures because he has some- compromise.
act with another actual person thing worth saying, and many
(and not a “submit” button) I’ll students skip out before even <d`cp`jX]i\j_dXe`eC8J%

Champaign-Urbana’s Only
Quite Simply the Best Full-Service Car Wash
“Who says oil and water don’t mix?”
1905 W. Bradley Ave. • 3 bay Quick Lube • Half-price Car Wash
Champaign, IL * 352-9200 • 2 Bay Detail Center with Oil Change
Mon-Fri 8-5:30, Sat 8-5 *
Timpone’s offers the perfect date Closed Sunday www.triple-tcarwashandlube.com
atmosphere, right here on campus.

Seasonal & Regional Simplicity


We combine the freshest seasonal ingredients
to create authentic, regional Italian dishes.
Homemade Pasta & Excellent Pizzas.
Science F9J<JJ<;
n`k_Ê8mXkXi6Ë
Technology
-8sKl\j[Xp#8gi`c(*#)'('snnn%[X`cp`cc`e`%Zfd
:_\Zbflkn_Xkk_\ÔcdËj
[`i\Zkfi#AXd\j:Xd\ife#
ZXccjXi\Xc$c`]\m\ij`fef]k_\
ÔcdXk;X`cp@cc`e`%Zfd

Classes
no longer

><KK@E>8=<<C
‘paper-
ful’ due to
Internet
classwork
Learning online
not the same as
attending lectures

=FID8K? Senior creates


sculptures to
aid young blind
<D@CP
?8IE;<E
JkX]]ni`k\i

K
o go to class or not to
go — that is the ques-
students in math tion many of us face
each Monday morning.
Actually, make that every
Monday through Friday,
morning ‘til night. Yet,
instead of debating with
myself about what cereal
9P8CC@JFE:FG<E98I><I Schneider, the fi rst legally blind “I wanted them to be appealing to Deana McDonagh, an industrial to eat when the sun comes
JK8==NI@K<I student to major in sculpture at kids so I incorporated curved sur- design professor, thinks appeal is up, I fi nd myself snapping,

=
the University, has created a series faces,” she said. “There are very few an important part of the success of crackling, and popping on
or many children who are of sculptures she believes will be fl at surfaces. I also put holes in them the project. a bowl of Rice Krispies
visually impaired, learn- appealing to kids and help them learn because after observing kids, I found “We just want them to be beauti- as I wonder, “Is it really
math more effectively. that their little fi ngers always like to ful little sculptures that you’ll want worth it?”
ing multiplication tables “The sculptures would create a fi nd holes.” to pick up,” she said. “Students will In all seriousness, this
gestural language for students,” Sch- Schneider said one of the reasons not only be feeling them but reading question isn’t one most
and mathematical equations neider said. “The project allowed me she wanted the design to be so appeal- equations in a very non-threatening, students struggle with
is simply not something they to still be a sculptor and create some- ing is that she understands fi rst- non-competitive way.” due to pure laziness (most
thing to help someone else.” hand how hard it can be for visually Schneider said being able to apply of the time anyway), but
like to spend time doing. Math The six sculptures are hand-held impaired students to learn math. the Braille to curved surfaces was rather because more and
and feature mathematical equations “Math was very difficult for me in the most challenging part of the proj- more classes are prov-
is hard for them. They would on the surfaces. school,” Schneider said. “I was very ect because usually Braille is used ing to us that attendance
Schneider said she put a lot of thought artistically inclined, but math and is not synonymous with
rather be playing games. Senior into the design of the product. science? I hated them!” J\\9I8@CC<#GX^\,8 an A. Which leads me to
Sheila Schneider has developed the true topic of this col-
umn: Is the college class-
something that she believes room becoming paper-
less? My initial reaction:
will bridge that gap. È@nXek\[k_\dkfY\Xgg\Xc`e^kfb`[jjf@`eZfigfiXk\[Zlim\[jli]XZ\j%%%@Xcjfglk_fc\j`e I don’t think so. But with-
out the obligation to turn
k_\dY\ZXlj\X]k\ifYj\im`e^b`[j#@]fle[k_Xkk_\`ic`kkc\Ôe^\ijXcnXpjc`b\kfÔe[_fc\j%É in homework and papers
during class due to an
J?<@C8J:?E<@;<I#j\e`fiXe[[\j`^e\i
online submitting policy,
or to attend lecture due
to the fact that many pro-
fessors put their Pow-
erPoint presentations

Agency works
online, it is noticeably less
“paper-full.”
Many classes I am in,
or have taken — atmo-
spheric science, sociology,

to reduce waste
Spanish — have been for-
matted as online friend-
ly. Posting lecture notes,
labs, assignments, paper
topics, vocabulary lists,
extra credit opportuni-
ties and even online office
9PD<>8EG@FKIFNJB@ more efficient in their practices by produc- hours through special
JK8==NI@K<I ing less waste. programs have all been
Located at 1 Hazelwood Drive, a few “Waste is result of a defective product made possible. And I for
blocks from Kirby Avenue and tucked away or process,” Marlin said. “If you can pre- one am not complaining.
from the rest of campus, the Illinois Sustain- vent (wasteful processes), you can prevent Efficient and effective, I
able Technology Center (ISTC) is bursting it from becoming waste.” am handed all the infor-
with activity for such a quiet location. Marlin also said most waste issues can be mation I need to obtain a
The ISTC is one of five survey groups that solved by addressing one of two main prob- good grade — which has
form the Institute of Natural Resource Sus- lems: leakages and contamination. In order started to make me think,
tainability (INRS). The Institute has existed to best combat these problems, the ISTC is why go to lecture for
in Illinois for over a century and the ISTC split into various sectors. these classes when they
is one of its newest survey groups. Dr. Tim Lindsey, Associate Director for are basically shoving an
“The agency was founded to help indus- technical assistance at the center, leads a B<M@E:?8E>K?<;8@CP@CC@E@ A into my fi ngertips as I
try,” said Dr. John Marlin, acting director group focusing on research in bio-based K`dC`e[j\p#XjjfZ`Xk\[`i\Zkfi]fik\Z_e`ZXcXjj`jkXeZ\Xkk_\@cc`ef`jJljkX`eXYc\K\Z_efcf^p scroll through Compass?
of the center. lubricants in particular. :\ek\i#[\jZi`Y\jk_\cXYËji\j\XiZ_fefi^Xe`Zf`c\okiXZk`fe%K_\@JK:_XjY\\e`efg\iXk`fe Yet, it’s not that simple.
In order to do this, Marlin said the main j`eZ\(0/,Xe[kXZbc\jnXjk\dXeX^\d\ek`jjl\jX]]\Zk`e^@cc`ef`j`e_fg\jf]lck`dXk\cp
goal of the ISTC is to help industry become J\\JLJK8@E89@C@KP#GX^\,8 i\[lZ`e^nXjk\Xe[iX`j`e^XnXi\e\jj% J\\?8IE;<E#GX^\,8

Have you ever wondered how a


multi-media
operation is run?
If so, we have an exciting opportunity for you!
l 7, 8 & 14
apr i

participants:
KDR Alpha Chi Rho •The Board of Directors of Illini Media is looking for two UIUC undegraduate student
Psi U Delts to serve on its Board.
Sigs Pikes •The Illini Media Board owns and publishes the Daily Illini, Buzz alternative weekly magazine,
the Illio yearbook, the Technograph magazine, and owns and operates WPGU-FM.
DU Sammies •Among other essential duties, the Board establishes general guidelines for the operation
of the company, selects student managers, sets advertising rates and publication schedules,
If your fraternity’s band wants to enter, email us and approves the budget.
at Frattle@wpgu.com. At least half of the band
members must be in the same fraternity. •Applications may be picked up at Illini Media, 512 East Green Street, Champaign,
or email marycory@illinimedia.com for an electronic copy.
•All applications are due by 5pm on Monday, April 19, 2010.

Presented by:

Sponsored by:
(9
Sports
DC9
I\[j%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% , I\[Jfo%%%%%%%%%%%%%%%%%%%%%%%%%% )
DXic`ej%%%%%%%%%%%%%%%%%%%%%%%%%%% , Kn`ej%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% ,
N_`k\Jfo%%%%%%%%%%%%%%%%%%%%% . IXe^\ij%%%%%%%%%%%%%%%%%%%%%%%%%% +
9cl\AXpj%%%%%%%%%%%%%%%%%%%%%%%% . @e[`Xej%%%%%%%%%%%%%%%%%%%%%%%%%%%% )
Kl\j[Xp
8gi`c(*#)'(' IfpXcj%%%%%%%%%%%%%%%%%%%%%%%%%%% (' EXk`feXcj%%%%%%%%%%%%%%%%%%%%%%% +
K`^\ij%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% , G_`cc`\j%%%%%%%%%%%%%%%%%%%%%%%%%%%% .
K_\;X`cp@cc`e`
nnn%;X`cp@cc`e`%Zfd

C\^\e[j
Zfek`el\
kf`ejg`i\
BPC<
;@CC<I
Jgfikj
Zfclde`jk

J
ports define our lives
beyond our teams’ win-
ning and losing. We all have
heroes; a special athlete that
we admire. We don’t always
realize how important these
heroes are, but the impact
they can have on our lives is
extraordinary.
Along with being a sports
fanatic, I’m also a huge film
buff. This weekend I decided
to combine the two and watch
the movie “Looking for Eric,”
in which an English soccer fan
experiencing a midlife crisis
and dealing with thoughts of
suicide seeks help from his
hero, Manchester United leg-
end Eric Cantona (or rather, a
hallucination of him). It really
struck me what a profound
impact our sporting heroes
can have on our lives.
Cantona happens to be one
of my heroes; that’s the rea-
son I had chosen to watch that
movie. Sadly, his career was
coming to an end early in my
days as a fan, but I remem- E<;DLCB8K?<;8@CP@CC@E@
ber his swagger on the field. @cc`ef`jË?fg\?fn\cc#c\]k#Xe[8j_c\p:feiX[nXkZ_XYXcc]XccXkk_\flkÔ\c[nXcc[li`e^k_\^Xd\X^X`ejkF_`fJkXk\feJXkli[Xp%K_\@cc`e`Xi\cffb`e^kfXmf`[YXZb$kf$YXZbcfjj\j#jfd\k_`e^k_Xk
He seemed so nonchalant, but _XjeËkfZZlii\[j`eZ\cXjkj\Xjfe%K_\@cc`e`n`cck\jkk_\`i[\k\id`eXk`feXjk_\p]XZ\k_\@cc`ef`jJkXk\I\[Y`i[jfeKl\j[Xp%

@cc`e`]fZljfe]lkli\#I\[Y`i[j
when the ball came to his feet
he could produce magic. I still
love watching his highlights on
YouTube.
He’s just one of many ath-
letes I hold as heroes. I looked
up to Michael Jordan as a kid.
Certain Manchester Unit-
ed players have become my
heroes. Ryan Giggs for his
commitment, having played
all 19 years of his professional
Threat of 9PJ8DL<CQL98
JK8==NI@K<I
As the No. 18 Fighting Illini
the red-hot Redbirds.
The last time these two teams
faced off, Illinois won on a late-
Zymkowitz said. “They outhit us
and outpitched us. We just have
to come back even stronger when
come prepared for its revenge
on Illinois.
“They are a strong softball pro-
career at the club — a rare feat
in any sport.
I’m sure all of you have
back-to- softball team prepares to take
on Illinois State on Tuesday, they
are looking to avoid doing some-
inning throwing error by Red-
birds catcher Caiti Kopp. In
hopes of turning a double play,
we play ISU because we know
they are out to get us.”
The Redbirds come into Tues-
gram, so we don’t have time to
feel sorry for ourselves,” head
coach Terri Sullivan said. “We
heroes. Since this is Illinois,
I’m sure a lot of you saw Jor-
dan as a hero, too. It might be
back losses thing they haven’t done since
May of 2009 — losing back-to-
back games.
Kopp sent the ball sailing over
the first baseman’s head, scor-
ing Kelley Wedel and giving the
day’s matchup boasting a record
of 22-10, while remaining unde-
feated in the Missouri Valley
will expect them to be ready to
go. We beat them (at Eichelberger
Field) in a tight one, so now we go
Wayne Gretzky for you hock-
ey fans. If you love extreme pushes team With a 10-2 drudging at the
hands of No. 20 Ohio State on Sun-
day still on their minds, the Illini
Illini the 8-7 win.
“Ohio State did come out with
their best (on Sunday),” All-Amer-
Conference. Fresh off a thrill-
ing walk-off victory via a homer
from the Redbirds’ Kara Nelson,
to their place. It’s exciting.”
All season, Sullivan has

J\\;@CC<I#GX^\*9 will head to Normal, Ill., to face ican second baseman Danielle Illinois State will undoubtedly J\\JF=K98CC#GX^\*9

@cc`e`\p\d`[n\\bn`e
Xd`[j\XiZ_]fif]]\ej\
9PG<K<IQ<IM8B@J at opposing stadiums. “We work on it all the time
JK8==NI@K<I Sophomore third baseman in practice,” sophomore Willie
Illinois baseball is heading Zach Borenstein and senior fi rst Argo said. “I don’t really know
into its third straight midweek baseman Alex Gee key the Pan- what we’ve got to do to fi x it,
stretch. ther offense. Borenstein is bat- because it’s more just fi nding a
But the Illini have yet to go 2- ting .314 with six rhythm.”
0 in midweek contests. They are
an even 2-2 in games not played
home runs and
28 RBIs for the
ÈN\Ëm\aljk^fkkf Redsh i r t
freshman Thom-
on Friday, Saturday or Sunday
since their spring trip.
season, while
Gee has hit .315,
Zfek`el\_`kk`e^ as Shelton, who
has seen spot
“Those middle-of-the-week
games are key for us,” out-
racking up three
homers and 16 k_\YXcc_Xi[%%% duty as a pinch
hitter and DH
fielder Casey McMurray said.
“This week, we’re playing two
RBIs.
Illini he ad N\Ëcc^\kXYi\Xb this season for
Illinois, believes
in-state teams, and we know
we’re going to get everyone’s
coach Dan Hart-
leb said his team fiknfXe[k_\e the orange and
blue will cor-
best game because we’re the big has to do a better rect the issue in
state school.” job offensively to \m\ipk_`e^n`ccjkXik the next couple
The Illini host the Eastern pick up one more of games.
Illinois Panthers on Tuesday midweek win. Zfd`e^kf^\k_\i%É “ We’ve just
at Illinois Field. “ W h at I ’ve got to continue
The Panthers are coming off been disappoint- K?FD8JJ?<CKFE# hitting the ball
a weekend series in which they ed with all year i\[j_`ik]i\j_dXe hard,” Shelton
took two of three from More- is that we don’t said. “Things
head State and outscored the move runners,” Hartleb said. will eventually fall into place.
Eagles 25-11. “We hit behind runners. As an We’ll get a break or two and
D@:?8<CJK<@EK?<;8@CP@CC@E@ Illinois (13-13) is coming off offense, you’ve got to capitalize then everything will start com-
@cc`ef`jË:Xj\pDZDliiXp++ jc`[\jX]k\iY\`e^]fiZ\[flkXkj\Zfe[YXj\[li`e^k_\^Xd\X^X`ejkD`jjfli`Xk back-to-back losses at Iowa. when you get guys on base.” ing together. We’ll be fi ne.”
9ljZ_JkX[`ld`eJk%Cfl`jfeN\[e\j[Xp%?\X[ZfXZ_;Xe?Xikc\YjX`[_\_XjY\\e[`jXggf`ek\[`ek_\k\XdËj EIU (9-21) has struggled on Illini players tend to echo
XY`c`kpkfdfm\ilee\ijk_`jj\Xjfe% the road this year, going 3-15 Hartleb’s concern. J\\98J<98CC#GX^\*9

DZ>\_\\Ëj0k_`ee`e^ :lYj[\]\Xk9i\n\ij
_fd\ijXm\j9i\n\ij `e(jkNi`^c\pdXkZ_
9P:FC@E=CP Kyle McClellan (0-1) with one 9PI@:B>8EF Nady said. “It’s a wonderful
K?<8JJF:@8K<;GI<JJ out to give Hoffman (1-1) an K?<8JJF:@8K<;GI<JJ place to play.”
MI LWAUK EE — Casey unlikely victory and help the CHICAGO — Xavier Nady got And the sounds were different
McGehee homered in the bot- Brewers avoid a three-game to see and hear Wrigley Field and the cheers resounded, espe-
tom of the ninth inning, lift- sweep after they tagged Car- from the other side. cially after his homer sparked a
ing the Milwau- dinals ace Chris No longer an opposing play- five-run third inning.
kee Brewers to an Carpenter for three er hearing hoots “Usually it’s not
8-7 victory over homers and seven from the bleachers like that when I’m
St. Louis after runs. — he once played out there,” he said.
the Cardinals ral- P ujols st r uck for the division- R icket ts, the
lied against closer :8I;@E8CJ 9I<N<IJ late. rival Pirates as well longtime fan whose

. /
Trevor Hoffman In the seventh, he as two other NL :L9J 9I<N<IJ family took over
on Sunday night.
Hoffman was
protecting a 7-4 lead with two
sliced a drive inside
the right-fi eld foul
pole with two outs to cut Mil-
teams — Nady got
an earful of cheers
Monday, helping the
0 , the team in Octo-
ber, joined his two
brothers and sis-
outs in the top of the ninth when waukee’s lead to 7-4 and chase Chicago Cubs win their season ter to sing “Take Me Out to the
baseball’s leader in career starter Randy Wolf. opener. Ball Game” during the seventh-
saves unraveled for the second Hoffman then again ran A Cubs’ newcomer, Nady hit inning stretch.
straight appearance. Albert into trouble with two outs in one of three Chicago homers in A crowd of 41,306 turned out
Pujols hit his second two-run the ninth after allowing Nick E8DP%?L?K?<8JJF:@8K<;GI<JJ a power display for new owner at Wrigley Field on a 58-degree
homer of the game to cut the Stavinoha to hit the go-ahead K_\:_`ZX^f:lYjËA\]]9Xb\i#i`^_k#Z\c\YiXk\jn`k_>\fmXepJfkf(/ Xe[ Tom Ricketts that led to a 9-5 win afternoon and watched the Cubs
lead to one, and Matt Holliday homer in the same situation on 8c]fejfJfi`XefX]k\i_`kk`e^Xknf$ile_fd\ileX^X`ejkk_\D`cnXlb\\ over the Milwaukee Brewers. rush to an 8-1 lead.
followed with a tying shot. 9i\n\ij[li`e^k_\k_`i[`ee`e^f]k_\:lYjË_fd\fg\e\ifeDfe[Xp%K_\ “You just hope to go out and
But McGehee connected off J\\:8I;@E8CJ#GX^\*9 :lYjY\Xkk_\9i\n\ij0$,]fik_\`iÔijk_fd\m`Zkfipf]k_\j\Xjfe% play the game the right way,” J\\:L9J#GX^\*9
)9 Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd

E?Ck\XdjÔ^_k]fiÊgi`q\nfik_Z_Xj`e^Ë
Stanley Cup advance against Colorado, back
in the playoffs after a one-year
absence.
against the Ottawa Senators.
“We just know what is expect-
ed of each other,” said Penguins

tournament “I don’t think we can look at


any numbers because for the
past so many years we suppos-
captain Sidney Crosby, who
scored a career-high 51 goals
this season. “Everyone gets a

kicking off
edly have been better than any- pretty good idea when you go
body in the league and we came through that many games and
short,” goalie Evgeni Nabokov adversity and all those things
said. “All the numbers, all the together. The expectations are
talk does not really matter. We high within this room, and hav-
9P@I8GF;<CC have to come out and win the ing that familiarity with what we
K?<8JJF:@8K<;GI<JJ hockey games. That’s the only need to do is important.”
To borrow an NHL slogan way we can get away from all Don’t write off the Penguins
from seasons past, the big- those talks.” just yet. Pittsburgh was the
gest question heading into this If the Sharks do get past the No. 4 seed in 2009 and took out
year’s postseason can be sim- Avalanche, they could face No. 2 Washington in the second
ply summed up as: Is this the Detroit in the second round. round.
year? “You’ve got to catch fi re,” Red “I’m certainly not looking for-
Is this the year the Detroit Wings coach Mike Babcock said. ward to playing them,” Capitals
Red Wings and the defending “Sometimes you’re not great in coach Bruce Boudreau said. “ If
champion Pittsburgh Penguins the early rounds, but you’ve got we have to play them, we have
give other teams a chance to play to catch fi re. There’s got to be a to play them. They’re the cham-
for the Stanley Cup? belief system, and you need role pions. No reason to think they
If so, will the San Jose Sharks players to step up and your best can’t do it again. They got the
fi nally step up in the Western players to be good. same cast of characters.”
Conference and live up to their “It’s a great, great trophy. Capitals captain Alex Ovech-
lofty regular-season marks and It’s a prize worth chasing. It’s kin ceded his hold on the Maurice
shake their underachieving rep- hard to win, which makes it so Richard Trophy, given each sea-
utation? If not, will the upstart special.” son to the NHL’s top goal scorer,
Chicago Blackhawks or surpris- The Red Wings will face the after a two-year reign. Ovech-
ing Phoenix Coyotes unseat the Coyotes in the fi rst round. Phoe- kin, the league MVP the past two
Red Wings, who won the Cup in nix hasn’t been in the playoffs seasons, fi nished one goal behind
2008 against the Penguins and since 2002, joining the Los Crosby and Tampa Bay young-
then fell in seven games a year Angeles Kings for the longest ster Steven Stamkos.
ago in the rematch? gap between appearances for Ovechkin trails Crosby in sev- :?8IC<J:?<D<P8JJF:@8K<;GI<JJ
The answers will begin to this year’s qualifiers. The No. 6 eral areas, most importantly in :_`ZX^f9cXZb_XnbjË:fc`e=iXj\i+- Z\c\YiXk\jn`k_;leZXeB\`k_#c\]k#Xe[GXki`ZbJ_XigX]k\ikp`e^`ek_\k_`i[
unfold Wednesday night when Kings will meet the No. 3 Van- the championship department. g\i`f[X^X`ejkk_\;\kif`kI\[N`e^j[li`e^XeE?C^Xd\feJle[Xp%;\kif`knfe*$)`efm\ik`d\%
the 16-team Stanley Cup tourna- couver Canucks, who won the In the past 12 months, Crosby
ment gets under way with four Northwest Division. has captured the Stanley Cup Washington is primed to make east Division-winning Buffalo for the 13th straight season, the
games. Three other series will The Penguins should face seri- and an Olympic gold medal — a long run. The Capitals’ path Sabres. second-longest current streak in
start Thursday, and the Central ous challenges out East as they two things that have eluded the starts Thursday against the The No. 7 Philadelphia need- the league to Detroit’s 19 con-
Division-champion Blackhawks begin their quest for a third Russian star. No. 8 Montreal Canadiens, who ed even more time — a shoot- secutive appearances.
will host the Nashville Preda- straight trip to the fi nals. Pitts- “I think he’s like any other didn’t secure a playoff spot until out win on Sunday over the New Philadelphia played poor-
tors on Friday in Game 1 of that burgh entered the fi nal week- player, he gets excited for the Saturday. York Rangers in a win or go ly down the stretch and nearly
Western matchup. end of the regular season with a playoffs and will ramp it up a The fi nal three places in the home game. The Flyers jumped missed the playoffs after being
San Jose finished first in chance to win the Atlantic Divi- little bit,” Boudreau said of East weren’t decided until the over Montreal with that victo- considered an early Stanley Cup
the West last year and was sion and the No. 2 seed, but a loss Ovechkin. last two days of the season. The ry and into a fi rst-round match- contender. The Flyers should
knocked out in the fi rst round to Atlanta on Saturday ruined With a loaded lineup that Boston Bruins, last year’s top- up with the New Jersey Devils, carry confidence and momen-
by No. 8 Anaheim. The Sharks those hopes. Now the Penguins includes forwards Nicklas Back- seeded team, nabbed sixth place who edged the Penguins for the tum into the series with the Dev-
(51-20-11) fi nished on top again are assured of home-ice advan- strom and Alexander Semin, on Saturday and earned a fi rst- Atlantic title. ils, a team they beat in five of six
with 113 points and will try to tage in only the fi rst round and defenseman Mike Green, round meeting with the North- The Devils are in the playoffs meetings this season.

DZ>n`i\Ëji\kliei\Z\`m\jfmXk`fe
DC99I@<=J
IXe^\ij+#@e[`Xej) The right-hander, who signed
a $15 million, two-year contract
CLEVELAND — Nelson Cruz with Washington as a free agent,
hit his fi fth home run of the sea- was an All-Star with Colorado

Despite steroid drama, St. Louis fans son, connecting in the 10th inning
and sending the Texas Rang-
last season.
The Phillies came back from

welcome McGwire back to stadium ers to a 4-2 win over Cleveland


on Monday, spoiling the Indi-
ans’ sold-out opener and man-
a 4-0 margin by scoring twice in
the fourth and chased Marquis
with five in the fi fth.
K?<8JJF:@8K<;GI<JJ board just behind manager Tony ager Manny Acta’s home debut.
ST. LOUIS — Mark McGwire La Russa and third base coach C r u z ’s two -r u n d r ive
drew a standing ovation before Jose Oquendo. came with one out against
IfpXcj('#K`^\ij,
the Cardinals’ home opener Cheers for McGwire dwarfed Ja mey Wright (0 -1) . DETROIT — Jose Guillen hit
Monday, a clear sign many St. the response both La Russa and Cruz leads the AL in home a two-run homer after his two-
Louis fans have forgiven the Oquendo received. After bound- runs. out foul popup was dropped by
former home run king for using ing out of the truck, he shook His line shot onto the pedes- Detroit fi rst baseman Miguel
steroids. hands with Cardinals Hall of trian home-run porch at Pro- Cabrera , sending the Kansas
There was an immediate Fame Stan Musial. gressive Field wrecked an other- City Royals to a 10-5 win Mon-
burst of applause even before Lee Carroll of Chesterfield, wise pleasant day for Cleveland day and ending the Tigers’ four-
the official introduction prior clad in a red Cardinals T-shirt in fans, who have to be concerned game winning streak.
to the game against the Houston the upper deck of Busch Stadi- about the club’s shaky bullpen. Guillen took advantage of
Astros. McGwire is the Cardi- um, said McGwire has endured Frank Francisco (2-2), who lost Cabrera’s error for a go-ahead
nals’ new hitting coach. enough scrutiny since admit- his job as Texas’ closer on Sun- homer in the fourth inning.
“It’s always exciting here for ting in January to using perfor- day, pitched a perfect ninth. Scott Podsednik had four hits,
opening day,” McGwire said mance-enhancing drugs during Neftali Feliz , Francisco’s tem- including a two-run single in
before the game. “I’m sure his career. A<==IF9<IJFE8JJF:@8K<;GI<JJ porary replacement, earned the sixth that helped the Roy-
it’s going to be awesome. I’m “You guys leave him alone,” Jk%Cfl`j:Xi[`eXcjYXkk`e^ZfXZ_DXibDZ>n`i\nX`kjkfkXb\k_\Ô\c[n`k_ his third career save throwing als pull away.
sure my stomach is going to be Carroll said. “It’s over. He’s k_\i\jkf]k_\k\Xd]fiXZ\i\dfepY\]fi\k_\:Xi[`eXcjËYXj\YXcc_fd\ fastballs at nearly 100 mph. Luke Hochevar (1-0) won
turning.” apologized, now move on. Forget fg\e\iX^X`ejkk_\?fljkfe8jkifjfeDfe[Xp`eJk%Cfl`j% The Indians have lost four in despite allowing five runs in
McGwire was riding in the about it, he knows hitting and a row. five-plus innings.
back of a dark blue fl at bed truck he’s going to do a good job.” season. He said he was enjoy- I just have to watch my emotions Max Scherzer (0-1) gave up
around the warning track in the McGwire suited up in his old ing coaching, even though the and stay positive with these guys five runs — just two earned —
team’s annual procession. He No. 25 at home for the fi rst time days are much longer. and keep them going and keep
G_`cc`\j.#EXk`feXcj+ in five innings.
showed up on the jumbo score- since retiring after the 2001 “It’s one of those things where pushing them,” McGwire said. PHILADELPHIA — Placido
Polanco hit a go-ahead single,
Chase Utley had a two-run hom-
Kn`ej,#I\[Jfo)

If\k_c`jY\i^\i[f[^\jXjjXlckZ_Xi^\j
er and the Philadelphia Phillies M I N N E A P OL IS — The
overcame an early deficit to beat Minnesota Twins are off to a
the Washington Nationals 7-4 in sunny start at Target Field.
their home opener Monday. After nearly three decades
The two-time defending NL inside the Metrodome, the
K?<8JJF:@8K<;GI<JJ The woman told an officer an could not say if she was raped, Dfi\fec`e\18lk_fi`k`\j champions are off to a 6-1 start, Twins moved outdoors and beat
MILLEDGEVILLE, Ga. — Roethlisberger sexually assault- and while some DNA was found, `e>\fi^`X_Xm\[\Z`[\[ their best since opening the 1993 the Boston Red Sox 5-2 Mon-
Pittsburgh Steelers quarterback ed her early March 5 at the Capi- there was not enough to determine efkkfZ_Xi^\Jk\\c\iËj pennant-winning season 7-1. day behind hometown star Joe
Ben Roethlisberger will not face tal City night club, where he was whom it belonged to. HlXik\iYXZb9\e Cole Hamels (2-0) earned Mauer in the fi rst regular-sea-
charges after a college student drinking with friends. “We are not condoning Mr. If\k_c`jY\i^\in`k_j\olXcXjjXlck% the win despite another so-so son game at their new ballpark.
accused him of sexually assault- Bright said the investigation Roethlisberger’s actions that KfÔe[flkdfi\m`j`k;X`cp@cc`e`%Zfd effort. Jason Kubel hit the fi rst home
ing her at a nightclub last month, showed the woman was heavily night,” Bright said. “But we do He allowed four runs and six run and Carl Pavano earned the
authorities said Monday. intoxicated that night. She and her not prosecute morals. We prose- hits in 5 2-3 innings. fi rst victory.
Ocmulgee Circuit District sorority sisters had met Roethlis- cute crimes.” beyond a reasonable doubt that The lanky left-hander is try- Red-white-and-blue bunting
Attorney Fred Bright said the berger at a different bar earlier in He said local and state inves- Mr. Roethlisberger was guilty of ing to bounce back following an hung from the ledges and com-
20-year-old student’s accusations the night, and he invited them into tigators spent weeks question- rape.” inconsistent year after a domi- missioner Bud Selig was in
could not be proven beyond a rea-
sonable doubt, and her lawyer said
in a letter that she did not want to
and ordered them shots. When the
woman walked down a hallway to
¾ ¾ ¾ ¾ ¾ ¾ ¾ ¾
a VIP area at the Capital City club ing witnesses even though the
woman sent a letter urging pros-
ecutors not to move forward with
One of the 20-year-old woman’s
attorneys, David Walbert, said in a
letter to Bright that his client was
nant postseason in 2008.
Josh Willingham hit a
solo homer and losing pitch-
attendance for the celebration,
as the crowd of 39,715 snapped
cell-phone pictures of the fi rst
press charges. a small bathroom, Roethlisberger charges. not recanting her accusation. But er Jason Marquis had a two- pitch by Pavano.
“Therefore there will be no followed her. “I know when I have a case the letter, released to the media run double for the Nationals. The unpredictable spring
arrests made nor criminal pros- What happened in that bath- and I know when I don’t,” Bright Monday, said she did not want to go Marquis (0-2) allowed seven weather played right along, too,
ecution against Mr. Roethlisberg- room is unclear, Bright said. A said. “And I do not have enough to trial because it would be “a very runs — six earned — and six with a blue, breezy 65-degree
er,” Bright said. doctor who examined the wom- evidence to convince 12 jurors intrusive personal experience.” hits in 4 1-3 innings. afternoon.

!"##$%&!"'($))*+,- &

    


    
     
¾ ¾ ¾ ¾ ¾
  
¾ ¾    
  

 
&&

 

     


 
&
&

‡&$OZD\VREWDLQWKHODQGORUG·VZULWWHQFRQVHQWWRVXEOHW
&&   

‡+DYH\RXUVXEOHDVHFRQWUDFWUHYLHZHGDW7HQDQW8QLRQ
&

‡&&KHFNODQGORUGFRPSODLQWKLVWRULHV²ZKRZDQWVWROLYH  


      
   
ZLWKEURNHQDLUFRQGLWLRQLQJRUDOHDN\URRIDOOVXPPHU"
&

‡&7DNHSKRWRJUDSKVDWWKHEHJLQQLQJDQGHQGRIWKHVXPPHUWR
SURWHFW\RXUGDPDJHGHSRVLW
&   
‡&3D\UHQWDQGGHSRVLWGLUHFWO\WRWKHODQGORUG
&

‡7UDQVIHUXWLOLW\ELOOLQJIURPRULJLQDOWHQDQWVWRVXEWHQDQWV
&&&&&& &
     

 
& &&&&&&&&&&&&& &7HQDQW8QLRQ&.&8QLYHUVLW\RI,OOLQRLVDW8UEDQD&KDPSDLJQ&
&

,OOLQL8QLRQ²ZHHNGD\V
&
3OHDVHWDNHWKHHOHYDWRURQWKH*UHHQ6WUHHWVLGHRIWKHEXLOGLQJWRRXURIILFH

  
&
&&///0)$+1+)"+*2+0*((*+2*30$4"&&&&&&&&&&&&&)$+1+)5*((*+2*30$4"$'3$,'%<625)&
&
&
&
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'(' *9

JF=K98CC 98J<98CC
=IFDG8><(9 =IFDG8><(9
preached the importance of stay- The Illini offense is led by out-
ing present and forgetting about fielders McMurray and Argo.
the past — both the wins and McMurray, a junior, is batting
losses — and this situation is no a team-high .398 with four home
different. runs and 28 RBIs, while Argo, a
“You’re not going to go very far sophomore, is hitting .389 with
in the season if you don’t also deal two homers and 18 RBIs.
with losses,” Sullivan said. “They “We’ve got to concentrate on
have got to just motivate you to these two games,” McMurray
come back with vengeance.” said.
Zymkowitz is taking her coach’s “We’ve got to come out ready
advice and focusing on forgetting and prepared so we can get
her team’s dismal performance things rolling going into a big
Sunday, while keeping her eye on series this weekend (against
what’s in front of her. Michigan).”
“It’s hard, but you just have to The Illini have also gotten
move on,” Zymkowitz said. “In strong hitting from freshman
sports, you’re up and down. You third baseman Brandon Hohl.
just have to try and be consistent. Hohl has batted .337 with two
But after a game like (Ohio State homers and 23 RBIs so far this
on Sunday), you just have to for- season.
get about it right away.” McMurray added the recent
Senior Hope Howell seconded emergence of Shelton has
the notion of having a short mem- further improved the team’s
ory when it comes to wins and hitting.
losses. She said her team needs to “He’s done great,” McMur-
forget and move on, because there ray said.
is a lot riding on this game. “He’s had a few opportunities
“We don’t have a choice,” How- to pinch hit and he’s been hitting
ell said. “Our record, our season balls really hard. They gave him
and our program depend on it. an opportunity to DH last Sun-
We don’t lose two in a row. So, day (against Iowa) and he took
obviously, we have to play for a advantage of it, so hopefully D@:?8<CJK<@EK?<;8@CP@CC@E@
win.” he’ll continue to do that.” @cc`ef`jËN`cc`\8i^f+) jc`[\jjX]\cp`ekf_fd\X^X`ejkD`jjfli`Xk9ljZ_JkX[`ld`eJk%Cfl`jN\[e\j[Xp%K_\@cc`e`gcXp<Xjk\ie@cc`ef`jXk_fd\Kl\j[Xp%

;@CC<I
JXY`efkfÔccjkXik`e^
and the determination he showed agree. These heroes can change
through adversity. Following the lives.
=IFDG8><(9 2006 World Cup, England’s coach Maybe it’s the athletic ability
told Beckham he was no longer that inspires you and makes you
sports, maybe it’s Tony Hawk. It part of his plans. The then-31- want to be a great athlete. May-

c`e\YXZb\iifc\XkFJL
doesn’t matter who; I’m sure any year-old Beckham was seen as be it’s the characteristics they
sports fan has some athlete they too old. show, such as work ethic, com-
see as a hero. Rather than give up, Beck- mitment or dedication. Beck-
For me, there has always been ham went back to his club team ham’s work ethic and determi-
one athlete who has been my motivated. He played some of nation motivated me to turn my
biggest hero: David Beckham. I the best soccer of his career, academics around. In “Looking
own eight jerseys with the name forcing the coach to recall him for Eric,” the main character
Beckham on the back. I’ve read to the national team. I was in the was saved from himself by his
his autobiography. He’s the only
player to leave Manchester Unit-
ed that I’ve continued to follow
stands as Beckham took the field
against Brazil in London, nine
months after he had been told his
hero Eric Cantona.
In the book “The Bro Code,”
Article 41 states that a bro
Buckeyes field. He waited patiently as a Sabino, a backup who saw action
backup for three years behind in every game last season.
All-American James Laurinaitis Fickell has raved about Sabi-
after his departure.
I can safely say that, while
not as extreme of an example as
international career was over.
I used that as inspiration and
I turned it around. In fact, last
should never cry. It then lists
three exceptions, one of which is
if a sports legend retires.
turn to Rolle before finally become a start- no’s work ethic and speed.
er last season. Then, when his “He’s the guy. He’s such a
moment had finally arrived, he young kid. I know he’s going to
in the movie, Beckham has had
some influence on my life. My
first semester at college, I really
semester I even made Dean’s
List. I can honestly attribute that
to the inspiration I found from
Thirteen years after his
retirement, I can still hear the
fans sing Cantona’s name when
for leadership was bumped to the strongside be a junior but he’s still only 19
linebacker job from inside. years old,” he said. “You’d like
Still, he made the move and to have some more time with
struggled to adapt. I never had my hero. I watch Manchester United 9PILJKPD@CC<I never complained. him, but he’s coming along and
to study in high school; I thought Some athletes change and games. How many people can JK8==NI@K<I “(It’s important) when guys I think this has been his best
I could do the same at college. define their respective sports. truly make such an impact in COLUMBUS, Ohio — When it buy into what you’re doing, spring so far.”
It’s safe to say my first semester They do what most cannot, and people’s lives? comes to its linebacking corps, when guys buy into their role,” The coaches felt Sabino was
ended horribly. I thought maybe in doing so, they become heroes. Ohio State is hitting .667 in linebackers coach Luke Fickell too mechanical his first two
I wasn’t cut out for college. For those who think sports are Bpc\;`cc\i`jXale`fi`eD\[`X%?\ZXe spring ball. said. “A great years. He knew
Then I remembered my hero just a game, I respectfully dis- Y\i\XZ_\[Xkb[`cc\i)7`cc`e`d\[`X%Zfd% With two of the three start-
ers returning, it isn’t nearly as
ex a mple
Austin Spitler.
is ÈPflËm\^fkk_\knf the plays, made
his read and went
important for the Buckeyes to
find a replacement for the gradu-
It wasn’t exact-
ly the role he
eXkliXcj#pflËm\^fk to where he was
supposed to be.
ated Austin Spitler as it is to find
the right fit.
thought. But
he bought into Ifjj?fdXeXe[ But at times, he
didn’t rely on his
“Really, there’s going to be
pretty good competition at the
his role. I think
in the long run 9i`XeIfcc\#k_fj\Xi\ instincts.
“Coach Fick-
linebacker group,” defensive
coordinator Jim Heacock said
it’s going to pay
off because he’s pfliknfc`e\YXZb\ij% ell always tells
us, ‘Don’t be a
at the start of spring workouts. going to have a robot,’” Rolle
“You’ve got the two naturals, lot of opportu- Efnn_fËjk_\ said. “If (Sabi-
you’ve got Ross Homan and Bri- nities (in the no) sees some-
an Rolle, those are your two line- NFL) because k_`i[$Y\jkfe\6É thing, he’s going
backers. Now who’s the third- of what he to get it. And
best one?” did.” A@D?<8:F:B# that’s something
The answer to that question so Homan and [\]\ej`m\Zffi[`eXkfi that takes a very
far is junior Etienne Sabino. Rolle are solid special player
Senior starters Rolle and at the other two spots. In their on this defense to do, to play
Homan are back in the fold from first season as starters, they had instinctive and go after things
last year’s team that captured a big years. when you see it.”
fifth straight Big Ten title and The steady, hard-hitting While Sabino takes Spitler’s
went on to win the Rose Bowl. Homan led the team with 108 spot on the field, Rolle has natu-
But the absence of Spitler leaves tackles, including two sacks and rally taken over some of Spitler’s
a leadership vacuum plus what five for minus yardage. He also leadership responsibilities.
he offered in experienced play. shared the team lead with five “I’m majoring in sociology to
“Obviously, Austin Spitler interceptions and recovered two be a teacher, so I like to help
must have meant a lot to our fumbles. people,” Rolle said. “So now
guys for them to vote him cap- Rolle, an upbeat, happy-go- that the coaches are giving me
tain without ever having started lucky and talkative sort, was a role to kind of help guys more,
a game,” head coach Jim Tres- almost as good. He was second being that I’m an older guy, I
sel said. “So his leadership will on the team with 95 tackles, with take it to heart. The coaches feel
certainly be missed.” seven coming behind the line of like I can lead this team, and
Spitler was a popular and scrimmage. He also intercepted I’m doing a great job of letting
respected elder statesman on the a pass and fell on a fumble. the guys know what they can
team, a practical joker, a selfless The front-runner to be the do to get better. And also bet-
team player and a coach on the third amigo at linebacker is ter myself.”

:L9J the team and rooting for the


team,” Piniella said. “And being
“If we get a quality start here
today, we’ve got a chance of win-
=IFDG8><(9 supportive like they are. It’s good ning that game,” Macha said.
:?8IC@<I@<;<CK?<8JJF:@8K<;GI<JJ to see.” “Doug’s just been off his game
G_`cD`Zb\cjfe#i`^_k#_l^j_`jZX[[`\A`dDXZbXpX]k\in`ee`e^k_\DXjk\ij^fc]kflieXd\ek]fik_\k_`i[k`d\`e_`j “We’ve been to a handful of Nady hit a three-run homer in his first two starts. He has in
ZXi\\iXk8l^ljkX#>X%feJle[Xp% pretty cold opening days, but the third after singles by Marlon the past given us quality starts.

D`Zb\cjfeËjn`e^ff[]fi^fc]
this opening Byrd and Der- That’s why we got him.”
day is going to
be the one I’ll
È@[feËkk_`ebk_\p^fk rek Lee. Alfon-
so Soriano then
Ramirez hit a two-run shot off
Claudio Vargas in the fourth, giv-
remember for-
ever,” Ricketts XepYXj\_`kj#Ylk`kËj singled and
Baker cleared
ing Ryan Dempster (1-0) a big
cushion.

Emotions high as incredible wife, an incredible “I was just really glad she
said.
How much e`Z\Xe[gfj`k`m\kf the left-field
bleachers for a
Dempster allowed seven hits
and five runs in 6 1-3 innings and

Lefty embraces
mother. She’s been an inspira-
tion for me this past year, seeing
was there,” Mickelson said. “I
wasn’t sure if she was going to
effect did the
Ricketts and all j\\fne\ij_`g_\i\ 5-0 lead against
Doug Davis (0-
ran his career record against the
Brewers to 12-3.
what she’s been through.” be there today. I knew she would the renovations 1), who had his Ryan Braun hit a three-run
jlggfik`e^k_\k\Xd
wife after victory It couldn’t have been more
sincere. It could hardly have
been more appropriate.
be watching. I didn’t know if she
would be behind 18. To walk off
the green and share that with
they’ve made
— like a new
weight room, Xe[iffk`e^]fik_\
second straight
shaky start.
“I just gave
homer and an RBI single for the
Brewers.
With Milwaukee trailing 5-0,
K?<8JJF:@8K<;GI<JJ All week long the talk at the her is very emotional for us.” kitchen and in a couple Corey Hart hit an RBI single in
AUGUSTA, Ga. — Phil Mickel-
son was doing his best not to cry
Masters was of another golfer
and other women. The circus
If it was emotional for Mick-
elson, it was also therapeutic to
players lounge
— have?
k\Xd%%%8e[Y\`e^ times when the
timing wasn’t
the fourth. A potential rally fiz-
zled when Gregg Zaun, now 0 for
again as he slipped on another
green jacket and tried to put into
that surrounded Tiger Woods
blew into town on Monday, and
golf. The throngs who crowd-
ed every hole as the leaders
“Obviously
what they’ve
jlggfik`m\c`b\k_\p right. I didn’t
make the pitch-
18 this season, bounced into a
double play.
words things that he couldn’t
possibly put into words.
the tent was still up as the lead-
ers teed off on a Sunday after-
made their way around Augus-
ta National may not have been
already done
for us with
Xi\%@kËj^ff[kfj\\%É es when I had
to,” Davis said.
Lee hit an RBI single with two
outs and Ramirez followed with
He had already shed a tear noon brimming with drama. quite sure how much emotion the amenities CFLG@E@<CC8# “The three- his second homer of the year.
on the 18th green, though he Mickelson hadn’t been they were going to invest with inside the club- :lYjZfXZ_ run home run Braun’s two-out homer in the
wasn’t alone. Anyone who knew ignored, but he had certain- Woods, but with Lefty there was house — wheth- and not keep- fifth got the Brewers within 8-4.
the story had to shed a few, too, ly been overlooked. He wasn’t no doubt. er it’s the kitchen or the weight ing your team in the game, Byrd had an RBI double in the
as Mickelson latched onto the alone, because the drama sur- They cheered him on every room or the lounge — is very gen- that’s the most frustrating part. bottom half, set up by shortstop
tiny blonde woman who had been rounding the comeback of Woods shot, pulled for him at every erous. It obviously makes you Two pitches cost me five runs. I Alcides Escobar’s error.
through so much and shared an overshadowed the entire week at turn. And when he hit the shot very comfortable as a player,” thought I was doing well up to Byrd, also making his first
embrace that neither seemed Augusta National. on No. 13 no one will ever forget, Nady said. that point. Two pitches weren’t appearance with the Cubs at
willing to end. Until early Sunday evening, they roared with delight. Manager Lou Piniella appreci- catchable.” Wrigley, had three hits.
He had struggled on the golf that is. That’s when the week The swashbuckler danced ated the changes, as well. Milwaukee manager Ken “Opening Day nervousness,
course all year, but that meant that golf feared suddenly with danger and pulled it off. “I don’t think they got any base Macha said it’s time for Davis to I hadn’t had it in about three
nothing. Nothing compared to became the week golf fans will Mickelson couldn’t help him- hits, but it’s nice and positive to pitch the way he’s capable, even years. It’s different being here
the struggles Amy Mickelson always remember. self because, while the risk see ownership here supporting if it is early. at Wrigley,” he said.
went through while battling It started with a shot a Vegas was great, the reward was even
breast cancer. high-roller would have never greater.
There would be plenty of time
later to talk about the shot that
dreamed of betting on. It end-
ed with a scene so touching
He’s taken that approach his
whole career, and he’s lost some :8I;@E8CJ day added one high off the bat-
ter’s eye in center for the clos-
after yielding seven all last sea-
son. Carpenter left his third
will live in Masters lore, plenty it washed away any lingering big tournaments because of it. er’s second blown save in two pitch up in the zone for Weeks,
=IFDG8><(9
of time to reflect on what a third memories of the stain Woods had Mickelson was red-eyed, seem- appearances. who hit a line-drive homer into
title means to his career. put on this Masters. ingly shell-shocked, the goofy Friday night. Hoffman’s last four blown the Brewers’ bullpen as Milwau-
As the fading sun added some The man who stands for every- grin that so often adorns his face This time, the 42-year-old saves have all come against the kee scored first for the first time
drama to the victory ceremony thing Woods doesn’t stood wear- gone for the moment. right-hander allowed a one-out Cardinals. this season.
on the practice putting green, ing the green jacket Woods so Amy, though, was all smiles. double to Felipe Lopez and got Rickie Weeks, Corey Hart and Hart homered in the second,
though, Mickelson wanted to desperately coveted. Even bet- “Good to see you guys,” she told Stavinoha to pop up as a pinch Braun homered for the Brewers, Milwaukee scored two runs on
talk about something closer to ter, when he looked up on the them. hitter for the second out. who finally figured out Carpen- two errors by Cardinals third
his heart — his wife. 18th green, his wife — who had Surely it was. But not nearly But Pujols hit a homer to left ter only to watch a five-run lead baseman David Freese, and
“We’ve been through a lot this been bed-ridden most of the as good as it was for golf to see a field that Ryan Braun could evaporate. Braun hit a two-run homer in
year; it means a lot to share some week — and his children were champion and his wife, together only watch for his first career Carpenter has allowed five the fifth to give the Brewers a
joy together,” he said. “She’s an there to share it all with him. once again. hit against Hoffman. Holli- homers in two starts this year 7-2 lead.
+9 Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd

FOR RENT

Employment Services Merchandise Pets 250 Transportation Rentals Houses (For Rent 510 Real Estate Things To Do Announcements
Help Wanted Business Services 110 Antiques/Collectibles 210 Sporting Goods 255 Automobiles 310 Apartments Condos/Duplexes 520 Commercial Property 610 Campus Events/Meetings 710 Lost & Found 810
Full Time 010 Child Care 120 Appliances 210 Stereo/TV/Video 260 Trucks 315 Furnished/Unfurnished 410 Rooms 530 Condos/Duplexes 620 Community Events/Meetings 720 Volunteer Opportunities 820
Part Time 020 Cleaning 130 Books 220 Gifts 265 Bicycles 320 Furnished 420 Room & Board 540 Houses (For Sale) 630 Vacation/Travel 730 Miscellaneous 830

DAILY Full/Part Time


Seasonal Jobs
030
035
Mind, Body & Spirit
Tutoring
140
150
Cameras
Clothing
225
230
Tickets
Jewelry
270
275
Motorcycles/Scooters
Boat & Recreational
330
335
Unfurnished
Sublets
430 Roommate Wanted
Office Space
550
560
Mobile Homes (For Sale)640
Residential Property 650
Entertainment
Classes
740
750
Adoption/Egg Donation 850
Shout Outs
ILLINI
CLASSIFIEDS
Job Wanted 040
Business Oppurtunities 050
Financial
Home & Lawn Care
160
170
Computers
Furniture
235
240
Garage Sales
For Sale
280
285
Going My Way
(Riders/Riders wanted)
340 Sublets
Summer Only
440
450
Parking/Storage
For Rent
570
580
Open Houses 660 Fitness 760
Shout Outs
Greek Shout Outs
900
901
Work From Home 060 Repair 180 Musical Instruments 245 Wanted To Buy 290 Auto/Truck Repair 345 Off-Campus 460 Wanted To Rent 590
Other For Rent 500

Rates Billed: 43¢/Word Minimum $2.00 Paid-In-Advance: 37¢/Word


Place your ad by phone! Call 217.337.8337 Monday - Friday, 9am - 5:30pm Deadline 2pm on the day before publication.
Online Ads Classifieds automatically appear online at dailyillini.com
Important Information About Your Ad
Report errors immediately by calling 337-8337.We cannot be responsible for more than one day’s incorrect insertion if you do not notify us of the error by 2 pm on the day of the first insertion. All advertising is subject to the approval of the publisher.The Daily Illini shall have the right to revise, reject or cancel, in whole or in part, any
advertisement at any time. The Daily Illini shall not be liable for failure to print, publish or circulate all or any part of any issue in which an advertisement accepted by the publisher is contained. The Daily Illini extends credit to classified advertisers as a courtesy.We reserve the right to set credit limits, to require cash in advance, and/or to
require a completed credit application. The Daily Illini screens classified advertising to avoid misleading or false messages. Please be cautious in answering ads, especially when you are asked to send money. If you have a question or concern about any advertisement which has appeared in our paper, we will be happy to discuss it
with you. Please call 337-8337. All real estate advertising in this newspaper is subject to the Federal Fair Housing Act of 1968, and similar state and local laws which make it illegal for any person to cause to be published any advertisement relating to the transfer, sale, rental, or lease of any housing which expresses limitation,
specifications or discrimination as to race, color, creed, class, national origin, religion, sex, age, marital status, physical or mental handicap, personal appearance, sexual orientation, family responsibilities, political affiliation, prior arrest or conviction record, source of income, or the fact that such person is a student.
Specification in employment classifications are made only where such factors are bonafide occupational qualifications necessary for employment.

APARTMENTS 410 APARTMENTS 420 APARTMENTS 420 APARTMENTS 420 APARTMENTS 420 APARTMENTS 420 APARTMENTS 420
employment Furnished/Unfurnished Furnished Furnished Furnished Furnished Furnished Furnished
205 EAST Available Fall 2010
209/211 E. Clark, St., C. 1107 S. 509 E. White, C. JOHN & 604 E. White, C. 5th &
HELP WANTED 010 HEALEY, C. 2 bed/1 bath
EUCLID, C
August 2010. Large Studio and 1
bedrooms. Security entry, balconies,
LOCUST, C
Security Entrance
Fall 2010, Large studio, 1, 2 HEALEY, C.
Full time August 2010. Huge 1 bdrm apts.
$625-$650/mo
pets allowed Aug 2010. 1 bdrms near Armory &
patios, furnished. Laundry, off-street
parking, value pricing. "2! at 309 Aug 2010. Huge one bdrms, Win-
bedroom, Loft Apartment. Furnished,
balconies, patios, laundry, off-street
August 2010. The BEST LOCATED
Window A/C, Parking $40/mo. To ARC. Window A/C, laundry, rents dow A/C. Rents from $380/mo to EFFICIENCIES & 1 BEDROOMS on
www.greenstrealty.com S. First, C. +,&%)#0'/!+,%%)#"2!. 
$1000-3200/month to drive new cars furnish $50/mo additional. Rents from $395/mo to $420/mo. Parking $405/mo. Parking $20/mo. Call for campus - period. Here's the best
THE UNIVERSITY GROUP S. First, C. part: (8%+'/%+'3 $400/mo to $425/
with ads. www.YouDriveAds.com from $425/mo to $495/mo. Call for $35/mo. Call for showing times. showing times.
showing times. universitygroupapartments.com THE UNIVERSITY GROUP mo & 1 bedrooms $550/mo. Parking
211 E. Clark St., C. BARR REAL ESTATE, INC BARR REAL ESTATE, INC.
BARR REAL ESTATE, INC. 352-3182 universitygroupapartments.com available at $50/mo. Call for show-
4 bed/1 bath 356-1873 356-1873
Resident Manager Needed  
 ing times.
356-1873 www.barr-re.com www.barr-re.com
Aug. '10 - May '11! If you are in- $995/mo BARR REAL ESTATE, INC.
www.barr-re.com
terested, email imanor@illinimanor. pets allowed 356-1873
com for more information and an ap- www.greenstrealty.com 705 W. Stoughton, U John Street Balcony in the Trees www.barr-re.com
plication.
808 S. 311 E. WHITE, Fall 2010
3 bedroom apartment. Spacious liv-
Apartments
58 E. John, C. August 2010. Studio,
2 BR and study; 3 BR
August, Elm on campus

PAINTERS LINCOLN, U 103 E. DANIEL, C.


Avail Aug 2010.  0#'/ %(* +(
CHAMPAIGN ing area. Communal balcony, great
backyard. Plus a bar area in kitchen,
two, three bedrooms, fully furnished.
Dishwasher, center courtyard, on-
217-840-5134
www.robsapartments.com Reduced: 502 W.
Aug 2010. Classic Building- across Avail Aug 2010. Large !1$ ($ ,
Students needed to paint campus from Jimmy John's on Lincoln Ave.
Frat Park. '+  &( Call () &), -)  %'(  (- +. +)'
dishwasher, washer/dryer in each
unit, value pricing.
site laundry, central air, parking. Green, Urbana
apts. from mid-May to mid-August.
Previous experience a plus.
Hardwood Floors, Laundry, Call for
showing times.
*"(.#'!+#&*
A

') +%$(" 
') $()0
+* -&&!)+,#)0$("-$' ,
THE UNIVERSITY GROUP
Starting at $298/person.
THE UNIVERSITY GROUP 508, 510, & Fully furnished 4 bedroom, 2 bath
with ,$# -&%$! tv, full-size
$9.50/hr. Stop by Roland Realty,
313 E. Green (corner of 4th and
'7$*&.$*&1 



356-1873
...)))(&
BARR REAL ESTATE, INC.
356-1873
universitygroupapartments.com
352-3182
universitygroupapartments.com
352-3182 512 E. washer/dryer. Walking %&! to
 #'%  ""!
$!%"!+""$
"0+*.(
-/
BARR REAL ESTATE, INC
000+++ )'
1006 S. 3rd, C.
STOUGHTON,  

"!"%&$" %&!&

JOBS IN PUBLISHING
  105 E. Green, 506 E. Stoughton, C.
For August 2010. Extra large !1-
Fall 2010 1 bedroom.
Location, location. Covered parking,
C.
www.barr-re.com
Full-time openings for CHAMPAIGN KARMA ciency apartments. Security building
entry, complete furniture, laundry,
laundry, furnished, patios. Value
*+$$("!1 - $+,- 
August 2010. Huge 1 bdrm plus den.
Close to Engineering & C/S. A/C,
906-908
general and technical copy Aug 2010. Studio apts at First & One Bedroom Residences Laundry, Parking $55/mo. Rent from
editors and project managers. 34 MAIN, C. Green. Wall A/C units, laundry. From
$315/mo to $325/mo. Parking $35/
Downtown Champaign.
off-street parking, value pricing. Of-
1 , #*+, 
   GROUP $620/mo to $655/mo. Call for show-
ing times.
S. Locust, C.
Go to www.pubserv.com Available August 2010. Amazing 2 August 2010. A Complete regenera- universitygroupapartments.com Locust III now offering #" and
mo. Call for showing times. 
for details. bedroom units in the heart of tion of living space in DT Cham-  
 BARR REAL ESTATE, INC. 1 bedroom apartments for 2010.
Not for summer only. downtown Champaign. Units fea- BARR REAL ESTATE, INC. paign. These artistically inspired res- universitygroupapartments.com 356-1873 Some pet " units. Schedule an
Graduates encouraged to apply. ture hardwood 4++-. designer kitch- 356-1873 idences are fully furnished and fea-  
 www.barr-re.com "
ens with granite +0*/"-/+,. central
 !&.%2.%"-.  20' ceilings
www.barr-re.com ture IKEA furniture and cabinetry,
"*/((1((*+.#(+-*#,0, off
706 S. FIRST, 367-2009
www "
with 10' windows and much more! street parking and laundry on site. Old Town CHAMPAIGN 1005 S. Second, C.
HELP WANTED 020
Rents from $1300/mo to $1500/mo.
Call for showing times. 1107 S. KARMA is designed to be a fusion of
art and living in a contemporary Champaign Aug 2010. 1/2 blk south of Green. 1
bdrm $430/mo. 2 bdrms from $475/
Fall 2010 studio and 4 bedroom
penthouse. Secured building. Pri-

Part time
BARR REAL ESTA
356-1873 EUCLID, C urban environment.
BARR REAL ESTATE, INC.
510 S. Elm, C. Available Now & Fall
2010. 2 BR close to campus,
mo. Window A/C. Parking $40/mo.
Call for showing times.
vate parking, laundry on-site. Value
*+$$("!1 - $+,- 
1007 S. FIRST
Aug 2010. 1 bdrms near Armory & hardwood 9//12 laundry, W/D, cen- Aug 2010. Near First & Gregory. 2
www.barr-re.com 356-1873 BARR REAL ESTATE, INC. THE UNIVERSITY GROUP
ARC. Window A/C, laundry, rents tral air/heat, off-street parking, 24 hr. bdrm apts from $595/mo. Window A/
Big Bucks! Suburban Express is www.barr-re.com 356-1873 universitygroupapartments.com C, Carpet, Laundry. Parking includ-
from $395/mo to $420/mo. Parking maintenance. Value pricing. '8$& at
now hiring. $10 - $11/hr plus re-
sponsibility and valuable experience.
Free rides after one semester. Pl-
510 S. $35/mo. Call for showing times.
BARR REAL ESTATE, INC
309 S. First, C.
THE UNIVERSITY GROUP
www.barr-re.com 
  ed. Call for showing times.
BARR REAL ESTATE, INC.
ease visit www.suburbanexpress. MATTIS, C. 356-1873
509 W. MAIN, universitygroupapartments.com
706 S.
356-1873
com/jobs for application times. Aug 2010. Beautiful luxury 1230 sq. www.barr-re.com 352-3182 LARGE 3 www.barr-re.com
ft. 2 bedrooms & 3 bedrooms town-
homes in great location with 2.5
URBANA LOCUST, C. BEDROOMS
Great Summer Job
Top Pay
baths, washer/dryers, ceramic tile,
ceiling fans, garages. 3 Bdrm now
2 BEDROOMS Aug 2010. 1 bdrm apts. From
$415/mo to $445/mo. Laundry, Win- John/Healey
Aug 2010. Window A/C, covered
parking $45/mo, laundry. 1 bdrm Near Engineering Campus 105 E. John, C.
Near Engineering Campus dow A/C, Parking, $45/mo. Call for $400/mo, 2 bdrms $550/mo. Call for Covered Parking, Cable TV. Fall 2010. Large 1, 2 bedroom fur-
Lifeguards $650/mo. and Aug 2010 $825/mo. 2 Furnished 1 & 2 bedroom near John
bedrooms Aug 2010 $800/mo. Covered Parking, Cable TV. $750 showing times. & Second $495/mo., Healey & Third showing times. $900-$1000 nished, great location. 352-3182.
All Chicago Suburbs Shlens Apartments BARR REAL ESTATE, INC. BARR REAL ESTATE, INC. Shlens Apartments !0 , $*+, 
Call for showing times. $395/mo., Studios on Healey and
No experience/will train and certify 217-344-2901 356-1873 356-1873 217-344-2901    GROUP
BARR REAL ESTATE First $345/mo. Available Now. Call
Look for an application on our web- cshlens@aol.com www.barr-re.com 356-1407 www.barr-re.com cshlens@aol.com universitygroupapartments.com
site 356-1873
www.barr-re.com
www.poolguards.com Lincoln
630-692-1500 x 103
'+!,)+)!#-.0*#+0/
Place Apartments

Email: work@spmspools.com 609 W. MAIN, U.


August 2010. 2bdrm Townhouses-
Furnished $620/mo, Unfurnished
'+!,)+. +
+%'+##.'+%*-1/
!"#$%&'()*+(,#--(./0/1
NCAA powerhouse Illini Men's $600/mo. 2 bdrm apts- Furnished  #".,,*/1.+'/&#" .(S"7+**2$ E367%* 0(S"7+**2
Place Apartments

Tennis is taking applications for $545/mo. Parking optional, Central On engineering & #01.#/ #+0.)'.#0
manager positions for the 2010-2011
academic year. High school varsity
A/C, Carpet, Laundry, Call for show-
ing times. computer science +0#.+#0.,2'"#" '/&3/&#.'!.,32# 0//0(H;(G-#+I4(J 0/D(E;(,*6+3F4(G 0/D(E;(,*6+3F4(G
experience preferred. Please send BARR REAL ESTATE, INC campus 
.('+%-!#-0 .,/0.###$.'%#.0,.
@/@(E;(H+%'F34(G @/>(T;(X+2*+P4(G A/>(T;(G-#+I4(G
resume and references to Janice (Urbana Side) 1+".4!')'0'#/  #/(/&'./
G-#+I(E3;(E367%*$4(G A0.(T;(G-#+I4(G
356-1873
Revell at jrevell@illinois.edu.
Deadline for application is April 14. www.barr-re.com Union 3 1/2 Blocks  )#,,(1- +/'0#+%#*#+0 K0@(H;(L#%&4(J
Grainger 2 Blocks .-#0#" 3+#.+%#"
>/>(E;(E%M3F4(G UF"(V%--#'"4(G
COUNTRY FAIR APARTMENTS Lincoln  
 NO":-P(+"&*5#3"7(!#&7*(Q-#="R
K(S"7+**2$ S6$"P(G*6+34(J
WORK ON CAMPUS 1 & 2 bedroom, furnished or unfur-
nished, FREE gas heat, water, trash
1 Bedroom C/0(H;(Y+""&4(J ./@(T;(E3*6'F3*&4(G
The Daily Illini and Buzz "") 901 W. Springfield, U UF"(ZEL(V;\;Q;(Q+*'+#2(
Advertising Department is seeking
removal, basic satellite TV & FREE NO":-P(+"&*5#3"7R C/0(W(C/@(T;(G-#+I4(G
enthusiastic representatives. Appli-
cants should be organized, depend-
parking! Pool, tennis court, inside
laundry. On 4 MTD bus routes.
Small pet O.K. Ask about our stu-
$ 540-595
911 W. Springfield, U Now Leasing for Fall 2010! '%5"$(*6+(+"$%7"&3$
"M=-6$%5"(7%$=*6&3$(#3(
@/0(E;(H#3"+4(G
NS"#63%)6-(!*)3$R
A/A(T;(G-#+I4(G
able, motivated and possess strong $ 570-610 -*=#-([6$%&"$$"$1 NJ8'+#7"7($367%*R
written and verbal communication
dent leases. M-F 9-5:30, Sat. 9-12.
Call 359-3713 or just stop by our of- 1004 W. Springfield, U 1, 2, 3, and 4 Bedroom Properties !**I()*+(ZEL(*&( >/>(E;(E%M3F4(G
skills. Email resume, spring and $ 495
summer availability to Tim Aden at
6!# in the red barn, at 2106 W.
White, C.
Apartments and Houses ,#="[**I1
NO":-P(+"&*5#3"7(!#&7*(Q-#="R
taden@illinimedia.com or come to
512 E. Green Street, 2nd *! for an www.myapartmenthome.com On or Off Campus
2 Bedroom
application.
901 W. Springfield, U Furnished or Unfurnished ,*+(-"#$%&'(%&)*+2#3%*&4(5%+36#-(3*6+$4(#&7(2*+"(8-"#$"(5%$%39
BEST OFFER :::;<$2#83$;=*2
Pia's Sports Bar and Grill CAMPUS
1 BR Loft
$ 695
111 S. Lincoln, U Green Street Realty !"#$%&'(%) .0>?@AB?C0/D A/A(E;(,%)3F(E3;4(GF#28#%'&
Summer bartending and wait staff
needed. Perfect job for students! No 2 BR $ 795-895 www.greenstrealty.com
experience necessary. Apply within 3 BR
at 1609 W %
 4 BR For Info: (217) 344-3008
24 East Green St., Champaign, IL 61820 Nogle & Black Apartments
Campus. 367-6626
Available August 2010
911 W. Springfield, Urbana 217-356-8750
www.BaileyApartments.com

HELP WANTED 030 For more information, or to schedule YOUR personal tour,
+ +
HUGE!
2 Bedroom Units
Full/Part time Various locations: Colony West, + please call 337-7990
1316 Alms, 1600-1700 W. Union St.,
Champaign and 701 W. Indiana, + + Tours: Monday - Friday
Urbana. Rents range from $700 to
$1000 per month depending on 309 N. Busey – August 2010 10:00 a.m. to 4:00 p.m.
location and amenities. 2 BR Fully furnished, W/D, ethernet
Call 384-0333 or 840-6860. & parking. Close to Beckman.
$625/mo. Call Chris anytime.

203 S. Wright + 841-1996 or 352-3182 +


     1 and 2 BR, Best Rates on Campus.
www.baraka-apts.com
Off-campus
 
 
Deluxe
The Champaign Country Club is
now accepting applications for: (FT/
PT) WAIT STAFF, POOL SIDE 1405-1407 W. KIRBY, 3 BR 702 W. Washington, Champaign
SNACK BAR & SUMMER LINE
COOK. Provide top notch service to
C.
Attractive Colonial building, on bus-
Townhouses One bedroom ~ $526 per month
our members. Experience is preferr-
ed, but we will train the right per-
line. Available Now and April 1st 2
BRs from $460 to $525/mo. Also
206 E. Green, C.
son(s). Apply in person 9am-5pm:
1211 South Prospect Avenue,
available, apartments for August 1 Free Parking Space
2010. 1 bedroom from $415/mo.
Champaign, IL Large 2 bdrm corner apts approx New Energy Efficient 4 Near Downtown Champaign
739 sq. ft. $460/mo, Remodeled
A/C and Heat 4 On Bus Route
$480/mo. Interior 2 bdrm apts. from
$440/mo, Remodeled $460/mo.
Ethernet Access 4 Fully Furnished Apartments
BUSINESS OPPS 050 $50/mo to furnish. Central A/C, car-
4 Large Bedrooms with Huge Closets
pet, laundry, parking avail. Call for
showing times.
$420/person/month
Paid Market Research 4 Central Vacuum
Market research company is looking BARR REAL ESTATE, INC. Call 621-3430
for students for paid research 356-1873 4 On-site Laundry and Storage
www.barr-re.com
studies. Apply at 4 FREE Off Street Parking
http://www.surveymonkey.com/s/dlyil
4 Heat, Water, Sanitary & Trash Removal Included!
BRAND NEW APARTMENTS AND HOUSES!
$IFGT,JUDIFOTt4UBJOMFTT4UFFM"QQMJBODFTt$FSBNJD5JMF
Locations Still Available: %FTJHOFS#BUITt+BDV[[J4QB5VCTt)BSEXPPE'MPPST
merchandise URBANA
-BSHF#FESPPNTt6OJRVF#VJMEJOHTt(SFBU-PDBUJPOT
501 W. California (1 bdrm)
707 W. California (1 bdrm) imanor@IlliniManor.com http://www.IlliniManor.com
507 W. Green (4 bdrm)

CAMERAS 225 CHAMPAIGN


54 E. John (CAMPUS) (3 bdrm)

Smith Apartments
312 S. State (studio & 1 bdrm)
Nikon D300 body, charger, battery. 503 N. State (studio & 1 bdrm) Choice of 1, 2 & 3
Excellent condition. $900. 217.649. 306 W. Washington (1 bdrms)
!"#$%&%'(&)(%*(+,-(%./-"'%01222 Bedrooms for Fall
2626, mrby@volo.net
SAVE $100! Now Renting for August 2010 Great • Laundry Facilities, many

BMI
BMI
management
www.BMIcity.com 217-384-1925 Campus
Locations!
with washer/dryer in unit
• Dishwasher/Microwave
217-390-9900 ext.1
NOW
• Intercom Entries
• 24 Hour Emergency
FOR RENT
rentals Efficiency Maintenance
LEASING • High-Speed Internet
201 E. Armory, C................................... $395 Access/Ethernet
• Balconies
APARTMENTS 410 • Parking
Furnished/Unfurnished 1 Bedroom Take a virtual tour at www.bankierapts.com
Fall 2010 Apartments 610 W. Stoughton, U ........................... $480
For showings call 217.328.3770 to set up an appointment

ENORMOUS
Monday - Saturday 217.328.3770

Efficiencies 2 Bedrooms 1 Bedrooms 1004 S. Locust, C .................... $530, $640


ONE BEDROOM · AUG 2010
104 E. John 104 E. John 508 S. First
305/307/311 W Birch, C.
On-site laundry, 1 parking spot 1103 S. Euclid 208/210 E.White 108 W. Charles
incl., No Pets from $485 312 E. White 104 E. John 2 Bedrooms
WWW.PPMRENT.COM · 351-1800 1103 S. Euclid 103 E. Healey
4 Bedrooms 105 S. Fourth
58 E. Armory, C ..................................... $835
Apartments, studios, 807 S. Locust 310 E. Clark 604 W. Stoughton, U ....................... $1,000
houses, co-ops, a 208/210 E. White 3 Bedrooms 507 S. Elm, C.
sublets, rommates n 1103 S. Euclid 1004 S. Locust, C .................. $730 - $770
needed, parking sp 807 S. Locust House 1009 W. Clark, U ................................... $720
spaces, lost and found, 208/210 E. White 108 E. Daniel
shout-outs, part-time 3 312 E.White 511 W. Church, C .................................. $660
meIllini
Daily jobs,Classifieds
full-time jobs,
tutoring,
(217) 337-8337 appilances, Call for an appointment 3 Bedroom House (near DT Champaign)
cameras, computers,
furniture, musical 351-1767 508 W. Park, C ....................................... $850
instruments, pets, TV, www.johnsonrentals.com
DVD, Xbox360, rentals@ johnsonrentals.com Parking available, laundry available
Playstation3, HD-DVD www.smithapartments-cu.com
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'(' ,9

APARTMENTS 420 APARTMENTS 420 APARTMENTS 420 APARTMENTS 420 APARTMENTS 430 APARTMENTS 430 HOUSES FOR RENT 510 HOUSES FOR RENT 510
Furnished Furnished Furnished Furnished Unfurnished Unfurnished
1 Sweet Deal 1007 S. Prairie

      
Pretty Good HEALEY COURT 101 N. BUSEY A 
115 W. 605 S. BRAND NEW August 1. Super 2 bedroom home
with basement, garage, laundry, ap-
 
  APARTMENTS At 401 E. Chalmers! Rent includes: WASHINGTON, U HOUSE pliances. $825/mo. 217-369-5759
August, Clark on campus 307-309 Healey Court, C. & 102 N. ALL utilities and 70 channels of
cable tv. You pay only: phone and in-
August 2010. 1 bdrms. Window A/C,
Laundry. From $360/mo to $495/mo.
RACE, U. 809 W. Main, U
217-840-5134 Fall 2010. Behind FU Bar. 2 Avail Aug 2010. Upstairs 1 bedroom
www.robsapartments.com bedrooms. Parking, laundry. Starting
0
-#./,+$4!#0

LINCOLN, U. ternet. http://www.illinimanor.com or
call 217-337-7990.
Call for showing times.
BARR REAL ESTATE, INC
in converted house. Hardwood 1))+,
and free parking. $425/mo. Call for
New 4 bedroom, 4 1/2 bath, 4 car
garage with electric openers. 2,000
704 W. Illinois St., U
10% discount before May 1!
Aug 2010. Near Green & Lincoln. 2 plus sq. ft., Kitchen, dining room,
First, C. bdrm apts from $540/mo. Window 356-1873 showing times. 4 BR, 2 Bath on campus.
209/211 E. Clark, C. "$"%!(!
THE UNIVERSITY GROUP A/C, Laundry. Parking $45/mo. Call www.barr-re.com BARR REAL ESTATE, INC. plan, fully furnished, W/D August Great location, available now!
2 bed/1 bath furnished 1+'2#./'03%.,1--.0*#+0/!,* for showing times. Available Now 4 BR House 356-1873 2010, call for rent. Contact Mary Williams
$495 until August 2010 352-3182 BARR REAL ESTATE, INC. furnished - w/d on site - dishwasher www.barr-re.com ADVANTAGE PROPERTIES msrwill3@peoplepc.com
Green Street Realty
24 E. Green St. Suite 10
356-1873 free parking 511 -513 S. ELM, C. www.advantageproperties.com
www.barr-re.com Ideal for students Aug. 2010. Corner of W. Green and 217-344-0394
Champaign, IL 61820 602 E. Stoughton, C 505 S. First St. Elm in quiet, attractive building with 703 W. Church, C. 707 W. Vermont
(217) 356-8750 Fall 2010. Unique 1, 2 bedroom on campus locked security entrance. Large 2 Aug 2010. Close to downtown in Available Fall 2010 4 BR, 3 Bath. W/D, Parking, Spa-
bdrm. apts with approximately 770 quiet location on busline. 1 bdrm

605 S. Fifth, C.
apartments. Furnished, laundry, in-
ternet. 2 Bedrooms starting at $387/ 706 S. Call 352-7712
sq. ft. Free covered parking, laundry
in building, Central A/C, Gas Heat,
$440/mo. 2 bdrms. $500/mo. Patio/
Balconies, Central A/C, Gas Heat,
304 S. Busey, U.
4 bed/2 bath
cious Campus House, low rate
$1580.

Fall 2010
person. Parking available. Must see!
WALNUT, U. Carpet. On busline. Rent starts at Carpet, Laundry in building. Call for $1995/mo www.baraka-apts.com

5th and Green location


THE UNIVERSITY GROUP
universitygroupapartments.com August 2010. Close to Downtown
Urbana, 1 bdrms $510/mo. 2 bdrms
1 Bedroom $540/mo. Call for showing times.
BARR REAL ESTATE, INC.
showing times.
BARR REAL ESTATE, INC
$1000 deposit
www.greenstrealty.com
Outdoor activity area. 1 bedrooms
available. Garage off-street parking,
352-3182
$540/mo. Central A/C, Laundry.
Luxury Apartments 356-1873 356-1873
24 Bedroom Fraternity rooming
house. Sublease or purchase. Park-
laundry.%-)*##'! 0,  Parking. Call for showing times. 605 E. Clark www.barr-re.com Available Fall 2010
www.barr-re.com ing. Susan 217-202-4688
S. First, C. BARR REAL ESTATE, INC. www.mhmproperties.com 104 W. Oregon, U.
THE UNIVERSITY GROUP 203 S. Sixth, C. 356-1873 --- 4 bed/2 bath
universitygroupapartments.com August 2010. Large 4 bedrooms, 2
bath. Balconies, laundry, covered
www.barr-re.com 2 Bedrooms 512 W. GREEN, C. 705 W. CHURCH, C. $1600/mo Near Engineering
 

parking. Starting at $250/person. Of- Green at Lincoln Aug 2010. Double security brick Aug 2010. Very attractive apts locat- $1000 deposit Campus
102 S. Lincoln, U. building in excellent location. Large ed near downtown. On busline. www.greenstrealty.com
6#%!2
)012 One block from County Market. 4
509 Bash Court, C.   807 to 809 www.mhmproperties.com 2 bdrm apts with approx 800 sq. ft.
Parking, Central A/C, Carpet, Laun-
Large apts. Balconies or patios. One
bdrms from $425/mo. Two bedrooms BR Furnished at 305 S. Fifth, C. D/
Fall 2010
Great 3 and 5 bedrooms, Behind
universitygroupapartments.com


 W. ILLINOIS, U
---
1 Bedroom Apartments with
dry facilities. On busline. Rents
$530/mo to $550/mo. Call for show-
from $475/mo. Call for showing
times.
602 Alabama, W, W/D, Parking for four, C/A. Avail-
able Mid-August. 217-352-4918,
crakers@comcast.net.
Legends. Fully furnished, dishwash-
ers, laundry. Off-street parking.
Aug 2010. 1 Bdrms corner of Lin-
coln & Illinois. Window A/C, Laun-
PAID UTILITIES!
101 S. Busey, U.
ing times.
BARR REAL ESTATE, INC.
BARR REAL ESTATE, INC
356-1873
C
0.0'+%0

-#./,+$5!#0 202 E. dry, Rent $550/mo. Parking $50/mo. www.mhmproperties.com 356-1873 www.barr-re.com
Avail Aug 2010. 2 bedroom/ 1 bath
with basement, w/d hookups. $575/
SPRINGFIELD, C. CONDOS/DUPLEXES 520
309 S. First, C. Call for showing times. www.barr-re.com
--- mo. Call for a showing.
THE UNIVERSITY GROUP BARR REAL ESTATE, INC.
August 2010. 1 bedroom units con-
1+'2#./'04%.,1--.0*#+0/!,* veniently located close to campus. 356-1873 3&4 2 Blocks East
BARR REAL ESTATE, INC
352-3182 Rent from $410/mo. Central A/C,
dishwashers, balconies. Call for
www.barr-re.com
Bedroom 111-121 W. 356-1873
www.barr-re.com
Brand New Luxury Condos on
Neil St.

411 HEALEY, C.
showing times.
ARBOR 48" TV & JACUZZI Park, U of Lincoln 11 Bedroom
1 & 2 bedrooms. Washer/dryer in
unit. No pets. Starting at $850. Avail-
BARR REAL ESTATE, INC. Avail Now & Aug 2010. Overlooking 614 West California, U. able April.
Best Location - Fall 2010 205 S. Sixth, C.
Spacious 4 bedroom apts. Fully
356-1873 APARTMENTS, C. www.mhmproperties.com
Crystal Lake Park. Adjacent to Carle 4BR, 2 BA. A/C, dishwasher. On Campus. $2800/mo. Fall 2010
367-6626
390-6685
www.barr-re.com Aug 2010. 1 bdrms at Third & Greg- Clinic and close to U of I Campus- Available August.
furnished, dishwasher, laundry, and ory. Window A/C, laundry, rents from --- Engineering & Computer Science. 217-377-8797
value pricing. Covered parking. $390/mo to $415/mo. Parking $35/ 3 & 4 Bedroom #5 &"+ &"/ from $365/mo and 2 nuchtmann@comcast.net CONDO FOR SALE or RENT
$375/person. Phone 352-3182. mo. Call for showing times. New Security bedrooms from $465/mo. Shown 7 10 Bedroom 2 BR, Urbana, 1.5 baths, living &
&7#%!2
)012
THE UNIVERSITY GROUP
404 W. HIGH, BARR REAL ESTATE, INC.
Building
days a week.
BARR REAL ESTATE, INC.
On Campus. $2800/mo. Fall 2010
367-6626
dining room, kitchen, dishwasher.
New windows and roof. A/C, gas
universitygroupapartments.com URBANA 356-1873
808 S. Oak, C. 356-1873
1901 Karen Ct, C heat, w/d, bus line to campus, pri-
www.barr-re.com Aug 2010. 2 bdrm apts in SW vate garage, yard. Myra @ 847-571-
Aug 2010. Huge 2 bdrms- 1,100 sq. www.mhmproperties.com
---
www.barr-re.com Champaign neighborhood near 101 E. Stoughton 1455
ft. W/D in each unit. From $695/mo
203 Healey, C. to $735/mo. Parking. Call for show- 111 E. Chalmers, C. FREE INTERNET IN MOST UNITS
Windsor Rd & Mattis Ave. 1 bdrm
from $495/mo, 2 bdrms $530/mo.
Large House
3 bed, 1 bath
Fall 2010. Great location on the
park. Private balconies. Fully fur-
ing times.
August 2010 studio, 1, 4 bedrooms. www.mhmproperties.com
722 S. Carpet, central a/c, dishwashers, Free parking
nished 3 bedrooms, $310/person.
BARR REAL ESTATE, INC. Furniture, skylights, off-street park- 337-8852 disposals, laundry in building, gas
Available Now ROOMS 530
Parking, laundry, value pricing. Of-
2!.
 %,-.
356-1873
www.barr-re.com
ing, laundry. Starting at $295/person.
$4!#0
'./0
BROADWAY, heat. Call for showing times.
BARR REAL ESTATE
352-3182

 GROUP  408 E. White, C. URBANA 356-1873


University Group WOMEN'S
universitygroupapartments.com 1+'2#./'03%.,1--.0*#+0/!,* Furnished 2 bedroom apartment for August 2010. 1 bdrm apts close to www.barr-re.com
306 W. John
CERTIFIED HOUSE
352-3182 102 N. GREGORY, U.

 August 2010. No pets. $720. Campus. Window A/C. Rents $400/
Deluxe furnished 3 BR bath 1/2
Near Nevada & Busey. Kitchen Priv-
Aug 2010. Close to Illini Union. 1 Steve Frerichs mo. Call for showing times. leges, color cable TV, laundry, park-
Now Leasing for Fall 2010 home. Excellent. $1100/mo. Ted- ing. On-site resident manager. 9
bdrm $440/mo, 2 bdrms $540/mo. (217)369-1182 BARR REAL ESTATE, INC. 766-5108.
307, 310 E. White, C Carpet, Laundry. Parking $45/mo.
WOW stevesapartments.com 356-1873 Studios 1, 2, 3 Bedrooms. Free Heat month lease. Summer lease at re-
Call for showing times. and Water. Landmark Apartments. duced rates. 337-1565 or 328-6490.
307, 309 Clark, C BARR REAL ESTATE, INC. 4 BR $1180
www.barr-re.com
502 W. Main, Urbana IL. 605 S. Prairie
Fall 2010. Large studio, double clos- 3 BR $990 217-384-5876.
356-173 August. Deluxe furnished 3 or 4 BR,
et, well furnished. Starting from
$350/mo. Behind County Market. Of- www.barr-re.com New Kitchens 111 S. BUSEY
MODERN 3 STORY, 2 BATH. GAR- Crystal Lake Park landmark-apts@sbcglobal.net. 2 BA home. Totally redone. Now - August
Flat Screen TV Excellent. $1300/mo. Ted 766-5108 Campus Rooms from $270
6"$ 1
 (/01 AGE Large 1 BR and study; 2 BR
106 E. Daniel 3 BEDROOM TOWNHOUSE (217) 367-6626
THE UNIVERSITY GROUP August, convenient to campus
universitygroupapartments.com 1108 S. Lincoln, U 217-352-3182 1700 sf 217-840-5134 213 W. Illinois, U 308 1/2 W. William,
352-3182 Avail Aug 2010. +"% & 1 universitygroupapartments.com 2 Bath, CA, WD Avail Aug 2010. 2 bedroom with
www.robsapartments.com
$##! "  %% # $ ' " 1 Block to campus hardwood/vinyl +""$% free parking. C ROOMMATE WANTED 550
+"*  !# " 1 $##! Rent $500/mo. Call for a %")! Very spacious 4 BR, LR, DR, 2 full
www.lincolnshireprop.com
104 E. Armory  !# '"$* " ' " Call 906 S. Oak $1125.00 Crestview time. #"'! '""#
Fall 2010, 4 bedrooms, 2 full baths
#$%#)"&!
Furnished 4 bedroom (3 bedroom $$%&&! " !! !!- Available NOW
Skylights, leather furniture,
$$ %&&" with study) apartment. For August
398-1998 Commons 356-1873  2 Bedroom Apartment
356-1873 2010. Recently remodeled. Laundry On Florida Ave in Urbana. Huge 2 www$$$" $$"# Pay half utilities, close to campus
#T.V. )))$$$#! in the apartment. No pets. BR apts, off-street parking, pets OK, 217-337-8852 $380/mo. 367-6626
Utilities included
$350 per person
$1340(1200) 207/211 John C. next to park, near U of I. $575/
month. Great move-in specials.
www ! !#"
Steve Frerichs 2, 3 BR. Great Location, on-site 804 S. Race, U
The University Group
714 W. Elm 217-369-1182 laundry)*$#'"!0 ,  217-344-2072. Available August 2010. 1 bedroom Available Now
!" 
QUIET, MODERN ENGINEERING stevesapartments.com First C. Managed by Ramshaw Real Estate. with hardwood +##%& free parking. 814 W. Clark, U. 1107 S. FOURTH
CAMPUS, 2 BEDROOM, 2 STORY  GROUP Rent $460/mo. Call for a showing Spacious 3 bedroom 1 bath house. $300/mo. includes utilities
universitygroupapartments.com time. Fully Furnished, near Engineering Fully furnished apartment
3rd and Clark TOWNHOUSES, $860.
SOUTHWEST campus, washer and dryer in bas-
August. Beautiful, furnished, 3 and 4
REALLY UNIQUE HUGE GREAT VALUE 352-3182 %% &''"
ement, free parking! $750 per
Private Bedroom
bedroom apts. Plasma TV, wood 2 BEDROOM WITH LOFT $1050 306-308-309 White, C PLACE APTS, C. 356-1873
month. Available Aug. 20th.
Located @ 4th and Gregory
)!!#$ Excellent. $800-$1100/month *C>www.lincolnshireprop.com August 2010. Furnished studios, 1, August 2010. Located in SW Cham- www%%%#! Flexible Leases Available
906 W. Clark, U. ADVANTAGE PROPERTIES (8%'#3
+123
Ted. 766-5108 398-1998 2, and 3 bedrooms. Balconies, pati- paign near Windsor & Mattis. 2 bdrm
217-344-0394
os, laundry, dishwashers, off-street
parking. Behind County Market.
GIGANTIC Duplexes, Fourplexes, Townhouses
and 1 bedrooms. Carpet, gas heat,
THE UNIVERSITY GROUP
352-3182
Looking to
1 Bedroom
central a/c. Some units have w/d's in
Reduced: 502 W. 1&2
Starting at $265/person.
THE UNIVERSITY GROUP
Fully Furnished one bedroom units, or laundry in bldg, garages, 701 N. Lincoln, U. universitygroupapartments.com
Green, Urbana apartment only 2-1/2 blocks from dishwashers, disposals, patio/balco- Spacious 3 bedroom 1 bath house.
Bedrooms SUBLET
universitygroupapartments.com campus! High speed Internet
Fully furnished 4 bedroom, 2 bath nies, parking. 1 bdrms from $490/ Fully furnished, near Engineering Available now
352-3182 included. Washer and dryer in the mo. 2 bdrms from $610/mo to $690/
with ,$# -&%$! tv, full-size $475-525.00/month campus, washer and dryer in bas- Share deluxe 4 BR 2 bath furnished
washer/dryer. Walking %&! to apartment. Available Aug 2010. mo. Call for showing times. ement, free parking! $750 per apartment at 3rd and Clark. Ted-
 #'% #$%"!"!
 
  
Washer/Dryer
104 N. Fifth, C.
ENGINEERING
$640/month.
Advantage Properties
BARR REAL ESTATE
356-1873
your month. Available Aug. 20th.
ADVANTAGE PROPERTIES
766-5108.

CAMPUS · AUG 2010


217-841-5407
APARTMENT?
"!"%&$" %&!& 217-344-0394 www.barr-re.com 217-344-0394
2BR, 1BA, from $655.
NEW 3 BDRM PARKING/STORAGE 570
FULLY ACCESSIBLE 1BR - $635
located at 1003 W Stoughton C/A,
UNIQUE TRI-LEVEL 905 W. Hill, U.
NEWER 1BR! on-site laundry, Ethernet Incl., No Pets APARTMENT! PET FRIENDLY
Spacious 3 bedroom 1 bath house.
Fully furnished, washer and dryer,
PARKING
WWW.PPMRENT.COM · 351-1800 $475/person free parking! $720 per month.
Available Now
808 W Illinois, U. C/A, W/D, D/W 2BR, 1.5BA, on busline, on-site Available Aug. 20th.
5th & Healey, C

No Pets $750 Available Aug 2010


1st & John - Campus! laundry, Avail July/Aug, limited off ADVANTAGE PROPERTIES
John & Locust, C
street parking, from $675 308 E Iowa, U Barr Real Estate, Inc.
Call BMI today! (217) 390-9900 217-344-0394
WWW.PPMRENT.COM · 351-1800 HUGE 1BR www.BMIcity.com WWW.PPMRENT.COM · 351-1800
356-1873
www.barr-re.com
ON GREEN ST • AUG 1 Sweet Deal

Online_Classi-
LUXURY HOUSE

BRAND NEW APRIL SPECIAL•FREE INTERNET 2BR ON FRATERNITY ROW


CHAMPAIGN · AUG 2010 VINTAGE 1BR CALL DI 811 W, Main, U.
Newer 4 bedroom, 4 1/2 bath, 4 car
BUILDING IN 2008! CAMPUS · AUG 2010 garage with electric openers. 2,000
fieds.
503 E Springfield, C. W/D, D/W,
205 E Green, Champaign
Water Included · On-site laundry
109 E Chalmers, 108 E John, C, huge apt with Classifieds! plus sq. ft. Kitchen, dining room,
# %#&" )"
1 BR walk-in closet, C/A, No Pets on-site laundry, C/A, D/W, balcony, hrdwd floors, security door, water incl, plan, fully furnished, W/D. August Use dailyillini.com
No Pets · A/C · Starting $515 2010, $2,200 per month.
Seach for jobs,
From $765 Avail Aug 2010 No Pets, $895 on-site laundry, No Pets from $585
ADVANTAGE PROPERTIES
WWW.PPMRENT.COM · 351-1800 WWW.PPMRENT.COM · 351-1800 WWW.PPMRENT.COM · 351-1800 217-334-0394
WWW.PPMRENT.COM · 351-1800
217-337-8337 apartments,
  
 
NEW KITCHENS Contact Justin at 618-304-8562 206 N. Gregory, U.
Spacious 4 bedroom 1 1/2 bath appliances, bi-
   
cycles, furni-
503 - 505 - 508 White Completely Furnished 3 4 house. Fully furnished, washer and
dryer in basement, free parking!
2 Bedroom with den $790 On-Site Parking & Laundry 7 6 9 4 8 2 7 1 3 5 8 $1100 per month.
        3 Bedroom $830-950 On-Site Resident Manager
9 1 2 7 4 3 5 6 8 9 7
Available Aug. 20th.
ture, tutoring,

 
 
  
D/&&3"/,(%-$! -+ ". 
! ,))' .$
&&.%&%.%!-(&/ !
theuniversity group universitygroupapartments.com
217-352-3182
2
6
8 5 3 6 9 1 4 2 7
2 1 8 5 7 9 3 4 6
1
3
ADVANTAGE PROPERTIES
217-344-0394 houses, cars,

    
/''!,*!%& ,))'
D%.(!--!(.!,
)'*/.!,&

1%,!&!--%(.!,(!.
%( )),*))&
#'!
8 5 4 6 1 8 3 7 9 2 9
910 W. Stoughton,
motorcycles,
&& ,))' ,))'
$)../
 1 3 7 9 2 6 4 8 5 1 4 U.
 ,)/*)"&& &/( ,3"%&%.!-
)/,.3, STAR 4 9 6 2 3 1 8 5 7 4 6 Very Spacious 4 bedroom 2 bath
D2!&&!(.,))''.!'.$%(# TING
Wanna know
$
349
house. Fully furnished, near Engi-
   
-!,0%! 1005 S. First, C: Studio AT 3 4 8 1 7 5 2 9 6 3 2 neering campus, washer and dryer
 %()&(0!
,(
  
D( -%.!'(#!'!(.
1009 S. First, C: 4BR 5 7 3 5 9 4 6 2 1 8 5 and free parking! $1900 per month.
Available Aug 20th. what we’re
playing?
D)&&3)1(!
111 .,%/' *,.'!(.- )'  


 202 E. White, C: VISIT
OU
CALL R WEBS T I P O F F C R A W ADVANTAGE PROPERTIES
2BR, 3BR, 4BR FOR IT
DETA E OR T U N E D O U T A E G I S 217-344-0394
ILS
1107 S. Sign a 4 or 5 bedroom lease 202 S. Lincoln, U: A B A N D O N A L L H O P E

Fourth and get second for 1/2 price! Studio, 1BR, 2BR
F
F
U
L
R
O
S H
P R A I
O
S
M
E
A
S
G E S
Cute House For Rent Available Check out
THE217.COM
Y E W H O E N T E R H
E R E Aug. 15th
209 Griggs, U: 1BR, 2BR Close to campus. 1004 S. Busey,
PERKS GALORE!
A S I T I S G E L
D I V I N E S T A L K Urbana. 3 Bedrooms, 1 bath, porch,
303 E. Clark, C: 1BR M A N E T C O M E D Y updated kitchen and %  Call
Great location. 2 blocks from main I S M A R A B I C 369-8254 or 378-7718
quad. Leather furniture, hardwood 905 S. Locust, C: 2BR T H E G A T E S O F H E L L
floors, & flat screen TV. Loft style
A R S
H E R S E
E N I O
L F M
A B
I
B
A
Y Campus Houses for the latest
4 and 5 bedrooms, each with 2
full bathrooms. Great location!
D A N
A M A
T E A L I
T I E V
G
E
H I E
A R D
R
E
I
N
Parking, A/C, laundry, hardwood
1))+,(*)+# , 107.1 WPGU playlist
Just across from the A P O D S T R E S S .&&0!.+($,# 
U of I Armory. 217-359-6400 3 BR, 706 W&&$()$,


theuniversity group Available Fall 2010: leasing@ramshaw.com 22 ILLINI STOPS HERE 4 BR, 709 W. W,#$("-)(
 

4BR Loft $1520 www.ramshaw.com EVERY 10 MINUTES ! HARDWOOD $-$)(&' ($-$ ,

FLOORS

   

www.gregory-towers.com
217-352-3182
5BR Loft $1800 GREGORY
TOWERS
1817 S. Neil, Champaign
rCFESPPNGVSOJTIFEBQBSUNFOUTXJUI
rCFESPPNGVSOJTIFEBQBSUNFOUTXJUI
+% +,)',-( -

4 BDRM HOUSE
SELLING
SOMETHING?
THIS IS A MUST SEE APT • $850
VQUPCBUISPPNT $475/person
ADVANTAGE PROPERTIES C-U r*OEPPSPVUEPPSQPPMT HBNFSPPN 
610 W Oregon, U · 2BR
Just remodeled · New windows
NFEJBMPVOHF àUOFTTDFOUFST New kitchen · New bath · No pets
507 W. Green-URBANA!
W/D in unit · Off-street parking
r'SFF*OUFSOFUDBCMF QMVTVUJMJUZBMMPXBODFT Call BMI today! (217) 390-9900
WWW.PPMRENT.COM · 351-1800 www.BMIcity.com
r*OEJWJEVBM
DPOUSBDUT 1 BR Apts 713 W SPRINGFIELD
r4FNFTUFS available now URBANA · AUG 2010 Advertise in the
BWBJMBCJMJUZ 314 and 316 S. State St. 4BR, 2BA, 1 block East of Lincoln.

Rents - $450-$550
2 car garage, No Pets.
Internet hookup provided
DI Classifieds!

 VULPSSPUVPZJVT Call 352-7712 $1,375
217-337-8337
WWW.PPMRENT.COM · 351-1800

WALK TO CAMPUS! Opening doors to quality living in


All of our apartments are 1-4 blocks from Campus
Champaign for over 30 years.
CALL FOR SPRING PRICING SPECIALS!
Let us walk you through the cleanest apartments in town!
• Free Internet 1 Bedroom Apartments
• Washer & Dryer in 2 Bedroom Apartments No matter where you want to live or what your needs are, Royse & Brinkmeyer
every unit 2 Bedroom 2 Bath Apartments has the answer. Search through over 1,000 apartments - customize your search
• Dishwasher in most units 3 Bedroom 3 Bath Apartments to include the number of bedrooms you need, your price range, amenities desired
• Furnished and more. Log on today and find the perfect apartment-home!
• Air Conditioning

HALF OFF 1ST MONTH’S RENT! www.roysebrinkmeyer.com


217-344-0394 Choose your new home today - Appointments helpful, walk-ins welcome!
www.advproperties.com 211 West Springfield Ave., Champaign 217-352-1129
Corner of Lincoln & University / 406 N. Lincoln Ave., Urbana
-9 Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd

Check out photos,


descriptions and
pricing information at
classifieds.dailyillini.
com/sublets

1006 S. Third St., C. 1 F     708-699-8989: $420, near Quad and the ARC 54 E. Chalmers , C. 3 U    847-373-0798: $500, 1-3 BR available in 4 BR apartment
505 E. Healey St., C. 1 F    704-779-5001: $300, female roommate at Boardwalk 202 E Chalmers, C. 4 F    tcmeehan2@gmail.com: $470, 1-2 female roommates

512 S. Third St. Apt. 204, C. 2 F    847-902-3313: $500, jacuzzi bathub and furnished brdrms 205 E. Stoughton Unit 32, C. 4 F     630-209-0106: $1560, 4 people Fall '10 - Spring'11

502 East John Street, C. 2 F     630-877-0378. Great Location! 309 E. Green St. , C. 4 F    leejennifer90@hotmail.com, Walk to the Quad
408 E. White Street #10, C. 2 F    clev.red@gmail.com. Cute 2 bedroom apartment 402 E. White St., C. 4 F     felts1@ilinois.edu: $400, house near Engineering Quad

309 E. Daniel St. Apt. 13, C. 2 F    630-651-0482, rechner2@uiuc.edu. Beautiful four bedroom 107 South Wright, C. 5 F    e-mail: Molly at mollyruth89@hotmail.com
505 E. Stoughton, C. 3 F     lboron2@illinois.edu, Leasing from Aug '10 - Dec '10 606 West Ohio, U. 24 F    217-202-4688: Call for rent, 24 bedrooms/14 parking spaces
512 S. Third Street, 216, C. 3 F    musetti2@gmail.com, 847-409-1873, 1 block from Green 1901 North Lincoln Ave, U. 1 F    whiterrell@gmail.com: $450, 1 BR available, utilities incl.
404 1/2 E. White Apt. 1, C. 0 F    217-840-0260: $410, 1 block away from County Market 502 W. Green St., U. 4 F     brentnelson6@gmail.com: $350, 1 BR avail, bus(5 Green)

616 E Green St, C. 4 F    lisa.mazzacco@gmail.com: $500, utilities incl, 4 BR Green Street Towers, C. 4 F    sunnyhertz@yahoo.com: $400, 1 block from Quad
1109 S. Third Street #202, C. 1 F    219-561-1575: $420, parking available, 1 block from ARC 705 S. First St., C. 4 F    thomas28@illinois.edu: $350 (negotiable), 1 br available
307 E White St, C. 1 F    peretz@illinois.edu. This is a lovely studio, very spacious. 501 N Randolph, C. 2 U    nick.schall@gmail.com: 2 BR, 1BA available now until July 31
103 E. Chalmers, C. 4 F     mwilli28@gmail.com: 2 bath, 2 parking spaces incl., loft 202 N Coler , U. 3 U    timolson@illinois.edu: $1200, water/cable incl., semi furnish

ACTION
410 E. Green St. , C. 3 F    ehaven2@gmail.com: $375, parking avail., lots of storage

real estate
!"#$%&

ADS!
COMMERCIAL PROP. 610
\m\ipk_lij[Xp
!%'()*
DAILY ILLINI CLASSIFIEDS 2010
PRIME CAMPUS LOCATION AVAILABLE FOR LEASE
Commercial/office space SUBMIT YOURS TODAY AT
classifieds.dailyillini.com/apartments/sublets/submit
available in the heart of
campustown near VIEW THEM ONLINE AT
classifieds.daily.com/sublets
6th and Green. &
IN THE CLASSIFIED SECTION OF THE DI 20 Words, 5 Days
2,000-6,000 square feet of
Sudoku
3
$20
very flexible space available. SKILL:

For further details call 2 1


Mary Cory at 10 Words, 5 Days
217.337.8310 7

HOUSES FOR SALE 630


announcements
8 5 3 1 4 $10
1 5 7

The Daily Illini


1608 Chevy Chase Drive, Cham-
paign
3 bedroom/1 bath ranch house with
attached garage. New tile, laminate
hardwood, carpet and paint. Double- ADOPTION 850 4 9
sided *#" central A/C, hot
Adoption & Egg Donation
water heat. Good neighborhood. 7 2 6 5
YOUR SOURCE.
Near bus lines. $135,100.
sumrdaze2009@live.com, 217-643- Adoption Journey
2010. We hope to build our family through
adoption. Your generous act of love
9 2 3
can help us realize our dreams.
Looking to sublet Join us in our adoption journey and
we can help each other. All approv- 7 5 3

  
your apartment? 
 
ed expenses paid.
Please call us at 1-888-815-5032. 8    
LCFS Lic. No. 012998
    
 # 
Enter the numbers 1-9 in the blank spaces so that 

each row, column and 3x3 square contains only one
Adoption: 
 
Call DI Classifieds Happily married couple has lots of
joy and laughter to give to a little
of each number. There is only one solution. (solu-
tion in Classifieds and online at www.dailyillini.com).  
 !"
217-337-8337
one. We look forward to sharing our
hearts and growing our family
through adoption. Your child will


have a home ( with love, fun and
family. For more information, please
  
 *Cash-in-advance only. No refunds,
call 1-800-Baby-Mom. Love, Jim and but you may cancel your ad.
Shavonne 
 
 



It’s coming...

A magical and revolutionary product


at an unbelievable price.
Starting at $499.* funded by SORF

Israel Week- April 16-24

www.bodyworkassociates.com
THE217.COM

$BNQVT$IPJDFGPS

Serious Stress Relief


Try a Precision Neuromuscular
Massage and get $5 off your
next visit!*
Now with 2 campus locations:
r*MMJOJ6OJPO0BTJT]6SCBOB
r"3$]$IBNQBJHO
PSNJOVUFT&YQJSFT
021709 DI

Introducing iPad. It’s the best way to experience the web, email,
photos, and video. All on a big, beautiful Multi-Touch screen. 217-355-3278
217-355-3278
1409 Neil St.
Open Late • Fast Delivery
With just the touch of a finger. Mon-Wed 11am-3am
Thurs-Sat 11am-3:30am • Sun1-2:30am,
11am-3am

* Price is as of April 3, 2010, is subject to change, does not include taxes or shipping, and is U.S. pricing. iPad is available in store only. Gumby Dammit 12” Mix’N Match
14” Large 16” XL
Cheese Cheese •10 Wings
or < choose any 2 for
Pizza Pizza •5 Pepperoni Rolls
$4.99 $6.49
•Valid delivery or carryout
•Valid Sunday-Thursday
•12” 1-item Pizza
•12” Pokey Stix
$15.00
•Must mention when ordering

16” Mix’N Match Campus Special


•20 Wings
1 - Item Pizza or Pokey Stix

512 E. Green Street, In The Heart of Campus


< choose any 2 for
•9 Pepperoni Rolls Small: $6.99 Medium: $7.99
•16” 1-Item Pizza
•16” Pokey Stix
$20.00 Large: $8.99 Ex-Large: $9.99
Massive 20”: $13.99

www.illiniapplecenter.com Store Hours: {Dorms and Greek Houses Only}

Spend $20 or more & receive a FREE sm. order of Pokey Stix!
217.337.3116 Mon–Sat: 9am–6pm
Now Open Sundays: Noon–5pm
The Daily Illini’s
Moms Weekend Guide
Tuesday, April 13, 2010
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
2

Beads N
Botanicals USDA CHOICE AGED STEAKS
Artisan Gallery SIGNATURE SALAD BAR
beads, crystals, “GRILL YOUR OWN” STEAK
jewelry, incense,
tarot & more FULL BAR + WINE LIST
FAMOUS SKILLET COOKIE DESSERT
117 N. Broadway Ave.
Urbana, IL 61801
217-365-WELL (9355)
www.beadsnbotanicals.com
beadsnbotanicals@gmail.com

SERVING THE URBANA-CHAMPAIGN COMMUNITY SINCE 1986

Treat your mom to classic


For reservations: Hours:
Italian food
Mon - Thurs: 4:30pm -9pm
Reserve a
table today! 202 W. Anthony Drive Fri & Sat: 4pm - 10pm
Sun: 11:30am-9pm
1201 S. Neil, Champaign 217.355.8656 Champaign, IL

Spring Sale Get those puppy-dog eyes ready for mom.


MacBook 13" MacBook Pro
$869 Save $50
Normal education price: $899 13-inch models MB990LL/A & MB991LL/A

+ Take 20% off all non-Apple


accessories in stock.
with a qualifying purchase

512 E. Green Street, In The Heart of Campus


www.illiniapplecenter.com Store Hours:
217.337.3116 Mon–Sat: 9am–6pm, Sun: Noon–5pm

Now Open Sundays: Noon–5pm


K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
3

DfdjN\\b\e[)'('K_`jn\\b\e[k_\dfdjXi\Zfd`e^kfkfne%Jkl[\ekjXZifjjZXdgljn`ccY\gXik`Z`gXk`e^`ek_\ZiX]k
]X`i#j\\`e^gcXpj#j_fgg`e^Xe[^\e\iXccpj_fn`e^k_\`idfdjX^ff[k`d\Xifle[:_XdgX`^e$LiYXeX%
?\i\Ëjfli^l`[\kfk_\n\\b\e[#n`k_jfd\\jjXpj]ifdjkl[\ekjXe[Zfddle`kpd\dY\ij%

Business booms over weekend celebration..................page 4


Atius-Sachem to celebrate moms with kids..................page 5
Students nominate mothers for ‘Mom of the Year’........page 6
Son bonds with mom over Latino culture.......................page 7
Making the most of a memory.........................................page 8
Calling all moms: Get involved.......................................page 9
Calendar of Moms Weekend events.............................page 10
Mom: Mentor, parent and best friend...........................page 13
Don’t let Mom go unappreciated...................................page 14
Five things to do with your mom...................................page 15
Some things never change.............................................page 16
Clean room makes good impression............................page 17
Keeping Mom classy.......................................................page 18
Friends are family in sororities......................................page 19

Saturday, April 17 : : Mom tastes for free!


(And buys you wine? Let’s hope!)
Mom’s Day Treats
The Corkscrew features over 1,100 We’ve Got ‘Em NEW Spring Hours
different wines, 200 different beers, and Treat your mom to Mon-Sat: 11am-10pm
over 150 different spirits. the very BEST in town! Sunday: noon-10pm
Your mom is treating you right this * Yummy Sundays *
weekend, so be sure to give her the best * Extra-thick Snowstorms *
options possible!
* SUPER-THICK Shakes and Malts *
* Delicious Custard Cups & Cones *
Corkscrew Wine Emporium * Fresh-baked Waffle Cones and Cups *
203 N Vine St, Urbana • 217.337.7704 Well worth the walk or 309 W. Kirby, C. | 217-352-2273
Mon-Sat: 11–8 Sun: 12–5 (just accross from Jerry’s IGA)
drive from Campus!
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
4

DfdjZifn[ZXdglj#
Mom’s Know Illini Tradition!
_\cgYlj`e\jj\jYffd
*Mom’s Weekend Pint Glasses* 9PD<C@JJ8D@:?8C8B
=<8KLI<J8JJ@JK8EK<;@KFI
competition among similar companies. Many
places, especially bars, are offering specials
As students get ready for their moms to visit, to try and get the upper hand. Even the Illini
businesses around campus are preparing as Union bookstore will be having specials for

ILLINI
well. Moms Weekend brings crowds of moth- the weekend.
ers as well as other family members to the U “We are having sales and are opening early
of I campus. Restaurants will be packed, stores on Sunday to accommodate the visiting moms,
will be flooded, and bars will experience a big in case they want to grab last minute things
increase in customers. before they head out,” Manager Brad Bridg-
LaDarian Crosby, an employee from the es said.
Italian restaurant Biaggi’s, said the restaurant This is also one of the busiest weekends
is usually completely booked for the week- for Follett’s. Employees will be handing out
BRING MOM FOR FREE! end months in advance. He added that Moms
Weekend is definitely one of their busiest, and
orange corsages to the first 300 moms that
purchase something.
year will be no different. Kams will be not only be having drink spe-
PURCHASE ANY FACIAL OR WAXING SERVICE AND “Saturday evening alone, we are looking at cials, like $5 double crown drinks and $2 Mom

MOM GETS THE SAME SERVICE 900 guests which is not exactly an ordinary
weekend,” he said.
“We are definitely upping our staff and prep-
pint glasses, but will also have a promotion-
al contest called Crown the Royal Mom with
prizes and give-aways. With our economy in a
OF EQUAL OR LESSER VALUE FOR FREE aration to get ready for the big crowds.”
Restaurants, clothing stores, and bars will
recession, most will agree that Mom’s Week-
end gives businesses on the U of I campus a
be experiencing extra business causing more much needed boost to their revenue.

Offer expires 4/30/10


Not valid with any other discounts or specials.
Services must be used on the same day.

(217) 693-4400 · HADACM.COM

  

HHQWHUHGWR
6LJQDOHDVH E
 D Q  ;% 2;    
:LQ
       
   
    
     
    
0RPV:HHNHQG$SULO 


  
 K?<;8@CP@CC@E@=@C<G?FKF
J`^dX:_`dfk_\ijXi\c\[[fne;Xe`\cjJki\\k`e:_XdgX`^efeJXkli[Xp#8gi`c(+#)''.Ypk_\`ijfej
 
    `eXgj\l[f`e`k`Xk`feZ\i\dfep%8jgXikf]DfdËj;Xp#dfk_\ijn_fj\jfejn\i\`e`k`Xk\[k_Xkjgi`e^
n\i\c\[Yc`e[]fc[\[`ekfBXdËjXkeffe%
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
5

>i\\bjj_fnZi\Xk`m\ AljkdpZlgf]k\X

j`[\`en\\b\e[J`e^
Atius-Sachem pairs to present fun, energetic skits
9P9<KJP;I8QE<I the event, much of the responsibility lies with
JK8==NI@K<I the individual groups.
For most, Moms Weekend is a chance to “It’s usually a combined effort between
visit with a parent and have a nice meal out. the paired up chapters, and they write and
For those involved in the Mom’s Day Sing, it choreograph their skit themselves,” said
is an opportunity to get together with friends Rybicki.
while singing and dancing to themes like Baker said being involved in the Sing is an
High School Musical, The Lion King and The easy way to meet new people while also doing
Hangover. something for the parents who do so much for
The Mom’s Day Sing is an event produced their kids. “It’s a lot of fun,” he said.
by members of Atius-Sachem, a “leadership The Mom’s Day Sing is an event “moms
honorary society that recognizes students want to come back to every year, even if their
who are very involved on campus,” said Tori kids aren’t in it,” said Frobish.
Frobish, programs chair for the event. “I think most moms appreciate the humor
The performers come from 22 fraternities of it all, especially seeing all the fraternity
and sororities and are paired up to create 11 men getting up on stage and dancing and
groups. The groups that perform in the Sing singing,” said Rybicki. “And of course it’s all
are primarily Greek because it is easier for about the moms, so I’m sure that makes them
them to already have a group formed, said pretty happy too.”
Frobish. “A lot of moms and other Greeks come to
Each group picks a mini theme to fit within watch it,” said Baker.
the overall theme chosen by Atius-Sachem. The Mom’s Day Sing performances are
This year, the theme is “Every Little Sing She Friday at 8 p.m. and Saturday at 7 p.m. in
Does is Magic.” The groups make costumes, Foellinger Auditorium. Tickets are $15 at the
skits and change the lyrics to popular songs door or $10 ahead of time. The money raised
to be about moms or college life. from the performances contributes towards
“Each team has to say the title somewhere the next year’s venue rental, programs and
in their dialogue during the show,” said Sarah tickets said Frobish.
Rybicki, vice president of Atius-Sachem. The The show is an event students and parents
title “Every Little Sing She Does is Magic,” alike look forward to all year. Rybicki said
refers to the moms and is an effort to appre- she was involved in the Sing last year and
ciate all that they do. enjoyed it so much she decided to help orga-
The groups begin practicing when they nize it this year.
return from winter break, and continue orga- “It’s a serious thing but at the same time
nizing all the way through the week before it’s meant to be fun, it’s meant to be funny,”
the event. Baker said.
“It’s not the biggest time commitment, so Although the show does have a comic angle,
it’s good to be in, but you have to stay on top the main point is still geared to honor Uni-
of people to make it the best it can be,” said versity mothers. K?<;8@CP@CC@E@=@C<G?FKF
Mark Baker, vice president of internal opera- “They get so creative,” Frobish said. “It DXepg\fgc\n\i\XYc\kf\`k_\igXik`Z`gXk\`efim`\nXAXgXe\j\K\X:\i\dfepg\i]fid\[
tions for Atius-Sachem. really shows how much we appreciate our Ypk_\LiYXeX$:_XdgX`^e8jjfZ`Xk`fef]:_X[fLiXj\eb\KXebfbX`Xkk_\AXgXe?flj\Fg\e
And although Atius-Sachem does oversee moms.” ?flj\feDfdËjN\\b\e[)''/%

Saturday April 17
Early Bird

## 
Sale. 8am-10am everything is 25% OFF!
10am-12pm everything is 20% OFF!
The earlier you shop, the 12pm-6pm everything is 10% OFF!
" !  12pm
Frombetter thetosale!
6pm Everything is 10% OFF!

 " "




  both
Karen’s Kloset locations

Storewide Spring Sale.


Know about something going on? Country Fair Shopping Cntr
231 S Mattis Avenue
College Hills Plaza
1503 E College Hills Avenue
Email us at
Champaign, IL 61821 Normal, IL 61761
calendar@the217.com
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
6

=`eXc`jkjm`\]fi
XeelXcXnXi[kf
Y\dfdf]p\Xi
Students recognize many ways
moms have affected their lives
9P<M8EDLE:? cago, were selected from a pool of around
JK8==NI@K<I twenty nominees.
Save for maybe a Hallmark-dominated Jansen said that the majority of student
Sunday in May, the duty of being a mother nominators were girls, and that a lot of stu-
is often a thankless job. dents, especially guys, wouldn’t feel com-
The Moms Association and the Illini fortable submitting a nomination.
Union Parent Programs Office is working “I’m sure my son loves me as much as
to change that. any son can love his mom. However, for him
On Friday at the “Explore Illinois” event to submit an application on me—that’s just
to kick-off Moms Weekend, the Moms not his personality,” Jansen said.
Association will announce the third annu- Maggie Johnson, freshman in Business,

OMJOF
al Amelia Alpiner Stern Mom of the Year said in an e-mail that she didn’t have any
Award. qualms about nominating her mom Susan,

0
“The Mom of the Year one of the three fi nalists.
Award is a really great
opportunity for students to
ÈJ_\_XjY\\eYpdp “She has been by my
side for over 19 years and
3RPMRI'SYVWIWJVSQXLI9RMZIVWMX]SJ-PPMRSMW get to recognize their mom
for the things that they do j`[\]fifm\i(0p\Xij I thought this would be a
simple way to say ‘thank
7YQQIV`9RHIVKVEHYEXI'SYVWIW because it’s not until col-
lege when a lot of students Xe[@k_fl^_kk_`j you’ for all the things she
has done for me,” Johnson
really recognize how much
their parents do for them,” nflc[Y\Xj`dgc\ said.
Johnson said she didn’t
said Emily Lyons, parent tell her mom about the nom-
%HZIVXMWMRK )RKPMWL
program specialist at the nXpkfjXpÊk_Xeb ination until hearing that
Illini Union. she was one of the three
%JVS%QIVMGER7XYHMIW )GSRSQMGW Students nominate their pflË]fiXcck_\k_`e^j fi nalists.
%KVMGYPXYVEP'SRWYQIV +PSFEP7XYHMIW mothers for the award, “I called her immediate-

)RZMVSRQIRXEP7GMIRGIW ,MWXSV] named after the founder
of the Moms Association
j_\_Xj[fe\]fid\%É ly, laughing, because I knew
she would think I was crazy
%KVMGYPXYVEPERH'SRWYQIV)GSRSQMGW ,YQER(IZIPSTQIRXERH*EQMP]7XYHMIW
in 1923, and a committee D8>>@<AF?EJFE# for doing something like this
%KVMGYPXYVEP'SQQYRMGEXMSRW .SYVREPMWQ selects a winner among for her,” Johnson said.
]i\j_dXe`e9lj`e\jj
%RXLVSTSPSK] 0EFSVERH)QTPS]QIRX6IPEXMSRW three fi nalists. “Although she does not
%WMER7XYHMIW 1SPIGYPEVERH'IPPYPEV&MSPSK] In the nomination form, typically take the spotlight,
&YWMRIWW%HQMRMWXVEXMSR students write essay responses to vari- I know she was incredibly happy and proud
4PERX4EXLSPSK] ous questions about the relationship they that I wanted her to be recognized for the
&YWMRIWWERH8IGLRMGEP;VMXMRK 4SPMXMGEP7GMIRGI have with their mother, including how their ways in which she has affected so many oth-
'LIQMWXV] 4W]GLSPSK] mother has helped them through college er people’s lives and mine.”
'PEWWMGEP'MZMPM^EXMSR 7SGMSPSK] and the best advice their mother has ever Though this is only the third Amelia Alpin-
)HYGEXMSREP4W]GLSPSK] given them. er Stern Mom of the Year Award, prior to the
7TIGMEP)HYGEXMSR The committee reads through the nom- Moms Association, the Illini Union presented
)RKMRIIVMRK inations and takes it very seriously, said the annual “Queen Mom” award.
Linda Jansen, committee chair. The winner of the Mom of the Year Award
“I read them. I reread them, and I try receives a plaque, and the Illini Union Book-
836)+-78)6:-7-8
to picture each relationship,” Jansen said. store donates a gift package to the three
[[[GSRXMRYMRKIHMPPMRSMWIHYSRPMRIGSYVWIW “This is a very prestigious award and any fi nalists.
mother would want this.” However, for the moms nominated, it’s the
%073%:%-0%&0)3RPMRIQEXLGSYVWIW[MXL2IX1EXL:MWMX[[[RIXQEXLMPPMRSMWIHY Jansen admitted that it can be difficult to gesture that is the real prize.
bestow the award by merely reading about “Although they take motherhood as a norm
the individuals on paper, and she added that and a regular responsibility, so much goes
3J½GISJ'SRXMRYMRK)HYGEXMSR`;IWX9RMZIVWMX]%ZIRYI a lot of moms are equally deserving. into being a mother,” Johnson said. “I think
9VFERE-0``MGSRMRJS$MPPMRSMWIHY This year’s three fi nalists, Susan John- it is nice to stop for a minute and recognize
son of Deerfield, Lois Porebski of Willow them in any way we can for the ways they
Springs and Amelia Sandoval-Colón of Chi- impact our lives.”
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
7

DXi[`>iXj`emX[\j?fik`Zlckli\:clY
Dfk_\i#jfe]fidjkife^
Yfe[fm\iCXk`efZlckli\
Volunteering mother meaningful way during this weekend. Latina
women are the backbones of our commu-
committed to community nity, but often don’t ever get credit for it,
much less expect it.

9PD8EL<C:FCFE
:FEKI@9LK@E>NI@K<I
Dfdk\XZ_\jjfeXYflkXeZ\jkip
Being part of the Latino community, fam-
ily is a very central part of our being, cul-
=Xd`cpZfd\jÔijk]fi`eÕl\ek`Xcdfk_\i ture and upbringing. And as such, it makes
It’s hard to try and quantify why my moth- sense that mothers are the central figures
er is special to me and why she deserves in our concept of our family. My maternal
recognition. grandparents had passed away prior the
First, I would say that my mother is an influ- birth of my siblings and me, but that nev-
ential and important person in the lives of er stopped my mother from stressing the
more people than just my siblings and mine. importance of family.
A respected sister amongst her siblings, she So when I got older and started asking
is the godmother of a handful of my first and questions of our family ancestry, my moth-
second cousins. er was always willing to teach me who was
Secondly, my mother has an undying com- who and where we came from. So much so,
mitment to helping the betterment of others. that when I was 16 she took me with her to
I’m certain that my commitment to service the hometown of my grandparents in Mexi-
is directly related to her always volunteering co so that I could get to know her aunts and
her time to help others. uncles and other cousins of mine. Since
And lastly, I think my mother should be rec- then, we’ve actually gone every other year
ognized as mother of the year because of her or so, and actually manage our online fam-
commitment to family and community; she ily tree site together.
K?<;8@CP@CC@E@=@C<G?FKF never has demanded or expected any kind of She has always supported my inquisitive
Pli`;fd`e^l\q#jfg_fdfi\`e8:<JXe[XXd\dY\if]k_\?fik`Zlckli\:clY#kXcbjn`k__\i]Xd`cp reciprocation for her hard work and it would nature and always does her best to partici-
XYflkk_\[`]]\i\ekgcXekj`e_\iDXi[`>iXj$k_\d\[[`jgcXpXkk_\JkfZbGXm`c`fe% be nice to recognize her in such a formal and pate with me in my educational journey.

/&8-0$"5*0/ findings
"GFXCMPDLTTPVUIPGEPXOUPXOBU4/FJM4U )40(*.3-('+)7'((((( BOU TI QU E
7+)&%C(B:;DEF<DGGA@
PSDIFDLVTPVUBUXXXCFMMBNJBCPVUJRVFDPN :;<:(=%'#(8"31/(.>%((((
*.HC(B:;DEF<DGGA;
!+.-7."2&?("4(@:AB:

Fashion, shoes,
accessories, jewelry
Shop Findings Mom’s Weekend
= RECEIVE 20% OFF STOREWIDE WHEN YOU BRING MOM IN! =

ALSO SHOP THE FOLLOWING BRANDS:


Designer shirts, = 1!12 = &"!(5($)% = *"0%4"#/
denim & more = ')*#(6)"% = 6)"% = !+3"'#)7+%3(14,%
= 8%&'"% = 4.&2,.2%(4)'(.&2%4%' = .2
= #+3%%(0)#' = +.&8/(7.&8/ .&0(-.&/(-)3%9

Home accents, gifts,


stationery

A jazzy space for


parties & events
 *4)3.(1%44.(+.#' !"#"$%&'()*(+,-.&"#/(0%&"- #(1.2'(',&03%''%'
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
8

DfdËjjg`i`kjk`cc
Getting you there. Fast.
_\i\]fin\\b\e[
217.355.3553
Faith, pictures help One word: Strength. My mother exempli-
fied it in every aspect of her life. It was her
lesson to me and it is the one lesson that
daughter remember
Put us in your phone!
no classroom setting could have ever put
into better terms.

mother’s love, life


Open 24/7
She graduated high school early, worked
hard for her managing position at work,
and stood up to a disease that she knew
9P8D8E;8DFFI< had ended the lives of others.
:FEKI@9LK@E>NI@K<I She is the primary example of strength
Tears in her eyes and a hospital blan- in my life. If asked today what one quality
ket by her side, she lay on the sterile mat- do people believe I possess the most- it is
tress. The environment was far from wel- strength. I know what I want and how I can
coming and put a smile onto few people’s achieve it. It is for this reason, that I must
Trying to prepare for

217-333-0820 to schedule an appointment at The Career Center today!


faces. I had on my light blue flowered dress thank my mom. Through her passing, her
development needs!
The Career Center,
a successful future?
Yep, we got a service

and was grinning from ear to ear. I still strength has become a part of me.
Choosing a major?

we help meet all


services for that

enjoyed playing with dolls and coloring The images are everywhere: my fi fth
We have lots of

pictures. Playing house birthday, a joyous


your career

was my passion. smile spread across


because at

To learn more visit www.careercenter.illinois.edu or call ÈFe\nfi[1Jki\e^k_%


for that.

“I love you too, and if my face, my arms


anything were to ever wrapped securely
happen to me I want you
to remember that. When Dpdfk_\i\o\dgc`]`\[ around her neck. Look-
ing back, all it took
the other children in
school are making moth- `k`e\m\ipXjg\Zkf]_\i was the click of a but-
ton and the blinding
er’s day projects, make
sure you make them c`]\%@knXj_\ic\jjfe fl ash of a camera.
Now, they are my
too. I will still be able everything. Pictures
to see them.” Her voice kfd\Xe[`k`jk_\fe\ provide me with reas-
was weak and quiet- she surance that the love
didn’t want to make us c\jjfek_XkefZcXjjiffd of a mother is truly
cry. infi nite. I can’t remem-
“Okay mommy,” my
adolescent mouth mut-
j\kk`e^Zflc[_Xm\\m\i ber every word spoken
or the way she hugged
tered. I wasn’t crying, glk`ekfY\kk\ik\idj%É me when I was sad, but
Counseling

nor was I angry. As most these pictures serve as


Career
?

8D8E;8DFFI<#
seven-year-olds would, I a keepsake that she too
?

was just taking it in. ]i\j_dXe`eC8J showed her love to me,


This woma n had even if I was just too
Workshops

inspired me to play the young to remember.


piano, to read and to not With life’s many col-
let anything stop you lisions it’s impossible
Development

from loving someone. Being the naive age to do it all on your own. Sometimes you
CAREER
ENTER

Career

of seven, I was oblivious; all I knew were need someone to pick you up and carry you.
THE
C

the facts: my mom was sick. The school It is with her wings she earned that night
nurse couldn’t fi x her, so I knew it was at the chapel and the strength of will that
Advising

something important. was forever embedded in her heart, that


Health

The next day we found ourselves sitting she carries me.


on the steps of a nearby Seattle chapel. It I know that no matter how alone I may
was late at night and there were no more feel she will always and forever be there.
visitors allowed inside. We didn’t care. It Some may say that the lessons a mother
wasn’t about the church. It was about our passes to her child are set by her example
connection with God and faith at a difficult of life here on Earth.
service for that.
Looking for a job?

crossing in our lives. I believe differently. With the leather-


service for that too.

Well, we have a
health profession?

Not sure what to


put on your
résumé? We got a

The bells of the church softly chimed. patented bible by her side and her brother
Thinking about a
We got a service

My dad’s powerful voice echoed in after the nearby reading the miraculous stories of
bells, “Do you know that every time that disciples and other believers, she knew that
happens another angel gets their wings?” there was reason.
for that.

To me, an angel was the white fairy you Whether it is the other hundreds of peo-
saw in the pamphlets at church on Sun- ple she might help through research or the
days, my mom ... an angel? I just couldn’t independence, maturity and strength her
comprehend it. two children will soon develop: God knew
It was not until I was older that I began what He was doing.
to question why. Many have tried to con- Although my mom isn’t parading the
vince me, “It’s the way life is.” But I believe streets of Champaign with me this week-
there is a reason. end I know, in my heart, that there is noth-
It’s important in life to search for rea- ing in the whole world she would have rath-
son. You must look past all your childhood er been doing.
wishes and dreams and into your heart She’s with me in spirit, not just now, but
and soul. It’s a matter of what is, not what always. In some unique ways, that may
could have been. make me the luckiest girl in the world.
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
9

>L<JK:FCLDE

L@XcldeXi\Õ\ZkjfegXjkXe[gi\j\ek
Moms Association promotes parent tative for the Moms Association, answering
questions for local parents about campus
and the college transition. In September
director of the Illini Union, updates us at
every meeting about what’s happening on
campus. Our Parent Programs Manager,

involvement, volunteer opportunities 2008, when our second daughter moved


to campus, I joined the Moms Association
Board of Directors. The Moms Board is
Becki Galardy, keeps our Association goal-
directed and running smoothly, with her
focused approach and friendly demeanor.
for mothers who have enjoyed being Den My personal favorite volunteer event is
9P9I<E;8:I8@>$:?<IM<EP As we parked near the Quad, Dave men- Mothers, Scout Leaders, and members of Summer Registration. The Moms and Dads
:FEKI@9LK@E>NI@K<I tioned how appropriate it was to honor PTO. It is also for those who never had Associations use this occasion to speak to

@
t was a cold, wet day in the fall semester Bogie with this burial location. We hid time to be involved, but have the time now. new Illini parents about the student transi-
of 1981. It had not been raining, but the under a tree next to a bench and dug a hole. It is for moms who like to meet other wom- tion to college. Meeting the enthused new
air held the dampness of many fall days. With a few words about the life of an Illini en who have common experiences regard- students and their intrigued parents is
The phone rang and Dave gave me the bad guinea pig who lived and died on campus, ing their children. The Association is for energizing and inspiring. I also take this
news, Bogie had died. we said our final good-byes to Bogie. With mothers who want an excuse to visit their opportunity to relive college days. Because
“Do you want to go with me to bury him the metal spoon, we scratched a cross on children on campus and to contribute in we work consecutive days, I am able to
on the Quad?” he asked. the back of the concrete bench, which sur- monumental ways to the well-being of their stay at Sherman Hall with my college
“Do you have anything to dig with?” Liv- prisingly would be visible after almost 30 offspring as young adults, students and roommate, who is also an Illini parent.
ing in the Armory House, with close-knit years. Over the years of family visits to leaders. It is for parents who like to net- Some thirty years ago, I made a mark
relationships with the hall staff, I contacted campus, the cross has marked a connection work, influence, guide and support. on a concrete bench, which left visible evi-
the RA who had a key to the kitchen. Find- of my past, to my children’s future. I love being on the Moms Association dence of my connection to campus as a stu-
ing a large metal spoon, Dave picked me up, Fast forward to 2010, and three of my Board. We have only four meetings a year, dent. Today, in a much more crucial and
toting Bogie in a brown paper bag. It was a four daughters are now attending Univer- but there are many other opportunities to significant manner, I continue to connect
sad occasion. Bogie had brought us much joy. sity of Illinois. As their mother, I have a represent the organization on campus. I with the University of Illinois as a parent
While chatting over beers and the tunes of new opportunity to connect with campus, learn something new about the Universi- and a member of the Moms Association
the ‘80s, Bogie would skitter across the liv- and with my children. I didn’t have to look ty of Illinois at every meeting and event I Board. I encourage all mothers who under-
ing room carpet, reminding us of the real far for a way to get involved. The Parent’s attend. I’ve heard Barbara O’Connor, our stand the intrinsic benefits of volunteer
world out there. The real world had pets, and Association had a table at Summer Regis- impressive Campus Police Chief, speak work, to get involved in the Moms Asso-
babies, and the elderly. But we lived on the tration, and my husband and I signed up. several times about the improvements ciation (www.uofiparentprograms.illinois.
island of the university, where common day That first fall, we worked the Move-In Day for campus safety. I’ve listened to Esther edu).
realities weren’t apparent. Dave was a metic- Picnic, handing out boxed lunches. We Patt, our knowledgeable and entertaining
ulous type, so Bogie’s tank never smelled of met many other Illini parents and had fun Director of the Tenant Union, talk about 9p9i\e[X:iX`^$:_\im\epC8J#(0/+ %9i\e[XXe[
the matted mulch that some rodents create. swapping stories about our children and the “Dos and Don’ts” of campus apartment _\i_ljYXe[Xi\Yfk_Xclde`f]k_\Le`m\ij`kpXe[
Bogie was our friend. our day. I also became a County Represen- rentals. Ed Slazinik, our down-to-earth k_i\\f]_\i[Xl^_k\ijXi\jkl[\ekjXkL@kf[Xp%

GOOD
TIMES
POURED
NIGHTLY
MARTINI FLIGHTS
ULTRAPREMIUM COCKTAILS
ECLECTIC WINE LIST

Located in the iHotel | 1902 S. First St. | 217.819.5005 | houlihans.com


©2009 Houlihan’s Restaurants, Inc.
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
10

DfdjN\\b\e[
:8C<E;8IF=<M<EKJ
=i`[Xp#8gi`c(-
Gc\Xj\efk\k_Xkjfd\\m\ekjfZZlidlck`$
f]Zi\Xk`m\XZk`m`kpÕfli`j_`e^`efli
Zfddle`kp#Yi`e^`e^kf^\k_\icfZXc
k_\=cfiXc;\j`^e:clYËjZfdg\k`k`fe
n_\i\pfln`cc_Xm\k_\fggfikle`kp
gifm`[\[%IJMGkfD`Z_\cc\Dfi]\pXk
)(.$***$/*)+fiddfi]\p7`ccc`ef`j%
9Xj\YXcc>Xd\1@cc`ef`jmj%
D`Z_`^Xe
Xik`jkj#Ylj`e\jj\j#Xe[fi^Xe`qXk`fej kf[\j`^eX:fek\dgfiXip$k_\d\[ \[l%Gi\$I\^`jkiXk`fe`ji\hl\jk\[2c`d`k
gc\[Xk\jk_ifl^_flkk_\n\\b\e[% kfgifdfk\k_\Xikk_Xkc`m\j_\i\% fiGXikp&:lckliXcKiX[`k`fej$k_\d\[ f],'gXik`Z`gXekj% =i`[Xps-g%d%
Dfi\k_XeXkiX[`k`feXcXikjnXcb# XiiXe^\d\ek%8ccÕfn\ijXe[mXj\j D<<K8KK?<<EK<GI@J<NFIBJ@E:L98KFI8K-'
k_\9fe\pXi[`jXle`hl\Zflekpn`[\ n`ccY\gifm`[\[%Fe\[\j`^e$/#knf ?8Q<CNFF;;I@M<#:?8DG8@>E#@C K`Zb\kGi`Z\j1Jkl[\ek$)2=XZlckp&
]\jk`mXck_XkkXb\jgcXZ\`efm\i [\j`^ej$(,%PfldXpYi`e^pflifne JkX]]$+28[lck$,
<ogcfi\@cc`ef`j (''m\el\j#`eZcl[`e^kiX[`k`feXc ZfekX`e\iYlkk_\pn`ccXcjfY\gifm`[\[ @cc`e`Le`feI\ZIffdËjDfdj @CC@EF@J=@<C;
=i`[Xps,1*'$.1*'g%d% ZX]\j#^Xcc\i`\jdlj\ldj Xe[ ]fi%,'$*\XZ_%
N\\b\e[;`ee\iXe[9fnc`e^ @cc`e`Le`feJkl[\ek9fXi[
<ogcfi\@cc`ef`j`jXe`ek\iXZk`m\ efe$kiX[`k`feXccXnf]ÔZ\j#\dgkp
\og\i`\eZ\k_Xk_`^_c`^_kjk_\ jkfi\]ifekjÕfn\ij_fgj %@k]\Xkli\j 8e8]k\ieffe9i\Xbn&k_\ Jg\Z`Xc Gi\j\ekj1>lpj;fccj
k_\nfibf]_le[i\[jf]Xik`jkj%
XdXq`e^i\j\XiZ_#gif^iXdjXe[
;\gXikd\ekf]=ff[JZ`\eZ\ =i`[Xps+$-1*'g%d%
g\fgc\k_XkdXb\lgk_\Le`m\ij`kp =fidfi\`e]fidXk`fe#m`j`k =i`[Xps.g%d%
f]@cc`ef`jZfddle`kp%@eX[[`k`fekf nnn%+'efik_%fi^
@E=F9FFK?N@CC9<8K-(-<8JK>I<<EFE=I@;8P#
Xe[?ldXeElki`k`fe *,]fi)g\fgc\@eZcl[\jfe\_fli
f]Yfnc`e^#j_f\i\ekXc#]flekX`e[i`ebj# K`Zb\kj^ffejXc\=\YilXip(#)'('%
`ek\iXZk`m\\o_`Y`kj#jkl[\ek^iflgjn`cc
gifm`[\\ek\ikX`ed\ek`e,$('d`elk\
8GI@C(-K?=IFD+1''G%D%$.1*'G%D%D8GJ8E; =i`[Xps*1*'g%d% Xe[)cXi^\g`\Z\jf]g`qqX]ifdJYXiif Fi[\iYpg_fe\Xk)(. ***$,'''%
FK?<I@E=FN@CC9<8M8@C89C<=FIM@J@KFIJ%% K`Zb\kjdXpXcjfY\gliZ_Xj\[Xk
g\i]fidXeZ\jk_ifl^_flkk_\\m\e`e^% K`Zb\kj1(,g\ig\ijfe 8[[`k`feXcYfnc\ijfek_\jXd\cXe\
k_\8jj\dYcp?Xcck`Zb\kf]ÔZ\fi
$(']fig`qqX#[i`ebj#Xe[j_f\j
K_\Dfdj8jjfZ`Xk`fen`ccXeefleZ\ ;XeZ\]fiGXib`ejfeËj;`j\Xj\ I\^`jkiXk`feY\^XeDXiZ_(Xk I\j\imXk`fejgi\]\ii\[#Ylkefk XkK`Zb\k:\ekiXc`ek_\@cc`e`Le`fe%
k_\)'('Dfdf]k_\P\Xii\Z`g`\ek
Xe[i\Zf^e`q\k_`jp\XiËjD\[Xcc`fef] =i`[Xps('X%d% _kkgj1&&\Zfdd\iZ\%XZ\j%`cc`ef`j%\[l& i\hl`i\[fec`e\Xk1`li\Ziffd7`cc`ef`j% K`Zb\kgi`Z\jXi\c`jk\[Y\cfn1
\[l 8cci\j\imXk`feji\hl`i\gi\$ J\Zk`fe8$(-&(+]fiLf]@
?fefiXe[@cc`e`Jg`i`k8nXi[n`ee\ij% :fjk1=i\\ dfdjn\\b\e[& gXpd\ek%I\^`jkiXk`fefg\ejDXiZ_/% jkl[\ekj
I\]i\j_d\ekj#Xgg\k`q\ij#Xe[[\jj\ikj 8kk\e[\\jn`cc\eafpXeX]k\ieffe J\Zk`fe9$(+&()]fiLf]@
n`ccY\j\im\[% K_`jnfibj_fg#fi`^`eXk\[Ypk_\ I<:IFFD#@CC@E@LE@FE
DXibDfii`j;XeZ\>iflgXe[k_\ f]elki`k`feXc`e]fidXk`feXe[@cc`ef`j jkl[\ekj
@]pflgcXekfXkk\e[gc\Xj\ n`e\\[lZXk`fe%9iX[c\p9\Xd#DJ#n`cc J\Zk`fe:$()&(']fiLf]@
9iffbcpeGXib`ejfe>iflg#n`ccgifm`[\
I<>@JK<I]fi<ogcfi\@cc`ef`j?<I<%
jpdgkfdi\c`\]]figXk`\ekjn`k_ ^l`[\gXik`Z`gXekj`ejXdgc`e^j\m\iXc GX^\j]fiG\ee`\j9ffbJXc\ jkl[\ekj
@CC@E@LE@FEJFLK?CFLE><8E;@CC@E@IFFDJ8#
GXib`ejfeËj[`j\Xj\Xe[]fZlj\jfe @cc`ef`jn`e\j%>l\jkjn`cck_\eZ_ffj\ =i`[Xps+$/g%d% Jg\Z`XcF]]\i1K_\i\`jX)&k`Zb\k
9: `dgifm`e^dfY`c`kp#Õ\o`Y`c`kp#YXcXeZ\# Xn`e\kf\eafpn`k_Yi\X[#Z_\\j\# Dfi\`e]fidXk`fen`ccY\XmX`cXYc\Xk [`jZflek]fi^iflgjf]('fidfi\%
iXe^\f]dfk`fe#dff[#Xe[fm\iXcc Xe[Xgg\k`q\ijXdgc`e^j]ifdk_\ _kkg1&&nnn%Yffbj)gi`jfe\ij%fi^&% =fidfi\`e]fidXk`fe#ZXcck_\@L9
Dfdj8jjfZ`Xk`fe@e]f9ffk_ hlXc`kpf]c`]\% 9\m`\i:X]„#Xjkl[\ek$ilefg\iXk`fe
XjjfZ`Xk\[n`k_k_\?fjg`kXc`kp
@E;<G<E;<EKD<;@8:<EK<I#;FNEKFNELI98E8
f]ÔZ\Xk)(. ***$*--'fi\$dX`c
c\n`j[7`cc`ef`j%\[l%
:Xi\^`m\ijXe[]i`\e[jf]gXk`\ekj GFJKF==@:<#)')J%9IF8;N8P#LI98E8
=i`[Xps*Æ,g%d% Xi\n\cZfd\kfaf`e`ek_`j]i\\ DXeX^\d\ekXe[;`\k\k`Zjgif^iXdj%
8JJ<D9CP?8CC
Efk\1Jf]k[i`ebjn`ccY\XmX`cXYc\]fi
EFIK?CFLE><#@CC@E@LE@FE
dfm\d\ekj\jj`fen`k_c`m\dlj`Zc\[
YpDXi`Xee\AXim`Xe[BXk\Blg\if] k_fj\n_fXi\efkf]c\^Xc[i`eb`e^X^\% ;`ee\iXkK_\Jg`Z\9fo
;XeZ\#Xe[XZZfdgXe`d\ekYp9\m\icp 9<M@<I:8=< =i`[XpsI\j\imXk`fejXmX`cXYc\ 8E`^_kf]k_\8ikj?fjk\[
:XdgljI\Zi\Xk`fe=XZ`c`k`\j ?`ccd\iXk@cc`ef`j% Y\kn\\e,Xe[.1*'g%d% YpM\cfZ`kp;XeZ\
=i`[Xps8cc[Xp Jlggfik\[Yp1DXibDfii`j;XeZ\
>iflg#Le`kpGXib`ejfeËj;`j\Xj\
Kflif]L@I\j\XiZ_GXib K_\Jg`Z\9fo`jXjkl[\ek$ =i`[Xps.g%d%
Dfdj^\k`e=I<<kfXep:Xdglj Jlggfik>iflg#:Xic\:c`e`Z#;XeZ\Xk =i`[Xps*1*'$+1*'g%d% ilei\jkXliXekXjjfZ`Xk\[n`k_
:fd\flkkfXe`^_kf][XeZ\
I\Zi\Xk`fe]XZ`c`kpn_\eXZZfdgXe`\[ @cc`ef`j#Xe[BiXee\ik:\ek\i% k_\Le`m\ij`kpf]@cc`ef`jLiYXeX$
K_\I\j\XiZ_GXibXkk_\Le`m\ij`kp :_XdgX`^eËj?fjg`kXc`kpDXeX^\d\ek Xe[dlj`Zj_fnZXj`e^XmXi`\kpf]
Ypk_\`i@cc`ef`jjkl[\ek% ;I8D8I<?<8IJ8CIFFDC<M<C) f]@cc`ef`jgifm`[\jXe\em`ifed\ek gif^iXd%K_\d\Xc_XjY\\ej\c\Zk\[ jkpc\j`eZcl[`e^AXqq#?`g$_fg#KXg#
:_\Zbk_\:XdgljI\Zi\Xk`feN\Y n_\i\k\Z_efcf^p$YXj\[Ylj`e\jj\j Ypj\e`fi_fjg`kXc`kpjkl[\ek#DXik\\ Df[\ieXe[dfi\%K_\i\n`ccXcjf
j`k\]fi_flijXe[XZk`m`k`\j
DfdjN\\b\e[=cfiXc;\j`^e
8I:#:I:<8E;@:<8I<E8
ZXenfibn`k_]XZlckpXe[jkl[\ekjfe =`jZ_dXe1ÈDpd\Xc#Ê8e<m\e`e^Xkk_\ Y\8:Xg\ccXj`e^`e^`eXmXi`\kpf]
ZfccXYfiXk`m\i\j\XiZ_%K_\I\j\XiZ_ ^\ei\j%G\i]fid`e^^iflgj`eZcl[\1
:fdg\k`k`fe GXib`j_fd\kf.'ZfdgXe`\jXe[
>iXe[?fk\cË]\Xkli\jXZfdY`eXk`fef]
M\cfZ`kp;XeZ\#Kfo`ZDfk`fe;XeZ\
kiX[`k`feXcefik_\ieD`Z_`^XeZl`j`e\
8eelXc9fe\pXi[8ikj=\jk`mXc =i`[Xps)$-g%d% ^ifn`e^#\dgcfp`e^fm\i(#+'' Xe[k_\\c\^XeZ\Xe[fc[$nfic[]\\c :fdgXep#EfJki`e^j8kkXZ_\[#Xe[
=i`[Xps8cc[Xp g\fgc\`e_`^_$k\Z_efcf^pZXi\\ij% f]DXZb`eXZ@jcXe[Xe[k_\>iXe[ :_Xe[Xe`%K_`j`jX^i\XknXpkf
È;\j`^ej]ifd8ifle[k_\Nfic[É# K_\I\j\XiZ_GXib`jXcjf_fd\kf ?fk\c%É=fidfi\`e]fidXk`fe#m`j`k jg\e[=i`[Xpe`^_kn`k_pfliDfd
Gi\j\ek\[XeelXccpYp+'Efik_ _fjk\[Ypk_\L@L:=cfiXc;\j`^e:clY *'jkXiklgZfdgXe`\j%=i\\GXib`e^ n_`c\\eafp`e^k_\XikjXkLf]@%
s//N\jk#k_\9fe\pXi[`jX+$[Xp Cffb`e^]fiXnXpkfj_fnZXj\ nnn%jg`Z\Yfo%l`lZ%\[l%I\j\imXk`fej
`jXmX`cXYc\2c`^_ki\]i\j_d\ekjn`ccY\ i\hl`i\[Xk)(.$***$-,)'% 8[d`jj`fe1=i\\]fi@$ZXi[?fc[\ij&
]\jk`mXcj_fnZXj`e^k_\YifX[iXe^\ pfliÕfiXc[\j`^ejb`ccj6:fd\kf

Your story.
Your school.
Your style. MOM’S DAY WEEKEND
Enjoy Your Mom’s Company
at Kennedy’s
Fri. & Sat. Nights 4p-10p
Experience our extensive Dinner and
SEE US AT FOLLET’S BOOKSTORE American Bistro Menu

SAT · SUN − APRIL 17TH · 18TH · 11AM-4PM Sat. & Sun. 11a-1:30 p 2560 Stonecreek Blvd, Urbana 217.384.8111
JOSTENS.COM/COLLEGE · 1-800-854-7464 Enjoy our Mom’s Day Buffet only $18 See our menus at kennedysstonecreek.com
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
11

,]fiefe$L@L:jkl[\ekj N\cZfd\kfZXdglj#dfdj
Af`elj]fiX]i\\ZXk\i\[YileZ_
>I<>FIP?8CCK?<8K<I
Ê?fik`Zlckli\8ifle[k_\Nfic[Ë%
8ccgcXekXe[^Xi[\e[\ZfiXk`fej
9Xj\YXcc>Xd\1@cc`ef`jmj% :XdgljI\Zi\Xk`fe
Xe[\ek\ikX`ed\ekXkk_\Nfd\eËj n`ccY\]fijXc\% D`Z_`^Xe =XZ`c`k`\j
=i`[XpE`^_kC`m\n`k_@cc`e` I\jfliZ\j:\ek\i%N\n`ccY\
]\Xkli`e^jfd\c`m\dlj`ZXc
LF=@JKF:BG8M@C@FE
JXkli[Xps*g%d%sXk@cc`ef`j=`\c[ Jle[Xps8cc[Xp
:_XYX[ \ek\ikX`ed\ekXe[f]]\iXe @cc`e`Le`feI\ZIffdËj K`Zb\kGi`Z\j1Jkl[\ek$)2 Dfdj^\k`e=I<<kfXep
fggfikle`kpkfm`\nk_\Xiknfib =XZlckp&JkX]]$+28[lck$, :XdgljI\Zi\Xk`fe]XZ`c`kpn_\e
=i`[Xps.1*'g%d% `efli?\Xc`e^Nfibj\o_`Y`k`fe#X DfdjN\\b\e[JZfkZ_ XZZfdgXe`\[Ypk_\`i@cc`ef`j
:fd\flkXe[af`ek_\dXep jkl[\ek%
gXi\ekj#jkl[\ekjXe[\ok\e[\[
dlck`$d\[`XZfcc\Zk`fef]Xiknfib
XYflk^\e[\iXe[`kji\cXk`fej_`gkf
;flYc\j/$YXccKflieXd\ek L@9cXZb:_filjDfdËj;Xp 8I:#:I:<8E;@:<8I<E8
A\n`j_Zfddle`kpfeZXdgljXkk_\ m`fc\eZ\Xe[_\Xc`e^gXik`ZlcXicp JXkli[Xps((X%d% :feZ\ik
n\\bcp=i`[XpE`^_kC`m\#X]lccZflij\ ]ifdj\olXcXjjXlck %N\n`ccXcjf
[`ee\i`e_fefif]k_\J_XYYXk%K_`j Y\jZi\\e`e^k_\9\jk=`cdj\c\Zk`fe
,\ekip]\\]fik\Xdf])
gXi\ek&jkl[\ek
JXkli[Xps.1*'gd ÈIXZ\k_\Iff]É,Bile&
n\\bk_\[`ee\i`j`e_fefif]pfl$ ]ifdfliÔijkXeelXc=`m\D`elk\ J`e^c\\c`d`eXk`fe2/$YXcc2 Af`ek_`jflkjkXe[`e^+($p\Xi nXcb
k_\gXi\ekj% =\d`e`jk=`cd=\jk`mXcN\_fg\pflËcc fc[\ej\dYc\Zfe[lZk\[YpFcc`\
]fidfi\`e]fidXk`fe\dX`ciXYY`7 Zfd\j_Xi\Xd\Xcn`k_ljXe[^\kkf
gXike\ijXck\ieXk\j_fkj
NXkkj;Xm`j]fik_\`iXeelXcDfdj
Jle[Xps('X%d%s:ipjkXcCXb\
Gi`q\j]fi(jk)e[gcXZ\j
`c`ef`j%\[lfiZXccflif]ÔZ\Xk)(.*,, befnk_\Nfd\eËjI\jfliZ\j:\ek\i ,'&), N\\b\e[g\i]fidXeZ\% GXib
/-.)%nnn%a\n`j_`cc`e`%fi^ feZXdgljXjXle`m\ij`kpÈ_fd\ =f\cc`e^\i>i\Xk?Xcc
CF:8K<;@EI<:IFFD#@CC@E@LE@FE J`^elg]fi?XY`kXk]fi
Jn`e^JfZ`\kp XnXp]ifd_fd\É :fjk1((&('J\e`fi:`k`q\e&/ ?ldXe`kpËjk\ek_XeelXcÈIXZ\k_\
Af`elj]fiXe`^_kf]Jn`e^[XeZ`e^ IJMGkfdfdj[XpYileZ_7^dX`c% Jkl[\ek Iff]É,Bile&nXcbfeJle[Xp#8gi`c
n`k_9cl\j@ZfeB`dDXjj`\Xkk_\ Zfdn`k_pflieXd\Xe[_fndXep @cc`ef`jNfd\eËjK\ee`j (/k_K_\iXZ\n`ccY\^`eXk('Xd
:flikpXi[:X]\`ek_\@cc`e`Le`fe% ^l\jkjpfln`ccY\Yi`e^`e^%
/$0gd$9\^`ee\i@ejkilZk`fe NFD<EËJI<JFLI:<J:<EK<I.'*J%NI@>?KJK#
DXkZ_ DfdjN\\b\e[:fd\[p Xe[n`ccY\_\c[Xk:ipjkXcCXb\
GXib%I\^`jk\ifec`e\Xk_kkg1&&nnn%
0gd$()Xd$C`m\YXe[Xe[[XeZ\ )E;=CFFI#:?8DG8@>E#@C$89FM<K?<=I<<JK8I
=i\\]fiLf]@jkl[\ekjXe[Dfdj#
98EB
8[d`jj`fe`j=I<< J_fn l`lZ_XY`kXk%fi^#fifej`k\k_\[Xp
J8KLI;8Ps()EFFEs8KB8?EFLK;FFI
(,^\e\iXcglYc`Z K<EE@J:FDGC<O
JXkli[Xps0gds@cc`e`Le`fe f]k_\\m\ek%I\^`jkiXk`fe`jfecp
(,g\igXik`Z`gXekXe[XccgifZ\\[j
:?898;:<EK<I=FIA<N@J?C@=<#,'0JFLK?
=FLIK?JK#:?8DG8@>E#@CC@EF@J-(/)'
8eelXc9fe\pXi[8ikj 9Xcciffd n`cc^fkfk_\L@L:ZXdgljZ_Xgk\i
=\jk`mXc DZB`ec\pI\cXoXk`feIffd Cffb`e^]fi\m\e`e^\ek\ikX`ed\ek f]?XY`kXk]fi?ldXe`kp%:fekXZk
Af_eajZ_e\)'7`cc`ef`j%\[l n`k_
@Z\8i\eXGlYc`ZJbXk\ JXkli[Xps8cc[Xp Xkk_\F8J@J ]fipfli]Xd`cp6M`j`kk_\Dfdj
N\\b\e[:fd\[pJ_fn#]\Xkli`e^ hl\jk`fej%
=i`[Xps.1*'$01*'g%d% Gi\j\ek\[XeelXccpYp+'Efik_ JXkli[Xps()g%d%$-g%d% Zfd\[`XeKfddpAf_eX^`e%<eafp_fi :IPJK8CC8B<G8IBCF:8K<;8KG8IBJK%8E;
s//N\jk#k_\9fe\pXi[`jX+$[Xp [Ëf\lim\j#ÈdfZbkX`cjÉ#Xe[X^ff[ 9IF8;N8P8M<%@ELI98E8
DfdjjbXk\]fi]i\\% ]\jk`mXcj_fnZXj`e^k_\YifX[iXe^\ F8J@J#@EK?<@CC@E@LE@FE#IFFD+'
cXl^_n`k_pfliDfd:fjk`jK9;%
@:<8I<E8 f]Zi\Xk`m\XZk`m`kpÕfli`j_`e^`efli GX^\j]fiG\ee`\j9ffb
JXkli[Xp#8gi`c(. Zfddle`kp#Yi`e^`e^kf^\k_\icfZXc
Xik`jkj#Ylj`e\jj\j#Xe[fi^Xe`qXk`fej
@cc`e`Le`feI\ZIffdËj
DfdjN\\b\e[N``K\ee`j Jle[Xp#8gi`c(/ JXc\
kfgifdfk\k_\Xikk_Xkc`m\j_\i\% Jle[Xps('X%d%$)g%d%
Dfdj8jjfZ`Xk`fe8eelXc Dfi\k_XeXkiX[`k`feXcXikjnXcb#
k_\9fe\pXi[`jXle`hl\Zflekpn`[\
KflieXd\ek 8eelXc9fe\pXi[8ikj Dfi\`e]fidXk`fen`ccY\
D\\k`e^ JXkli[Xps(g%d% XmX`cXYc\Xk_kkg1&&nnn%
]\jk`mXck_XkkXb\jgcXZ\`efm\i
(''m\el\j#`eZcl[`e^kiX[`k`feXc
=\jk`mXc Yffbj)gi`jfe\ij%fi^&%
JXkli[Xps01''X%d% ZX]\j#^Xcc\i`\jdlj\ldj Xe[
CfZXk\[`eI\ZIffd#@cc`e`Le`fe
Jle[Xps8cc[Xp K?<@E;<G<E;<EKD<;@8:<EK<I#;FNEKFNE
,\ekip]\\]fik\Xdf]) LI98E8GFJKF==@:<#)')J9IF8;N8P#LI98E8
@CC@E@LE@FEIFFD)('
efe$kiX[`k`feXccXnf]ÔZ\j#\dgkp gXi\ek&jkl[\ek Gi\j\ek\[XeelXccpYp+'Efik_
jkfi\]ifekj]cfn\ij_fgj %@k J`e^c\\c`d`eXk`fe s//N\jk#k_\9fe\pXi[`jX+$[Xp
]\Xkli\jk_\nfibf]_le[i\[jf] Gi`q\j]fi(jk)e[gcXZ\ ]\jk`mXcj_fnZXj`e^k_\YifX[iXe^\ K_\,,k_8eelXc
@L9DfdËj;Xp:iX]k=X`i Xik`jkj% ,'&), f]Zi\Xk`m\XZk`m`kp]cfli`j_`e^`e ?fik`Zlckli\:clY
JXkli[Xps('X%d%Æ,g%d% =fidfi\`e]fidXk`fe#m`j`k fliZfddle`kp#Yi`e^`e^kf^\k_\i
nnn%+'efik_%fi^ DfdËj;Xp=cfn\iJ_fn
:fd\Z_\Zbflkk_\Dfdj 8eelXcDfdËj;Xp:feZ\ik cfZXcXik`jkj#Ylj`e\jj\j#Xe[
fi^Xe`qXk`fejkfgifdfk\k_\Xik È?fik`Zlckli\8ifle[k_\
8jjfZXk`feZiX]kYffk_kfj\\k_\
j\c\Zk`fef]@cc`ef`ja\n\cipXe[ K_\,,k_8eelXc n`k_k_\L@Nfd\eËj>c\\ k_Xkc`m\j_\i\% Nfic[É
fieXd\ekj ?fik`Zlckli\:clY :clY Dfi\k_XeXkiX[`k`feXcXikj
nXcb#k_\9fe\pXi[`jXle`hl\ Jle[Xps('X%d%$)1*'g%d%
@CC@E@LE@FE DfdËj;Xp=cfn\iJ_fn JXkli[Xps)g%d% Zflekpn`[\]\jk`mXck_XkkXb\j :fd\flkXe[\og\i`\eZ\
gcXZ\`efm\i(''m\el\j#`eZcl[`e^
È?fik`Zlckli\8ifle[k_\ Af`ek_\Nfd\eËj>c\\:clY
kiX[`k`feXcZX]\j#^Xcc\i`\j
^Xi[\ej[\j`^e\[Xe[ZfejkilZk\[
DfdËj;Xp9ileZ_Xkk_\ Nfic[É
Xe[jg\Z`Xc^l\jkj#`eZcl[`e^k_\
MXij`kpD\eËj>c\\:clY#]fik_`j dlj\ldj Xe[efe$kiX[`k`feXccXn
Ypjkl[\ekjk_Xkj_fnZXj\
Ê?fik`Zlckli\8ifle[k_\Nfic[Ë%
Nfd\eËjI\jfliZ\j:\ek\i JXkli[Xps0X%d%$,g%d% XeelXcZfeZ\ikkfZ\c\YiXk\Dfdj f]]`Z\j#\dgkpjkfi\]ifekj]cfn\i
8ccgcXekXe[^Xi[\e[\ZfiXk`fej
JXkli[Xps('X%d%$effesNfd\eËj N\\b\e[% j_fgj %@k]\Xkli\jk_\nfibf] n`ccY\]fijXc\%
:fd\flkXe[\og\i`\eZ\ =f\cc`e^\i>i\Xk?Xcc _le[i\[jf]Xik`jkj%
I\jfliZ\:\ek\i#.'*J%Ni`^_kJk% ^Xi[\ej[\j`^e\[Xe[ZfejkilZk\[ :fjk1('&.J\e`fi:`k`q\e&+ =fidfi\`e]fidXk`fe#m`j`k
LF=@JKF:BG8M@C@FE

)e[Õffi%IJMGI\hl`i\[ Ypjkl[\ekjk_Xkj_fnZXj\ Jkl[\ek nnn%+'efik_%fi^

Move to the head of the class,


bring Mom to Alto Vineyards!
<ok\e[\[?flij8gi`c(/k_('Xd$/gd

+)('E%;leZXeI[%#:_XdgX`^e
(%,d`c\jEfik_f]9cffd`e^kfeI[%fe;leZXe
Kl\$K_li()$-›=i`()$.›JXk('$/›Jle()$,
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
12


        




     
    

QTKIKPUTGPGYGF  
9jlakYfk[j]Ylaf_gmjnaf]%l`]e]\hdYfl]j
mk][]jYea[kkcaddkhYkk]\l`jgm_`_]f]jYlagfk$
kcaddkl`Ylfgokmhhgjll`]aj^Yeada]kYf\[geemfala]k&



 
 
H]j[`af_:aj\kHdYfl]j
Na]lfYe$*0
)(-F&OYdfml$;`YehYa_f

        
     

     
   
EgfÇL`m$KYl)(Ç.$>ja )(Ç0
*)/%+-*%0*((
   !


 
[`YehYa_f&l]fl`gmkYf\naddY_]k&[ge

:jaf_afl`akY\lgK9N=)- gfqgmjf]plhmj[`Yk]&
G^^]jnYda\YlhYjla[ahYlaf_klgj]kmflad,'+(')(&FglnYda\oal`gl`]j\ak[gmflk$hmj[`Yk]g^_a^l[Yj\kgjGja]flYdjm_k& (-1(.)(

Welcome Illinois Moms


<YadqAddafaEgeÌk<YqO]]c]f\
L]fL`gmkYf\NaddY_]k;`YehYa_f
/&../p+&-
,;
Free Carnations and Chocolate!



 
 
  L]fL`gmkYf\NaddY_]k
H]jeakkagflgmk]l`akj]kgmj[]YkalYhh]Yjk& 9FQ9DL=J9LAGFKGJMK=
G>?J9H@A;=D=E=FLK YhYjl^jgel`ak\]ka_fEMKL:=9HHJGN=<
Zq L]fL`gmkYf\NaddY_]k9jl<aj][lgj$ /)/!0-1%0)((&

SALE
EVENT! 
ILLINOIS “MOM” T-SHIRTS  



Buy one, get one FREE!
ALL CAPS Buy one, get one 1/2 off !
3 FOR $10 Illinois Clearance T-shirts
50% off Select Nike tees  
Flowers and Chocolate while supplies last
Corner of 6th & Green Street, Campustown • (217) 328-7722 • www.gamedayspirit.com  
“OFFICIAL FAN STORE OF THE FIGHTING ILLINI” 

   
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
13

PFLIMF@:<

Jfec\Xiej]X`k_#
nfib\k_`Zk_ifl^_
dfk_\iËjk\XZ_`e^j
Relationship strong after son
goes to college, joins fraternity
9PK@DDL<CC<I school to the importance she placed on
:FEKI@9LK@E>NI@K<I my academic achievements. In fact, I

K
here is no doubt that most of our think she is the reason I am studying
relationships in life are constantly here at the University of Illinois in the
changing. We may have experienced first place.
a childhood playmate moving away or One thing my mom and I have always
our best friend from high school attend- shared is our faith in God. From a very
ing a different university. While these young age, my mom read me religious
relationships do not ever have to end, the stories or talked to me about church and
strength of our relationships may fluctu- God. We spent time together leading
ate based on the frequency of time spent our church youth group, and we have
together. There is one relationship, how- both spent time volunteering at our par-
ever, that has never wavered in my expe- ish as Sunday School teachers. Even
rience: my relationship with my mom. today we are constantly having conver-
Before I was even born my moth- sations about our religion and giving
er loved me enough to carry me in her each other books on the topic that we
womb for 8 months (Yes, I was a month find interesting.
premature). That is really a pretty phe- When I first left for college, it was an
nomenal thing if you take the time to entirely new experience to come home
think about it. As a young child, I remem- at night without ever seeing my mom,
ber loving spending time with my moth- but she encouraged me to embrace the
er, especially the time before bed when college life and enjoy my time here.
my mom would sit on my bed and read to Just as she did before I left for col-
me. I really looked forward to it because lege, my mom was always supportive of
I knew that I would always have that time whatever I decided to devote my time
to spend with her. I especially remember to. When I decided to run a half-mara-
looking forward to reading during the thon on campus last year, she would
Christmas season, as we both call it our call me to talk about my training and
favorite holiday. brought the whole family to Champaign
Throughout middle school and high to watch the actual race. She was even
school, my relationship with my mom supportive of my choice to join a frater-
blossomed into the friendship we still nity, which may seem strange to some
share today. She was always willing to mothers, given the negative stereotypes
help me study and learn as a young stu- some people choose to associate with
dent, and to this day is still willing to edit fraternities. My mom trusted that I was
essays for me. When I became involved making the right decision and now loves
in sports, she always made an effort to to see all the opportunities I have had
come watch me play, no matter how crazy because of my fraternity. Not only has
it made her schedule. When I began run- being involved with my fraternity (Pi
ning year round in high school, my mom Kappa Alpha) and the Interfraternity
traveled across Southern Illinois to my Council given me the chance to meet
cross country and track meets to make hundreds of other students I would have
sure she could cheer me on from the never met otherwise, but it has also
sidelines. provided me with the chance to take on
My mother has given me a number leadership roles and make a positive
of valuable pieces of advice. One thing impact on campus.
she has always taught me was to strive Throughout my life my mom has been
for perfection in the classroom. Being a more than just a mentor and a parent:
perfectionist herself, she pushed me to She has been one of my best friends.
stay focused on my schoolwork. Look- She has always been there to support
ing back on my academic history, it is me no matter what, and I thank God
easy to attribute earning the honors of every day that I was blessed with such a
valedictorian in grade school and high loving and caring mom.
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
14

:HOFRPH0RP
If you take your student out
or stay in partying, you need to know:
Gfb\dfedfk_\ij
!"#$%#&'(·)*+,&(-&('*)%.!&#/)
Supplies are unlimited, so purchase any quantity desired!

Possession /Consumption of Alcohol, < 21: $300 Min. Fine


ki\Xk\[le]X`icp#
Carrying open liquor out of premises: $155 Min. Fine

Fake ID (unlawful use of identi¿cation) : Up to $2,500 ¿ne


and/or 364 days in Jail AND loss of driving privileges for 12 mos.
j`d`cXikfi\Xcc`]\
Moms unappreciated by children
Driving Under the InÀuence of Alcohol : $300 Min. Fine,
2-yr loss of driving privileges PLUS new sanctions in 2009

** Searches through pockets, purses and wallets for additional


charges will be performed at of¿cers’ discretion**
she is happy as ever to see you.
And while you are at home visiting you
#!&" &
 JK<M<C<JE@<NJB@ rest up, probably raid the food cabinet
for peanut butter and jelly, and then you
#"''' %("' 8jj`jkXekn\Ygif[lZ\i
leave and are back on your journey.
STUDENT LEGAL SERVICE '"""#'&!&'%+#( Mom kind of gets the shaft because

9
eing the huge Pokemon fan that I although she wants to talk to you, she
www.odos.illinois.edu/sls #+#(%&'("'""#'(&'("' am, I bought Pokemon SoulSilver doesn’t really get a chance.
324 Illini Union  %)("' '"*'&!&'% the day it was released last month. But thanks to advances in technology,
The game play was nostalgic, bringing you can talk to your mom while on the
M-F, 8:30am-Noon, and 1-4:30pm '''&$ '("'&#"&( '#" back memories of my wasted youth in road.
PAID FOR BY S.O.R.F.  &&(&
#(&"#"&(!%& front of my beat up teal Game Boy Color. There are cell phones, mirroring the
As I have always thought the Gold/Silver mobile phone in Pokemon SoulSilver.
&(&'%,''&!(!#% versions of the Pokemon franchise to be Mom often calls you, telling you how
the best, it was exciting for me to replay much she is proud of you and everything
the silly quests and Bug Catching Con- you are doing. But, you tend to ignore
tests, but that is neither here nor there. what she is saying, wanting to get back to
The reason I bring whatever it is you were
up the Pokemon game
is the unique use of the Pflidfd`j^`m\eX doing before, and say,
“Thanks Mom. I am try-
player’s mom in the ing my best.”
Take your Mom out for fine Asian cuisine at series. k_Xebc\jjkXjbXe[j_\`j Then she sends you
Every game tends care packages, and
e\m\i\og\Zk`e^Xepk_`e^
GINGER ASIAN BISTRO to start off the same:
your mom tells you to
talk to the local pro- ]ifdpfl`ei\klie%9lk
has them sent express
delivery.
But, you rarely call
fessor in town, you get back and say ‘thanks’,
Phone: 217. 352. 6688 www.gingerab.com your Pokemon and then
you book out of your
[feËkpflk_`eb`k`jk`d\ granted, in the game,
she buys them with your
1902 center drive, champaign il 61820
acrossthestreetfrommarketplacemall
home town to start an
adventure.
pflj_flc[6Dfdj money.
In the game, and in
on neil street
Rarely do you go
back and tell good ol’
N\\b\e[`jXZ_XeZ\ life, your mom wants
to spend time with you,
EFN mom where you are
kfj_fndfdk_Xkpfl but she never gets to go
E :_`e\j\ going and that you may hang out with you on
FG < be gone for some time.
Xggi\Z`Xk\\m\ipk_`e^ your adventure. She is
Poor mom is just sit- always stuck at home,

AXgXe\j\
ting there, probably
thinking: “Oh my! I j_\_Xj[fe\]fipflXe[ working to fund your
adventure abroad.

;X`cp
hope Steve didn’t get
lost walking down the c\k_\i\og\i`\eZ\k_\ Your mom is given
a thankless task and
K_X` street. He is surely tak- she is never expect-
CleZ_ ing a long time; I hope aflie\ppflXi\_Xm`e^% ing anything from you
JG<:@8C he is alright.” in return. But don’t
Jlj_` While it is just a you think it is time you
$6.95 game, I can’t help but draw some simi-
larities between the Pokemon games’
should? Mom’s Weekend is a chance to
show mom that you appreciate every-
?`YXZ_` moms and how college students treat
their moms.
thing she has done for you and let her
experience the journey you are having.
Here is how it tends to play out in real It is a small token of gratitude that
life: Mom looks out for you and encour- really goes a long way.
ages you to go to college and be the best, Your mom will always love you, wheth-
like no one before ever was. You meet er you become a Pokemon Master, or not,
;I@EBJG<:@8CJ some professors that inspire you to go or if you are like me, still play Poke-
out across the land searching far and mon. So, go and make Moms Weekend an
M O N DAY T U E S DAY W E D N E S D AY T H U R S DAY F R I DAY wide for knowledge and experience, and opportunity to show your mom that you
$4 Premium $2 Wells $3 Wine $4 Cocktails $3 Infused you kind of forget about mom sitting love her too.
Martinis Sake there at home. I mean, sure you come
back and visit every once in awhile and Jk\m\`jXjfg_fdfi\`eD\[`X%
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
15

C`]\n`k_dfd`jaljkc`b\KM
Five things to do with mom this weekend to make her feel special
9PEFI8@9I8?@D ( <Xkjfd\Zffb`\j% is acquaint her to the campus so that the though she may not find the time to take
8JJ@JK8EKE<NJ<;@KFI next time I don’t pick up her 17 missed for herself on a regular basis, she and I
Those who know the Ibrahim girls Oatmeal, peanut butter or whoopie pie, calls or don’t reply to the six missed will put the age-old adage “walk it off”
know we are a close bunch. these delicacies can draw the attention of texts, she’ll remember I’ll probably call into fruition.
Like the Bennet family, the March any girl from any walk of life. her back after I’ve left the lecture hall.
sisters or the Gilmore Girls, we have This applies most especially to my mom
earned a reputation among our friends and I, connoisseurs of the culinary arts.
, ?Xm\XZlgf]Zf]]\\%
for having the greatest fondness for each Though, we both agree the sugary arts
* 9lpXYXkZ_f]Õfn\ij% It can be a cup of any form of caffeine,
other. are best. May I also suggest the Cookie Jar? Yes, these won’t be practical to haul really.
This Moms Weekend, however, my Quite the treat, if I do say so myself. around campus, and no, there probably And if not caffeine, we can make it hot
mom and I will abandon the rest of the won’t be a vase in the hotel room. chocolate. If not hot chocolate, make it
gang to conquer and explore Chambana. Still, this may be the sincerest way to milk.
This weekend, I’ll play the Kate Hud-
) NXcb_\ik_ifl^_dpZcXjjjZ_\[lc\% thank her for the many years of diaper Regardless of the beverage type, my
son to my mom’s Goldie Hawn, the Chel- No kidding, this may be the best thing changes she had to go through. It might mom and I often find ourselves chatting
sea to the Hillary Clinton, the Mary I ever do for my mom. be the only way to amend for the smell. into the depths of the night. As I have
Shelley to the Mary Wollstonecraft. There have been countless times Now that I think about, I’ll buy some learned, moms find real joy in talking to
And I couldn’t be more excited. where I couldn’t get home from work or a perfume, too. their kids in a conversational manner.
I have devised a to-do list for this friend’s place until well into the night. And nothing, and I mean nothing, can
weekend’s shenanigans. My sisters have since shared with me strike up more enthralling conversations
Feel free to take inspiration from this how, on these occasions, my mom is plas-
+ KXb\Xcfe^nXcb% than the ones shared over a cup of Joe.
and adapt it for your own Mom’s Week- tered to the phone and stalking the “cell Let’s admit it, moms don’t have it easy. So buckle your seat belt, Chambana,
end plans. phone-locater” Web site endlessly until From chauffeuring to cooking, bud- because my mom and I will be taking the
Keep in mind these tend to be mother- I call to reassure her I made it safely to get managing to tutoring, moms take town in storm. The Liza Minnelli to her
daughter oriented. my bed. on a myriad of jobs in the span of a day. Judy Garland, the Natasha Richardson to
The least I can do this Moms Weekend \y mom is certainly no exception. So, her Vanessa Redgrave.

Winery6 Art Gallery6 Gifts


SALE
Bring Mom out for a
relaxing visit tasting
20% off all Vera Bradley
locally produced wines. 4 Days Only
April 15 - April 18
Just 20 minutes from C-U!
Take I74 to exit 206 *We cannot
*We hold merchandise
cannot for the sale
hold merchandise for the sale
at Oakwood, IL .
Go south 3.5 miles.

Friday and Saturday, 10am - 6pm,


Extended Sale Hours!
Sunday noon - 5pm Thursday: 10-6  Friday: 10-5:30
Expanded hours starting in May:
Wednesday and Thursday, 10am - 6pm
Saturday: 10-6  Sunday 1-4
Friday and Saturday, 10am - 8pm,
Sunday noon - 5pm Old Farm Shops
1729 West Kirby Avenue,
217-733-0330 Champaign
www.sleepycreekvineyards.com
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
16

www.bodyworkassociates.com
L@8cldeXi\Õ\Zkj
$6T$IPJDFGPS
Serious Pain Relief
fegXjk\og\i`\eZ\j
Mom: ‘Some things never change’
Try a Precision Neuromuscular
Massage and get $5 off your
next visit!*
Now with 2 campus locations:
r*MMJOJ6OJPO0BTJT]6SCBOB
r"3$]$IBNQBJHO <[`kfiËjefk\1K_`jXik`Zc\fi`^`eXccpiXe`ek_\ was in Courtney’s apartment last year.
PSNJOVUFT&YQJSFT 8gi`c('#)''.`jjl\f]K_\;X`cp@cc`e`% I am absolutely sure it was the same
021709 BZ
carpeting.
9P8EEC@E<?8E However, some things have really
:FEKI@9LK@E>NI@K<I changed.
When I graduated from the University of When was that new Engineering Quad
 
 Illinois in May 1979, I wondered what the
world had in store for me.
built?
There were only a few buildings North
What exactly was I going to do with a of Green Street in May of 1979.
  degree in Human Resources and Family Ser-
vices from the College of Agriculture?
Some exciting things must have been
happening over there.

 I knew I had the right key to unlock a
great future. I had a degree from U of I
Many of my friends spent late nights key-
punching cards for their CS 105 classes.

  and the confidence that all would turn out
OK.
Now we all enjoy the fruits of their labor
in our Wi-Fi world each day.
It did. And now I return to celebrate The names of some favorite campus and
 
moms weekend at U of I for the eighth campustown buildings have changed, but
time. the activities that took place in the build-
My mom and I celebrated moms’ week- ings remain the same.
ends together - usually my dad came along My friends and I saw “Gone With the

    too - and I have kept the out-to-eat-and-
shopping tradition going with my daugh-
Wind” and “Tommy” at The Auditorium
(now called Foellinger) and attended Clas-
ter, Courtney. sical Civilization classes with Professor

 
 

 But things in Champaign have certainly Scanlon who packed the place with his the-
changed since I went to school here. atrical lecture.
I may be a bit biased, but I believe the Uni- What happened to “The” in Assembly
versity is a great place full of traditions. Hall? The drinking age was 19 and we went
My earliest memories are of my par- to T-Bird - now Canopy Club - for bucket
ents bringing me to Fighting Illini foot- night, Boni’s, Red Lion, Second Chance,
ball games. Mabel’s and White Horse on Fridays after
The beginning of my love of Illini foot- we watched “Dallas” on TV.
ball games was the fun of tailgating, and Every once in a while I will hear a Billy
the excitement of the band marching across Joel song and I just smile, remembering
the field before the game playing the state having so much fun with great friends.
song. Once I took a tour of The Plaster Cast
When I arrived as a freshman in 1975, I Museum that was in either Greg Hall or
joined the Block I and will admit that I was the English building.
“passed up” to the top of the west side. Why travel the world when one could see
Those football games are still loads of so many great works of art at Illinois?
fun and yes, I was the crazy mom in the I saw my fi rst performance of The Nut-
student section at the last home game this cracker at Krannert and gave my mom the
season dancing, cheering, singing the best gift ever when we attended a concert
fi ght songs and of course thrilled to see of opera singer Leyontyne Price.
the Chief. Uncle John’s Pancake House turned into
When Courtney paid her visit to the cam- Aunt Sonya’s and was recently demolished.
pus as a junior in high school, I walked What happened to the memorabilia?
down Wright Street with a group of people And I was a very proud alumna when the
I had never seen before in my life and pro- basketball team made it to the fi nal game
claimed to all “How could anyone want to of the NCAA playoffs two years ago.
go anyplace but here for college? This is Now I am waiting for the football team’s
the best university anywhere!” exciting season next fall.
Both Courtney and her 12-year-old sis- The University was founded to educate
ter, Cara, were shocked at my behavior. students from Illinois.
The memories were flowing. I was from the small town of Robinson
Some things never change, like the hike in the southern part of the state when I
from FAR to the Quad each day. Are the arrived in 1975; Courtney arrived as a grad-
green houses still there? I’m sure The Mor- uate of one of the largest high schools in
row Plots still stand, but what about the tun- the Chicago metropolitan area in 2003 yet
nel connecting the libraries? Do Psych 101 we both met people from all over the coun-
students still have to participate in “stud- try who have become fast friends that will
ies” to get credit for the class? Bevier Hall, last a lifetime.
the Child Development Lab and most of the One of the great things about U of I is
Quad buildings don’t look like they have students can be themselves. If the Greek
changed. (Please tell me they have been system is for you, great! If not, that’s great
updated and the asbestos removed). And the too!
apartments in Champaign! I believe I sat There are plenty of majors and friends
on the same couch when I was a junior that for all.
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
17

9\[iffdji\mXdg\[]fidfdj
Students anticipate parents’ arrival, clean to hide messy lifestyles
<[`kfiËjefk\1K_`jXik`Zc\fi`^`eXccpiXe`ek_\ make a good impression. she did not help her move in.
8gi`c/#)''/#DfdËjN\\b\e[<[`k`fe% Scott McAdam, senior in ACES, said he “She’s more excited probably,” Lang
doesn’t have much to do before his mom said.
9PJK<G?8E@<9<E?8IK
JK8==NI@K<I
arrives this weekend.
“Everything is in order,” he said.
Clean rooms are not the only issue some
students think about when preparing for K_\]i\\[fdXmX`cXYc\kf
Many mothers still might not see their
college-age children as adults.
On the other hand, Trevor Woodland,
junior in LAS, said his mom has not seen
mom’s visit; entertaining their moms on
this special weekend is also at the top of Zfcc\^\jkl[\ekj_\cgj
Instead, they see them as little boys who his room on a typical day, with things scat- the list of things to think about.
like to play in the mud or little girls who tered everywhere. Koelling said her mom planned an itin- kf\ogXe[_fi`qfej
still wear pigtails in their hair, both of Aside from putting away items his mom erary for their weekend together, and she
which might be true. might deem “inappropriate,” he added he will be getting tickets for various events Xe[kf^ifn#Ylkfk_\i
But college life is different from home would make sure his laundry is clean, fold- in the area.
life.
The freedom available to college stu-
ed and put away before his mom arrives
on campus.
“I’d prepare a tour of the University,”
said Brian Kim, junior in Business.
i\jgfej`Y`c`k`\j#jlZ_Xj
dents helps to expand horizons and to grow,
but other responsibilities, such as cleaning,
“I just don’t want anything lying around,”
he said.
Jesse Kappel, senior in LAS, said if stu-
dents are planning to take their moms out
Zc\Xe`e^#jfd\k`d\jk\e[
sometimes tend to go by the wayside with-
out mom saying “clean your room.”
Some students may want to show their
parents they are here doing what they
to dinner, they should be sure to make res-
ervations ahead of time.
kf^fYpk_\nXpj`[\
Before moms come to visit for Moms
Weekend, some students will overhaul their
are supposed to be doing: studying and
learning.
Wenyi Ying, freshman in LAS, said if
her mom were visiting, she would want to
n`k_flkdfdjXp`e^
rooms to prove to mom they can keep clean
while away from her watchful eye.
Jeff Lambert, junior in Engineering,
said he would put books out in his room
prepare a small gift for her.
Whatever students do, they will want to ÈZc\Xepfliiffd%É
Ashley Koelling, junior in Business, to show his mom he has working hard in spend quality time with their moms.
said her room is normally pretty clean, his studies. “I plan on doing stuff I couldn’t do at
but she’ll probably do “a little dusting and Jennifer Lang, junior in LAS, said she is home with her,” said Claire Brown, junior
vacuuming” before her mom arrives to excited for her mom to see her room since in LAS.

55th Annual Mom’s Day Flower & Garden Show


Theme: “Celebrating Horticulture Around the World”
April 17th & 18th
Saturday: 9am to 5pm
Sunday: 10am to 3pm
U of I Stock Pavilion ADMISSION IS FREE
1402 W. Pennsylvania Ave. Garden Displays
Urbana, IL 61801 Plants for Sale
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
18

Authentic Thai Cuisine with Smiles

WELCOME MOMS!
Mon-Fri 11am-3pm Mon-Fri 5pm-10pm
Sat 11am-10pm Sun 12-9pm

212 W. Main Street Downtown Urbana


We use vegetable oils and no MSG. (217) 367-THAI (8424) www.siamterrace.com

K?<;8@CP@CC@E@=@C<G?FKFJ
Jkl[\ekjj_flc[i\d`e[gXi\ekjkf[i\jjk_\`iX^\c\]k #efkkf`d`kXk\k_\]Xj_`fef]k_\Zfcc\^\
jkl[\ekjXifle[k_\d[li`e^DfdjN\\b\e[%

DfdjkfdXb\X]Xj_`fe
jkXk\d\ekk_`jn\\b\e[
<[`kfiËjefk\1K_`jXik`Zc\fi`^e`XccpiXe`ek_\8gi`c/# your mom try too hard.
)''/#DfdËjN\\b\e[>l`[\% “They should wear something where
they’re not trying to look young, but look
9P8E;PBN8CN8J<I their own age,” Desai said.
JK8==NI@K<I “If an older woman tries to pull off some-
Tell your mother to leave the neon green thing very trendy, it usually doesn’t work
poncho at home when she comes down for well.”
Moms Weekend. Desai said fabrics can be light, as long as
And that skimpy dress she found in your they are not transparent. Neutral is good.
closet? Neon is not.
Don’t let her wear that, either. “Anything that’s flamboyantly colored -
Every one of the moms heading to cam- stay away from that,” she said.
pus this weekend have the potential to wear Your mom might want to relive her own
something that will embarrass their Illini. college days. Don’t let her.
Don’t let it happen to you. Rebecca Lewis said her mother is com-
But how do you avoid a Moms Weekend ing down next week, after the Moms Week-
meltdown? end rush, but said she is not too concerned
“Encourage your mom to look hip and about the clothing question.
trendy, but don’t tell to her wear the same “It’s my mom and she can wear what-
things you wear,” said Pooja Desai, presi- ever she wants,” said Lewis, junior in
dent of Runway, a fashion RSO. Engineering.
“An 18-year-old girl and a 60-year-old “If someone doesn’t like it, that’s their
woman have different body types.” problem.”
Desai, junior in LAS, said mothers should In the end, keep your mom’s clothes
dress conservatively but comfortably. simple.
A knee-length dress and a cardigan Keep them comfortable and classy.
LE
might work. And if you plan on taking her to the bars,
It’s okay to be creative. Just don’t let just keep them on her.
K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd Kl\j[Xp#8gi`c(*#)'('
19

Dfk_\i#[Xl^_k\i# 8jn`dk_ifl^_Zlckli\j

efn>i\\bj`jk\ij
Friends are family in sororities
9P9IFFB<B<EE<;P people. Throughout the past four years, I
:FEKI@9LK@E>NI@K<I have found a group of women in this chap-
She is the picture of perfection: curly ter who will be there when I need a shoul-
brown hair, glowing green eyes and big der to cry on, a friend to laugh with, or a
dimples when she smiles. She is my moth- cheerleader in this crazy game called life.
er, Jeanne Kennedy. It makes me happy to know that my mom
In college, my mom was always the life is still best friends with many of her Sig-
of the party in her fashionable clothes and ma Kappa sisters. Her Sigma Kappa girl-
fi re-engine red nail polish. She was often friends have adopted me as their second
seen telling a tale that kept her friends in daughter. They are my friends, my men-
stitches for hours at a time. I am sometimes tors, my support system, and most impor-
the opposite: a quiet girl who would rather tantly, they are my sisters.
stay in and watch a movie than go out and Although being a member of Sigma Kap-
party. Even though we have very different pa has given me many things, one of the
personalities, my mom and I both found a things I am most grateful for is the spe-
home at Sigma Kappa. cial bond my mom and I now share. Even
As a college student, my mother founded though U of I is far from home, my mom
a Sigma Kappa chapter at Elmhurst Col- has been an important part of my college
lege and became their second President. experience. She has supported me in all
More importantly; however, both my moth- of my endeavors, especially in my leader- K?<;8@CP@CC@E@=@C<G?FKF
er and I have found a group of Sigma Kap- ship experiences within Sigma Kappa. My  e`m\ij`kpjkl[\ekjg\i]fidn`k_k_\@cc`e`JpeZ_ife`q\[Jn`d:clY[li`e^DfdjN\\b\e[`e)''-Xk
L
pa sisters who bring out the best in us. We mother is simply amazing and I hope that =i\\iGffc]fik_\`iXeelXcDfk_\iËjN\\b\e[G\i]fidXeZ\%K_\k_\d\f]k_\j_fnnXj#È@cc`e`JpeZ_if
found friends who help us become better I am too one day. Love you, Mom! >f\j>cfYXc#ÉXe[`k]\Xkli\[dlj`Z]ifdXccfm\ik_\nfic[%

THURSDAY
DOWNTOWN CHAMPAIGN April 15th
sponsored by the217.com

FRIDAY
U of I CAMPUS April 16th
sponsored by JSM MANAGEMENT
SATURDAY
DOWNTOWN URBANA April 17th
sponsored by the217.com

SUNDAY
OUT & ABOUT CHAMPAIGN CO. April 18th
Mahomet Sidney Rantoul Urbana-Champaign
Cruise the Bone-
yard with the guide
to the arts iPhone
app by OJCtech.

www.40north.org com. Download


now! Keyword
“40N” in the
ART: Grotto of Broken Dreams by Glen C. Davies AppStore.
POSTER + PHOTOGRAPHY: Kurt Bielema/singlestereo.com
Kl\j[Xp#8gi`c(*#)'(' K_\;X`cp@cc`e` s nnn%;X`cp@cc`e`%Zfd
20

MOMS WEEKEND
ONE DAY SALE PRICING
OPEN 9-11 ON SATURDAY WITH ALL DAY SPECIALS
GET A CLINIQUE GIFT WITH PURCHASE
USE A VISITOR PASS FOR EXTRA SAVINGS
(passes available at your local hotel or at the store)

EVENTS ALL DAY


FASHION SHOW AT 2:30
$250 GIFT CERTIFICATE GIVEAWAYS
(must be present to win)

96.1 LIVE RADIO REMOTE

ALSO LOOK FORWARD TO:


DIAMOND SHOW: featuring exclusive Iberjoya diamonds
ED HARDY FRAGRANCE: MEET THE NATIONAL EXPEXPERTS
Receive your free sample from 4-9 on Friday and 11-5 on Saturday
LEVI FIT CLINIC: ÀQG\RXUSHUIHFWSDLURIMHDQV
COPS FOR CANCER: fundraiser for Mills Breast Cancer Center
JESSICA SIMPSON, PARIS HILTON, QUEEN LATIFA
Receive your free sample from 10-5 on Saturday

Vous aimerez peut-être aussi