Vous êtes sur la page 1sur 182

Thse d'Anne-France Prouvost, Lille 1, 2008

Universit des Sciences et Technologies de Lille


Thse
Prsente par

Anne-France PROUVOST
Pour lobtention du grade de Docteur de lUniversit des Sciences et Technologies de Lille

Discipline : Sciences de la vie et de la sant

Rle du priplasme dans la perception par la


bactrie de son environnement :
Utilisation des -galactanes par Erwinia chrysanthemi
Voie de signalisation du systme Rcs dans la virulence
dErwinia chrysanthemi

Soutenue le 22 octobre 2008, devant la commission dexamen compose de :

Prsident :

Jean-Claude MICHALSKI

Rapporteurs :

Alain FILLOUX
Jean-Claude LAZZARONI

Examinateurs :

Jean-Marie LACROIX
Anthony PUGSLEY

Directeur de Thse :

2009 Tous droits rservs.

Jean-Pierre BOHIN

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Sommaire

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Sommaire
.

Remerciements ................................................................................................................. 7

Introduction ...................................................................................................................... 9
A.

Lenveloppe des protobactries .................................................................................... 9


1. Lenveloppe des bactries .......................................................................................... 9
a) La membrane interne.............................................................................................. 9

La double couche lipidique ................................................................................ 9

Les protines de la membrane interne.............................................................. 10


b) La membrane externe ........................................................................................... 11

La double couche lipidique .............................................................................. 11

Les protines de la membrane externe ............................................................. 12


c) Le priplasme ....................................................................................................... 14

Le peptidoglycane ............................................................................................ 14

Les glucanes priplasmiques osmorguls....................................................... 15

Les protines priplasmiques ........................................................................... 15


d) Structures associes lenveloppe ....................................................................... 16

La capsule......................................................................................................... 16

Les flagelles...................................................................................................... 17

Les pilis ............................................................................................................ 17


e) Structures traversant lenveloppe : les systmes de transport .............................. 18

Le systme Sec ................................................................................................. 18

Le systme TAT ............................................................................................... 19

Le systme de type I : systme de type ABC (ATP Binding Cassette)............ 20

Le systme de type II ....................................................................................... 21

Le systme de type III ...................................................................................... 21

Le systme de type IV ...................................................................................... 21

Le systme de type V ....................................................................................... 21

Le systme de type VI...................................................................................... 22


2. Pouvoir pathogne, facteurs de virulence, facteurs dantivirulence......................... 22
a) Lacquisition de gnes de virulence. .................................................................... 22
b) Llimination de gnes dantivirulence................................................................ 23

B.

Les glucanes priplasmiques osmorguls : les OPG .................................................. 25


Les OPG : structure des familles.............................................................................. 25
a) La famille I ........................................................................................................... 25
b) La famille II.......................................................................................................... 26
c) La famille III ........................................................................................................ 26
d) La famille IV ........................................................................................................ 26
2. Synthse des OPG chez E. coli et E. chrysanthemi et leur rgulation ..................... 28
3. Rle et impact sur la virulence ................................................................................. 31
1.

C.
1.

Les systmes deux composants et les phosphorelais................................................. 34


Structure ................................................................................................................... 34
a) Le capteur ............................................................................................................. 34

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

b)
c)
2.
3.
4.
5.
D.

Le rgulateur ........................................................................................................ 34
Les phosphorelais ................................................................................................. 35
La perception du signal ............................................................................................ 36
Le paradigme EnvZ-OmpR ...................................................................................... 37
Une rponse gradue ................................................................................................ 38
Rle dans la virulence .............................................................................................. 40

Le phosphorelais : RcsCDB ......................................................................................... 45


RcsCDB.................................................................................................................... 45
a) RcsC ..................................................................................................................... 45
b) RcsD ..................................................................................................................... 45
c) RcsB ..................................................................................................................... 45
d) RcsA ..................................................................................................................... 47
2. Protines interagissant avec le phosphorelais Rcs ................................................... 47
a) RcsF...................................................................................................................... 47
b) IgaA ...................................................................................................................... 47
c) DjlA...................................................................................................................... 49
3. Autres lments interagissant avec le phosphorelais Rcs ........................................ 49
4. Les gnes cibles du systme Rcs.............................................................................. 50
5. La mutation suppressive rcsC2 ................................................................................ 51
1.

E.

Le modle dtude : Erwinia chrysanthemi 3937 ........................................................ 53


1. Structure de la paroi de la plante hte ...................................................................... 53
2. Mcanismes de virulence ......................................................................................... 55
Objectifs .......................................................................................................................... 60

.
Partie I Contribution la caractrisation du locus gan impliqu dans lutilisation
des galactanes chez Erwinia chrysanthemi. .......................................................................... 61
A.

Caractrisation du locus gan chez Erwinia chrysanthemi............................................ 61


1. Identification du locus .............................................................................................. 61
2. Caractrisation du locus : utilisation des galactanes et de leurs drivs .................. 64
a) Caractrisation des activits galactanases ............................................................ 64

GanA : lendo-1,4--galactanase...................................................................... 64

GanB : lexo-1,4--galactanase........................................................................ 67
b) Caractrisation du systme de transport des galactanes....................................... 68

B.

Rgulation des gnes gan. ............................................................................................ 69


1. Effet de la source de carbone sur lexpression des gnes gan ................................. 69
a) Effet des conditions de culture sur lexpression des fusions transcriptionnelles . 69
b) Effet des conditions de culture sur lactivit endo-1,4--galactanase.................. 75

Effet sur lactivit de GanA ............................................................................. 75

Effet sur la fusion transcriptionnelle ganA::uidA............................................. 75


c) Effet des conditions de culture sur lactivit exo-1,4--galactanase.................... 75
2. Effet de la phase stationnaire sur lexpression des gnes gan.................................. 76
3. Effet de GanR sur lexpression des gnes gan ......................................................... 78
4. Rle du locus gan dans linfection de lhte............................................................ 79
a) Impact sur la virulence ......................................................................................... 79
b) Expression du locus lors de linfection ................................................................ 79

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C.

Relation entre le locus gan, les OPG et le systme RcsCDB....................................... 81

D.

Conclusion et discussion .............................................................................................. 82

.
Partie II - Rle du systme deux composants RcsCDB dans le pouvoir pathogne
dErwinia chrysanthemi et lien existant entre les OPG et le systme RcsCDB. ................ 87
A.

Impact du systme RcsCBD sur le pouvoir pathogne dErwinia chrysanthemi. ....... 87


1. Effet des mutations dans le systme Rcs (rcsC2, rcsC, rcsD, rcsB, rcsCBD et
rcsF) dans les contextes sauvage et opgG........................................................................ 87
a) Effet des mutations sur la mucosit...................................................................... 89
b) Effet des mutations sur la motilit........................................................................ 89
c) Effet des mutations sur lactivit pectinase.......................................................... 90
d) Effet des mutations sur la rsistance aux sels biliaires......................................... 90
e) Effet des mutations sur la virulence ..................................................................... 91
f) Bilan des mutations .............................................................................................. 92
2. Caractrisation de la mutation rcsC2 ....................................................................... 94
a) Effets des mutations sur les fusions transcriptionnelles....................................... 94

Fusion flhD-uidA .............................................................................................. 94

Fusion ftsA-uidA............................................................................................... 96
b) La souche rcsC2 opgG ne peroit plus le choc osmotique .................................. 97
c) Dominance de la mutation rcsC2 ......................................................................... 99

Clonage du locus rcsCBD ................................................................................ 99

Phnotype du mrodiploide : opgG, rcsC2, miniTn5rcsCBD ......................... 99

Test de motilit............................................................................................... 100

Virulence du mrodiplode............................................................................. 100


3. Expression dune version soluble de la lipoprotine RcsF : TAT-RcsF ................ 101
a) Construction de la version soluble : TAT-RcsF................................................. 101
b) Caractrisation de la structure de la protine : mutations des cystines ............ 103
c) Dtermination par dltion de la partie active de RcsF...................................... 105
d) Impact des mutations et des dltions dans TAT-rcsF sur lexpression de la
fusion cpsB-lacZ......................................................................................................... 106
e) Surexpression transitoire par le plasmide pNFW177 (contenant TAT-rcsF) chez
E. chrysanthemi .......................................................................................................... 108
4. Effet de la surexpression des gnes TAT-rcsF, igaA, djlA ..................................... 109
a) Surexpression chez E. coli ................................................................................. 109
b) Surexpression chez E. chrysanthemi : phnotypes sur bote.............................. 109

La mucosit .................................................................................................... 110

La motilit ...................................................................................................... 111


c) Surexpression chez E. chrysanthemi : dosage de la fusion ftsA-uidA ................ 112
d) Virulence ............................................................................................................ 113

Test de virulence sur les tubercules de pomme de terre................................. 113

Test de virulence sur les feuilles dendive. .................................................... 115


e) Bilan des surexpressions .................................................................................... 116

B.

Relation entre les OPG et le systme Rcs .................................................................. 117


1. Construction de paraBAD opgGH.............................................................................. 117
2. Effet de la variation de la quantit des OPG .......................................................... 118
a) Sur un des gnes cibles du systme Rcs : la fusion ftsA-uidA............................ 118
b) Sur la fusion opgG-uidA..................................................................................... 121

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C.

Conclusion et Discussion ........................................................................................... 122

Discussion globale......................................................................................................... 133

Matriels et mthodes .................................................................................................. 137


A.
1.
2.
3.

Souches et milieux ..................................................................................................... 137


Milieux de culture et conditions de croissance des bactries ................................. 137
Gnotypes des souches utilises............................................................................. 138
Plasmides utiliss ................................................................................................... 141

1.
2.
3.
4.

Techniques gntiques ............................................................................................... 144


Transduction........................................................................................................... 144
Conjugaison (pUT et pOK) .................................................................................... 144
Transformation ....................................................................................................... 144
Electroporation ....................................................................................................... 144

1.
2.
3.
4.

Techniques de biologie molculaire........................................................................... 145


Extraction et purification dADN : plasmide, bande, ADNg ................................. 145
Enzymes de restriction et de modification ............................................................. 145
Raction de polymrisation en chane (PCR et PCR inverse) ............................... 146
Squenage............................................................................................................. 147

B.

C.

D.

Clonage molculaire : Etude du systme Gan............................................................ 148


1. Construction des mutants ganA.............................................................................. 148
2. Construction des mutants ganB.............................................................................. 149
3. Construction du mutant ganL ................................................................................. 149
4. Construction du mutant ganE................................................................................. 149
5. Construction du mutant ganK ................................................................................ 149
6. Construction des mutants ganR.............................................................................. 149
7. La mutation crp ...................................................................................................... 150

E.

Clonage molculaire : Etude du systme Rcs ............................................................ 150


1. Clonage du locus rcsCBD ...................................................................................... 150
2. Constructions des mutants (rcsC, rcsD, rcsCBD, rcsB, rcsF).............................. 151
a) Construction des mutants rcsC et rcsD .............................................................. 151
b) Dltion du locus rcsCBD : rcsCBD ............................................................... 152
c) Construction du mutant rcsB.............................................................................. 152
d) Construction du mutant rcsF.............................................................................. 153
3. Construction des fusions transcriptionnelles.......................................................... 153
a) Construction de la fusion ftsA-uidA ................................................................... 153
b) Construction de la fusion flhD-uidA................................................................... 154
c) Construction de la fusion cpsB-uidA .................................................................. 154
4. Clonage de TAT-rcsF, djlA, igaA ........................................................................... 155
a) Clonage de TAT-rcsF ......................................................................................... 155
b) Clonage de djlA .................................................................................................. 156
c) Clonage de igaA ................................................................................................. 156
5. Les mutations dans TAT-rcsF ................................................................................ 157
a) Mutant TAT-rcsF C75S ...................................................................................... 157
b) Mutant TAT-rcsF C110S .................................................................................... 157

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

c)
d)

Mutant TAT-rcsF C119S .................................................................................... 157


Mutant TAT-rcsF C125S .................................................................................... 157

F.

Techniques de biochimie............................................................................................ 157


1. Dosage des protines .............................................................................................. 157
2. Dosage des activits -galactosidase, -glucuronidase et -glucuronidase ........... 158
3. Test phnotypiques : pectinase, cellulase, protase et galactanase ........................ 158

G.

Test de virulence ........................................................................................................ 159


Rfrences ..................................................................................................................... 160

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Remerciements

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Remerciements
Ce travail a t ralis au sein de lunit de Glycobiologie Structurale et Fonctionnelle
(UMR8576 CNRS) de luniversit des Sciences et Technologies de Lille dans lquipe de
Gntique des Enveloppes Bactriennes sous la direction de Monsieur le Professeur
Jean-Pierre Bohin.
Je tiens remercier Monsieur Alain Filloux et Monsieur Jean-Claude Lazzaroni davoir
accept dtre les rapporteurs de ce travail, Monsieur Jean-Marie Lacroix et Monsieur
Anthony Pugsley dexaminer ma thse et Monsieur Jean-Claude Michalski de prsider le jury.
Je remercie Jean-Pierre Bohin de mavoir accueillie dans son quipe, de mavoir
encadre pendant cette thse et davoir partag son savoir. Merci davoir attendu la fin de ma
thse pour partir en retraite
Merci Carmen dberg-Ferragut pour notre travail en collaboration, pour toutes ces
discussions et notre qute de la mucosit. Merci Aurlie Delangle et Nicole Hugouvieux
Cotte-Pattat pour le travail en collaboration sur le sujet gan . Merci Gilles Boussemart
pour le travail en quipe sur le sujet Et si on faisait varier la quantit dOPG ? .
Un grand merci tous ceux qui font partie ou qui sont passs par lquipe de gntique
des enveloppes bactriennes : Jean-Marie Lacroix, notre nouveau chef, pour toutes nos
discussions scientifiques et gastronomiques, Virginie Cogez pour mavoir encadre en Master
recherche et pour sa bonne humeur et Olivier Vidal pour son intarissable sens de la
conversation. Merci aux tudiants du labo : Franck Bouchart, Eglantine Titoune Rollet,
Aurlie Delangle, Gilles Boussemart et Galle Ezeque pour tous les bons moments passs au
labo. Enfin Merci Jacqueline Dondeyne de soccuper de nous et Peggy Gruau pour son
amiti, tu vas devoir me supporter lanne prochaine
Merci tous les membres du C9 pour leur accueil, leur aide et leur sympathie. Un merci
tout particulier Brigitte Delrue, pour son soutien, ses conseils et son accompagnement dans
notre insertion dans la vie professionnelle.
Merci mes amis de mavoir encourage et supporte pendant cette thse : Lolotte,
la bibi de mon chri (si si Aline), Vivi et Gaby (Une petite belote ??), Maion et Fab, Xav et
Julie, Aurore et tous les autres Un gros bisou mes fous de Paris : Caro et Virz, Nath,
Cyrille, Lolo et Vanou, on na pas pu se voir autant que jaurai voulu mais la BAC est & sera
toujours au taquet

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Merci mes parents, Gat et Lulu, Mathias et Tinca et toute la famille pour vos
encouragements, votre soutien et pour tout le reste. Vive les voyages en famille, Do Brasil
On remet a quand ? Un bisou et une pense pour mes grands parents, merci pour tous vos
gnes scientifiques. Merci aussi la famille Boussemart pour leur soutien et leur accueil dans
la famille.
Le meilleur pour la fin, merci Gilles pour ton soutien, tes petits plats et ton amour !
Lanne prochaine cest ton tour, jespre pouvoir te soutenir autant que tu mas soutenue.

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Introduction

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Introduction
A. Lenveloppe des protobactries
1. Lenveloppe des bactries
Lenveloppe des protobactries est compose de deux membranes : la membrane interne et la
membrane externe permettant la dlimitation dun compartiment part entire : le priplasme
(figure 1). Lenveloppe des protobactries est essentielle puisquelle est un lieu dchanges
et de communication avec le milieu extrieur. Cest au sein de cette enveloppe que la bactrie
prsente de nombreux lments lui permettant de sadapter lenvironnement.

Figure 1: Schma de lenveloppe chez les Protobactries, daprs Raetz (1986).

a)

La membrane interne

La double couche lipidique

La membrane interne ou cytoplasmique spare le cytoplasme de lenvironnement, cest une


barrire hydrophobe slective empchant un passage des molcules polaires et permettant
ainsi une accumulation de mtabolites et de protines. Sa structure, sa composition et le rle

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

des protines sont proches de ceux des eucaryotes. Elle est compose 50% dune double
couche lipidique et 50% de protines aux fonctions diverses. La double couche lipidique se
compose

de

espces

majeures

de

phospholipides :

environ

75%

de

phosphatydilethanolamine (PE), environ 20% de phosphatidylglycrol (PG) et environ 5% de


cardiolipides (CL) (Boom et Cronan, 1989). Leur proportion varie selon la souche et son tat
physiologique. Ils sont constitus de glycrol-3-phosphate estrifi par 2 acides gras (position
1 et 2). Les acides gras sont essentiellement de lacide palmitique, de lacide palmitolique, de
lacide myristique et de lacide cis-vaccnique. La longueur et la saturation de ces acides gras
varient avec les conditions environnementales comme la temprature, la phase de croissance,
la composition du milieu de croissance etc. (Kadner, 1996). La composition en
phospholipides de la membrane interne influence de nombreux systmes comme la
translocation des protines, la rplication du chromosome, la rsistance aux antibiotiques
(Kadner, 1996). Ces phospholipides servent galement des prcurseurs dautres lments. En
effet, les OPG (Cf. le chapitre B : Les glucanes priplasmiques osmorguls : les OPG)
prsentent des substitutions par le phosphoethanolamine (PE) et le phosphoglycerol (PG)
provenant de la double couche lipidique (Van Golde et coll., 1973) ou encore le transfert de
phosphoethanolamine sur le lipopolysaccharide.

Les protines de la membrane interne

Elles sont plus dune centaine au niveau de la membrane interne. Leur nombre et leur quantit
varient en fonction de la phase de croissance et les conditions environnementales, permettant
ainsi une adaptation aux changements environnementaux (Sato et coll., 1977).
La membrane interne intervient dans un grand nombre de fonctions dont la production
dnergie, le transport de mtabolites, la translocation des macromolcules de lenveloppe ou
encore dans la rplication et la sgrgation des chromosomes. Cette membrane est le sige de
nombreuses synthses comme celle du lipopolysaccharide, du peptidoglycane, des
phospholipides, des exopolysaccharides (EPS) et des OPG.
Parmi les protines de la membrane interne, on retrouve galement des protines impliques
dans la transduction des signaux environnementaux, tels que la prsence de nutriments,
losmolarit etc. Les signaux capts par lenveloppe sont transmis au cytoplasme par
lintermdiaire de systmes deux composants (comprenant un capteur transmembranaire et
un rgulateur cytoplasmique) permettant une adaptation aux variations environnementales.

2009 Tous droits rservs.

10

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Nous dvelopperons ces systmes ultrieurement (Cf. le chapitre C : Les systmes deux
composants).

b)

La membrane externe

La membrane externe permet de protger les bactries contre des agressions du milieu
extrieur comme les antibiotiques, les dtergents, les molcules de dfense de la cellule
infecte, une variation de temprature ou un choc osmotique. De petits composs hydrophiles
peuvent passer cette membrane grce des transporteurs (spcifique ou non).
La membrane externe des bactries Gram ngatif comprend 2 feuillets avec des
compositions totalement diffrentes et des protines.

La double couche lipidique

Le feuillet interne est constitu de phospholipides similaires ceux retrouvs dans la


membrane interne (PE, PG et CL).
Le feuillet externe est compos de lipopolysaccharide (LPS) (figure 1 et 2). Le LPS est
constitu de 3 parties (Raetz, 1986):

une partie hydrophobe : le lipide A. Le lipide A est form de 2 rsidus de glucosamine

phosphate substitus par des rsidus dacides gras (saturs pour la plupart).

une partie hydrophile oligosaccharidique centrale : le noyau. Il est compos par 2 sucres

spcifiques : lacide 3-dsoxy-D-manno-octulosonique (le KDO) et un heptose (le L-glycroD-manno-heptose), puis dautres sucres qui peuvent varier selon lespce (le glucose, le
galactose et la N-actyl-D-glucosamine).

une partie hydrophile polysaccharidique distale : lantigne O. Il est compos dunits

rptes de glucides (3 5 rsidus selon les souches) et nest pas toujours prsent.
Le LPS joue donc un rle structural important pour lenveloppe ainsi quun rle important
dans la relation hte-bactrie.

2009 Tous droits rservs.

11

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 2: Modle structural du lipopolysaccharide chez les entrobactries (Kastowsky


et coll., 1992).

Les protines de la membrane externe

La membrane externe, bien que trs paisse, est trs permable grce la prsence de
nombreuses protines : les OMP (Outer Membrane Proteins). Elles sont diffrentes de celles
de la membrane interne et comportent plusieurs types :

Les porines sont les protines majoritaires de la membrane externe. Elles forment des

pores relativement peu spcifiques permettant le passage de molcules hydrophiles travers


la membrane externe. Les plus rpandues sont les porines OmpF, OmpC et PhoE. Elles
sorganisent en homotrimres. Les porines OmpF et OmpC sont toujours produites mais en
quantit variable en fonction des conditions environnementales comme losmolarit et la
temprature. En effet, les gnes ompF et ompC sont rguls principalement par un systme
deux composants OmpR-EnvZ (Hall and Silhavy, 1981). Cette rgulation sera dveloppe
dans la partie sur les systmes deux composants puisque le systme OmpR-EnvZ en est le
paradigme. Il existe galement des porines slectives impliques dans la diffusion de sucres

2009 Tous droits rservs.

12

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

ou de mtaux comme LamB, porine implique dans le transport des maltodextrines et du


maltose chez E. coli ou encore KdgM qui permet lentre doligogalacturonates (produits de
dgradation de la pectine) travers la membrane dE. chrysanthemi (Blot et coll., 2002). Ces
porines peuvent servir de rcepteur des phages (ex : LamB chez E. coli, est le rcepteur du
phage lambda).

La protine OmpA est une protine majeure de la membrane externe. Elle est

monomrique et aurait une fonction structurale. En effet, elle possde un domaine N-terminal
ancr dans la membrane externe et un domaine C-terminal localis dans le priplasme qui
pourrait interagir avec le peptidoglycane (Mot & Vanderleyden, 1994). Elle permettrait
lintgrit de la membrane externe.

On trouve galement des protines mineures dont la synthse est inductible. Elles

regroupent notamment les protines impliques dans les systmes de scrtion. Nous
dvelopperons ce point par la suite (Cf. e. Structure traversant lenveloppe : les systmes de
transport). Il existe galement des rcepteurs haute affinit qui sont capables de capter des
molcules prsentes dans le milieu extrieur une faible concentration, par exemple la
protine BtuB chez E. coli, le rcepteur de la vitamine B12.

Les lipoprotines sont majoritairement ancres dans le feuillet interne de la membrane

externe par un lipide en N-terminal (un rsidu cystine en position N-terminale est substitu
par des acides gras permettant lancrage), dautres peuvent tre localises dans la membrane
interne (figure 3). La mise en place des lipoprotines fait intervenir plusieurs tapes. La
modification de la lipoprotine intervient aprs la translocation du cytoplasme la membrane
interne (feuillet priplasmique) de la lipoprotine prcurseur par lintermdiaire du systme
Sec. Cette tape permet davoir lancrage dans la membrane de la lipoprotine par un lipide
en position N-terminal et le clivage de la squence signal. Une fois ancre dans la membrane
interne, elles peuvent tre transportes dans le feuillet interne de la membrane externe. Sur les
90 lipoprotines prdites chez E. coli, seule une dizaine sont prdites pour tre localises dans
la membrane interne (Narita & Tokuda, 2006). Le transport de la lipoprotine vers la
membrane externe fait intervenir un systme de transport de type ABC : le systme Lol
(figure 3). Les lipoprotines sont dtaches de la membrane interne par le transporteur
LolCDE en prsence de la protine priplasmique LolA. Le complexe LolA-lipoprotine va
interagir avec la lipoprotine LolB (localise dans la membrane externe). La lipoprotine va
tre transfre la lipoprotine LolB, qui va permettre lincorporation de la lipoprotine dans
le feuillet interne de la membrane externe. La plus connue est la lipoprotine de Braun qui
existe en trs grand nombre de copies dans la bactrie. Prs dun tiers de cette lipoprotine est

2009 Tous droits rservs.

13

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

lie de faon covalente au peptidoglycane par son extrmit C-terminale priplasmique


permettant une fois de plus la stabilit de la membrane externe (Nikaido, 1996). Une autre
lipoprotine importante est la lipoprotine LolB implique dans la mise en place des
lipoprotines dans la membrane externe. Il existe galement des lipoprotines impliques dans
la signalisation des systmes deux composants. Nous dvelopperons ce point avec la
lipoprotine RcsF intervenant dans la signalisation du systme deux composants RcsCDB
(Cf. chapitre D : Le phosphorelais Rcs).

Figure 3 : Systme de transport Lol permettant la localisation des lipoprotines dans la


membrane externe. In et Out reprsentent respectivement les lipoprotines
spcifiques de la membrane interne et spcifiques de la membrane externe (Narita & Tokuda,
2006).

c)

Le priplasme

Ce compartiment est dlimit par la membrane interne et la membrane externe. Il reprsente


environ 20 40 % du volume cellulaire (Stock et coll., 1977). Il formerait une sorte de gel
visqueux (Hobot et coll., 1984). Le priplasme contient 2 types de glucanes spcifiques des
bactries : la couche de peptidoglycane et les glucanes priplasmiques osmorguls (OPG). Il
contient galement de nombreuses protines (figure 1).

Le peptidoglycane

Le peptidoglycane (figure 4), galement appel murine, est un htropolymre compos de


chanes glycaniques (avec un motif disaccharidique rpt de N-actylglucosamine et dacide

2009 Tous droits rservs.

14

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

N-actylmuramique lis en -1,4) relies entre elles par des peptides. Ces liaisons permettent
au peptidoglycane de former un rseau dense autour de la cellule. Il permet de protger la
cellule des pressions osmotiques, dtermine sa forme et sa taille puisque la cellule sallonge et
se divise uniquement si le peptidoglycane sest largit. Ceci contribue laspect visqueux du
priplasme.

Figure 4 : Structure du peptidoglycane dEscherichia coli.


Les chanes glycaniques sont constitues dune alternance de rsidus N-actylglucosamine et
dacide N-actylmuramique lis en -1,4 et se terminent par un rsidu dacide Nanhydroactylmuramique (1,6-anhydroMurNAc). La marque jaune reprsente une sous unit
compose dun disaccharide et dun tetrapeptide (Vollmer et coll., 2008).

Les glucanes priplasmiques osmorguls

Les glucanes priplasmiques osmorguls (OPG) sont des oligosaccharides prsents dans le
priplasme des Protobactries. Leur quantit dpend de losmolarit du milieu, en effet, plus
losmolarit est faible plus la quantit dOPG est importante. Nous dcrirons ces glucanes
ultrieurement (Cf. le chapitre B : Les glucanes priplasmiques osmorguls : les OPG).

Les protines priplasmiques

Elles peuvent tre classes par groupe fonctionnel :


-

dans la synthse des constituants de lenveloppe et leur assemblage, comme le


peptidoglycane, le LPS, la capsule et les OPG ou encore comme le systme Lol
impliqu dans le transport des lipoprotines vers la membrane externe.

2009 Tous droits rservs.

15

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dans la mise en conformation des protines comme DsbA, DsbC qui catalysent la
formation des ponts disulfures.

dans la scrtion de protines ou de polysaccharides extracellulaires.

dans mise en place des flagelles et/ou des pilis.

dans la nutrition par le transport entrant et/ou la dgradation de nutriments. Ces


enzymes cataboliques vont dgrader des molcules complexes en prcurseurs simples
utilisables par la cellule.

dans la dtoxication par la dgradation et/ou le transport sortant de toxiques qui ont
russi traverser la membrane externe (exemple : la -lactamase).

dans la signalisation par la perception et la transmission dinformations externes,


* pour le chimiotactisme et la motilit (en particulier par les flagelles),
* pour ladaptation physiologique aux conditions de lenvironnement.

d)

Structures associes lenveloppe

Les bactries ont plusieurs types de structures associes lenveloppe : la capsule, les
flagelles et les pilis.

La capsule

Elle est associe la membrane externe et se compose dexopolysaccharides de haut poids


molculaire. Cette structure nest pas constante. En effet, la synthse est conditionnelle et
dpend du milieu de croissance, des conditions environnementales. Ces exopolysaccharides
sont des dterminants antigniques comme par exemple lantigne K et lantigne M (acide
colanique) chez E. coli. La capsule est essentielle pour la bactrie dans son environnement,
car elle est le dterminant majeur de sa capacit coloniser une niche particulire. Cest
galement un lment intervenant dans la dfense de la bactrie contre la phagocytose (Vimr
et coll., 1995). Les bactries prsentant une capsule sont glissantes et chappe la
phagocytose. La capsule est donc un facteur de virulence. Chez E. coli et chez E.
chrysanthemi, la synthse des exopolysaccharides est gouverne par les gnes cps ( capsular
polysaccharide synthesis ). Les gnes cps sont fortement rguls selon les conditions
environnementales telles que la temprature, losmolarit Une augmentation de
lexpression de ces gnes confre une colonie un aspect muqueux. Nous aborderons une
partie de la rgulation des gnes cps par la suite.

2009 Tous droits rservs.

16

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Les flagelles

Ce sont des appendices sortant de la membrane externe, au del de la capsule. Le flagelle est
lorgane de locomotion des bactries. Le flagelle est compos de trois parties (figure 5) : un
moteur appel le corps basal, dun crochet et dun filament qui stend dans le milieu de 5
10m.

Figure 5 : schma reprsentant un flagelle (daprs Aizawa & Kubori, 1998)


Les bactries flagelles sont distingues par le nombre et la position des flagelles, par
exemple, Pseudomonas ne possde quun flagelle polaire alors quE. coli est
pritriche (plusieurs flagelles rparties sur toute la surface de la bactrie). Le flagelle permet
la bactrie de se dplacer vers un lieu favorable sa croissance ou de sloigner du milieu
hostile. Ce filament permet alors le phnomne de nage ou un phnomne de culbute en
fonction du sens de rotation du filament sur lui-mme. Le changement de sens de la rotation
dpend du moteur qui rpond alors aux stimuli environnementaux comme le gradient de
concentration dun attractif ou dun rpulsif, cest le chimiotactisme.

Les pilis

Les pilis, galement appels fimbriae, sont le second type de structure protique se dployant
au del de la surface bactrienne. Ce sont des organites permettant lattachement aux surfaces
constitus de protines structurales nommes pilines. Il existe plusieurs types de pilis par
exemple :

les pilis communs de type I permettent lattachement de la bactrie une autre interface

comme les cellules eucaryotes, et joue donc un rle dans les interactions hte-pathogne. Ils
prennent naissance dans la membrane externe.

Les pilis sexuels jouent un rle essentiel dans la conjugaison bactrienne, puisquils

permettent lattachement initial des partenaires.

2009 Tous droits rservs.

17

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Les pilis de type IV prennent naissance dans la membrane interne.

e)

Structures traversant lenveloppe : les systmes de transport

La bactrie a de nombreux systmes traversant lenveloppe. Ils sont utiliss pour le transport
ou la scrtion de protines. Il y a 2 systmes de transports : le systme Sec (majoritaire) et un
minoritaire : le systme TAT (figure 6).

Le systme Sec

Le systme Sec est le systme majeur de translocation des protines qui permet la
translocation des protines de la membrane externe et du priplasme travers la membrane
interne. Dans ces deux cas, il est ncessaire davoir une squence signal en N-terminal. Ce
systme permet galement ladressage de protines ayant un large domaine priplasmique
dans la membrane interne

Figure 6: Schma des systmes de transport Sec et TAT chez E. coli. (a) Acheminement
co-traductionnel et (b) post-traductionnel et translocation de protines non conformes par la
translocase Sec. (c) Translocation des prcurseurs protiques conforms par la translocase
TAT (Natale et coll., 2007).

2009 Tous droits rservs.

18

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le systme TAT

Le systme de scrtion TAT (twin arginine translocation system) est impliqu dans la
scrtion de protines priplasmiques. Ce systme permet le passage travers la membrane de
protines dj conformes et ayant souvent fix un cofacteur. Le systme TAT est compos
de 5 protines : TatABCDE chez E. coli. La reconnaissance de la protine transloquer
seffectue grce un peptide signal dit 2 arginines localises en N-terminal (le motif
reconnu est SRRXFLK). Le systme TAT permet notamment la scrtion de la protine
OpgD qui joue un rle dans la biosynthse des OPG (cf. chapitre B : Les Glucanes
Priplasmiques Osmorguls : les OPG) (Stanley et coll., 2001).

Plusieurs systmes permettent la scrtion des protines : Les systmes de scrtion de type I,
II, III, IV, Va et Vb (figure 7).

Figure 7 : Schma reprsentant les principaux systmes de scrtion des protines chez
les protobactries (Filloux et coll., 2008).

2009 Tous droits rservs.

19

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le systme de type I : systme de type ABC (ATP Binding Cassette)


(figure 7 et 8)
Le systme de scrtion de type I permet la scrtion de protines vers le milieu
extrieur en utilisant la force protonmotrice. Cest le cas de la scrtion dhmolysine (HlyA,
toxine extracellulaire produite par certaines souches dE. coli) qui ncessite le produit de trois
gnes: hlyD, hlyB, tolC.
Ce type de systmes permet galement la rsistance de multiples agents
antimicrobiens comme le systme de transport AcrAB/TolC qui va permettre dtablir un
tunnel travers les deux membranes bactriennes, afin dliminer certaines drogues entres
dans le priplasme ou le cytoplasme. Chez Erwinia amylovora, il a t montr que lors de
linfection, la bactrie est expose une varit de composs antimicrobiens produits par la
plante : les phytoalexines. Lexistence de transporteurs defflux multidrogues de type
AcrAB/TolC confre E. amylovora la rsistance ces composs antimicrobiens (Burse et
coll., 2004).

Figure 8 : (1) La toxine HlyA est exporte dE. coli sans intermdiaire priplasmique
par un systme de scrtion comprenant une translocase nergtique compose de deux
protines : HlyD et lATPase HlyB, et de la protine TolC. (2) Les drogues sont
exportes sans intermdiaire priplasmique par un systme de scrtion comprenant
une translocase compose de deux protines : AcrA et AcrB (antiport proton) et de la
protine TolC.

2009 Tous droits rservs.

20

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le systme de type II (figure 7)

Le systme de scrtion de type II ncessite une premire tape de translocation travers la


membrane interne via le systme Sec ou le systme TAT. La deuxime tape de translocation
seffectue travers la membrane externe et ncessite un systme de transport comprenant 13
15 protines diffrentes. Ce systme est utilis par les bactries qui ne vont pas rentrer dans
les cellules de lhte et permet donc de secrter les enzymes capables dattaquer lhte. Les
pectinases et les cellulases dE. chrysanthemi sont secrtes par ce systme (systme Out).
Ces enzymes seront prsentes dans le chapitre consacr la virulence dE. chrysanthemi (Cf.
le chapitre E : le modle dtude : E. chrysanthemi).

Le systme de type III (figure 7)

Il est rserv aux bactries pathognes et permet dinjecter directement des protines
transloques dans le cytoplasme de la cellule hte parasite. Il prsente de grande analogie
avec le flagelle. Il permet notamment lexportation des protines harpin-like dErwinia
amylovora (Van Gijsegem et coll., 1993).

Le systme de type IV (figure 7)

Le systme de scrtion de type IV prsente de fortes similitudes avec le systme de transfert


dADN par conjugaison. Il ncessite plus de 10 protines. Il y a formation dun canal entre la
bactrie et la cellule hte pour permettre un transfert de substrat dADN ou de protines.

Le systme de type V (figure 7)

Le systme de scrtion de type Va permet la scrtion dune seule protine par le systme et
ne requiert quune seule protine. Cest la mme protine qui effectue son propre transport
dans le milieu extrieur, on parle alors dautotransporteur. Il est retrouv chez de nombreuses
bactries pathognes et permet la scrtion de protases, de toxine et des adhsines. La
protine a alors 3 domaines dintrt : une squence signal permettant le passage de la
protine dans le priplasme, la protine mature qui sera secrte et la partie C-terminale qui
va assurer le transport de la protine mature dans le milieu extrieur. Le systme de scrtion
de type Vb permet la scrtion dune protine travers un pore de la membrane. Ils
contiennent toute linformation pour la translocation travers lenveloppe cellulaire.

2009 Tous droits rservs.

21

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le systme de type VI (figure 8)

Plus rcemment un sixime systme de transport a t dcrit (Filloux et coll., 2008). Ce


systme est probablement une machine de scrtion multiples composants, souvent
impliqus dans les interactions avec lhte, permettrait la scrtion des protines Hcp et
VgrG. Son rle prcis et son mode daction restent toute fois inconnus (Filloux et coll., 2008).

Figure 8: Reprsentation schmatique du systme de scrtion de type VI (T6SS)


(Filloux et coll., 2008).

2. Pouvoir pathogne,
dantivirulence

facteurs

de

virulence,

facteurs

Lvolution des bactries pathognes depuis leur anctre non pathogne est conditionne par
2 lments : lacquisition de gnes de virulence et llimination de gnes dantivirulence. Ces
phnomnes sont essentiels pour une bonne adaptation de la bactrie la nouvelle niche
quelle colonise.

a)

Lacquisition de gnes de virulence.

Lacquisition de gnes de virulence va seffectuer par des transferts horizontaux directement


dautres bactries par conjugaison, par transduction ou par transformation. Lacquisition de

2009 Tous droits rservs.

22

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

plasmide, de prophages ou dlots de pathognicit a bien t tudie. Les lots de


pathognicit sont des groupes de gnes (10 200kb), prsents chez une bactrie pathogne,
absents chez son anctre non pathogne et prsentant des gnes potentiellement impliqus
dans la virulence de la bactrie. Dans le gnome, ils sont dtectables par leur pourcentage en
G+C diffrent du reste du gnome.

b)

Llimination de gnes dantivirulence.

La contribution de la perte de gnes dans lvolution dune bactrie non pathogne vers une
bactrie pathogne est de plus en plus tudie. Ce processus est caus par des mutations
pathoadaptatives qui sont des modifications gntiques permettant une meilleure adaptation
de la bactrie son nouvel environnement. Ces mutations peuvent tre de plusieurs sortes :
mutations ponctuelles, insertion et dltion. Dans certaines conditions, pour permettre une
meilleure adaptation la nouvelle niche, il y a une grande dltion dans le gnome contenant
les gnes dantivirulence, on parle alors de trou noir . Pour quun gne soit appel gne
dantivirulence, il faut que son expression soit incompatible avec la virulence de la bactrie.
Nous pouvons citer lexemple de la bactrie Shigella qui a volu dE. coli par lajout de
plasmide de virulence, de transferts latraux dlots de pathognicit (SH1 et SH2) et par la
perte de gnes dantivirulence cadA et avl (figure 9). Il a t montr que le gne cadA tait
absent de toutes les espces de Shigellae, que les souches dE. coli enteroinvasives ne
prsentaient pas non plus ce gne (alors que les souches commensales lexpriment) et que
lexpression du gne cadA chez Shigella entranait une diminution de la production
denterotoxine. Le gne cadA prsente donc toutes les caractristiques du gne
dantivirulence.
Dans certains cas, les mutations pathoadaptatives permettent la bactrie dexprimer les
gnes uniquement dans un certain contexte environnemental. Un exemple de mutations
pathoadaptatives est le niveau dexpression de gnes de virulence chez Shigella. La bactrie
pathogne a acquis des gnes de virulence (sur un plasmide) qui sont sous le contrle dun
rgulateur prsent dans la souche ancestrale et dont la rgulation dpend de la temprature
(activ 37C et inhib des tempratures plus basses). Ainsi les gnes de virulence sont
exprims que lorsque la temprature sapproche de 37C, soit la temprature laquelle la
bactrie est dans lhte. Ainsi elle nexprime les gnes de virulence que lorsquelle est dans
lhte.

2009 Tous droits rservs.

23

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 9 : Modle dvolution de Shigella depuis son anctre E. coli (Maurelli, 2007).
Des transferts de gnes horizontaux et des mutations pathoadaptatives sont reprsents. SHI-1
et SHI-2 sont des lots de pathognicit acquis par Shigella et se localisent sur le
chromosome. cadA et avl reprsente les gnes dantivirulence codant la lysine dcarboxylase
et une protine encore inconnue.

Les pathognes voluent donc par diffrentes tapes successives qui peuvent tre des
acquisitions de gnes de virulence par transferts horizontaux et mutations pathoadaptatives
qui engendrent linactivation ou la perte dexpression de gnes incompatibles avec la
virulence (gne dantivirulence). La virulence est donc le rsultat complexe de lexpression
des gnes de virulence et de linhibition de lexpression des gnes dantivirulence.

2009 Tous droits rservs.

24

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

B.

Les glucanes priplasmiques osmorguls : les OPG

Les OPG sont des oligosaccharides prsents chez la majorit des entrobactries. Ils
reprsentent de 0,5% ( haute osmolarit) 5% ( faible osmolarit) du poids sec des
bactries. A ce jour, les OPG sont le seul lment priplasmique connu dont la synthse est
induite faible osmolarit.

1. Les OPG : structure des familles


Les OPG sont prsents chez de nombreuses espces bactriennes, leur structure prsente
plusieurs points communs :

Le seul sucre constituant les OPG est le D-glucose.

Les units de glucose sont majoritairement lies par des liaisons -glycosidiques.

Le nombre dunit de glucose est limit : de 5 24 rsidus

La concentration des OPG dans le priplasme augmente en rponse une diminution


de losmolarit du milieu extrieur.

Le squelette glycosidique peut tre dcor de diffrents substituants en fonction de lespce.


Ils appartiennent deux classes :

Des substituants originaires des phospholipides de la membrane comme le


phosphoglycrol, la phosphothanolamine, ou la phosphocoline.

Des substituants originaires du mtabolisme intermdiaire comme lactyle, le


succinyle ou le mthylmalonyle. Pour cette classe, lacyl-coenzyme A semble devoir
tre la molcule donatrice.

La structure des OPG a t dcrite pour plusieurs bactries des subdivisions , et des
protobactries. Les OPG sont ainsi diviss en 4 familles structurales dont la classification a
t effectue sur la base de lorganisation du squelette glucidique (Bohin, 2000).

a)

La famille I

Les OPG de la famille I sont retrouvs chez E. coli (Kennedy, 1996), Pseudomonas syringae
(Talaga et coll., 1994), Erwinia chrysanthemi (Cogez et coll., 2001), Salmonella enterica
serovar typhimurium (F. Norel, V. Robbe-Saule, A. Bohin et J.-P. Bohin, rsultats non
publis) et P. aeruginosa (Y. Lequette et coll., 2007). Les structures des OPG de ces espces
sont trs similaires. Chez E. coli, les OPG sont htrognes en taille : de 5 12 rsidus de
glucose et dont les espces les plus reprsentes comportent 8 ou 9 glucoses (Figure 10). Le

2009 Tous droits rservs.

25

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

squelette est form par une chane linaire de glucoses lis en -1,2 et prsentant des
ramifications lies en -1,6. Lhtrognit des OPG est accentue par lhtrognit des
substituants venant sy greffer. En effet, les OPG d E. coli sont substitus par du
phosphoglycrol, de la phosphothanolamine et du succinate (Kennedy, 1996), ceux
dE. chrysanthemi sont plus faiblement substitus et uniquement par du succinate et de
lactate (Cogez et coll., 2001) alors que ceux de P. syringae ne sont pas du tout substitus
(Talaga et coll., 1994). Chez S. enterica, le succinate est le substituant majeur.

b)

La famille II

Les OPG de la famille II sont retrouvs chez plusieurs membres des Rhizobiaces abortus
(Breedeveld et Miller, 1994) comme Agrobacterium, Rhizobium, Sinorhizobium ou encore
Brucella (Briones et coll., 1997; Choma et Komaniecka, 2003). Ils sont cycliques et se
composent de 17 25 rsidus de glucose lis en -1,2 (Figure 10). Ils peuvent tre substitus
majoritairement par du phosphoglycrol mais galement par du succinate et du
mthylmalonate. Le degr de substitution peut varier fortement parmi ces espces.

c)

La famille III

Les premiers OPG dcrits pour cette famille sont ceux de Bradyrhizobium japonicum
(appartenant la famille des Rhizobiaces). Ils comprennent 10 13 glucoses et sont
cycliques grce aux liaisons -1,6 et -1,3 (Rolin et coll., 1992; Breedveld et Miller, 1994)
Les OPG reprsents sur la figure 10 sont ceux de Azospirillum brasilense (Altabe et coll.,
1994) (Figure 10). Des OPG trs similaires ont t retrouvs chez Azorhizobium caulinodans
(Komaniecka et Choma, 2003). Les OPG de cette famille sont majoritairement non chargs
mais les OPG de Bradyrhizobium japonicum peuvent toute fois tre substitus par de la
phosphocholine (Rolin et coll., 1992).

d)

La famille IV

Ils sont retrouvs chez Ralstonia solanacearum (Talaga et coll., 1996), Xanthomonas
campestris (York, 1995, Talaga et coll., 1996) et Rhodobacter sphaeroides (Talaga et coll.,
2002). Ils sont cycliques et peuvent possder 3 degrs de polymrisation selon lespce: 13,
16 et 18 rsidus de glucose lis en -1,2 et une liaison en -1,6 permet de confrer aux OPG
cette structure cyclique (Figure 10). Les OPG de X. campestris et de R. solanacearum ne sont

2009 Tous droits rservs.

26

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

pas substitus contrairement ceux de R. sphaeroides qui peuvent prsenter de 1 7 succinyl


et 1 2 acetyl.
Ainsi les OPG sont trs htrognes parmi les espces bactriennes, puisquils diffrent par
leur taille, par la structure du squelette glucidique, par le nombre et la nature des substituants.

Famille I
E. coli
E. chrysanthemi
P. aeruginosa
etc.

Famille II
S. meliloti
A. tumefaciens
B. abortus

Famille III
B. japonicum
A. caulinodans
A. brasilense

Famille IV
R. sphaeroides
X. campestris
R. solanacearum

4 familles dOPG
Figure 10 : Reprsentation des quatre familles dOPG (de I IV) (Bohin et Lacroix,
2007).

2009 Tous droits rservs.

27

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Synthse des OPG chez E. coli et E. chrysanthemi et leur


rgulation
Le modle bactrien tudi au cours de ma thse est E. chrysanthemi (Cf. le chapitre E : le
modle dtude : E. chrysanthemi). Nous avons vu prcdemment que ses OPG appartenaient
la famille I. Ils sont constitus de 5 12 rsidus de glucose et sont substitus par le succinate
et lactate. Losmolarit du milieu influence la synthse des OPG puisqu haute osmolarit,
une forte rduction de la quantit dOPG est observe, ainsi quune augmentation de la
substitution par le succinate (Cogez et coll., 2001). Ces OPG sont synthtiss par les protines
OpgG et OpgH, codes par lopron opgGH. Les mutants opgG et opgH sont incapables de
synthtiser des OPG (Page et coll., 2001). Les gnes opgG et opgH dE. chrysanthemi
prsentent plus de 85% de similitude et 75% didentit avec les gnes opgGH dE. coli. Nous
pouvons donc penser que la synthse des OPG dE. chrysanthemi est identique celle dE.
coli qui a t particulirement tudie (figure 11).
Chez E. coli, la biosynthse des OPG ncessite les protines OpgG, OpgH et pour une raison
inconnue la protine ACP (acyl carrier protein) implique dans la biosynthse des acides gras.

Figure 11 : Modle de biosynthse des OPG chez E. coli (Bohin et Lacroix, 2007)

2009 Tous droits rservs.

28

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

OpgH est une protine de 97 kDa, localise dans la membrane interne et

prsentant une activit glucosyltransfrase (Weissborn et Kennedy, 1984). Elle possde 8


segments transmembranaires et 3 grandes rgions cytoplasmiques. Il a ainsi t postul que
ces segments transmembranaires forment un canal pour la translocation de la chane
glucidique naissante vers le priplasme (Debarbieux et coll., 1997).

Le squelette linaire naissant serait ensuite pris en charge par la protine

priplasmique OpgG (56 kDa). OpgG est secrte du cytoplasme vers le priplasme par le
systme Sec (Loubens et coll., 1993). Il a t envisag que cette protine interviendrait dans la
translocation des OPG vers le priplasme grce une interaction avec OpgH et aurait un rle
dans le branchement des OPG (Rollet, 2006).

Chez E. coli (et non chez E. chrysanthemi), une troisime protine OpgD est

prsente. opgD est le paralogue dopgG. A la diffrence dOpgG, la protine OpgD possde
une squence signal caractristique du systme TAT (Lequette et coll., 2004). Un mutant
opgD prsente des OPG avec un squelette glucidique altr avec un degr de polymrisation
plus lev. OpgD semble donc tre implique dans la rgulation de la biosynthse (Lequette et
coll., 2004).

Chez E. coli, la substitution par le succinate est assure par OpgC (Lacroix et

coll., 1999), la substitution par le phosphoglycerol est assure par OpgB et OpgB cods par
le mme gne (Lequette et coll., 2008). Le gne de la protine OpgE codant une
phosphoethanolamine transferase (permettant la substitution par la phosphothanolamine) a
t rcemment identifi (Virginie Cogez, communication personnelle).

Chez E. chrysanthemi, seuls les gnes opgG et opgH sont prsents. Les OPG

sont substitus par des actyles et des succinyles. Cependant aucun gne codant les protines
impliques nont encore pu tre identifis, et aucun gne homologue dopgC dE. coli na pu
tre retrouv dans le gnome dE. chrysanthemi.

La biosynthse des OPG est rgule par losmolarit chez de nombreuses

protobactries (Bohin, 2000). En gnral, la quantit dOPG augmente lorsque losmolarit


diminue. Chez E. coli, ils reprsentent de 0,5% ( haute osmolarit) 5% ( faible osmolarit)
du poids sec des bactries. La rgulation osmotique a lieu un niveau transcriptionnel et/ou
post traductionnel. Indpendamment de losmorgulation, il a t observ un rtrocontrle du
produit final (Bohin et Lacroix, 2007).

Chez E. coli, les gnes opgG et opgH font partie du rgulon E, facteur

alternatif impliqu dans la rponse au stress. Cette voie est surtout active lors de la prsence

2009 Tous droits rservs.

29

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dans le priplasme de protines de lenveloppe mal conformes apparues suite diverses


conditions (chaleur, thanol, surexpression de OMP) (Raivio et Silhavy, 2001).

Figure 12: La rponse au stress extracytoplasmique dpendante de E (Hayden et Ades,


2008).
Le facteur E est contrl par le facteur antisigma RseA, protine de la membrane interne
avec un domaine cytoplasmique qui interagit avec E et un domaine priplasmique qui
interagit avec la protine priplasmique RseB (figure 12). La squestration de E au niveau de
la membrane interne par RseA le rend inactif. RseB interagit avec le domaine priplasmique
de RseA pour protger RseA de la protolyse en absence de stress. Les OMP mal conformes
vont activer la protase DegS qui va cliver le domaine priplasmique de RseA. La protine
RseA partiellement dgrade devient le substrat de la protase RseP qui va cliver la domaine
priplasmique de RseA, librant un complexe compos du facteur E et de la partie
cytoplasmique de RseA. La partie cytoplasmique de RseA est dgrade par ClpXP permettant
de librer facteur E qui va interagir avec lARN polymrase pour activer la transcription de
nombreux gnes. Les gnes activs par cette voie sont notamment des gnes impliqus dans la
synthse du LPS, des gnes codant des protines chaperons (fkpA, surA, degP, skp), les gnes
rpoErseABC codant le facteur E et ses rgulateurs, les gnes opgG et opgH (Dartigalongue et
coll., 2001 ; Rhodius et coll., 2006 : Hayden et Ades, 2008).

2009 Tous droits rservs.

30

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

3. Rle et impact sur la virulence


Les mutants dficients dans la synthse des OPG ont t obtenus pendant la recherche de
mutants affects dans la virulence (prsentant une virulence attnue ou une non virulence
vis--vis de leur plante ou animal hte). En effet, des mutants incapables de synthtiser des
OPG chez Agrobacterium tumefaciens (Puvanesarajah et coll., 1985), chez Pseudomonas
syringae (Loubens et coll., 1993) et chez Xanthomonas campestris (Minsavage et coll., 2004)
sont compltement ou svrement affects dans la virulence vis--vis de leurs plantes htes.
De plus, il a t montr, chez Yersinia enterocolitica, quopgH tait requis au stade prcoce
de linfection (Young et Miller, 1997). Il a galement t montr que des mutants opgH isols
par mutagense alatoire chez Pseudomonas aeruginosa PA14 prsentent une virulence
rduite chez le ver Caenorhabditis elegans (Mahajan-Miklos et coll., 1999). Enfin, les OPG
sont ncessaires la survie de Brucella abortus dans les macrophages et les cellules
pithliales en empchant la formation du phagolysosome (Arellano-Reynoso et coll., 2005).
Chez E. chrysanthemi, une mutation opg se traduisant par labsence de synthse dOPG
entrane un phnotype plotrope caractris par :

la perte de la virulence sur tubercules de pomme de terre et sur feuilles dendive.

la diminution de la synthse et de la scrtion dexoenzymes (pectate-lyase, cellulases,


protases)

un aspect muqueux des colonies d la surproduction dexopolysaccharides


engendre par une augmentation de lexpression des gnes eps

la diminution de la motilit

une hypersensibilit aux sels biliaires

Le mutant opg prsente galement un trouble dans la division cellulaire puisque lorsquelles
sont cultives en bouillon de culture (LB), elles sont de plus petites tailles et plus rondes que
la souche sauvage, alors quen milieu minimum, elles filamentent (Franck Bouchart,
communication personnelle).
La perte de virulence du mutant opg dE. chrysanthemi ne peut sexpliquer par la diminution
de la synthse et de la scrtion des exoenzymes puisquun mutant outS (ne prsentant plus le
systme de transport (type II) impliqu dans la scrtion des exoenzymes) prsente une
virulence seulement diminue. De plus, une exprience de coinoculation in planta dune
souche sauvage et dun mutant opg ne permet pas le dveloppement de la souche opg. Le
mutant opg est donc incapable de crotre mme dans un tissu macr (Page et coll., 2001). La
membrane externe dE. chrysanthemi semble relativement permable et laisserait chapper

2009 Tous droits rservs.

31

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

des OPG dans le milieu (Cogez et coll., 2001). Lexprience de coinoculation dmontre donc
que les OPG doivent imprativement tre dans le priplasme pour pouvoir jouer leur rle. Une
conclusion similaire avait t tire lors de ltude de mutants opg de la famille des
Rhizobiaceae, puisque lajout dOPG purifis un inoculum de mutant opg ne permettait pas
la restauration de lattachement, de la virulence ou de la symbiose (Bohin et Lacroix, 2007).
Les OPG sont donc un composant essentiel dans lenveloppe bactrienne requis pour la
virulence ou la symbiose. Cependant le rle exact des OPG reste dterminer. Plusieurs
hypothses ont alors tre envisages :

Kennedy a propos que les OPG seraient des osmoprotecteurs du fait de leur charge en
participant au maintien du potentiel de Donnan (Kennedy, 1982).

Les phnotypes montrent que la structure de lenveloppe semble altre par labsence
des OPG. Il a ainsi t suggr que les OPG joueraient un rle structural en permettant de
prserver lintgrit de lenveloppe bactrienne en interagissant avec le peptidoglycane et/ou
les phospholipides (Banta et coll., 1998).
Les OPG pourraient galement jouer un rle informationnel en interagissant avec
dautres composants priplasmiques. En effet, il a t propos chez E. coli que les OPG
seraient le signal capt par les capteurs de systmes deux composants prsent dans la
membrane interne : EnvZ (Fiedler et Rotering, 1988) et RcsC (Ebel et coll., 1997). Chez E.
chrysanthemi, les phnotypes observs chez le mutant opg (aspect muqueux, dfaut de
motilit, problme de division cellulaire) pourraient rsulter dune activation du systme
deux composants RcsCDB (voir le chapitre D : le phosphorelais Rcs).
Afin de caractriser le rle des OPG, deux approches ont t effectues au sein du
laboratoire : une premire approche protomique et une approche gntique.
Lapproche protomique (Bouchart et coll., 2007) a permis la comparaison du
protome soluble du mutant opg avec celui de la souche sauvage. En plus des phnotypes
dcrits, le mutant opg prsente une forte perturbation du mtabolisme gnral de la bactrie
avec une augmentation du catabolisme traduisant un besoin accru en nergie. Cela a dj t
observ chez des bactries lors de divers stress tels que le stress osmotique (Prasad et coll.,
2003). Une surexpression de protines impliques dans la mise en conformation et la
dgradation des protines a galement t montre. Ainsi cette approche a donc permis de
montrer que la bactrie opg induit une rponse au stress et que la perte de virulence pourrait
rsulter de la combinaison des changements de structure de lenveloppe et des modifications
du mtabolisme cellulaire.

2009 Tous droits rservs.

32

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Lapproche gntique a consist en la recherche de mutations permettant la


suppression du phnotype opg. Pour cela, une mutagense la N-mthyl N'nitro
N-nitrosoguanidine (NTG) de la souche opgG a t effectue. Franck Bouchart a recherch
des bactries ayant une restauration de la motilit. Aprs avoir isol des clones, il a ensuite
analys les autres phnotypes tests pour le mutant opgG. Il sest intress particulirement
un clone dont la mutation permettait de restaurer la quasi-totalit des phnotypes sauvages :
restauration de la motilit, absence de mucosit, restauration partielle de la rsistance aux sels
biliaires, restauration de la scrtion des exoenzymes, restauration de la virulence sur
tubercules de pomme de terre mais pas sur feuilles dendive. La mutation a ensuite t
localise dans le gne rcsC : rcsC2. Le gne rcsC est un gne prsent dans un locus de 3
gnes : rcsC-rcsBD. Ce locus code un systme deux composants.

2009 Tous droits rservs.

33

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C. Les systmes deux composants et les phosphorelais


Les systmes deux composants sont galement appels les systmes capteurs-rgulateurs. Ils
permettent la transduction dune information (stimulus peru) pour obtenir une rponse
adaptative.

1. Structure
Les bactries sont dans la nature confrontes de nombreuses variations environnementales.
Afin de sadapter au mieux leur environnement, elles ont dvelopp des systmes deux
composants. Ils comprennent un capteur (HK), le plus souvent dans la membrane interne
avec une boucle priplasmique, et un rgulateur transcriptionnel (RR) dans le cytoplasme
permettant une activation ou une rpression transcriptionnelle de gnes cibles dont les
produits sont impliqus dans cette adaptation. Les gnes codant le capteur et le rgulateur sont
le plus souvent organiss en opron. E. coli prsente 30 protines HK et 34 protines RR
(Yamamoto et coll., 2005). Pour notre modle dtude E. chrysanthemi, 32 systmes ont t
annots dont 4 spcifiques (Bohin JP, communication personnelle).

a)

Le capteur

Il est gnralement dans la membrane interne (figure 13a). Il est compos de deux segments
transmembranaires dlimitant un segment priplasmique (N-terminal) ncessaire la
reconnaissance du signal et un domaine Histidine kinase cytoplasmique (C-terminal). Le
domaine cytoplasmique se divise en 2 parties, le premier sous domaine fixe lATP et permet
lautophosphorylation dune histidine conserve au niveau du deuxime sous domaine, le
domaine phosphotransferase de la kinase. Ces capteurs fonctionnent en dimre, la
dimrisation est ncessaire pour le bon fonctionnement du capteur, cela a t montr pour
EnvZ chez E. coli (Cai et Inouye, 2003).
Parfois le capteur peut possder dautres domaines modulant son activit, comme le domaine
PAS ou le domaine HAMP, localiss dans la rgion charnire entre le deuxime segment
transmembranaire (TM2) et le domaine kinase.

b)

Le rgulateur

Il possde deux domaines, le domaine rcepteur qui contient un rsidu daspartate


phosphorylable et le domaine rgulateur, responsable de la reconnaissance des squences

2009 Tous droits rservs.

34

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

opratrices des gnes cibles et donc de lactivation ou de la rpression transcriptionnelle


(figure 13a). Le rgulateur est phosphoryl ou dphosphoryl par le capteur, le groupement
phosphate provenant alors du rsidu histidine du capteur. La variation de phosphorylation du
rgulateur permet la modulation de son activit. En effet, la phosphorylation va engendrer un
changement de conformation permettant une meilleure interaction avec lADN.

c)

Les phosphorelais

Dans certains cas, une version plus complexe des systmes deux composants implique un
phosphotranfert multiple (His1Asp1His2Asp2), ils sont alors appel les phosphorelais
(figure 13b). Cela implique donc la prsence dautres domaines constitus dun domaine
receveur comme celui du rgulateur avec un aspartate (D1) et un domaine Hpt (Histidinecontainig phosphotransfer) contenant le rsidu histidine (H2). Dans la plupart des cas, le
capteur contient une histidine (H1) et un aspartate (D1). Lhistidine H2 est au niveau du
domaine Hpt dune protine supplmentaire intervenant entre le capteur et le rgulateur. Nous
dvelopperons un exemple avec le phosphorelais Rcs (Cf. chapitre D : Le phosphorelais Rcs).

Figure 13 : Reprsentation des diffrents domaines des protines constituant les systmes deux
composants et les phosphorelais. (a) Systme deux composants typique constitu dun capteur
dimrique (HK) et dun rgulateur cytoplasmique (RR). Le monomre reprsent possde des
domaines transmembranaires (TM1 et TM2) permettant de dlimiter une rgion priplasmique. LHK
catalyse lautophosphorylation ATP dpendante sur un rsidu histidine H1 conserv. Le phosphate (P)
est transfr sur un rsidu Aspartate (D) du domaine rgulateur du RR, modulant ainsi sa capacit de
fixation lADN des gnes cibles. (b) Le phosphorelais ncessite des domaines supplmentaires par
rapport aux systmes deux composants, comme un domaine comportant un aspartate en C-terminal
du capteur ainsi quun domaine Hpt prsent sur une protine intermdiaire (West & Stock, 2001).

2009 Tous droits rservs.

35

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. La perception du signal
Mascher a rpertori trois mcanismes diffrents de la perception du signal (Mascher et coll.,
2006). Tout dabord, le plus courant, la perception du signal se fait au niveau des boucles
priplasmiques du capteur (figure 14A). La perception du signal par le capteur peut galement
se faire au niveau des domaines transmembranaires de celui-ci (figure 14B). Enfin, il a
rpertori la perception dun signal cytoplasmique par le capteur qui peut tre soluble ou
ancr dans la membrane (figure 14C).
Chez E. chrysanthemi, parmi les 32 systmes deux composants prdits, 2 prsentent un
capteur cytoplasmique (Bohin JP, communication personnelle).

Figure 14 : Reprsentation schmatique des trois diffrents mcanismes de la perception du


signal (Mascher et al, 2006). (A) HK percevant le signal dans le priplasme. (B) HK avec des rgions
transmembranaires permettant la perception du signal. (C) HK percevant un signal cytoplasmique, le
capteur peut tre soluble ou ancr dans la membrane. Le stimulus est reprsent en rouge (flche ou
toile) et les protines interagissant avec le stimulus sont en couleur.

2009 Tous droits rservs.

36

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

3. Le paradigme EnvZ-OmpR

Figure 15 : Rgulation de ompF et ompC par le systme deux composants EnvZ-OmpR


et par les facteurs environnementaux (Pratt et coll., 1996).
Chez E. coli, lexpression de 2 porines majeures (OmpC et OmpF) est rgule par les
paramtres environnementaux et par dautres facteurs. OmpC est une porine dont les pores
sont plus grands que ceux de OmpF. Le systme deux composants EnvZ/OmpR contrle la
transcription des gnes ompC et ompF en rponse losmolarit. EnvZ tant le capteur et
OmpR le rgulateur transcriptionnel. Il existe galement un ARN antisens MicF qui influence
la transcription de ompF.
La rgulation seffectue en fonction de losmolarit (figure 15 et 16):

A faible osmolarit, on observe une phosphorylation faible du capteur EnvZ qui va


donc phosphoryler faiblement le rgulateur OmpR. OmpR-P va se fixer aux sites de
forte affinit des promoteurs de ompF pour lactiver.

A forte osmolarit, on observe une phosphorylation du capteur EnvZ qui va


phosphoryler le rgulateur OmpR. OmpR-P va se fixer aux sites de forte et faible
affinit des promoteurs de ompF et ompC. On observe alors une rpression de la
transcription de ompF, activation de la transcription de ompC. La rpression de ompF
haute osmolarit est facilite par le domaine IHF puisquil facilite la courbure de

2009 Tous droits rservs.

37

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

lADN pour empcher la transcription. On a galement une augmentation de la


transcription de micF : un ARN complmentaire de lARN de ompF (rpression de
ompF).

Figure 16 : Rgulation de la transcription de ompF et ompC par OmpR (Pratt et coll.,


1996).
OmpF est donc synthtise faible osmolarit. Cest la forme majoritaire quand la bactrie
est lextrieur. Cette porine permet la pntration des substrats prsents dans les solutions
rencontres. Alors que OmpC est synthtise forte osmolarit. Cest la forme majoritaire
quand la bactrie est dans lintestin et elle permet lexclusion de nombreuses molcules
toxiques rencontres dans lintestin.

4. Une rponse gradue


Un moyen quont les bactries de sadapter au milieu est de rguler lexpression des gnes.
Nous venons de voir que les systmes deux composants sont impliqus dans cette
rgulation. Le rgulateur phosphoryl va interagir avec les rgions rgulatrices des gnes
cibles afin dactiver ou dinhiber ceux-ci. Le retour au niveau initial va ncessiter la
dphosphorylation du rgulateur. Pour cela, la dphosphorylation peut seffectuer par la
protine portant galement lactivit kinase, on dit alors que le systme est bifonctionnel,

2009 Tous droits rservs.

38

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

sinon la dphosphorylation est effectue par une phosphatase distincte, le systme est alors
monofonctionnel (Figure 17). Le plus frquemment, le capteur est bifonctionel, il est alors
capable, quand il est non phosphoryl de dphosphoryler le rgulateur. Cette activit
phosphatase peut galement tre module par les signaux environnementaux. Il a t trouv
que les systmes deux composants bifonctionnels sont plus efficaces pour amplifier le signal
pour limiter les signaux parasites (ractions croises) et pour amortir le rtrocontrle. Par
contre, un systme deux composants monofonctionnel est plus efficace pour intgrer les
signaux de diffrentes sources (Igoshin et coll., 2008).

Figure 17 : Reprsentation de la phosphorylation et de la dphosphorylation des


systmes deux composants (Igoshin et coll., 2008).
Un modle mathmatique a t tabli en utilisant le systme deux composants EnvZ OmpR
pour tester la rponse gradue et la bistabilit (Igoshin et coll., 2008).
Les cellules rpondent aux changements dun signal dune manire gradue (trait continu)
(figure 18). Cependant une analyse plus pousse a montr lexistence dun seuil en dessous
duquel le signal est trop faible pour produire une rponse significative : signal ON (trait
discontinu montant), le mme phnomne est observ pour la perte de rponse avec un seuil
partir duquel la rponse ne sera plus significative (trait discontinu descendant). Ainsi dans une
population, au lieu davoir une rponse gradue pour toutes les bactries, on a une population
bi-modale avec deux populations dans un tat stable avec des rponses diffrentes. On
sattend alors un phnomne dhystrsis : le chemin ON et le chemin OFF ne sont
pas confondus cause du seuil diffrent des deux chemins. La rponse observe est donc la
somme des diffrents tats dans la population.

2009 Tous droits rservs.

39

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 18 : Rponse observe suite un signal (Igoshin et coll., 2008).


Grce cette bistabilit, il y a en permanence dans la population des bactries qui sont
susceptibles de pouvoir sadapter des variations environnementales, ces bactries ne sont
pas les mieux adaptes pour le contexte actuel mais seraient adaptes anticiper un contexte
ultrieur. La bistabilit est donc un processus pigntique qui permet des cellules avec un
mme gnome dexprimer en rponse aux mmes informations des tats diffrents.

5. Rle dans la virulence


De nombreux systmes deux composants sont connus pour affecter la virulence des
bactries. Le tableau 1 prsente une liste de systmes deux composants dont on a montr
quils taient impliqus dans la virulence chez diverses bactries pathognes.

2009 Tous droits rservs.

40

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Tableau 1 : Systmes deux composants contribuant la rgulation de la virulence


(Beier & Gross, 2006)

2009 Tous droits rservs.

41

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La virulence rsulte de laction de plusieurs systmes deux composants dont les actions
peuvent tre associes.
La figure 19 nous montre les systmes impliqus dans la virulence de S. enterica. Il faut noter
quil existe des relations complexes entre les diffrents systmes deux composants puisque
les systmes PhoP-PhoQ et EnvZ-OmpR rgulent lexpression du systme SsrB-SsrA qui
contrle la transcription des gnes codant notamment le systme de scrtion de type III.
De plus, nous pouvons noter que le stimulus peru par les systmes deux composants nest
pas toujours connu.

Figure 19 : Reprsentation schmatique de systmes rgulant lexpression de gnes


impliqus dans la virulence chez S. enterica (Beier & Gross, 2006). Les couples capteurrgulateur sont reprsents dans la mme couleur.

2009 Tous droits rservs.

42

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Chez E. carotovora, 4 systmes sont connus pour tre impliqus dans la virulence de la
bactrie dont 3 sont reprsents sur la figure 20 :

GacS-GacA contrle la production denzymes extracellulaires impliques dans la


virulence de la bactrie. Un mutant gacA (expA) prsente une virulence attnue sur
tubercules de pomme de terre ainsi quune diminution denzymes extracellulaires
(Eriksson et coll., 1998).

PehS-PehR (similaire au systme PhoP-PhoQ de E. coli) contrle la synthse des


polygalacturonases (Peh). Une mutation dans un des gnes provoque une virulence
attnue sur le tabac. La concentration en Ca2+ et en Mg2+ est perue comme un signal
environnemental spcifique dans la rgulation dune endopolygalacturonase, PehA
(Flego et coll., 2000).

HrpX-HrpY : ce systme deux composants est connu pour rguler lexpression des
gnes hrp impliqus dans la scrtion de type III. Une mutation par transposon dans le
gne hrpX entrane une expression un haut niveau les gnes hrp et une diminution de
la virulence dans les phases prcoces de linfection ( Lehtimki et coll., 2003).

Figure 20 : Reprsentation schmatique de systmes rgulant lexpression de


gnes impliqus dans la virulence chez E. carotovora (Mole et coll., 2007).

2009 Tous droits rservs.

43

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

PmrA-PmrB : Ce systme est activ par un excs de fer en pH acide. Il est impliqu
dans la virulence puisquun mutant dans un des deux gnes prsente une diminution de
leur virulence sur tubercules de pomme de terre. Ce systme permet la rsistance la
polymixine B (Hyytiinen et coll., 2003).

Chez E. chrysanthemi, 2 systmes deux composants sont connus pour affecter la virulence :

PhoP-PhoQ : Un mutant phoQ prsente une rduction de survie dans les tissus
vgtaux cause dune sensibilit accrue au pH acide et une rduction de sa virulence
sur feuilles dendive. Ce systme est induit dans la plante mais aussi par une faible
concentration en Mg2+ (Llama-Palacios et coll., 2003). De plus, une tude a montr
quune mutation dans phoQ affectait la transcription dau moins 40 gnes dont ceux
impliqus dans le mtabolisme du fer et un sidrophore ncessaire une virulence
optimale. Les auteurs en concluent que certains gnes impliqus dans des
transporteurs sont galement touchs. PhoP-PhoQ gouvernerait donc lexpression de
plusieurs facteurs de virulence et pourrait galement interagir avec dautres systmes
rgulateurs (Venkatesh et coll., 2006).

GacS/GacA : GacA est ncessaire pour une expression approprie des gnes de
virulence lors de linfection de la plante par EC3937. Un mutant gacA prsente une
production diminue des pectate-lyases, des proteases et des cellulases. Le systme de
scrtion de type III est diminu (Lebeau et coll., 2008 ; Yang et coll., 2008).

2009 Tous droits rservs.

44

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

D. Le phosphorelais : RcsCDB
1. RcsCDB
Le systme Rcs est un systme de phosphorelais et se compose de 3 protines permettant la
transduction du signal. Les gnes codant les capteurs et le rgulateur sont organiss en
opron : rcsDB-rcsC, cette organisation est conserve chez la plupart des Entrobactries
(figure 21a). Il a t initialement caractris chez E. coli comme activant la synthse
dexopolysaccharides (Gottesman et coll., 1985).

a)

RcsC

RcsC (figure 21b) est un capteur transmembranaire possdant 2 segments transmembranaires


(TM1 et TM2) permettant de dlimiter un domaine priplasmique. Ce domaine priplasmique
interviendrait dans la perception des signaux environnementaux. La partie cytoplasmique
comprend un domaine PAS, un domaine histidine kinase (domaine comprenant lhistidine
phosphorylable H1) et un domaine receveur (domaine comprenant laspartate phosphorylable
D1).

b)

RcsD

RcsD (anciennement appel YojN) (figure 21b) est galement une protine transmembranaire
avec 2 segments transmembranaires (TM1 et TM2) dlimitant galement un domaine
priplasmique qui pourrait participer avec RcsC ou indpendamment la perception des
signaux environnementaux. Le domaine cytoplasmique ne prsente pas de domaine histidine
kinase mais prsente un domaine Hpt (histidine-containing phosphotransmitter), domaine
transmetteur de phosphate avec une histidine phosphorylable (H2).
On peut noter une plus grande conservation du domaine priplasmique de RcsD que du
domaine correspondant de RcsC. Ainsi RcsD semble un meilleur candidat que RcsC une
interaction avec un partenaire de structure conserve.

c)

RcsB

RcsB est le rgulateur du phosphorelais (figure 21b). Il est cytoplasmique et possde un


domaine receveur avec un aspartate phosphorylable (D2) et un domaine de fixation lADN.

2009 Tous droits rservs.

45

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le capteur form de RcsC et RcsD peroit un signal environnemental au niveau de la boucle


priplasmique, il y a alors autophosphorylation au niveau de lhistidine H1 (RcsC), puis
transfert du phosphate sur laspartate D1 de RcsC. Il y a alors transfert de ce phosphate sur
une histidine (H2) du domaine Hpt de RcsD puis transfert du groupement phosphate sur
laspartate du domaine receveur du rgulateur RcsB (D2). RcsB est phosphoryl ou
dphosphoryl par le capteur. Le niveau de phosphorylation permet la modulation de son
activit. Le rgulateur, grce son domaine responsable de la reconnaissance des squences
de rgulation, permet ainsi leur activation ou leur rpression transcriptionnelle (figure 22).
Comme nous lavons dit prcedemment, les capteurs fonctionnent en dimre. Dans la
littrature, le capteur est dans la plupart des cas un htrodimre (RcsCD), cependant nous ne
pouvons exclure que ce capteur soit un htrottramre (RcsC2D2) ou quil se compose de 2
dimres (RcsC2 + RcsD2).

Figure 21: Le systme phosphorelais Rcs daprs Madjalani et Gottesman, 2005.


(a) Organisation du locus rcs : rcsDB-rcsC.
(b) Organisation des domaines des protines du systme Rcs et RcsA.

2009 Tous droits rservs.

46

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

d)

RcsA

Chez E. coli et de nombreuses entrobactries, la protine RcsA est prsente (figure 21b). Le
gne rcsA se localise loin de lopron rcsCBD. RcsA est un cofacteur interagissant avec RcsB
au niveau de botes RcsAB des squences rgulatrices de certains gnes cibles. La formation
de cet htrodimre nest pas obligatoire. En effet, lactivation des gnes impliqus dans la
synthse des exopolysaccharides (cps) et la rpression des gnes impliqus dans la synthse
du flagelle (flh) ncessitent la prsence de RcsA (Francez-Charlot et coll., 2003). Par contre,
lactivation de gnes comme les gnes fts impliqus dans le contrle de la division cellulaire
nest pas dpendante de RcsA (Carballs et coll., 1999). RcsA est dgrade par la protase
Lon, ce qui explique que les mutants lon sont muqueux (Markovitz A. 1964). La protase Lon
dgrade galement SulA, un inhibiteur de FtsZ induit lors de la rponse SOS ce qui explique
que les mutants lon sont sensibles aux UV (ils filamentent) (Mizusawa et coll., 1983).
Chez E. chrysanthemi, la protine RcsA nest pas prsente. RcsB rgulerait alors les gnes
seul ou en interagissant avec un autre cofacteur encore inconnu.

2. Protines interagissant avec le phosphorelais Rcs


Il existe plusieurs protines interagissant avec le phosphorelais RcsCDB(A) (figure 22).

a)

RcsF

RcsF est une lipoprotine ancre dans la membrane externe. Elle joue un rle dans la
transduction du signal de la membrane externe vers RcsC (prsent dans la membrane interne).
Il a t montr dune part que la surexpression de RcsF active les gnes cps
(exopolysaccharides) et dautre part, que lactivit de RcsF est dpendante de DsbA, protine
priplasmique catalysant la formation de ponts disulfure.

b)

IgaA

IgaA (Intracellular-growth-attenuator-A) est une protine de la membrane interne connue


pour agir ngativement sur le systme Rcs. Une mutation dans igaA rduit la motilit de
Salmonella enterica en activant Rcs. Il faut noter que chez cette bactrie la mutation est ltale
sauf dans un contexte o le systme Rcs est inactif (mutant rcsC, rcsD ou rcsB) et ceci
indpendamment de RcsA et RcsF (Cano et coll., 2002 ; Majdalani et Gottesman, 2005). De
plus, il a rcemment t montr quen absence de IgaA, le locus rcsCBD tait instable chez
Salmonella (dltion) (Mariscotti et coll., 2008).

2009 Tous droits rservs.

47

http://doc.univ-lille1.fr

48

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 22 : Reprsentation du systme RcsCDB, des protines interagissant avec lui et des gnes cibles

Thse d'Anne-France Prouvost, Lille 1, 2008

c)

DjlA

DjlA est une protine ancre dans la membrane interne par un segment N-terminal. Une
surexpression de DjlA entrane une activation du systme Rcs (Clarke et coll., 1997). Il a t
montr que lactivation ncessite la prsence de DjlA en coopration avec DnaK et GrpE et la
prsence du segment transmembranaire (TM) notamment impliqu dans la dimrisation de
DjlA (figure 23, Toutain et coll., 2003). Par contre, il a t montr chez E. coli quune
dltion dans djlA engendrait une augmentation de lactivit du systme Rcs et quune
surexpression ( faible niveau) entranait une diminution de lactivit du systme Rcs. DjlA
est donc un autre rpresseur du systme Rcs (Shiba et coll., 2006).

Figure 23 : Reprsentation schmatique de DjlA et de son mode dactivation du systme


RcsCDB, conduisant une augmentation de la production dacide colanique (Toutain et
coll., 2003).

3. Autres lments interagissant avec le phosphorelais Rcs


Les signaux perus par le systme Rcs sont pour le moment inconnus. Cependant, il a t
montr que des mutations dans lopron rfa impliqu dans la biosynthse du LPS
(lipopolysaccharides) et dans le gne opgH impliqu dans la biosynthse des OPG activent de
manire constitutive le systme Rcs (Parker et coll., 1992 ; Ebel et coll., 1997). Il a alors t
suggr des interactions entre le phosphorelais et le LPS ou les OPG. Le LPS et les OPG
pourraient avoir un effet sur RcsF d la perturbation de la membrane. Les travaux de Ebel et

2009 Tous droits rservs.

49

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

coll. en 1997, laissent penser que les OPG pourraient tre un signal directement peru par
Rcs.

4. Les gnes cibles du systme Rcs


Le Systme RcsCDB est connu pour tre impliqu dans la rgulation dun grand nombre de
processus cellulaires.
La synthse des exopolysaccharides
Comme cit prcdemment, le systme Rcs a dabord t identifi comme activateur des
gnes impliqus dans la biosynthse des exopolysaccharides (cps) chez E. coli (Gottesman et
coll., 1985).
La division cellulaire
Il a t montr chez E. coli que la protine RcsB active, indpendamment de RcsA,
lexpression des gnes ftsA et ftsZ impliqus dans la formation de lanneau lors de la division
cellulaire.
Il a t montr que lopron tolQRA, (codant des protines impliques dans le maintien
de lintgrit membranaire) chez E. coli tait rgul par le systme RcsCDB. Il a t montr
que le systme RcsCDB est activ dans les mutants tol ou quand les protines Tol sont
surexprimes (Clavel et al., 1996; Vianney et coll., 2005).
La motilit
Le systme RcsCDB rprime la motilit en rgulant ngativement la transcription des gnes
flhDC, opron matre de la biosynthse du flagelle (Francez-Charlot et coll., 2003) (figure
24). Cette rpression ncessite la prsence de RcsA.

Figure 24: Schma reprsentant les gnes rgulant la synthse du flagelle et son
assemblage. Lopron flhDC est sous le contrle dune rgulation globale qui conduit
lexpression ou linhibition de la synthse du flagelle (Chevance & Hughes, 2008).

2009 Tous droits rservs.

50

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La virulence
De nombreux travaux ont montr limportance de ce phosphorelais dans la virulence, comme
pour Salmonella (Mouslim et coll., 2004), pour des souches entrohmoragiques dE. coli
(Tobe et coll., 2005), pour E. amylovora (Bereswill et Geider, 1997) ou encore
Y. enterocolitica (Venecia et Young, 2005). Il a ainsi t suggr que les bactries pathognes
diminuaient lexpression de certains gnes lors de linfection, gnes incompatibles avec le bon
droulement de linfection (Mouslim et coll., 2004). Il a t montr quune activation
constitutive du systme RcsCDB engendrait une attnuation de la virulence chez Salmonella
(Garcia-Calderon et coll., 2005).
Cette liste nest pas exhaustive puisquune tude rcente (Hinchliffe et coll., 2008)
utilisant des puces ADN afin de montrer le rle du phosphorelais Rcs chez les Yersiniae a
montr quil rgulait lexpression de 136 squences codantes dont 60% sont prdites pour
affecter lenveloppe, de nombreux gnes potentiellement impliqus dans la virulence dont les
gnes codant les protines impliques dans la formation des biofilms, la motilit, ladhsion
aux cellules mammaliennes...

5. La mutation suppressive rcsC2


La recherche de mutations permettant la suppression du phnotype opgG dE. chrysanthemi a
t effectue par Franck Bouchart (il a recherch des bactries ayant une restauration de la
motilit). La mutation permettait de restaurer la quasi-totalit des phnotypes sauvages :
absence de mucosit, restauration partielle de la rsistance aux sels biliaires, restauration de la
motilit, de la scrtion des exoenzymes et de la virulence sur tubercules de pomme de terre
mais pas sur feuilles dendive. La mutation a t localise dans le gne rcsC : rcsC2. La
mutation ponctuelle se situe dans la partie cytoplasmique en C-terminal entre le domaine PAS
et le domaine histidine kinase (figure 25) et permet un changement de lalanine 463 en valine.
Dautres mutations ponctuelles affectant les capteurs de systmes deux composants ont t
tudies. Ces mutations affectent lactivit kinase ou phosphatase. Parmi elles, chez
Bordetella pertusis, une mutation ponctuelle en C-terminal de BvgS (H1172N) abolit son
activit (Uhl & Miller, 1996), ou encore chez E. coli des mutants ponctuels de EnvZ ne
prsentent plus dactivit phosphatase mais conserve leur activit kinase, on observe alors un
phnotype constitutivement activ (Tokishita & Mizuno, 1994). Une mutation ponctuelle dans
BarA du systme BarA/UvrY cre une activit kinase affaiblie et une augmentation de son
activit phosphatase chez E. coli (Tomenius et coll., 2006).

2009 Tous droits rservs.

51

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

TM1

Domaine
priplasmique

TM2

Domaine
PAS

Domaine histidine
kinase

H1

D1

A463V

Figure 25 : Organisation des diffrents domaines de la protine RcsC et localisation (en


rouge) de la mutation rcsC2. Schma ralis daprs la reprsentation obtenue grce au
logiciel SMART dInfobiogen.
Le phnotype de la souche rcsC2 dans un contexte sauvage (Opg+) a galement t analys.
Ce mutant produit presque 2 fois moins dOPG, scrte plus de pectinases et est
hyperrsistant aux sels biliaires. On observe galement une hypervirulence sur tubercules de
pomme de terre et sur feuilles dendive. Cest notre connaissance, le premier mutant du
systme Rcs stimulant la virulence dune entrobactrie pathogne (Bouchart, 2006).
Ainsi les travaux de F. Bouchart et ceux dEbel en 1997 montrent un lien troit entre la
prsence des OPG et le niveau dactivation du systme RcsCDB.

2009 Tous droits rservs.

52

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

E.

Le modle dtude : Erwinia chrysanthemi 3937

Erwinia chrysanthemi est une entrobactrie phytopathogne faisant partie de la subdivision


des

Protobactries

qui

comprend

en

particulier

les

Enterobacteriaceae

et

Pseudomonadaceae. E. chrysanthemi est un pathogne pour de nombreuses plantes dans les


rgions tropicales et subtropicales, et peut galement infecter certaines cultures dans les
rgions tempres comme les endives, les pommes de terre, le saintpaulia E. chrysanthemi
provoque la pourriture molle cause par la scrtion dune batterie de pectinases qui
provoquent la dstructuration de la pectine. Laction de ces enzymes est prrequise pour la
dgradation de la paroi des cellules vgtales par les cellulases et les protases (Collmer &
Bateman, 1981). E. chrysanthemi a galement t classe dans un autre genre,
Pectobacterium parce quelle possdait une activit pectinolytique provoquant la macration
des tissus vgtaux (Hauben et coll., 1998). Plus rcemment encore, Pectobacterium
chrysanthemi a t transfre dans le nouveau genre Dickeya (Samson et coll., 2005) et son
nom actuel est Dickeya dadantii. Dans cette thse, la nomenclature initiale est conserve,
nous lappellerons donc Erwinia chrysanthemi.

1. Structure de la paroi de la plante hte


La paroi des cellules vgtales se compose de plusieurs parties :

la paroi primaire, compose de fibres de cellulose assembles dans une matrice de pectine.

La paroi secondaire est constitue de cellulose et dhmicellulose. Cette paroi peut tre
renforce par de la lignine.

La lamelle moyenne, constitue de pectine, est la partie la plus externe de la paroi. La


pectine permet la cohsion entre les cellules.

La combinaison des diffrentes enzymes pectinolytiques permet lors de linfection par la


bactrie pathogne la dissociation des cellules afin de provoquer la pourriture molle.

2009 Tous droits rservs.

53

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Lamelle moyenne

Paroi primaire
Paroi secondaire
Membrane plasmique

Figure 26: Structure de la paroi des cellules vgtales.


La paroi des cellules vgtales est donc compose majoritairement de polysaccharides
rpartis en trois groupes : la cellulose, lhemicellulose et la pectine (figure 26).

La cellulose est un polymre de glucoses lis en -1,4.

Lhemicellulose est un htropolysaccharide compos de xyloglucanes et de xylanes dont

les proportions varient en fonction de la plante (Muyerowitz et Somerville, 1994) :


Les xyloglucanes sont constitus dun squelette linaire de cellulose ramifi
principalement par des rsidus de xylose mais aussi par des rsidus de galactose et de
fucose.
Les xylanes sont constitus de rsidus de xylose lis en -1,4 et ramifis
principalement par de larabinose.

La pectine est un htropolysaccharide mthylestrifi constitu principalement

(figure 27) :

dhomogalacturonane (HGA) : une chane linaire dacide galacturonique

(GalA) lis en -1,4.

de rhamonogalacturonane de type I (RGI). : un htropolymre branch

alternant des rsidus dacide galacturonique lis en -1,4 et de rhamnose lis en -1,2.

Sur le RGI sont attachs des chanes d -1,5-arabinane (A)

Sur le RGI, on retrouve des chanes de rhamnogalacturonane de type II

constitues de divers sucres (galacturonate, fucose, rhamnose, arabinose, ) (RGII)


(Vincken et coll., 2003, Willats et coll., 2001).

2009 Tous droits rservs.

54

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Sur le RGI, il y a galement des chanes darabinogalactane (G) qui peuvent

tre des chanes de -1,4-galactanes (galactanes de type I) ou des galactanes lis en -1,3
qui peuvent tre branchs par des rsidus de galactopyranose en -1,6 (galactanes de type
II). La structure de ces chanes va varier selon lespce et vont faire varier les proprits
de la pectine (Hwang et coll., 1993). Ce sont les galactanes de type I qui nous
intresserons particulirement par la suite (Partie I : Contribution la caractrisation du
locus gan impliqu dans lutilisation des galactanes chez Erwinia chrysanthemi.).

HGA

RGI

galacturonate
galactose
arabinose

RGII

RGII

fucose

Figure 27 : Reprsentation schmatique de la structure de la pectine. HGA,


homogalacturonate ; RGI, rhamnogalacturonate de type I ; RGII, rhamnogalacturonate de type
II ; A, arabinane ; G, galactane (daprs Vincken et coll., 2003).

2. Mcanismes de virulence
E. chrysanthemi, quand elle ne cause pas la macration, peut vivre dans la plante dune
manire endophytique, sur la surface de la plante dune manire epiphytique ou dune
manire saprophytique dans le sol ou dans les nappes phratiques.
E. chrysanthemi pntre dans la plante par des blessures ou par des entres naturelles. A
lintrieur de la plante, elle est retrouve dans le tissu vasculaire et dans les espaces
intercellulaires o elle peut rester un long moment avant de provoquer la maladie. Durant
cette phase, on ne sait pas si la bactrie est en dormance et non reconnue par la plante ou si il
y a un processus dynamique de la croissance bactrienne contre les dfenses de la plante.
Lorsquelle devient virulente, les symptmes de la maladie se manifestent par la ncrose des
tissus vgtaux. Elle est produite par la dsorganisation des tissus vgtaux et la lyse des
cellules provoques par la dgradation de la paroi de ces cellules. Cette dgradation est
assure par la scrtion de cellulases, de protases mais surtout de pectinases.

2009 Tous droits rservs.

55

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Les cellulases
Elles prsentent une activit endoglucanase, permettant la digestion de la cellulose des parois
primaire et secondaire. Chez E. chrysanthemi, deux cellulases sont connues : CelZ et CelY.
CelZ, majoritaire, est une enzyme extracellulaire scrte par le systme Out (typeII), tandis
que CelY est une enzyme priplasmique. Elles ne sont pas essentielles pour la pathognicit
mais agissent en synergie avec les autres exoenzymes.
Les protases
Les exoprotases ne sont pas essentielles pour la virulence. Elles sont scrtes par le systme
Ptr de type I. Il est compos de 3 protines, PtrD, PtrE et PtrF, traversant toute lenveloppe. Il
permet la translocation des protines du cytoplasme au milieu extrieur en une tape en
utilisant lhydrolyse de lATP pour le transport (Delepelaire et Wandersman, 1991).
Les pectinases
La structure complexe de la pectine ncessite laction combine de plusieurs pectinases pour
une dstructuration efficace (figure 28). Lors de linfection bactrienne, la dgradation de la
pectine commence grce laction de pectine estrases (PemA, PaeY), de dpolymrases
(PelA, PelB, PelC, PelD, PelE, PelI, PelL, PelZ et RhiE) pour aboutir la formation
doligomres qui peuvent entrer dans le priplasme bactrien par la porine KdgM (Blot et
coll., 2002). Les pectinases sont scrtes par le systme de scrtion de type II, appel Out
(Salmond, 1994). Dans le priplasme, les oligomres sont dsestrifis (PemB et PaeX) puis
clivs (PelX, PehV, PehW et PehX). Les petits oligomres (majoritairement des dimres et
trimres) issus de cette dgradation entrent dans le cytoplasme grace au systme de transport
TogT et TogMNAB o ils sont dgrads par lexopectate-lyase PelW et loligogalacturonatelyase Ogl, pour donner des monomres : le galacturonate et le 5-cto-4-dsoxyuronate
(Hugouvieux-Cotte-Pattat et coll., 1996 ; Hugouvieux-Cotte-Pattat et Reverchon, 2001).

2009 Tous droits rservs.

56

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 28: Dgradation et catabolisme de la pectine chez E. chrysanthemi, daprs


Hugouvieux-Cotte-Pattat et coll., 2001.

E. chrysanthemi clive donc la pectine afin de lutiliser comme source de carbone et dnergie.
La rgulation de ces gnes dpend de leffet cumul de diffrents rgulateurs. La transcription
des gnes pel est induite par les produits du catabolisme de la pectine, ltat stationnaire de
croissance, les mtabolites de la plante hte (Bourson et coll., 1993), la carence en fer
(Masclaux et coll., 1996), et la protine H-NS (protine associe au nuclode) (Nasser &
Reverchon, 2002). Par contre, la transcription de ces gnes est rprime lors de la privation en
azote, des tempratures leves, haute osmolarit et est soumise la rpression
catabolique (Hugouvieux-Cotte-Pattat et coll., 1992 ; Reverchon et coll., 1997). La rpression
catabolique est exerce par la protine CRP (Reverchon et coll., 1997). Chez E .coli, il existe
en amont des promoteurs soumis la rpression catabolique, un site de fixation pour une

2009 Tous droits rservs.

57

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

protine activatrice de la transcription. Tant que cet activateur nest pas fix, linitiation de la
transcription est faible. La fixation de CRP sur lADN est dpendante de la prsence dAMPc.
Le complexe CRP+AMPc se fixe sur lADN et active la transcription. En prsence de glucose
dans le milieu, ladnylate cyclase est incapable de fabriquer de lAMPc, il ny a pas de
formation du complexe CRP+AMPc et donc absence dactivation de la transcription. En
absence de glucose, ladnylate cyclase est active, lAMPc form va se complexer la
protine CRP et ainsi activer la transcription. Chez E. chrysanthemi, la production de pectates
lyases est soumise cette rpression catabolique. Celle-ci est observe lors de la croissance en
prsence de glucose mais galement en prsence des produits de dgradation de la pectine
(Hugouvieux-Cotte-Pattat et coll., 1996).
De plus, la synthse et la scrtion des pectinases sont trs lies puisque les gnes pel
et out prsentent une rgulation similaire par les mmes facteurs de rgulation (Condemine &
Robert-Baudouy, 1995).
Dautres facteurs interviennant dans la virulence.
Dautres facteurs vont intervenir dans le pouvoir pathogne dE. chrysanthemi.

Le systme de scrtion de type III, prcdemment cit, permet dinjecter les protines

dans les cellules de la plante. Ces protines pourront alors perturber le mtabolisme cellulaire
et empcher les mcanismes de dfense de la plante dtre efficace. Ce systme de scrtion
fait partie des gnes hrp ( hypersensitive response and pathogenicity ) et hrc (
hypersensitive response and pathogenicity genes conserved ). Il joue un rle dans la
virulence bactrienne dE. chrysanthemi (Yang et coll., 2002) et dE. carotovora (Rantakari et
coll., 2001). La surproduction ou labsence des gnes hrp diminue la virulence.

Condemine et coll. ont montr en 1999, quun mutant eps affect dans la biosynthse

des exopolysaccharides tait moins efficace pour la phase initiale de la macration.

Des mutants affects dans la structure du lipopolysaccharide (LPS) ont perdu leur

capacit infecter le saintpaulia (Schoonejans et coll., 1987)

Lors de linfection, Erwinia colonise les espaces intercellulaires de la plante. Erwinia

rencontre alors un environnement oxydatif, puisque les cellules de la plante produisent de


loxygne actif en rponse lattaque bactrienne. La bactrie a pour se protger des systmes
qui la protge comme la methionine sulfoxide rductase MsrA et une superoxide dismutase
qui sont essentielles au rsultat final de linfection ( El Hassouni et coll., 1999. Santos, R.,
2001).

2009 Tous droits rservs.

58

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La fixation du fer par les sidrophores (la chrysobactine et lachromobactine) est

importante dans la pathognicit dE. chrysanthemi. Les sidrophores fixent le fer dans un
environnement pauvre en fer comme dans la plante. Le fer fix est un signal activant
notamment la transcription des gnes des pectates lyases et des gnes codant le transport du
fer. Des mutants affects dans lassimilation du fer prsentent une croissance plus faible lors
des phases prcoces de linfection (Enard et coll., 1988).

Nous lavons dvelopp dans le chapitre sur les OPG, les Glucanes Priplasmiques

Osmorguls (OPG) sont ncessaire la virulence dE. chrysanthemi (Page et coll., 2001).

2009 Tous droits rservs.

59

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Objectifs
Au sein du laboratoire, nous nous intressons aux glucanes priplasmiques osmorguls
(OPG). Ces oligosaccharides sont essentiels pour la virulence dE. chrysanthemi puisquun
mutant opgG incapable de synthtiser ces glucanes prsente un phnotype plotrope dont une
absence de virulence sur tubercule de pomme de terre et sur feuille dendive. Il a t montr
que les OPG, prsents dans le priplasme, pouvaient interagir avec des systmes deux
composants qui sont impliqus dans la perception de changements environnementaux.
Cette thse est une contribution la comprhension du rle du priplasme dans la perception
de lenvironnement par la bactrie. Ma thse comporte deux parties distinctes correspondant
des expriences effectues paralllement.
A la suite de ltude protomique du mutant opgG, nous nous sommes intress une
protine priplasmique inconnue trs abondante. En collaboration avec Nicole HugouvieuxCotte-Pattat et Aurlie Delangle, nous avons pu caractriser cette protine et montrer quelle
faisait partie dun systme de transport et de dgradation des -galactanes, produits issus de la
dgradation de la pectine. Ce systme Gan permet donc le transport doligosaccharides
travers lenveloppe de la bactrie afin de les utiliser comme source de carbone. Ce transport
ncessite plusieurs tapes de dgradation indispensables dont une qui a lieu dans le
priplasme.
Une approche gntique visant obtenir des mutations suppressives du mutant opg a permis
lobtention dune mutation dans le gne rcsC par F. Bouchart au sein du laboratoire. Au cours
de ma thse, jai voulu prciser le rle du systme deux composants RcsCDB dans le
pouvoir pathogne dE. chrysanthemi et notamment pourvoir dterminer limpact de la
mutation rcsC2 sur les gnes cibles du systme Rcs. Je me suis ensuite intresse au lien qui
existe entre les OPG et ce systme RcsCDB. Jai enfin voulu voir les relations qui pouvaient
exister entre le systme deux composants et les protines interagissant avec ce
phosphorelais : les protines DjlA, IgaA et une version soluble de RcsF. Nous avons entrepris
en collaboration avec Carmen dberg-Ferragut de caractriser la lipoprotine RcsF par
mutagense dirige, afin dapporter des lments sur la structure de cette lipoprotine.

2009 Tous droits rservs.

60

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Rsultats :
Partie I Contribution la caractrisation du locus gan
impliqu dans lutilisation des galactanes
chez Erwinia chrysanthemi.

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Partie I Contribution la caractrisation du


locus gan impliqu dans lutilisation des galactanes
chez Erwinia chrysanthemi.
Ce travail a t ralis en collaboration avec Madame Nicole Hugouvieux-Cotte-Pattat
(Adaptation et Pathognie, UMR 5240, Lyon) et avec Aurlie Delangle, doctorante du
laboratoire. Nicole Hugouvieux-Cotte-Pattat a notamment particip aux constructions
gntiques ainsi qu ltude de la rgulation du locus et Aurlie Delangle a ralis la
caractrisation biochimique de ce travail.
E. chrysanthemi est un pathogne pour de nombreuses plantes dans les rgions
tropicales et subtropicales, et peut galement infecter certaines cultures dans les rgions
tempres comme les endives, les pommes de terre, le saintpaulia E. chrysanthemi
provoque la pourriture molle cause par la scrtion dune batterie de pectinases qui
provoquent la dpolymrisation de la pectine. Laction de ces enzymes est prrequise pour la
dgradation de la paroi des cellules vgtales par les cellulases et les protases (Collmer &
Bateman, 1981) (Cf. le chapitre E : le modle dtude : E. chrysanthemi).

A. Caractrisation du locus gan chez Erwinia


chrysanthemi
1. Identification du locus
Lors de ltude protomique dun mutant opgG (Bouchart et coll., 2007), une protine
inconnue fortement exprime a pu tre identifie. Elle prsente un fort degr de similarit
avec les produits de gnes inconnus de Yersinia pestis, Y. pseudotuberculosis, Y.
enterocolitica (83%) et Erwinia carotovora (78%).
Le gne de cette protine, que nous avons appel ganA, fait partie dun locus
comprenant 4 units de transcription et 9 gnes : ganR, ganL, ganEFGABC et ganK. Ce locus
semble tre impliqu dans lutilisation des galactanes (produits par la dgradation de la
pectine). Daprs une tude gnomique comparative, ce locus est conserv chez E. carotovora
et Y. pseudotuberculosis mais est absent chez E. coli. Lorganisation gntique du locus est
conserve chez Y. pseudotuberculosis et chez E. carotovora, lexception des gnes ganL,
localis lautre extrmit du locus et ganR, absent chez E. carotovora (Figure 29).

2009 Tous droits rservs.

61

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 29 : Locus gan dE. chrysanthemi potentiellement impliqu dans lutilisation des
-galactanes. Il est conserv chez E. carotovora et Y. pseudotuberculosis. Nous avons appel
les gnes (gan) R, L, EFGABC et K. Les flches correspondent aux phases ouvertes de lecture
et lorientation de la transcription des gnes. La taille des locus est donne grce lchelle en
haut de la figure (en kb).
Le gne ganA est entour par des gnes typiques dun systme de transport de type
ABC dont le paradigme est le transport des maltodextrines chez E. coli (Mayer &
Boos, 2005). On y retrouve une porine GanL (48% de similarit avec LamB) dans la
membrane externe, une protine affine priplasmique GanE (45% de similarit avec MalE),
deux protines de la membrane cytoplasmique GanF et GanG (respectivement 62% et 56% de
similarit avec MalF et MalG), une protine dutilisation de lATP : GanK (72% de similarit
avec MalK) (Figure 30).
On retrouve en plus du systme de transport, un systme de dgradation comprenant
une

endo-1,4--galactanase

priplasmique

(GanA)

et

une

exo-1,4--galactanase

cytoplasmique ou -galactosidase (GanB). En effet, la protine GanB prsente de forte


similarit avec des -galactosidases de nombreuses bactries notamment de Y. pestis (84% de
similarit), E. carotovora (83%).
Le gne ganC code une protine semblable un fragment dune protine IIB dun
systme PTS (systme de translocation de groupe des sucres). Cette protine est conserve
chez Y. pestis et E. carotovora (respectivement 86% et 75%) mais aucune fonction na pu lui
tre attribue.
Enfin le gne ganR code un rgulateur transcriptionnel semblable LacI (62% de
similarit) : le rpresseur de lopron lactose chez E. coli.

2009 Tous droits rservs.

62

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Un modle dutilisation des galactanes a t construit en se referant au transport des


maltodextrines chez E. coli (Figure 30). Ce modle propos chez E. chrysanthemi par le locus
gan est le suivant :
La pectine est dgrade par les pectates lyases (PL) et les rhamnogalacturonates lyases
(RGL). Les oligogalactanes librs entreraient dans le priplasme grce la porine GanL
(LamB) prsente dans la membrane externe (ME) et seraient dgrads par lendo-1,4-galactanase priplasmique GanA. La protine affine priplasmique GanE (MalE) apporterait
les oligomres au systme de transport GanFGK2 (MalFGK2) prsent au niveau de la
membrane interne. Le transport seffectuerait grce lhydrolyse dATP. Lexo-1,4-galactanase GanB cliverait les oligomres en galactose qui sera pris en charge par les
protines GalKTE, permettant la synthse dUDP-Galactose (Cf. Figure 40 dans la
discussion).

Figure 30 : Transport des maltodextrines chez E. coli (daprs M Schwartz)

2009 Tous droits rservs.

63

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Caractrisation du locus : utilisation des galactanes et de leurs


drivs
Afin dtudier le locus gan, des mutations dans diffrents gnes ont t ralises. Ces
mutants ont t construits par gntique inverse aprs inactivation par insertion de cassette
(Cf. Matriels et Mthodes).
La souche sauvage EC3937 est capable de crotre en prsence de galactanes de pomme
de terre (MEGAZYME) comme seule source de carbone. Par contre, les mutants ganA ou
ganB en sont incapables. Le locus gan est donc ncessaire lutilisation des galactanes par la
bactrie (Tableau 2). De plus, ni la souche sauvage EC3937, ni les mutants gan ne sont
capables de crotre en prsence de galactobiose (MEGAZYME) comme seule source de
carbone.

a)

Caractrisation des activits galactanases

Les galactanases sont galement prsentes chez de nombreux vgtaux. En effet, lors
de ltude de la maturation de fruits comme le plaqueminier du Japon (Diospyros kaki), il a
t observ que la maturation du fruit se fait grce la solubilisation des polysaccharides
pectiques. Cette solubilisation de la pectine et le ramollissement du tissu qui en dcoule sont
causs par laction conjointe de la protine GalA (endo-1,4--galactanase) et dune
-galactosidase. Trois activits -galactosidases sont dcrites, elles sont capables de modifier
la paroi des cellules vgtales, et provoquent le ramollissement pendant la maturation des
fruits. Une de ces trois activits -galactosidase a t dcrite comme tant une activit exo1,4--galactanase (Nakamura et coll., 2003, Lazan et coll., 2004). De plus, ltude de la
galactanase code par galA chez Pseudomonas fluorescens, a montr que la protine purifie
tait capable dhydrolyser les galactanes et de librer majoritairement des galactotrioses, des
galactobioses et du galactose en fin de raction (Braithwaite et coll., 1997). Lendo-1,4-galactanase chez Aspergillus. niger clive larabinogalactane pour librer principalement des
galactobioses et galactotrioses (de Vries et coll., 2002). Cette activit navait jamais t
dcrite chez E. chrysanthemi.

GanA : lendo-1,4--galactanase

Pour valuer si la bactrie a la capacit dhydrolyser les -1,4 galactanes, les bactries
sont dposes sur un milieu 63 complment en source de carbone et contenant en surcouche
de lAZCL galactan (MEGAZYME). Aprs incubation, lapparition dun halo bleu rvle la

2009 Tous droits rservs.

64

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

prsence dune activit galactanase. Les souches EC3937, NF3653 ganA::Cml, NF3674
ganB::Cml, NF3678 ganA::uidA-Kan sont dposes sur ces boites (Figure 31). Lorsque la
souche sauvage EC3937 est inocule sur ces boites, on observe la formation dun halo bleu
autour de la colonie d lhydrolyse du substrat. Par contre, aucun halo nest visible lorsque
lon inocule les souches NF3653 ganA::Cml, NF3678 ganA::uidA-Kan. Le locus gan est donc
bien impliqu dans une activit galactanase. Par contre, on observe la prsence dun halo bleu
autour de la colonie NF3674 ganB::Cml. Ces rsultats montrent que cest bien la protine
GanA qui attaque ce substrat (spcifique dune activit endo-1,4--galactanase). La souche
NF3657 outS::Kan montre galement un halo de dgradation de taille identique la souche
sauvage. Le systme de scrtion de type II ne semble donc pas impliqu dans cette activit.
La prsence dune activit endo-1,4--galactanase est galement observable par le
dosage de lactivit hydrolytique dun substrat soluble : lAZO-galactan (MEGAZYME).
Les rsultats du dosage de lactivit endo-1,4--galactanase, grce ce substrat soluble, sont
prsents dans la partie concernant ltude de la rgulation du locus.
De plus, nous avons test la croissance du mutant ganA sur milieu solide contenant des
galactanes comme seule source de carbone. Alors que lon observe une croissance pour la
souche sauvage (EC3937), aucune croissance nest observe pour le mutant ganA. Ceci
confirme que GanA est ncessaire pour lutilisation des galactanes.

Figure 31 : Test dactivit endo-1,4--galactanase. Les souches EC3937 et NF3653


ganA::Cml sont dposes sur les boites AZCL-galactan. Une activit endo-1,4--galactanase
permet la formation dun halo autour de la colonie. La souche EC3937 prsente une activit
endo-1,4--galactanase contrairement la souche NF3653 ganA::Cml.

2009 Tous droits rservs.

65

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Croissance sur
galactose

Croissance sur
galactanes

Croissance sur gal3


gal6

3937 (sauvage)

0,7

0,7

A4809 (ganA)

0,13 (19%)*

A4807 (ganB)

A4868 (ganL)

0,17 (24%)*

A4810 (ganE)

NFB3701 (ganK)

A4863 (ganR)

0,7

0,7

souches

Tableau 2 : Croissance de la souche sauvage et de diffrents mutants dE. chrysanthemi.


Les bactries sont cultives en milieu M63 contenant du galactose, des galactanes ou des
oligogalactanes (gal3 gal6) comme seule source de carbone (2g/L). Le rendement de
croissance est exprim DO620nm en phase stationnaire de croissance. (*)Les pourcentages
reprsentent le rendement de croissance de la souche par rapport celui de la souche sauvage
(Cf. matriels et mthodes).

Activit -galactosidase
spcifique (nmol/min/mg)

Activit -galactosidase
spcifique en %

3937 (sauvage)

252

100

NFB3680 (lacZ)

241

96

A4807 (ganB)

NFB3687 (lacZ, ganB)

A4809 (ganA)

46

18

A4810 (ganE)

49

19

A4863 (ganR)

58

23

Souches

Tableau 3 : Activit -galactosidase spcifique de la souche sauvage et de diffrents


mutants dE. chrysanthemi. Lactivit spcifique est exprime en nmole dONP libre par
min et par mg de protines (Cf. matriels et mthodes).

2009 Tous droits rservs.

66

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La localisation de la protine GanA a pu tre dtermine par le dosage de lactivit


endo-1,4--galactanase mesure par lAZO-galactan (Cf. matriels et mthodes). La totalit
de lactivit endo-1,4--galactanase est retrouve dans le culot cellulaire (aprs centrifugation
des bactries) et aucune activit nest dtecte dans le surnageant. Prs de 90% de lactivit
est retrouve dans les extraits priplasmiques. De plus, lors de ltude protomique du mutant
opgG (Bouchart et coll., 2007), la protine GanA est retrouve en grande quantit dans les
protines solubles. La protine GanA est donc bien priplasmique.
La protine GanA a t purifie partir dextraits priplasmiques et ses proprits
(activits enzymatiques en fonction du pH et de la temprature) ont t caractrises par
Aurlie Delangle (Delangle et coll., 2007). Ensemble, nous avons analys, par spectromtrie
de masse de type MALDI-TOF, les produits de dgradation des galactanes pectiques par
GanA (dgradation in vitro). La digestion a t effectue aux conditions optimales daction de
lenzyme (50C, dans du tampon actate de sodium 0,2 M pH 5,8). On observe une faible
htrognit du produit de dgradation. La dgradation est limite des molcules de plus de
5 rsidus galactosyles. En effet, aprs 15 min dincubation, on observe 66% de DP4 (DP =
degr de polymrisation), 19% de DP3 et 14% de DP5. Cette production reste inchange lors
dune incubation prolonge de 2h (Figure 32).

80

Pourcentage relatif

70
60
15min

50

30min

40

1h

30

2h

20
10
0
Gal3

Gal4

Gal5

Gal6

Figure 32: Distribution des produits de dgradation des galactanes par GanA aprs
diffrents temps dincubation 50C (Cf. Delangle et coll., 2007).

GanB : lexo-1,4--galactanase

En 1985, Hugouvieux Cotte Pattat & Robert-Baudouy ont effectu une tude de lactivit
-galactosidase chez E. chrysanthemi afin de pouvoir exprimer des fusions transcriptionnelles
grce au gne lacZ dE. coli. Elle avait permis de mettre en vidence la prsence de 2 activits

2009 Tous droits rservs.

67

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

-galactosidases codes par 2 gnes nomms lacZ et lacB sans que les gnes naient t
localiss. Le squencage du gnome de la souche EC3937 a permis de confirmer que lacZ est
prsent chez E. chrysanthemi. Le gne lacB dcrit semble donc correspondre ganB. Le
dosage de lactivit -galactosidase a t effectu pour observer la part de lactivit
-galactosidase de GanB (Tableau 3). Pour cela, lactivit -galactosidase de la souche
sauvage, du mutant lacZ (Bouchart, 2006), du mutant ganB et du double mutant ganB, lacZ a
t analyse en utilisant lONPG comme substrat. La majorit de lactivit -galactosidase
(96%) est retrouve chez le mutant lacZ, une faible activit (3%) est prsente chez le mutant
ganB, et aucune activit -galactosidase est dtecte dans le double mutant ganB, lacZ.
Lactivit -galactosidase observable chez le mutant ganB est donc due lactivit de LacZ et
celle observable chez le mutant lacZ provient donc de lactivit de GanB. Chez E.
chrysanthemi, lactivit -galactosidase est donc majoritairement assure par la protine
GanB et minoritairement par la protine LacZ. Il faut noter que les diffrentes souches testes
lors du dosage ont t dposs sur des boites contenant du X-Gal, substrat trs sensible une
activit -galactosidase. Les souches EC3937, A4807 ganB, NFB3680 lacZ, sont bleues, alors
que la souche NFB3687 ganB, lacZ est blanche. Il ny a donc aucune autre activit
-galactosidase prsente chez E. chrysanthemi et ces rsultats indiquent que lacB et ganB sont
le mme gne.
De plus, lactivit -galactosidase chez le mutant ganA et ganE reprsente environ 20 % de
lactivit retrouve pour la souche sauvage. Ces mutations ont donc un effet partiellement
polaire sur le gne ganB (Figure 29).
Nous avons test la croissance des mutants ganB et lacZ sur milieu solide contenant des
galactanes comme seule source de carbone. Alors que la croissance pour le mutant lacZ est
normale, aucune croissance nest observe pour le mutant ganB. Ceci indique que GanB,
contrairement LacZ, est ncessaire pour lutilisation des galactanes (Tableau 2).

b)

Caractrisation du systme de transport des galactanes.

Le gne ganA est entour par des gnes typiques dun systme de transport de type
ABC dont le paradigme est lopron maltose impliqu dans le transport des maltodextrines.
On y retrouve une porine GanL dans la membrane externe, une protine affine priplasmique
GanE, deux protines de la membrane interne GanF et GanG, une protine dutilisation de
lATP GanK. Afin de caractriser le systme de transport, nous avons compar la croissance
des mutants gan en prsence de galactanes, doligogalactanes (gal3 gal6 issus de la

2009 Tous droits rservs.

68

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dgradation des galactanes in vitro par GanA) et de galactose. Les mutants analyss sont les
mutants ganL (porine), ganK (ATPase) et ganE (protine affine priplasmique) (Tableau 2).
Toutes les souches sont capables dutiliser le galactose comme source de carbone avec
le mme rendement. Le systme gan ne semble donc pas impliqu dans le transport du
galactose. La souche sauvage et le mutant ganR prsentent une croissance en prsence de
galactanes et doligogalactanes (gal3 gal6) avec un rendement de 70%. Les mutants ganL,
ganA ne sont pas capables dutiliser les galactanes mais utilisent les gal3 gal6 comme seule
source de carbone avec un rendement denviron 20%. Les mutants ganE, ganB et ganK ne
sont capables dutiliser ni les galactanes ni les gal3 gal6.
Ainsi labsence de croissance du mutant ganL sur les galactanes indique que cette
porine est bien spcifique du transport des galactanes. Cette mutation ne peut engendre de
mutation polaire sur dautres gnes puisquil est le seul dans lunit transcriptionnelle. La
porine est donc essentielle pour le transport. La croissance de 20% du mutant ganL en
prsence des gal3 gal6 nous laisse penser que les petits oligomres (gal3) pourraient diffuser
travers la membrane externe de faon aspcifique par les porines majeures.
Labsence de croissance des mutants ganE et ganK en prsence de galactanes ou
doligogalactanes montre que ces protines sont spcifiques et ncessaires au transport des
galactanes. Il faut noter que le dosage de lactivit -galactosidase (Tableau 3) chez le mutant
ganE reprsente environ 20 % de lactivit retrouve pour la souche sauvage. La mutation
ganE nest donc pas totalement polaire. Labsence de croissance du mutant ganE ne peut donc
sexpliquer par labsence des protines GanA et/ou GanB.

B.

Rgulation des gnes gan.

1. Effet de la source de carbone sur lexpression des gnes gan


a)
Effet des conditions de culture sur lexpression des fusions
transcriptionnelles
Nous prdisons 4 units de transcription pour le locus gan : ganR, ganL, ganEFGABC et
ganK (Figure 29). Afin de dterminer la rgulation de la transcription des gnes impliqus
dans lutilisation des galactanes, Nicole Hugouvieux-Cotte-Pattat et moi-mme avons
construit des fusions transcriptionnelles dans les gnes ganA (A4809), ganB (A4807), ganE
(A4810), ganK (NFB3701) et ganL (A4868) avec le gne uidA, gne codant lactivit
-glucuronidase. Le dosage de lactivit -glucuronidase a t effectu sur des extraits de

2009 Tous droits rservs.

69

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

cultures des diffrents mutants cultivs en milieu minimum en prsence de diffrentes sources
de carbone (glycrol, galactose, glucose ou saccharose). Les dosages sont effectus pour des
souches prleves en phase exponentielle (DO620nm de 0,8) (voir matriels et mthodes).
En prsence de glucose et de saccharose, lexpression diminue dun facteur 3 (ganB) un
facteur 7 (ganL) par rapport lexpression en prsence de galactose ou de glycrol (Figure
33). Ces rsultats nous laissent penser que les gnes du locus gan sont soumis la rpression
catabolique contrle par la protine CRP ( cAMP receptor protein ). Par ailleurs, la
recherche

de

la

squence

consensus

de

la

protine

Crp

par

un

logiciel

(http://fasta.bioch.virginia.edu/fasta/cgi/consensus2.cgi) a permis de mettre en vidence au


moins un site consensus en amont des promoteurs des 3 units transcriptionnelles :
ganEFGABC, ganK et ganL.
Ce type de rgulation a dj t dcrit pour plusieurs systmes impliqus dans la dgradation
de la paroi des cellules vgtales chez E. chrysanthemi (Hugouvieux-Cotte-Pattat et coll.,
1996). Ces rsultats sont confirms grce ltude du mutant crp::Cml qui montre bien la
perte dactivation. En effet, nous avons transduit la mutation crp::Cml dans les souches
contenant les fusions ganK::uidA, ganE::uidA ou ganL::uidA (Figure 34). Nous avons
analys lexpression des fusions pour des cultures ralises en milieu 63 contenant du glucose
comme source de carbone. La mutation crp engendre respectivement une diminution de 3 et
de 5 fois pour lexpression de ganK::uidA et de ganE::uidA et une diminution de 83 fois est
observe pour lexpression de ganL::uidA. Pour les gnes pectinolytiques, une diminution de
2 260 fois est observe dans un contexte crp selon les gnes tests (Reverchon et coll.,
1997). Le locus gan est donc bien soumis la rpression catabolique.

2009 Tous droits rservs.

70

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Activit -glucuronidase

Activit -glucuronidase
(nmol/min/mg de protines)

500
450
400
350

glucose
glycerol
saccharose
galactose

300
250
200
150
100
50
0
ganA

ganB

ganE

ganK

ganL

Figure 33 : Activit -glucuronidase des fusions transcriptionnelles des gnes ganA,


ganB, ganE, ganK, ganL avec le gne uidA en fonction de diffrentes sources de carbone.
Les activits sont exprimes en DO410nm/min/mg de protines.

90
Activit -glucuronidase
(nmol/min/mg
de protines)
Activit -glucuronidase

80
70
60
50

Crp+
Crp-

40
30
20
10
0

ganK

ganE

ganL

Figure 34 : Activit -glucuronidase des fusions transcriptionnelles des gnes ganK,


ganE et ganL avec le gne uidA mesure dans un contexte sauvage (Crp+) ou dans un
contexte crp::Cml (Crp-) en milieu minimum contenant du glucose comme source de
carbone. Les activits sont exprimes en unit arbitraire DO410nm/min/mg de protines.

2009 Tous droits rservs.

71

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 35: Dosage de lactivit endo-1,4--galactanase (GanA) en prsence de


diffrentes sources de carbone. Les activits sont exprimes en unit arbitraire
A590nm/min/mg de protines. Les activits de la phase exponentielle sont reprsentes en vert
clair et les activits en phase stationnaire en vert fonc.

glycrol
glucose
galactose
galactanes
saccharose
PGA
gluconate
jus d'endives
jus de pommes de terre

Phase exponentielle Phase stationnaire


100
100
17
77
145
113
70
54
24
57
19
24
342
211
20
65
14
90

Tableau 4 : Pourcentage de lactivit endo-1,4--galactanase (GanA) par rapport


lactivit en glycrol en phase exponentielle ou stationnaire (100%). Les activits dites de
base sont surlignes en jaune, les activits prsentant une diminution ne sont pas surlignes
(blanc) et lactivit prsentant une augmentation est surligne en orange.

2009 Tous droits rservs.

72

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 36: Dosage de lactivit glucuronidase de la fusion transcriptionnelle ganA::uidA


en prsence de diffrentes sources de carbone. Les activits sont exprimes en unit
arbitraire A410nm//min/mg de protines. Les activits de la phase exponentielle sont
reprsentes en jaune et les activits de la phase stationnaire en orange.

glycrol
glucose
galactose
saccharose
PGA
gluconate
jus d'endives
jus de pomme de terre

Phase exponentielle Phase stationnaire


100
100
26
60
123
115
33
47
47
63
312
253
19
67
16
51

Tableau 5 : Pourcentage de lactivit glucuronidase de la fusion transcriptionnelle


ganA::uidA par rapport lactivit en glycrol en phase exponentielle ou stationnaire
(100%). Les activits dites de base sont surlignes en jaune, les activits prsentant une
diminution ne sont pas surlignes (blanc) et lactivit prsentant une augmentation est
surligne en orange.

2009 Tous droits rservs.

73

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 37 : Dosage de lactivit exo-1,4--galactanase (GanB) en prsence de diffrentes


sources de carbone. Les activits sont exprimes en unit arbitraire A410nm/min/mg de
protines. Les activits de la phase exponentielle sont reprsentes en bleu clair et les activits
de la phase stationnaire en bleu fonc.

glycrol
glucose
galactose
galactanes
saccharose
PGA
gluconate
jus d'endives
jus de pommes de terre

Phase exponentielle Phase stationnaire


100
100
44
76
100
101
120
116
58
71
58
69
142
157
28
98
29
115

Tableau 6 : Pourcentage de lactivit exo-1,4--galactanase (GanB) par rapport


lactivit en glycrol en phase exponentielle ou stationnaire (100%). Les activits dites de
base sont surlignes en jaune, les activits prsentant une diminution ne sont pas surlignes
(blanc) et lactivit prsentant une augmentation est surligne en orange.

2009 Tous droits rservs.

74

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

b)
Effet
des
conditions
endo-1,4--galactanase.

de

culture

sur

lactivit

Effet sur lactivit de GanA

Le dosage de lactivit endo-1,4--galactanase a t effectu sur des extraits de cultures de la


souche sauvage EC3937 en prsence de diffrentes sources de carbone. Les souches sont
prleves en phase exponentielle puis en phase stationnaire (voir matriels et mthodes).
Quelque soit la phase de croissance (phase exponentielle ou stationnaire), on observe les
mmes effets de la source de carbone, cest dire une activit galactanase de base pour le
glycrol, le galactose et pour les galactanes. On observe une activit galactanase rduite en
prsence de glucose, saccharose, PGA, jus dendives et jus de pomme de terre. Enfin, on
observe une activit maximale pour le gluconate (Figure 35).

Effet sur la fusion transcriptionnelle ganA::uidA

Cet effet a t en partie tudi dans le paragraphe prcdent lors de la comparaison de leffet
des conditions de culture sur lexpression de toutes les fusions transcriptionnelles (ganA,
ganB, ganE, ganK et ganL) (Figure 33).
Le dosage de lactivit -glucuronidase de la fusion transcriptionnelle ganA::uidA a t
effectu sur des extraits de cultures de la souche NFB3678 en prsence de diffrentes sources
de carbone. Les souches sont prleves en phase exponentielle puis en phase stationnaire (voir
matriels et mthodes).
Quelque soit la phase de croissance (phase exponentielle ou stationnaire), on observe les
mmes effets de la source de carbone, cest dire une activit -glucuronidase de base pour le
glycrol et le galactose. On observe une activit galactanase rduite en prsence de glucose,
saccharose, PGA, jus dendives et jus de pomme de terre. Enfin, on observe une activit
maximale pour le gluconate (Figure 36).

c)
Effet
des
conditions
exo-1,4--galactanase

de

culture

sur

lactivit

Le dosage de lactivit exo-1,4--galactanase a t effectu sur des extraits de cultures de la


souche sauvage EC3937 en prsence de diffrentes sources de carbone (nous considrons que
lexpression de lacZ est ngligeable par rapport lexpression de ganB). Les extraits utiliss
sont les mmes que ceux utiliss pour le dosage de lactivit endo-1,4--galactanase (Figure
37).

2009 Tous droits rservs.

75

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Quelque soit la phase de croissance (phase exponentielle ou stationnaire), on observe une


activit -galactosidase de base pour le glycrol, pour le galactose et pour les galactanes. On
observe une activit -galactosidase rduite en prsence de glucose, saccharose, PGA, jus
dendives et jus de pomme de terre. On observe une forte activit pour le gluconate.
Il faut noter que dans tous les cas (ganA::uidA, GanA et GanB), les diffrences dexpression
entre les diffrentes sources de carbone sont plus faibles en phase stationnaire quen phase
exponentielle (Tableau 4,5 et6).
De plus, on observe que les diffrences dexpression entre les diffrentes sources de carbone
sont plus faibles pour lactivit exo-1,4--galactanase (GanB) que pour lactivit exo-1,4-galactanase (GanA).

2. Effet de la phase stationnaire sur lexpression des gnes gan


Les dosages des activits endo-1,4--galactanase, -glucuronidase (fusion ganA::uidA) et
exo-1,4--galactanase montrent quil existe une diffrence dactivit entre la phase
exponentielle et la phase stationnaire (Tableau 7).
endo-1,4--galactanase
GanA

-glucuronidase
(ganA::uidA)

exo-1,4--galactanase
(-galactosidase) GanB

glycrol

3,7

2,2

glucose

17,2

5,2

1,7

galactose

2,9

1,8

galactanes

2,9

ND

1,1

saccharose

8,7

2,4

1,2

PGA

4,7

3,2

1,2

gluconate

2,3

1,7

jus dendives
Jus de pomme de
terre

12,1

6,6

3,4

24,5

3,8

Tableau 7 : rapports dactivits entre la phase exponentielle et la phase stationnaire des


souches EC3937 pour les activits endo-1,4--galactanase et exo-1,4--galactanase et
NF3678 pour lactivit -glucuronidase. Lactivit -glucuronidase en prsence de
galactanes comme seule source de carbone nest pas ralisable (ND) puisque la souche
NF3678 ganA::uidA-Kan nest pas capable dutiliser les galactanes. Les activits dites de base
sont surlignes en jaune, les activits prsentant une diminution dexpression ne sont pas
surlignes (blanc) et lactivit prsentant une augmentation dexpression est surligne en
orange.

2009 Tous droits rservs.

76

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

On observe tout dabord que les rapports de niveaux dexpression sont plus levs pour
lactivit de lendo-1,4--galactanase, que pour les activits -glucuronidase (ganA::uidA) et
exo-1,4--galactanase. Pour les activits qui prsentaient une expression faible (en prsence
de glucose, saccharose, PGA), on observe un rapport dactivit plus important que pour celles
qui prsentaient les activits dites de base (glycrol, galactose et galactanes). On observe un
rapport lev lors de ltude en prsence de jus de pomme de terre et jus dendives. Nous
avons donc une augmentation de lexpression en phase stationnaire dont le niveau varie en
fonction des conditions. Les activations sont plus importantes pour la protine GanA que pour
celles de GanB o lactivation en phase stationnaire est visible uniquement pour les cultures
en prsence de jus. Les profils dactivation mesurs pour les activits -glucuronidase et
exo-1,4--galactanase sont comparables.
Lexpression la plus importante a lieu, dans les 3 cas (activit -galactanase,
-glucuronidase et -galactosidase), lors de la croissance en gluconate comme seule source de
carbone. Dans ce milieu o la croissance est trs lente (temps de gnration de 4 heures contre
2 heures environ pour toutes les autres sources de carbone y compris les jus de pomme de
terre et dendive), on observe un comportement de la bactrie voisin de celui observ en phase
stationnaire. Nous avons donc voulu voir si le gluconate jouait un rle spcifique. Pour cela,
nous avons cultiv la souche NF3678 ganA::uidA-Kan en prsence de galactose ou de
gluconate, complment ou non en acides amins. Lajout dacides amins va permettre de
diminuer le temps de gnration pour la culture en gluconate (2 heures contre 4 heures) mais
ninfluence pas le temps de gnration pour la culture en galactose. Le dosage de lactivit glucuronidase en phase exponentielle a permis de montrer plusieurs choses :
* Tout dabord, lajout dacides amins ne fait pas varier lexpression de la -glucuronidase
pour la culture de galactose. Lajout dacides amins ne fait donc varier que le temps de
gnration et ne fait pas varier lexpression de la -glucuronidase.
* Lorsque lon sintresse lactivit -glucuronidase en prsence ou non dacides amins
dans le milieu minimum complment en gluconate, on nobtient pas de diffrence
significative dactivit -glucuronidase (entre le gluconate et le gluconate avec acides
amins). Les diffrences observes entre les rsultats obtenus pour les cultures en galactose et
en gluconate sont conserves avec lajout dacides amins. Cet ajout fait donc varier le temps
de gnration mais ninfluence pas lexpression de la -glucuronidase. Ce nest donc pas le
ralentissement de croissance qui explique les rsultats obtenus pour le gluconate. Le gluconate
a donc un rle spcifique dans lactivation.

2009 Tous droits rservs.

77

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

3. Effet de GanR sur lexpression des gnes gan


Le locus gan comprend le gne ganR codant un rgulateur transcriptionnel semblable
LacI (62% de similarit) : le rpresseur de lopron lactose chez E. coli. ganR est galement
prsent chez Y. pseudotuberculosis , mais il est absent dE. carotovora.
Afin de caractriser le rle de GanR dans la rgulation du locus, jai construit un mutant
ganR (NFB3758). Ce mutant et la souche sauvage ont t dposs sur un milieu 63
complment en source de carbone et contenant en surcouche de lAZCL galactan. On
observe alors une taille rduite du halo de dgradation de la souche ganR par rapport la
souche sauvage. De plus, lexpression de lactivit -galactosidase de la souche ganR est
galement diminue (nous considrons que lexpression de lacZ est ngligeable par rapport
lexpression de ganB) (Tableau 3).
Paralllement notre tude, Nicole Hugouvieux-Cotte-Pattat a construit un mutant ganR
(A4863). Elle sest intresse limpact de cette mutation sur les fusions ganK::uidA et
ganE::uidA (Figure 38). Lactivit -glucuronidase des fusions a t mesure dans un
contexte sauvage et ganR. Lexpression des fusions ganE::uidA et ganK::uidA est affecte par
labsence de GanR, puisque lexpression diminue respectivement dun facteur 8 et 5. GanR

Activit -glucuronidase
(nmol/min/mg
de protine)
Activit -glucuronidase

active donc lexpression des gnes du locus gan.

14000
12000
10000
8000

GanR+
GanR-

6000
4000
2000
0

ganE

ganK

Figure 38 : Activit -glucuronidase des fusions transcriptionnelles des gnes ganE et


ganK avec le gne uidA dans un contexte sauvage ou dans un contexte ganR::Cml dans
un milieu minimum contenant du glycrol comme source de carbone.

2009 Tous droits rservs.

78

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

4. Rle du locus gan dans linfection de lhte


a)

Impact sur la virulence

Des tests de virulence sur pomme de terre et sur feuille dendives ont t raliss afin
de voir limpact de chaque mutation du locus (ganA, ganB, ganE, ganK, ganL et ganR) sur la
virulence. Aucune diffrence de macration na t observe chez les diffrents mutants et la
croissance nest pas affecte non plus. Ltude de limpact des mutations sur la virulence a
donc permis de montrer que ces gnes navaient pas une implication majeure dans la
virulence dans les conditions testes en laboratoire. Une conclusion similaire a t tire de
ltude des cellulases (endoglucanases) (Boccara et coll., 1994). Les principaux facteurs
restent donc les pectinases qui sont ncessaires la dstructuration de la paroi des cellules
vgtales. Cette pectinolyse permet alors de librer diffrents oligomres qui entreront dans le
priplasme, dont les galactanes qui seront donc utiliss grce aux protines Gan.

b)

Expression du locus lors de linfection

Lanalyse de lexpression des fusions transcriptionnelles ganA::uidA, ganE::uidA a t


ralise aprs infection de feuilles dendive pendant 24H et 30C. Lexpression dune fusion
pelD::uidA (pelD codant une pectate-lyase) a t utilise comme tmoin, puisque il a t
montr quelle tait fortement exprime in planta (Hugouvieux-Cotte-Pattat et coll., 1992).
ganA et ganE sont fortement transcrits dans le tissu macr, respectivement 4 et 3 fois plus
que pelD (Figure 39).

2009 Tous droits rservs.

79

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Activit -glucuronidase
Activit -glucuronidase
(nmol/min/mg
de protine)

100
80
60
40
20
0
ganA

ganE

pelD

Figure 39 : Activit -glucuronidase des fusions des gnes ganA, ganE et pelD aprs 24h
de macration sur les feuilles dendives, daprs Nicole Hugouvieux-Cotte-Pattat (Delangle
et coll., 2007)

2009 Tous droits rservs.

80

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C. Relation entre le locus gan, les OPG et le systme


RcsCDB
Lors de ltude protomique du mutant opgG, on a observ que la protine GanA tait
surexprime dun facteur 4,4 dans un mutant opgG par rapport la souche sauvage (Bouchart
et coll., 2007) et sous exprim dans le mutant rcsC2 dun facteur 0,8 (Delangle, 2007). Cette
protine est trs abondante. Jai donc voulu voir si il existait un lien entre lexpression du
gne ganA, les OPG et le systme RcsCDB en regardant limpact des mutations opgG et
rcsCBD sur lexpression de la fusion ganA::uidA.
Le dosage de lactivit -glucuronidase a t effectu sur des bactries permabilises (Cf.
matriels et mthodes). Les cultures ont t effectues en LB sans NaCl et arrtes en phase
stationnaire (Figure 40).

Figure 40 : Activit -glucuronidase de la fusion gan::uidA dans un contexte sauvage,


opgG et rcsCBD dans un milieu LB-NaCl. Les cellules ont t arrtes en phase
stationnaire et permabilises pour faire le dosage. Les rsultats prsents sont la moyenne de
3 dosages indpendants.

Nous avons observ le mme niveau dexpression de la fusion ganA::uidA pour la souche
NFB3678 (ganA::uidA) et NFB3718 (opgG, ganA::uidA). Par contre, nous observons que la
fusion ganA::uidA est exprime 80% dans la souche NFB3843 (rcsCBD, ganA::uidA) par
rapport la souche NFB3678 (ganA::uidA).
Aurlie Delangle a ralis le dosage de lactivit endo-1,4--galactanase et a trouv des
rsultats similaires. Il semble donc quil y ait eu une diffrence dexpression du gne ganA
lors de lanalyse protomique du mutant opgG.

2009 Tous droits rservs.

81

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

D. Conclusion et discussion
Ce travail constitue la premire description du locus gan chez E. chrysanthemi. Nous avons
suppos que ce locus tait impliqu dans la dgradation et le transport doligogalactanes issus
de la pectine de la paroi vgtale (Figure 40). La dgradation de la paroi des cellules vgtales
est assure par la production de diffrentes enzymes, principalement les pectinases ainsi que
les cellulases et les protases. Les pectinases sont les seules tre ncessaires pour le
dveloppement de la pourriture cause par E. chrysanthemi (Collmer et Keen, 1986). Elles
sont ncessaires pour dstructurer la pectine afin den librer des sous fractions qui seront
utilises comme source de carbone pour la croissance dans les tissus vgtaux.
Le locus identifi comporte 9 gnes :
cinq sont impliqus dans le transport dont quatre gnes (ganE, ganF, ganG, et ganK)
codant un systme de transport de type ABC et le gne ganL codant une porine. Le gne
codant la porine a t initialement annot lamB, cette annotation est inapproprie puisque
E. chrysanthemi 3937 est rsistante au phage et quelle est incapable dutiliser le maltose ou
les maltodextrines comme source de carbone.
Deux sont impliqus dans la dgradation du substrat : les gnes ganA et ganB codant
des glycosides hydrolases (endo -1,4-galactanase et exo -1,4-galactanase) intervenant dans
la dgradation des -1,4-galactanes en galactose.
Le gne ganC code un fragment de lenzyme IIBC de systme PTS. Bien que cette
protine soit conserve parmi plusieurs espces bactriennes, aucune fonction na pu lui tre
prdite, ni attribue.
Le dernier gne, ganR, code un rgulateur transcriptionnel.

2009 Tous droits rservs.

82

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

RGII

Pectate-lyases
Rhamnogalacturonate-lyases

G
RGI

GanL

RGII

GanA
GanE

HGA

galacturonate

GanFGanG

galactose

Pectine

arabinose
fucose

ATP
ADP

GanK GanK

GanB

Figure 41 : Reprsentation schmatique chez E. chrysanthemi du systme gan impliqu


dans le transport et le catabolisme des galactanes. Aprs laction denzymes
pectinolytiques, les galactanes (G) librs traversent la membrane externe par la porine GanL,
sont dgrads dans le priplasme par GanA en galactotriose puis pris en charge par la protine
affine GanE qui amne ces oligomres au systme de transport de type ABC, GanFGK2. Ces
oligomres sont ensuite dgrads dans le cytoplasme en galactose.

2009 Tous droits rservs.

83

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Nous avons compar la croissance des mutants gan en prsence de galactanes, de gal3 gal6
(issus de la dgradation des galactanes in vitro par GanA) et de galactose. Les mutants gan ne
sont plus capables de crotre en prsence de galactanes comme seule source de carbone, seuls
les mutants ganL et ganA sont capables de crotre en prsence des produits de dgradation des
galactanes et enfin toutes les souches sont capables dutiliser le galactose. Par contre, aucune
souche nest capable dutiliser le galactobiose, y compris la souche sauvage.
Nous proposons donc le modle suivant (Figure 41): les chanes de galactanes diffusent
travers la membrane externe par la porine GanL, GanA capture les galactanes au cours de leur
entre par GanL et les clive dans le priplasme. Ces oligomres sont pris en charge par GanE,
la protine affine priplasmique qui les amnent au complexe GanFGK2, permettant le
transport travers la membrane interne. GanB clive alors les oligomres en galactose qui
seraient pris en charge par les protines GalKTE, permettant ainsi la synthse
dUDP-Galactose. Lactivit de GanB est lactivit -galactosidase majoritaire, alors que
lautre activit -galactosidase code par lacZ est minoritaire. E. chrysanthemi est incapable
de mtaboliser le lactose comme seule source de carbone bien quelle possde une activit galactosidase. Le rle du gne lacZ reste donc peu clair.
La protine GanA permet in vitro la production de gal3 gal6 issus de la dgradation in vitro
des galactanes, avec en majorit des gal4. Cependant un mutant ganL ou ganA ne permet un
rendement de croissance que de 20%, ce qui correspond la proportion de gal3, suggrant que
la fraction utilisable par la bactrie est constitue des gal3. La diffrence de taille des produits
issus de la dgradation des galactanes in vitro (gal3 gal6) et in vivo (potentiellement les gal3)
pourrait sexpliquer par labsence des protines GanL et GanE lors de la production in vitro
des gal3 gal6. Il pourrait donc y avoir un contrle de GanA impliqu dans la dgradation des
galactanes par ces protines (GanL et GanE). Ainsi in vivo, GanA permettrait donc de
produire des gal3, qui sont transports par GanFGK2, les galactotrioses sont alors dgrads en
galactose par lexo -1,4-galactanase GanB.
Les endo--1,4-galactanases prsentent plusieurs localisations :
Elle peut avoir une localisation extracellulaire, cest le cas pour Aspergillus niger,
Bacillus subtilis et Pseudomonas fluorescens. Cette localisation extracellulaire permet
lendo--1,4-galactanase de dgrader directement les galactanes lis la pectine (De Vries et
coll., 2002 ; Shipkowski et Brenchley, 2006. ; Braithwaite et coll., 1997).
Chez Bifidobacterium longum, cette enzyme est extracellulaire mais ancre dans la
membrane (Hinz et coll., 2005), ce qui la rapproche de celle d E. chrysanthemi. Le substrat

2009 Tous droits rservs.

84

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

ne sera utilisable que lorsque les galactanes seront librs par dautres enzymes qui auront
dgrad la pectine et libr les galactanes.
Pour E. chrysanthemi, la localisation priplasmique de GanA implique un systme de
transport relativement complexe. Il ncessite dabord les pectinases quelle synthtise afin de
librer les galactanes de la pectine, puis un systme de transport et de dgradation pour cliver
et transporter travers lenveloppe les oligogalactanes utilisable par la bactrie.
Ce systme est complexe mais il peut prsenter un avantage car la bactrie dgrade les
galactanes uniquement pour sa propre utilisation. Une localisation extracellulaire entranerait
une dgradation directe des galactanes en oligosaccharides disponibles pour dautres bactries
se trouvant aux alentours mais ne lobligerait pas avoir un systme de transport aussi
sophistiqu.
Lensemble des gnes de ce locus est conserv avec la mme organisation chez Y. pestis, Y.
pseudotuberculosis et Y. enterocolitica. Cette conservation suggre que diffrentes espces de
Yersinia ont aussi les capacits de transporter et cataboliser les -1,4-galactanes. Cela peut
paratre surprenant puisque ma connaissance, les galactanes ne sont prsents que dans les
plantes. Cependant des enzymes pectinolytiques et cellulolytiques actives ont dj t
identifies chez des entrobactries qui ne sont pas phytopathognes, comme une pectatelyase chez Y. pseudotuberculosis (Manulis et coll., 1988), une pectate-lyase chez Y.
enterocolitica (Liao et coll., 1999) ou une carboxymthylcellulase chez Salmonella
typhimurium (Yoo et coll., 2004). Ces enzymes pourraient alors servir la nutrition des
bactries pour leur survie en tant que saprophytes.
Ltude de la rgulation a permis de mettre en vidence limplication de 3 facteurs :
CRP comme pour de nombreuses enzymes pectinolytiques (Hugouvieux-Cotte-Pattat
et coll., 1992 ; Bourson et coll., 1993). Un mutant crp prsente bien une perte dactivation.
la phase de croissance puisquon observe une augmentation en phase stationnaire.
GanR : ces gnes sont galement contrls par un rgulateur spcifique. GanR
appartient la famille des rpresseurs de type LacI, mais il semble agir comme activateur de
lexpression des gnes gan. Cette rgulation est peu significative chez E. chrysanthemi. De
plus chez E. carotovora, tous les gnes gan sont prsents lexception de ganR. Nous
pouvons envisager une diffrence de rgulation chez les bactries pectinolytiques, ainsi
quune expression et un rle de GanR faibles chez E. chrysanthemi. Les rgulateurs

2009 Tous droits rservs.

85

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

transcriptionnels de type LacI sont connus pour reconnatre un site de fixation compos de
deux squences imparfaites rptes inverses de 9 nuclotides avec une paire centrale de GC
(Gelfand et Laikova, 2003). Nous avons donc recherch lexistence de tels sites dans le locus
gan. Un palindrome imparfait avec une paire centrale de GC a t reconnu dans les rgions
intergniques ganK-ganE et ganR-ganL. La squence consensus du site potentiel de fixation
de GanR est la suivante : ATGTGAACGTAatACaT. La prsence dun consensus nous permet
denvisager que GanR rgule directement lexpression des gnes du locus gan.
Deux tudes protomiques ont montr que la souche EC3937 prsentait une grande quantit
de lendo -1,4-galactanase GanA pour des cultures en milieu riche (LB) ou en milieu
minimum (M63) (Bouchart et coll., 2007 ; Babujee et coll., 2007). Nous ne pouvons donc
exclure une drgulation dans la souche EC3937.
Certaines tudes ralises au laboratoire (Bouchart et coll., 2007 et Delangle, 2007)
montraient que lexpression de la protine semblait affecte dans un mutant opgG et un
mutant rcsC2. Le systme RcsCDB est connu pour rguler de nombreux gnes impliqus dans
la virulence et labsence dOPG entrane un phnotype plotrope dont labsence de virulence
et une diminution de la synthse et de la scrtion dexoenzymes. Jai donc voulu voir
limpact des mutations opgG et rcsCBD sur lexpression du gne ganA. Les rsultats ont
montr quil ny avait pas de diffrence significative dexpression du gne ganA dans ces
deux contextes. Le rgulon gan ne semble donc pas tre sous le contrle du systme RcsCDB
et ne semble pas affect par labsence dOPG.
Ltude de limpact des mutations sur la virulence a permis de montrer que ces gnes gan
nont pas une implication majeure dans la virulence sur feuilles dendive, tubercules de
pomme de terre et Saintpaulia ionantha dans les conditions testes en laboratoire. Ces gnes
gan sont exprims pendant linfection mais leur expression nest pas essentielle pour la
virulence dE. chrysanthemi. Une conclusion similaire a t tire de ltude des cellulases
(endoglucanases) (Boccara et coll., 1994). Les principaux facteurs restent donc dans un
premier temps, les pectinases qui sont ncessaires la dstructuration de la paroi des cellules
vgtales. Cette pectinolyse permet alors de librer diffrents oligomres qui seront dgrad
par des enzymes de dgradation dans un second temps. Parmi celles-ci, les protines Gan
codes par le locus tudi qui permettront lutilisation des galactanes. Ils pourraient tre
utiliss lorsque linfection est bien tablie, ce qui expliquerait lexpression plus abondante des
gnes gan en phase stationnaire.

2009 Tous droits rservs.

86

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Rsultats :
Partie II Rle du systme deux composants RcsCDB
dans le pouvoir pathogne dErwinia chrysanthemi et
lien existant entre les OPG et le systme RcsCDB.

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Partie II - Rle du systme deux composants


RcsCDB dans le pouvoir pathogne dErwinia
chrysanthemi et lien existant entre les OPG et le
systme RcsCDB.
Afin de comprendre le rle des OPG, une approche gntique a consist en la recherche de
mutations permettant la suppression du phnotype du mutant opgG. Pour cela, une
mutagense la N-mthyl-N-nitroso-N-nitrosoguanidine (NTG) de la souche opgG a t
effectue. Franck Bouchart a recherch des bactries ayant une restauration de la motilit (les
bactries opgG ayant une perte de motilit). Aprs avoir isol des clones, il a ensuite analys
les autres phnotypes tests pour le mutant opgG. Il sest intress particulirement un clone
dont la mutation permettait de restaurer la quasi-totalit des phnotypes sauvages :
restauration de la motilit, absence de mucosit, restauration partielle de la rsistance aux sels
biliaires, restauration de la scrtion des exoenzymes, restauration de la virulence sur
tubercules de pomme de terre mais pas sur feuilles dendive. La mutation a ensuite t
localise dans le gne rcsC : rcsC2. Le gne rcsC est un gne prsent dans un locus de 3
gnes : rcsC-rcsBD. Ce locus code un systme deux composants.

A. Impact du systme RcsCBD sur le pouvoir pathogne


dErwinia chrysanthemi.
1. Effet des mutations dans le systme Rcs (rcsC2, rcsC, rcsD,
rcsB, rcsCBD et rcsF) dans les contextes sauvage et opgG.
Jai ralis une comparaison phnotypique du mutant rcsC2 avec des mutants affects dans le
locus rcsCBD (par insertion de cassette ou dltion totale du locus). Les tests phnotypiques
raliss sont ceux utiliss lors de la caractrisation du phnotype du mutant opgG : test de
scrtion enzymatique, test de motilit, test de mucosit et tests de virulence (feuille dendive
et tubercule de pomme de terre).
Les mutants rcsC et rcsD ont t construits par Franck Bouchart au cours de sa thse, jai
quant moi construit les mutants rcsB, rcsCBD et rcsF (Cf. Matriel et mthodes). Les
phnotypes cits pour la souche sauvage (EC3937) et la souche opgG sont ceux dcrits par
Page et coll. en 2001.
Lensemble des rsultats prsents est rcapitul dans le tableau 8.

87
2009 Tous droits rservs.

http://doc.univ-lille1.fr

2009 Tous droits rservs.

Virulence

Diamtre
Souches

Mucosit

des colonies

Activit pectinase

sur glose

Rsistance aux
sels biliaires

molle
EC3937 (sauvage)

++ (2,2)

NF3500 (opgG)

NF3591 (rcsC2 ; opgG)

NF3611 (rcsC2)

NF3683 (rcsC ; opgG)

Feuille

Tubercule de pomme

dendive

de terre

++

(0,8)

(2)

++ (2,3)

+++

+++

++

++

(2)

++

ND

NF3682 (rcsC)

++ (2,3)

+++

+++

NF3670 (rcsD ; opgG)

+/- (1,2)

ND

NF3669 (rcsD)

ND

+/-

NF3821 (rcsB ; opgG)

+/-

(1)

+/-

ND

NF3820 (rcsB)

++ (2,5)

++

ND

NF3754 (rcsCBD; opgG)

+/-

+/-

NF3753 (rcsCBD)

++ (2,5)

++

+++

NF3786 (rcsF; opgG)

+/-

(1)

+/-

ND

NF3785 (rcsF)

++ (2,2)

++

ND

(0,6)

(1,2)

http://doc.univ-lille1.fr

Tableau 8: Rcapitulatif de tous les phnotypes tests en laboratoire des souches affectes dans le systme Rcs et dans la synthse des
OPG (opgG). Les phnotypes de mucosit sont reprsents par un (-) pour une souche non muqueuse et par (+) pour une souche muqueuse. La
motilit est reprsente par le diamtre de la colonie qui est exprime entre parenthse (cm). Les tests de rsistances aux sels biliaires nont pas
t effectus pour toutes les souches (ND= Non dtermin).

88

Thse d'Anne-France Prouvost, Lille 1, 2008

++

Thse d'Anne-France Prouvost, Lille 1, 2008

a)

Effet des mutations sur la mucosit

La souche sauvage nest pas muqueuse contrairement la souche opgG qui prsente un
phnotype muqueux sur bote. Comme attendu, les souches rcsC, rcsD, rcsB et rcsCBD ne
sont pas muqueuses et ceux dans un contexte sauvage ou opgG. Comme la souche rcsF, la
souche rcsF opgG nest pas muqueuse sur bote, ce qui correspond au rsultat obtenu par
Shiba et coll. en 2004. La souche rcsC2 opgG nest pas muqueuse, la mutation permet donc
de supprimer le phnotype de la souche opgG. La souche rcsC2 ne prsente pas de phnotype
muqueux.

b)

Effet des mutations sur la motilit

La motilit est caractrise par le diamtre des colonies sur glose molle, que nous appelons
ici halo de nage.
La souche opgG prsente une diminution de la motilit.
La souche rcsC2 opgG prsente un halo de nage de taille similaire voire lgrement
infrieure celui de la souche sauvage. La mutation permet donc de supprimer le phnotype
opgG. La souche rcsC2 prsente un halo de nage de taille semblable voire lgrement
suprieure celui de la souche sauvage.
Comme pour la mutation rcsC2, la mutation rcsC engendre une restauration de la
motilit de la souche opgG (c'est--dire un halo de nage de taille semblable ou lgrement
infrieur celui de la souche sauvage) et pour le mutant rcsC, on observe un halo de nage de
taille semblable voire lgrement suprieure celui de la souche sauvage.
La souche rcsD opgG prsente un halo de nage de taille suprieur celui de la souche
opgG mais infrieur celui de la souche sauvage. La mutation permet donc de supprimer
partiellement le phnotype opgG. Cependant, la souche rcsD prsente un halo de nage
infrieur celui de la souche opgG. La mutation rcsD prsente un phnotype pas attendu,
nous en discuterons par la suite.
La dltion totale du locus rcsCBD et les mutations rcsB et rcsF permettent dans un
contexte opgG dobtenir un halo de nage de taille intermdiaire entre la souche sauvage et la
souche opgG. La mutation permet de supprimer partiellement le phnotype opgG. Les
souches rcsF, rcsB et rcsCBD prsente un halo de nage de taille identique ou lgrement
suprieur celui de la souche sauvage.

2009 Tous droits rservs.

89

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

c)

Effet des mutations sur lactivit pectinase

Contrairement la souche sauvage, la souche opgG ne prsente pas de halo de


dgradation sur bote PAG.
La souche rcsC2 opgG prsente un halo de dgradation de taille infrieure celui de la
souche sauvage, mais suprieur celui de la souche opgG. La mutation permet donc de
supprimer partiellement le phnotype opgG. La souche rcsC2 prsente un halo de dgradation
suprieur celui de la souche sauvage.
La souche rcsC opgG prsente un halo de dgradation dune taille similaire celui de
la souche sauvage. La mutation permet donc de supprimer le phnotype opgG. La souche
rcsC prsente un halo de dgradation suprieur celui de la souche sauvage.
Les souches rcsD et rcsD opgG prsente un halo de dgradation de taille infrieure
celui de la souche sauvage, mais suprieur celui de la souche opgG. La mutation rcsD
permet donc de supprimer partiellement le phnotype opgG. La souche rcsD contrairement au
mutant rcsC et rcsC2 prsente un halo de dgradation infrieur celui de la souche sauvage.
Les souches rcsB, rcsCBD et rcsF prsente un halo de dgradation semblable celui
de la souche sauvage. Ces mutations dans un contexte opgG permettent dengendrer une
diminution de la taille des halos de dgradation, les souches ont une taille de halo trs
infrieure celle de la souche sauvage mais lgrement suprieure celle de la souche opgG.
La mutation permet donc de supprimer partiellement le phnotype opgG.
Ces rsultats sont en contradiction avec les rsultats obtenus lors de ltude de lexpression
des enzymes dgradant la paroi des cellules vgtales chez Pectobacterium carotovorum
(Erwinia carotovora) (Andresen et coll., 2007). Les auteurs ont alors montr quune mutation
par insertion dun mini transposon dans les gnes rcsC, rcsD et rcsB permettait une
augmentation de lexpression des enzymes de dgradation ainsi quune augmentation de la
virulence. Leffet le plus marqu est observ pour le mutant rcsB, alors que nous nous
nobservons aucune diffrence entre la souche sauvage et le mutant rcsB. Par contre, la
mutation rcsF nengendre pas non plus de variations significatives de lexpression des
enzymes dgradant la paroi des cellules vgtales chez Pectobacterium carotovorum
(Andresen et coll., 2007).

d)

Effet des mutations sur la rsistance aux sels biliaires

La souche opgG prsente une forte sensibilit aux sels biliaires (Page et coll., 2001).

2009 Tous droits rservs.

90

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La mutation rcsC2 permet une restauration partielle de la mutation opgG car le mutant
rcsC2 opgG prsente une rsistance aux sels biliaires suprieure la souche opgG mais reste
infrieure celle de la souche sauvage EC3937. La mutation rcsC2 seule engendre une
rsistance accrue aux sels biliaires (suprieure celle de la souche sauvage).
La dltion du locus rcsCBD permet galement une restauration partielle de la
mutation opgG (le mutant rcsCBD opgG prsente une rsistance aux sels biliaires
intermdiaire entre celle observe pour la souche opgG et celle observe pour la souche
sauvage EC3937). Comme pour la mutation rcsC2, la dltion rcsCBD et la mutation rcsC
engendrent dans un contexte opg+ une rsistance accrue aux sels biliaires (suprieure celle
de la souche sauvage).
Leffet des autres mutations sur la rsistance aux sels biliaires na pas t test.

e)

Effet des mutations sur la virulence

La souche opgG nest pas capable de crotre in planta, elle est donc non virulente
(Page et coll., 2001).
Le mutant rcsC2 opgG est virulent sur tubercule de pomme de terre mais pas sur
feuille dendive. La mutation rcsC2 permet donc une restauration partielle de la virulence,
dpendante de la plante infecte. Cette mutation seule (rcsC2) permet dengendrer une
hypervirulence sur feuille dendive ainsi que sur tubercule de pomme de terre avec 3 fois plus
de macration recueillie pour la souche rcsC2 que pour la souche sauvage et pour un mme
inoculum (Bouchart, 2006).
Le mutant rcsC est virulent sur tubercule de pomme de terre et sur feuille dendive,
avec une virulence similaire celle de la souche sauvage EC3937. Le mutant rcsC ne prsente
pas dhypervirulence comme la souche rcsC2. Cette mutation rcsC permet de supprimer le
phnotype opgG, puisquune souche opgG rcsC est virulente sur tubercule de pomme de terre
et faiblement virulente sur feuille dendive.
Le mutant rcsD prsente une virulence sur tubercule de pomme de terre et sur feuille
dendive trs attnue. Cette mutation rcsD permet de supprimer partiellement le phnotype
opgG, puisquune souche opgG rcsD est virulente sur tubercule de pomme de terre mais pas
sur feuille dendive.
Les mutants rcsB, rcsF et rcsCBD sont virulents sur tubercule de pomme de terre et
sur feuille dendive, par contre ces mutations ne permettent pas de supprimer le phnotype

2009 Tous droits rservs.

91

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

opgG, puisque les souches opgG rcsB; opgG rcsF et opgG rcsCBD ne sont pas virulentes ni
sur tubercule de pomme de terre ni sur feuille dendive.

f)

Bilan des mutations

La mutation rcsC2 permet de restaurer la majorit des caractres phnotypiques


sauvages chez la souche opgG. La mutation rcsC2 dans un contexte opg+ permet une
augmentation de la virulence, de la rsistance aux sels biliaires, de la motilit et de lactivit
pectinase.
La mutation rcsC permet de restaurer la totalit des caractres phnotypiques sauvages
chez la souche opgG. Contrairement la souche rcsC2, la mutation rcsC nengendre pas une
hypervirulence ni sur tubercule de pomme de terre ni sur feuille dendive.
La mutation rcsD permet de restaurer partiellement les caractres phnotypiques
sauvages chez la souche opgG, mais pas autant que les mutations rcsC2 et rcsC. Par contre, le
mutant rcsD est trs affect dans la motilit et dans la virulence contrairement aux mutants
rcsC2 et rcsC. La mutation dans le gne rcsD a t construite par linsertion de la cassette
chloramphnicol (Cml). On ne peut exclure que cette cassette puisse avoir un effet sur la
transcription du gne rcsB localis en aval du gne rcsD. Le mutant rcsB ne prsente pas les
phnotypes observs pour le mutant rcsD, il semble donc que si la mutation dans le gne rcsD
affecte la transcription de rcsB, alors on aurait plutt une augmentation de sa transcription
plutt quune diminution.

La dltion du locus rcsCBD et la mutation rcsB dans un contexte opgG engendrent

une perte de mucosit, une lgre augmentation de la motilit et de la scrtion des pectinases
(par rapport aux phnotypes de la souche opgG) mais ne permettent pas de restaurer la
virulence de la souche opgG. De plus, la dltion du locus rcsCBD et la mutation rcsB
engendrent une lgre augmentation de la motilit et la dltion du locus rcsCBD engendre
une rsistance accrue aux sels biliaires. Les souches rcsCBD et rcsB sont virulentes. Le
locus rcsCBD et le gne rcsB ne sont pas essentiels la virulence.
Bien que les mutations rcsC2 et rcsCBD nengendrent pas les mmes phnotypes, ils
permettent tout deux de supprimer la sensibilit aux sels biliaires de la souche opgG et
dengendrer une rsistance accrue dans un contexte opgG+.
La mutation du gne rcsF dans un contexte opgG engendre une perte de la mucosit et
augmentation de la scrtion des pectinases par rapport la souche opgG mais ne permet pas

2009 Tous droits rservs.

92

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

de restaurer sa virulence. De plus, cette mutation dans un contexte opgG+ nengendre pas de
phnotype diffrent de la souche sauvage.
Nous pouvons donc dire que la mucosit est dpendante du systme Rcs, toute
mutation nulle dans les gnes rcsF, rcsC, rcsD ou rcsB engendre une perte de lactivation. La
lipoprotine RcsF est donc ici essentielle pour la mucosit.
De plus, pour les autres phnotypes tests, les rsultats obtenus diffrent en fonction
des mutations. La rgulation des gnes est donc alors dpendante du systme Rcs et dautres
composantes.

2009 Tous droits rservs.

93

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Caractrisation de la mutation rcsC2


Nous venons de voir les diffrents phnotypes de la souche rcsC2. Nous avons voulu
caractriser plus prcisment cette mutation. Pour cela, jai voulu voir limpact des mutations
opgG, opgG rcsC2 et rcsC2, sur lexpression de fusions transcriptionnelles connues pour tre
rgules (positivement ou ngativement) par le systme Rcs et avec comme contrle la
souche sauvage et le mutant rcsCBD. Les fusions transcriptionnelles qui ont t ralises
sont les fusions : flhD-uidA et ftsA-uidA.
Les sites dinsertion des Tn5 ne sont pas encore dfinis, cependant nous avons vrifi que les
diffrentes insertions des Tn5 comportant les fusions transcriptionnelles nengendrent aucune
variation des phnotypes observs (virulence, motilit, etc).

a)

Effets des mutations sur les fusions transcriptionnelles

Fusion flhD-uidA

Le gne flhD est connu pour tre rprim par le systme RcsCDB. Jai mesur lexpression de
la fusion transcriptionnelle flhD-uidA pour des souches cultives en LB-NaCl et arrtes en
phase exponentielle (DO = 0,7) (figure 42 et tableau 9).
Dans la souche opgG, la fusion transcriptionnelle flhD-uidA diminue dun facteur 3 (34%) par
rapport la souche sauvage. Dans un contexte rcsC2 opgG, la fusion est exprime 127%.
Enfin les souches rcsC2 et rcsCBD prsentent respectivement 203% et 177% dactivit.
Ces rsultats sont corrls avec les phnotypes observs sur bote. La souche opgG se
caractrise par une motilit plus faible que la souche sauvage, la souche opgG rcsC2 prsente
une restauration de la motilit (crible utilis pour isoler le clone), les souches rcsC2 et
rcsCBD prsentent un halo de nage suprieur celui de la souche sauvage.

2009 Tous droits rservs.

94

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

DO/min/mg de protines * 10-3

4,5
4
3,5
3
2,5
2
1,5
1
0,5
0

opgG

rcsC

rcsC2

rcsC2

+
rcsCBD

Figure 42: Expression de la fusion transcriptionnelle flhD-uidA dans un contexte


sauvage (NFB3800), opgG (NFB3805), opgG rcsC2 (NFB3806), rcsC2 (NFB3807) et
rcsCDB (NFB3808). Les souches ont t cultives en LB-NaCl, arrtes en phase
exponentielle (DO = 0,7), casses la presse de French. Le substrat utilis pour doser
lactivit -glucuronidase est le PNPU. Lactivit observe est la moyenne de 3 mesures
indpendantes, le rsultat est exprim en DO410nm/min/mg de protines*10-3.

Ainsi dans un contexte opgG, on observe une rpression plus importante de la fusion (le
systme Rcs est activ en absence dOPG).
La mutation rcsC2 permet dans un contexte opgG un retour proche au niveau sauvage
(127%) d une compensation de la rpression (engendre par labsence dOPG) par la
diminution de la rpression due la mutation rcsC2. La mutation rcsC2 dans un contexte
sauvage engendre une augmentation de lexpression de la fusion (cause par une diminution
de la rpression du systme Rcs).
Enfin la dltion totale du locus engendre une perte de la rpression.

2009 Tous droits rservs.

95

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Fusion ftsA-uidA

Le gne ftsA est connu pour tre activ par le systme RcsCDB. Jai mesur lexpression de la
fusion transcriptionnelle ftsA-uidA pour des souches cultives en LB-NaCl et arrtes en
phase exponentielle (DO = 0,7) (figure 43 et tableau 9).

DO/min/mg de protines * 10-3

2,5

1,5

0,5

opgG

rcsC

rcsC2

rcsC2

rcsCBD

rcsC2
miniTn5 rcsCBD

Figure 43: Expression de la fusion transcriptionnelle ftsA-uidA dans un contexte sauvage


(NFB3809), opgG (NFB3810), opgG rcsC2 (NFB3811), rcsC2 (NFB3812), rcsCDB
(NFB3813) et opgG, rcsC2, miniTn5rcsCBD (3859). Les souches ont t cultives en LBNaCl, arrtes en phase exponentielle (DO = 0,7), casses la presse de French. Le substrat
utilis pour doser lactivit -glucuronidase est le PNPU. Lactivit observe est la moyenne
de 3 mesures indpendantes, le rsultat est exprim en DO410nm/min/ mg de protines*10-3.

Dans la souche opgG, la fusion transcriptionnelle ftsA-uidA augmente dun facteur 13,2
(1324%) par rapport la souche sauvage. Dans un contexte rcsC2 opgG, la fusion est
diminue dun facteur 1,72 (58%). Enfin les souches rcsC2 et rcsCBD prsentent une
diminution dun facteur 1,85 (54%) et 2,38 (42%) respectivement.

2009 Tous droits rservs.

96

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Ainsi dans un contexte opgG, on observe une augmentation trs importante de lexpression
de la fusion (le systme Rcs est activ en absence dOPG).
Dans une souche rcsC2 opgG, lactivation engendre par labsence dOPG est compense
par la mutation rcsC2 (diminution de lactivation du systme Rcs). La mutation rcsC2 dans
un contexte sauvage engendre une diminution de lactivation de lexpression de la fusion
(cause par une diminution de lactivation du systme Rcs).
Enfin la dltion totale du locus engendre une perte dactivation.

Phnotype de la souche

Dosage de la fusion

Dosage de la fusion

flhD- uidA

ftsA-uidA

Sauvage

2,07

(100%)

0,15

(100%)

opgG

0,70

(34%)

2,03

(1324%)

opgG, rcsC2

2,64

(127%)

0,09

(58%)

rcsC2

4,20

(203%)

0,08

(54%)

rcsCBD

3,67

(177%)

0,06

(42%)

0,41

(270%)

rcsC2, opgG, miniTn5rcsCBD

ND

Tableau 9: Rcapitulatif des fusions transcriptionnelles flhD-uidA et ftsA-uidA dans un


contexte sauvage, opgG, opgG rcsC2, rcsC2 et rcsCDB. Les rsultats sont exprims en
DO410nm/min/ng de protines, le chiffre entre parenthse reprsente le pourcentage dactivit
par rapport la souche sauvage.

Nous pouvons donc conclure que :


la mutation opgG engendre une activation du systme Rcs, cest dire une augmentation
de la phosphorylation de RcsB.
la mutation rcsC2 entrane donc un niveau de phosphorylation plus faible de la protine
RcsB.

b)

La souche rcsC2 opgG ne peroit plus le choc osmotique

Une mutation ponctuelle rcsC2 supprime partiellement une mutation opgG en restaurant la
majeure partie des caractres du mutant lexception de la virulence qui nest pas
compltement restaure (absence de virulence sur feuille dendive).
Lanalyse de la fusion ftsA-uidA suite un choc osmotique montre que la souche sauvage et la
souche opgG rcsC2 ne se comportent pas de la mme faon face un choc osmotique (figure

2009 Tous droits rservs.

97

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

44). En effet, suite un choc osmotique, on observe une augmentation de lexpression de la


fusion ftsA-uidA pour la souche sauvage alors que dans un contexte opgG rcsC2, on nobserve
pas de variation de lexpression de la fusion.
La suppression de la mutation opgG par la mutation rcsC2 permet un retour un phnotype
proche de la souche sauvage mais la souche prsente quand mme une altration dans la
perception de son environnement. Cela peut tre d limpact de labsence des OPG sur
dautres systmes deux composants, nous en discuterons par la suite.

300

Pourcentage dactivit (%)

250

200

150

100

50

0
Temps

t0

t30

t60

t90

Figure 44: Expression de la fusion transcriptionnelle ftsA-uidA dans un contexte sauvage


(NFB3809, en gris fonc), opgG rcsC2 (NFB3811, en gris clair). Les souches ont t
cultives en LB-NaCl, prleves en phase exponentielle (DO = 0,7) (t0), puis un choc
osmotique a t ralis par ajout de 0,4 M de NaCl dans le milieu, les bactries ont alors t
prleves toutes les 30 minutes (t30, t60 et t90) puis casses la presse de French. Le substrat
utilis pour doser lactivit -glucuronidase est le PNPU. Le rsultat est exprim en
pourcentage dactivit par rapport la souche sauvage au temps t0.

2009 Tous droits rservs.

98

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Deux hypothses ont alors t proposes pour expliquer le phnotype de la souche rcsC2.
Cela peut tre d une diminution de la phosphorylation de RcsB ou une augmentation de sa
dphosphorylation. Afin de caractriser la mutation rcsC2, jai construit un mrodiplode par
une insertion ectopique du locus rcsCBD dans la souche rcsC2, opgG.

c)

Dominance de la mutation rcsC2

Clonage du locus rcsCBD

Pour cloner le locus rcsCBD en entier, jai effectu un clonage direct en masse : jai digr
lADN gnomique de la souche EC3937, rcupr les fragments de taille comprise entre 6 et
8kb (le fragment rcsCDB est de 7kb). Jai ensuite clon les fragments dans un vecteur :
pUC18Not et jai slectionn les clones sur LB+Amp+Xgal. Jai obtenu plusieurs clones
blancs dont certains prsentaient un phnotype muqueux.
Jai donc analys ceux-ci : un de clones contenait un fragment dADN comportant le gne
rcsF, et 2 autres clones comportaient le locus rcsCBD en entier. Jai vrifi par digestion
enzymatique et squenc les bornes de linsert pour confirmer la prsence du locus rcsCBD
en entier. Le plasmide portant le locus rcsCBD en entier est appel pNFW257. Jai ensuite
sous clon le fragment NotI comprenant le locus dans un pUTminiTn5Sp (digr par NotI)
afin de pouvoir exprim chez E. chrysanthemi le locus rcsCBD : pNFW261. La souche
comportant ce pUT miniTn5 Sp rcsCBD est galement muqueuse.

Phnotype du mrodiploide : opgG, rcsC2, miniTn5rcsCBD

Pour savoir si la mutation rcsC2 est dominante ou rcessive, jai introduit par conjugaison le
miniTn5rcsCBD dans la souche NFB3811 (rcsC2, opgG, miniTn5 ftsA-uidA).
Jai ralis 2 conjugaisons indpendantes, jai analys un clone pour chaque conjugaison
(NFB3859 et NFB3860) et les rsultats obtenus sont similaires. Jai donc dcid de prsenter
uniquement les rsultats dune insertion.
Jai analys lexpression de la fusion ftsA-uidA dans ce contexte. Les bactries sont prleves
en phase exponentielle (culture LB-NaCl), casses la presse de French. Les rsultats
prsents sont la moyenne de 3 valeurs indpendantes (figure 43).
La mutation opgG entrane une augmentation dun facteur 13,2 de lexpression de la fusion
ftsA-uidA par rapport lexpression de la fusion de la souche sauvage alors que la souche
rcsC2 opgG entrane une diminution dun facteur 1,72 de lexpression de la fusion ftsA-uidA.
Le rapport dexpression de la fusion entre la souche opgG et la souche opgG rcsC2 est donc

2009 Tous droits rservs.

99

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dun facteur 22,6 fois. Pour le mrodiploide (rcsC2, opgG, miniTn5 rcsCBD), lexpression de
la fusion transcriptionnelle augmente de 2,7 fois par rapport la souche sauvage. Le rapport
dexpression de la fusion entre la souche opgG et la souche opgG rcsC2 miniTn5 rcsCBD est
alors dun facteur 4,95 fois. Lexpression de la fusion ftsA-uidA est donc intermdiaire pour la
souche opgG rcsC2 miniTn5 rcsCBD.

Test de motilit

Jai voulu voir la capacit de nage du mrodiploide (tableau 10). La souche opgG rcsC2
prsente un halo de nage (diamtre sur glose molle des colonies) proche de celui de la
souche sauvage. Lajout du miniTn5rcsCBD permet dobtenir une souche avec un diamtre
suprieur celui de la souche opgG mais infrieur celui de la souche sauvage et du double
mutant opgG rcsC2.
On observe donc une dominance de la mutation rcsC2 sur la copie sauvage du gne rcsC.

Souche
Diamtre des colonies sur
glose molle (cm)

EC3937

NFB3500

NFB3609

NFB3859 rcsC2, opgG,

opgG

opgG, rcsC2

miniTn5rcsCBD

0,8

1,5

2,3

Tableau 10: Diamtre des colonies sur glose molle (cm) des souches EC3937, NFB3500,
NFB3609 et NFB3859.

Virulence du mrodiplode

Jai ensuite voulu savoir si lajout du locus rcsCBD allait permettre la souche de rester
virulente (lallle rcsC2 est dominant sur lallle rcsC) ou si la souche allait perdre sa
virulence et retrouver un phnotype opgG (lallle rcsC2 est rcessif par rapport lallle
rcsC). Ltude de la virulence a t effectue sur les tubercules de pomme de terre. Lorsque
lon inocule les tubercules avec 107 bactries (rcsC2, opgG, miniTn5rcsCBD), on observe une
pourriture dans la moiti des cas (15 inoculations ont engendres une pourriture molle contre
15 inoculations qui nont pas engendres de pourriture). Lorsque lon inocule les tubercules
avec 108 bactries, on observe une pourriture dans tous les cas (10 inoculations sur 10).
La complmentation de la mutation rcsC2 par le locus rcsCBD dans la souche opgG
nengendre pas un retour au phnotype du mutant opgG (perte totale de virulence avec une
inoculation de 107 et 108 bactries).
De plus, cette souche rcsC2, opgG, miniTn5rcsCBD ne prsente pas de phnotype muqueux.

2009 Tous droits rservs.

100

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Lexpression de la fusion ftsA-uidA et le test de motilit nous permettent daffirmer que la


mutation rcsC2 est dominante. De plus, cette souche reste virulente. Cette dominance nous
permet donc de proposer que la mutation rcsC2 entrane une dphosphorylation accrue de
RcsB par RcsC (et non une diminution de la phosphorylation de RcsB par RcsC), nous en
discuterons par la suite.

3. Expression dune version soluble de la lipoprotine RcsF :


TAT-RcsF
Lensemble de cette partie du travail a t ralis en collaboration avec Carmen
dberg-Ferragut.

a)

Construction de la version soluble : TAT-RcsF

Nous avons voulu caractriser la lipoprotine RcsF. Cependant, les recherches de prdiction
de structures ne nous ont pas permis de prdire des domaines structuraux bien dfinis (figure
45). Nous avons donc voulu dterminer la partie minimale active de la protine qui permettait
dactiver le systme Rcs. Nous avons donc exprim une version soluble (sans lancrage dans
la membrane externe) de la lipoprotine RcsF dE. chrysanthemi dans le priplasme.
Lancrage dans cette membrane se fait par la prsence de 3 acides gras en position Nterminale sur le premier rsidu, une cystine (surligne en vert sur la figure 46), de la
squence protique mature.
Carmen dberg-Ferragut a construit un vecteur contenant la squence signal TAT dOpgD de
Xylella fastidiosa dans le plasmide pYZ4 sous le contrle du promoteur placUV5. Ce vecteur,
pXFD11, permet la scrtion par le systme TAT de diverses protines et dans le cas de
pXFD11, il permet la scrtion de la -lactamase (Figure 47). Elle a ensuite introduit dans ce
vecteur, une version tronque du gne de la lipoprotine RcsF dE. chrysanthemi codant une
protine dpourvue de sa squence signal et du premier acide amin de la lipoprotine mature
permettant lancrage la membrane externe : la cystine 16 (Figure 46 et 47). Ce plasmide
sappelle pNFW176.
La souche dE. coli contenant ce plasmide pNFW176 (avec la version soluble de RcsF) est
trs fortement muqueuse indiquant une surexpression de la synthse des exopolysaccharides.
La surexpression de la version soluble de la lipoprotine RcsF dErwinia chrysanthemi
entrane une activation du systme Rcs dE. coli.

101
2009 Tous droits rservs.

http://doc.univ-lille1.fr

2009 Tous droits rservs.

27
|

37
|

47
|

57
|

67
|

77
|

87
|

97
|

107
|

117
|

127
|

MRAVPVLLLAFSLTGCSLLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
+ -+ +- +++
+
+
+
+
MLRC
DSC
PHD
GORIV

::
hhhhhhhhhh
eeehhhhhh
hhhhhhhhhh
hhhhhhhhhhh

* *

*:

**
* ::
*
hhhhhhhhhhhhhhhhhhhhhh
hhhhhheeeeeeeee
hhhhhhhhhhhhhh
hhhhhhhhhhhhhhhhhhhh

*
*
hhheee
eeeee
eeeeeeee

* :
eeee

Figure 45 : Squence de la lipoprotine RcsF et prdictions de structure.

Squence signal de RcsF


dE. chrysanthemi
MRAVPVLLLAFSLTGCSLLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSG

SSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ

Remplac par :

B
MGRRDFLKSVTAAWVAFGLPNPLGGPFATNRVIALRRLGQSQRFDYESLLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSG
SSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ

http://doc.univ-lille1.fr

Figure 46 : Squence protique de RcsF avec la squence signal et le rsidu cystine, en vert, permettant lancrage dans la membrane (A)
remplace par la squence signal dOpgD de X. fastidiosa (B).

102

Thse d'Anne-France Prouvost, Lille 1, 2008

Squence signal dOpgD de X. fastidiosa

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 47 : Plasmide construit pour lexpression priplasmique de RcsF


dE. chrysanthemi en orange (pNFW176) partir dune construction du laboratoire avec
blaM en jaune (pXFD11). En vert est reprsente la squence signal dOpgD de xylella
fastidiosa.

b)
Caractrisation de la structure de la protine : mutations des
cystines
Il a t montr que la lipoprotine RcsF prsentait au moins un pont disulfure puisque
lactivit de RcsF est dpendante de DsbA, protine priplasmique qui catalyse la formation
de ponts disulfures (Kadokura et coll., 2004). Les ponts disulfures sont raliss grce la
prsence de cystines. Nous avons donc ralis des mutagenses ponctuelles de chacune des 4
cystines (les cystines sont reprsentes en turquoise dans la figure 48). Nous avons
remplac chaque cystine par une srine, afin de voir les rsidus impliqus dans la formation
du pont disulfure, nous avons ainsi obtenu les plasmides comportant RcsF soluble avec les
mutations : C75S, C110S, C119S et C125S. La mutation C125S a t introduite dans un
plasmide comprenant une version raccourcie de RcsF (L18-K131) qui confre toujours un
phnotype muqueux.
Les souches dE. coli portant les plasmides avec les mutations C75S et C119S ont un
phnotype muqueux contrairement aux souches portant les plasmides avec les mutations
C110S et C125S qui ont un phnotype non muqueux sur bote (figure 49).

103
2009 Tous droits rservs.

http://doc.univ-lille1.fr

2009 Tous droits rservs.

27
|

37
|

47
|

57
|

67
|

77
|

87
|

97
|

107
|

117
|

127
|
Mucosit

+ -+ +- +++
+
+
+
+
LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
-------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
---------------------------------------EELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
------------------------------------------------DMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*

+
+
-

LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFR*--------------------------------------------------------------------LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHD*-------------------------

-------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
-------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHD*-------------------------------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVA*-----------------------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVC*---------------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQG*-------------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSA*-----------------------------------PAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALK*---

+
+

LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSSQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVCQGSALKVSAQ*
LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDSQIVSNVAGCYRQAVCQGSALKVSAQ*
LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGSYRQAVCQGSALKVSAQ*
LLHKPAAPAPQPQTPVAVEPPPKPKPVTHPAPAVLYKSAEELVGKPFRDMGEVSGSSCQSSAQDTPPSIPSARRRMQNRATAMKANAVLLHDCQIVSNVAGCYRQAVSQGSALK*

+
+
-

En turquoise, rsidus cytines muts en srines.


En gris, constructions donnant un phnotype muqueux

http://doc.univ-lille1.fr

104

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 48 : Comparaison des diffrentes versions tronques de TAT-RcsF et mutations des diffrentes cystines de TAT-RcsF.
Les phnotypes de mucosit sont reprsents par un (-) pour une souche non muqueuse et par (+) pour une souche muqueuse.

Thse d'Anne-France Prouvost, Lille 1, 2008

C75S

C110S

C119S

C125S

Figure 49: Reprsentation de la mucosit des souches dE. coli portant les plasmides
pNFW268 (C75S), pNFW246 (C110S), pNFW247 (C119S), pNFW269 (C125S).
Ces rsultats montrent que les cystines C110 et C125 sont ncessaires au bon
fonctionnement de RcsF. Il existe donc bien un pont disulfure entre les cystines C110 et
C125.

c)

Dtermination par dltion de la partie active de RcsF

Par mutagense dirige, Carmen dberg-Ferragut a delet progressivement le domaine


priplasmique de RcsF du ct N-terminal et du ct C-terminal de la protine afin de
caractriser la partie minimale active. Le phnotype muqueux sur bote permet ainsi de dire si
la protine est active ou non (tableau 11).
Il a donc t dtermin que la protine RcsF ltat soluble prsente une activit lorsque
est maintenue la rgion comprise entre les rsidus P49 et K131. De plus, une dltion au del
du rsidu E57 (en N-terminal) ou une dltion partir du rsidu A129 (en C-terminal) abolit
lactivit de la protine RcsF ltat soluble.
Il faudrait donc construire dautres mutations entre les rsidus P49 et E57, ainsi que le
mutant V130 afin de dterminer la partie minimale active (puisquune souche ayant une

2009 Tous droits rservs.

105

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dltion partir du rsidu A129 est non muqueuse et quune souche ayant une dltion
partir du rsidu K131 est muqueuse).
Cette version soluble serait le domaine dinteraction de la protine RcsF avec les protines
RcsC ou RcsD.

d)
Impact des mutations et des dltions dans TAT-rcsF sur
lexpression de la fusion cpsB-lacZ
Afin de confirmer ces rsultats, les plasmides ont t introduits dans une souche dE. coli
portant une fusion cpsB-lacZ (Davalos-Garcia et coll., 2001). La souche SK1291 contenant la
fusion cpsB-lacZ est rsistante la kanamycine, or le plasmide portant toutes les constructions
permet galement la rsistance la kanamycine. Carmen dberg-Ferragut a donc ralis, pour
chaque construction, linterruption du gne permettant la rsistance la kanamycine en
introduisant au niveau du site SspI une cassette permettant la rsistance lampicilline
(fragment BspHI rendu bouts francs de pUC19).
Nous avons ainsi pu doser leffet de la surexpression des diffrentes versions solubles de
RcsF sur la fusion cpsB-lacZ de la souche SK1291 (tableau 11).

La souche SK1291 prsente une activit basale (de 11UM) due lactivation de la fusion
cpsB-lacZ par la protine RcsF dE. coli.

Tous les phnotypes non muqueux (dltions en C-terminal jusquau rsidu A129, la
construction E57-Q135 et les mutations C110S et C125S) prsentent une activit nulle
proche de celui de la souche SK1291 (sans plasmide, 11UM) avec en moyenne une
expression de 19UM +/- 4. Cette moyenne reprsente le niveau de base lorsque le
plasmide est prsent mais ne permet pas la synthse dune protine active.

La surexpression de la version soluble entire TAT-RcsF (L18-Q135) engendre une


augmentation de lexpression de la fusion cpsB-lacZ dun facteur 8,4 par rapport au
niveau de base.

Pour 2 mutations (C75S et P49-K131), on observe une expression plus faible que pour la
version soluble mais suprieure au niveau de base, avec une augmentation de 2,5 fois par
rapport au niveau de base. Cette augmentation de 2,5 fois est suffisante pour rendre la
souche muqueuse.

Pour le mutant muqueux C119S, on observe une expression plus importante que pour la
version soluble avec une augmentation de lexpression de la fusion cpsB-lacZ dun facteur
35,6 par rapport au niveau de base, soit 4 fois plus que pour la version soluble entire
(L18-Q135).

2009 Tous droits rservs.

106

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Pour le mutant muqueux P49-Q135, on observe une expression plus importante que pour
la version soluble avec une augmentation de lexpression de la fusion cpsB-lacZ dun
facteur 46,5 par rapport au niveau de base.

Les plasmides L18-Q135 C119S et P49-135 engendrent, pour une raison inconnue, une
activation trs suprieure la version soluble entire (5 fois environ).

souche SK1291
L18-Q135
L18-Q135 C75S
L18-Q135 C110S
L18-Q135 C119S
L18-K131 C125S
P49-Q135
E57-Q135
L18-R65
L18-D109
P49-D109
P49-A117
P49-Q126
P49-G127
P49-A129
P49-K131

Mucosit
+
+
+
+
+

Fusion cpsB-lacZ
11
160
47
28
676
12
884
21
14
18
22
19
20
20
19
46

Tableau 11: Dosages de la fusion cpsB-lacZ de la souche SK1291 avec des plasmides
contenant diffrentes versions de TAT-rcsF. Les phnotypes sur bote sont reprsents dans
la colonne mucosit (- pour non muqueux et + pour muqueux). Les dosages ont t raliss
sur des souches permabilises une DO=0,8. Les rsultats prsents sont en Unit Miller.

2009 Tous droits rservs.

107

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

e)
Surexpression transitoire par le plasmide pNFW177 (contenant
TAT-rcsF) chez E. chrysanthemi
Jai lectropor diffrentes souches dE. chrysanthemi affectes dans le locus rcsCBD avec le
plasmide pNFW177 (permettant la synthse de TAT-RcsF). Aprs une postincubation de 1
2 heures, jai ensuite tal les lectroporations sur bote LB+Ampicilline afin de voir leffet
de la surexpression de TAT-RcsF. La surexpression est transitoire car E. chrysanthemi ne
conserve pas les plasmides et le nombre de copies nest pas contrl. Cependant aprs 48
heures dincubation 30C, des clones rsistants lampicilline ont t obtenus. Il faut noter
que 4 expriences dlectroporation ont t effectues pour chacune des souches, nous
obtenions en moyenne 200 colonies par bote pour les souches EC3937, NFB3669,
NFB3682, NFB3753 et NFB3820. Par contre, pour la souche NFB3611 (rcsC2), nous
obtenions un rendement trs faible avec en moyenne 4 colonies. La souche NFB3611
prsente donc une sensibilit llectroporation pouvant reflter une fragilit de la souche.
La surexpression transitoire de TAT-rcsF dans la souche sauvage permet bien dactiver le
systme RcsCDB puisque les clones issus de llectroporation de la souche sauvage EC3937
sont muqueux. Cette surexpression ncessite la prsence de toutes les protines du systme :
les protines RcsC, RcsD et RcsB, puisque les mutants rcsC, rcsD, rcsB et rcsCBD ne sont
pas muqueux. La surexpression de TAT-rcsF ne permet pas non plus dobtenir un phnotype
muqueux dans une souche rcsC2.
Le signal dans un contexte rcsC2 semble bloqu un niveau faible : la protine RcsB reste
faiblement phosphoryle (tableau 12).

Souche
mucosit

EC3937
+

NFB3611

NFB3669

NFB3682

NFB3753

NFB3820

(rcsC2)

(rcsD)

(rcsC)

(rcsCBD)

(rcsB)

Tableau 12 : Phnotypes sur bote des souches suite llectroporation du plasmide


pNFW177 contenant le gne TAT-rcsF (- pour non muqueux et + pour muqueux).

2009 Tous droits rservs.

108

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

4. Effet de la surexpression des gnes TAT-rcsF, igaA, djlA


Jai faiblement surexprim (insertion ectopique dune copie) des gnes connus pour
intervenir dans la rgulation de la transmission du signal transitant via RcsCDB : les gnes
igaA, djlA et celui codant la version soluble de RcsF (TAT-rcsF).

a)

Surexpression chez E. coli

Lors de la construction des plasmides permettant la surexpression des diffrents gnes, jai
pu observer des phnotypes de mucosit sur bote LB aprs 24 heures de croissance 37
(tableau 13).
TAT-rcsF

djlA

igaA

pUC18Not

Muqueux (++)

Muqueux (++)

Non muqueux

pUTminiTn5

Muqueux (+)

Non muqueux

Non muqueux

Tableau 13 : Phnotype de mucosit observ lors du clonage des diffrents gnes


(TAT-rcsF, djlA et igaA) dans diffrents vecteurs : pUC18Not (grand nombre de copies)
et pUTminiTn5 (faible nombre de copie).
On observe que la surexpression chez E. coli des gnes TAT-rcsF et djlA dans un plasmide
grand nombre de copies (pUC18Not) permet dengendrer un phnotype muqueux montrant
une activation du systme Rcs. On observe que la surexpression chez E. coli du gne
TAT-rcsF dans un plasmide faible nombre de copies (pUT) permet dengendrer un
phnotype muqueux montrant une activation du systme Rcs. Par contre, la surexpression
chez E. coli du gne djlA dans ce plasmide (pUT) ne permet pas dengendrer un phnotype
muqueux. Il a dj t montr que la surexpression de djlA dans un plasmide grand nombre
de copies permettait une activation du systme Rcs alors quune surexpression dans un
plasmide faible nombre de copies permettait une diminution de lactivit du systme Rcs
(Shiba et coll., 2006). Comme attendu, la surexpression digaA nengendre pas de phnotype
muqueux sur bote ni pour un grand nombre de copie ni pour un faible nombre de copies du
plasmide, puisque IgaA est connue pour inhiber le systme Rcs.

b)

Surexpression chez E. chrysanthemi : phnotypes sur bote.

Les clones ont t obtenus par conjugaison des plasmides pNFW271 (miniTn5 TAT-RcsF),
pNFW289 (miniTn5 djlA), pNFW265 (miniTn5 igaA) avec la souche NF3809 (miniTn5 ftsAuidA).

2009 Tous droits rservs.

109

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Pour chaque surexpression, 4 mutagenses indpendantes ont t ralises pour analyser des
insertions indpendantes (Tableau 14). Chaque rsultat reprsent est la moyenne des
diffrentes insertions qui prsentaient des rsultats similaires.
Mutagense 1

Mutagense 2

Mutagense 3

Mutagense 4

3809, miniTn5TAT-rcsF

NFB3874

NFB3893

NFB3894

NFB3895

3809, miniTn5 djlA

NFB3875

NFB3896

NFB3897

NFB3898

3809, miniTn5 igaA

NF3B876

NFB3899

NFB3900

NFB3901

Tableau 14: Souches prsentant les insertions des miniTn5 permettant la surexpression
des gnes TAT-rcsF, djlA et igaA.

La mucosit

Les souches ont t stries sur bote de milieu 63+ glucose, la mucosit est observe aprs 24
heures dincubation 30 (figure 50).
On observe que la souche portant le miniTn5TAT-rcsF est muqueuse, les souches contenant
les miniTn5igaA et miniTn5djlA ne prsentent pas de phnotype muqueux.
Ainsi la surexpression de TAT-rcsF par linsertion ectopique dune seule copie permet une
activation du systme Rcs engendrant un phnotype muqueux.
La surexpression de djlA nengendre pas de phnotype muqueux sur bote, cette
surexpression engendre une activation pas suffisante pour voir un phnotype ou permet une
rpression du systme.
La surexpression de igaA nengendre pas de phnotype muqueux sur bote, ce qui tait
attendu puisque IgaA est connue pour inhiber le systme Rcs.

NF3874

NF3809

NF3875

NF3876

Figure 50: Reprsentation de la mucosit des souches NFB3809 (sauvage), NFB3874


(miniTn5 TAT-rcsF), NFB3875 (miniTn5 djlA), NFB3876 (miniTn5 igaA).

2009 Tous droits rservs.

110

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

La motilit

Jai mesur la taille des halos de nage des diffrents clones (diamtre sur glose molle des
colonies) (figure 51). La souche sauvage prsente une moyenne de halo de nage de 2,4 cm de
diamtre et la souche opgG un halo de 0,8 cm de diamtre. La surexpression de TAT-rcsF et
de djlA engendre un halo dune moyenne de 2,16 cm de diamtre et la surexpression de igaA
engendre un halo dune moyenne de 2,64 cm de diamtre.
La surexpression de TAT-rcsF et de djlA engendre une lgre diminution de la taille du
halo.
La surexpression de igaA engendre une lgre augmentation de la taille du halo.
Cependant les variations de la taille des halos de nage ne permettent pas de montrer une
diffrence suffisamment significative de motilit.

Diamtre des colonies sur glose molle (cm)

2,5

1,5

0,5

0
NF3809

NF3809

NF3809

NF3809

NF3809

(sauvage)

miniTn5 TAT-rcsF

miniTn5 djlA

miniTn5 igaA

opgG

Figure 51: Test de motilit. Mesure du diamtre sur glose molle des colonies dans un
contexte sauvage (NFB3809), NFB3809 miniTn5 TAT-rcsF, NFB3809 miniTn5 djlA,
NFB3809 miniTn5 igaA et NFB3810 (3809, opgG). Les souches ont t cultives en LB, les
gouttes de 2l de bactries (soit 4.106 bactries) ont t dposes sur une bote faiblement
glose (0,3%). Ces rsultats reprsentent la moyenne de 2 mesures pour chaque insertion (4
insertions indpendantes), soit la moyenne de 8 dpts.

2009 Tous droits rservs.

111

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

c)
Surexpression chez E. chrysanthemi : dosage de la fusion
ftsA-uidA
Jai mesur lexpression de la fusion transcriptionnelle ftsA-uidA pour des souches cultives
en LB-NaCl et arrtes en phase exponentielle (DO = 0,7). Lactivit observe est la
moyenne de dosages raliss sur 4 clones issus de mutagnses indpendantes par
conjugaison, le rsultat est exprim en DO410nm/min/mg de protines *10-3 (figure 52).
Pour les souches prsentant linsertion ectopique de TAT-rcsF, la fusion transcriptionnelle
ftsA-uidA augmente dun facteur 2,8 (282%) par rapport la souche sauvage. Pour les
souches prsentant linsertion ectopique de igaA et de djlA, la fusion est exprime
respectivement 98% et 86%. Le dosage de la fusion ftsA-uidA de la souche prsentant
linsertion ectopique de igaA a un grand cart type d une variation importante entre les
diffrentes insertions.

DO/min/mg de protines * 10-3

1,2

0,8

0,6

0,4

0,2

0
NF3809

NF3809

NF3809

NF3809

(sauvage)

miniTn5 TAT-rcsF

miniTn5 djlA

miniTn5 igaA

Figure 52: Expression de la fusion transcriptionnelle ftsA-uidA dans un contexte


sauvage (NFB3809), NFB3809 miniTn5 TAT-rcsF, NFB3809 miniTn5 djlA, NFB3809
miniTn5 igaA. Les souches ont t cultives en LB-NaCl, arrtes en phase exponentielle
(DO = 0,7), casses la presse de French. Le substrat utilis pour doser lactivit glucuronidase est le PNPU. Lactivit observe est la moyenne de dosages raliss sur 4
clones issus de conjugaisons indpendantes (insertions indpendantes), le rsultat est exprim
en DO410nm/min/ng de protines.

2009 Tous droits rservs.

112

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Ainsi la surexpression ectopique de TAT-rcsF permet dactiver la fusion ftsA-uidA cause


par une activation du systme Rcs.
La faible surexpression ectopique de igaA et djlA naffecte pas la fusion ftsA-uidA ni dans
un sens ni dans lautre.

d)

Virulence

Jai voulu voir si la surexpression des protines impliques dans la rgulation du systme Rcs
allait engendrer des variations de virulence. Les tests de virulence ont t effectus sur
tubercule de pomme de terre et sur feuille dendive pour chaque insertion.

Test de virulence sur les tubercules de pomme de terre.

Pour vrifier limpact des surexpressions sur la virulence, il a fallu comparer la masse de
macration produite suite linfection des diffrentes souches (107 bactries). La macration
a t recueillie aprs 48H dincubation des souches NF3809 (sauvage) et des diffrentes
insertions. Les rsultats obtenus reprsentent la moyenne de 2 infections indpendantes pour
chaque insertion (soit la moyenne de 8 valeurs par surexpression) (figure 53).
La macration recueillie pour la souche sauvage (NF3809) est de 4,9g. La surexpression de
TAT-rcsF engendre une lgre diminution de la macration (3,9g de macration, soit 80% de
la macration sauvage). Par contre, ni la surexpression de djlA ni celle de igaA nengendre de
variation significative de macration (respectivement 5g de macration, soit 102% de la
macration sauvage et 5,25g de macration, soit 107% de la macration sauvage).
Seule la surexpression de TAT-rcsF permet de dgager un phnotype avec ici une lgre
diminution de la macration, provoque par une activation accrue du systme RcsCDB qui
participe la rgulation de la virulence.

2009 Tous droits rservs.

113

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Masse de tissu macr (g)

0
NF3809

NF3809

NF3809

NF3809

(sauvage)

miniTn5 TAT-rcsF

miniTn5 djlA

miniTn5 igaA

Figure 53: Macration engendre par la souche NF3809 (sauvage), la souche


surexprimant TAT-rcsF, djlA ou igaA sur tubercules de pommes de terre. 107 bactries
ont t inocules et aprs 48h dincubation, la macration est rcupre et pese. Les rsultats
indiqus correspondent la moyenne obtenue par linoculation de 8 tubercules de pommes
de terre (2 infections pour les 4 insertions indpendants et pour chaque contexte).

Figure 54 : Test de virulence sur feuille dendive de la souche NFB3809 (sauvage), de la


souche NFB3500 (opgG) et des souches surexprimant TAT-rcsF, djlA ou igaA.

2009 Tous droits rservs.

114

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Test de virulence sur les feuilles dendive.

Les tests de virulence ont galement t effectus sur les feuilles dendive puisquils
permettent dobserver des diffrences de virulence plus marques. En effet, alors quun
mutant rcsC2 opgG est virulent sur tubercule de pomme de terre, il ne lest pas sur feuille
dendive.
Les feuilles dendive sont scarifies au scalpel, perpendiculairement la feuille.
Linoculation est ralise au niveau de lincision avec 107 bactries dans un volume de 5 l,
les feuilles sont incubes 30C pendant 24 48 h, pour la souche NF3809 (sauvage) et les
diffrentes insertions. Jai effectu 2 infections indpendantes pour chaque insertion (soit 8
infections par surexpression).
La surexpression de TAT-rcsF a engendr une diminution de la macration pour 7 infections
sur 8, dont 4 avec une virulence fortement rduite et 3 avec une virulence attnue (cas
reprsent sur la figure 54).
La surexpression de djlA a engendr une diminution de la macration pour 3 infections sur 8
avec une virulence attnue et dans les 5 autres cas, aucune diffrence significative na pu
tre observe (cas reprsent sur la figure 54).
La surexpression de igaA engendre une augmentation de la macration pour 4 infections sur
8 avec une virulence accrue (cas reprsent sur la figure 54), pour les autres infections
aucune diffrence significative na pu tre observe.
La surexpression de TAT-rcsF permet de dgager un phnotype avec une diminution de la
macration. La surexpression de djlA ne permet pas de dgager un phnotype avec aucune
diffrence de macration sur feuille dendive. La surexpression digaA permet de dgager un
phnotype avec une augmentation de la macration sur feuille dendive. Cependant la
diffrence de virulence sur feuille dendive ne peut tre value que dune faon visuelle.

2009 Tous droits rservs.

115

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

e)

Bilan des surexpressions

La surexpression de TAT-rcsF permet dengendrer une augmentation de lexpression de la


fusion ftsA-uidA, une augmentation de la synthse des exopolysaccharides (aspect muqueux
des colonies d une activation du gne cps). Ces deux gnes sont activs par le systme
Rcs. De plus, les souches prsentant une insertion ectopique de TAT-rcsF semble prsenter
une diminution de la virulence sur tubercule de pomme de terre et sur feuille dendive. Il a
t montr quune activation constitutive du systme RcsCDB engendrait une attnuation de
la virulence chez Salmonella (Garcia-Calderon et coll., 2005). La surexpression de TAT-rcsF
permet donc dactiver le systme Rcs. Par contre, cette surexpression na pas permis de
montrer un effet suffisamment significatif sur la motilit dans les conditions testes en
laboratoire.
La surexpression de djlA et igaA na pas permis de montrer une diffrence significative
pour lexpression de la fusion ftsA-uidA, la synthse des exopolysaccharides, la motilit.
Cependant, la surexpression du gne igaA a permis de montrer une lgre augmentation de la
virulence sur feuille dendive. La surexpression de igaA permet donc une lgre rpression
du systme Rcs.
Il faut noter que les gnes djlA et igaA sont sous le contrle de leur promoteur, contrairement
TAT-rcsF qui est sous le contrle du promoteur placUV5. Afin de voir un effet
suffisamment significatif de la surexpression de ces gnes, il faudrait cloner les gnes sous le
contrle dun promoteur inductible. De plus, il serait intressant de voir leffet de mutations
dans les gnes igaA et djlA.

2009 Tous droits rservs.

116

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

B.

Relation entre les OPG et le systme Rcs

Nous avons montr que lexpression des diffrentes fusions variaient en prsence et en
absence dOPG (figure 42 et 43). Nous avons voulu savoir si la quantit dOPG influenait
lexpression des fusions transcriptionnelles. Nous savons que la quantit dOPG varie en
fonction de losmolarit (les OPG sont fortement synthtiss lorsque losmolarit du milieu
est faible), mais pour pouvoir faire uniquement varier la quantit dOPG, il a fallu construire
une souche dont lexpression de lopron opgGH tait inductible.

1. Construction de paraBAD opgGH


Au cours de sa thse, Gilles Boussemart sintresse la relation qui existe entre les systmes
deux composants et les OPG. Il a construit une souche permettant de moduler la synthse
des OPG indpendamment de losmolarit. Il a construit un plasmide dans lequel lopron
opgGH dE. chrysanthemi est sous le contrle dun promoteur inductible, le promoteur utilis
est celui du locus araBAD dE. coli impliqu dans lutilisation de larabinose :paraBAD
(Guzman et coll., 1995). Il a ensuite sous clon cette construction dans un pUTminiTn5Sp,
puis il la introduit par conjugaison afin de pouvoir exprim chez E. chrysanthemi la
construction. Le miniTn5 paraBAD opgGH est insr dans la rgion intergnique entre les
CDS14775 et CDS16288. Ce systme permet donc en faisant varier la quantit dinducteur
(arabinose) de moduler le niveau de transcription des gnes opgGH.
Avec Gilles Boussemart, nous avons analys lexpression de la fusion ftsA-uidA en fonction
dune quantit croissante dinducteur. Il a en parallle dos la quantit dOPG synthtiss
dans chaque condition. Les rsultats reprsenteront donc le dosage de la fusion ftsA-uidA en
fonction de la quantit dOPG.
Nous avons choisi dtudier leffet sur la fusion ftsA-uidA puisque ctait la fusion
transcriptionnelle qui variait le plus en absence dOPG. En effet, dans la souche opgG, la
fusion transcriptionnelle ftsA-uidA augmente dun facteur 13,2 par rapport la souche
sauvage alors que la fusion transcriptionnelle flhD-uidA diminue dun facteur 3 pour des
cultures en LB-NaCl (figure 42 et 43).

2009 Tous droits rservs.

117

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Effet de la variation de la quantit des OPG


a)

Sur un des gnes cibles du systme Rcs : la fusion ftsA-uidA

Avec Gilles Boussemart, nous avons analys lexpression de la fusion ftsA-uidA en fonction
dune quantit croissante de linducteur (arabinose). Les dosages ont t effectus sur la
souche NFB3837 (opgG ::Cml, miniTn5 paraBAD opgGH, miniTn5 ftsA-uidA) cultive en
milieu 63 complment de glycrol (2 g/L) et dune quantit croissante darabinose (de 0
0,3%).
Pour chaque dosage, une culture de 300 mL a t ralise. 50 mL taient destins au dosage
de la fusion ftsA-uidA (quantit casse la presse de french) et 250mL taient utiliss pour le
dosage des OPG.
On observe une diminution de lexpression de la fusion ftsA-uidA en fonction de la
concentration croissante darabinose (figure 55).
Gilles Boussemart a mesur la quantit dOPG synthtiss pour chaque concentration
dinducteur. Il a ainsi montr que pour une quantit croissante darabinose, on observait une
quantit croissante OPG synthtiss, dpendante du niveau de synthse des protines OpgG
et OpgH (figure 56). La figure 56 nous montre donc que lexpression de la fusion ftsA-uidA
diminue lorsque la quantit dOPG synthtiss augmente (cause par une augmentation de la
quantit darabinose).
Lorsque lon analyse lexpression de la fusion transcriptionnelle ftsA-uidA en fonction de la
quantit dOPG (figure 57), on observe que lexpression de la fusion est inversement
proportionne la quantit dOPG prsents dans le priplasme. La quantit dOPG prsents
dans le priplasme permet donc de moduler lexpression des gnes cibles du systme deux
composants : le systme RcsCDB.

2009 Tous droits rservs.

118

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Expression relative de la fusion ftsA-uidA

1,2

0,8

0,6

0,4

0,2

2E-5 2E-4 3E-4 2E-3 3E-3 1E-2 2E-2 3E-2 0,1 0,2

0,3

Concentration croissante darabinose (%)

Figure 55 : Expression de la fusion transcriptionnelle ftsA-uidA de la souche NFB3837


(opgG ::Cml, miniTn5 paraBAD opgGH, miniTn5 ftsA-uidA). La souche a t cultive en
milieu 63 complment de glycrol (2 g/L) et dune quantit croissante darabinose (de 0
0,3%), les cultures ont t arrtes en phase exponentielle (DO = 0,7), casses la presse de
French. Le substrat utilis pour doser lactivit -glucuronidase est le PNPU.

2009 Tous droits rservs.

119

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 56: Expression de la quantit relative dOPG et de lactivit de la fusion


ftsA-uidA en fonction du logarithme de la concentration en arabinose.

Figure 57: Expression de lactivit de la fusion ftsA-uidA en fonction de la quantit


relative dOPG. Les crochets montrent la zone de la quantit dOPG dans laquelle il existe
une relation quasi linaire entre cette quantit dOPG et lactivation du systme Rcs.

2009 Tous droits rservs.

120

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

b)

Sur la fusion opgG-uidA

Jai voulu voir si la prsence dOPG influenait la transcription de lopron opgGH. Pour
cela, jai dos lactivit -glucuronidase de la fusion opgG-uidA de la souche NFB3839
(opgG-uidA, miniTn5 paraBAD opgGH) dans 2 conditions : 63+glucose et 63+arabinose.
En prsence de glucose, il ny a pas de transcription de lopron paraBAD opgGH (induit en
prsence darabinose uniquement), il ny a donc pas dOPG synthtiss. En prsence
darabinose, il y a transcription de lopron paraBAD opgGH. La souche produit des OPG.
Nous avons observ que la fusion opgG-uidA pour la souche qui a synthtis des OPG
(culture en prsence de linducteur : larabinose) sexprime 70% par rapport la souche
cultive en prsence de glucose (OPG non synthtiss).
Ces rsultats semblent donc montrer que la souche qui possde des OPG prsente une
activit transcriptionnelle de lopron opgGH plus faible que celle qui nen possde pas. Il
semble donc exister un rtrocontrle ngatif des OPG sur la transcription de lopron.

2009 Tous droits rservs.

121

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C. Conclusion et Discussion
Au sein du laboratoire, nous nous intressons aux glucanes priplasmiques osmorguls
(OPG). Chez E. chrysanthemi, un mutant opgG, incapable de synthtiser les OPG, prsente
un phnotype plotrope caractris par la diminution de la synthse et de la scrtion
dexoenzymes, un aspect muqueux des colonies d la surproduction dexopolysaccharides,
la diminution de la motilit, une hypersensibilit aux sels biliaires et la perte de la virulence
sur tubercules de pomme de terre et sur feuilles dendive (Page et coll., 2001). Cette perte de
virulence est due lincapacit de la bactrie crotre in planta. Une tude protomique du
mutant opgG dE. chrysanthemi, ralise au sein du laboratoire (Bouchart et coll., 2007), a
permis de montrer quun mutant opgG prsente une forte perturbation du mtabolisme
gnral (augmentation du catabolisme refltant une augmentation dun besoin dnergie)
ainsi quune surexpression de protines impliques dans la mise en conformation et la
dgradation des protines. Cette perturbation du mtabolisme est observe chez les bactries
lors de la rponse divers stress environnementaux. Sachant quune relation entre les OPG et
le facteur E (stress de lenveloppe) a dj t dcrite (Dartigalongue et coll., 2001),
labsence dOPG chez E. chrysanthemi pourrait entraner une activation des voies impliques
dans la rponse au stress de lenveloppe. Labsence dOPG engendre galement une
augmentation de la rigidit des membranes (Bohin et coll., 2005). Tous ces phnotypes
laissent penser que la bactrie prsente une perturbation des proprits de lenveloppe.
Labsence dOPG va engendrer une perturbation de la perception par la bactrie de son
environnement et en particulier des interactions entre les bactries et la plante hte, ce qui
expliquerait lincapacit crotre in planta. Ces oligosaccharides sont donc des constituants
du priplasme essentiels.
En 1997, Ebel et coll ont montr quune mutation dans le gne opgH dE. coli conduit un
tat constitutivement activ du systme deux composants RcsCDB, ce mutant prsente un
phnotype muqueux. Ce phnotype est supprim par lajout dune mutation dans rcsC, rcsB
ou rcsA. Ces auteurs ont alors mis lhypothse que les OPG pourraient tre le signal peru
par le systme Rcs.
Au cours de sa thse, Franck Bouchart par une approche de recherche de mutation
suppressive a galement montr quil existe un lien entre le systme Rcs et les OPG. En effet,
il a isol une mutation permettant de restaurer la quasi-totalit du phnotype sauvage :
restauration de la motilit, absence de mucosit, restauration partielle de la rsistance aux

2009 Tous droits rservs.

122

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

sels biliaires, restauration de la scrtion des exoenzymes, restauration de la virulence sur


tubercules de pomme de terre mais pas sur feuilles dendive. Cette mutation se situe dans le
gne rcsC : rcsC2. Cette mutation conduit lchange dune alanine en valine (A463V) dans
la partie cytoplasmique de la protine, entre le domaine PAS et le domaine histidine kinase.
Ces deux approches gntiques permettent donc de mettre en avant un lien troit entre les
OPG et le systme Rcs.
Impact de la mutation opgG et caractrisation de la mutation rcsC2
Le premier objectif de ce travail a t de montrer limpact des mutations opgG et rcsC2 sur
les gnes cibles du systme Rcs. Jai ainsi pu mettre en vidence que deux gnes cibles du
systme Rcs (les gnes flhD et ftsA) sont influencs par labsence des OPG (figure 42 et 43).
Une mutation opgG engendre une diminution de lexpression de la fusion flhD-uidA et une
augmentation de lexpression de la fusion ftsA-uidA. Ces rsultats sont corrls avec les
observations phnotypiques du mutant opgG : diminution de la motilit (flhD) et trouble dans
la division cellulaire (ftsA) puisque lorsque les bactries opgG sont cultives en milieu riche,
elles sont de plus petites tailles et plus rondes que la souche sauvage (Franck Bouchart,
communication personnelle). Sachant que le systme Rcs rprime les gnes flh (impliqus
dans la synthse du flagelle) et active les gnes fts (impliqus dans le contrle de la division
cellulaire), nous sommes amen conclure que la mutation opgG engendre bien une
activation du systme Rcs cause par une phosphorylation accrue de RcsB (Figure 58).
Nous avons donc mis lhypothse que la mutation rcsC2 conduit une diminution du
transfert du signal due labsence dOPG afin de revenir un niveau proche de celui de la
souche sauvage. Les rsultats obtenus nous permettent de confirmer cette hypothse. En
effet, la mutation rcsC2 dans un contexte opgG permet de diminuer la rpression de la fusion
flhD-uidA et de diminuer lactivation de la fusion ftsA-uidA pour revenir un niveau proche
de celui observ pour la souche sauvage (Figure 42 et 43). De plus dans un contexte rcsC2
opg+, on observe une augmentation de lexpression de la fusion flhD-uidA et une diminution
de la fusion ftsA-uidA. Lensemble des donnes obtenues avec les fusions confirme les
phnotypes obtenus pour les mutants rcsC2 (dans un contexte opg+ou opg). Lanalyse des
fusions dans les contextes o rcsC2 est mut (pour les souches opg+et opg) nous permet de
dire que la mutation rcsC2 engendre une diminution de la signalisation du systme Rcs par
un niveau faible de phosphorylation de RcsB (figure 58).

123
2009 Tous droits rservs.

http://doc.univ-lille1.fr

2009 Tous droits rservs.

124

Thse d'Anne-France Prouvost, Lille 1, 2008

http://doc.univ-lille1.fr

Figure 58 : Reprsentation de leffet des mutations opgG et rcsC2 sur le niveau de phosphorylation du systme deux composants
et consquences sur la transcription des gnes cibles.

Thse d'Anne-France Prouvost, Lille 1, 2008

De plus, lhypervirulence de la souche rcsC2 nous conforte dans lide que cette mutation
conduit un niveau faiblement phosphoryl de RcsB. Il existe une diffrence entre la souche
rcsC2 et la souche rcsB, c'est--dire que le phnotype observ pour un niveau faiblement
phosphoryl de RcsB (rcsC2) ne correspond pas au phnotype de la souche rcsB. On peut
donc envisager lexistence dune phosphorylation de RcsB indpendante de RcsCD qui
expliquerait les diffrences de phnotype obtenu. Une telle hypothse a dj t formule par
Fredericks et coll. en 2006 (les auteurs ont observ, chez E. coli, une phosphorylation de
RcsB indpendamment de RcsC) et par Castanie-Cornet et coll en 2007 (les auteurs ont
observ que RcsB rgulait lexpression de certains gnes indpendamment de RcsC/RcsD).
Une autre hypothse envisageable est que la protine RcsB puisse agir lorsquelle est non
phosphoryle, cette hypothse a dailleurs t suggr par Andresen et coll. en 2007, lors de
ltude du phosphorelais chez E. carotovora (Pectobacterium carotovorum ssp carotovorum).
A lheure actuelle, cest la premire mutation dans rcsC qui conduit une diminution du
rapport RcsB phosphoryl/RcsB non phosphoryl (mise part celles modifiant lhistidine
phosphorylable du domaine histidine-kinase ou laspartate phosphorylable du domaine
receveur o il ny a pas de phosphorylation possible de capteur).
La mutation rcsC2 est dominante
Deux hypothses ont alors t proposes pour expliquer ce phnotype rcsC2. Cela peut tre
d une diminution de la phosphorylation de RcsB par RcsC ou une augmentation de sa
dphosphorylation. Afin de caractriser la mutation rcsC2, un mrodiploide a t construit par
une insertion ectopique du locus rcsCBD dans la souche rcsC2, opgG. Lanalyse des
phnotypes de ce mrodiploide nous montre que la souche rcsC2, opgG, miniTn5 rcsCBD
prsente un phnotype proche de celui de la souche rcsC2, opgG (restauration de la virulence,
de la motilit et de lexpression de la fusion ftsA-uidA). Puisque la mutation est dominante, on
peut alors dire que le faible niveau de phosphorylation est caus par une dphosphorylation
accrue de RcsB par RcsC. Si la mutation avait t rcessive, ce faible niveau aurait t d
une diminution de la phosphorylation de RcsB par RcsC. De tels rsultats ont dj t obtenus
chez E. coli o une mutation ponctuelle dans la rgion correspondante de la protine BarA
(situe entre le segment transmembranaire et le domaine histidine kinase de la protine) du
systme 2 composants BarA/UvrY cre une activit kinase affaiblie et une augmentation de
son activit phosphatase (Tomenius et coll., 2006). Les diffrents phnotypes tests pour le
mrodiploide montrent tout de mme une lgre diffrence entre la souche rcsC2 opgG et ce
mrodiploide. En effet, lexpression de la fusion ftsA-uidA (du mrodiploide) bien que faible
est suprieure celle du double mutant (fig rcs2), la motilit est infrieure celle du double

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

mutant (tableau 10) et la virulence nest pas forcement restaure (pour 107 bactries, nous
avons 50% des inoculums qui engendrent la pourriture molle et pour 108 bactries, 100% des
inoculums provoquent la pourriture molle). Lensemble de ces rsultats pourrait sexpliquer
par la formation dhtrottramre (ou de lassociation de 2 dimres 2RcsC + 2RcsD). La
diffrence pourrait alors tre due la formation de 3 combinaisons : (2RcsC2 + 2RcsD),
(RcsC2RcsC + 2RcsD) ou (2RcsC + 2RcsD). Dans ce dernier cas, le capteur fonctionnerait
normalement et permettrait dattnuer leffet de la mutation rcsC2. Nous ne pouvons
galement exclure la possibilit que la mutation rcsC2 pourrait changer laffinit du
rgulateur (RcsB) pour le capteur (RcsC ou RcsC2 et RcsD).
Les autres mutants du locus rcsCBD
Nous avons construit des mutants par insertion de cassette (mutant rcsC, rcsD et rcsB) ou par
dltion totale du locus (rcsCBD). Les diffrents mutants ne prsentent pas les mmes
phnotypes (Cf. g. Bilan des mutations). La mutation rcsC permet de restaurer la totalit des
caractres sauvages de la souche opgG (alors que la mutation rcsC2 restaure la quasi-totalit).
La mutation rcsC dans un contexte opg+ permet une augmentation de lactivit pectinase et
une rsistance accrue aux sels biliaires (par rapport la souche sauvage).
La mutation rcsD permet de restaurer partiellement les caractres phnotypiques de la souche
opgG. Par contre, le mutant rcsD est trs affect (perte de la motilit et virulence attnue). La
mutation par insertion de cassette (Cml) dans le gne rcsD pourrait avoir un effet polaire sur
rcsB tant donn quils font partie de la mme unit transcriptionnelle (Cf. Introduction figure
21a). Aux regards des phnotypes observs pour le mutant rcsB, leffet de la mutation dans
rcsD ne semble pas entraner une absence de la protine RcsB, la cassette chloramphnicol
(Cml) pourrait alors entraner une augmentation de la synthse de la protine RcsB. On ne
peut galement exclure que linsertion de la cassette dans le gne rcsD gnre une protine
rsiduelle RcsD suffisamment grande pour permettre un caractre dominant de la mutation
rcsD. Une mutation de rcsD par insertion dun miniTn10 chez E. coli prsentait dj un
phnotype inattendu (Shiba et coll., 2004). Cette mutation permettait une activation du
systme Rcs. Les auteurs ont alors mis lhypothse que lactivation serait due la production
dune protine tronque stable, qui pourrait interagir avec RcsC et serait doue dune capacit
dautophosphorylation qui entranerait une activation du systme sans stimulus. Cette
hypothse est renforce par le fait que le phnotype est observ 30C mais ne lest pas
42C, temprature o la protine tronque serait instable (Shiba et coll., 2004). Le mutant
rcsD dE. chrysanthemi tudi ici ne prsente pas de phnotype de mucosit particulier mais
prsente une absence de motilit qui pourrait rsulter dune rpression accrue engendre par

2009 Tous droits rservs.

126

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

une activation du systme Rcs. Il serait donc intressant de construire un autre mutant rcsD
avec une dltion en phase du gne rcsD et qui naffecterait pas rcsB.
La dltion du locus rcsCBD et la mutation rcsB permettent de restaurer partiellement
certains des caractres phnotypiques de la souche opgG, mais ne permettent pas de restaurer
la virulence de la souche opgG. De plus, la dltion du locus rcsCBD et la mutation rcsB
engendrent une lgre augmentation de certains caractres phnotypiques : motilit et
rsistance aux sels biliaires pour la souche rcsCBD. Les souches rcsCBD et rcsB sont
virulentes. Le locus rcsCBD et le rgulateur RcsB ne sont donc pas essentiels pour la
virulence dE. chrysanthemi. Par contre, les rsultats obtenus montrent que RcsB doit tre
prsent pour restaurer la virulence du mutant opgG et que quand RcsB est prsent, il doit tre
faiblement phosphoryl pour pouvoir engendrer la virulence. Garcia-Calderon et coll en 2005
ont montr quune hyper activation du systme Rcs engendrait la non-virulence de S. enterica.
De plus, les auteurs ont montr quun certain niveau de phosphorylation de RcsB est
ncessaire pour la virulence, grce ltude de diffrentes mutations ponctuelles dans RcsC
qui activent le systme Rcs. Les auteurs ont alors montr une corrlation entre le degrs
dattnuation de la virulence et lactivation du systme Rcs (Garcia-Calderon et coll., 2005).
Chez E. chrysanthemi, ce sont donc les mutations dans les gnes codant les protines
composant le capteur (RcsC et RcsD) qui ont un effet sur la suppression du phnotype opgG.
Lexpression des gnes soumis la rgulation du systme RcsCDB est influence par la
quantit dOPG.
Il a t montr que la synthse des polysaccharides extracellulaires rpond aux diffrences
dosmolarit du milieu avec une augmentation de la biosynthse haute osmolarit. Cette
rponse est dpendante du systme Rcs puisque la synthse nest possible que lorsque le
systme est intact (Sledjeski et Gottesman, 1996). En 1997, Ebel et coll. ont montr quune
mutation dans le gne opgH dE. coli conduit un tat constitutivement activ du systme
deux composants RcsCDB, en dcoule lhypothse que les OPG pourraient tre le signal
peru par le systme Rcs. Nous savons que la biosynthse des OPG varie galement en
fonction de losmolarit. Nous avons donc voulu savoir si le systme Rcs peroit les
variations de losmolarit par lintermdiaire des OPG. Pour cela, Gilles Boussemart, au sein
du laboratoire, a construit une souche permettant de contrler la synthse des OPG
indpendamment de losmolarit. Lopron opgGH dE. chrysanthemi a t plac sous le
contrle dun promoteur inductible par larabinose (paraBAD). En modulant la quantit
darabinose dans le milieu, on a ainsi pu faire varier le niveau dexpression des protines
OpgG et OpgH. Ces travaux ont permis Gilles Boussemart de montrer que la quantit

2009 Tous droits rservs.

127

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

dOPG variait avec la quantit darabinose et donc de lexpression des protines OpgG et
OpgH. Plus il y a denzymes synthtises, plus la quantit dOPG augmente (figure 56).
Ensemble, nous avons montr que plus la quantit dOPG tait importante, plus lexpression
de la fusion ftsA-uidA diminuait. Le gne ftsA est activ par le systme Rcs. Dans un contexte
Opg- (sans arabinose), le systme Rcs est trs activ. Avec une augmentation croissante de la
quantit darabinose, on observe donc une augmentation progressive de la quantit dOPG et
une diminution corrle de lexpression de la fusion ftsA-uidA (figure 56). Nous avons ainsi
montr que lexpression de la fusion rgule par RcsB est inversement proportionne la
quantit dOPG synthtise dans le priplasme (figure 56 et 57). La quantit dOPG
dtermine donc le niveau dexpression de certains gnes, par lintermdiaire des systmes
deux composants. Bouchart et coll ont montr que labsence dOPG induit une rponse au
stress (Bouchart et coll., 2007). Les OPG influencent lexpression des gnes cibles du systme
Rcs. Nous sommes donc amen nous demander si le systme Rcs ne jouerait pas un rle
dans le contrle permanent de ltat de lenveloppe.
Contrairement la souche sauvage, la souche rcsC2 opgG ne peroit plus le choc osmotique.
La suppression de la mutation opgG par la mutation rcsC2 permet un retour un phnotype
proche de la souche sauvage mais la souche prsente quand mme une altration dans la
perception de son environnement. Cette altration pourrait sexpliquer par labsence dOPG
qui pourrait affecter dautres systmes deux composants comme EnvZ/OmpR impliqu dans
la perception de losmolarit du milieu. De plus, il avait dj t postul que les OPG seraient
le signal capt par le capteur du systme deux composants EnvZ/OmpR par lintermdiaire
des boucles priplasmiques de EnvZ (Fiedler et Rotering, 1988).
Dans la construction o lopron opgGH est sous le contrle du promoteur paraBAD,
lexpression de lopron ne devrait plus varier en fonction de losmolarit. Il reste donc
dterminer si en faisant varier losmolarit du milieu sans faire varier la quantit darabinose,
on peut faire varier ou non lexpression des fusions, en vrifiant qualors la quantit dOPG
ne varie pas. Si elles ne varient plus, le systme RcsCDB capterait alors bien les variations de
losmolarit uniquement par lintermdiaire des OPG.
Les OPG font donc varier par lintermdiaire du systme RcsCDB lexpression des gnes
cibles. Cependant la dltion rcsCBD ou une mutation rcsB ne permet pas de restaurer le
phnotype opgG. Ces rsultats nous laissent donc penser que les OPG pourraient interagir
avec dautres systmes deux composants.

2009 Tous droits rservs.

128

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Rle des protines interagissant avec le systme RcsCDB


La premire protine interagissant avec le systme RcsCDB est la lipoprotine RcsF. La
mutation du gne rcsF permet de restaurer partiellement certains des caractres phnotypiques
de la souche opgG (scrtion des pectinases), abolit la mucosit mais ne permet pas de
restaurer la virulence. Shiba et coll en 2004 avait dj montr quune mutation rcsF permettait
galement de supprimer linduction du gne cpsB. De plus, cette mutation dans un contexte
opg+ nengendre pas de phnotype diffrent de la souche sauvage observable en laboratoire.
La lipoprotine RcsF est donc essentielle pour la synthse des exopolysaccharides.
Avec Carmen dberg-Ferragut, nous avons surexprim une version soluble de cette protine :
TAT-RcsF. Chez E. coli, nous avons analys sa surexpression en multicopie et observ un
phnotype extrmement muqueux de la souche portant le plasmide. Ce crible nous a permis
de dterminer les rgions et les rsidus importants de la protine. Il a t montr que la
lipoprotine RcsF prsentait au moins un pont disulfure puisque lactivit de RcsF est
dpendante de DsbA, protine priplasmique qui catalyse la formation de ponts disulfure
(Kadokura et coll., 2004). Nous avons donc entrepris la mutagense dirige des cystines
potentiellement impliques dans la formation de ponts disulfures. Nous avons ainsi pu
montrer que seule la mutation des cystines C110 et C125 engendre la perte de mucosit et
donc montrer limplication de ces cystines dans un pont disulfure. De plus, Carmen
dberg-Ferragut a pu mettre en vidence par dltions successives une version soluble
raccourcie active. Cette partie minimale active pourra alors tre analyse par RMN afin
dessayer den dterminer la structure. Certains mutants prsentent une activation beaucoup
plus importante que la version soluble entire (tableau 11). Il faudrait reconstruire ces
mutations dans la squence codant la lipoprotine, afin de voir si ces mutations conduiraient
galement une activation aussi importante.
Chez E. chrysanthemi, jai surexprim faiblement cette version soluble TAT-RcsF et jai
montr quelle permettait dactiver le systme Rcs. Lactivation est beaucoup plus faible que
celle observe pour une mutation opgG. Chez E. chrysanthemi, jai galement surexprim les
protines connues pour interagir avec le systme Rcs. Jai surexprim faiblement les protines
DjlA et IgaA. Cette surexpression na pas eu dimpact significatif sur les diffrents
phnotypes tudis en laboratoire. Contrairement la protine TAT-RcsF, les gnes codant
DjlA et IgaA sont sous le contrle de leur propre promoteur (le gne TAT-rcsF est sous le
contrle du promoteur placUV5). Linsertion ectopique dune seule copie napparat pas
suffisante pour observer un effet. Il faudrait alors mettre ces gnes sous le contrle dun
promoteur inductible afin de pouvoir lexprimer diffrenciellement pour observer

2009 Tous droits rservs.

129

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

ventuellement un effet. De plus, il faudrait galement surexprimer faiblement une version de


la lipoprotine RcsF, pour voir si leffet observ lors de la surexpression de la version soluble
(TAT-RcsF) est d au changement de sa localisation dans le priplasme.
Il serait galement intressant de voir leffet de mutations (par insertion de cassette) dans les
gnes djlA et igaA.
Perspectives et modle daction des OPG
Les OPG sont des glucanes prsents dans le priplasme. Nous avons montr quune variation
de leur quantit permettait de moduler lexpression des gnes cibles du systme RcsCDB.
Cependant nous ne savons pas encore si cette interaction est directe ou non. Si linteraction
est directe, elle devrait seffectuer avec les boucles priplasmiques de RcsC ou de RcsD. Cette
interaction pourrait galement interfrer dans la relation entre le capteur et les protines
interagissant avec celui-ci dont RcsF. On peut alors envisager de cloner les squences codant
les boucles priplasmiques de RcsC et RcsD et tudier les interactions entre RcsC et ou RcsD
avec la version soluble TAT-RcsF mais aussi avec les OPG. Ltude comporterait une partie
physiologique en observant les phnotypes lors de la surexpression des boucles
priplasmiques de RcsC et de RcsD en prsence ou non des OPG et en prsence de la version
soluble de TAT-RcsF et une tude biochimique afin de dterminer les interactions entre les
boucles de RcsC et de RcsD avec une version soluble de RcsF et les OPG par Biacore.
Il a t rcemment montr que le gne rcsA de Y. pseudotuberculosis a volu chez Y. pestis
pour devenir un pseudogne (Sun et coll., 2008). Lorsque lon remplace le pseudogne rcsA
dY. pestis par rcsA de Y. pseudotuberculosis, on observe une diminution de la formation de
biofilms dans la puce (hte intermdiaire). Lvolution de rcsA en pseudogne permet Y.
pestis de produire un biofilm pour mieux coloniser sa niche. Chez Y. pestis, le gne rcsD tait
prdit comme tant un pseudogne caus par un dcalage de phase de lecture. Cependant sa
dltion engendre une diminution de la formation des biofilms. Les auteurs mettent alors
lhypothse que la partie N-terminal de RcsD pourrait interagir avec RcsC.
Lorsque lon sintresse la conservation des protines RcsC et RcsD chez les
entrobactries, on observe que la squence codant la boucle priplasmique de RcsD est plus
conserve que celle codant la boucle priplasmique de RcsC (figure 59 et 60). Cest pourquoi
il faudrait envisager de faire de la mutagense sur la boucle priplasmique de RcsD pour voir
si cela affecte linteraction potentielle avec RcsF et les OPG.

2009 Tous droits rservs.

130

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Cytoplasmique
RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

Transmembranaire

-----MPLKVIASFFQTTLKVSRYMMFRALATTLWILGALISIFYVNKELNQRESHLRQI
--------MKYLASFRTTLKASRYMFR-ALALVLWLLIAFSSVFYIVNALHQRESEIRQE
MLFHHGIRLKYLSSFRTTLKISRYLFR-VLAVMLWSLGALLTTFYILNVLNEKKADIRQE
--------MKYLASFRTTLKVSRYLFR-ALALLIWLLIAFVSVFYIVNALHQRESEIRQE
--------MKYLASFHTTLKVSRYLFR-VLAVMLWVLGALISVFYVTKVLNEKESELRQE
: *:**** ***:: .** :* * *: : **: : *:::::.:**

Priplasmique
RcsCEch
RcsCEco
RcsCYpe
RcsCEca

FSLNFEQSLGYIRHTTDVARELRYIAANRLSTPVAPRERST----AKKTPSAIYPLSSTF
FNLSSDQAQRFIQRTSDVMKELKYIAENRLSAENGVLSPRGRE--TQTDVPAFEPLFADS
YNNNFGLAQNYIRHSAEIIRDIKYMAENRLDKNASDTDATSGMVMNKKAVPQYYPLNSDS
YNLSFDQSQGYIRHASDIVRELQYLAANRLVLAREKAEPPT----EGGPGVSVYALAPGA
:. .
: :*:::::: ::::*:* ***
.
.* .

RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

DCSEQYEKNPAQLQSLTGFFDQWHDDFSSVYDLNRIFFVDSSQQCIVDFGIRNQSLDSDS
DCSAMSNTWRGSLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGLRDMPVERDT
GCTTASTSNQASVNTLSNLIWYWKENFTAAYDLNRVFFIGTDTLCMVDFDIRNAPSLQEN
DCAAMGSAWRGSLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGLREMPVERDD
TCSTQYGGN-AALLSLSHFFNGWQDNFSAVYDLNRVFFVGGDRRCMVDFGIRNQSLDRDN
*:
. : :*: :: *:::*::.*****:*::. . *:.:*.:*: .
:

Priplasmique

Priplasmique
RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

LMKSVQERLQNQKSNRAGNRREESLFWVMPGPTPDSGYLYALTPVYVDNRLVTMMGIEQT
ALKALHERINKYR-NAPQDDSGSNLYWISEGPRPGVGYFYALTPVYLANRLQALLGVEQT
LLKSLYEHTLKYRDTKNQD-KDSNIYWVVPGARPDIGVLYVLSPVYLGNRLEAMIGFEQS
ALKALHERIMKYR-NAPQEESGNNLFWISQGARQGVGYFYALTPVYLANRLQALLGVEQS
LLKNVQDRFQDQKKNRPQTGRDETLYWITPASIPDVGYLYALTPIYVDNKLEVIMGIEQT
:* : :: . : .
..::*: .. . * :*.*:*:*: *:* .::*.**:

Priplasmique
RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

IRLDDFMLNGDLPFSVRLLDQNDRALLQFTDSQS--GNSLSHYPDSNNYFGYSDGYGALL
IRMENFFLPGTLPMGVTILDENGHTLISLTG-PESKIKGDPRWMQERSWFGYTEGFRELV
VRLEDFISSRTLPIRVTLLNQDNEPVLQMASG-DRYPAILDDYPDSPSYFGYADDYKDLI
IRMENFFTPGSLPMGVTIIDENGHSLISLTG-PDGIIKAEPRWMQERSWFGYTPGFRELV
IRLDDFVTVGKFPINARLLDQYNQVVLQFSDAKDRYTSSVDSYPSDHNYFGYVNGYDELI
:*:::*.
:*: . :::: .. ::.::. .
: .. .:*** .: *:

RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

MKKALPPTSMTVVYSLPLEVILMSLNTLIINIALLNLASAICLFLLTRLFERKIFLPAER
LKKNLPPSSLSIVYSVPVDKVLERIRMLILNAILLNVLAGAALFTLARMYERRIFIPAES
LKKALPPSPLSIAYSLPVKTIIEAFKLLIFNALLLNVLSAVVIFTLAWLFERKMFHPAED
LKKSLPPSSLSIVYSVPVDLVLERIRILILNAILLNVLVGAGLFTLARMYERRIFIPAES
LKKSLPPTSFSIVYALPLKVLLSHISALMINMLVLNILWAIFLFVLALVFERKMLLPAEV
:** ***:.:::.*::*:. :: : *::* :**: . :* *: ::**::: ***

RcsCEch
RcsCEco
RcsCYpe
RcsCStm
RcsCEca

NALQLEENEQFNRKIVASAPVGICILRISDGTNIISNELAHNYLSLLTYEDRVRIVRIIC
DALRLEEHEQFNRKIVASAPVGICILRTADGVNILSNELAHTYLNMLTHEDRQRLTQIIC
NALRLEEHEQFNRKIVASAPVGISILRISDGTNILSNELAHNYISLLTNEDRERITRIIC
DAQRLEEHEQFNRKIVASAPVGICILRTIDGVNILSNELAHTYLNMLTHEDRQRLTQIIC
NAFQLEENEQFNRKIVASAPVGICILRINDGTNILSNELAHNYLNLLTHEDRLRITRIIC
:* :***:***************.*** **.**:******.*:.:** *** *:.:***

Transmembranaire

Cytoplasmique

Figure 59 : Comparaison de la squence du domaine priplasmique (en bleu) de la


protine RcsC dE. chrysanthemi (RcsCEch) avec celle dE. coli (RcsCEco), de Yersinia
pestis (RcsCYpe), de Salmonella typhimurium (RcsCStm) et Erwinia carotovora ssp
atroseptica (RcsCEca). En jaune sont reprsents les deux domaines transmembranaires
prdits par le logiciel Toppred (http://bioweb.pasteur.fr/seqanal/interfaces/toppred.html).

2009 Tous droits rservs.

131

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Transmembranaire
RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

--------------MPAAIVRFFLLFILLLLLMTGAYSYNYVNSWMTEKKSALTDIAEGM
MRQKETTATTRFSLLPGSITRFFLLLIIVLLVTMGVMVQSAVNAWLKDKSYQIVDITHAI
------MQNNSSTHSAANITRYFWLFIVLLLMTVGLYAYNYTNAYLTEKKHALTNIANGL
MSQSDTTVSTRFSLLPGSITRFFLLLIIVLLVTMGVMVQSAVNAWLKDKSYQIVDITHAI
-------------MMPAIILRYFSLLTVLSILITGTFGYSYINDLLADKKHSLTTIAQGV
.. * *:* *: :: :: *
. * : :*. :. *:..:

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

QKRIDAYRFFTDQIYKNLISDPTQPDTP-NINLITLMPNVFYVEKSGHKTDALIFGPHDK
QKRVDTWRYVTWQIYDNIAATTSPSSGE-GLQETRLKQDVYYLEKPRRKTEALIFGSHDN
QQRIDDYRYHTYQIYDLVNNPIKASEPPPVVQETRLRPDVYYIEKPRRKTDAIIFGNHEP
HKRVDTWRYVTWQIYDNIAATTTPSTGE-GLQETRLKQDVYYLEKPRRKTEALIFGSHDS
QKRIDTYRFFTYQIYGSLNSEPSASDAS--ITAINLMPNVFYVEKNGQKTDALIFGQHDK
::*:* :*: * *** :
. .
:
* :*:*:** :**:*:*** *:

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

TTLGAMHRISQYLDVLWGAKTDIYSMYYLNGQDNSLTMVSTQPLKDISSQFRGSYLSSMV
STLEMTQRMSTYLDTLWGAENVPWSMYYLNGQDNSLVLISTLPLKDLTSGFKESTVSDIV
ATLTMALQISDYLDNLWGPQNDTYSMYYLNGQDNSLLLITTQALKEVTSRFKESYLTAFA
ATLEMTQRMSTYLDTLWGAENVPWSMYYLNGQDNSLILISTLPLKDLSSGFKESTIGNIV
GTLTSVRRISRYLDILWGAENNVYSMYYLNGIDNSLTMISTQTLKDISSQFRGNYITVIA
**
::* *** ***.:. :******* **** :::* .**:::* *: . : :.

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

ESRKTEMLQQANTLDERESFSPLRKLRFYNDYYFTLRTTFNQPGHLATVIAFDLSINDLI
DSRRAEMLQQANALDERESFSNMRRLAWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLI
ESRRAEMLQQVNTLDERESFSPLRKLRFQNAYYFTLRTTFNRPGHLATVIAFDLPINDLI
DSRRAEMLQQANALDERESFSSLRKLAWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLI
EARRTEMLQQANVLDERESFSPLRKLRFYNDYYFTLRTTFNQPGHLATILAFDLPINDLI
::*::*****.*.******** :*:* : * :*********:******::****.*****

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

PRNMSRDNFMLRQQTPPVNADANA-DNDIPTDIRREGALLEISAQLMNSPIKLVYAIPLG
PPGMPLDSFRLEPDATATGNNENEKEGTDSVSIHFNSTKIEISSALNSTDMRLVWQVPYG
PPNMARSNFLLQPDKVPLNEGATP-EDIAATSVSLNGSWVEFSAPLANVTLKIIYRVPVS
PPGMPLDSFRIEPDATQATGRSSEKEAPDSVTISFNGSKIEISSALNSTGMRLIWQVPFG
PDTIPREFLMLKPDTP-AASNMDS-NGEGTADVQLHGSNLEISATLVNAPIKIVFQVPVK
* :. . : :. :
:
.. : ..: :*:*: * . ::::: :*

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

RLVTDMLRNNIWVIALNLALLTLSLMGFYALRRYYAR-----PKDDLSHHLKEQQRMYGE
TLLLDTLQNILLPLLLNIGLLALALFGYTTFRHFSSRSTESVPSTAVNNELRILRAINEE
HLIIDLLINNFWLILANIVLLALTILAAYFVRHQYGR-----PSADVTGQLEAQRLLSQE
TLLLDTLQNILLPLLLNIGLLALALFGYATFRHQPGRSTESTSGNAANNELRVLRAINEE
TLIVDSLRNNIWLLLLNLVLLSASIAGFYLFRRKYAH-----PGEDLSHQLEKKLDIYRE
*: * * * : : *: **: :: .
.*: .:
.
. .*.
: *

RcsDEch
RcsDEco
RcsDYpe
RcsDStm
RcsDEca

IVSRIPVGVLVYDFSNNKVMVANALAERLYPHLSLKKISTLAEEHQGVIQATVDNEMYEV
IVSLLPLGLLVHDQESNRTVISNKIADHLLPHLNLQNITTMAEQHQGIIQATINNELYEI
IITNLPQGLLIYDFSNSTVIASNKIAENLLPHLNLQKIATMAEQHHGVIQGTVNNEVYEI
IVSLLPLGLLVYDQEGNRTVISNKIADHLLPHLNLQNITSMAEQHQGVIQATINNELYEI
TTGKIPMGVLVYDFSSNKVVIQNERAEHLLPHLSLQKITNMADEHQGVIQVTINNEMYEI
:* *:*::* ... .: * *:.* ***.*::*:.:*::*:*:** *::**:**:

Priplasmique

Priplasmique

Priplasmique

Priplasmique

Transmembranaire

Cytoplasmique

Figure 60 : Comparaison de la squence du domaine priplasmique (en bleu) de la


protine RcsD dE. chrysanthemi (RcsDEch) avec celle dE. coli (RcsDEco), de Yersinia
pestis (RcsDYpe), de Salmonella typhimurium (RcsDStm) et Erwinia carotovora ssp
atroseptica (RcsDEca). En jaune sont reprsents les deux domaines transmembranaires
prdits par le logiciel Toppred (http://bioweb.pasteur.fr/seqanal/interfaces/toppred.html).

2009 Tous droits rservs.

132

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Discussion globale

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Discussion globale
Lenveloppe des Protobactries est compose de deux membranes, la membrane interne et la
membrane externe, dlimitant un compartiment aqueux : le priplasme. Ce compartiment
contient le peptidoglycane, les glucanes priplasmiques osmorguls (OPG) et des protines.
Les protines du priplasme jouent un rle dans de nombreuses fonctions comme dans la
scrtion de protines ou de polysaccharides extracellulaires, dans la dtoxication par la
dgradation et/ou le transport sortant de toxiques, ou encore dans la nutrition par le transport
entrant et la dgradation de nutriments. Lenveloppe est donc un lieu dchanges.
Lenveloppe est galement un lieu de perception par la bactrie du milieu extrieur. La
bactrie va pouvoir grce la perception de son environnement engendrer des mcanismes lui
permettant de sadapter celui-ci. Cette perception va notamment seffectuer par les systmes
deux composants forms dun capteur transmembranaire situ dans la membrane interne et
dun rgulateur transcriptionnel cytoplasmique.
Ma thse a comport deux parties distinctes visant toutes deux comprendre comment la
bactrie va percevoir son milieu et sy adapter en faisant varier la transcription des gnes
ncessaires pour le bon droulement de linfection. Cette thse est une contribution la
comprhension du rle du priplasme dans la perception de lenvironnement par la bactrie.
Le priplasme est donc un compartiment trs complexe de la bactrie, avec un aspect de gel et
permettant deffectuer un sas entre le cytoplasme de la bactrie et le milieu externe par
lintermdiaire des membranes externe et cytoplasmique. Ce compartiment comprend de
nombreuses protines essentielles pour le transport travers lenveloppe, ou depuis le
cytoplasme vers le milieu extrieur. A la surface de la membrane cytoplasmique, on retrouve
les boucles priplasmiques de nombreux capteurs permettant la bactrie de percevoir son
environnement afin de sy adapter.
Le priplasme contient 2 types de glucanes spcifiques des bactries : la couche de
peptidoglycane permettant la formation dun rseau dense autour de la cellule donnant ainsi la
forme de la bactrie et les glucanes priplasmiques osmorguls (OPG).
Ltude protomique du mutant opgG (Bouchart et coll., 2007) nous a amen nous
intresser une protine priplasmique trs abondante dans le priplasme : une
endo-1,4--galactanase priplasmique (GanA) (Delangle et coll., 2007). Il sest avr que
cette protine fait partie dun systme de transport et de dgradation des -galactanes,
produits issus de la dgradation de la pectine. Ce systme Gan permet donc le transport

2009 Tous droits rservs.

133

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

doligosaccharides travers lenveloppe de la bactrie afin de les utiliser comme source de


carbone. Ce transport ncessite plusieurs tapes de dgradation indispensables dont une qui a
lieu dans le priplasme o GanA dgrade les chanes de galactanes (entrant par lintermdiaire
de la porine GanL, et en collaboration avec GanE) en oligomres (gal3) qui sont alors
transportables par le systme de transport de type ABC (GanFGK2) vers le cytoplasme de la
bactrie. Lors de linfection de la plante, les gnes codant ce systme Gan sont fortement
induits. La bactrie, une fois dans la plante hte, va percevoir son environnement et activer
lensemble des gnes codant les enzymes qui permettront la dstructuration de la paroi et
lutilisation des produits de dgradation comme source de nutriments pour un dveloppement
optimal de la bactrie dans la plante hte.

Figure 59 : Reprsentation de plusieurs systmes deux composants agissant sur les


gnes cibles, en interagissant ou non avec les OPG (ronds rose). La virulence va rsulter
de lactivation des gnes de virulence et de linactivation des gnes dantivirulence. Une
perturbation de laction des systmes deux composants peut engendrer des variations
dexpression des gnes conduisant une absence de virulence (activation des gnes
dantivirulence ou inactivation des gnes de virulence). Un inhibiteur de la synthse des OPG
(toile violette) pourrait faire varier la perception des systmes deux composants, il en
rsulterait une diminution du pouvoir pathogne de la bactrie.

2009 Tous droits rservs.

134

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Les OPG sont des oligosaccharides essentiels pour la virulence dE. chrysanthemi. Leur
absence conduit un stress pour la bactrie qui ne percevrait plus la ralit de son
environnement. Chez E. coli, il a t montr que ces OPG, prsents dans le priplasme,
pouvaient interagir avec des systmes deux composants (prsents dans la membrane interne)
qui sont impliqus dans la perception de changements environnementaux. Les OPG seraient le
signal capt par les capteurs de systmes deux composants par lintermdiaire de leurs
boucles priplasmiques : EnvZ (Fiedler et Rotering, 1988) et RcsC (Ebel et coll., 1997). Nos
travaux ont permis de mettre en vidence que la mutation opgG engendrait une activation du
systme Rcs, quune mutation ponctuelle rcsC2 supprime la mutation opgG. Cette mutation
rcsC2 diminue la signalisation du systme Rcs par une dphosphorylation accrue du
rgulateur RcsB par le capteur RcsC (un niveau faible de phosphorylation de RcsB). De plus,
nous avons montr que lexpression des gnes soumis la rgulation du systme RcsCDB est
influence par la quantit des OPG.
De nombreux travaux ont montr limportance du systme Rcs dans la virulence, comme pour
Salmonella (Mouslim et coll., 2004), pour les souches pathognes dE. coli (Tobe et coll.,
2005), pour E. amylovora (Bereswill et Geider, 1997) ou encore Y. enterocolitica (Venecia et
Young, 2005). Il a ainsi t suggr que les bactries pathognes diminuaient lexpression de
certains gnes lors de linfection, gnes incompatibles avec le bon droulement de linfection
(diminution de lexpression des gnes dantivirulence) (Mouslim et coll., 2004). Chez
E. chrysanthemi, la dltion rcsCBD ou une mutation rcsB ne permet pas de supprimer la
mutation opgG. Ces rsultats nous laissent penser que les OPG pourraient interagir avec
dautres systmes deux composants que le systme RcsCDB. Cest pourquoi Gilles
Boussemart cherche identifier de nouveaux systmes deux composants dont lactivit
serait module par les OPG. Ainsi les OPG pourraient agir sur une srie de gnes cibles par
lintermdiaire des systmes deux composants. La virulence serait donc la rsultante
complexe de lactivation des gnes de virulence et de linhibition des gnes dantivirulence
(figure 59) par les rgulateurs des systmes deux composants qui sont eux mme
phosphoryls par un plusieurs capteurs des diffrents systmes deux composants.
Park & Forst en 2006 ont propos un modle dans lequel le systme deux composants
EnvZ/OmpR est impliqu notamment dans la rgulation des gnes flhDC impliqus dans la
motilit, tout comme le systme Rcs. La relation entre les OPG et le systme EnvZ/OmpR
serait donc galement approfondir.

2009 Tous droits rservs.

135

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

De plus, une tude rcente chez E. carotovora (Cui et coll., 2008) a montr que les protines
FlhDC rgulent lexpression de nombreux gnes dont certains sont impliqus dans la
virulence et la production dexoenzymes et notamment la protine GacA qui fait partie du
systme deux composants GacS/GacA. Nous avons montr que lexpression de lopron
flhDC varie en absence dOPG et ce par lintermdiaire du systme Rcs.
Linteraction des OPG avec dautres systmes deux composants pourrait donc tre directe
ou indirecte par lintermdiaire dautres systmes deux composants.
Enfin plus long terme, de nombreuses recherches sont menes afin de trouver de nouvelles
cibles pour des agents antibactriens. Les systmes deux composants permettent de rguler
lexpression coordonne de gnes impliqus dans la virulence. Cest pourquoi les systmes
deux composants sont considrs comme des cibles privilgies pour lutter contre les
pathognes. Les OPG sont des constituants priplasmiques importants pour la virulence de
nombreuses bactries, phytopathognes ou zoopathognes. Labsence des OPG rend les
bactries peu ou pas virulentes. Le lien troit qui existe entre les OPG et le systme Rcs connu
pour rguler la virulence ainsi que le lien possible avec dautres systmes deux composants
nous conforte dans lide que les OPG sont une cible privilgier. Des recherches
dinhibiteurs de synthse pourraient ouvrir de nombreuses perspectives (figure 59).

2009 Tous droits rservs.

136

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Matriels et Mthodes

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Matriels et mthodes
A. Souches et milieux
1. Milieux de culture et conditions de croissance des bactries
Les souches dE. coli et dE. chrysanthemi sont cultives respectivement 37C et 30C, et
sous agitation 140 rpm et 125 rpm.
La croissance bactrienne est suivie par mesure de la turbidit 620 nm. Une densit optique
de 1 correspond 109 bactries/mL.
Les milieux de culture utiliss sont :
Le milieu LB (Luria Broth), le milieu LB est aussi utilis sans NaCL (LB-NaCl) afin
davoir un milieu dosmolarit rduite (150 mosM) (Miller, 1992).
Le milieu 63 (Miller, 1992) est un milieu minimum complment par les mtabolites
ncessaires la croissance des diffrentes souches : les acides amins et bases azotes 40
mg/mL, la thiamine 2 mg/mL et la source de carbone 2 g/L. Par contre, le
polygalacturonate est ajout une concentration de 4 g/L. Les extraits de pommes de terre
(pluches) ou de feuilles dendive sont obtenus en broyant les produits au robot mnager
puis en centrifugeant 4C pendant 10 min 4000 g. Le surnageant est ensuite strilis sur
filtre de 0,45 m (Millipore). Ces extraits sont ajouts dans le milieu de culture une
concentration de 10 % (vol/vol).
Ces milieux sont solidifis par lajout dagar 15 g/L. La motilit des bactries est teste
sur boite de milieu LB glos 4g/L.
Le milieu bas phosphate se compose de Tris HCl (120 mM), NaCl (90 mM), KCl (40
mM), NH4Cl (21 mM), CaCl2 (0,1 mM), Na2SO4 (25 M), KH2PO4 (0,5 mM), bactopeptone
(0,25%), pH 7,4. Ce milieu carenc en phosphate est utilis pour favoriser la perte des
plasmides introduits chez E. chrysanthemi par lectroporation, Il est complment par une
source de carbone et lantibiotique adquats (Torriani, 1968).
Pour la dtermination des CMI (concentration minimale inhibitrice) en sels biliaires, les
bactries sont tales sur des botes de milieu LB glos contenant des concentrations
variables de sels biliaires (Bile salts N3, Difco laboratories).
Les souches sont conservs -20C et -80C avec du glycrol 15%.

2009 Tous droits rservs.

137

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Le X-Gal (5bromo-4chloro-3indolyl--D-galactopyranoside) et le X-Gluc (5bromo4chloro-3indolyl--D-glucuronide) sont utiliss une concentration de 20 g/mL.


LAZCL-galactane ( Azurine-crosslinked galactan , Megazyme, Bray, Irlande) est
compos de particules en suspension qui sont tales en surcouche 2 g/l sur un milieu solide
contenant du glycrol comme source de carbone. La dgradation de ce substrat gnre un halo
bleu diffusible.
Les antibiotiques sont ajouts aux concentrations finales suivantes (tableau 15):
Antibiotique

E. coli

E. chrysanthemi

Ampicilline (Amp)

50 g/mL

25 g/mL

Chloramphnicol (Cml)

25 g/mL

12,5 g/mL

Kanamycine (Kan)

50 g/mL

25 g/mL

Spectinomycine (Sp)

100 g/mL

50 g/mL

Ttracycline (Tet)

25 g/mL

12,5 g/mL

Tableau 15: Concentration des antibiotiques.

2. Gnotypes des souches utilises


Les souches dE. coli K12 et dE. chrysanthemi utilises sont dcrites respectivement dans les
tableaux 16 et 17.
Souche

Gnotype

rfrence

JM83

(lac-pro), ara, rpsL, thi, (80lacZ-M15)

Vieira et Messing, 1982

Top10

F- mcrA (mrr-hsdRMS-mcrBC) 80lacZ-M15 lacX74 deoR

Invitrogen

recA1 araD139 (ara-leu)7697 galU galK rpsL endA1 nupG


S17-1pir

recA1, thi, pro, hsdR-M+, RP4:2-Tc::Mu-Kan::Tn7, pir

Lazzaroni

SM10 pir

thi-1, thr, leu, lacY, recA::cat-aadA (CmlR), pho-510, recA+

De lorenzo et coll., 1994

BW25141

(araD-araB)567, lacZ4787 (::rrnB-3), (phoB-phoR)580, -,

Datsenko

galU95, uidA3()::pir$^+$, recA1, endA9(-ins)::FRT, rph-1,

2000

&

Wanner

DE(rhaD-rhaB)568, rrnB-3, hsdR514


SK1291

F- - rph-1 lacIZ(MLuI) (cps-lacZ)

Davalos-Garcia et coll.,
2001

Tableau 16 : Souches dE. coli.

2009 Tous droits rservs.

138

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Souche

Gnotype

source ou rfrence

EC3937

Wild type

Collection du laboratoire

NFB3500

opgG::uidA-Kan

Page et coll., 2001

NFB3591

opgG::uidA-Kan, rcsC2

Cette tude, partie RcsCDB

NFB3602

opgG::Cml, ura

Cette tude, partie RcsCDB

NFB3609

opgG::Cml, ura, rcsC2

Cette tude, partie RcsCDB

NFB3611

rcsC2

Cette tude, partie RcsCDB

NFB3669

rcsD::Cml

Cette tude, partie RcsCDB

NFB3670

opgG::uidA-Kan, rcsD::Cml

Cette tude, partie RcsCDB

NFB3682

rcsC::Cml

Cette tude, partie RcsCDB

NFB3683

opgG::uidA-Kan, rcsC::Cml

Cette tude, partie RcsCDB

NFB3753

rcsCBD::Cml

Cette tude, partie RcsCDB

NFB3754

opgG::uidA-Kan, rcsCBD::Cml

Cette tude, partie RcsCDB

NFB3800

Tn5flhD-uidA

Cette tude, partie RcsCDB

NFB3805

opgG::Cml, ura, Tn5flhD-uidA

Cette tude, partie RcsCDB

NFB3806

opgG::Cml, ura, rcsC2, Tn5flhD-uidA

Cette tude, partie RcsCDB

NFB3807

rcsC2, Tn5flhD-uidA

Cette tude, partie RcsCDB

NFB3808

rcsCBD::Cml, Tn5flhD-uidA

Cette tude, partie RcsCDB

NFB3809

Tn5ftsA-uidA

Cette tude, partie RcsCDB

NFB3810

opgG::Cml, ura, Tn5ftsA-uidA

Cette tude, partie RcsCDB

NFB3811

opgG::Cml, ura, rcsC2, Tn5ftsA-uidA

Cette tude, partie RcsCDB

NFB3812

rcsC2, Tn5ftsA-uidA

Cette tude, partie RcsCDB

NFB3813

rcsCBD::Cml, Tn5ftsA-uidA

Cette tude, partie RcsCDB

NFB3862

Tn5cpsB-uidA

Cette tude, partie RcsCDB

NFB3863

opgG::Cml, ura, Tn5cpsB-uidA

Cette tude, partie RcsCDB

NFB3864

opgG::Cml, ura, rcsC2, Tn5cpsB-uidA

Cette tude, partie RcsCDB

NFB3865

rcsC2, Tn5cpsB-uidA

Cette tude, partie RcsCDB

NFB3866

rcsCBD::Cml, Tn5cpsB-uidA

Cette tude, partie RcsCDB

NFB3859

opgG::Cml, ura, rcsC2, Tn5ftsA-uidA, Tn5rcsCDB

Cette tude, partie RcsCDB

NFB3874

Tn5ftsA-uidA, Tn5TAT-rcsF clone 1

Cette tude, partie RcsCDB

NFB3893

Tn5ftsA-uidA, Tn5TAT-rcsF clone 2

Cette tude, partie RcsCDB

NFB3894

Tn5ftsA-uidA, Tn5TAT-rcsF clone 3

Cette tude, partie RcsCDB

NFB3895

Tn5ftsA-uidA, Tn5TAT-rcsF clone 4

Cette tude, partie RcsCDB

NFB3875

Tn5ftsA-uidA, Tn5djlA clone 1

Cette tude, partie RcsCDB

2009 Tous droits rservs.

139

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

NFB3896

Tn5ftsA-uidA, Tn5djlA clone 2

Cette tude, partie RcsCDB

NFB3897

Tn5ftsA-uidA, Tn5djlA clone 3

Cette tude, partie RcsCDB

NFB3898

Tn5ftsA-uidA, Tn5djlA clone 4

Cette tude, partie RcsCDB

NFB3876

Tn5ftsA-uidA, Tn5igaA clone 1

Cette tude, partie RcsCDB

NFB3899

Tn5ftsA-uidA, Tn5igaA clone 2

Cette tude, partie RcsCDB

NFB3900

Tn5ftsA-uidA, Tn5igaA clone 3

Cette tude, partie RcsCDB

NFB3901

Tn5ftsA-uidA, Tn5igaA clone 4

Cette tude, partie RcsCDB

A4807

ganB::uidA-Kan

Cette tude, partie Gan

A4809

ganA::uidA-Kan

Cette tude, partie Gan

A4810

ganE::uidA-Kan

Cette tude, partie Gan

A4863

ganR::Cml

Cette tude, partie Gan

A4868

ganL::uidA-Kan

Cette tude, partie Gan

NFB3677

ganA::Cml

Cette tude, partie Gan

NFB3674

ganB::Cml

Cette tude, partie Gan

NFB3677

crp::Cml

Cette tude, partie Gan

NFB3679

ganA::uidA-Kan, crp::Cml

Cette tude, partie Gan

NFB3680

lacZ::Cml

Collection du laboratoire

NFB3681

ganB::FRT

Cette tude, partie Gan

NFB3687

lacZ::Cml, ganB::FRT

Cette tude, partie Gan

NFB3701

ganK::uidA-Kan

Cette tude, partie Gan

NFB3703

ganK::uidA-Kan, crp::Cml

Cette tude, partie Gan

NFB3758

ganR::uidA-Kan

Cette tude, partie Gan

NFB3792

ganL::uidA-Kan, crp::Cml

Cette tude, partie Gan

NFB3793

ganE::uidA-Kan, crp::Cml

Cette tude, partie Gan

NFB3718

opgG, ganA::uidA

Cette tude, partie Gan

NFB3843

rcsCBD, ganA::uidA

Cette tude, partie Gan

Tableau 17 : Souches dE. chrysanthemi.

2009 Tous droits rservs.

140

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

3. Plasmides utiliss
Souche

Gnotype

source ou rfrence

pBSK

AmpR

Stratagene

pUC18Not

AmpR

Yanisch-Perron et coll., 1985

pUC19

AmpR

Yanisch-Perron et coll., 1985

pNFCml

CmlR

Collection du laboratoire

pUIDK11

CmlR, portant la cassette uidA-Kan

Bardonnet & Blanco, 1992

pOK

sacB, sacR, mobRK2,oriRK6, SpeR

Huguet et coll., 1998

pCP20

FLP+, cI857+, prRepts, AmpR,, CmlR

Cherepanov & Wackernagel. 1995.

pUTminiTn5-TetR

AmpR, TetR

De Lorenzo et coll., 1990

pUTminiTn5-SpR

AmpR, SpR

De Lorenzo et coll., 1990

pUTminiTn5-KanR

AmpR, KanR

De Lorenzo et coll., 1990

pXfD11

pYZ4, squence signal dOpgD de Xylella fastidiosa


entre NcoI et SacI devant blaM entre SacI et EcoRI

Carmen dberg-Ferragut

pNFW137

pUC18, rcsC

Franck Bouchart

pNFW149

pUC18, rcsC::Cml

Franck Bouchart

pNFW161

pOK, rcsC::Cml

Franck Bouchart

pNFW134

pUC18, rcsD

Franck Bouchart

pNFW135

pUC18, rcsD::Cml

Franck Bouchart

pNFW155

pOK, rcsD::Cml

Franck Bouchart

pNFW170

pUC18, (rcsCB rcsD)

Cette tude

pNFW173

pUC18, (rcsCB rcsD)::Cml

Cette tude

pNFW257

pUC18Not, rcsCBD

Cette tude

pNFW261

pUTminiTn5-SpR, rcsCBD

Cette tude

pNFW230

pUC18Not, rcsCB::Cml-rcsD

Cette tude

pNFW183

pBSK, rcsF

Cette tude

pNFW184

pBSK, rcsF::Cml

Cette tude

pNFW181

pUC18Not, flhD

Cette tude

pNFW203

pUC18Not, flhD-uidA-Kan

Cette tude

pNFW204

pUC18Not, flhD-uidA

Cette tude

2009 Tous droits rservs.

141

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

pNFW215

pUTmini-Tn5Kan, flhD-uidA

Cette tude

pNFW182

pUC18Not, ftsA

Cette tude

pNFW193

pUC18Not, ftsA-uidA-Kan

Cette tude

pNFW201

pUC18Not, ftsA-uidA

Cette tude

pNFW220

pUTmini-Tn5Kan, ftsA-uidA

Cette tude

pNFW205

pUC18Not, cpsB

Cette tude

pNFW206

pUC18Not, cpsB-uidA-Kan

Cette tude

pNFW207

pUC18Not, cpsB-uidA

Cette tude

pNFW262

pUTmini-Tn5Kan, cpsB-uidA

Cette tude

pNFW258

pUC18Not, djlA

Cette tude

pNFW289

pUTminiTn5-SpR, djlA

Cette tude

pNFW259

pUC18Not, igaA

Cette tude

pNFW265

pUTminiTn5-TetR, igaA

Cette tude

pNFW175

pYZ4, TAT-rcsF (L18-Q135)

Carmen dberg-Ferragut

pNFW177

pUC18Not, TAT-rcsF (L18-Q135)

Cette tude

pNFW271

pUTminiTn5-TetR, TAT-rcsF (L18-Q135)

Cette tude

pNFW268

pYZ4, TAT-rcsF (L18-Q135,C75S)

Cette tude

pNFW246

pYZ4, TAT-rcsF (L18-Q135,C110S)

Cette tude

pNFW247

pYZ4, TAT-rcsF(L18-Q135, C119S)

Cette tude

pNFW269

pYZ4, TAT-rcsF (L18-K131, C125S)

Cette tude

pNFW225

pYZ4, TAT-rcsF (P49-Q135)

Carmen dberg-Ferragut

pNFW238

pYZ4, TAT-rcsF (E57-Q135)

Carmen dberg-Ferragut

pNFW226

pYZ4, TAT-rcsF (D66-Q135)

Carmen dberg-Ferragut

pNFW223

pYZ4, TAT-rcsF (L18-R65)

Carmen dberg-Ferragut

pNFW224

pYZ4, TAT-rcsF (L18-D109)

Carmen dberg-Ferragut

pNFW227

pYZ4, TAT-rcsF (P49-D109)

Carmen dberg-Ferragut

pNFW228

pYZ4, TAT-rcsF (P49-A117)

Carmen dberg-Ferragut

pNFW229

pYZ4, TAT-rcsF (P49-Q126)

Carmen dberg-Ferragut

pNFW239

pYZ4, TAT-rcsF (P49-G127)

Carmen dberg-Ferragut

pNFW240

pYZ4, TAT-rcsF (P49-A129)

Carmen dberg-Ferragut

pNFW241

pYZ4, TAT-rcsF (P49-K131)

Carmen dberg-Ferragut

2009 Tous droits rservs.

142

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

pI2872

pGEM-T, ganA

Cette tude

pI2873

pGEM-T, ganA::uidA-Kan

Cette tude

pI2874

pGEM-T, ganB

Cette tude

pI2876

pGEM-T, ganB::uidA-Kan

Cette tude

pI2866

pGEM-T, ganE

Cette tude

pI2867

pGEM-T, ganE::uidA-Kan

Cette tude

pI2868

pGEM-T, ganL

Cette tude

pI2869

pGEM-T, ganL::uidA-Kan

Cette tude

pI2870

pGEM-T, ganR

Cette tude

pI3136

pGEM-T, ganR::Cml

Cette tude

pNFW130

pBluescript, ganA

Cette tude

pNFW140

pBluescript, ganA::Cml

Cette tude

PNFW142

pBluescript, ganB

PNFW145

pBluescript, ganB::Cml

PNFW154

pOK, ganB::Cml

PNFW162

POK, ganB::FRT

pNFW158

pBluescript, ganK

pNFW163

pBluescript, ganK::uidA-Kan

Cette tude
Cette tude
Cette tude
Cette tude
Cette tude
Cette tude

Tableau 18 : Plasmides utiliss.

2009 Tous droits rservs.

143

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

B.

Techniques gntiques

1. Transduction
Les transductions chez E. chrysanthemi ont t effectues en utilisant le phage EC2
daprs Rsibois et coll. (1984).

2. Conjugaison (pUT et pOK)


Des volumes gaux (0,2 mL) de souches donatrices S17-1 et rceptrices (E. chrysanthemi)
sont mlangs et dposs sur boite de milieu 63 sans source de carbone pendant 1h 30C.
Les bactries sont ensuite reprises dans 1,5 mL de milieu 63. Des chantillons de 0,1 mL de
cette suspension (dilue 10-1 ou non) sont tals sur milieux slectifs :

Pour pUT : sur boites de milieu 63 + antibiotique du miniTn5. Les colonies apparues sont
repiques sur boite 63 + antibiotique et boite 63 + antibiotique + ampicilline (rsistance
apporte par le plasmide pUT). Seuls les clones sensibles lampicilline sont utiliss.

Pour pOK : dans un premier temps, les bactries sont tales sur boites de milieu 63 +
glycrol + antibiotique (cassette interrompant le gne dintrt). Puis les cellules sont
reprises dans 2mL de 63 et tales diffrentes dilutions sur boites de milieu 63 +
saccharose (5%) + antibiotique (cassette interrompant le gne dintrt). Cela permet une
slection associe la perte du plasmide. En effet, le vecteur contient le gne sacB qui
rend la souche sensible au saccharose (Huguet et al.,1998).

3. Transformation
Les cellules dE. coli sont rendues comptentes et transformes selon la mthode au chlorure
de rubidium dHanahan (1983).

4. Electroporation
Cette technique est notamment utilise pour la construction de mutants par insertion de
cassette. Les cellules dE. chrysanthemi ont t transformes par lectroporation daprs
Sambrook et coll (1989). Les bactries sont ensuite tales sur boite LB + antibiotique
(cassette interrompant le gne dintrt) permettant la slection des bactries ayant reu le
plasmide. Des cultures successives dans un milieu carenc en phosphate complment par une
source de carbone et lantibiotique adquat sont utilises pour favoriser la perte des plasmides
et observer la recombinaison homologue (Torriani, 1968).

2009 Tous droits rservs.

144

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

C. Techniques de biologie molculaire


1. Extraction et purification dADN : plasmide, bande, ADNg
La prparation de lADN plasmidique est effectue par lyse alcaline selon la mthode de
Birnboim & Doly (1979). LADN est finalement prcipit par un volume disopropanol,
centrifug, lav lthanol froid 70%, centrifug, sch et remis en solution dans leau.
Lorsquil tait ncessaire (sous-clonage, squenage), la purification de lADN plasmidique
est obtenue en utilisant le kit Nucleospin plasmid (Macherey Nagel).
LADN chromosomique est prpar selon la mthode de Davis et al (1980).
Lextraction de bande dans des gels seffectue grce au kit Nucleospin Extract II
(Macherey Nagel).

2. Enzymes de restriction et de modification


Les endonuclases de restriction (New England Biolabs, Takara, Boehringer Mannheim,
Eurogentec, Gibco BRL) ont t utilises selon les recommandations des fabricants. Les
fragments de restriction sont spars par lectrophorse en gel dagarose 1% en prsence de
bromure dthidium (1g/mL) et de RNase (4g/mL, Sigma) dans du TAE (Tris 200mM,
EDTA 5 mM, ajust pH 8,5 par de lacide actique). Le marqueur de masse molculaire est
le Smart ladder dEurogentec.
Certains fragments sont rendus bouts francs grce au fragment de Klenow de
lADN-polymrase I dE. coli (Biolabs) utilise dans les conditions spcifies par le fabricant.
Pour permettre lactivit ADN-polymrase (53), les dNTP sont ajouts une
concentration de 2 mM et la raction seffectue 10 minutes temprature ambiante. Si le site
ncessite dtre trait par lactivit exonuclase (35), la raction a lieu 5 minutes sans
dNTP temprature ambiante puis lajout des dNTP (concentration finale 2mM) permet de
terminer par une activit ADN-polymrase (53). Lenzyme est ensuite inactive 20
minutes 65C.
LADN-ligase du bactriophage T4 (New England Biolabs) a t utilise dans le tampon
fourni par Biolabs, pendant la nuit 4C ou une heure temprature ambiante.

2009 Tous droits rservs.

145

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

3. Raction de polymrisation en chane (PCR et PCR inverse)


LADN polymrase (Taq DNA polymerase, Eppendorf) a permis de raliser des PCR dans les
conditions standard prconises par le fabriquant. Les ractions sont ralises dans un volume
de 50L. Les PCR sont faites avec 100 ng dADN gnomique ou sont effectues avec une
colonie. Le tableau 19 rcapitule les amorces utilises.
Amorce
ganRG
ganRD
ganLG
ganLD
ganK1
ganK2
ganEG
ganED
ganA1
ganA2
ganAG
ganAD
ganB1
ganB2
ganBG
ganBD

Squence
GCGGATCCGGACCAGCTGTTACAATC
CGTCTAGATGCGCCGCAACATGCTAC
GCAGATCTGGATTGTAACAGCTGGTCC
CGTCTAGATAACCGGTCGGTGAGCGG
AAACTGCAGGCCGGCATGACAAACCCCCTTTCGCCAGAA
AAACTGCAG CGCGTCGGTGAAGCTGTCTTGCTCGGCCTT
GCGGATCCTCAACGGGTTATCAATACGG
CGTCTAGAGTTGTCCTTGCTCCAGGTCG
AAGGATCCCCAGTTACACCACCTACGC
AATCTAGACGACCAGTCGCTGTAGGTA
GCGGATCCTGACCTCAGGCAGTACCAAAG
CGTCTAGACGGATTCAAAGGCGTAAATCG
AAGGATCCGCCTGCCTATCGAAATAGAG
AATCTAGACCCAAGAGAAAACGCCCATG
GCGGATCCTATGCTCTCTGCCTATTCAG
CGTCTAGATCAGATCAGACGGCGGCGAATC

Tableau 19 : Amorces utilises pour ltude du systme Gan

2009 Tous droits rservs.

146

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Amorce
delrcs1
delrcs2
delrcs3
delrcs4
RcsC1
RcsC4
YojN1
YojN8
flhD1
flhD2
ftsA1
ftsA2
cpsB1
cpsB2
RcsF1 sma
RcsF2 Xba
rcsFTAT1
rcsFTAT2
rcsF-xho-C75SF
rcsF-xho-C75SR
RcsF-C110S-F
RcsF-C110S-R2
RcsF-BamC119S-R
RcsF-BamC119S-F
RcsF-C125S-R
pYZ4-R
PYZ4FOR
RcsF-R65-R
RcsF-P49-F
RcsF-D66-F
RcsF-D109-R
RcsF-A117-R
RcsF-Q126-R
RcsF-Xba-R
RcsF-Xba-F
RcsF-S55-F
RcsF-A129-R
RcsF-K131-R
RcsF-G127-R
djlA1-Ech
djlA2-Ech
igaA1-Ech
igaA2-Ech
jep132
omegaC2

Squence
AAGGTACCTTGCCGGAAGCGAGCCGCGGCGCTCGCGGT
AACCCGGGTCAAAGGCATACCGTAAAGGTTGTCAGCAA
AACCCGGGCGCAGGCATGAAATCAGGCTCCTGATGAAC
AAAAGCTTTACCCCGTAATAACCTGCTTACCCACCCGC
GCTGAACCGGTGGAAGACGATGAGCTCGACAGCGTG
CTGAAAGGTGTCTTTGCCATGCTGAATCTTCATCCC
CTGTGACAAAGCCTTCGATCTG
GTTCATCAGGAGCCTGATTTC
CACTGCGGGGTAAGGATCCGTGAAATATTATG
GCATCGAGCTCGATGCGTCTGAGGTGCCGGCTCTTCA
GATCGAGGATCCGCCCTGGATTAAACAGGCCAGCG
CGGCATGAGCTCATTGCCGATGCGCTCAGCCGGC
TTAACTGAATTTTAAAAGTCATATCGCA
CCTGCAGCATGGAATTCTGACCGTGG
AACCCGGGATCCTGCTGGTGGTTCTGGTTTATCTCATT
AATCTAGACTGCGCCAGCACCTGGCTGATGAAACGCCG
CAGGGAGCTCCCTGCTGCACAAACCTGCTGC
GCAGAATTCGCTCATTGCGCGGAAACTTTCAGTGCG
GGCTCCTCGAGTCAGTCCAGCGCGCAAG
GACTGACTCGAGGAGCCAGACACTTCAC
TGCCGTACTGCTGCATGACAGCCAGATC
GACGATCTGGCTGTCATGCAGC
GACGGTAGGATCCTGCGACATTACTG
TCGCAGGATCCTACCGTCAGGCCGTC
ATTGCGAATTCTATTTCAGTGCGGAACCCTGGCTGACGG
GAAGGGCGATCGGTGCGGGCCTC
CTTAGGAGGGTTTTTACCATG
CTTCACGAATTCAGCGGAACGGCTTGCCTAC
CACGCAGAGCTCTCCTGCCGTGCTGTATAAAAGTG
CAAGCCGAGCTCCGATATGGGTGAAGTGTC
CTGACGAATTCTCAGTCATGCAGCAGTACG
GACGGTGAATTCATGCGACATTACTGACGATC
CAGTGCGGAATTCTAGCAGACGGCCTGACGG
CGGTAGCATTCTAGAACATTACTGACG
CCGTCAGGCCGTTCTAGAGGGTTCCGCACTG
GTATAAGAGCTCTGAAGAACTGGTAGG
CGCGGAGAATTCCTATGCGGAACCCTGGCAG
CATTGCGAATTCTATTTCAGTGCGGAACCCTG
GGAAACTTTGAATTCCTAACCCTGGCAGAC
GTCATCCCGGGAAACGGTCAGAGACTATATCA
GCGTTGAGCTCGCCGATGCATTTTCGCTGCGA
TGCTCCCGGGCAATTATTAATAATTCATCAGA
CCGGTGAGCTCATCCGGGAGTGGAGTACTGAG
CTAGGCGGCCAGATCTGATCAA
TCAAAAGGTCATCCACCGGATC

Tableau 20: Amorces utilises pour ltude du systme Rcs.

4. Squenage
Le squenage des plasmides et des produits de PCR a t ralis par la socit GenoScreen.

2009 Tous droits rservs.

147

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

D. Clonage molculaire : Etude du systme Gan


Ce travail a t ralis en collaboration avec Madame Nicole Hugouvieux-Cotte-Pattat
(Adaptation et Pathognie, UMR 5240, Lyon) qui a notamment particip aux constructions
gntiques.
Les diffrents plasmides sont rcapituls dans le tableau 19. Les amorces permettant le
clonage des gnes sont listes dans le tableau 19. Des sites de restriction ont t ajouts dans
les amorces (sites souligns) pour faciliter le clonage dans les vecteurs. La cassette
chloramphnicol est obtenue partir du plasmide pNFCml digr par EcoRV et la cassette
uidA-Kan est issue de la digestion de pUIDK11 par EcoRV. Lorientation de la cassette uidAKan a t dtermine par restriction.

Figure 60 : Reprsentation du locus gan dE. chrysanthemi.

1. Construction des mutants ganA


* La PCR ganA1-ganA2 contenant le gne ganA a t clon dans pBluescript (pNFW130),
linactivation de ganA a t ralise par insertion de la cassette chloramphnicol Cml au
niveau du site AfeI (pNFW140).
* La PCR ganAG-ganAD contenant le gne ganA a t clon dans pGEM-T (pI2872), la
fusion a t ralise par insertion de la cassette uidA-Kan au niveau du site EcoRV (pI2873).

2009 Tous droits rservs.

148

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Construction des mutants ganB


* La PCR ganB1-ganB2 contenant le gne ganB a t clon dans pBluescript (pNFW142),
linactivation de ganB a t ralise par insertion de la cassette chloramphnicol Cml au
niveau des sites NruI (pNFW145). Cette cassette est borne par des sites de recombinaison
(site FRT) de la FLP recombinase qui va permettre lexcision de la cassette. La FLP
recombinase est exprime partir du plasmide pCP20. Elle reconnat un site FRT, permet
lexcision de la cassette et laisse en place le site FRT. Lexcision de la cassette Cml se fait
chez E. coli et laisse un site comportant un codon stop dans les 6 phases de lecture
(Cherepanov & Wackernagel, 1995). Cela a t utilis pour obtenir la mutant ganB CmlS. En
effet, le gne ganB::Cml est ensuite sous clon dans un plasmide pOK (pNFW154) qui
permettra la conjugaison du plasmide de la cellule donatrice E. coli S17-1pir la rceptrice
E. chrysanthemi. Lexcision de la cassette chloramphnicol (pNFW162) a t obtenue pour
construire le mutant ganB CmlS.
* La PCR ganBG-ganBD contenant le gne ganB a t clon dans pGEM-T (pI2874), la
fusion a t ralise par insertion de la cassette uidA-Kan au niveau du site HpaI (pI2876).

3. Construction du mutant ganL


La PCR ganLG-ganLD contenant le gne ganL a t clon dans pGEM-T (pI2868), la fusion
a t ralise par insertion de la cassette uidA-Kan au niveau du site BamHI (pI2869).

4. Construction du mutant ganE


La PCR ganEG-ganED contenant le gne ganE a t clon dans pGEM-T (pI2866), la fusion
a t ralise par insertion de la cassette uidA-Kan au niveau du site BglI (pI2867).

5. Construction du mutant ganK


La PCR ganK1-ganK2 contenant le gne ganK a t clon dans pBluescript II SK
(+)(pNFW158), la fusion a t ralise par insertion de la cassette uidA-Kan au niveau du site
ZraI (pNFW163).

6. Construction des mutants ganR


La PCR ganRG-ganRD contenant le gne ganR a t clon dans pGEM-T (pI2870),
linactivation de ganR a t ralise par insertion de la cassette chloramphnicol Cml au
niveau du site PstI (pI3136) et de la cassette uidA-Kan au niveau du mme site.

2009 Tous droits rservs.

149

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

7. La mutation crp
La mutation crp ::Cml a t transduite par lintermdiaire du lysat de la souche A2507.

E.

Clonage molculaire : Etude du systme Rcs

Les diffrents plasmides sont rcapituls dans le tableau 18. Les amorces permettant le
clonage des gnes sont listes dans le tableau 19.

1. Clonage du locus rcsCBD

Figure 61 : Reprsentation du locus rcsCBD dE. chrysanthemi.


Afin de cloner le locus rcsCBD en entier, jai effectu une digestion dADN gnomique de la
souche EC3937. Jai digr 5g dADN par lenzyme SacI puis lenzyme XbaI. Aprs
sparation en gel dAgarose des fragments de lADNg digr et jai rcupr lADN prsent
de 6 8kb (le fragment rcsCDB est de 7kb). Jai ensuite clon les fragments SacI-XbaI dans
pUC18Not digr par SacI-XbaI. Jai slectionn sur LB+Amp+Xgal. Jai obtenu plusieurs
clones blancs dont certains prsentaient un phnotype muqueux. Jai donc analys ceux-ci par
squenage: un de clones contenait un fragment dADN comportant le gne rcsF, et deux
autres clones comportait le locus rcsCBD en entier. Jai vrifi par digestion enzymatique et
squenc les bornes de linsert pour confirmer la prsence du locus rcsCBD en entier.

2009 Tous droits rservs.

150

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Constructions des mutants (rcsC, rcsD, rcsCBD, rcsB, rcsF)


a)

Construction des mutants rcsC et rcsD

Ces mutants ont t raliss par Franck Bouchart.

Figure 62 : Reprsentation du locus rcsCBD dE. chrysanthemi avec les amorces et les sites
de restriction utiliss pour la construction des mutants rcsC et rcsD.
Afin de construire le mutant rcsC, Franck Bouchart a clon le fragment de PCR RcsC1-RcsC4
(SacI-HindIII) dans pUC18 digr par les mmes enzymes (pNFW137). Il a ensuite dlt le
fragment SmaI-PshAI et insr une cassette chloramphnicol (issue de la digestion EcoRV de
pNFCml) dans ce plasmide dlt (pNFW149). Enfin, il a sous-clon le fragment SalI-HpaI
dans le plasmide pOK digr par SalI-SmaI (pNFW161). Le plasmide a t introduit chez E.
chrysanthemi par conjugaison.
Afin de construire le mutant rcsD, Franck Bouchart a clon le fragment de PCR YojN1YojN8 (HindIII) dans pUC18 digr par HindIII (pNFW134). Il a ensuite insr une cassette
chloramphnicol (issue de la digestion EcoRV de pNFCml) dans le plasmide digr par PshAI
(pNFW135). Enfin, il a sous-clon le fragment SmaI dans le plasmide pOK digr par SmaI
(pNFW155). Le plasmide a t introduit chez E. chrysanthemi par conjugaison.

2009 Tous droits rservs.

151

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

b)

Dltion du locus rcsCBD : rcsCBD

Figure 63 : Reprsentation du locus rcsCBD dE. chrysanthemi avec les amorces pour la
dltion du locus.
Afin de dlter le locus rcsCBD, j ai clon dans pUC18Not (KpnI-HindIII), les fragments de
PCR delrcs1-2 (KpnI-SmaI) et delrcs3-4 (SmaI-HindIII) (=pNFW170= pUC18, gyrA
(rcsCB rcsD) menF). Une cassette chloramphnicol (Cml) a t introduite au niveau du site
SmaI de pNFW170. Ce plasmide (pNFW173) a t lectropor dans EC3937.

c)

Construction du mutant rcsB

Figure 64 : Reprsentation du locus rcsCBD dE. chrysanthemi et du site de restriction


HpaI permettant linsertion de la cassette pour la construction du mutant rcsB.
Afin de construire le mutant rcsB, jai insr une cassette chloramphnicol au niveau du site
HpaI de pNFW257 (pUC18Not rcsCBD). Jai ensuite lectropor la construction (pNFW230)
dans EC3937.

2009 Tous droits rservs.

152

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

d)

Construction du mutant rcsF

Figure 65 : Reprsentation du gne rcsF dE. chrysanthemi et du site de restriction AgeI


permettant linsertion de la cassette pour la construction du mutant rcsF.
Afin de construire le mutant rcsF, jai clon le fragment de PCR rcsF1-rcsF2 (BamHI-PvuII)
dans pBSK digr par BamHI et EcoRV (pNFW183). Jai ensuite insr une cassette
chloramphnicol au niveau du site AgeI de pNFW183. Enfin, jai lectropor la construction
dans EC3937.

3. Construction des fusions transcriptionnelles


Pour la construction des fusions uidA, la cassette uidA-Kan provenant du plasmide pUIDK11
a t utilise (Bardonnet & Blanco, 1992). Pour chaque construction, ltape de linsertion de
la cassette a t effectue dans la souche BW25141 afin de cribler des souches ayant une
activit glucuronidase (BW25141 en tant dpourvue).

a)

Construction de la fusion ftsA-uidA

Figure 66 : Reprsentation de lopron ftsQA dE. chrysanthemi et les amorces


permettant la construction de la fusion ftsA-uidA.
Afin de construire la fusion ftsA-uidA, jai clon le fragment de PCR ftsA1-ftsA2 (BamHI et
SacI) dans pUC18Not digr par BamHI et SacI (pNFW182). Jai ensuite insr une cassette

2009 Tous droits rservs.

153

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

uidA-Kan (issue de la digestion par SmaI du plasmide pUIDK11) au niveau du site NgoMIV
rendu bout franc de pNFW182 (pNFW193). La cassette Kan a t enleve par digestion
NcoI+HpaI), le plasmide a t rendu bout franc et referm (pNFW201). Le fragment NotI
comprenant la fusion ftsA-uidA a t sous-clon dans le pUTminiTn5Kan (pNFW220). Le
miniTn5 est introduit dans les souches dE. chrysanthemi par conjugaison.

b)

Construction de la fusion flhD-uidA

Figure 67 : Reprsentation de lopron flhDC dE. chrysanthemi et les amorces


permettant la construction de la fusion flhD-uidA.
Afin de construire la fusion flhD-uidA, jai clon le fragment de PCR flhD1-flhD2 (BamHI et
SacI) dans pUC18Not digr par BamHI et SacI (pNFW181). Jai ensuite insr une cassette
uidA-Kan (issue de la digestion par SacI du plasmide pUIDK11) au niveau du site SacI de
pNFW181 (pNFW203). La cassette Kan a t enleve par digestion NcoI+HpaI, le plasmide a
t rendu bout franc et referm (pNFW204). Le fragment NotI comprenant la fusion flhDuidA a t sous-clon dans le pUTminiTn5Kan (pNFW215). Le miniTn5 est introduit dans les
souches dE. chrysanthemi par conjugaison.

c)

Construction de la fusion cpsB-uidA

Afin de construire la fusion cpsB-uidA, jai clon le fragment de PCR cpsB1-cpsB2 (DraI et
EcoRI) dans pUC18Not digr par SmaI et EcoRI (pNFW205). Jai ensuite insr une
cassette uidA-Kan (issue de la digestion par EcoRI du plasmide pUIDK11) au niveau du site
EcoRI de pNFW205 (pNFW206). La cassette Kan a t enleve par digestion NcoI+HpaI, le
plasmide a t rendu bout franc et referm (pNFW207). Le fragment NotI comprenant la
fusion flhD-uidA a t sous-clon dans le pUTminiTn5Kan (pNFW262). Le miniTn5 est
introduit dans les souches dE. chrysanthemi par conjugaison.

2009 Tous droits rservs.

154

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Figure 68 : Reprsentation de lopron cpsBG dE. chrysanthemi et les amorces permettant la


construction de la fusion cpsB-uidA.

4. Clonage de TAT-rcsF, djlA, igaA


a)

Clonage de TAT-rcsF

Le fragment de PCR rcsFTAT1-rcsFTAT2 digr par EcoRI SacI a t clon dans pXfD11
digr par les mmes enzymes. La souche contenant ce plasmide (pNFW176) prsente un
phnotype muqueux. Cette construction a t ralise par Carmen dberg-Ferragut . La
construction permet de remplacer le gne blaM du plasmide pXfD11 par le gne rcsF
(dpourvu de la partie permettant lancrage de la lipoprotine).

Figure 69 : Reprsentation de la construction TAT-rcsF dE. chrysanthemi, les amorces


permettant la construction du plasmide (pNFW176) les amorces permettant la
construction des mutations : C75S, C110S, C119S et C125S.
Jai sous-clon le fragment EcoRI-MLuI de ce plasmide pNFW176 dans pUC18Not digr
par SmaI (pNFW177). Le fragment NotI (comprenant TAT-rcsF) a t sous-clon dans le
pUTminiTn5Tet digr par NotI (pNFW271). Toutes ces souches prsentent galement un
phnotype muqueux.
Le miniTn5 est introduit dans les souches dE. chrysanthemi par conjugaison.

2009 Tous droits rservs.

155

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

b)

Clonage de djlA

Figure 70 : Reprsentation du gne djlA dE. chrysanthemi et les amorces permettant le


clonage du gne.
Jai clon le fragment de PCR djlA1-djlA2 (XmaI et SacI) dans pUC18Not digr par les
mmes enzymes (pNFW258). Cette souche prsente un phnotype muqueux chez E. coli.
Le fragment PvuII comprenant le gne djlA a t sous-clon dans le pUTminiTn5Sp digr
par NotI et rendu bout franc (pNFW289). Le miniTn5 est introduit dans les souches dE.
chrysanthemi par conjugaison.

c)

Clonage de igaA

Figure 71 : Reprsentation du gne igaA dE. chrysanthemi et les amorces permettant le


clonage du gne.
Jai clon le fragment de PCR igaA1-igaA2 (XmaI et SacI) dans pUC18Not digr par les
mmes enzymes (pNFW259).
Le fragment NotI comprenant le gne igaA a t sous-clon dans le pUTminiTn5Tet digr
par NotI (pNFW265). Le miniTn5 est introduit dans les souches dE. chrysanthemi par
conjugaison.

2009 Tous droits rservs.

156

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

5. Les mutations dans TAT-rcsF


Carmen dberg-Ferragut a ralis par mutagense dirige lensemble des dltions du
domaine priplasmique de RcsF du ct N-terminal et du ct C-terminal. Jai quant moi
particip la ralisation des mutations des cystines par lutilisation damorces de PCR
mutes (figure 69).

a)

Mutant TAT-rcsF C75S

Nous avons clon les fragments de PCR1 (RcsFXhoC75SR-rcsfTat1 digr par SacI et XhoI)
et PCR2 (RcsFXhoC75SF -pYZ4-R digr par XhoI et pvuII) dans pNFW176 digr par SacI
et pvuII (pNFW247).

b)

Mutant TAT-rcsF C110S

Nous avons clon les fragments de PCR1 (RcsFC110SR-rcsfTat1 digr par SacI et RsaI) et
PCR2 (RcsFC110SF-pYZ4-R digr par RsaI et EcoRI) dans pNFW176 digr par SacI et
EcoRI (pNFW246).

c)

Mutant TAT-rcsF C119S

Nous avons clon les fragments de PCR1 (RcsFBamC119SR-rcsfTat1 digr par SacI et
BamHI) et PCR2 (RcsFBamC119SF -pYZ4-R digr par BamHI et pvuII) dans pNFW176
digr par SacI et pvuII (pNFW247).

d)

Mutant TAT-rcsF C125S

Nous avons clon le fragment de PCR (RcsFC125SR-rcsfTat1 digr par SacI et EcoRI) dans
pNFW176 digr par SacI et EcoRI (pNFW269).

F.

Techniques de biochimie

1. Dosage des protines


Le dosage des protines est ralis par la mthode de Bradford (1976) (Bio-Rad protein
assay) avec une solution de srum-albumine bovine comme rfrence.

2009 Tous droits rservs.

157

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

2. Dosage des activits -galactosidase, -glucuronidase et


-glucuronidase
Les dosages sont raliss sur des cultures en phase exponentielle de croissance (environ
7.108 bactries/mL de culture soit une DO de 0,7). Les cellules sont centrifuges(50mL
7000g, 10min, 4C) et reprises dans 10 mL de milieu 63. Les cellules sont ensuite casses la
presse de French 1,4 107 Pascal. Puis lextrait est centrifug (7000g, 10min, 4C) pour
liminer les dbris cellulaires. Les dosages ont t raliss 3 fois sur des extraits
indpendants. Certains dosages sont effectus sur des cultures de 5mL, les cellules tant
permabilises par lajout de 0,1 mL de SDS 0,1% et 0,1mL de chloroforme.
* Lactivit -galactosidase est mesure par hydrolyse de lortho-nitrophnyl--D-galactoside
(OPNG, 4mg/mL), dans du tampon Z + -mercapto-thanol (2,7 mL/L), temprature
ambiante, en suivant laugmentation de labsorbance 410 nm (Miller). La raction se fait
avec 200L de substrat, 200L dchantillon et 600L de tampon Z + -mercapto-thanol
(2,7mL/L).
* Lactivit -glucuronidase est mesure dans du milieu minimum 63+ -mercapto-thanol
(2,7mL/l), temprature ambiante, par hydrolyse du 4-nitrophnyl--D-glucuronide (PNPU,
4mg/mL). La raction se fait avec 100L de substrat, 200L dchantillon et 700L de milieu
minimum 63 + -mercapto-thanol (2,7 mL/L) (Bardonnet & Blanco, 1992).
* Lactivit -galactanase est mesure par hydrolyse de lAZO-galactan (MEGAZYME). La
raction se fait avec 200L de substrat 5g/L et 200L dchantillon. Elle seffectue dans du
milieu 63+ -mercapto-thanol (2,7mL/L), 50C pendant 15 min. Une fois la raction
termine, les polymres de haut poids molculaire sont prcipits par laddition de 1mL
dthanol 95% et agits au vortex pendant 10s. Aprs 10min dincubation temprature
ambiante, les tubes sont centrifugs 1000g pendant 10min et labsorbance du surnageant est
mesure 590nm.

3. Test phnotypiques
galactanase

pectinase,

cellulase,

protase

et

* Le test galactanase se ralise sur boite de milieu minimum 63 solide contenant une source
de carbone. LAZCL-galactan (MEGAZYME) est dpos en surcouche (3 mL de F-top
contenant 2g/L dAZCL-galactan). Cest un substrat insoluble compos doligogalactanes
sur lesquels est greff un groupement chromogne bleu. Une coupure endoglycolytique,

2009 Tous droits rservs.

158

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

spcifique lactivit endo-1,4--galactanase, libre un oligogalactane soluble provoquant un


halo bleu autour de la colonie d la libration le chromogne.
* Le test pectinase se ralise sur boite de milieu minimum 63 solide contenant du
polygalacturonate PGA (4g/L) et du glycrol (2g/L) comme deuxime source de carbone si
ncessaire. Aprs 24 h de croissance 30C, le milieu est recouvert par une solution aqueuse
dactate de cuivre (100g/L) qui forme un complexe avec le PGA. Un halo translucide sur
fond bleu correspondant la zone de dgradation du PGA apparat alors autour des colonies
secrtant des pectinases.
* Le test cellulase (Teather et Wood, 1982) se ralise sur boite de milieu minimum 63 solide
contenant de la carboxymthylcellulose (0,2%), du glycrol (0,2%) et du MgSO4 (7mM).
Aprs 24 h de croissance 30C, le milieu est recouvert pendant 15 min par une solution
aqueuse de rouge congo (1g/L) qui se fixe la carboxymthylcellulose. Lexcs de colorant
est limin par plusieurs lavages par du NaCl 1M durant 5 10 min. Les souches secrtant
des cellulases sont entoures dun halo translucide jaune sur fond rouge, d lhydrolyse de
la cellulose du milieu.
* Le test protase se ralise sur boite de milieu LB solide contenant 1% de lait crm en
poudre. Aprs 24 h dincubation 30C, les souches scrtrices de protase sont dtectables
par la prsence dun halo transparent sur fond trouble autour des colonies, d lhydrolyse
des protines du lait.

G. Test de virulence
Les bactries sont cultives une nuit en milieu LB ou 63 additionn de glycrol comme
source de carbone, centrifuges puis ressuspendues dans du milieu 63. Les tubercules de
pomme de terre sont lavs, striliss en surface par du NaOCl 0,5%, rincs leau strile puis
schs par ventilation. Linoculation est ralise avec 106 et 107 bactries dans un volume de 5
L dans un trou creus laide dun cne de micropipette strile. Les tubercules sont incubs
30C pendant 48 72h en atmosphre humide. Les feuilles dendives sont laves leau
strile puis scarifies au scalpel. Linoculation est ralise au niveau de lincision avec 107
bactries dans un volume de 5 L, les feuilles sont incubes 30C pendant 24 48 h.

2009 Tous droits rservs.

159

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Rfrences

2009 Tous droits rservs.

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

. Rfrences
Aizawa, S. I. and Kubori, T. 1998. Bacterial flagellation and cell division., Genes Cells
(3:10), pp. 625-634.
Altabe, S. G., de Iannino, N. I., de Mendoza, D. and Ugalde, R. A. 1994. New
osmoregulated beta(1-3),beta(1-6) glucosyltransferase(s) in Azospirillum brasilense., J
Bacteriol (176:16), pp. 4890-4898.
Andresen, L., Kiv, V., Alame, T. and Me, A. 2007. The Rcs phosphorelay modulates the
expression of plant cell wall degrading enzymes and virulence in Pectobacterium
carotovorum ssp. carotovorum., FEMS Microbiol Lett (273:2), pp. 229-238.
Arellano-Reynoso, B., Lapaque, N., Salcedo, S., Briones, G., Ciocchini, A. E., Ugalde, R.,
Moreno, E., Moriyn, I. and Gorvel, J. 2005. Cyclic beta-1,2-glucan is a Brucella virulence
factor required for intracellular survival., Nat Immunol (6:6), pp. 618-625.
Babujee, L., Venkatesh, B., Yamazaki, A. and Tsuyumu, S. 2007. Proteomic analysis of
the carbonate insoluble outer membrane fraction of the soft-rot pathogen Dickeya dadantii
(syn. Erwinia chrysanthemi) strain 3937., J Proteome Res (6:1), pp. 62-69.
Banta, L. M., Bohne, J., Lovejoy, S. D. and Dostal, K. 1998. Stability of the Agrobacterium
tumefaciens VirB10 protein is modulated by growth temperature and periplasmic
osmoadaption., J Bacteriol (180:24), pp. 6597-6606.
Bardonnet, N. and Blanco, C. 1992. 'uidA-antibiotic-resistance cassettes for insertion
mutagenesis, gene fusions and genetic constructions., FEMS Microbiol Lett (72:3), pp. 243247.
Beier, D. and Gross, R. 2006. Regulation of bacterial virulence by two-component systems.,
Curr Opin Microbiol (9:2), pp. 143-152.
Bereswill, S. and Geider, K. 1997. Characterization of the rcsB gene from Erwinia
amylovora and its influence on exoploysaccharide synthesis and virulence of the fire blight
pathogen., J Bacteriol (179:4), pp. 1354-1361.
Birnboim, H. C. and Doly, J. 1979. A rapid alkaline extraction procedure for screening
recombinant plasmid DNA., Nucleic Acids Res (7:6), pp. 1513-1523.
Blot, N., Berrier, C., Hugouvieux-Cotte-Pattat, N., Ghazi, A. and Condemine, G. 2002.
The oligogalacturonate-specific porin KdgM of Erwinia chrysanthemi belongs to a new porin
family., J Biol Chem (277:10), pp. 7936-7944.
Boccara, M., Aymeric, J. L. and Camus, C. 1994. Role of endoglucanases in Erwinia
chrysanthemi 3937 virulence on Saintpaulia ionantha., J Bacteriol (176:5), pp. 1524-1526.

2009 Tous droits rservs.

160

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Bohin, A., Bouchart, F., Richet, C., Kol, O., Leroy, Y., Timmerman, P., Huet, G., Bohin,
J. and Zanetta, J. 2005. GC/MS identification and quantification of constituents of bacterial
lipids and glycoconjugates obtained after methanolysis as heptafluorobutyrate derivatives.,
Anal Biochem (340:2), pp. 231-244.
Bohin, J. P. 2000. Osmoregulated periplasmic glucans in Proteobacteria., FEMS Microbiol
Lett (186:1), pp. 11-19.
Bohin JP and Lacroix JM. 2007. Osmoregulation in the periplasm. In The Periplasm, pp
325-341. Edited by M. Ehrmann. Washington, DC: American Society for Microbiology.
Boom, T. V. and Cronan, J. E. 1989. Genetics and regulation of bacterial lipid metabolism.,
Annu Rev Microbiol (43), pp. 317-343.
Bouchart, F., Delangle, A., Lemoine, J., Bohin, J. and Lacroix, J. 2007. Proteomic
analysis of a non-virulent mutant of the phytopathogenic bacterium Erwinia chrysanthemi
deficient in osmoregulated periplasmic glucans: change in protein expression is not restricted
to the envelope, but affects general metabolism., Microbiology (153:Pt 3), pp. 760-767.
Bouchart F. 2006. Impact des mutations opg chez Erwinia chrysanthemi : recherche de
suppresseurs et analyse protomique des mutants. Thse de Doctorat, Universit des Sciences
et Technologies de Lille.
Bourson, C., Favey, S., Reverchon, S. and Robert-Baudouy, J. 1993. Regulation of the
expression of a pelA::uidA fusion in Erwinia chrysanthemi and demonstration of the
synergistic action of plant extract with polygalacturonate on pectate lyase synthesis., J Gen
Microbiol (139:1), pp. 1-9.
Bradford, M. M. 1976. A rapid and sensitive method for the quantitation of microgram
quantities of protein utilizing the principle of protein-dye binding., Anal Biochem (72), pp.
248-254.
Braithwaite, K. L., Barna, T., Spurway, T. D., Charnock, S. J., Black, G. W., Hughes,
N., Lakey, J. H., Virden, R., Hazlewood, G. P., Henrissat, B. and Gilbert, H. J. 1997.
Evidence that galactanase A from Pseudomonas fluorescens subspecies cellulosa is a
retaining family 53 glycosyl hydrolase in which E161 and E270 are the catalytic residues.,
Biochemistry (36:49), pp. 15489-15500.
Breedveld, M. W. and Miller, K. J. 1994. Cyclic beta-glucans of members of the family
Rhizobiaceae., Microbiol Rev (58:2), pp. 145-161.
Briones, G., de Iannino, N. I., Steinberg, M. and Ugalde, R. A. 1997. Periplasmic cyclic
1,2-beta-glucan in Brucella spp. is not osmoregulated., Microbiology (143 ( Pt 4)), pp. 11151124.
Burse, A., Weingart, H. and Ullrich, M. S. 2004. The phytoalexin-inducible multidrug
efflux pump AcrAB contributes to virulence in the fire blight pathogen, Erwinia amylovora .,
Mol Plant Microbe Interact (17:1), pp. 43-54.

2009 Tous droits rservs.

161

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Cai, S. and Inouye, M. 2003. Spontaneous subunit exchange and biochemical evidence for
trans-autophosphorylation in a dimer of Escherichia coli histidine kinase (EnvZ)., J Mol Biol
(329:3), pp. 495-503.
Cano, D. A., Domnguez-Bernal, G., Tierrez, A., Portillo, F. G. and Casadess, J. 2002.
Regulation of capsule synthesis and cell motility in Salmonella enterica by the essential gene
igaA., Genetics (162:4), pp. 1513-1523.
Carballs, F., Bertrand, C., Bouch, J. P. and Cam, K. 1999. Regulation of Escherichia
coli cell division genes ftsA and ftsZ by the two-component system rcsC-rcsB., Mol Microbiol
(34:3), pp. 442-450.
Castani-Cornet, M., Treffandier, H., Francez-Charlot, A., Gutierrez, C. and Cam, K.
2007. The glutamate-dependent acid resistance system in Escherichia coli: essential and dual
role of the His-Asp phosphorelay RcsCDB/AF., Microbiology (153:Pt 1), pp. 238-246.
Cherepanov, P. P. and Wackernagel, W. 1995. Gene disruption in Escherichia coli: TcR
and KmR cassettes with the option of Flp-catalyzed excision of the antibiotic-resistance
determinant., Gene (158:1), pp. 9-14.
Chevance, F. F. V. and Hughes, K. T. 2008. Coordinating assembly of a bacterial
macromolecular machine., Nat Rev Microbiol (6:6), pp. 455-465.
Choma, A. and Komaniecka, I. 2003. Characterisation of Mesorhizobium huakuii cyclic
beta-glucan., Acta Biochim Pol (50:4), pp. 1273-1281.
Clarke, D. J., Holland, I. B. and Jacq, A. 1997. Point mutations in the transmembrane
domain of DjlA, a membrane-linked DnaJ-like protein, abolish its function in promoting
colanic acid production via the Rcs signal transduction pathway., Mol Microbiol (25:5), pp.
933-944.
Clavel, T., Lazzaroni, J. C., Vianney, A. and Portalier, R. 1996. Expression of the tolQRA
genes of Escherichia coli K-12 is controlled by the RcsC sensor protein involved in capsule
synthesis., Mol Microbiol (19:1), pp. 19-25.
Cogez, V., Gak, E., Puskas, A., Kaplan, S. and Bohin, J. 2002. The opgGIH and opgC
genes of Rhodobacter sphaeroides form an operon that controls backbone synthesis and
succinylation of osmoregulated periplasmic glucans., Eur J Biochem (269:10), pp. 2473-2484.
Cogez, V., Talaga, P., Lemoine, J. and Bohin, J. P. 2001. Osmoregulated periplasmic
glucans of Erwinia chrysanthemi., J Bacteriol (183:10), pp. 3127-3133.
Collmer, A. and Bateman, D. F. 1981. Impaired induction and self-catabolite repression of
extracellular pectate lyase in Erwinia chrysanthemi mutants deficient in oligogalacturonide
lyase., Proc Natl Acad Sci U S A (78:6), pp. 3920-3924.
Collmer A and Keen NT. 1986. The role of pectic enzymes in plant pathogenesis. Annu Rev
Phytopathol. 24:383-409.

2009 Tous droits rservs.

162

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Condemine, G., & Robert-Baudouy, J. 1995. Synthesis and secretion of Erwinia


chrysanthemi virulence factors are coregulated. Mol. Plant. Microbe. Interact. 8: 632-636.
Condemine, G., Castillo, A., Passeri, F. and Enard, C. 1999. The PecT repressor
coregulates synthesis of exopolysaccharides and virulence factors in Erwinia chrysanthemi.,
Mol Plant Microbe Interact (12:1), pp. 45-52.
Cui, Y., Chatterjee, A., Yang, H. and Chatterjee, A. K. 2008. Regulatory network
controlling extracellular proteins in Erwinia carotovora subsp. carotovora: FlhDC, the master
regulator of flagellar genes, activates rsmB regulatory RNA production by affecting gacA and
hexA (lrhA) expression., J Bacteriol (190:13), pp. 4610-4623.
Dartigalongue, C., Missiakas, D. and Raina, S. 2001. Characterization of the Escherichia
coli sigma E regulon., J Biol Chem (276:24), pp. 20866-20875.
Datsenko, K. A. and Wanner, B. L. 2000. One-step inactivation of chromosomal genes in
Escherichia coli K-12 using PCR products., Proc Natl Acad Sci U S A (97:12), pp. 66406645.
Davalos-Garcia, M., Conter, A., Toesca, I., Gutierrez, C. and Cam, K. 2001. Regulation
of osmC gene expression by the two-component system rcsB-rcsC in Escherichia coli., J
Bacteriol (183:20), pp. 5870-5876.
Davis, R. W., D. Botstein, and J. R. Roth. 1980. A manual for genetic engineering.
Advanced bacterial genetics. Cold Spring Harbor Laboratory, Cold Spring Harbor, New York.
Debarbieux, L., Bohin, A. and Bohin, J. P. 1997. Topological analysis of the membranebound glucosyltransferase, MdoH, required for osmoregulated periplasmic glucan synthesis in
Escherichia coli., J Bacteriol (179:21), pp. 6692-6698.
Delangle, A., Prouvost, A., Cogez, V., Bohin, J., Lacroix, J. and Cotte-Pattat, N. H. 2007.
Characterization of the Erwinia chrysanthemi Gan locus, involved in galactan catabolism., J
Bacteriol (189:19), pp. 7053-7061.
Delangle A. 2007. Contribution lanalyse du pouvoir pathogne dErwinia chrysanthemi.
Thse de Doctorat, Universit des Sciences et Technologies de Lille.
Delepelaire, P. and Wandersman, C. 1991. Characterization, localization and
transmembrane organization of the three proteins PrtD, PrtE and PrtF necessary for protease
secretion by the gram-negative bacterium Erwinia chrysanthemi., Mol Microbiol (5:10), pp.
2427-2434.
Ebel, W., Vaughn, G. J., Peters, H. K. and Trempy, J. E. 1997. Inactivation of mdoH leads
to increased expression of colanic acid capsular polysaccharide in Escherichia coli., J
Bacteriol (179:21), pp. 6858-6861.
Enard, C., Diolez, A. and Expert, D. 1988. Systemic virulence of Erwinia chrysanthemi
3937 requires a functional iron assimilation system., J Bacteriol (170:6), pp. 2419-2426.

2009 Tous droits rservs.

163

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Eriksson, A. R., Andersson, R. A., Pirhonen, M. and Palva, E. T. 1998. Two-component


regulators involved in the global control of virulence in Erwinia carotovora subsp.
carotovora., Mol Plant Microbe Interact (11:8), pp. 743-752.
Fiedler, W. and Rotering, H. 1988. Properties of Escherichia coli mutants lacking
membrane-derived oligosaccharides., J Biol Chem (263:29), pp. 14684-14689.
Filloux, A., Hachani, A. and Bleves, S. 2008. The bacterial type VI secretion machine: yet
another player for protein transport across membranes., Microbiology (154:Pt 6), pp. 15701583.
Flego, D., Marits, R., Eriksson, A. R., Kiv, V., Karlsson, M. B., Heikinheimo, R. and
Palva, E. T. 2000. A two-component regulatory system, pehR-pehS, controls
endopolygalacturonase production and virulence in the plant pathogen Erwinia carotovora
subsp. carotovora., Mol Plant Microbe Interact (13:4), pp. 447-455.
Francez-Charlot, A., Laugel, B., Gemert, A. V., Dubarry, N., Wiorowski, F., CastaniCornet, M., Gutierrez, C. and Cam, K. 2003. RcsCDB His-Asp phosphorelay system
negatively regulates the flhDC operon in Escherichia coli., Mol Microbiol (49:3), pp. 823832.
Fredericks, C. E., Shibata, S., Aizawa, S., Reimann, S. A. and Wolfe, A. J. 2006. Acetyl
phosphate-sensitive regulation of flagellar biogenesis and capsular biosynthesis depends on
the Rcs phosphorelay., Mol Microbiol (61:3), pp. 734-747.
Garca-Caldern, C. B., Garca-Quintanilla, M., Casadess, J. and Ramos-Morales, F.
2005. Virulence attenuation in Salmonella enterica rcsC mutants with constitutive activation
of the Rcs system., Microbiology (151:Pt 2), pp. 579-588.
Gelfand MS and Laikova ON. 2003. Prolegomena to the evolution of transcriptional
regulation in bacterial genomes. In E. V. Kooning, and M. Y. Galperin (ed.), Frontiers in
computational Genomics. Wymondham, Caister Academic Press. p195-216.
Gijsegem, F. V., Genin, S. and Boucher, C. 1993. Conservation of secretion pathways for
pathogenicity determinants of plant and animal bacteria., Trends Microbiol (1:5), pp. 175180.
van Golde, L. M. 1973. Metabolism of membrane phospholipids and its relation to a novel
class of oligosaccharides in Escherichia coli., Proc Natl Acad Sci U S A (70:5), pp. 13681372.
Gottesman, S., Trisler, P. and Torres-Cabassa, A. 1985. Regulation of capsular
polysaccharide synthesis in Escherichia coli K-12: characterization of three regulatory genes.,
J Bacteriol (162:3), pp. 1111-1119.
Guzman, L. M., Belin, D., Carson, M. J. and Beckwith, J. 1995. Tight regulation,
modulation, and high-level expression by vectors containing the arabinose PBAD promoter., J
Bacteriol (177:14), pp. 4121-4130.

2009 Tous droits rservs.

164

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Hall, M. N. and Silhavy, T. J. 1981. The ompB locus and the regulation of the major outer
membrane porin proteins of Escherichia coli K12., J Mol Biol (146:1), pp. 23-43.
Hanahan, D. 1983. Studies on transformation of Escherichia coli with plasmids., J Mol Biol
(166:4), pp. 557-580.
Hassouni, M. E., Chambost, J. P., Expert, D., Gijsegem, F. V. and Barras, F. 1999. The
minimal gene set member msrA, encoding peptide methionine sulfoxide reductase, is a
virulence determinant of the plant pathogen Erwinia chrysanthemi., Proc Natl Acad Sci U S A
(96:3), pp. 887-892.
Hauben, L., Moore, E. R., Vauterin, L., Steenackers, M., Mergaert, J., Verdonck, L. and
Swings, J. 1998. Phylogenetic position of phytopathogens within the Enterobacteriaceae.,
Syst Appl Microbiol (21:3), pp. 384-397.
Hayden, J. D. and Ades, S. E. 2008. The extracytoplasmic stress factor, sigmaE, is required
to maintain cell envelope integrity in Escherichia coli., PLoS ONE (3:2), pp. e1573.
Hinchliffe, S. J., Howard, S. L., Huang, Y. H., Clarke, D. J. and Wren, B. W. 2008. The
importance of the Rcs phosphorelay in the survival and pathogenesis of the enteropathogenic
yersiniae., Microbiology (154:Pt 4), pp. 1117-1131.
Hinz, S. W. A., Pastink, M. I., van den Broek, L. A. M., Vincken, J. and Voragen, A. G.
J. 2005. Bifidobacterium longum endogalactanase liberates galactotriose from type I
galactans., Appl Environ Microbiol (71:9), pp. 5501-5510.
Hobot, J. A., Carlemalm, E., Villiger, W. and Kellenberger, E. 1984. Periplasmic gel: new
concept resulting from the reinvestigation of bacterial cell envelope ultrastructure by new
methods., J Bacteriol (160:1), pp. 143-152.
Hugouvieux-Cotte-Pattat, N., Condemine, G., Nasser, W. and Reverchon, S. 1996.
Regulation of pectinolysis in Erwinia chrysanthemi., Annu Rev Microbiol (50), pp. 213-257.
Hugouvieux-Cotte-Pattat, N., Dominguez, H. and Robert-Baudouy, J. 1992.
Environmental conditions affect transcription of the pectinase genes of Erwinia chrysanthemi
3937., J Bacteriol (174:23), pp. 7807-7818.
Hugouvieux-Cotte-Pattat, N. and Reverchon, S. 2001. Two transporters, TogT and
TogMNAB, are responsible for oligogalacturonide uptake in Erwinia chrysanthemi 3937.,
Mol Microbiol (41:5), pp. 1125-1132.
Hugouvieux-Cotte-Pattat, N. and Robert-Baudouy, J. 1985. Lactose metabolism in
Erwinia chrysanthemi., J Bacteriol (162:1), pp. 248-255.
Huguet, E., Hahn, K., Wengelnik, K. and Bonas, U. 1998. hpaA mutants of Xanthomonas
campestris pv. vesicatoria are affected in pathogenicity but retain the ability to induce hostspecific hypersensitive reaction., Mol Microbiol (29:6), pp. 1379-1390.
Hwang J, Pyun YR and Kokini JL. 1993. Sidechains of pectins: some thoughts on their role
in plant cell walls and foods. Food Hydrocolloids 7: 39-53.

2009 Tous droits rservs.

165

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Hyytiinen, H., Sjblom, S., Palomki, T., Tuikkala, A. and Palva, E. T. 2003. The
PmrA-PmrB two-component system responding to acidic pH and iron controls virulence in
the plant pathogen Erwinia carotovora ssp. carotovora., Mol Microbiol (50:3), pp. 795-807.
Igoshin, O. A., Alves, R. and Savageau, M. A. 2008. Hysteretic and graded responses in
bacterial two-component signal transduction., Mol Microbiol (68:5), pp. 1196-1215.
Kadner, R. J. 1996. Cytoplasmic Membrane in Escherichia coli and Salmonella
typhimurium. Cellular and molecular biology. Neidhardt F. C. (Ed in chief) 2nd ed.
Washington DC: American Society for Microbiology. pp: 58-87.
Kadokura, H., Tian, H., Zander, T., Bardwell, J. C. A. and Beckwith, J. 2004. Snapshots
of DsbA in action: detection of proteins in the process of oxidative folding., Science
(303:5657), pp. 534-537.
Kastowsky, M., Gutberlet, T. and Bradaczek, H. 1992. Molecular modelling of the threedimensional structure and conformational flexibility of bacterial lipopolysaccharide., J
Bacteriol (174:14), pp. 4798-4806.
Kennedy, E. P. 1982. Osmotic regulation and the biosynthesis of membrane-derived
oligosaccharides in Escherichia coli., Proc Natl Acad Sci U S A (79:4), pp. 1092-1095.
Kennedy, E. P. 1996. Membrane derivated oligosaccharides (periplasmic beta-D-glucans) of
Escherichia coli, p. 1064-1074. In F. C. Neidhardt, R. Curtiss III, J. L. Ingraham, E. C. C.
Lin, K. B. Low, B. Maganasik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E.
Umbarger (ed.), Escherichia coli and Salmonella. Cellular and Molecular Biology, 2nd ed.,
ASM Press, Washington, D. C.
Komaniecka, I. and Choma, A. 2003. Isolation and characterization of periplasmic cyclic
beta-glucans of Azorhizobium caulinodans., FEMS Microbiol Lett (227:2), pp. 263-269.
Lacroix, J. M., Lanfroy, E., Cogez, V., Lequette, Y., Bohin, A. and Bohin, J. P. 1999. The
mdoC gene of Escherichia coli encodes a membrane protein that is required for succinylation
of osmoregulated periplasmic glucans., J Bacteriol (181:12), pp. 3626-3631.
Lacroix, J. M., Loubens, I., Tempte, M., Menichi, B. and Bohin, J. P. 1991. The mdoA
locus of Escherichia coli consists of an operon under osmotic control., Mol Microbiol (5:7),
pp. 1745-1753.
Lazan, H., Ng, S., Goh, L. and Ali, Z. M. 2004. Papaya beta-galactosidase/galactanase
isoforms in differential cell wall hydrolysis and fruit softening during ripening., Plant Physiol
Biochem (42:11), pp. 847-853.
Lebeau, A., Reverchon, S., Gaubert, S., Kraepiel, Y., Simond-Cte, E., Nasser, W. and
Gijsegem, F. V. 2008. The GacA global regulator is required for the appropriate expression
of Erwinia chrysanthemi 3937 pathogenicity genes during plant infection., Environ Microbiol
(10:3), pp. 545-559.

2009 Tous droits rservs.

166

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Lehtimki, S., Rantakari, A., Routtu, J., Tuikkala, A., Li, J., Virtaharju, O., Palva, E.
T., Romantschuk, M. and Saarilahti, H. T. 2003. Characterization of the hrp pathogenicity
cluster of Erwinia carotovora subsp. carotovora: high basal level expression in a mutant is
associated with reduced virulence., Mol Genet Genomics (270:3), pp. 263-272.
Lequette, Y., Lanfroy, E., Cogez, V., Bohin, J. and Lacroix, J. 2008. Biosynthesis of
osmoregulated periplasmic glucans in Escherichia coli: the membrane-bound and the soluble
periplasmic phosphoglycerol transferases are encoded by the same gene., Microbiology
(154:Pt 2), pp. 476-483.
Lequette, Y., Odberg-Ferragut, C., Bohin, J. and Lacroix, J. 2004. Identification of
mdoD, an mdoG paralog which encodes a twin-arginine-dependent periplasmic protein that
controls osmoregulated periplasmic glucan backbone structures., J Bacteriol (186:12), pp.
3695-3702.
Lequette, Y., Rollet, E., Delangle, A., Greenberg, E. P. and Bohin, J. 2007. Linear
osmoregulated periplasmic glucans are encoded by the opgGH locus of Pseudomonas
aeruginosa., Microbiology (153:Pt 10), pp. 3255-3263.
Liao, C. H., Revear, L., Hotchkiss, A. and Savary, B. 1999. Genetic and biochemical
characterization of an exopolygalacturonase and a pectate lyase from Yersinia enterocolitica.,
Can J Microbiol (45:5), pp. 396-403.
Llama-Palacios, A., Lpez-Solanilla, E., Poza-Carrin, C., Garca-Olmedo, F. and
Rodrguez-Palenzuela, P. 2003. The Erwinia chrysanthemi phoP-phoQ operon plays an
important role in growth at low pH, virulence and bacterial survival in plant tissue., Mol
Microbiol (49:2), pp. 347-357.
de Lorenzo, V., Herrero, M., Jakubzik, U. and Timmis, K. N. 1990. Mini-Tn5 transposon
derivatives for insertion mutagenesis, promoter probing, and chromosomal insertion of cloned
DNA in gram-negative eubacteria., J Bacteriol (172:11), pp. 6568-6572.
de Lorenzo, V. and Timmis, K. N. 1994. Analysis and construction of stable phenotypes in
gram-negative bacteria with Tn5- and Tn10-derived minitransposons., Methods Enzymol
(235), pp. 386-405.
Loubens, I., Debarbieux, L., Bohin, A., Lacroix, J. M. and Bohin, J. P. 1993. Homology
between a genetic locus (mdoA) involved in the osmoregulated biosynthesis of periplasmic
glucans in Escherichia coli and a genetic locus (hrpM) controlling pathogenicity of
Pseudomonas syringae., Mol Microbiol (10:2), pp. 329-340.
Mahajan-Miklos, S., Tan, M. W., Rahme, L. G. and Ausubel, F. M. 1999. Molecular
mechanisms of bacterial virulence elucidated using a Pseudomonas aeruginosaCaenorhabditis elegans pathogenesis model., Cell (96:1), pp. 47-56.
Majdalani, N. and Gottesman, S. 2005. The Rcs phosphorelay: a complex signal
transduction system., Annu Rev Microbiol (59), pp. 379-405.
Manulis, S., Kobayashi, D. Y. and Keen, N. T. 1988. Molecular cloning and sequencing of
a pectate lyase gene from Yersinia pseudotuberculosis., J Bacteriol (170:4), pp. 1825-1830.

2009 Tous droits rservs.

167

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Mariscotti, J. F. and Portillo, F. G. 2008. Instability of the Salmonella RcsCDB signalling


system in the absence of the attenuator IgaA., Microbiology (154:Pt 5), pp. 1372-1383.
Markovitz, A. 1964. Regulatory mechanisms for synthesis of capsular polysaccharide in
mucoid mutants of Escherichia coli K12., Proc Natl Acad Sci U S A (51), pp. 239-246.
Mascher, T., Helmann, J. D. and Unden, G. 2006. Stimulus perception in bacterial signaltransducing histidine kinases., Microbiol Mol Biol Rev (70:4), pp. 910-938.
Masclaux, C., Hugouvieux-Cotte-Pattat, N., & Expert, D. 1996. Iron is a triggering factor
for differential expression of Erwinia chrysanthemi strain 3937 pectate lyase in pathogenesis
of African violets. Mol. Plant. Microbe. Interact. 9: 198-205.
Maurelli, A. T. 2007. Black holes, antivirulence genes, and gene inactivation in the evolution
of bacterial pathogens., FEMS Microbiol Lett (267:1), pp. 1-8.
Mayer, C., & Boos W. 2005, Hexose/Pentose and Hexitol/Pentitol Metabolism, in
Escherichia coli and Salmonella, Module 3.4.1, electronic version www.ecosal.org.
Miller JH. 1992. A short course in bacterial genetics: a laboratory manual and handbook for
Escherichia coli and related bacteria. Cold Spring Harbor Laboratory Press, New York.
Minsavage, G. V., Mudgett, M. B., Stall, R. E. and Jones, J. B. 2004. Importance of
opgHXcv of Xanthomonas campestris pv. vesicatoria in host-parasite interactions., Mol Plant
Microbe Interact (17:2), pp. 152-161.
Mizusawa, S. and Gottesman, S. 1983. Protein degradation in Escherichia coli: the lon gene
controls the stability of sulA protein., Proc Natl Acad Sci U S A (80:2), pp. 358-362.
Mole, B. M., Baltrus, D. A., Dangl, J. L. and Grant, S. R. 2007. Global virulence
regulation networks in phytopathogenic bacteria., Trends Microbiol (15:8), pp. 363-371.
Mot, R. D. and Vanderleyden, J. 1994. The C-terminal sequence conservation between
OmpA-related outer membrane proteins and MotB suggests a common function in both grampositive and gram-negative bacteria, possibly in the interaction of these domains with
peptidoglycan., Mol Microbiol (12:2), pp. 333-334.
Mouslim, C., Delgado, M. and Groisman, E. A. 2004. Activation of the RcsC/YojN/RcsB
phosphorelay system attenuates Salmonella virulence., Mol Microbiol (54:2), pp. 386-395.
Muyerowitz EM and Somerville CR. 1994. Arabidopsis. Cold spring harbor laboratory
press.
Nakamura, A., Maeda, H., Mizuno, M., Koshi, Y. and Nagamatsu, Y. 2003. betaGalactosidase and its significance in ripening of Saijyo Japanese Persimmon fruit., Biosci
Biotechnol Biochem (67:1), pp. 68-76.
Narita, S. and Tokuda, H. 2006. An ABC transporter mediating the membrane detachment
of bacterial lipoproteins depending on their sorting signals., FEBS Lett (580:4), pp. 11641170.

2009 Tous droits rservs.

168

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Nasser, W. and Reverchon, S. 2002. H-NS-dependent activation of pectate lyases synthesis


in the phytopathogenic bacterium Erwinia chrysanthemi is mediated by the PecT repressor.,
Mol Microbiol (43:3), pp. 733-748.
Natale, P., Brser, T. and Driessen, A. J. M. 2007. Sec- and Tat-mediated protein secretion
across the bacterial cytoplasmic membrane-Distinct translocases and mechanisms., Biochim
Biophys Acta.
Nikaido. 1996. Outer Membrane. Neidhardt, R Curtiss III, J. L. Ingraham, E. C. C. Lin, K.
Brooks Low, B. Maganasik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E. Umbarger.
(ed.), Escherichia coli and Salmonella. Cellular and Molecular Biology. 2nd ed., American
Society for Microbiology, Washington, D. C. 29-47.
Page, F., Altabe, S., Hugouvieux-Cotte-Pattat, N., Lacroix, J. M., Robert-Baudouy, J.
and Bohin, J. P. 2001. Osmoregulated periplasmic glucan synthesis is required for Erwinia
chrysanthemi pathogenicity., J Bacteriol (183:10), pp. 3134-3141.
Park, D. and Forst, S. 2006. Co-regulation of motility, exoenzyme and antibiotic production
by the EnvZ-OmpR-FlhDC-FliA pathway in Xenorhabdus nematophila., Mol Microbiol
(61:6), pp. 1397-1412.
Parker, C. T., Kloser, A. W., Schnaitman, C. A., Stein, M. A., Gottesman, S. and Gibson,
B. W. 1992. Role of the rfaG and rfaP genes in determining the lipopolysaccharide core
structure and cell surface properties of Escherichia coli K-12., J Bacteriol (174:8), pp. 25252538.
Prasad, J., McJarrow, P. and Gopal, P. 2003. Heat and osmotic stress responses of
probiotic Lactobacillus rhamnosus HN001 (DR20) in relation to viability after drying., Appl
Environ Microbiol (69:2), pp. 917-925.
Pratt, L. A., Hsing, W., Gibson, K. E. and Silhavy, T. J. 1996. From acids to osmZ:
multiple factors influence synthesis of the OmpF and OmpC porins in Escherichia coli., Mol
Microbiol (20:5), pp. 911-917.
Puvanesarajah, V., Schell, F. M., Stacey, G., Douglas, C. J. and Nester, E. W. 1985. Role
for 2-linked-beta-D-glucan in the virulence of Agrobacterium tumefaciens., J Bacteriol
(164:1), pp. 102-106.
Raetz, C. R. 1986. Molecular genetics of membrane phospholipid synthesis., Annu Rev Genet
(20), pp. 253-295.
Raivio, T. L. and Silhavy, T. J. 2001. Periplasmic stress and ECF sigma factors., Annu Rev
Microbiol (55), pp. 591-624.
Rantakari, A., Virtaharju, O., Vhmiko, S., Taira, S., Palva, E. T., Saarilahti, H. T. and
Romantschuk, M. 2001. Type III secretion contributes to the pathogenesis of the soft-rot
pathogen Erwinia carotovora: partial characterization of the hrp gene cluster., Mol Plant
Microbe Interact (14:8), pp. 962-968.

2009 Tous droits rservs.

169

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Resibois, A., Colet, M., Faelen, M., Schoonejans, E. and Toussaint, A. 1984. phiEC2, a
new generalized transducing phage of Erwinia chrysanthemi., Virology (137:1), pp. 102-112.
Reverchon, S., Expert, D., Robert-Baudouy, J. and Nasser, W. 1997. The cyclic AMP
receptor protein is the main activator of pectinolysis genes in Erwinia chrysanthemi., J
Bacteriol (179:11), pp. 3500-3508.
Rhodius, V. A., Suh, W. C., Nonaka, G., West, J. and Gross, C. A. 2006. Conserved and
variable functions of the sigmaE stress response in related genomes., PLoS Biol (4:1), pp. e2.
Rolin, D. B., Pfeffer, P. E., Osman, S. F., Szwergold, B. S., Kappler, F. and Benesi, A. J.
1992. Structural studies of a phosphocholine substituted beta-(1,3);(1,6) macrocyclic glucan
from Bradyrhizobium japonicum USDA 110., Biochim Biophys Acta (1116:3), pp. 215-225.
Rollet E. 2006. La biosynthse des glucanes priplasmiques osmorguls : de la
dmonstration des gnes impliqus chez Pseudomonas aeroginosa lanalyse structurale de
protines impliques chez Escherichia coli. Thse de Doctorat, Universit des Sciences et
Technologies de Lille.
Samson, R., Legendre, J. B., Christen, R., Saux, M. F., Achouak, W. and Gardan, L.
2005. Transfer of Pectobacterium chrysanthemi (Burkholder et al. 1953) Brenner et al. 1973
and Brenneria paradisiaca to the genus Dickeya gen. nov. as Dickeya chrysanthemi comb.
nov. and Dickeya paradisiaca comb. nov. and delineation of four novel species, Dickeya
dadantii sp. nov., Dickeya dianthicola sp. nov., Dickeya dieffenbachiae sp. nov. and Dickeya
zeae sp. nov., Int J Syst Evol Microbiol (55:Pt 4), pp. 1415-1427.
Santos, R., Franza, T., Laporte, M. L., Sauvage, C., Touati, D. and Expert, D. 2001.
Essential role of superoxide dismutase on the pathogenicity of Erwinia chrysanthemi strain
3937., Mol Plant Microbe Interact (14:6), pp. 758-767.
Sato, T., Ito, K. and Yura, T. 1977. Membrane proteins of Escherichia coli K-12: twodimensional polyacrylamide gel electrophoresis of inner and outer membranes., Eur J
Biochem (78:2), pp. 557-567.
Salmond, G. P. C. 1994. Secretion of extracellular virulence factors by plant pathogenic
bacteria. Annu. Rev. Phytopathol. 32: 181-200.
Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. Molecular cloning: a laboratory manual
2nd ed. Cold Spring Harbor Laboratory, Cold Spring Harbor, New York.
Schoonejans, E., Expert, D. and Toussaint, A. 1987. Characterization and virulence
properties of Erwinia chrysanthemi lipopolysaccharide-defective, phi EC2-resistant mutants.,
J Bacteriol (169:9), pp. 4011-4017.
Shiba, Y., Matsumoto, K. and Hara, H. 2006. DjlA negatively regulates the Rcs signal
transduction system in Escherichia coli., Genes Genet Syst (81:1), pp. 51-56.

2009 Tous droits rservs.

170

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Shiba, Y., Yokoyama, Y., Aono, Y., Kiuchi, T., Kusaka, J., Matsumoto, K. and Hara, H.
2004. Activation of the Rcs signal transduction system is responsible for the thermosensitive
growth defect of an Escherichia coli mutant lacking phosphatidylglycerol and cardiolipin., J
Bacteriol (186:19), pp. 6526-6535.
Shipkowski, S. and Brenchley, J. E. 2006. Bioinformatic, genetic, and biochemical evidence
that some glycoside hydrolase family 42 beta-galactosidases are arabinogalactan type I
oligomer hydrolases., Appl Environ Microbiol (72:12), pp. 7730-7738.
Sledjeski, D. D. and Gottesman, S. 1996. Osmotic shock induction of capsule synthesis in
Escherichia coli K-12., J Bacteriol (178:4), pp. 1204-1206.
Stanley, N. R., Findlay, K., Berks, B. C. and Palmer, T. 2001. Escherichia coli strains
blocked in Tat-dependent protein export exhibit pleiotropic defects in the cell envelope., J
Bacteriol (183:1), pp. 139-144.
Stock, J. B., Rauch, B. and Roseman, S. 1977. Periplasmic space in Salmonella
typhimurium and Escherichia coli., J Biol Chem (252:21), pp. 7850-7861.
Sun, Y., Hinnebusch, B. J. and Darby, C. 2008. Experimental evidence for negative
selection in the evolution of a Yersinia pestis pseudogene., Proc Natl Acad Sci U S A
(105:23), pp. 8097-8101.
Talaga, P., Cogez, V., Wieruszeski, J., Stahl, B., Lemoine, J., Lippens, G. and Bohin, J.P.
2002. Osmoregulated periplasmic glucans of the free-living photosynthetic bacterium
Rhodobacter sphaeroides., Eur J Biochem (269:10), pp. 2464-2472.
Talaga, P., Fournet, B. and Bohin, J. P. 1994. Periplasmic glucans of Pseudomonas
syringae pv. syringae., J Bacteriol (176:21), pp. 6538-6544.
Talaga, P., Stahl, B., Wieruszeski, J. M., Hillenkamp, F., Tsuyumu, S., Lippens, G. and
Bohin, J. P. 1996. Cell-associated glucans of Burkholderia solanacearum and Xanthomonas
campestris pv. citri: a new family of periplasmic glucans., J Bacteriol (178:8), pp. 2263-2271.
Teather, R. M. and Wood, P. J. 1982. Use of Congo red-polysaccharide interactions in
enumeration and characterization of cellulolytic bacteria from the bovine rumen., Appl
Environ Microbiol (43:4), pp. 777-780.
Tobe, T., Ando, H., Ishikawa, H., Abe, H., Tashiro, K., Hayashi, T., Kuhara, S. and
Sugimoto, N. 2005. Dual regulatory pathways integrating the RcsC-RcsD-RcsB signalling
system control enterohaemorrhagic Escherichia coli pathogenicity., Mol Microbiol (58:1), pp.
320-333.
Tokishita, S. and Mizuno, T. 1994. Transmembrane signal transduction by the Escherichia
coli osmotic sensor, EnvZ: intermolecular complementation of transmembrane signalling.,
Mol Microbiol (13:3), pp. 435-444.
Tomenius, H., Pernestig, A., Jonas, K., Georgellis, D., Mllby, R., Normark, S. and
Melefors, O. 2006. The Escherichia coli BarA-UvrY two-component system is a virulence
determinant in the urinary tract., BMC Microbiol (6), pp. 27.

2009 Tous droits rservs.

171

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Torriani, A. 1968. Alkaline phosphatase subunits and their dimerization in vivo., J Bacteriol
(96:4), pp. 1200-1207.
Toutain, C. M., Clarke, D. J., Leeds, J. A., Kuhn, J., Beckwith, J., Holland, I. B. and
Jacq, A. 2003. The transmembrane domain of the DnaJ-like protein DjlA is a dimerisation
domain., Mol Genet Genomics (268:6), pp. 761-770.
Uhl, M. A. and Miller, J. F. 1996. Integration of multiple domains in a two-component
sensor protein: the Bordetella pertussis BvgAS phosphorelay., EMBO J (15:5), pp. 10281036.
Venecia, K. and Young, G. M. 2005. Environmental regulation and virulence attributes of
the Ysa type III secretion system of Yersinia enterocolitica biovar 1B., Infect Immun (73:9),
pp. 5961-5977.
Venkatesh, B., Babujee, L., Liu, H., Hedley, P., Fujikawa, T., Birch, P., Toth, I. and
Tsuyumu, S. 2006. The Erwinia chrysanthemi 3937 PhoQ sensor kinase regulates several
virulence determinants., J Bacteriol (188:8), pp. 3088-3098.
Vianney, A., Jubelin, G., Renault, S., Dorel, C., Lejeune, P. and Lazzaroni, J. C. 2005.
Escherichia coli tol and rcs genes participate in the complex network affecting curli
synthesis., Microbiology (151:Pt 7), pp. 2487-2497.
Vieira, J. and Messing, J. 1982. The pUC plasmids, an M13mp7-derived system for
insertion mutagenesis and sequencing with synthetic universal primers., Gene (19:3), pp. 259268.
Vimr, E., Steenbergen, S. and Cieslewicz, M. 1995. Biosynthesis of the polysialic acid
capsule in Escherichia coli K1., J Ind Microbiol (15:4), pp. 352-360.
Vincken, J., Schols, H. A., Oomen, R. J. F. J., McCann, M. C., Ulvskov, P., Voragen, A.
G. J. and Visser, R. G. F. 2003. If homogalacturonan were a side chain of
rhamnogalacturonan I. Implications for cell wall architecture., Plant Physiol (132:4), pp.
1781-1789.
Vollmer, W., Blanot, D. and de Pedro, M. A. 2008. Peptidoglycan structure and
architecture., FEMS Microbiol Rev (32:2), pp. 149-167.
Vries, R. P. D., Parenicov, L., Hinz, S. W. A., Kester, H. C. M., Beldman, G., Benen, J.
A. E. and Visser, J. 2002. The beta-1,4-endogalactanase A gene from Aspergillus niger is
specifically induced on arabinose and galacturonic acid and plays an important role in the
degradation of pectic hairy regions., Eur J Biochem (269:20), pp. 4985-4993.
Weissborn, A. C. and Kennedy, E. P. 1984. Biosynthesis of membrane-derived
oligosaccharides. Novel glucosyltransferase system from Escherichia coli for the elongation
of beta 1-2-linked polyglucose chains., J Biol Chem (259:20), pp. 12644-12651.
West, A. H. and Stock, A. M. 2001. Histidine kinases and response regulator proteins in
two-component signaling systems., Trends Biochem Sci (26:6), pp. 369-376.

2009 Tous droits rservs.

172

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Willats, W. G., McCartney, L., Mackie, W. and Knox, J. P. 2001. Pectin: cell biology and
prospects for functional analysis., Plant Mol Biol (47:1-2), pp. 9-27.
Yamamoto, K., Hirao, K., Oshima, T., Aiba, H., Utsumi, R. and Ishihama, A. 2005.
Functional characterization in vitro of all two-component signal transduction systems from
Escherichia coli., J Biol Chem (280:2), pp. 1448-1456.
Yang, C., Gavilanes-Ruiz, M., Okinaka, Y., Vedel, R., Berthuy, I., Boccara, M., Chen, J.
W., Perna, N. T. and Keen, N. T. 2002. hrp genes of Erwinia chrysanthemi 3937 are
important virulence factors., Mol Plant Microbe Interact (15:5), pp. 472-480.
Yang, S., Peng, Q., Zhang, Q., Yi, X., Choi, C. J., Reedy, R. M., Charkowski, A. O. and
Yang, C. 2008. Dynamic regulation of GacA in type III secretion, pectinase gene expression,
pellicle formation, and pathogenicity of Dickeya dadantii (Erwinia chrysanthemi 3937)., Mol
Plant Microbe Interact (21:1), pp. 133-142.
Yanisch-Perron, C., Vieira, J. and Messing, J. 1985. Improved M13 phage cloning vectors
and host strains: nucleotide sequences of the M13mp18 and pUC19 vectors., Gene (33:1), pp.
103-119.
Yoo, J., Jung, Y., Chung, S., Lee, Y. and Choi, Y. 2004. Molecular cloning and
characterization of CMCase gene (celC) from Salmonella typhimurium UR., J Microbiol
(42:3), pp. 205-210.
York, W. S. 1995. A conformational model for cyclic beta-(1->2)-linked glucans based on
NMR analysis of the beta-glucans produced by Xanthomonas campestris., Carbohydr Res
(278:2), pp. 205-225.
Young, G. M. and Miller, V. L. 1997. Identification of novel chromosomal loci affecting
Yersinia enterocolitica pathogenesis., Mol Microbiol (25:2), pp. 319-328.

2009 Tous droits rservs.

173

http://doc.univ-lille1.fr

Thse d'Anne-France Prouvost, Lille 1, 2008

Titre : Rle du priplasme dans la perception par la bactrie de son environnement


Erwinia chrysanthemi est une entrobactrie phytopathogne responsable de la formation
dune pourriture molle sur un large spectre de plantes htes. Sa virulence dpend
principalement de la scrtion dexoenzymes (dont les pectinases et cellulases) qui vont
dgrader la paroi des cellules vgtales. Lobjectif de cette thse est de participer la
comprhension du rle du priplasme dans la perception de lenvironnement par la bactrie.
Nous avons caractris gntiquement et biochimiquement le locus gan codant 9 protines
impliques dans le transport et la dgradation des -galactanes (un des composants de la
pectine). Les OPG (glucanes priplasmiques osmorguls) sont essentiels pour la virulence
dE. chrysanthemi puisquun mutant opgG incapable de les synthtiser prsente un phnotype
plotrope dont la perte de virulence. Une mutation suppressive de la mutation opgG localise
dans le gne rcsC a t obtenue au laboratoire. Nous avons voulu prciser le rle du systme
deux composants RcsCDB dans le pouvoir pathogne de la bactrie. La mutation rcsC2
conduit une diminution de la phosphorylation du rgulateur RcsB due une augmentation
de lactivit phosphatase de RcsC. Pourtant RcsB nest pas essentielle pour la virulence. Nous
avons galement montr que lexpression des gnes rguls par le systme RcsCDB est
influence par la quantit des OPG. Une faible surexpression dune version soluble de RcsF
engendre une activation du systme Rcs et que la faible surexpression de DjlA et IgaA na pas
deffet significatif. Enfin, nous avons entrepris de caractriser la structure de RcsF par
mutagense dirige.
Mots Cls : Erwinia chrysanthemi, glucanes priplasmiques osmorguls (OPG), dgradation
et transport des galactanes, systme deux composants RcsCDB, virulence

Title: Role of the periplasm in bacterias environment perception.


Erwinia chrysanthemi is a phytopathogenic enterobacterium causing soft rot disease in a wide
range of plant species. The maceration of plant tissues is essentially caused by the secretion of
a set of plant cell wall degrading enzymes (including pectinases and cellulases). The aim is to
participate to the understanding of the role of the periplasm in environment perception by
bacteria. We characterised genetically and biochemically the gan locus encoding 9 proteins
involved in galactan transport and catabolism (galactan is a pectic component).
Osmoregulated periplasmic glucans (OPGs) are essential for E. chrysanthemi pathogenicity.
An opgG mutant lacks OPGs and shows a pleiotropic phenotype including nonvirulence. A
rcsC point mutation (rcsC2) suppresses the phenotype induced by OPGs defect. We wanted to
clarify the role of the Rcs system in pathogenicity. The rcsC2 mutation leads to the reduction
of transcriptional activity of RcsB caused by an increase of phosphatase activity of RcsC.
Mutations in RcsCDB proteins show that RcsB is not essential to virulence. We have shown
that genes expression regulated by RcsCBD phosphorelay is influenced by the quantity of
OPGs in the periplasm. An ectopic overexpression of a soluble version of RcsF leads to a
RcsCDB phosphorelay activation, while an ectopic overexpression of DjlA and IgaA has no
significatives effects. Finally, we have characterized RcsF structures by site-directed
mutagenesis and deletion mutagenesis.
Keywords : Erwinia chrysanthemi, osmoregulated periplasmic glucanes (OPGs), galactan
transport and catabolism, RcsCDB two component system, virulence.

2009 Tous droits rservs.

http://doc.univ-lille1.fr