Vous êtes sur la page 1sur 30

MO B A FI R ENET WO R K

MOBAFIRE NETWORK

League of Legends Champion Guides

UTOPUS

CHAMPIONS

Builds & Guides

CREATE GUIDE

+0

MORE SITES

Database

LEAGUEOFLEGENDS

&LOLWIKI

Tournaments
LEAGUEOFLEGENDS

Community

LOLFORUMS&NEWS

Watch League
STREAMS&VIDEO

LEBLANCBUILDGUIDEBYOWENTHEAWESOMER

The Deciever - LeBlanc Guide


OwenTheAwesomerLastupdatedonFebruary6,2016
S+

BUILD GUIDE

UNFAV

REPORT

DISCUSSION (37)

702K

37

27

VIEWS

COMMENTS

VOTES

MORE LEBLANC GUIDES

CHEATSHEET

The Deciever - LeBlanc Guide


LEBLANC BUILD

QuintofAbility
Power

MarkofMagic
Penetration

SealofScaling
Health

GlyphofScaling
CDReduction

3x

9x

9x

9x
COMMUNITYCUPS

Hideitemnames

STARTING ITEMS

Upon review of probuilds, i noticed that there's like a 30/70 split on morellos
vs FQC. I'm surprised FQC
is not mentioned in your cheat
RUSH
FINISH
sheet though.



MARCH
1$



MARCH
(8:

REGISTER

x2
Doran'sRing

VIEWALLTOURNAMENTSONMOBAFIRE

HealthPotion

Morellonomico
n

CHOOSE ONE, THEN THE OTHER

Luden'sEcho

REGISTER

Bootsof
Speed

Needlessly
LargeRod

Rabadon's
Deathcap

LAST ITEM OPTIONS

VoidStaff

Zhonya's
Hourglass

Liandry's
Torment

Sorcerer's
Shoes

I dislike the lack of abyssal


scetpre. The item really
gives leblanc a lot of
defenses against APs
that can handler her later,
like ahri or fizz

LichBane

EXAMPLE BUILD

LeBlanc
MORE GUIDES

TOP LEBLANC GUIDES

YourcomprehensiveLeblanc
resourceforalllanes.
BYBAEKSTRA

TheDecieverLeBlancGuide
BYOWENTHEAWESOMER
Morellonomico
n

Sorcerer's
Shoes

Rabadon's
Deathcap

Luden'sEcho

VoidStaff

Zhonya's
Hourglass

LeBlancTheDeceiver
BYFINISHFLASH

ABILITY SEQUENCE

HowtoDummyKidswithLeBlanc
[6.3]
BYTHEVIRUXX

10

12

13

WEEKLY FREE CHAMPIONS

14
6

15

11

17
16

MASTERIES

18

MORE GUIDES

5/5

1/1

5/5

5/5

5/5

1/1

1/1

5/5

1/1

1/1

)HURFLW\

&XQQLQJ

5HVROYH

THREATS TO LEBLANC WITH THIS BUILD

THREAT

THREAT

LOW

HIGH

CHAMPION

SHOW ALL

NOTES

Lux

[Check"ChampionMatchup"sectionforindepthnotes]Startdoransring.
Verysimplematchup,gofortradestoburnhershieldandthegoforthekill.

WelcometomyLeBlancGuide!

B
L

1.Introduction
2.ProsandCons

B
L

E
O
F
C
O
N
T
E
N
T
S

2.ProsandCons
3.SummonerSpells
4.Items
5.Masteries
6.Abilities
7.Combos
8.Matchups
9.Gameplay
10.Conclusion

E
O
F
C
O
N
T
E
N
T
S

WelcomeToMyLeBlancGuide!

MynameisOwen,andthisismyguideonLeBlancTheDeciever!Iloveplayingleagueoflegends,andhavebeen
doingsosincethebeginningofseason4.LeBlancwasoneofthefirstchampionsIreallyfellinlovewithduetoher
abilitytosinglehandedlycarryagameifyouaregoodenoughather,andthisiswhatIamgoingtoteachyouto
dotoday.HereonMOBAFireIenjoyhangingoutontheforums,andmakingotherpeoplegraphicssuchas
signaturesandbannersfortheirownguide.Ifthereissomethingyoudisagreewith,orbelieveiswrongwithmy
guidebesuretoleaveacommentsothatIcanfurtherimprovemyguide.Ifyouenjoyedit,anupvoteisgreatly
appreciated!
Emoriam,Embracing,UtopusandCrsDekar
(Seth346)forreviewingmyguide,andoffering
memanytips.
Myfriend,Turnupgoose,forhisconstantspelling
andgrammarchecks:)
Jhoijhoi,forherincredibleguideonmakinga
guide.
FoxyRiven,forhistablecodingguidewhich
helpedmewithmycodingalot!
Allofyou,forreadingtheguide!
Hopeyouenjoyreading,
Owen:)

LeBlanc's strengths greatly outweigh her weaknesses


LeBlancistheidealchampionforsoloq.Hermixof
damage,mobility,andwaveclearmakeitveryeasyto
carryteammatesbyhelpingthemout.Shecanpush
wavesfast,andthenroamtohelpherteammates

Pros

+GreatRoams
+HighMobility

whichwilloftenleadtoahugeteamadvantge.Sheis
abletoburstdownhighprioritytargetsbeforethey

+HugeBurst

haveachancetoreactwhichallowsherteamtogain

+GoodWaveclear
+Manyoptionsforburst

advantagesovertheenemy.Shecanlockdowntankier
targets,allowingherteamtofollowupandgetsome

+Picksofftargets

easykills,andcanalsosnarefedenemiesifshecan't

+DecentCC
+Highskillcap

killthemherself.PickupLeBlancifyouareconfidentin
yourability,andyouwillbeclimbingtheladderinno

I never pictured leblanc as a very strong wave clearer.


Especially since the strategy against her is to push her
into tower.

time.WWWWWWWWWWWWWWWWWWWWW
WWWWWWWWWWWWWWWWWWWWWWW
WW
LeBlancstillhasweaknessesthatyouwillhavetolearn
toworkaround.Shefallsofflategameduetothe
defensiveitemstheenemycarrieswillbegintostart
Cons

+Fallsofflate
+Notgreatteamfight
+CounteredbyFastCC
+Requiresgoodmechanics
+Mustmakequickdecisions

buyingsuchas GuardianAngeland Banshee's


Veil.Herteamfightpotentialisprettyweakbecauseof
herlackofsustainableandreliableAOEdamageaswell
ashersusceptibilitytofastCC(suchas Annie's
Summon:Tibbers)whichwilloftenleadtodeathdueto
squishyness.Sherequiresgoodmechanicstoplay
properly,andfastthinkingtoperformtoherpotential.
Theseweaknessesarestillnotenoughtoholdherback
fromcarryingherteam.

There are not many options when it comes to summoner spells for LeBlanc.

Flash

Ignite

Teleport

Success iin team fight is based around flanking


opponents and deleting a carry.

Mandatory

Recommended

Flashisanecessityonevery

IgniteiswhatIrecommendas

Situational
Teleportisanoptional

midlaner,includingLeBlanc.It
allowshertohaveanextra

yoursecondsummonerspellin
mostifnotallgames.Theadded

summonerspellthatoffersyou
thebestabilitytohelpoutyour

aggressiveanddefensive

DPSisextremelyhelpful

teammates.Ifyourunthisspell,

resourcewhichshecanuseat
will.Itisoneof,ifnotTHEonly

throughouttheentiregame,andit
isoftenthedecidingfactorinwhich

yougiveupabitoflanepressure
(from Ignite)inexchangefor

summonerspellwhichprovides

engagesaresuccessful.This

mappresencewhichwillslowly

youwithincredibleoffensiveand
defensiveuses.Useittododge

summonerisalsousefulfor
counteringenemieswhohavelots

outscalethelanepressure
towardsthelategame.Makesure

skillshots,engagewithoutusing

ofhealingpowerbecauseofthe

youcoordinatewithyourbotlane

grievouswoundspassive.

sothatyoucansetupaTPgankif

Distortion,andflashingaway
overawall.

yourun Teleport,andonlyuse
ittogetbacktolaneifyoudie
withinthefirst67minutes,or
yourtowerisabouttofall.

Ifyoustillaren'tcompletelysureif Teleportiswhatbettersuitsyourplaystyle,thenyoucancheckoutthis
videothatRedmercymadeonthebenefits/drawbacksofrunningteleport,andwhotoruniton.

Asyoucanseeifyouwatchedthevideo,Redmercyisn'tcompletelysurehowwell
teleportduetothefactthat

LeBlancwouldworkwith

Igniteoffershersomuchkillpressureintothemidgame.Hedoesacknowledge,

however,thathecansee

Teleportbeingextremelystrongifyoumanagetouseiteffectivelytopressurethe

map.ThisiswhyIdonotfeelthereisonesummonerspellthatisultimately'better'thantheother.Theyboth
havebenefitsanddrawbacks,andtheonlywaytofindoutwhichoneyoupreferistotestthembothout!

LeBlanc's build order is very situational

outdated

StartingItems
Mostofthetimeyouwillwanttobuy Doran'sRingand2 Health
Potion'sforyourstartingitemsonLeBlanc.TheHP,manaregeneration,

Option1

andAPwillgreatlybenefityourearlygamelanepresence,andwilloffer
yourmorekillpotentialthanstartinga CrystallineFlaskand3
HealthPotion'swould.Ifyouareagainstoneofthechampionswho

countersyouearlygame(seematchupsection)thentheflaskstartcanbe
effectivetohelpgetthroughtheearlygame.

Inthecasethatyouagainstoneofyourmaincounters(mentionedin
counterssection)then TheDarkSealandthree HealthPotionswill
helpmitigateenemypoke.Prettymuch,ifyouaren'tconfidentthatyou
willbeabletosurvivetheearlygame, TheDarkSealprovidessome
muchneededsustainallowingyoutokeepfarming,whileavoidingdeath.

care to defend this?

Option2

Youwillobviouslyhavetosell TheDarkSeallater,andshouldNOT
builditinto Mejai'sSoulstealer.

Rush
MorellonomiconismypersonalfavoriterushonLeBlancduetoit'sgold
efficiency,stats,andhowsimpleitistobuild.20%CDRisawesomefor
early/midgame LeBlancsothatyoucancastmoreabilities,whether

theybeformobility,CC,ordamage. BootsofSpeedisagreatearly
itemtogetwhenyoucan'taffordanythingbetter,becauseyouwill
eventuallyhavetoupgradeto Sorcerer'sShoes. NeedlesslyLarge
Rodprovidesquitealargespikeinabilitypower,whichiswhatyouwill

needmostgoingintomidlaneinordertohavethebiggestimpactonthe
game.

Finish
Finishing

Rabadon'sDeathcapand

Sorcerer'sShoesprovidesyou

withoneof LeBlanc'sbiggestpowerspikes.Bythispointyoushouldbe
abletoclearallthecasterminionswithone Distortion,soyour
waveclearwillobviouslyskyrocket.ThehugeAPspikefrom Rabadon's

Deathcapwillhaveyoudoingwaymoredamagethanbefore,andthe
magicpenetrationfrom Sorcerer'sShoeswillallowyoutobegin
penetratingtankierenemies.

BuildThese
Youprettymuchalwayswanttobuildbothoftheseitemsatthispoint,

thechoiceiswhichonefirst.Ifthereismorethanonepersonbuilding
magicresistontheenemyteam,then VoidStaff'sdamagewill
outweigh Luden'sEcho.However,dependingonyourelotheremaybe
onlyoneperson,ornoonebuildinganymagicresistance.Inthiscase
Luden'sEchoisthebetteroptionbecauseitprovidesmoreAP,andhasa
greatpassivewhichaddstoyourburst.

IfyouarelosinglanetoanAPmidlaneryoumaywanttogoforan

Situational

AbyssalScepterafterfinishing Rabadon'sDeathcapinsteadofa
VoidStaff.ThemagicresistancewillhelpyousurviveagainstAPmid
lanerswhocouldeasilykillyouwhenfed( Fizz, Syndra,etc.)andit
willalsoprovideyouwithawaytopenetratemagicresistthattheenemy
mightbebuilding.Overall, AbyssalScepterisagreatalternativeto
VoidStaffagainstAPcompositionsorafedAPchampion.

LastItemOptions
Zhonya'sHourglassisgreatifyouareagainsthighADassassinssuch
as Talonor Zed,astheywillbeabletoeasilykillyouiftheymanage
togetontoyouwhileyouareoutofposition,orjustnotpayingattention.
Liandry'sTormentisbestagainsttankierteamcompositionsduetoit's
magicpenetrationandpercentofHPdamage. Banshee'sVeilisgreat
againstmostlyAPteams,whohavelostofCCorpoke(ex. Lux)which
isconstantlykillingyouorrestrainingyoufromdoingdamagetothe
enemy.

ExampleBuilds:

Add to cheat sheet please.


To be honest, i'd prefer abyssal to any of your 6th item
recommendations. Except maybe zhonya's on
occasion.

AgainstmostlyADdamagedealerswhoposeasthreatstoyouduetotheirassassinationpotential.

AgainstmostlyAPdamagedealerswhoposeasthreatstoyou,manypeoplewithlotsofhealthandMR.

Exchangebootsfor

LichBaneifyourareextremelyfed,andtheyposeasnothreatstoyou.

Masteries are extremely important in enhancing LeBlanc's Pros


Byputting12pointsintotheFerocitytree,and18pointsintotheCunningTreeweutilizemanyusefulstats,and
weacquirethe Thunderlord'sDecreemasterywhichisextremelygoodon LeBlanc.Thekeystonemasteries
inFerocityarenotthatgoodonLeBlanc,whichisalsoareasonwhywefocusmoreintoCunning.Ifeelthe
FerocityismuchbetterthantheresolvetreebecausethepercentdamageandbonusAPwillbemuchmoreuseful
thanasmallamountofhealthandslightlyreducedsummonerspellcooldowns.

Ferocity Tree
Tier15pointsin Sorceryisverystandardonany
APchampion,asitismuchmoreeffectivethanattack
speed.
Tier2Takingthepointinto

Feastisnotideal,

howeverIthinkthelanesustainismuchbetterthan
taking DoubleEdgedSwordwhichisnoteffectiveon
anyrangedchampions.Doinganextra2%damageis
space notworthtakinganextra2%inreturn.
Tier35pointsinto

NaturalTalentwillhelpyou

farmthroughoutthegame,aswellasdoingslightly
moredamagewithyourabilities. LeBlancmakes
littleuseof Vampirismbecauselifestealispretty
muchuselessonher.
Tier4Iprefertotakethepointinto Bounty
Hunterbecausechancesare,oncelaningphaseisover
youwillhavekilledatleastoneoftheenemy,andwill
haveoftengottenasuccessfulroamoffalso,meaning
thattheeffectivenessof BountyHunterwillvery
quicklyoutweightheeffectivenessof Oppressor.

Cunning Tree
Tier1Dueto LeBlanc'slameautoattacks,points
into Savagerywillbeverybeneficialwhenfarming
minions.Remember,morefarmmeansmoregold,
whichwillallowyoutobedoingmoredamagebecause
oftheitemsyoucanafford.
Tier2Iprefertotakepointsinto Assassindueto
thefactthatitwillbegivingyoumoredamage

throughouttheentirelaningphase(exceptwhenyour
jungleristhereofcourse).Itisalsoviabletotakethe
pointinto SecretStashformorelanesustain,butI
stillpreferthedamage.
Tier3Takingpointsinto Mercilessisriskierthan
Meditationhowever,onceyougetyourmanaitem
space
Meditationisnotveryeffective. Mercilessisgreatfor
finishingpeopleoffafteryouhavepokedthemdown.
Tier4

DangerousGameisprettymuchtheobvious

choicehere. Banditisonlyusedonsupportsandfull
AP LeBlancmidisdefinitelynotasupport!
Tier5Theaddedtankinessfrom Precisionisvery
usefulsothatyoudon'tbecomeEXTREMELYsquishy.
Intelligenceisalsoviable,butIprefer Precision
becausemostofthetime,itwillprovideyouwithbetter
dueling.
Tier6 Thunderlord'sDecreeisliterallythemain
reasonwhywego1218forourmasteries.Itis
incrediblyusefulthroughouttheentiregame,especially
intheearlygameforaddedpokeandburst.Itisvery
easytoprocthismastery,whichisalsooneofthe
reasonsitissogreaton LeBlanc.

Using LeBlanc's abilities in synchronicity increases her potential

StandardLevelingOrder

10 11 12 13 14 15 16 17 18

SigilofMalice
Distortion
EtherealChains
Mimic
E

Choosingtomax Distortionover SigilofMaliceisapersonalpreference.Maxing SigilofMaliceisalso


viable,butmatchesaverydifferentplaystyle.Maxing Distortionisgreatforearlygametrades,roaming,and
beingabletoclearwavesfasterandmoreefficiently.ItalsoprovidesyouwiththeoptionofAOEburstinthecase
thatmultiplepeoplearegroupedveryclosetogether,inwhichcaseasimple Distortion Mimiccomboishighly
effective.Roamingtootherlanes,andapplyingpressuretothewholemapisextremelyimportantas LeBlanc
thisismadeeasierbyhavingbetterwaveclear,andashortercooldownmobilityspell,bothofwhicharewhat
maxing

Distortionwillprovideyou.

AlternativeLevelingOption
1

10 11 12 13 14 15 16 17 18

SigilofMalice
Distortion
EtherealChains
Mimic

AsIstatedpreviously,maxing

SigilofMaliceisanoption,howeveritdoesnotsuitmyplaystylefor

LeBlanc.

MaxingQprovidesyouwithabitmoresingletargetdamage,whichisusefulwhengoingforsolokillsinlane.You
willbedoingevenmoredamagewithyourdouble SigilofMalicecombo,butwillnothaveasmuchwaveclear,or
potentialtoroamandgetawayfromganksasyouwouldwith Distortion.Iwouldonlysaythatthiscombois
completelybetterthanthestandardskillingorderifyouareplayingwithplayersatalowerskilllevelthanyouor
smurfing,becauseinthiscaseyouwillwanttogetyourselfextremelyfed,andshouldn'thavetoworryabouthow
yourteammatesdobecauseyouwillbeabletosolocarrythegame.

LeBlanc'sAbilities:

Passive:MirrorImage
WheneverLeBlancisbelow40%health,shecreatesacontrollablecloneofherselfthatlastsfor8
seconds.
ThisabilityoffersLeBlancwithevenmorejukingpotential,especiallyinlowlevelgames.Ifyousimply
standstillafteryourpassivepops,youcanoftentrickpeopleintorunningafteryourclone!Trytomake
surethisisn'toncooldownifyouareabouttogoforakillonanenemyassassin,becauseiftheytrytoburstyou
whenyouengagetheycouldhaveahardtimedecidingwhich LeBlancistherealone.



Q:SigilOfMalice
LeBlancfiresanorbathertarget,dealingmagicdamageandmarkingthem.Themarkcanbepopped
byanyofherotherabilitiestodobonusdamage.
Thisabilitydoesn'tdomuchdamagebyitself,butwhenusedincombinationwithLeBlanc'sother
abilities(poppingthemark)youcandohugeburstdamage.ThisabilitycontributestoLeBlanc'swide
varietyofpossiblecombostoassassinateyourtarget,anditalsohasaverylowcooldownwhichmeansyoucanbe
throwingthisout,andthenfollowingitupwithanyotherabilitesyouhaveforsomefreepokeontheenemylaner.



W:Distortion
LeBlancdashestowardsthecursordealingdamageandleavingareturnpadfromwhereitwascasted.
Shecanthenreturntothepadfor4secondsaftercastingit.
Thisabilityiswhattrulydefines

LeBlanc.ItgivesherSOmuchmobilityforroaming,dodging

skillshots,avoidingganks,andalsoalsohertojumpovermanywallsonSummonersRift.Ithelpsher
tradinginlanedueherabilitytousethistogetinrange,throwyour SigilofMaliceand EtherealChains,
thengetoutforfree.ThisiswhatmakesLeBlancsohardtochase.4secondsisalongtimeinleague,andbyusing
thisabilitytwiceyoucaneasilyjukeandoutruntheenemy.



E:EtherealChains
Leblancthrowsachainatherenemy,whichtethersthem.Iftheydonotleavetheareawithin1.5
secondstheyarerooted.
EtherealchainsisicingonthecakeforLeBlanc,andithasahugerangewhichaidsherinchasingand
beingabletofollowupwith

Distortion.ThisprovidesherwithsomemuchneededCCwhichcan

helpherkiteifneeded.Thisabilityisgreatforroaming,allowingyoutorootyourenemywhileyourteamfollows
up.Alsonotethatifyouusethisabilityafter Distortion,andthengobackto Distortionimmediatelyafter
throwingit,itwillextendtodealdamagetotheenemy.



R:Mimic
LeBlanccastsamimicversionoftheabilityshepreviouslycasted.
LeBlanc'sultimate,Mimicisonanextremelyshortcooldownconsideringhowgooditis.Thereareso
manydifferentusesforthisability.Mimic SigilofMaliceisthemostdamagingultimatebecauseif
youhave2q'syouessentiallyhavethedamageoffourbecauseofthemarkitleaves.Mimic
DistortionisthemostmobilityLeBlanccangetandisalsogreatforteamfightsifyouwanttogetAOEdamageon
thecarries.Mimic EtherealChainsisgreatforpermanentlyrootingyourenemyifyouarenotquiteasstrongso
youcantoneshotyourenemy,thisallowsyourteamtimetofollowupandkilltherootedenemy.



There are many combinations LeBlanc can use to suit a variety of situations.

Standard Lane Poke

QW
Thisis

LeBlanc'sbreadandbuttercomboforpokingtheenemylaner.Ifyouhaveoverabout40%manayou

willwan'ttobeusingthiswhenevertheenemycomescloseenoughforyoutolandthe

Distortionafterthe

SigilofMalice. Distortionwillpopthemarkfrom SigilofMalicedoingquiteabitofdamage,andthenyoucan


use Distortionagaintoreturntowearyoucasteditform.InlowerELO,youwilloftenbeabletoperformthis
combowithouttakinganydamageinreturnfromtheenemy.

Full Wave Clear

WR
Thisbasiccomboisextremelycommonfor LeBlancplayerstodowhentheywanttopushthewavevery
quickly,allowingthemtoeitherroamorgobacktobasewhiletheenemylosessomeCStothetoweryoupushed
into.Toexecuteproperly,simplywalkinacirclearoundtheminionwaveasitcomestowardsyou,whichwillcause
alloftheminionstogroupintoasmallareawhereyoucan Distortion Mimictokillthem.Dependingonhow
muchAPyouhave,andthetimeofthegame,youmayneedtoautoattackthemeleeminionsacoupletimes
eachbeforetheydie.

Highest Burst Combo

QREW
ThiscombinationwillbeLeBlanc'smostdamagingcombopossible.Usethisagainstmeleeorrangedopponentswho
willalreadybeinyourrange.Byusingyour SigilofMalicetwiceyouarepoppinganadditionaltwo Sigilof
Malice'sduetothemarkonyourinitial SigilofMalice,thisiswhyitdoesthemostdamage.Thisiswhatyou
shouldbeusingasyourmaincombowheneveryoucan,anditworksespeciallywellwhileanenemyfacechecksa
bushthatyouarewaitingin.

Lock Down

QERW
ThisisLeBlanc's'Lockdown'combo,allowinghertoccherenemiesforupto3seconds.ThisSHOULDbeenough
timeforherteamtofollowupandfinishoffthekillifLeBlanchasn'talready.Bymakinguseoftwo Ethereal
Chains'youwillbeabletosnaretheenemyforquitealongtime.Youcanalsousethiscomboifyouarerunning
awayfromsomeone,howeverinsteadofusing Distortionasdamageyoucanuseittoescape.Dependingon
howmuchhealthyouhave,youmaynotwanttouse SigilofMalicebeforeyour EtherealChainsifyouneed
togetawayasquicklyaspossible.

Easy Assassination

WQRE
Usethiswhenyouareprettyfedanddonotneedyourdistortionasextradamage.Byusingdistortiontogetin
rangeofyourenemyandthenusingyourotherabilitiesinquicksuccessionyoucanburstdownyourenemy.Also
usethiscomboforsomefreeharassinlaneifyouspottheenemyjunglersomewhereotherthanyourlane,itis
oneofthesafestwaystopoke,anddoesatonofdamageespeciallyifyoucanlandyour EtherealChainstopop
your

Mimic

SigilofMalice.Ifyouareextremelyconfidentinyourabilitytoexecutethiscombotheyoumay

wanttouse Flash,andthen Distortiontocoveramassiveamountofrange,andthenreturntoyour


Distortionafterfinishingoffyourenemy.

No Skill Necessary

WRQE
ThiscomboisforlessadvancedLeBlancplayerswhoarelesscomfortableusingtheirabilities.Forthistoworkyou
must,however,useyourfirstdistortionfordamageonyouenemyandthenusetheseconddistortionformore
damage,meaningyoumustgetwithinaprettycloserange.Thiscombocanalsobeveryeffectiveifyouseethat
theenemyisgroupedverycloselytogether,sobyusingboth

Distortionand

Mimicyouwillbeabletodoa

massiveamountofdamagewithinaveryquicktimeframe.

The Triple Q Combo

QREQ
Inthiscomboweusethree

SigilofMalice'stodomaximumdamageoutputoveralongerdurationoftime.The

goalistowaitforalittlebitmorebetweenthefirstthreeabilitiessothatyouwillbeabletoqathirdtimebefore
yourchainrunsout.Thisway,thesecondprocofyourchainwilldobonusdamagebecauseofyour Sigilof
Malice.

A General Note
Atfirstyoumayhavetroubledecidingwhichcombosuitsbestsituation,andbeingabletoexecutethatcombo
correctlymayseemimpossible,butstickwithit.Practiceincustomgamesifyouwant,ortrytheseoutwithsome
friends.Themoreyoupracticethebetteryouwillget,andIassureyouthepracticewillbeworthit.Mastering
LeBlanc'scombosmakesheramuchmorereliablepickinsoloQ,andifyouplayherenoughyoumayevenbeable
topulloffsomeoftheseinsaneplays:

LeBlanc may encounter a variety of champions in the mid lane


Difficulty:Medium
Counters Zhonya'sHourglass

AbyssalScepter

Playaggressiveearlygameinattempttopushhimoutoflane.Abuseyour

Distortionautoattack

comboatleveloneforfreepokebecausehewillnotbeabletoouttradeyouatanystagesofthe
laningphase.His Playful/Trickstertakesupamajorityofhisdamagebutyoucaneasilydodgeit
withyour

Distortion.Hecan,however,oneshotyouifhelandshis

ChumtheWaters.

Difficulty:Medium
Counters

Zhonya'sHourglass

Thisisacompleteskillmatchupandthebestplayershouldalwayswinifthereisminimaljungle
pressure.Ifyoudodgehis RazorShurikenafterhehasusedhis DeathMarkthenyoushouldwin
inanallinsituation.Alwayskeeptrackofenemysummonerspellsbecausetheycanoftendetermine
thewinnerinsuchaclosechampionmatchup.

Lane is stalemated. Basically whoever goes in first gets


fucked.
Double distortion should save you from most sharks
unless you're really pushed up.
Zed kinda counters LB. He can push her under tower too
easily after level 4--5

Difficulty:Medium
Counters

Luden'sEcho

AbyssalScepter

Thisisalsoaskilledmatchupandthewinnerisusuallydeterminedbetweenwhetherornotahrilands
her Charm.Ifshedoeslandher Charmitwillbeverydifficultforyoutooutplayhertothepoint
thatyouwillkillher.But,thankfullyyouhaveyour
beverydifficulttolandyour

Distortiontododgeheraggravatingkiss.Itcan

EtherealChainsduetoherhighmobilityultimate:

SpiritRush

Difficulty:Easy
Counters VisionWard
YoucanEASILYwinthislanebyplayingaggressivethroughoutthelaningphase.Yououtrange,out
burst,andouttradeherduringtheearlyandmidstagesofthegame.Shecanbegintooutroamyou
butyoucaneasilyfollowher,orjustpushthewavewith

Distortion

Mimic

Difficulty:Medium
Counters Zhonya'sHourglassor AbyssalScepter
Anniecanbeaverydifficulttoplayagainstduetoherlowcounterplayoneshot.Youcanapplymuch
morepresencearoundthemapthananniebecauseofherhavingnoinnateescapeormobility.Ifyou
predictannie's
difficulttopulloff.

Summon:Tibbersthenyoushouldhavenoproblemagainsther,butthisisvery

Difficulty:Hard
Counters: AbyssalScepter

VoidStaff

Cho'GathisoneofthehardestchampionstolaneagainstasLeBlanc.Hehassomanythingsthat
counteryousuchashis FeralScreamforthesilenceandhisgenuinetankinessthatmakeshim
veryhardtokill.Theonlywayforyoutogetaheadiswithextremelygoodfarmingorstrategic
roaming.

Difficulty:Easy
Counters: AbyssalScepter
Cassiopeiaisanextremelyeasymatchupduetoherlackofmobilityanddifficultydealingwithyour
abundanceofmobility.PlayaggressiveagainstCassiopeiaintheearlygamebecauseifsheplayswell
shewillhaveamuchbiggerlategameinfluenceduetoherscaling,andAOEstun/slowwithher
AspectoftheSerpentand

PetrifyingGaze.

LeBlanc's playstyle can vary throughout the game

Whenyougetintothegameyouwillwanttobuyyourstartingitems,andthenheadstraighttolane.Ifyour
enemycomeswithinyour Distortionrangeatlevelone,youcaneasilygetoffsomefreeharassbyusing
Distortionontothem,autoattackingonce,goingbacktoyour Distortion,andthenautoattackingagain.Ifthe
enemylanerisnotcomingcloseenoughforyoutodothisthendon'tworry,astherearemanyopportunities
whereyouwillbeabletogetoffsomeharass.Onegreatwaytodothisiswithautoattacks.Intheearlygame
everyonehasverylittlehealthandarmor,sotrytoautoattacktheenemywheneveryoucan.
LeBlanchasoneofthebestlevel2powerspikesinthegame,soyouwillwanttobeautoattackingtheminions
asmuchaspossiblesothatyoureachlevel2beforetheenemy.Youwillhitlevel2afterexactly7minions,which
includestheentirefirstwaveandthen1meleeminionfromthenextwave.Startwalkingforwardjustbeforeyou
areabouttokillthe7thminion,sothatwhenyouhitlevel2youwillbereadytoperformyourcombo.Walkingup
toearlywillscaretheenemyaway,soitmighttakeafewgamestogetthetimingperfect.Afterhittinglevel2you
willwanttouseyour
then

SigilofMaliceontheenemy,followedimmediatelyby

Distortion,oneautoattack,and

Distortionagaintogetbackout.

Dependingontheenemychampionsrunesandmasteries,thissimplecombocandoupto60%oftheirhealth!
Thiswillprovideyouwithahugelaneadvantage,andmaycauseyouropponenttousemultiplepotions.Continue
tousethiscombothroughoutlaningphasewheneveryougettheopportunitybecauseit'seffectivenessisobsurd,
andwhenfollowedbyyour

EtherealChainscouldevenleadtokillsintheearlygameifyouropponent

overstays.

LeBlanchasanamazingopportunitytokilltheenemywhenshehitslevel6ifshehasbeeneffectivelypoking
downtheenemyintheearlierlevels.Iftheenemyisunderaround65%healththenyoucanpotentiallycausethe
enemytouseflash,andiftheydon'thaveflash,orfailtouseiteffectivelythenyoumaybeabletogetakill.The
idealcomboyoucanuseinthissituationistheQREW,orQRWEcomboasmentionedinthe'AbilityCombination'
section.Ifyouchosetorunignitethenthiscomboismorelikelytokilltheenemybecauseitprovidesextra
damage,andalsopreventstheenemyfrombeingabletosurvivewith520healthfromtickinga
atthelastsecond.

HealthPotion

This is subpar.
Been watching a lot of gordon ramsay lately, so pardon
the smacktalk xD
You teach your readers about lebllanc's level 2
powerspike, but you don't teach them how to really
make the most of it. Against favorable lane matchups,
you want to be positioned around your opponents melee
minion wave to really zone them from CS. Warding your
flanks will prevent you from getting ganked easily.
Against champions with AoE abilities (zed, lux, ziggs),
you want to stand usually away from the minion wave.
Pathing is a bitch and you don't want to make your
opponents life easy by allowing them to poke you (or
attempt to do so) while still getting CS. One of leblanc's
strengths is that she can force all of her opponents
actions to have an opportunity cost. Your opponents are
very weak once they have their main damaging ability
on cooldown and you can continue to zone them from
CS if they don't respect leblanc early on.
Likewise, against skillshot reliant champions (ezreal,
KINDA corki?), you want to be positioned in the minion
wave.
Against even lanes, or lanes with more kill pressure on
you, you want to be positioned further back, and wait for
openings to distortion in and whittle them down with
leblanc's mimic before all-inning them later.
As always, it's more valuable for leblanc to have full
health than for her to zone opponents from CS. If you're
in danger of getting hit by a skillshot, it's usually okay to
just distortion away to avoid taking damage.

Justlikewiththelevel2combo,itisbestifyouengagebeforetheenemyhitslevel6sothatyouwillhavethe
clearadvantage.Onceyoureachlevel5,starttoautotheminionsalittlebitextraeverysooften,andkeeptrack
oftherateatwhichtheenemyisautoattackingminionsandtrytobealittlebitfaster.Thisensuresthatyouwill
hitlevel6first.Whenyourecognizethatyouwillhittinglevel6withinaminionortwo,casuallystarttowalkupto
youropponenttoabouttherangeofyour Distortion.Then,rightwhenyouhitlevel6youshoulduse Sigilof
Malice,directlyinto Mimicandthen Distortion.Autoattacktheenemyuntilyouhaveaclearpathtoshoot
your

EtherealChains,ifatthispointtheyareataround15%healththenyouwillwanttouse

Attached below are 2 links that kind of give you a rough


idea of what I expect in this section
http://prnt.sc/a6m5ij
http://prnt.sc/a6m5ij
I expect you to include more images in this section.

Ignite,and

continueautoattackingasmuchasyoucan.Mostpeoplewillflashbeforeyour EtherealChainssnaresthemin
place,butoftenpeopleunderestimateyourdamage(inlowerELOespecially)andmayevenuseflash,andthendie
to

Ignite.

Thatistheidealcomboyouwillbeusing,butiftheenemyisplayingextremelypassivelythenyoucanalsouse
your

Distortiontogetintorangetouse

SigilofMalice

Mimic,and

EtherealChains.Thiscombooften

endsintheenemyflashingawayorevendyingtoyourunexpectedburst.
TLDR,Pushforlevel6,allinwithQRWEiftheenemyisinrange,orWQREifyouneed

Distortiontogetin

range.

Thisiswhenyouareatyourstrongestpointon

LeBlancbecauseyoushouldbeabletooneshottheenemy

backlinewithyourfullcombo.Duringthemidgameiswhenyoushouldbebuyingwardsandlookingforpicks.
RoamtohelpyourteamandtakeadvantageofyourHUGEmidgamepowerspike.Occasionallyuseyour
FarsightAlterationintheenemyjunglewhenyounoticethattheenemyjunglerorbotlanehasbeenMIAforan
extendedperiodoftime.Gettingpicksinthejungleissomething

LeBlancexcelsatduetoherabilityto

maneuverthroughoutthejungle,andinstantlykilltheenemy.Youcanalsogetpicksbyplacingpinkwardsat
enemyjunglecampssuchasredorbluebuff,andthenkillingwhoevertakesit.Makesurethanwhenyougoto
wardyouwatchthattheirbotlanedoesn'tgoMIA,becauseiftheydoitcouldmeanyouhavebeenspottedbya
ward,andtheyarecomingtocollapseontoyou.
RoamingbotlaneisoneofthebestwayyoucansnowballinSoloQ,becauseitwillallowyoutogetyourADCmore
gold,thereforealleviatingsomeofthepressureonyoutocarry.Communicatewithyourbotlanewhenyouare
planningonroaming,maybeaskiftheenemybotlanehaswardedtheriver,inwhichcaseyouwillnotbeableto
roamuntilthewarddiesout,orhasbeencleared.Whenroaming,youwillwanttowalkasfarfrombehindthe
enemyasyoucanwithoutusing Distortion,becauseiftheyflashawayyouwillneedthistocatchthem.If
possible,startwith SigilofMalice,into EtherealChainsandthen Mimicon,preferably,theADC.Ifthey
flash,orusesomethinglike

Valkyrietogetawayyouwillthenwanttouse

Distortiontocatchup.

Youwillalsowanttoidentifyifitisworthroamingdependingonthechampionmatchupsbotlane.Iftheenemy
teamhasaneasyescape,andyourbotlanehasverylittleCCormobility,thenitmightnotbetherightgamefor
youtotrytoroam.Forexample,iftheyhavean
Jannathenroamingisalmostimpossible.

Ezreal,

Namilane,andyourteamhasa

Kog'Mawanda

This is not quite the message that you wanted to


capture. Leblanc is reliably better at ganking lanes
than she is at tower diving. Before you even think
about leaving mid, you need to assess the minion
wave of your bot lane and see if it will push favorably
to you by the time you reach your side lane (towards
your tower, or it's pushing really hard towards the
opponent tower and you see a window to tower dive)
PM me if you don't understand what i'm trying to say..

Teamfightingas

LeBlancisextremelydifficultbecauseifyoumanagetogetCC'edthenyouareprettymuch

instantlydead.ThefollowingvideoshowsateamfightbetweenFNCandAHQwhereFNCuse
burstfrom Distortion Mimictoit'sabsolutefullestpotential.

LeBlanc'sAOE

TherearenumerousreasonswhyitwentsowellforFNC:
LeBlancwaspatient,anddidnotengageattheverystartofthefight.
LeBlancposition'sherselfsothat
and

Kennencan'tlandhis

Sivirsimultaneously,thismeans

SlicingMaelstromonbothherself,

LeBlancdoesn'thavetouse

Distortiontoavoidthe

stun.
Shealsopositionedherselfoppositethe Zed,sothatheisnotathreattoher,andinsteadgoes
onto Elisewhichinineffectivebecauseofher Rappel.
LeBlancwaitsfor
Sheuses
When

Kennentodiebeforeengagingtoensurethatshewon'tbeCC'ed.

SigilofMaliceonto

Zed,and

Mikael'sCrucibleisused.

LeBlancengagessheknowsthattherearenoimmediatethreatsbecauseallof

Zed's

abilitieshavebeenused,andthecasttimeon BodySlamwillstophimfromCC'ing LeBlanc.


Shealsoknowsthat TahmKenchdoesnothavehis TongueLashup,becauseheusedit
earlier,sohewillnotbeableto
LeBlancusesher

Flash,

Devourher.
Distortion

Mimiccomboinstantly,andlandsitonto4enemy

championswithouttakinganydamageinreturn. Gragasisnotabletopredictit,anduses
BodySlamtolateduetothespeedatwhich LeBlancusesthiscombo.

So give your readers some actual tips!


It's obvious that it's better for a leblanc to land a double
4 man distortion than it would be for her to WQRE some
carry. Where do you draw the threshold? You don't have
to be right 100% of the time, you just have to really
teach your reader how to think.
Against what team compps (instant CC) is it better to
wait instead of trying to assassinate a carry?
Around what areas is it easier/harder to find flanks
(include: ALL areas of river), various lanes, towers,
gates, etc

Obviouslybothoftheseteamsareextremelygood,andyouwillnotreachnearlythisamountofcoordinationin
yourSoloQgames,howeverusethisasageneralguidelineonwhatyoushould,andshouldnotdotowin
teamfights.Themoregamesyouplaythebetteryouwillbecomeatidentifyingthepropertimestoengage,which
abilitiestouse,andwhen.

Asyousaw,thereisalotofthoughtthatgoesintoplaying

LeBlancinthelategame.Atthisstage,becautious

andpatientarethetwomostimportantthings.Youhavethepotentialatthispointtodoanincredibleamountof
damage,butgoinginhalfasecondtooearlycouldeasilyloseyouthegame.Also,beingtoohesitantaboutwhether
ornottogoinmaycauseyoutomissyouropportunity,andyoucouldeasilyendupdoingnothingatall.Youhave
tofindthebalancebetweentoearly,andtoolate,because
mostcases.

LeBlanc'swindowforgoinginisextremelysmallin

Atthisstageofthegame baronisgoingtobeoneofthemosthighlycontestedobjective.Insidethebaronpit,
your Distortion Mimiccomboisextremelyeffectivebecausetheenemyisforcedtogroupquiteclosely
together.Keepwatchonobjectiveswithyour

FarsightAlteration,andbuyan

ElixirofSorcerywheneveryou

havetheextragold,evenifyouarestillfinishingyourlastitem.Thebonus50AP,15flatmanaregeneration,and
truedamagetochampionsandturretsisworthslightlydelayingyourlastitem.

I hope you enjoyed my guide!


Thankyousomuchfortakingthetimetoreadmyguide.Ifyouhaveany
criticismmakesureyouletmeknow,eitherinthecommentsorthrough
myNAaccount,OwenTheAwesomer.Thisguideisaconstantworkin

progress,soanyandallfeedbackisgreatlyappreciated!Ifyoulikedthe
graphicsintheguidethenyoucancheckoutmygraphicshoptogetsome
ofyourown.GoodluckontheFieldsofJustice!WWWWWWWWWWWW
COMING SOON!

FLAG COUNTER AS OF JANUARY 1ST 2016

GUIDE DISCUSSION (37)

LEAGUE OF LEGENDS CHAMPION


Aatrox
Ahri
Akali
Alistar
Amumu
Anivia
Annie
Ashe
Azir
Bard
Blitzcrank
Brand
Braum
Caitlyn
Cassiopeia
Cho'Gath
Corki

MOBAFIRE & LEAGUE OF LEGENDS


MOBAFireisastrategyguidetoolandcommunityforLeagueof
Legends,anonlinebattlearenastylegamebasedonDefenseof
theAncients,apopularmodforWarcraft3.
LoLfansareencouragedtoexploreourvastlibraryofuser
generatedchampionbuildguidestoenhancetheirbattlefield
strategy.Learnnew,effective,winningstrategyfromplayers
dominatingthefield.
LeagueofLegendsisateambased,realtimestrategygameset
inamythicalworldofswords&magicwhereepicbattlesdecide
thefateofmysticalnations.Gameplayerstakeontheroleofa
Summonerwhoconjuresandcontrolschampionstofightforthem
attheInstituteofWar.Duringgameplaychampionsgain
experienceanditemstoenhancetheirskillsandabilities.How

Darius
Diana
Dr.Mundo
Draven
Ekko
Elise
Evelynn
Ezreal
Fiddlesticks
Fiora
Fizz
Galio
Gangplank
Garen
Gnar
Gragas
Graves
Hecarim
Heimerdinger
Illaoi
Irelia
Janna
JarvanIV
Jax
Jayce
Jhin
Jinx
Kalista
Karma
Karthus
Kassadin
Katarina
Kayle
Kennen
Kha'Zix
Kindred
Kog'Maw
LeBlanc
LeeSin
Leona
Lissandra
Lucian
Lulu
Lux
Malphite
Malzahar
Maokai
MasterYi
MissFortune
Mordekaiser
Morgana
Nami
Nasus
Nautilus
Nidalee
Nocturne
Nunu
Olaf
Orianna
Pantheon
Poppy

playersdevelopandplaytheirchampionscanbethedifference
betweenacrushingdefeatoragloriousvictory!

Quinn
Rammus
Rek'Sai
Renekton
Rengar
Riven
Rumble
Ryze
Sejuani
Shaco
Shen
Shyvana
Singed
Sion
Sivir
Skarner
Sona
Soraka
Swain
Syndra
TahmKench
Talon
Taric
Teemo
Thresh
Tristana
Trundle
Tryndamere
TwistedFate
Twitch
Udyr
Urgot
Varus
Vayne
Veigar
Vel'Koz
Vi
Viktor
Vladimir
Volibear
Warwick
Wukong
Xerath
XinZhao
Yasuo
Yorick
Zac
Zed
Ziggs
Zilean
Zyra

QUICK NAVIGATION

FOLLOW US

BROWSE MOBAFIRE NETWORK

QUICK NAVIGATION
BuildGuides

Forums

FOLLOW US

BROWSE MOBAFIRE NETWORK

Facebook

MOBAFire

SMITEFire

Twitter

ELOphant

VaingloryFire

Champions

HeroesFire

InfiniteFire

Tournaments

DOTAFire

CreateGuide

MOBAFIRE

NETWORK

ADVERTISING

USERAGREEMENT

CONTACTUS

JOBS

Centres d'intérêt liés