Vous êtes sur la page 1sur 330

ELGRANDICCIONARIO

DELASDOLENCIASYENFERMEDADES.
Eldiccionariomsampliosobrelascausasdelasdolenciasyenfermedades
relacionadasconlospensamientos,sentimientosyemociones.
De
JACQUESMARTEL.
EditionsQuintessence.

DedicadoatodoslosbuscadoresdelaVerdad.
Agradecimientos.
QuierodarlasgraciasenparticularalaseoraLucieBerniernosloporsulabor
decoordinacinenlostrabajosdellibrosinotambinporsuvaliosaayudacomo
colaboradora durante los dos ltimos aos de la produccin del libro. Su
experiencia de vida personal, de psicoterapeuta, su formacin en el enfoque
metafsico de las dolencias y enfermedades, su mente sinttica y su intuicin
facilitaronlosprogresossignificativosdelostrabajosdeestelibro.
GraciasenespecialalSr. ClaudeSabbah quien,porsusinvestigacionesdesde
hace ms de 30 aos, su excepcional competencia, su gran experiencia y su
enseanzadelabiologatotaldelosseresvivosbajoformadehistorianaturalme
permitiirmslejosenlasinvestigacionesyconstatacionesquehabahechohasta
lafecha.Sumenteabiertaysuamorporelserhumanosonparamunejemplopor
perpetuar, sabiendo que el amor es el nico sanador en el trabajo que
desempeamos para resolver los conflictos que hicieron que se manifestar la
enfermedad.
QuieroagradecertambinalSr.GeorgeWright,psicoterapeutayamigopersonal,
porsuconstanteapoyoysunimofrentealtrabajoqueavecesmeparecalargoy
laboriosoenelcursodelossieteaosdelaproduccindeestelibro.
GraciastambinalaSeoraClaudiaRainvillequemepermititrabajarasulado
(198889)yconquienpudeprofundizarbeneficindomedesusconocimientosen
elcampodelametafsicadelasdolenciasyenfermedades.Sudinamismoysus
conviccionespersonales,juntoconsuexperiencia,fueronparamunafuentede
motivacin en la continuidad de mi orientacin profesional ms centrada en el
campodelcrecimientopersonal.
Quierodarlasgraciastambinalaspersonassiguientesporsuparticipacinenla
realizacindeestelibro:
Sra.NicoleGagn
Sra.GinetteQuintal
Sr.SimonAlarie
Sr.PaulEmileDrouin
Sra.DeniseBoucher
Sr.PierreCouture.
Mipadre:NoMartel

Sr.JeanDumas
Sra.GinetteCaron
Sra.DanielleEast
Sra.LouiseDrouin
Sr.LaurentChiasson
Sr.BobLengham
Sra.FleuretteCouture.
2

Prefacio.
Aceptomicuracin.
Tomar consciencia de quien soy y de la transformacin que se est
produciendoenmresultasiempreexcitantecuandoloquedescubroconrelacina
m y frente a los dems es positivo y hermoso. Qu sucede cuando los
descubrimientosqueresultandeunandarpersonal,elquesea,mellevanaver
aspectosocultosdemipersonaycuandoimplicanquemevuelvaconscientedelas
dolenciasyenfermedadesquemesucedieronoqueprobablementehubiesentenido
lugarenelinteriordemicuerpo?
Puesbien,esloquesucedialolargodeestosdosltimosaoscuando
comprend que las enfermedades se haban sutilmente instalado a causa de
emociones mal administradas y que, aprendiendo a volver a armonizar este
torbellinodeemocionesdetodaclasequemehabitaban,podatenerelpoderde
curacin sobre cualquier dolencia o cualquier enfermedad que haba dejado
instalarsecomoreyydueoenmiTemplodeCarne.
Naturalmente,laresponsabilidadqueaceptvolveraasumirfrenteami
salud,fueunlargoprocesodeintrospeccinydeunnuevoplanteamientodemis
valoresy,sobretodo,meconcedilacertezadequetengoelpoderdecurarme.
Paraello,tuveelprivilegio,desdeahorahacenueveaos(1988),deconoceryestar
alladodeJacquesypoderadquirirconocimientosdurantelosmltiplestalleresy
conferenciasquedio.Graciasasufacilidadporhacersimpleyaccesibleuntema
queparamuchospuedeparecermuycomplejo,porsuamorincondicionalysu
deseodeayudaraquelagentealcanceunmejorbienestartantoanivelfsicocomo
a nivel emocional y espiritual, fue y sigue siendo un pilar, un gua que sabe
ayudarmeaahuyentarmiculpabilidadysustituirlaporunasumirdemivida,para
quemesientacadavezmslibre,bienenmipiel,dueodemivida.Jacquesme
ayud a aceptar la enfermedad, la que sea, como una experiencia positiva
porqueesparamocasindepararme,interrogarmesobreloqueestsucediendo
enmivida.Paramuchagentecomoyo,laenfermedadmediolaocasindepedir
ayuda,cosaquefrecuentementequieroevitar.Deborecordarquecaer,eshumano;
perolevantarse,esdivinoyqueparaempezarunprocesodecuracin,esesencial
abrirsealosdems,abrirseasmismoyenprimerlugar,abrirsealAmor,porque
cualquierdolenciaocualquierenfermedadpuedecurarsiestoylistaparaaceptar
dejarcaermisviserasyecharunamiradanuevaypositivasobrecualquier
situacinquepuedavivir,pormsdifcilquepuedaparecer,porquesque,cuando
hayacomprendidoenmicoraznlallegadadedichaexperienciaenmivida,sta
podrseguirsucaminoyrecobrarunasaludperfecta.
3

ste es el objetivo de este libro que considero un instrumento de


transformacinexcepcional. Esunaventana abiertasobre estemundoan muy
desconocidodelasemociones.Esuninstrumentoquemedalaposibilidaddeque
me abra a la semilla que permiti que este microbio, este virus, este tumor o
cualquier otra afeccin fsica germine en mi cuerpo y brote a la luz del da.
Dndomeocasindeamarmeyaceptarme atravsdetodasestasemociones
malvividasonovividas,darunpasohacamsarmona,mspaz,msamor.
Aprendiendoadescifrarestenuevodiccionariodelasemociones,ahoravoy
apoderinvertirenmicapitalsalud,siendoahoracapazdepreveniryevitarmuchas
dolenciasquemeacechaban.
EnelcursodeestosltimosaosenqueestuvecolaborandoconJacquesal
nacimientodeestelibro,mesorprendilacantidaddetiempo(milesdehoras)que
fuenecesarioinvertir,sincontartodalaenergayaperturaimprescindiblespara
canalizar todas estas informaciones que estaban mal administradas y que,
frecuentemente,tocabanobienunperododemividapersonalobienunasituacin
vividaporunapersonaqueconoca.
Todosfuimosenfermoscomomnimounavezennuestravidayelhechode
desmenuzarlacausadeunmalquenosafectaoafectaaunapersonacercananos
invitaadesapegarnos(enelsentidodeverunaenfermedaddeunmodopositivoy
despojarnos delainfluencia negativaquedejamos quetengasobre nosotros) y
volvermeuntestigodetodosestosmalesyyanomsunavctima.
Estoesloquedeseoatodos,medianteesteinstrumento.Quecadaunode
nosotrossevuelvacadavezmsautnomo,mscapazde reconocerdedonde
proceden lasdolencias yenfermedades queleafectanopodranafectarle. Este
reconocimientoservirdeprevencinyaportarloscambiosnecesariosennuestra
vidapararecobrarlasalud.Setratadeuncomplementoextraordinarioqueseaade
alamultituddetcnicasqueyaexisten,tantoalniveldelamedicinatradicional
comonueva,yqueserevelaesencialnosloparaunacuracinanivelfsico,sino
tambin al nivel del corazn (del amor) , ah donde se opera la autntica
curacin
Asusalud!
LucieBernier.
Psicoterapeuta,Coordinadoradelostrabajos.

Introduccin.
Lasaludsiemprehasidoparamuntemapreocupante.Enefecto,yaen
temprana edad,empec atener problemas desalud sinconocer exactamente la
causadestos.Mimadreestuvoconfrontadaconsituacionesdifcilesque,durante
numerosos aos, requirieron cuidados tales como operaciones, tratamientos los
cualescausaronaosdehospitalizacin.
Encuantoam,comonoseconseguaencontrarloquetena,escomosiuna
duda planeara constantemente: crea que estos males podan ser psicolgicos.
Entonces,medijeammismo:obienestoestenmimente,obienhayun
motivoaloqueestsucediendo.Decidoptarporlasegundaeleccinyescuando
empecabuscarloquelellevabaavivirtodosestosinconvenientes.
En1978,empecatrabajarenelcampodelasalud,enloscomplementos
alimentarios.Entonces,empecadarmecuentapormmismo,enelcursodelas
consultasindividualesquehacaypormiobservacin,quepodaexistirunnexo
entre las emociones, los pensamientos, y las enfermedades. Haba empezado
intuitivamenteadescubrirel nexoqueexistaentreciertas emocionesyciertas
enfermedades. En1988,mematriculacursos decrecimientopersonalytom
contacto con lo que hoy se llama el enfoque metafsico de las dolencias y
enfermedades.Veocomootrosyyo,consultbamoslarecopilacindedolenciasy
enfermedadeshechaporLouiseHayensulibro.Tambin,observabaalagenteque
empezabasuinvestigacinconsigomismosoconlosdemsparacomprobarla
exactitud de lo que ella deca, apasionados por descubrir nuevas avenidas de
investigacinparapermitirlescomprendermejorloqueestabanviviendo.
Apartirdeestemomento,miintersparaesteenfoquenodejdeaumentar,
sobretodoporquemeorientabahacaelcampomsespecficodelcrecimiento
personal.Desdeeseda,nohedejadodecomprobar,atravsdemisconsultas
personales,loscursosotalleresqueanimo,lapertinenciadeestosdatossobrelas
dolencias y las enfermedades. An hoy, en el colmado o cuando voy a hacer
fotocopias, hago preguntas a personas sobre lo que viven en relacin con sus
dolenciasosusenfermedades.
Anveoaestaspersonasquememiranconaireasombradoeinterrogante,
preguntndosesisoyunvidenteounextraterrestreyaquestantascosassobresu
vida personal sin que me las hayan comentado. Cuando se sabe descifrar las
dolencias y las enfermedades y cuando se sabe a cuales emociones o a cuales
pensamientos estn vinculadas, entonces esfcildecir alapersonaloque est
viviendo. Entonces, digo a la gente que sencillamente es el conocimiento del
5

funcionamiento del ser humano y el conocimiento de los nexos con los


pensamientos,emocionesyenfermedadesquemepermitendarestainformacin.
Enunsentido,lesexplicoquesepodraentrarlacantidaddedatosmsgrande
posibleenunordenador,yquealguiendieralossntomasdesudolenciaodesu
enfermedad,osimplementenombrarlaylainformacinpodrasalirrevelandolo
queestviviendoestapersonaensuvidapersonal,seaconscienteonoelladeello.
Entonces,nosetratadevidenciasinodeconocimiento.
Hoy,conlaexperienciaylosconocimientosquetengo,puedoafirmarquees
imposiblequealguienpadezcadediabetessinvivirunatristezaprofundayuna
repugnanciafrenteaunasituacinquevivi.Param,esimposiblequeunapersona
padezcaartritissinvivirunaautocrticaocriticandoaalguienosituacionesdesu
vida.Param,esimposiblequeunapersonavivaproblemasdelhgadosinvivir
unaira,unafrustracinhacasmismaohacalosdems,etc.Aveces,semeha
hecholareplicasiguiente:Cuandodescifraslasdolenciasyenfermedades,telas
arreglasparaqueestofuncione.Entoncessemedicequetodoelmundoest
viviendoira,frustracin,pena,rechazo,etc.Aesto,contestoquetodoelmundono
reaccionadelmismomodo.Tomemosporejemploelhechodequehayacrecidoen
unafamiliadedocehijoscuyopadreeraalcohlicoylamadredepresiva.Mis
hermanosyhermanas habrntenidolosmismospadresqueyoperocadahijo,
incluido yo, estar afectado o no y lo ser de un modo diferente debido a su
interpretacindelovividoconsuspadres.Porqu?Porquetodossomosdiferentes
yquetenemosquetomarconscienciadeunmododiferenteennuestrorecorrido
personal.Aselfenmenoderechazopodractivarunaenfermedadenunapersona
peronoenotra.Estodependedelmodoenquemesentafectado,conscientemente
o inconscientemente. Si mi estrs psicolgico es suficientemente grande, estar
traducidoenunestrsbiolgicobajoformadeenfermedad.
Duranteuntallerquedabasobreelenfoquemetafsicodelasdolenciasy
enfermedades,conocasindeunaferiademuestrassobrelasaludnaturalylas
terapias alternativas, las dolencias y enfermedades que se me comunicaron
estuvierondescifradasbastanterpidamenteyconexactitud.Unpocomstarde,
unaamigaqueestabaentrelosasistentesduranteestetaller,medijo:Jacques,
deberas prestar atencin cuando contestas a la gente y das la respuesta
directamente y rpidamente. Las personas que estaban a mi lado tuvieron la
sensacinqueeltallerestabapreparadoparaqueestofuncione.Nohabanada
deestonaturalmente.Loqueaquhayqueentender,esqueprimero,lapersona
afectadaporladolenciaoporlaenfermedadsabequelodichoparaellaesverdad
pero quizs no es tan evidente para los dems que no estn personalmente
relacionados.Segundo,loqueesnuevoyreveladoanuestraconscienciapuede
parecernosirreal.Negarestarealidadpuedetambinserunmododeprotegerse
paranosentirseresponsabledeloquenossucede.
6

He aqu una ancdota ilustrando esta constatacin. El famoso inventor


Thomas Edison encontr a los miembros del Congreso Americano para
presentarlessunuevoinvento,elfongrafo,unamquinahablante.Serelataque
cuandohizofuncionarsuinvento,ciertosmiembrosdelCongresolotacharonde
impostor, diciendo que deba tratarse de algn fraude ya que, para ellos, era
imposiblequelavozhumanapuedasalirdeunacaja.
Lostiemposhancambiado.Porestoesimportantemantenernosabiertosalas
nuevasideasquepodranaportarnosrespuestasinnovadorasamuchosproblemas.
MuchaspersonasdeEstadosUnidosyEuropahandesarrolladoestaperspectiva
segnlacualexisteunnexoentrelosconflictosdelasemocionesypensamientosy
laenfermedad,estoayudandoaqueseconozcaestecampodeinvestigacinno
sloenelQuebec(Canad)sinotambinenotraspartesdelmundo.
Frecuentementedigo,enelcursodemisconferencias,quetengounmental
queesmuyfuerteperoquetambintengounaintuicinmuyfuerteyqueelreto
msgrandedemividahasidoysiguesiendohoy,conciliarambos.Miformacin
acadmicacomoingenieroenelectricidadmellevaconcretizarelaspectolgico
yracionaldelascosas.Lafsicameensequeaunacausaestconectadaun
efectobienreal.Esestaleydecausaaefectoque,mstarde,pudeaplicaralcampo
delasemocionesypensamientos,aunqueseamenostangiblequelapropiafsica.
Peroesestoverdad?Inclusoenuncampoquetratadefsicaoelectricidad,se
trabajaconalgoqueelserhumanonuncavio:laelectricidad.Porque,dehecho,se
trabajaconlosefectoscomolaluz,elcalor,lainduccinelectromagntica,etc.Del
mismomodo,lospensamientosyemocionesnonecesariamentesonfsicosenel
sentidoliteraldelapalabraperopuedentenerrepercusionesfsicasbajoformade
dolenciasyenfermedades.Poresto,unodelosobjetivosdeestelibroesdemostrar
que,aalgonovisiblecomolospensamientosyemocioneshayunareaccinque,
ella, es fsica y mensurable, frecuentemente bajo forma de dolencias y
enfermedades.puedomedirlaclera?No.Peropuedotomarlamedidademi
fiebrecuandotengofiebre.Puedomedirelhechoquefrecuentementetengola
sensacindetenerquelucharenlavidaparalograrloquequiero?No,peropuedo
medir la cantidad de glbulos rojos que han disminuido cuando tengo anemia.
Puedomedirelhechoquelaalegranocirculabastanteenmivida?No,peropuedo
medirelporcentajedecolesterolsanguneodemasiadoelevado,etc.Entonces,si
tomoconscienciadelospensamientosyemocionesquehicieronquesemanifestara
la dolencia o la enfermedad, puede que cambiando mis pensamientos o mis
emociones,puedarecobrarlasalud?Meatrevoaafirmarques.
Sinembargo,estopuedesermscomplejoomshondoquelaparteenla
cual puedo estar consciente. Por esto, puedo tener necesidad de consultar a
personas que trabajan en el campo mdico o a otras personas que usan otros
7

enfoquesprofesionalesparaayudarmeaefectuarcambiosenmivida.Simehede
haceroperarycomprendoloquemellevavivirtalsituacin,esmuyposibleque
merecuperemuchomsprontodemioperacinqueotrapersonaquenoquiso
saberloquesucedaensuvidaoqueloignorabamuysencillamente.Adems,sino
he comprendido el mensaje de mi enfermedad, la operacin o el tratamiento
parecerhacerdesaparecerestaenfermedad,perostapodrrepercutirsobreotro
aspectodemicuerpo,bajootraforma,mstarde.
Hayqueconfiarquecadavezhabrmsempresasquetomenconscienciade
lautilidaddeayudarasusempleadosensuandarpersonal,enelplanoemocional.
Esto permitir disminuir ms los accidentes en la empresa y el porcentaje de
ausencias,aumentandoalavezlaeficaciaindividual.Simividapersonal,familiar
o profesional hace que no est bien conmigo mismo, tendr tantas ms
probabilidadesdeatraerhacam,inclusoinconscientemente,unaenfermedado
unaccidenteparapodertenervacacionesoparaquesecuidendem.
En1990,semeocurrilaideaderedactarundiccionariotratandodelas
causasmetafsicasdelasdolenciasyenfermedades,yen1991,inicilatarea.En
aquelmomento,nosospechabalacantidaddetrabajoquemeesperaba.Porsuerte,
porquedesaberlo,creoquenuncahubieseempezadoesteproyecto.Peromedijea
mmismo:Unacosaalavez!Loconseguir;voyatrabajarhastaqueestlo
bastantesatisfechocomoparapublicarestaobra.Simencionoesto,estambin
porqueestorequieremuchotrabajo,energayvoluntadparahacerloscambios
sobresmismo.UnautoramericanoescribiundaSlolosvalerososylosque
gustan de la aventura tendrn la experiencia personal de Dios. Lo que
entiendodeestacitacin,esquemideterminacinavencerlosretosyelvalorde
experimentaravenidasnuevasparammeprocuraronciertoestadoderealizaciny
debienestar.Esteestadodebienestarcorrespondealasaludfsica,mentaly
emocional.
De1978a1988,trabajenelcampodeloscomplementosalimentariosque
sepuedellamarelenfoqueorthomolecular,locualsignificadaralorganismolos
alimentosnecesarioscomolasvitaminas,mineralesyotrosnutritivos,bajoforma
dealimentoocomplementosalimenticios,paraayudararestableceromanteneruna
salud ptima. Entonces me fundaba en los trabajos de psiquiatras y dems
mdicos,bioqumicosydiversosinvestigadorescanadiensesyamericanos(sobre
todo) que, por su experimentacin, demostraron que dando los nutritivos
necesarios,sepodallegaramejorar,inclusocurarenciertoscasoslasaludfsica,
mentalyemocional.Dehecho,existenvariosenfoquesparaobteneruna salud
ptimaquetodostienensuimportancia,cadaunodeellosactuandodeunmodou
otro sobre todos los aspectos de nuestra vida. En 1996, vi un reportaje 1 en la
1

TambinrelatadoenlarevistaLIFEdeseptiembrede1996bajoeltemageneral:TheHEALINGrevolution.

televisin referente a un hospital, el ColumbiaPresbyterian Hospital de Nueva


York,enelcualhablabandeunpaciente,elseorJosephRandazzo,queibaaestar
operado por tres puentes coronarios. Este paciente se benefici de sesiones de
visualizacin,tratamientosenergticos,reflexologaantesdesuoperacin.Durante
laoperacinrecibatratamientosenergticos.Despusdesuoperacin,estemismo
paciente particip otra vez en sesiones de visualizacin, recibi tratamientos
energticos y reflexologa para permitirle recuperarse ms rpidamente. Estas
intervenciones dieron su fruto ya que el paciente se recuper mucho ms
rpidamentedespusdeestaoperacinmayorquelohubiesehechootropaciente
encondicioneshabituales.Elmdicotratante,MehmetOz,mencionabaquehaca
estaexperimentacinsobre300desuspacientesparaanalizarlosresultadosdel
aadirestasterapiasalternativasaltratamientomdicoconvencional.
As que el presente libro quiere ser un complemento de cualquier
enfoque,bienseamdicooenrelacinconlasmedicinassuaves.Tratatantodel
enfoquealoptico,msmdico,comodelenfoqueholsticoquecomprendemejor
elaspectofsico,mental,emocionalyespiritualdemiser.Deseoardientementeque
todoslosprofesionalesdelasalud,alnivelqueestn,usenestediccionariocomo
complementodesuprctica,comoinstrumentodetrabajoydeinvestigacin,para
ayudarasuspacientesensuprocesodecuracin.Pormiparte,experimentlas
operaciones, la medicina tradicional, los medicamentos, la acupuntura, los
tratamientosenergticos,laradiestesia,lavitaminoterapia,lasesenciasfloralesdel
Dr. Bach, la quiroprctica, la orthoterapia, la iridologa, la psicoterapia, el
rebirthing (respiracin consciente), la homeopata, etc. S que si una tcnica
fueravlidaparatodoelmundo,solohabrasta.Peronoeselcasoporqueelser
humano es el animal del planeta con ms posibilidades pero tambin con la
complejidadmsgrande.
Poresto,debointentarentendercomprenderpormmismoloquevivo
hacindomeayudarporlosdemssiesnecesario,enelcamporespectivodesu
competencia. El mismo autor que mencionaba anteriormente escribi un da:
DEBEMOSAPRENDERDELOSQUESABEN.Esascomodebobuscarlo
mejor de lo que existe en cada una de las profesiones. Cuando me encuentro
delantedeunmdico,medigoquelsabemsqueyoenmedicinayquedebo
estaratentoaloquemediceyaloquemepropone,dejndomelalibertaddeelegir
luego mi orientacin. Del mismo modo, cuando me encuentro delante de un
acupuntor,estoyatentoaloquelmediceoaloquemeproponecomotratamiento
porqueconocemejorqueyoelfuncionamientodelequilibrioenergticodemi
cuerpoenfuncindelosmeridianos.Eslomismoparatodaslasprofesiones.
El otro da, una dama me deca que no crea en todas estas historias de
pensamientosyemocionesenconexinconlasenfermedades.Lecontestqueno
9

eranecesariocreerenello.Despusdehaberleledoalgunostextosquesereferan
asus dolencias o aenfermedades que ya habatenido oque an laafectaban,
pudimosobservarquesuactitudhabacambiadoyqueestabamsreceptivaaeste
enfoque.Dehecho,hayunaparteinternamaquesabeloqueestsucediendoy
queloquesedicedemcorrespondealoquevivoyqueestonosedebealazar.
Aqu,hayqueestarprudente:nodebosentirmeculpabledeloquemesucedey
pensarquesemeestdiciendoqueestoyenfermoporculpama.Soyresponsable
deloquemesucedepero,enlamayoradeloscasos, noesculpama. Esel
desconocimientodelasleyesquerigenlospensamientosyemocionessobreel
cuerpofsicoloquemellevaavivirsituacionesdedolenciasoenfermedades.
Debopuestomarconscienciademitrayectoriapersonalo,enelsentidoamplio
delapalabra,demitrayectoriaespiritual.Ahdondedescubrquenohaba
amoroquelohabapoco,debovolveradescubrirqueelamorerapresenteapesar
detodo.Noesevidente,dirVd.?Peroases.Simetirodesdearribaelbalcny
merompounapierna,dirqueDiosmehacastigado?Dehecho,existeunaleyque
sellamalaleydelagravedadquetiendeatraermealsuelo.Estaleynoesnibuena,
nimala,eslaleydelagravedad.Aunquemepongaadiscutiryestarenfadado
contraestaleyporqueporculpadeella,meherotounapierna,estonocambianada
a la ley porque la LEY, ES LA LEY. As es como se contemplan todas las
enfermedadescomounacarenciadeamor.Sedicequeelamoreselnicosanador.
Entonces,siestoesverdad,noserasuficientesimplementedaramorparaver
manifestarselacuracin?Estoesverdadenciertoscasos.Dehecho,escomosiel
amortuvieraqueentrarporciertaspuertasparaqueseopereunacuracin,porestas
puertasquesecerraronalamorduranteheridasanteriores.Heaqutodouncampo
dehallazgoytomadeconsciencia!
Este libro no contempla directamente traer soluciones a dolencias y
enfermedadessinopreferentementeaayudarmeatomarconscienciadequeloque
siento como dolencia y enfermedad procede de mis pensamientos y de mis
emocionesyqueapartirdeesto,puedotomarlosmediosqueveooportunospara
realizarcambiosenmivida.Sinembargoelmerohechodesaberdedondeprocede
midolenciaomienfermedadpuedeserbastanteparaaportarcambiosenmicuerpo
fsico.Enciertoscasos,elcambiopositivopuedeserdel50%einclusodel100%o
sealacuracintotal.
Pormiparte,cuandoconoclasclasesdecrecimientopersonalen1988y
pudetomarconscienciadeloscambiosqueseproducanenm,tuveelsentimiento
queempezabaarenaceryvinacerenelhorizontedasmejores.Porfinencontrun
mediodehacercambiosimportantesenmividaydeverlosresultados. Deba
actuarporqueestabaenreaccinconrelacinalaautoridad,vivaenormementeen
elrechazo,elabandonoylaincomprensin.Sabatodoestoperonecesitabaan
encontrar el medio de cambiar, curar mis heridas interiores. Por esto me
10

comprometconestareadeactividadqueeselcrecimientopersonal.Mitrabajo
me permita trabajar conmigo mismo mientras trabajaba con los dems para
ayudarlesaabrirsuconsciencia. Creosinceramentequecadaunodenosotros
puedeasumirsedemodocadavezmsautnomoyquecadaunodenosotros
puedeaccederaungradodesabidura,deamorydelibertadsuperior!Lo
merecemostodos.
Estediccionarioquiereseruninstrumentodeaperturadeconscienciayde
investigacindesmismo.Cuandomesucedealgoenrelacinconmisalud,voy
aleerotravezloescritoenestediccionarioparaestaranmsconscientedeloque
estsucediendo.Enefecto,elserhumanotienefcilmentetendenciaaocultar,es
decir,hacerdesaparecerdesumemoriaconscienteloquelemolesta.As,cuando
leo el diccionario, lo hago con ojos de alguien que quiere aprender y ser ms
conscientedeloquelesucede.Miladomentalyintelectualtomanconscienciade
lainformacinconlacualvoyatenerquetrabajar. Porqueelnicoautntico
poder que tengo, es el poder sobre m mismo; soy creador de mi vida.
Cuantomsconscienteestoy,mspuedohacerloscambiosapropiados.
Desdehaceunsigloymsparticularmentedesdeloscincuentaltimosaos,
hicimos un salto extraordinario desde el punto de vista tecnolgico, lo que
permiti,enmuchoscasos,mejorarnuestrascondicionesdevida.Apesardetodo
esteprogreso,unonosedamuybiencuentaquelaciencianotienelacontestacin
a todo y que existe en este planeta, muchos hombres y mujeres que padecen
enfermedades. Si vivimos en pases industrializados o en va de desarrollo,
debemoscuidardenosotrosyenfrentarnosconlaspreguntassiguientes:Quin
soy?Adndevoy?Culesmiobjetivoenlavida?
Esimportantequeuseestelibrocomouninstrumentodecomprensin,
investigacinytransformacin.Sitengoideasnuevasalleerestostextos,debo
sentirmelibredecompletarlosconmispropiaspalabras. Esteinstrumentodebe
volverseuninstrumentovivoalcualcadaunodenosotrospuedeaportarsu
contribucin. Es as como ciertos trozos del libro se redactaron a peticin de
personas que saban que estaba trabajando en esta obra. As, cuando se me
pregunt:Entulibro,tratastedelasalergiasalamantequilladecacahuete?La
respuestafue:No,perolohar.Sucedilomismoconvariasenfermedadesque
semepidiincluir.Esunadelasrazonesporlascualesellibroesaccesiblesobre
Internet2,nosloparaconsultarlo,sinotambinparahacerpuestasalda,aadirle
loscomentariosdeloslectores,etc.Estopermiteunadifusinaladimensindel
planeta.

DireccinInternet:atmainc.com

11

Porlotantolesdeseo:Buenalectura!
JacquesMartel
Psicoterapeuta.

12

Generalidades.
Este libro constituye un documento de investigacin sobre el aspecto
metafsico (pensamientos, sentimientos, emociones) de las dolencias y
enfermedades.SepondraldaenelfuturoysepodrverenlaredInternet 3.El
autorsedisculpaporcualquiererrorquehubiesepodidohacerseeinvitaallectora
queleparticipedichoserroresdirectamenteenlapginaInternetoporescrito.
Elautordeestelibronopretendedarningnconsejomdicodirectamenteo
indirectamente. No pretende tampoco dar ningn diagnstico directamente o
indirectamente.Lasideascontenidasenestelibrolosonattulodeinformacin,
como posibilidad de investigacin de una dolencia o de una enfermedad para
ayudaralapropiapersona,almdicotratanteoalterapeutaacomprendermejorel
origendeladolenciaodelaenfermedad.
Las afirmaciones contenidas en este libro figuran slo a ttulo de
informacin.Elautoresconscientedelhechoquelasdolenciasyenfermedades
tratadasenestelibrosecontemplanapartirdeunenfoquemetafsicodeladolencia
odelaenfermedadyquevariosotrosaspectosrelativosalasaludpuedenestar
relacionados.Elautoresconscientedelhechoquelasenfermedadespuedenser
muchomscomplejasqueloqueestexplicado.
Elenfoquesimplificadodeciertasenfermedadescomoelcncer,ladiabetes,
etc.,facilitarallectorlaaperturadeunapuertaparabuscarlacausametafsicade
ladolenciaodelaenfermedadconunprofesionaldelasalud.Laideadeeste
diccionarioesprimeroempezarconunenfoquesencillodeladolenciaodela
enfermedadparaquelainformacinsealamsaccesibleposiblealacomprensin
de un mayor nmero de gente. Este enfoque quiere ser complementario de
cualquierenfoquealoptico4yholstico5.
Cualquier persona que quiera aportar cambios a un tratamiento existente
debera hablar de ello con su mdico tratante o su terapeuta profesional. Las
personas que viven situaciones de enfermedades como la diabetes (insulino
dependiente),lasenfermedadescardiacas(necesitandocomprimidosadiario),etc.,
deberntenerunconsejomdicoantesdeaportarcambiosasumedicacin,por
msquecreanquehanhalladolacausadesuenfermedadypormsquecrean
queahoratodoestsolucionadoybajocontrol.
3

ladireccinanteriorponiendowwwantes.
Aloptico:queusauntratamientomdicoconelfindecombatirlaenfermedad.Estetrminosirvehabitualmente
paradesignarlamedicinaconvencional.
5
Holstico:quetieneencuentaelaspectoglobaldelapersona,esdecirelaspectofsico,mentalyemocionale
inclusoaveces,elaspectoespiritual.
4

13

Sinembargo,lapersonaqueutilizaestelibroparasuinformacin,lohace
parasmismayestensuplenoderecho.Elautoryeleditordeclinantoda
responsabilidadporlosactosquepodrandarsedespusdelalecturadeestelibroy
quepodranllevarallectorahacergestosotomardecisionespudiendoirencontra
desubienestar.
Seusaelmasculinoeneltextoparasimplificaryaliviarlaescrituray,salvo
enelcasodeciertasenfermedadespropiasaloshombresoalasmujeres,eltexto
redactadoenmasculinosedirigetantoalasmujerescomoaloshombres.
Mifacultadmentalfuncionaavecesconloshomnimos,palabrasquetienen
elmismoocasielmismosonidocuandoselaspronunciacomoporejemplo:mot
y maux [en francs palabra y males] {ejemplos en espaol: el trmino
(palabra)yeltrmino(superficiedelaaldea)yeltrmino(final)ytermino
(yoacabo)otermin(lacab);ovesaRomaovesaromaobesaRomaobesar
Oma;oaDiosyadis}.Losejemplosmencionadosenestelibroserefierenala
experienciadelautorensuentornodeQuebecendondelalenguahabladaesloque
sellamaelcanadienseFrancs.Sepodrnencontrarotrasreferenciasdeacuerdo
conotrosentornosdehablaFrancesaprobablementeypodrnseraadidas.Puede
Vd. tambin hallar asociaciones de palabras que podran hacerse y permitiran
explicar mejor los sentimientos, los pensamientos o las emociones que podran
estarvinculadasaunaenfermedad.
:Estesmboloquesehallaeneltextorepresentalaenergaasociadaalaimagen
mentaloasociadaaunaemocinvinculadaaunasituacinquehagopasardemi
cabezahacamicorazn!Seproduceentoncesobienunacuracinenelamor,o
bienelfortalecimientodeunaactitudpositiva.
La mayora de los trminos o expresiones siguientes estuvieron explicados en
notasdepiedepginacuandosepresentabanporprimeravez.Sinembargo,
comoqueundiccionarionoseleecomounanovela,elautorquisorecogerlas
explicacionescorrespondientesatrminosoexpresionesquesepuedeencontrar
aqu o ac en el texto para aclarar el sentido que l quiso darle para ciertos
trminos,comoporejemplolosqueseusanenellenguajedeQuebecperono
necesariamenteenunidiomaFrancsinternacional.
Dealer:procededeltrminoInglsdealquesignificaunbuennegocio.Aqu,
esto frecuentemente significa responder a un reto o bien componer con los
acontecimientosolassituacionesdelavidaquesepresentan.

14

Estar correcto: expresin que significa estar de acuerdo con mis valores
personales, queestn enarmona onoconlasde lasociedad, oconlasdela
sociedadenlacualestoyviviendoyconlascualesmeidentifico.
Groundado:procededeltrminoInglsgroundquesignificatierra.Aqu,estose
refierealhechodesentirseconectadoconlatierraoelmundomaterial.Estopuede
querer referirse a alguien que es realista en oposicin con otra persona que
describiramoscomoestandoenlasnubesensentidofigurado.
Integrar: hace referencia al hecho de asimilar una situacin o unaidea en mi
interior.Cuandoestoserefiereaunaheridaemocionalyquedigoqueintegrla
situacin,estosignificaquecurtotalmentelaheridainternaqueestabavinculadaa
esta situacin y que hice la toma de consciencia correspondiente a dicha
experiencia.
Miburbuja:expresinusadaparahacerreferenciaalespacioquemerodeayque
mepertenece,miespaciovitalanivelenergtico.
MiYosuperior:estoserefierealapartesuperiordemmismoquesellama
consciencia,alma,etc.
Miguainterior:igualcomoparalaexplicacindelyosuperior,estoserefierea
estapartequeestdentromoyquepuedeguiarme,siestoformapartedemi
creencia.
Ocultacin:elhechodeborrardemimemoriaconscienteodemisensibilidad.
Pattern:procededeltrminoInglspatternquesignificaaqu unesquemade
pensamientoquehacequeserepitanacontecimientosenmivida.
Psquico:quesesitaalniveldemispensamientos,alnivelmental.
Reencarnacin: es un aspecto cada vez ms tratado en los nuevos enfoques
teraputicosyeslaraznporlacuallehacereferenciaelautordevezencuando.
Sinembargo,elautorquierequeellectorsesientatotalmentelibredeadherir,ono,
adichaideasabiendoquelasmencioneshechasreferentealareencarnacinslose
hacenamerottuloinformativo.
YinyYang:ElYineselnombrequesedaenmedicinaChinaalaenergade
polaridadnegativa,femeninaointuitiva;elYangeselquesedaalaenergade
polaridadpositiva,masculinaoracional.Sehallanestostrminos,YinyYang,en
acupunturaentreotrasdisciplinas.CuandoseusanlostrminosYinyYangenel
15

texto, se refieren a la polaridad energtica o al aspecto intuitivo o racional en


nosotrosenvezdelaacupuntura.
Tcnica de integracin por pronunciacin monosilbica rtmica y secuencial.

Puedoservirmedelasinformacionescontenidasenellibroparaefectuarcambios
alniveldemisemociones.Procediendoalejercicioquesigue,puedoactivarmi
memoriaemotivayhacerque,desdemicabezahacamicoraznunapartede
lasemocionesestcuradaenelamor.
Setratadequecojayoeltextodeunadolenciaodeunaenfermedadyquelolea
slaba por slaba, tomando por lo menos un segundo por slaba. Por ejemplo,
tomemoslaenfermedadsiguiente:laartritis.Eltextoquesigue:
ARTRITIS(engeneral)
Laartritis est definidacomo siendolainflamacindeunaarticulacin.Puede
afectarcadaunadelaspartesdelsistemalocomotorhumano:trtesedeloshuesos,
ligamentos, los tendones o los msculos. Se caracteriza por la inflamacin, la
rigidez muscular y dolor todo lo cual corresponde en el plano metafsico a:
encierre,crtica,pena,tristezaoira.
Setransformaen:
ARTRITIS(engeneral)
Laartritisestdefinidacomosiendolainflamacindeunaarticula
cin.Puedeafectarcadaunadelaspartesdelsistemalocomotor hu
mano:trtesedeloshuesos,ligamentos,lostendonesolosmsculos.
Secaracterizaporlainflamacin,larigidezmuscularydolortodolo
cualcorrespondeenelplanometafsicoa:encierre,crtica,pena,
tristezaoira
Ysigolalecturaconeltextocompletoqueleoenellibro.Esmuyimportanteir
muy despacio, cuanto ms una slaba por segundo o ms despacio an. No es
importantequemepreguntesimiintelectocomprende,ono,laspalabrasolas
frases que pronuncio. Puede que hayan emociones de pena o tristeza que se
manifiestenduranteelejercicio:setratadeponeramorenlasituacin.Puedocoger
eltextodeunaenfermedadquetengoactualmenteodeunaenfermedadqueyatuve
odeunaenfermedadquepodratemercontraer.Siyovivoemocionesduranteel
ejercicio,puedovolverenlmstardeduranteeldauotroda,hastaqueyano
vivaemocionesyquemesientacmodoconeltexto.
16

Puedo hacer este ejercicio, si quiero, despus de una meditacin o despus de


escucharunamsicarelajanteodeunarelajacindirigida.Puedohacerelejercicio,
tambin,tomandoeltextodelprefaciooeltextodeintroduccin.
Lasinformacionesquesiguentiendenadarmsexplicacionessobreelusodedicha
tcnica. Primero precisemos que para m el trmino integracin se refiere al
hechodevolverseconscienteensuser;estosignifica,enciertamedidacuracin
enelsentidoenelcualladolenciaolaenfermedadslosonunmensajequeme
mandaelcuerpoparaayudarmeatomarconscienciadeloqueestoyviviendoen
estemomento.
UtilicestatcnicaprimeroenlostalleresdeVolveraencontraralNiodentro
desquedoydesdemarzo1993.Seusacuandoeladultoescribeunacartaasu
niointeriorycuandoelniointeriorcontestaaladulto.
Qusucededurantelaaplicacindeestatcnicaqueconsistealeerslabapor
slabaeltexto,tardandocomomnimounsegundoporslaba?Primerohayque
comprender quecuantomsrpidoleo,mssesitamilecturaalniveldemi
mental,enmicabeza.Ycuantomslentamentelea,msestencontactolalectura
conelcentrodeenergadelcorazntambinllamadochakradelcorazn. Todas
las dolencias y las enfermedades son interpretaciones, conscientes o
inconscientes, que hice en cuanto a una situacin o una persona, de una
carencia de amor. Entonces, es como si este mensaje, o incluso esta herida
podramosdecir,hubieseestadograbadaenelniveldelamorquecorrespondepara
elserhumanoalcentrodeenergadelcorazn.
Misheridasconrelacinaunacarenciadeamorestngrabadasenmicoraznbajo
forma de rechazo, abandono, ira, incomprensin, tristeza, decepcin, etc. Para
poder hacer el cambio de este mensaje grabado adentro mo, debo activar la
informacin en el punto del principio, es decir, debo estar en contacto con la
carpetaquehacequedichaheridaregistrunainformacinqueseactivacadavez
que una situacin similar se produce en mi vida. Es como si la situacin me
permitiera activar la emocin porque est puesta en resonancia por el
acontecimientoqueseproduce.
As,cuandoactivoenmicoraznlasituacinquemecauspena,tristeza,ira,etc.
abroaselcentrodeenergadelcoraznparaquedejeentrarlaenergadeamor
que aporta la curacin y por el mismo hecho, la toma de consciencia que la
acompaaoviceversa.
Paraqueelejerciciodepronunciacinseamseficaz,meimaginoquemispalabras
salendemalniveldelcorazncomosiunabocasehallasealniveldemicorazn.
17

Aconsecuencia,puedequesientaenelcorazndelejerciciobienunhormigueoen
diferentes partes de mi cuerpo, corrientes de calor que pueden pasearse en
diferentes partes demi cuerpo;tambin,pena,tristeza ocualquier otrotipode
emocinpuedenaflorar.Bastaconmantenerlacalmasifuertesemocionesdepena
otristezasemanifiestanporquelascosashabitualmenteestnbajocontrolyes
comosimicuerposupieraloqueescapazdecoger.
Siporunmotivouotro,tuviesetemoraviviremociones,puedohacerelejercicio
teniendoaunapersonaquepuedasostenermeenloqueestoyviviendo,oseauna
personaresponsableounterapeuta.
Cmo estn clasificadas las dolencias y enfermedades?

Engeneral,figuranenlatabladecontenidos,porordenalfabticodeladolenciao
enfermedadcomoporejemplo:
ABASIA
Aunquemismsculosytodomimecanismodelandarnomecausenningn
malestar,slopuedoandarparcialmenteosoyincapazdeello.Esmisistemade
mandosituadoenelcerebeloquepuedeestarafectado,bienporunalesin,un
trastornovascularountumor.Estoprocedeavecesdeungranmiedorelacionado
con mis pensamientos, que tuvo por efecto el dejarme petrificado in situ. Este
miedooculpabilidadestenconexinconelhechodeprogresarenlavida.Sera
buenoqueencuentrelacausa deestainseguridadodeesteculpabilidadyque
desarrollemsconfianzaenm.Puedoempezaravisualizarmeandandocadavez
msfcilmente,almismotiempoqueampliomisentimientodefeenm.Tambin
tomo consciencia de que la vida me aporta los instrumentos necesarios a mi
progreso.
ABDOMEN (ver: VIENTRE)
ABORTO (ver: PARTO ABORTO)
ABSCESO O EMPIEMA (en general).
Un absceso es un tipo de infeccin caracterizada por la formacin y la
acumulacindepusacuestadetejidosnormalmenteconstituidos.Sueleproducir
unsaliente(unbulto)yloencuentrosolamentesobreeltejidocorporalosobreun
rgano.Elabscesoindicaquemanifiestounarespuestaalacleraoaunaherida
emocional, aun sentimiento de irritacin, de confrontacin, de venganza, de
18

incapacidadodefracaso(elpusestconectadoconlosfluidosdemicuerpoya
misemociones).Frecuentemente,esunexcesodeirritacinodedisgustoqueno
consigoexpresarconrelacinam,aunapersonaounasituacin.Pensamientos
malsanos,quepuedenirhastalavenganzayquefermentan,producirninfeccin
y pus. Esta frustracin contenida puede presentarse para finalizar con una
situacin, es decir reventar el absceso. Puede producir en m una revolucin
mental(igualcomounhinchazn)causandoelvacoyelagotamiento.Estetipode
infeccin(absceso)esnicamenteunamanifestacin(ounacreacin)delomental,
demispensamientos.Yaestiempoquepaseaotracosa,quecambiedeactitudsi
quieromejorarmisuerteymicuerpo,antesdequesemanifiesteunainfeccin
msgeneralizada.Adems,elabscesocorrespondeaunpesarprofundo,inclusoa
unadesesperanzainteriorquecausarnunsentimientoprofundodeimpotenciao
defracaso.Puedenseguirelvacoyelagotamiento.Semanifiestaenelorigendela
pena,esdecirquelaemocinvividaestasociadaalafuncinyalapartedel
cuerpoendondesemanifiestael absceso.Porejemplo,sisesitaenmi pierna,
estconectadoconlasresistenciasylosconflictos,locualmeindicaquedebo
orientarmividaenciertasdirecciones.Sisesitaalniveldemisojos,setratade
unadificultadenverquiensoy,loquesoy,adondevoyyloqueadvieneparam.
Alniveldelospies,tengodificultades,planteamientosomiedosconectadosconel
porveniroconsuconcepcin.Enmisorejas,esalgoqueoigo.Enmiscaderas,
tengo dificultad en lanzarme en la vida, etc. Todo esto est conectado con la
destrezaenaguantarmedepie,aexpresarmiindependenciaymilibertad.Acepto
alniveldelcorazndejarfinalizarmismiedos,misinseguridades,mistemores
ymiabscesofinalizartambinl.Elabscesosuperficialqueestaccesibleala
vistayaltactocorrespondeaunarabiareferenteasituaciones demividaque
puedenestarfcilmenteidentificables.Poseetambinunacorrespondenciaconla
partedelcuerpoafectadatalcomoelcuello,laespalda,losdedos,etc.Elabsceso
profundo puede encontrarse en el interior de mi cuerpo y corresponde a una
decepcinconrelacinasentimientosmsprofundosdemiser.Segnsuposicin,
unabscesopuedetenerconsecuenciasgraves.Porejemplo,sisesitaenelnivel
delcerebro,estconectadoconmiindividualidadylaideaquemehagodem
mismo;enelniveldelospulmones,estconectadoalavida;enelniveldelos
riones,conlosmiedos;enelniveldelhgado,conlacrtica.Puedoencontrarel
porqu esta clera puntual llega en mi vida yendo a ver el significado
correspondientealaparterelacionada.Aspuedoponermsamorycomprensin
conrelacinalasituacinquemellevaviviresteenfado.Elabscesocomoun
botndecamisadesignaunoovariosabscesossuperficialesqueestnconectados
con otro absceso profundo o a tejidos ms profundos. Es pues invisible a ojo
desnudo. As, mi cuerpo me dice que mi clera ahora est afectando mi vida
exterioreinterior.Escomosidicha irritacin meperforaseelcuerpoyme
expresara la necesidad apremiante de curar estas heridas mediante el amor. El
19

absceso caliente suele conllevar una reaccin inflamatoria y puede formarse


rpidamente. El hecho que frecuentemente el absceso est rodeado de una
membranaindicaperfectamentequeestoprocededeunpensamientonobenfico
queprovocaira.Elabscesofronopresentareaccininflamatoriaysuprogresin
msbieneslenta.PuededeberseahongosoalbacilodeKoch.Estetipodeabsceso
indicaquemiclerasemanifiestabajoformadedecepcinoderesignacinfrente
aunasituacin.Acepto losnuevospensamientosdeamory memantengo
abierto, a nivel corazn, a mi entorno, en vez de fijar mi atencin sobre mis
antiguas heridas, en mi pasado o en ciertas formas de venganza. Tomando
conscienciadeesteprocesodeaceptacin,elabscesoentoncesestlistopara
desaparecerparasiempre.
ABURRIMIENTO (ver tambin: DEPRESIN, MELANCOLA)
Tanprontocomodigomeaburro(mehagoburro),esquenousomifuerza
omipotencial.Porqusiemprenecesitolacompaadelosdemscomoestmulo?
Elaburrimientoesmelancola,yalargotrmino,puedellevarmealadepresin
nerviosasinoreacciono.Lamelancolaestvinculadaaunacarencia,aunvaco
quesientoenmivida.Tomoconscienciadeesteestado.Debodejarmeguiarpormi
yosuperioryaquetodoslosrecursosestnenm.Aceptoestaralaescuchade
mivozinterior.Lameditacinytratamientosenergticospuedenayudarme.Me
pertenecedirigirmividaporquesoyenteroyautnomoenmiuniverso.
ACCIDENTE
El accidente suelesersinnimode culpabilidad.Estconectadoconmis
culpabilidades,conmimododepensaryconmifuncionamientoenlasociedad.
Tambindenotaciertareaccinhacalaautoridad,inclusovariosaspectosdela
violencia.Puedesucederquetengadificultadenafirmarmefrenteaestaautoridad,
a hablar de mis necesidades, mis puntos de vista, etc. Entonces me hago
violenciaammismo.Elaccidenteindicaunanecesidaddirectaeinmediatade
pasar a la accin. La necesidad inconsciente de cambio es tan grande que el
pensamiento usa de una situacin extrema, incluso dramtica para que tome
conscienciaquedeboprobablementecambiarladireccinqueactualmenteestoy
tomando.Esunaformadeautocastigoconscienteoinconsciente.Lapartedel
cuerpoheridaduranteelaccidentehabitualmenteyaestenfermaodebilitada,bien
por una enfermedad, una dolencia, un corte, una quemadura o cualquier
predisposicinalosaccidentes.El accidente mepermiteobservarestadebilidad
hacindolasubiralasuperficie.Elaccidentetambinesmiincapacidadavermey
aaceptarmetalcomosoy.Yaquesoyresponsableal100%demisactosyde
mividaentera,puedoexplicarmemselporqu meheatradotalformade
accidente.Atrado,diceVd.?S,porquetodoestovienedemispensamientosms
profundos, de mis patterns o esquemas de pensamiento de infancia. Es muy
20

posiblequemeatraigacastigos si,hoy,tengolasensacindehaceralgoydeno
estar correcto. Exactamente como en mi infancia; me castigaban cuando no
estaba correcto. Est esto grabado en mi mental y es tiempo de cambiar mi
actitud.Elladomoraldelserhumanolollevaacastigarsesisesienteculpable,
de aqu el dolor, las aflicciones y los accidentes. Es capital saber que puedo
sentirmeculpableenunasituacincualquiera siyslo squehagodaoaotra
persona. En todas las dems situaciones, soy responsable pero no culpable.
Debo recordarme que soy mi propia autoridad (en el sentido de individuo).
Necesitotomarmilugareneluniverso.Debocesardehacermeviolencia.Comoya
loescribanteriormente,el accidente estvinculadoala culpabilidad ysta,al
miedo con relacin a una situacin. El miedo a no estar correcto se percibe
frecuentementebajoelaspectodelaculpabilidadenvezdeldelaresponsabilidad.
Frecuentementeel accidente meobligaacesar ofrenarmisactividades.Sigue
algnperododeplanteamiento.Mantenindomeabiertoyobjetivoconrelacina
mmismo,descubrirrpidamentelaolasrazonesdedichoaccidente.Perdel
control de la situacin? Es para m el momento de cambiar de orientacin ?
Tengodificultadenescucharlossignosinterioresomiintuicin,detalmodoque
me atraigo un signo radical en el plano fsico? Observ cmo se produjo el
accidente?Culeramiestadoantesydespus?Esmuyimportantevolveraver
las condiciones que rodean el accidente; analizo las palabras usadas y tomo
conscienciaqueponenenevidencialoquevivoenelmomentodel accidente.
Observotodoslossignosysmbolosdeestasituacin(accidente)yescuchomi
vozinteriorparaencontrarunasolucinquemeevitarprobablementeempeorar
todoesto.Lapredisposicinalosaccidentesesunestadoqueseproducedurante
una relacin conflictual con la realidad, la incapacidad de estar plenamente
presenteyconscientedeluniversotalycomosepresentaam.Escomosiquisiera
estarenotrolugar.Estoydesconectadodeloquesucedealrededormo,quizs
porqueencuentromirealidadinaceptableodifcildevivir.Necesitoestarmejor
conectadosobremmismoparadescubrirmiseguridadymiconfianzainteriores.
ACCIDENTE CEREBRO VASCULAR (A.C.V.)(ver: CEREBRO
ACCIDENTE CEREBRO VASCULAR [A.C.V.])
ACIDOSIS (ver tambin: GOTA, REUMA).
Elcidosueleconectarseconloqueroeelmetalyconloqueesamargo
(acidezpsquica).As,laacidosisindicaquerehusasimilarunasituacinque
seacumulaahoraenunnivelinconsciente,conllevandoenelplanocorporalun
granporcentajedeacidezenlasangreoenellquidoenelcualbaanlasclulas.
Asimilar significa resolver, tratar, arreglar cualquier problema, situacin, o
conflictoquememolesta,querechazo,queenvenenamiexistencia!Porejemplo,
puedopreguntarmeculeslasituacin(frecuentementedenaturalezaemocional)
21

quemeroeinteriormenteyquemevuelvetanamargofrentealavida.Esposible
quevivaahoraenunasituacinquehaceaflorarenminsatisfaccinreferentealas
relacionesquetenaconmimadre.Inclusopuedovivirunainsatisfaccinsimilar
conmishijos,amigosoempleadosparaloscualesmesientocomounamadre.
Laacidosis metablicaqueserefiereamicuerpoengeneralreflejarmilado
amargo haca la vida en general. La acidosis respiratoria o acidosis gaseosa
provienedelhechoquenoeliminosuficientementeelgascarbnicodurantemi
respiracin. As mi lado amargo en la vida ms bien tiene relacin con mis
relacionesylagentequemerodea.Enelcasodelaacidosislctica,hallamosuna
cantidad excesiva de cido lctico en la sangre. Ya que la sangre transporta
normalmentelaalegra,resultaqueelladoamargoenlavidaytodoloquesucede
en ella me afectan enormemente. Por esto, puedo encontrar este estado si soy
diabtico(locualcorrespondeatristezaprofunda),sivivoinsuficienciarenal(que
correspondeagrandesmiedosfrentealavida),sitengoleucemia,unaformade
cncerdelasangre(quecorrespondealhechoquesiempretengolasensacinde
tenerquelucharenlavida).Enelcasoextremo,la reuma eslaconsecuencia
directayavecesinevitabledeunexcesodeacidezqueeslaacidosis.Acepto
verytrataralniveldelcoraznlassituacionesdemivida,inclusosimeirritany
me molestan. Poniendo la atencin sobre un proceso consciente de apertura y
aceptacin,puedoevitarsoportarfsicamenteestaenfermedaddolorosa(tanto
como su tratamiento!). Resuelvo las situaciones para vivir ms la alegra, la
liberacinylapazinterior.
ACN (ver: PIEL ACN).
ACUFENO (ver: OREJAS - ACUFENO)
ACROMEGALIA (ver: HUESO ACROMEGALIA)
ACROQUERATOSIS (ver: PIEL ACROQUERATOSIS)
ADDISON6 (enfermedad de) (ver tambin: SUPRARRENALES
[dolencias de cpsulas])
La enfermedad de Addison se caracteriza por una insuficiencia de las
glndulassuprarrenales7.Esunaformadedecepcinconrelacinammismo.
Es un estado extremo de desnutricin emocional y espiritual. Tener esta
6

ADDISON(Thomas):MdicoInglsquien,en1855,describilaenfermedadcomounainsuficienciasuprarrenal
lenta.
7
Glndulassuprarrenales:Glndulasendocrinassituadassobrelosriones,enformadepirmideycuyafuncines
ladeproduciradrenalinaqueregularizaelpulsoylapresinsanguneaprincipalmente.Sonestasglndulaslasque,
cuandomividaoladeotroestenpeligro,puedenpermitirmedesarrollarunafuerzasobrehumanaparami
supervivencia.

22

enfermedadpuedesignificarquevivmuchosometidoaunouotrodemispadres
enmiinfancia.Puedequemehayasentidoagredidopsquicamente,quevivaun
traumatismoounairritacinintensaenlacualpodasentirquemividaestabaen
peligro.Esteestadomellevavivirunagraninseguridadfrentealporvenirya
dudarmuchodemiscapacidades.Estaenfermedadsedistingueporunaactitud
sumamentederrotista,unacarenciadeobjetivoodeinterspormoporloqueme
rodea.Vivomuchodeansiedadyantipata.Estiempoquetomemilugar,quevaya
hacadelanteyquemanifiestelaenergaparaelaborarciertosobjetivospersonales
sinesperarlaaprobacinyelacuerdodemientorno,pocoimportalaimportancia
de mi gestin (mi objetivo). Intento encontrar un mtodo que me ayudar a
conectarmsconmiyointeriorqueposeerecursosilimitadosyunaaltaestimade
s.
ADENITIS (ver tambin: GANGLIO [linftico], INFLAMACIN)
Cuandotengounainflamacindeungangliodelsistemalinftico,esporque
vivoinseguridadvinculadaalmiedoenelplanoafectivo.Lapartedelcuerpoque
estafectadamedaunaindicacindelaspectodemividareferido.Intentoconocer
lafuentedemipenaparaayudarmeatomarconscienciadelmiedoquemehabitay
desarrollarmiconfianzaparasuperarestaemocin.
ADENOIDES (ver tambin: PECHOS [dolencias en los ])
Deunmodogeneral,unadenomaesuntumorbenignoqueseencuentraen
unaglndula.Comocualquiertumor,estoprocededeungolpeemocionalqueseha
solidificadoen la parte del cuerpo que est conectada con elgolpe emocional,
trtese del pncreas, el hgado, un pecho, un rin, la prstata e incluso las
glndulasendocrinas.Acepto lossucesos pasados,parapermitirmeirhaca
delante,conplenaconfianza.
ADENOPATIA (ver tambin GANGLIO [linftico], INFECCIONES,
INFLAMACIN, TUMOR(ES)).
La adenopata secaracterizaporunaumentodelvolumendelosganglios
linfticosypuedeprocederdeunainflamacin,untumorounainfeccin.Yaque
los ganglios del sistema linftico actan como pequeos riones del sistema
linftico,estosignificaquevivounestrsoungolpeemocionalvinculadoamiedos
enelplanoafectivo.Asesquemesientobloqueado,cogidoeneseplano.La
reginafectadameindicaconmsprecisinelaspectodemividaqueesttocado,
trtese del trax, el abdomen, el cuello, la axila, la ingle. Tengo ventaja en
desarrollarmiautonomaymiconfianzaparatomarmividaenmano!
ADHERENCIA
Siadhierodeunmodoexcesivo,osiquedoapegadoaideasnegativas,
malsanasoinadecuadas,arencor,aodio,aclerafrenteaalguien,aculpabilidad,
23

asueosilusorios,aunavidademasiadocentradasobreelmediofamiliarosobreel
hogar (por ejemplo, la madre incubadora o protectora), corro el riesgo de
manifestaradherenciasalniveldelasvsceras8.Algunassonpatolgicas,esdecir
que se producen despus de una inflamacin vinculada a rabia o a un tumor
cualquiera que procede de emociones inhibidas. Dichas adherencias se
caracterizanporunaformadesoldaduradedosrganosdelcuerpoporuntejido
conjuntivo.Decidosoltarelpasado,lasviejasideasylospensamientosnegativos
quefrenanmifelicidad.Vivoenelmomentopresenteysaboreocadainstantede
mivida.
ADORMECIMIENTO TORPOR
Eladormecimientosecaracterizaporunmiembroqueesinsensible,pesado,
conhormigueoygeneralmentenopuedemoverse.Eladormecimientofsicoesel
reflejodemiadormecimientomental.Padezco,estoyherido.Medueletantoque
deciddejardesentir.Adormezcomissentimientos.Meretiroporqueunaparte
mafueheridayqueyanolaquierosentir.Porlotanto,mehagomenossensible.
Se trata de una muerte parcial para evitarme el sufrimiento. Estas heridas
frecuentementeexistendesdelainfancia,seagravanconelpasodelosaosylas
llevocomounpeso.Noaprendaamarmeymecerralamorenvezdecompartir
esteamorymicompasin.Esunaformadehuida.Estopuederepresentarparam
unafrialdadinterior,undeseoderetenerelamor,unafaltadedinamismo.Laparte
demicuerpoafectadaascomoellado(izquierdooderecho)mepermiteidentificar
elnivelenquesitomiherida.Micuerpomedicequeestiempoderecobrarmi
espontaneidadfrentealavida,quedebodespertarenmmsamor,dinamismoy
entusiasmosobreelaspectodemividaencuestin.Asaumentarmicalidadde
vidaenestemundo,loalocualtengoderecho.Acepto,aquyahora,aprender
aamarmemsyabrirmerealmentealamor,envezde detener esteamorymi
compasin.Levantolabarreraquehabainstaladodesdetantotiempo.Cuantoms
aprendoaamar,mscomprendoquehayunretorno:reciboamoryamistad.Esta
serenidad que buscaba desde siempre en el exterior ahora brota de m y la
comunicoalosdems.
AFONA o EXTINCIN DE VOZ.
Lavozeslaexpresindes,lacreatividad.Unaemocindemasiadogrande
(desamparo,inquietud)puedellevarmeayanosaberqudecirniculdireccin
tomar,nicmointerpretarestadireccinconrelacinalaemocinvivida.Puede
queestafuerteemocinhayasidovividaenelplanosexualyserepercutems
directamenteenlagargantaoenlascuerdasvocalesporque,enciertomodo,mi
segundocentrodeenerga(sexual)estvinculadomsdirectamentealagarganta,
miquintocentrodeenerga.Detodosmodos,misensibilidad(hiperemotividad)
8

Visceras:Trminogeneralparadesignarcadaunodelosrganoscontenidosenelinteriordelcrneo,delacaja
torcicaodelabdomen.

24

est herida y ya no consigo decir nada.! Tengo el aliento cortado! Si disperso


demasiadomisenergas,enparticulardespusdeungolpeemocional,unvaco
interior se crear debido a mi desasosiego interior y los sonidos estarn
engullidosporestevaco.Porlotantoesmuyimportanteparamquevuelvaa
conectar con el soplo de mi comunicacin interior. Aun es posible que esta
experienciameprotejaporqueestoyenunestadoenqueyanodebohablar,yano
puedodecirsecretos.Usodeunmodosanomivozymiscuerdasvocales?Hede
quedarmesilenciosodurantealgntiempo?Avecessedice:lapalabraesdeplatay
elsilencioesdeoroAprendoaexpresarmisemociones,micreatividadymis
ideasdelmodoenquemejormesiento,enelrespetodemiscapacidades.
AFTA (ver: BOCA AFTA)
AGITACIN (ver tambin: HIPERACTIVIDAD)
Laagitacinesunestadoquemealcanzarsisoyunapersonamuynerviosa
peroqueconsiguesinembargocanalizarsusenergaslomejorquepuede!Est
prxima a un estado de emergencia, un proceso de exteriorizacin de las
emociones,generalmenteungritodealarmapararevelaralosdemscmome
siento interiormente: cogido, desconfiado, miedoso en ciertas situaciones,
emprendedorperogeneralmentepocohbilysobretodomuymolestoparalagente
quemerodea!Siestoymuyagitadofsicamenteeinteriormente,puedoviviruna
formadedesequilibrioporquetengodificultadenmantenermecentrado(estable
yanclado)sobremmismo;utilizopuesesteestadoinconscientementeporque
necesitoaumentarmiconfianzaenm,probarmequepuedotenerxito,atrayendo
la atencin: Mrenme, vean! Mantengo la calma, comunico verbalmente mis
sentimientosymisnecesidadesytodoirporlomejor.
AGORAFOBIA (ver tambin: ANGUSTIA, MUERTE, MIEDO).
La agorafobia vienedelaspalabrasgriegasAGORA(quesignifica plaza
pblica)yPHOBUS(temor).Eselpnicodelamuchedumbreytambinelde
tenerlemiedo.Estfuertementevinculadoaunmiedoinconscientealamuerte.Si
estoy afectado de agorafobia, soy probablemente una persona muy sensible,
receptivaavariosniveles(sobretodopsquico9)ydotadadeunaimaginacinmuy
frtil.Soymuydependienteenelplanoafectivoyverdaderamentenohecortado
conel(los)lazo(s)materno(s).Tengodificultadendiscernirmiverdaderoyodelo
queyoestoycreandoenelplanopsquico,esdecirformaspensamientos,locual
alimentamisangustias.Soysimilarauna esponja:absorbolasemocionesajenas
(sobretodolosmiedos)sindiscernir,filtrarniprotegerloquemepertenecedel
resto,yaumentotantomismiedoscomolosdelosdems.Porlotanto,tengo
tendencia a replegarme sobre m mismo, a sentirme responsable de todo, a
9

Psquico:Alniveldemispensamientos,alnivelmental.

25

comunicar muy poco , salvo con la persona en quien tengo enormemente


confianza,conquienmesientoenseguridad:measlopuesportemoraapartarme
deestaformadeseguridad.Inclusopuedopensarestarafectadodelocuraydebo
cesardecreerestoloantesposible.Meesfcilcontrolartodoestoenunlugar
dondeestoyentotalseguridad.Sinembargo,tanprontocomodejoste,todose
derrumba!Meangustioportodo,comosimismiedosmeinvadiesenalpuntode
tener la sensacin de perder el control! Tan pronto como una experiencia me
estimulademasiadofuerte(nacimiento,accidente,fallecimiento,catstrofe),corro
elriesgodeahondarmeanmsenmisangustias(ruidos,gente,etc.)sinjams
hallar ninguna situacin duradera, de donde la ampliacin de la agorafobia.
Adems,miniveldecrticaestaltoporquevivomuchainseguridad,hagopoca
confianzaycreoquelascosasysituacionesnovantanbiencomoquisiese:porlo
tanto,critico.Laagorafobiasobreentiendeavecesunconflictoconmimadre,a
quiencriticoconstantemente.Debocambiarmiactitudahoramismo.Acepto
mismiedosunoporuno,talescomoson,porquesqueenvenenanmivida,pero
puedentambinhacermeprogresar!Aprendoaamarmeyaaceptarme,aamar
miladomaternoyprotector(madre),aconstruirmeununiversofsicoeinterior
lleno de felicidad, sin crtica ni dependencia. Tengo tambin la ventaja de
expresarmeenmicomunicacinverbalymicreatividad.Debosuperareltemora
perder mi lugaryestar enarmonaconmigomismo! Sigoresponsabledemi
felicidad,inclusositengotendenciaacreerquedeterminotantolafelicidadcomo
la desgracia de los dems. Acepto coger los riesgos y anticiparme a mis
temoresquefrenanmipodercreativo.Estomeayudaracontrolarmejormividay
misimpulsosinteriores.Unasexualidadequilibradayactivatendrlaventajade
hacermesoltarestafijacinemocionalligadaalplanomental.
AGOTAMIENTO (ver BURNOUT)
AGRESIVIDAD (ver tambin: ANGUSTIA, ANSIEDAD, NERVIOS [crisis
de], NERVOSIDAD, SANGRE-HIPOGLICEMIA)
Laagresividadesunacantidaddeenergainhibidaquederiva,lamayorade
veces, de una frustracin vivida en una experiencia o una situacin.
Frecuentemente,esinconscienteyestafrustracinpuedeenvenenartantomividay
miexistenciaquecojolaagresividadcomomediodeexpresin(laagresividades
unmediodeexpresin),comovlvuladetodaestapresinexistentedentrodem.
Esunmediodedefendermeporquemesientoatacado,norespetado,abusado,en
tensin, incomprendido. Quiero que me comprendan! Puede serme difcil
quedarmeabiertoydejarfluirlaenerga.Esevidentequeunapersonaenestadode
agresividadsecortatemporalmente,ymsparticularmente,delaenergaespiritual
y de la apertura de corazn. Es un estado innato, instantneo e irreflexivo de
defensayproteccin.Si soyagresivo,suelotener elsentimientodeser elms
26

fuerteporquedecidoatacarelprimero.Mepongoenunestadodedominacin
sumisinyestoydesgarradofrenteam mismo.Lapersonafrenteamacta
comounespejo.Proyectounapartemaqueannoheaceptadoyestopulsa
mimando10.Consecuencia?Seamplificalaexcitacin,subelatensinyahoraes
lamanifestacindelacontraccinmuscular!Estoyrgidoytenso,enguardia,listo
parasaltarcontralosataques!Estoyaladefensivayluchocontramisangustias.
Qu hacer? Quedarse abierto, trabajar consigo en primer lugar, escuchar mi
intuicinymivozinteriorquemeprotegenyguanmispasos.
AGUJETAS
La agujeta es una sensacin de estar dolorido, de tener los msculos
cansadosdespus deunesfuerzoinacostumbradooenlafaseinicialdeciertas
infeccionesvirales(gripe,hepatitis,etc.).Laagujetasemanifiestaporunbloqueo
deenergaalniveldelosmsculos.Estconectadaconeldolorsentidocuandouna
necesidad(afectivaoemocional)nofuesatisfechaLaenergaalmacenadaalnivel
de mis msculos se expresa generalmente por un movimiento o un gesto pero
bloqueo inconscientemente esta energa al nivel del msculo. Estoy pues en
reaccin interior (dolor mental) y lo expreso fsicamente por estas agujetas.
Necesitocambiarmicomportamiento,movermeenlabuenadireccinsinestaren
reaccin.Laagujetasesitaadiferentesnivelesylosdoloresseosindicanun
dolorinternomuyprofundo.Estoyafectadohastalomshondodemiser,demi
espacio.Aceptoserloquesoy,vivirelinstantepresente,sabiendoquelavida
colmainteriormentemisnecesidadesmsfundamentales.
AHOGOS (ver: RESPIRACIN AHOGOS)
ALCOHOLISMO (ver tambin: ALERGIAS [en general], CNCER DE LA
LENGUA,
CIGARILLO,
DEPENDENCIA,
DROGA,
SANGREHIPOGLICEMIA)
Elabusodebebidasalcohlicascausaunconjuntodetrastornos:fsicamente,
el cuerpo cambia y se crispa, las capacidades y el funcionamiento del cerebro
disminuyen,lossistemasnerviososymuscularsevuelventensosyexcesivamente
tensos. Similar a todas las dems formas de dependencia, el alcoholismo se
manifiesta principalmente en el momento en que necesito colmar un vaco
afectivoointeriorprofundo,unaspectodemmismoqueenvenenarealmente
mi existencia! Puedo beber abusivamente por diversos motivos: huir de mi
realidad,cualquiersealasituacin(conflictouotra)porqueestonomeconviene;
resistiramismiedos,alaautoridad(sobretodopaterna)yalagenteaquienamo
porquejustamentetengomiedoderevelarmetalcomosoy,alaluzdelda;darme
valor paraseguir adelante,hablar,afrontaralagente(notenque,siestoyalgo
10

Pulsamimando:expresinquesignificaquesepuedeactivarunelementoquedisparaunareaccinounaemocin.

27

feeling11, suelo estar ms abierto porque estoy menos fijado sobre mis
inhibiciones12)darmeunsentimientodepotenciayfuerza;darmepoderenuna
relacinafectivaporquemiestadoseguramentemolestaralotro.Yanoveolas
situacionesquepuedenserpeligrosasparam.Vivociertasoledad,aislamiento,
culpabilidad,angustiainterior,incomprensin yalguna formadeabandono
(familiaruotro)ytengoelsentimientodeserunapersonaintil,sinvalor,inepta,
inferior e incapaz de ser y actuar para m y para los dems. Entonces, tengo
necesidad de un pequeo tnico. Frecuentemente, quiero huir una situacin
conflictualoquemehacedaoahogandomipenaocualquierotraemocincon
lacualtengodificultaddedealer13.Elalcoholismopuedeestarvinculadoaunao
variassituacionesquemecreanunatensin.Cuandotomounvasodealcohol,esta
tensindisminuyeenunprimertiempoygraboentonceslarelacinquepareceser:
tensinalcoholbienestar.Locualquieredecirquecuandovivounatensin,la
informacin inscrita en mi cerebro es la de tomar una copa de alcohol para
sentirmemejor.Luego,esposiblequedesarrolleunautomatismoyque,cadavez
quevivaunatensin,lainformacininscritaenmicerebrosealadetomaruna
copadealcoholparasentirmemejor.Unodelosorgenesdel alcoholismo esla
dificultadqueconoc,siendonio,detratarconunafamiliaendondeunodesus
miembros(frecuentementeelpadreolamadre)es alcohlico.Generalmentehay
msdiscordia,avecesviolenciafsicaypsicolgicaoabusodetodotipo.Incluso
puedo querer intentar disociarme de la familia en la cual estoy y que no me
conviene.Entonces,bajamisentidomoral:losespectculosdediscordiafrecuentes
provocan en m una desvalorizacin de las imgenes parentales y la no
integracindelasestructurasticas.Enciertasfamiliastambin,lacostumbredel
alcoholestfavorecidapor laeducacin,losadultoshabiendoacostumbradoal
nioqueeraabeberporjuegoohaciendolaabsorcinhabitualyregulardebebida
comocosanormal.Lostrastornosneurticosylasalteracionesdelapersonalidad
quederivansonfactorespoderososdealcoholismoenmquemehevueltoadulto.
Incluso carencias nutricionales pueden llevar a la bsqueda de una
complementariedad alimentaria aportada por el alcohol. El alcoholismo puede
procedertambindemiestadoqueeshipoglicmico,sobretodoquelasmolculas
de alcohol pueden transformarse rpidamente en azcar sanguneo
(temporalmente). Es lo que explica que si soy alcohlico pero que dejo de
consumir,puedoencontrarmebebiendounaimpresionantecantidaddecaf,fuente
deestimulanteporlacafena,ydeazcar,pastelesopostres(fuentedeazcar).A
vecesmepondrafumarconsiderablementeporqueelcigarrillomedalafuentede
estimulante(aceleracindelritmocardacoquenecesitoparasentirmeenforma.Es
importanteparamdescubrirloquecausaestatristezavinculadaalahipoglicemia
enmivida,yaquenoheresueltolacausa.Otracausadelalcoholismopuedeser
11

Expresinusadaparadecirqueunapersonaempiezaaestarbajoelefectodelalcoholoalgoebria.
Fenmenodeparn,bloqueodeunprocesopsicolgico.
13
dealer:Anglicismoquesignificaaceptarelreto.
12

28

lasalergias.Aspuedoseralcohlicodecoacsolamente,deginebra,dewhiskyde
centeno o Escocs. Parece que slo este tipo de bebida pueda satisfacerme.
Entonces es probable que est alrgico a uno u otro de los ingredientes que
sirvieronafabricarestabebidaparticular,queseaenuncasoeltrigo,lacebada,el
centeno, etc. Puedo entonces preguntarme a qu o a quin estoy alrgico? El
alcoholismopuedetambinprocederdeunapersonaosituacinquenoacept
cuandoerajoven.Sifuivctimadecontactossexualesindeseables,odeloscuales
mesientoculpable,viniendodeunapersona alcohlica cuandoerajoven,puede
quepensandoenestasituacin,estomelleveabeber.Sinoaceptlaclerade
mipadrealcohlico,puedemuybienque,porunfenmenodeasociacin,tenga
enfadoscomomipadreyquemevuelvaalcohlico.Esascomopuedobeberpara
olvidarmispreocupaciones,mipasadoyelporvenirperosobretodoelpresente.
Huyo sin cesar y me creo un universo ilusorio y de fantasa, una forma de
exaltacin artificial para huir del mundo fsico y as disociar una realidad
frecuentementedifcildeunsueocontinuamenteinsatisfecho.Pierdoentoncesel
contacto, para algn tiempo, con mis sentimientos de soledad, incomprensin,
impotencia,denosercomolosdems,derechazodem.Puedoabandonarmis
responsabilidades.Yestoyliberadoduranteuntiempo.Solovaempeorandoesta
situacinamedidaquemanifiestounadependenciadelalcohol(odelasdrogas)
porqueestoycadavezmsinsatisfechodemiexistencia.Quierosepararmedela
realidadyndomeenunmundodeilusin,perocuandoestoysereno,larealidad
meapareceanmsdifcildeviviryentoncesseproduceladepresin.Notengo
todami claridadmental,sobretodocuandomevuelvodependiente,delmismo
tipodedependenciaafectivaquequizsmehubiesegustadoteneryquetengola
sensacin que mi padre o mi madre nunca me dieron. Ser amado
incondicionalmente Es tiempo de fijarme en mis bellas cualidades fsicas y
espirituales,inclusosielpasadofuedolorosoparamyque,enciertamanera,mi
botella fue mi mejor amigo. A partir de ahora, acepto ordenar mi vida,
empezaraamarmiscualidadesyloquesoy.Estoyahoraenlavadelxito.Estar
en condiciones de respetarme ms y hallar ms fcilmente la solucin a mis
problemas(experiencias)envezdeestarenunestadotemporalocasipermanente
dehuidaydesesperacin.
ALERGIAS (en general) (ver tambin: ALCOHOLISMO, ASMA).
La alergia es el estado de un sujeto que, por contacto anterior con un
antgeno apropiado, ha adquirido la propiedad de reaccionar cuando se da una
segundaagresinporelmismoantgeno,deunmododiferente,frecuentemente
msviolentoeincontrolable.Una alergia esunarespuestasobreactivadadel
sistema inmunitario a un antgeno exterior. La sustancia alergena no conlleva
reaccinenlamayoradelagenteperoestidentificadaparamcomopeligrosa
por el sistema inmunitario. Esta respuesta, resultado de una causa interior,
29

frecuentementeeselmedioporelcualelcuerpomeindicaquevivounestadode
agresividadydehostilidadconrelacinaunapersonaoaunasituacincualquiera,
enfuncindelainterpretacinporlomentaldeloquevivocomotanespecial.Las
alergias(incluyendolafiebredelheno)sonparecidasalasma,perolareaccinse
sitamsalniveldelosojos,narizygarganta,envezdelospulmonesodelpecho.
Aqutengo alergia?Quesloquemesobreactivatanto?Quesloque
causarealmentelairritacinylafuerterespuestaemocionaldemicuerpo(ganasde
sonarme, lagrimeo de los ojos, ganas de llorar)? Son todas las respuestas del
sistemaemocional,laliberacindeemocionessuprimidasporunareaccindemi
cuerpo. ste reacciona a algo, una especie de smbolo mental, porque intenta
rechazar,ocultar14oignorarloquelemolesta.Rechazopuesunapartemaqueme
agrede.Eselmedioqueusoparaexpresarmisemociones,para echarafueraal
malo!Nadapuedepararestareaccinderechazoporelmomento,yestonoes
racionalporqueestoformapartedelcampodelinstintoydelinconsciente.Escomo
si hubiese algo que est fuera de contexto aqu, un enemigo que moleste mis
barrerasdeproteccin.Esteenemigocoge poder,mipoderdeserydehacer,y
estomeimpresiona.Estoyimpresionadoporelpoderdelosdemsendetrimento
delmo.Mesientoamenazadoporciertomiedoinconscientequerehusovivir.Las
alergiastiendenpuesaindicarunprofundoniveldeintolerancia,quizselmiedo
a tener que participar plenamente a la vida, a liberarme de todas las muletas
emotivasquemesoportanyquemepermitiranvivirlaautosuficiencia.Quizs
tengadificultadendiscernir,elegir,tomarellugarquemetoca.Lacaracterstica
propiaalapersona alrgica esfrecuentementelasensacindenoser bastante
correcta!Quieroatraerytenerlaatencin,lasimpatayelsoportedelosdems.
Usolaalergiaparateneramor?Esposible.Encualquiercaso,unacosaessegura:
tengounaalergiaporquerehusounapartedemmismoymiluchainconsciente
esgrande.Esmiresistencia,mimododedecirno.Tengoelpoderdedecidirlo
queesconvenienteparamenmipropiouniverso.Losindividuospuedenestar
alrgicosatodotipodecosas;alimentos,objetos,formas,olores.Todoloque,de
cercaodelejos,implicaloscincosentidos(particularmenteelolfatoqueesel
sentidomspoderosodesdeelpuntodevistadelamemoria).Mimentalgrabauna
multitud de sensaciones buenas o malas para m. Es muy posible que, si soy
alrgicoaalgo,esquemimentallohaasociadoaciertorecuerdobuenoomaloy
quemiinstintolorechazaenestemomento.La alergia aparecefrecuentemente
despusdeunacontecimientoenquemehesentidoseparadodeunacosa,deun
animal,unapersona.Cuandovuelvoavivirunasituacinquemerecuerdaeste
acontecimientotristeydesgarradorparam,tendrestaalergiaporque,enalguna
parte,micuerpo(missentidos)seacuerdandetodoytodoestgrabadoenmis
clulas.Silasituacinvividaseacompaadeunagranangustia,sonlossenosque
estarn afectados (resfriado del heno, estornudos). Si predomina el miedo, mi
14

Ocultar:Borrardemimemoriaconscienteodemisensibilidad.

30

alergiaseexpresarmsporlatos(dificultadenrespirar)ysiesmsbienlapropia
separacinque viv difcilmente,las reacciones alrgenas se encontrarn msa
niveldelapiel(eczema,urticaria,dermitis,etc.)La alergia aunalimento(por
ejemplo:elazcar,elalcoholenelalcohlico)estvinculadaaunaexperienciaen
lacual,estandocolocadoenunasituacinenquetuvequedecirnoaloquems
megustaba,siguelafrustracinymevuelvoalrgicoaella.Frecuentementeesun
miedoalonuevoyalaaventura,unafaltadeconfianzafrentealavida.Mesiento
ahoraobligadoaprivarmedeestetipodealegra,pensandoquelavidaesalgo
ordinario,sinreto.Quesloquequieroevitarafrontar?Quesloquemehace
reaccionartanto?Quesloqueespantatantointeriormente?Existealgodelo
cualdesconfoalpuntodemantenerloapartadodem?Mepareceque,enciertos
casos,mimentalhaceunaasociacindeciertassituacionesconsustanciasporel
biesdeloshomnimos.As,situvequedejarlamanzana(demibarrio)paraira
trabajaraotraciudad,mehevueltoalrgicoala manzana (fruta).Algunosaos
ms tarde, habiendo aceptado e integrado este cambio, la alergia ha
desaparecido.Acontinuacin,damosotroejemplo:unrecinnacidoalrgicoalos
pressacs(melocotonesencatalnoseaunafruta).Porqu?Porquesumadre
impacienteyapuntodedaraluz,algunosmesesantes,habadichoasucnyuge
cataln: de presa, o farem tard al hospital! Aqu, la palabra pressac es
homnimacasidepresa.As,enlabasedela

alergia

,siemprehayunaemocin
deirritabilidadodefrustracinasociadaaunproductooaunasituacinporloque
representa para recordarme este malestar que debo integrar o conscienciar.
Empezandoaaceptaraniveldecoraznmividaymismiedos,elprocesode
integracin se activar y las alergias que complican mi existencia volvern al
universo.Necesitopazinteriorysobretodoamor.Memantengoabiertoytodoir
paralomejor.
ALERGIA AL ACEITE o A LA MANTEQUILLA DE CACAHUETE
Cuandotomoaceitedecacahueteomantequilladecacahuete,estoactiva
enmlamemoriadeunacontecimientoenelcual,dejoven,melohicieronpasar
muymal.Puedequehayatenidolasensacinentoncesquememandabanhacer
unostrabajossinestarlosuficientementeremunerado(endinero,enafecto,etc.).
Estaba interiormente furioso de trabajar por unos peanuts (cacahuetes)15.
Intentandoencontrarelsucesoolassituacionesenquepudevivirtalsentimiento,
podrmodificarmimemoriaemotivayregularizarlasituacin.Tomoconsciencia
detodoslosaspectosdemividaenquemesientoayudadoyenquelavidaespara
mrelativamentefcil,yamplioeste sentimientodebienestar paraayudarmea
equilibrarlossentimientosdedificultadquepudegrabarenmiinfancia.

15

EnQuebec(Canad),seusafrecuentementelapalabraInglesapeanutsporcacahuetes.trabajarporpeanuts
(cacahuetes)significatrabajarpormuypocacosa.

31

ALERGIA A LOS ANIMALES (en general)


Los animales poseen un instinto y una sexualidad innatas y cada animal
representaunafacetadelamor.Porlotanto,unaalergiaaunanimal,engeneral,
correspondeaciertaresistenciaconrelacinalaspectoinstintivoosexualqueel
animalrepresentaparam.Aceptotodoslosaspectosdelasexualidad.Acepto
tambinmisdeseos,tantoconscientescomoinconscientes,porqueformanparte
integrantedemiser.
ALERGIA A LOS ANTIBITICOS
El antibitico16 (anti = contra / bio = vida) es un cuerpo ( de origen
bacteriano u otro) especializado en la lucha contra los microbios. Pero los
microbiosrepresentanellostambinlavida.Haypuescontradiccin.Elantibitico
teniendo el papel de matar cierta forma de vida en m, porqu he de estar
alrgicoalosantibiticos?Probablementeporquerechazociertasformasdevida,
ciertassituaciones vivas demiexistencia(experienciasdiversasymsomenos
agradables).Tengounatomadeconscienciaporhacerlacualesaceptardichas
experienciasporque,aunquepuedanresultardifcilesparam,tengounaleccin
porsacardestas.Tengofeenmipotencialcreativo.
ALERGIA A LOS CABALLOS
Elcaballoestasociadoalaspectoinstintivodelasexualidad.Comoque
el instinto est ms vinculado al primer chakra (o coxis)17, el miedo puede
traducirseporeldetenerinstintossexualesbajosymanifestarseporunaalergia
aesteanimalfuerteyfogoso.Puedequeencuentrequelasexualidadnoesbastante
espiritualparam,sisientoenelfondodemeldeseodevivirestasexperiencias
paraayudarmeatraermejorlaespiritualidadenlamateria.Meabropuesanuevas
experienciasquevanaayudarmeaconocermemejoryadesarrollarme.
ALERGIA FIEBRE DEL HENO (RESFRIADO RINITIS ALERGICA)
Esta alergia est fundamentalmente enla base de unareaccin al polen,
granovegetalformandoelelementomasculinodelaflor.Esteelementomasculino
transportaelsmbolodelareproduccinydelafertilizacin.Esta alergia afecta
habitualmentelosojos,lanariz,ylossenos.La alergia estenlabasedeuna
resistenciaaunasituacinenmivida,deunrecuerdopasado.Esposible,pues,que
resista frecuentemente inconscientemente a una forma de la sexualidad o a
ciertosaspectosdesta,sobretodosiloquesientoconrelacinalasexualidadno
huelebien.Esciertoquepuedoatraermeunaalergiaporvariasrazonesperouna
16

Antibitico:sedebeeldescubrimientodelapenicilinaen1928aSir.AlexanderFleming,mdicoybacterilogo
Britnico(Darve1881Londres1955),lacualslopodrextraerseen1939yprobarseenloshumanosen1941;
conesto,seabrilaeradelosantibiticos.
17
Primerchakra:Elprimerchakraesunodelossieteprincipalescentrosdeenergaenelcuerpoyestsituadoal
niveldelcoxis,enlabasedelacolumnavertebral.

32

cosaessegura:meahogoomesientoahogadoporunasituacin.Merebelo,algo
nomeconvieneenabsolutoperolohagoapesarmoparacomplacer,ymeahogo.
Cambiodeideabajolainfluenciadealguien,estoylistoparacualquiercosa,yme
ahogo.Pudosentirme ahogado enlascosaspordeciroporhacer,sobretodosi
tengodificultadentomarmilugaryadecirno.Tengotendenciaavivirtambin
mucha culpabilidad. Manipulo para tener lo que quiero Ve Vd. la
programacin?Puedesertantomental(maneradellorar)comodelasestaciones
porqueelperodoestivalesidealparalamanifestacindeestaalergia,sobretodosi
tengonecesidaddeunaexcusaparatrabajarcadavezmenosduranteestebello
perododelao!Ciertaspersonastienenla fiebredelheno(resfriadorinitis
alrgica)duranteperodosalcanzandohastasieteaos!Estiempodecambiaresto
inmediatamenteoporlomenosquetomeconscienciadeello.Tomoconscienciade
que el resfriado del heno (rinitis alrgica) puede volverse un medio que me
permiteevitarciertassituaciones,porqueseraincapazdetodosmodosderehusar
hacerunatareaoiraunlugarenparticular.Porlotanto,ahora,tengounabuena
razn! Tomando mi espacio vital, mi burbuja de luz 18, estoy en medida de
abrirme a los dems bajo mi verdadero aspecto, sin artfices. La primera
manifestacin del resfriado del heno puede haber sido inconscientemente
conectada con un suceso sealado y en el cual viv probablemente fuertes
emociones.Cuandovuelveelmismoperododelao,meacuerdoomsbien,mi
cuerposeacuerda,yapareceelresfriadodelheno.Espuesimportantequetome
conscienciadeestesucesoparaquepuedaromperelpatterndelaenfermedad:en
elfuturo,yanolanecesitarporquehehecholatomadeconscienciaquedeba
hacer.Elresfriadodelhenosloeraunasealparaayudarmeapararyahallarla
profundacausademimalestar.Voyasentirmemslibre,msdueodemivida.
Acepto lo que es bueno para m, aunque esto implique cierta forma de
sexualidadnuevaydesconocida.Squetodoesposible,enelamorylaarmona.
ALERGIA A LOS FRESONES
La alergia a los fresones est asociada a una frustracin que pone en
contradiccin el sentimiento de amor y de placer, ste siendo una necesidad
fundamental para m,al mismo ttuloque elalimentooelsueo.Esta alergia
puedeprocederdeunacontecimientoquevivobienqueprecisamentenovivcon
relacinaunapersonaoaunasituacin.Unsentimientodeodioydefrustracin
aliadoaculpabilidadpuedehacernacerenmestaalergia.Elplacerformapartede
mi vida, como ser humano, a tal punto que las fuertes crisis de alergia a los
fresones pueden provocar una incapacidad a respirar pudiendo conducir a la
muerte.Lospulmonesrepresentanlavidaypongoasenevidencia,conmicrisis,
unanecesidadfundamentalenmividaquenohasidocolmada.Esimportanteque
tomeconscienciademisnecesidadesfundamentalessabiendoquecuandotomoun
18

Miburbujadeluz:Puedoimaginarmeyvisualizarmeenunaburbujadeluz,locualaumentamiproteccin
frenteamientornoymedamsconfianza.

33

alimento,tengoamorhacam.Cuandodisfruto,tambintengoamorhacam.La
alergiaalosfresonespuedeprocedertambindeunsentimientoquepudesentir
paraunapersonaoqueunapersonasintihacam.Porejemplo,pudedecirme
paramisadentros:nomegustasufresa!queriendosignificarconestaexpresin
quesurostronomeessimptico,quenomegustaestapersona.Deboaceptar
quecadaunodenosotrostienesuindividualidadconsuscualidadesysus
miedosyqueencadaser,hayunaestrellaquebrilla.
ALERGIA A LOS GATOS.
El gato es un animal mucho ms sensible a lo que es invisible que la
mayoradelaspersonas.Puedequeuna alergiaalosgatos estmsenrelacin
con el aspecto de mi personalidad que puede sentir cosas (lado o aspecto
femenino),sinque,poresto,tengapruebasconcretasdeello.Porlotantopuedo
vivirciertaintoleranciaporquenotengoprueba(enelplanoracional).Espues
claroqueel gato(olagata) simbolizael ladosexualfemenino19,ytodaslas
cualidadesfemeninastalescomoladulzura,elencantoylaternura.Debopues
aceptarunodedichosaspectosqueprobablementerehusoobienrecibirobien
manifestar.
NOTA:Esta sensibilidadfelina seexplicaporelhechoquelamorfologa
delgatoposeeunsistemanerviososituadosobretodoenperiferiadelcuerpo,
contrariamente al ser humano cuyo sistema nervioso est ms dentro del
cuerpo.Estamorfologaparticularhacequeelgatoseams sensible alas
vibracionesoalasenergasparticularesdelaspersonasydeloslugareso,si
sequiere,deloqueemanaunapersonaounlugar.
ALERGIA A LA LECHE o A LOS PRODUCTOS LCTEOS.
Lalecherepresentaelcontactoconlamadreyaenlosprimerosinstantesde
millegadaalmundo.Esunalimentocompletoquemepermitetenertodoslos
nutritivosquenecesitoparamicrecimientodurantelasprimerassemanasdemi
vida.Yaqueoriginalmente,obtengoestalechemedianteelcontactoconmimadre,
este alimento es adems significativo del amor que recibo de mi madre.
Entonces,sidentrodemientorno,hayunapersonaqueidentifiqu,seamimadreu
otrapersona,quejuegaelpapeldemadreyquesientofrustracinconrelacina
ellaenelpapelqueleprest,estopuedeexplicarelporqutengounaalergiaala
leche.Vivofrustracinreferentealaformadeatencineinclusodecrticadeesta
personatienehaca,locualhacedesagradableelcontactoquepuedatenercon
ella.Siesta alergia sedesarrollaalnacimiento,debocomprobarcualessonlos
miedosolasfrustracionesquepodavivirmimadremientrasmellevaba,haciendo
mossusmiedosofrustracionesquemellevaronavivirestaalergia.Estaatencin
19

Femenino:ver:FEMENINO(principio).

34

quemeprestanpodrahacermedecir:Porquinsetoma?Secree quees mi
madre?. Es importante para m poner amor en la situacin y armonizar mis
sentimientos con relacin a este nexo privilegiado y fundamental para la
supervivenciadelaespecieyqueestgrabadoenm,eldelnexodeunamadrecon
suhijo.
ALERGIA A LOS PECES O A LOS FRUTOS DE MAR.
Conozcolaexpresinser pezquesignificaquesoyunapersonaaquien
fcilmenteseengaa.As,mialergiatraduceperfectamentemisentimientode
frustracin frente a una o varias situaciones en que me encontr ingenuo o
novato.Debotomarmilugarytomarconscienciaquelavidaesunasecuenciade
experienciasparaaprender.Cuantomsaumentemiconfianzaenmymisentido
de las responsabilidades, ms se ira desvaneciendo este sentimiento e ir
desapareciendoestaalergia.
ALERGIA A LOS PERROS
Sedicequeel perro eselmejoramigodelhombre(delser humano),
entoncespuedopreguntarme,cuandovivoestetipodealergia,culeslapersonao
lasituacin,conrelacinalaamistad,quehacenacercleradentrodem.Sisoy
alrgicaalosperros,inclusopuedoviviragresividadeinclusociertaviolenciacon
relacinalasexualidadquevinculoconlaamistad.Puedequevivaunmalestar,sin
sabermuybiendefinirparamellugarquetomanlasexualidad,laamistadyel
amor. Este malestar hace subir en m clera que se manifiesta bajo forma de
alergia. Delimito los parmetros de la amistad, la defino para aclarar ciertas
situacionesdemividaquesehallanquizsdemomentoenunazonagris.Me
respetoenmisnecesidadesyenmiselecciones.
ALERGIA A LAS PICADURAS DE ABISPAS Y ABEJAS.
Seguramente, tengo la sensacin de estar constantemente pinchado o
criticadopormientornoinmediato.Yestoactasobremcomosimepicasen
constantemente.Cuandorealmentealgomepicafsicamente,estoactivaelodio
queheidoacumulandoenmentodasestassituacionesenquemesentaatacado.
Aprendoaocuparellugarquemecorrespondeyexaminolasmedidasquehayque
tomarparaquelacrticadisminuyaenmientornoyparaquepuedadesprenderme
msdeloquelosdemspuedanpensardem.
ALERGIA A LAS PLUMAS
Me he vuelto alrgico a una situacin o a una persona que me da la
sensacindeestarclavadoalsueloydenopodervolarparasentirmemslibrey
feliz? Entonces, es muy probable que viva ira vinculada al hecho de que
35

interiormente tengo el sentimiento de sentirme cogido entre una situacin


cualquieraylalibertadquebuscoparasermsfeliz.
ALERGIA AL POLEN (ver ALERGIA FIEBRE DEL HENO).
ALERGIA AL POLVO.
Elpolvoestconectadoconlasuciedadylaimpureza,siestoyalrgicoal
polvo,vivoinseguridadfrenteaaspectosdemividaquepuedocalificardesucios
eimpuros,yesmuyprobablequeestemiedosemanifiesteenmisexualidad.Si
soyalrgicoalpolvo,puedequetengaquetrabajarmuchoconmipropiaestima.
As,laexpresinusadaenlareliginErespolvoyenpolvoteconvertirstraduce
bienelsentimientodeinutilidadquepuedavivirosentirenalgunassituaciones.La
expresin todo se va en polvo permite tambin traducir el sentimiento de
inutilidadquepuedoalbergarfrentealoqueheemprendidooaloqueemprendo,
bienenelplanopsicolgico,afectivo(emocional)omaterial.Pormsquenotenga
sntoma fsico vinculado a una alergia al polvo, puede que sea una persona
manacadelalimpieza.Aqu,quierodecirdemodoexcesivo.Entoncespuedo
buscarculpartedempuedeopinarquemisexualidadessuciaopreguntarmesi
metemoqueestoseasucio.Aprendoavalorizarmeyavalorizartodoloquehago.
ALEXIA CONGNITA (ceguera de las palabras) (ver: OJOS ALEXIA
CONGNITA).
ALUCINACIONES (ver tambin: ALCOHOLISMO, DEPENDENCIA,
DROGA, TOXICOMANIA)
Cuando estoy desgastado fsicamente o moralmente, puedo hacerme una
montaadeideasnegras,frecuentementefalsas.As,puedoperderpieconloreal
sintenerconscienciadeello,puedodespegarmedeloreal.Confrontadoconuna
realidadquenoquierover,meinventounaaunquepuedaserfalsa.Entoncespuedo
darme razn y probar mi propia interpretacin de esta realidad que no puedo
aceptar . Estas interpretaciones, estos mundos imaginarios, creados detodas
partespormmismo,puedentambinhacerrecalcarmispropiosmiedos.Puedo
teneralucinacionescuandovivounniveldeestrsmuyelevado.Si,porejemplo,
estoy buscando un documento que necesito absolutamente y cuya prdida
representara millones de dlares, mi cerebro podr crear una imagen de este
documento(holograma)quemeparecermuyrealyqueduranteunosmomentos,
harbajarminiveldeestrs.Despusdndomecuentadequealucin,puedoahora
pensarmsclaramenteypodrobienpedirquesemeayudeabuscarloobien
explorarotroslugaresendondesehallarprobablementeeldocumento.Sinesta
alucinacin,hubieseseguidoestandopresodemiestadodeestrs.Enloquea
drogasserefiere,provocanunestadodeconscienciaenexpansin.As,lapersona
36

puede experimentar dimensiones a las cuales no tiene acceso ordinariamente.


Porqutomodroga?Esunahuidademissufrimientosinterioresquenoconsigo,
porfaltadeayuda,afrontar?Puedovolvermedependientededrogas,lasquesean.
Puedendarmeunestadodebienestartemporal.Perounavezstraight,oseade
vueltaalonormal,yanoeselmismorefrn.Entonces,adndebuscar?Enuno
mismo.Soloseentraahconelamorytambinporsupropiocaminopersonaly
espiritual.Unaespiritualidadquemeliberadelascadenasdelpasadoyquemeda
milibertadymiautonoma.Puedetambinquedespusdeunaccidente,unestrs
intensoosimplementedemidesarrollopersonalyespiritual,mitercerojoseabra
cadavezms,locualmepermitevercoloresalrededordelaspersonas,corrientes
deenergaenelespacioopresenciastraslcidas(nomateriales)enmientorno.As
puedotenerlasensacindequealucinosobretodoporquemisensibilidadsueleser
mayorcuandotengoestetipodepercepcin.Entonces,hagoconfianzaymesiento
rodeado de luz blanca y dorada, sabiendo que estoy constantemente guiado y
protegido.Cadavezmegustamsdescubriryexperimentarlaverdaderarealidad,
elYoSoy.
ALZHEIMER20 (enfermedad de) (ver tambin AMNESIA)
Estaenfermedadconllevaunadegeneracindelasclulasdelcerebroquese
traduceporunaprdidaprogresivadelasfacultadesintelectualesquellevanaun
estado demencial (la locura). Esta enfermedad de los tiempos modernos,
caracterizadaprincipalmenteporeldeseoinconscientedeacabarconsuvida,de
acabardeunavezportodas,dedejarestemundoodehuirdemirealidad,sedebe
alaincapacidadcrnicadeaceptar ,deenfrentarmeodedealer21 conesta
mismarealidad,conlassituacionesdelavidaporquetengomiedoymeduele.As
mevuelvoinsensibleamientornoyamisemocionesinteriores.Mealetargo,
meabstraigoyaslavidameparecemsfcil.ElAlzheimerserefiereaesta
formadedemencia.Estamanifestacinconllevaprincipalmenteladegradacinde
lamemoria,laconfusinmentalylaincapacidaddeexpresarmeconclaridad,la
violencia,ciertasformasdeinconscienciadelentorno,inclusouncomportamiento
deinocenciaprximoaldelnio.Ladesesperacin,lairritabilidad,elmalde
vivirmellevanareplegarmesobremyavivirdentrodemiburbuja.Medejo
morirpocoapoco.Estaenfermedadmeindicaquetengoelmaldevivir,que
huyounasituacinquemedamiedo,meirritaomehiere.Esunasituacingravea
primeravista,delacualpuedoquedarmeinconscientemuchotiempo.Semeve
comounapersonanormalyequilibradaperoseobservaquemerepliegosobre
mpordesesperacin,cleraofrustracin,locualmehaceinsensiblealmundoque
merodea.Meniegoasentirloquesucedealrededormoydentromo; prefiero
20

ALZHEIMER(Alois).Neuropatlogoalemnquedescribien1906alteracionesdelcerebrosobreunapersona
afectadadedemencia(locura).
21
DealerAnglicismosignificandoaceptarelreto.

37

dejarmeir.Puedotenermuchadificultadensoltarmisviejasideasyaqueesmuy
grande su cantidad en mi memoria! Y como que mi atencin est mucho ms
centradasobreelpasadoquesobreelinstantepresente,lamemoriaacortoplazo
sevuelvetotalmentedeficienteyse atrofia,sinaportarnadanuevonicreativo.
Consecuencia:lamemoria sedesgasta conviejascosasenvezdegenerarideas
nuevas y frescas. Desde el punto de vista mdico, los factores emocionales y
mentales as como sus correspondencias corporales (lquidos, sangre, tejido y
huesos) estn implicados en la manifestacin de dicha enfermedad. Cuando la
sangre est suprimida de ciertas reas del cerebro, ocurre una especie de
traumatismomental.Sonreaccionesmuyviolentasalnivelcerebral.Escomosiel
flujosanguneoseretirasededichasreas.Puedehaberunmiedoextremodetodas
las facetas de la vejez o del alba de la muerte, lo que conlleva un regreso
inconsciente haca un comportamiento infantil y la ocultacin22 del presente,
pasadoyporvenirparaignorarlos.Micuerpo,atacadoporladegeneracindelas
clulasdelcerebro,mepreparainconscientementeparaesteperodoenquedeber
marchar23.Estosetraduceporuncomportamientoinfantilenelcualmepermito
viviryrealizartodosmisfantasmasytodasmisfantasas.Elamoryelapoyoson
necesariosental experiencia.Vivoelmomentopresente yacepto soltar el
pasadoempezandoacuidarmedem!
AMENORREA (ausencia de las reglas) (ver: MENSTURACIONES
AMENORREA)
AMNESIA (ver tambin: MEMORIA [ fallos de ])
La amnesia es la prdida de mi memoria, parcial o total, tanto de las
informacionesyaadquiridasenelpasadocomodelaspresentes.La amnesia es
comparable a la enfermedad de Alzheimer bajo diversos aspectos. La persona
amnsicapadeceterriblementedelmomentopresenteensuvidaactual.Mideseo
dehuir ydemarcharestangrande(pocoimportalasituacinvivida)queme
repliegosobrempordolor,clera,incapacidadodesesperacinymeencierro
volvindomeinsensibleacasitodo.Meescapo,mealetargoomehagoinsensiblea
unapersonaoaunasituacin.Rehusovivirlassituacionesylasexperienciasde
todoslosdas,pocoimportasuintensidad.Eldolorinterioresproporcionalala
gravedaddelaamnesia,seastaparcial(ocultacin24mentalparcialdeimgenes
muydolorosasdelainfancia)ototal(tentativainconscientedetenerunanueva
vidayunnuevodeseodevivirporqueyanopuedovivirconestaprimeravida!).
Vergenza y culpabilidad pueden manifestarse, cualquier sea la razn. Intento
ignorarvariascosas,entrelascualesmifamiliayvariassituacionesdifciles.Estoy
22

Ocultacin:elhechodeborrardesumemoriaconscienteodesusensibilidad.
Marchar:Empleadoaqupreferentementealtrminomorir.
24
Ocultacin:elhechodeborrardesumemoriaconscienteodesusensibilidad.
23

38

msomenosseparadodelarealidadpresente.Elprocesodeaceptacinyde
integracin es muy importante porque el fenmeno de ocultacin de ciertas
experiencias por el mental puede jugarme pasadas en experiencias futuras. Es
posiblequevivaalgunassinsabernicomprenderporqumesuceden!Esunatoma
deconscienciadiariaconrelacinaloquesoyyaloquemequedaporarreglaren
mividaparavolveratomarcontactoconmiverdaderoyosuperior.
AMIGDALAS AMIGDALITIS (ver tambin: GARGANTA, INFECCIN)
Las amgdalas, que significan almendras forman parte del sistema
inmunitarioydelalinfa(lquidoquelimpiaelcuerpohumano),ysondefinidas
como filtros que controlan todo lo que circula al nivel de la garganta (lo cual
correspondealacreatividad,alacomunicacin).Cuandoestninflamadas,tengo
dificultad en tragar y corro el riesgo de ahogarme. Inhibo mis emociones y
ahogomicreatividad.Hayunasituacinquemeahogaatravslacualinhibomis
sentimientosdecleraydefrustracin.Unaamigdalitis(itis=clera)semanifiesta
generalmentecuandomi realidadquetragometrae unaintensa irritacinatal
puntoquemisfiltros(lasamgdalas)nopuedencogerlotodoysevuelvenrojasde
clerapornopoderalcanzarunobjetivointeriorqueestoyviviendo.Puedeserel
miedodenopoderalcanzarunobjetivoenperspectivaodenosercapazderealizar
algoimportanteparam,porfaltadetiempoodeoportunidad.Tengolasensacin
queestoyapuntodelograralgoquemeescaro(untrabajo,uncnyuge,uncoche,
etc.)perotemoquesemeescapeyquedebahacersinello,oqueslopueda
disfrutardeelloenparteonototalmente,locualparamesdurodetragar.Un
conflictointeriormuyintensoestahogadoynoexpresado.Esunbloqueo,el
cierre de esta va de comunicacin. Tengo yo la sensacin de que hay una
situacinquetragoequivocadamente?Vivoenrebelinconunapersonacercana
am(familia,escuela,trabajo)inclusoenrevuelta.Sisoyunnio,frecuentemente
tengoamigdalitisporqueannoestoybastanteconscientedeloquesucedeyno
tengocontrolsobrelosacontecimientos.Vivofrustracinvinculadaaloquedebo
tragarenlavida.Siquieroresolverlaamigdalitis,acepto lascosastales
comosonalrededormo,tomoeltiempodeaceptarlassituacionesquetrastornan
mivida,concalmayserenidad.Esposibleyfcilensearestaactitudalosnios
que estn preparados para ello. Observemos que la ablacin de las amgdalas
significalaaceptacin detragarlarealidadsinqueestfiltradaocensurada
(protegida)previamente.Esunacarenciadeproteccin.Debotratarestasituacin
deunmododiferentequeseramsarmoniosaparam.
AMPOLLAS (ver PIEL AMPOLLAS)
AMPUTACIN (ver tambin AUTOMUTILACIN)
La amputacin total o parcial de un miembro, que est practicada por
razonesaccidentalesomdicas(gangrena,tumor)esgeneralmentevinculadaauna
39

granculpabilidadfrenteaunaspectodemivida.Siseamputamipieizquierdo,
escomosimimiedoomiculpabilidadfuerantalesqueprefieromorirparala
direccinquehedetomaroparalaquetomenmividaafectiva;lapiernaderecha
serefiereamimiedooculpabilidadfrenteamisresponsabilidades,etc.Sivivouna
amputacin,esimportantequerecuerdequemicuerpo,energticamente,noest
amputado.As,sihetenidolapiernaderechaamputada,puedoponerelamor,la
comprensinylaintegracinparalatomadeconscienciaquedebohacerpara ir
msrpidamentehacadelanteenmisresponsabilidadescomosisiguieseteniendo
mipierna.Hagodesaparecertodaculpabilidad,sabiendoquesiempreactopara
lomejor.
ANDROPAUSIA (ver tambin: PRSTATA / [en general] / [dolores de ])
La andropausia, propia del hombre, corresponde a la menopausia en la
mujer, a pesar de que esto no corresponde a un cambio hormonal equivalente.
Todaslasinseguridadesvinculadasalavejez,alascapacidadessexuales,alos
sentimientosdeinutilidadydedebilidadsemanifiestaninteriormenteyfsicamente
pordoloresenlosrganosgenitales(enparticularlaprstata)yaunoodiversos
aspectos del concepto masculino. Como hombre, debo tomar mi lugar en el
universoenarmonaconcadaaspectodemipersona,elladofemeninocomoel
ladomasculino.
ANFETAMINA (consumo de) (ver: DROGA)
ANGINA (en general) (ver tambin: GARGANTA [dolores de])
Laanginasecaracterizaporunaprietoalniveldelagarganta,debidoauna
inflamacinagudadelafaringe.Hayalgoquenopasa,unaemocinbloqueada
que me impide decir a mi entorno mis verdaderas necesidades. Tengo el
sentimiento de que apretando la garganta (chakra o centro de energa de la
creatividadodelaexpresin),nopuedoexpresarloqueestoyviviendoyloque
siento para con los dems, y sigo poniendo intilmente la atencin sobre esta
creencia.Deboencontrarloquemellevapensarenesto.Habitualmentepuedo
encontrarunarespuestadentrodelasltimas48horaspreviasaldolor.Serauna
ligerairritacin(conductoinflamado)ounapequeafrustracin quenotrago y
quesubsistirhastaquecambiemiactitudymispensamientos?Noescuestinde
tragarestahistoriainclusosiestomeponeelfuegoalagarganta.Tambin
pueden ser pensamientos negros y negativos con relacin a alguien o a una
situacin. Hay algo que quiero absolutamente coger; como por ejemplo, un
nuevoempleo,unresultadoescolarexcepcionalquemeevitaraunasituacinen
dondedeberjustificarme,explicarmeorendircuentas?Pocoimportaelmotivo,
es tiempo de quedarse abierto y volver a abrir este mismo canal si mi viva
40

sensibilidadestuvoherida.Misnecesidadesfundamentalesdebenestarsatisfechas
y tengo derecho a ellas como todo el mundo. Me mantengo abierto a mis
necesidadesycentradosobremiserinteriorsiquieroevitarestetipodeanginaal
niveldelagarganta.
ANGINA DE PECHO o ANGOR (ver tambin: CORAZN).
Angina vienedelapalabralatinaANGENEquesignifica apretar.Esun
dolormuyvivoasociadoalareginprincipaldelcorazn(centroenergticodel
amor). Esta falta temporal de oxgeno al nivel de los msculos que rodean el
corazn aporta todas las consecuencias que conozco: insuficiencia del caudal
sanguneo en esta regin, intervencin quirrgica, puente, etc.El corazn
representa frecuentemente el motor o la mquina de mi sistema. Cuando doy
demasiadoamor(conunaactituddeapego),puedequeelcoraznsecansedetodas
estaspreocupacionesyqueyanosientasuficientealegra25enestassituaciones(de
aquelriegosanguneodisminuido).Siestoyensituacindeangina,posiblemente
tomo demasiado apecho lavidaylas cosas que hagoyquemegustan. Mis
inquietudes(tantocomomisalegras)estnexageradamenteampliadas:meirritoy
mehierenfcilmente,vivoinsatisfaccin,tristezaoirritacinconrelacinauna
situacinlacual,alfinal,noestangrave.Puedequerecibaunaprimerasealde
alarmademicuerpodespusdeestosestadosdeser:espasmosodolorqueperfora
elcorazn.stelanzaunS.O.S.paraquetomeconscienciadelossentimientosque
me habitan y del hecho que estoy de algn modo destruyndome con mis
pensamientos desacordes, poniendo en peligro mi armona interior, y dndome
malaconsciencia.Grandealegraspuedentambintraercrisisdeanginaporque,
enestemomento,elcentrodeenergadelamor(elcorazn)seabremsypuede
activarlamemoriadegrandespenasqueestnpresentesyasprovocarunacrisis
deangina.Hagoquizsmuchoporobligacinynoconalegrayplacer.As,deja
laalegradecircular.Escomosiprestaseatencinalosdems(sufelicidadysus
dolencias) en vez de ocuparme de mi propio bienestar primero. Mi ego es tan
presentey activo queestseparadodelatotalidaddelser,locualconllevaun
bloqueoenelplanoemocional.Esunaumentoinconscientedelaestimades
colocandocasiexclusivamentelaatencinsobrelosdems.Eselprincipiojudeo
cristianodelaentregaporelsacrificio.Daralosdems!Mevuelvovulnerabley
semanifiestaelmiedoaabrirmealosqueamo.Yanadamealcanza,pero
empiezanlosdolores!Espasmos,puntosenelcorazn,extremidadesfras(manos
ypies).Micuerpomeadvierteseriamentequealgovamal(esteavisosereconoce
mejor generalmente en el plano metafsico psquico que fsico).
Inconscientementepuedodeseardejarlavidaterrestreporquetengolasensacin
deestarahogadoporlaspreocupacionesyquenoscmosalirme,peroeltiempo
nonecesariamentehallegado!Qutemo,enelfondo?Lavidaesunintercambio
25

Alegra:Yaquelasangreestrelacionadaconlaalegra,unadisminucindelriegosanguneoexpresajustamente
estadisminucindelaalegravinculadaalamor.

41

continuo.Doytantocomorecibo,comolacontraccinyladilatacindelosvasos
sanguneos,sinovivoundesequilibrioymiatencindebevolveraesteequilibrio
necesarioaunavidasana.Esunprocesofundamentalenlaexistenciahumana
porque soy un ser divino que debe expresarse en este equilibrio. Mi toma de
conscienciaessta:Dejodetomarlavidaenserioymemantengoabierto!.Esfcil
porquenotengoganasdemorirsinoquetengoganasdevivir,deabrirmealamor
ydejarcualquierluchadepoder.Pongomiatencinsobrelosaspectoshermosos
delavida.Aprendoaamarmetalcomosoy:mienergavitalpodrasvolverala
vida.Sonlosprimerospasoshacaunrestablecimientoseriodeestaenfermedad.
Un ltimo punto que recalcar: vigilar todas las expresiones vinculadas con el
corazn: un corazn de piedra, un corazn duro, no tiene corazn, es un sin
corazn,etc.Cadaexpresineslaindicacindequesucedealgoquemerecemi
atencin
ANGIOMA PLANO (ver: MANCHAS DE VINO)
ANGUSTIA (ver tambin ANSIEDAD, CLAUSTROFOBIA)
Laangustiaestcaracterizadaporunestadodedesorientacinpsquicaenla
cualtengoelsentimientodeestar limitadoyrestringidoenmiespacio ysobre
todo ahogado enmis deseos. Sientomiespacio limitadopor fronteras que,en
realidad,noexisten.EstoycogidooMesientocogidoenunatrampa.Estoyde
acuerdoconelhechoquelagenteinvademiespaciopsquicoyestosemanifiesta
enmporunaespeciedeaprietointerior.Dejoentoncesdeladomisnecesidades
personalesparacomplacerprimeroalosdemsparaatraerelamorquenecesito
(aunquehayaotrosmodosdehacerlo).Elaprietomellevageneralmenteaampliar
misemocionesymiemotividadgeneralendetrimentodeunequilibrioadecuado.
Yaquevivoenlaniebla,laconfianzaenmsetambalea,ladesesperacinylagana
deyanolucharmsseinstalan.Culpuedeser lasituacin enquemesent
apretado cuando era joven de tal modo que reproduzco an fielmente este
pattern26 hoy?(observemosqueangustiayclaustrofobiasonsinnimosporla
palabraaprieto.).Esnaturalpormicuerpoparacolmarmisnecesidadespsquicas
fundamentales:lanecesidaddeaireparaviviryrespirar,elespacioentremylas
demspersonas,lalibertaddedecidirydiscernirloqueesbuenoparam.Si,a
partir de ahora, contesto a mis esperas frente a la vida en primer lugar, hay
muchasprobabilidadesparaquedejelasdelosdemsensusitio:as,estoyms
segurodeestardeacuerdoconellos!Ysinviolarsuespacio 27porquedeborecordar
que si me siento ahogado, es porque ahogo conscientemente o no a la gente
alrededor mo. Se manifiesta la angustia tambin como una espera inquieta y
opresiva,aprensindealgoquepodraocurrir,conunatensindifusa,espantosa
y generalmente sin nombre. Puede estar vinculada a una amenaza concreta
26

Pattern:esquemadepensamientoquehacequeserepitanacontecimientosenmivida.
Espacio:significaaqudejaralosdemslalibertaddepensamientoodeaccinyrespetarlos.

27

42

angustiosa(talcomolamuerte,catstrofepersonal,sancin)Setratamsdeun
miedo,generalmentevinculadoanadaqueseainmediatamenteperceptibleose
pueda expresar. Por esto las fuentes profundas de la angustia se encuentran
frecuentemente enel nioquefuiysevinculangeneralmente conelmiedoal
abandono, a perder el amor de un ser querido y al sufrimiento. Cuando me
encuentroenunasituacinsimilar,laangustiavuelveaaflorar.Cadavezqueuno
deestosmiedosreapareceoqueseviveunasituacinimaginariaorealista,esto
est captado por mi inconsciente como una seal de alarma: hay peligro! la
angustia reapareceanmsfuerte.Cuandosoynio,laangustiase manifiesta
frecuentemente por el miedo a la oscuridad y una tendencia a vivir una vida
solitaria.Apartirdeahora,usodediscernimiento,valoryconfianzaenlavidapara
respetarme y dejar ir a los dems a su espacio sin pesar, y borro de mi vida
cualquierremordimiento.Asvermsclaroyadelantarenlavidaconmucho
mslucidez.
ANO
El anoeselorificiodelrecto,ellugardondesueltoloqueyanonecesito.
Losproblemasaquestnconectadosconelhechoderetenerysoltar;porestosi
soy un nio que va estreido o si ensucio mis paales frecuentemente es para
vengarmedepadresqueconsiderocomoautoritarios,manipuladoresoabusivos.Es
lugardedescargadelasprincipalestoxinasdelcuerpohumano.Elanosesitaal
niveldelapelvis,cercanoalcoxisyalprimerchakraocentrodeenerga,elasiento
entreelyoyeluniversoquemerodea.Estvinculadoalabaseenergticadel
cuerpo. Ciertos miedos internos, el estrs y las emociones se evacuan por este
orificio.Puedocomprobarlassituacionessiguientes:Quesloqueintentoignorar
hastaelpuntoderetenerlo?Hastadondepuedoyodejarmeir?Soycapazderelajar
ydejarquemeguelavida?Estoylistoparavivirnuevassensacionesfrenteala
vida?Aprendoatenerconfianzaenm,mientrassueltoloqueyanonecesitoy
sustituyndolopornuevasideas,actitudespositivasynuevosproyectos!
ANO ABSCESO ANAL (ver tambin: ABSCESO [en general])
Elabscesoesunmontndepus,frustracioneseirritabilidadvinculadoa
una situacinquenoquierosoltarodejarir (ano).Frecuentemente,inclusosi
meaguanto,semeescapaapesarmo.Este absceso saldrosemanifestarde
todosmodos.Esposiblequeestenfadadocontrammismoporquenoquiero
evacuar,cederfrenteaciertasfijacionesmentalesquedaanmividapresente.
Inclusopuedoestarllenodevenganzareferenteaunasituacinpasadaoaalguien
aquienrehusoperdonar.Estemalestarmedicequedebohacerconfianzaalavida
yaloqueeshermosoalrededormo.Confoenalguienoenalgoy,sobretodo,
perdonoalagentequemerodea.Meabandonoyhagoconfianzaalavida.
43

ANO COMEZN ANAL (ver tambin: PIEL IRRITACIONES)


Las comezonesserelacionanconlosremordimientosylaculpabilidadcon
relacinamipasado.Algomecomeomepicaymesientoculpableenloque
debo retener o soltar. Tengo inters en escuchar mi cuerpo y alcanzar la
satisfaccinentodoporquelaculpabilidadslofrenamievolucin,sinverdaderos
beneficios.
ANO DOLORES ANALES (recto colitis)
Los dolores anales (llamadas recto colitis) se relacionan con la
culpabilidad.Mehagodaoporquenomecreobastanteeficazpararealizarmis
deseos.Esunaformadeautocastigo,unairritacin,laganadecondenarmedeun
modoquemanifiestaunaheridainterna,misensibilidaddesgarradadespusdeun
acontecimientopasadoqueannoacept.Vivounapenaprofundaquepuede
llegar a la prdida sangunea e incluso, en ciertos casos, la hemorragia. Puedo
aceptarhacermemsresponsabledemisdeseos,dejardedesvalorizarmeenlo
quesoyydejardenegarmevivirydejardecastigarmeintilmente.Podradejarde
estarincmodoconeltraseroenfuegoyempezarotravezdenuevoaceptando
muchomsmisexperienciaspasadas,presentesyporveniryascorrermsen
lavida.
ANO FISURAS ANALES
Las fisurasanales sonligerashendidurasquelleganasangraralniveldel
ano,locualsignificaciertaprdidadealegradevivirvinculadaaunasituacin
quedebocambiar.Sivivotristezaquepuedehendirmeelculo,compruebolo
queprovocaestatristezayaceptoloscambiosenmivida.Sobretododejode
esperaralosdemsparacambiar.Eliminomifrustracin,miclerafrenteauna
personaoaunsucesoquemehiendeeltraseroofrentealcualpuedosentirme
comosentadoentredossillas.
ANO FISTULAS ANALES ( FISTULAS)
Unafstulaanalencuentrasuorigenenunasituacinquevivoyenlacual
experimentocleraconrelacinaloquequieroreteneryquenoconsigoguardar
dentromo.Escomosiquisieraconservarviejosresiduosdelpasado(viejasformas
pensamientos,emociones,deseos),peronoloconsigo.Inclusopuedomantener
sentimientosdevenganzaconrelacinaalguienoaalgo.Lamanifestacinesla
fstula,especiedecanalcomunicandoanormalmenteentreunavsceraylapiel.No
consigodecidirmeentrelofsicoyloespiritual,entrelosdeseosyeldesapego(en
elsentidoamplio).Mequedoabiertoalniveldelcoraznyaceptoconvoluntad
devaciarcompletamenteestasbasurasdeideasnegras,malsanasyvengativas
aquyahora.
44

ANOREXIA (ver tambin: APETITO [prdida de] BULIMIA, PESO


[exceso de])
Laanorexiaestcaracterizadaporun rechazo completodelavida.Esla
desganatotalportodoloquevivoenmyquepuedeentrarenmicuerpofeopara
alimentarlo.Estesentimientopuedeinclusotransformarseenodio.Existenvarios
smbolosdevida:elagua,elalimento,elaspectomaterno(madre),elamor,ellado
femenino.Eseldeseoardienteeinconscientedeescaparalavida,deodiarseyde
rechazarse porque vivo el miedo extremo de abrirme a la maravillosa vida
alrededor mo. Vivo desanimo a tal punto que me pregunto lo que podra
ayudarme.Tengoeldeseoinconscientededesaparecerparamolestarlomenos
posible a mi entorno. Me rechazo pues permanentemente. La anorexia y la
obesidad vienen de un sentimiento profundo insatisfecho de amor y de afecto,
aunque las dos enfermedades toman fsicamente caminos divergentes. Varios
trastornosdelaalimentacindescansansobrelarelacinmadrehijoenlacual
existeoexistiunconflicto.Adems,setratamuyamenudodeunacontrariedad
encuantoamiterritorioquetengolasensacindenotener,deperderobiende
que no me lo respetan. Este territorio puede estar constituido tanto por mis
posesionesfsicas(vestidos,juguetes,coche,casa,etc.)comodemisposesionesno
fsicas(misderechos,misadquiridos,misnecesidades,etc.)odelaspersonasque
me rodean (mi padre, mi madre, mis amigos, mi marido, etc.) Vivo una
contrariedadqueesrecienteconrelacinaalguienoaalgoquenopuedoevitary
quenodigiero.Aunquelaanorexiasehallemsfrecuentementeenlaadolescencia,
staexistetambinenelbebyenelniojoven.Simepongoenellugardelbeb,
si me doy cuenta que el rechazo de la comida puede derivar de un contacto
perturbadoentremimadreyyo:puedeserlaprivacindelpechomaternoydel
clido ambiente fsico que deberan acompaar la toma de la leche, el modo
artificialdealimentacin,dosificadaydemasiadorgidaensuaplicacin,lasobre
osubalimentacinimpuestaporrespetoaunacurvadepesoidealcondesprecio
deciertosritmosalimentariosindividualescambiantes.Puedoreaccionaraestopor
unrechazoprogresivodealimentarme,vmitos,prdidadepeso,trastornosdel
sueo,caprichosalimentarios,etc.Esimportantequeyo,comomadre,respetelos
gustos,losritmospropiosdelnioyquedejedequererserlamadreperfectay
superprotectora.Sisoyunniounpocomsmayoryquemanifiestoanorexia,
suele ser ms atenuada y se caracteriza por un pequeo apetito, siendo un
pequeocomedorquedetestalatareadelascomidas,concaprichosalimentarios,
conrehusoobstinadodeciertosalimentos,acabandoraravezmiplato,vomitando
frecuentementeymasticandosinfinelmismobocado.Aestaedad,lamesaysus
imperativos sociales juegan un papel importante, porque las comidas son una
reuninfamiliarbajolaautoridaddelospadresenlacualpuedenbrotarreacciones
yconflictos.Laanorexiaesfundamentalmenteminecesidaddecolmarunvaco
interiordealimentoafectivo.Necesitoamoryaceptacinincondicionaldemi
45

madreinterior.Laanorexia,contrariamentealaobesidad,eselintentodehacer
morirdehambremivacointeriorparahacerlotanpequeoquedesapareceryque
yanopedirnadaenabsoluto.Esunodelosmotivosporloscualessigovindome
gordo(fijacinmentalsobrelagordura)inclusosisoydelgadoyesbelto.Dichode
otromodo,sigoviendomisnecesidadesafectivasyemocionalesmuygrandesyme
sientovencidoporellas.Laanorexiapuedetambinaproximarseaunsentimiento
deestarreidoporlavidacomopormimadre,smbolomaternoquemeempujaa
pesardetodohacaeldeseodeindependenciaydeindividualidad.Eslaraznpor
lacualrechazoelalimento almismotiempoqueamimadre,porquesiempre
tuvelasensacindesentirnicamentesupoderosocontrolmaternoenmijuventud.
Vivopueselsentimientodeestarfuerademipropiocontrolconrelacinalos
acontecimientos e intento de un modo exagerado recuperar el control. No me
gustaelmodoenquemimadremeamayladetestoporesto.Quieroseguir
siendounamuchachaounmuchachoporquequieroacercarmelomsposiblede
una forma de pureza fsica e interior. (Es durante la pubertad que suele
manifestarselaanorexia).Esunabsquedaabsolutadejuventud.Comomuchacha
o muchacho, rechazo las fases sexuales correspondientes a mi edad, as que
cualquier intento de intimidad sexual, descubrimiento y abandono haca una
eventualpareja(ausenciademadurez)soncasiintiles.Sivivotodoestodeun
modoprofundo,frecuentementeestoest vinculadoaunprofundotraumatismo
sexualpasado,aunabusooaunainseguridadafectiva.Estaexperienciafavoreci
elhechoqueseinstaleenmicuerpofsicoladesesperacinycerrlapuertaa
mis deseos fsicos, espirituales y emocionales. Aceptar gradualmente mi
feminidad o mi lado intuitivo y emotivo en el muchacho es esencialmente la
primera cosa por hacer para resolver mi estado anorxico. Uso la manera que
quiero,perodebohacerla!Aceptociertaintimidadsexual,femeninaeincluso
materna(porquedeboaprenderaamaramimadre!).Aprendoaamaramicuerpoy
aamaralosdems!.Voylentamenteporqueesunasituacindelicadaenlacual
deboabrirmealamoryalabellezadeluniverso.Pidoayuda,siesnecesario.Y
sobretodomemantengoabiertoaloquemedeparalavida!Aceptacinyamor
incondicionalessernaltamenteapreciados.Hagoactividades(deportivasuotras),
si posible. He aqu una parntesis interesante. Como persona anorxica, puedo
tener la impresin de encontrarme interiormente como cogida dentro de unos
anillos=pequeosanos(anorxico)comosiestuvieraenelinteriordevarios
aros tipo hulahup que me aslan del resto del mundo mientras se va
intensificandomisentimientodelimitacinfrentealavida.Memantengoabiertoa
cualquier otro signo de este tipo. Me visualizo liberndome de estos aros
dicindolesGRACIASporlatomadeconscienciaquemeayudaronahacerpero
sabiendoque,ahora,yanosonnecesarios.Visualizotambinestaimagen:concada
inspiracin, ms luz est entrando en m para llenar mi sentimiento de vaco
interior.
46

ANQUILOSIS (estado de) (ver tambin: ARTICULACIONES [en


general], PARALISIS [en general])
Estadodeadormecimientocaracterizadoporladesaparicingeneralmente
temporal de los movimientos de una o varias de mis articulaciones. El
anquilosamiento es parcial pero puede ser total si decido de volverme
completamente inactivo; es el primer paso haca la parlisis, tanto fsicamente
comoenpensamiento.Debotomarconscienciadelaresponsabilidadquehede
asumirsimequedoaqusinhacernada,sinquerersentirnimoverme.Qutemo?
Es lo desconocido, lo que me est esperando, algo nuevo para m lo que me
molesta? Puedo ir a consultar la parte del cuerpo implicada para darme
informacionessuplementariassobrelafuentedemianquilosis.Porejemplo,siest
enelbrazo,estoyyoenunestadoenquerehusolasnuevasexperienciasdela
vida?Tengoelsentimientodeestarmutilado?Sisetratadeunhombro,me
parecelavidapesada,oqueunapersonaosituacinestodounpeso?lasoledad
olanecesidaddeenfrentarmealodesconocidocongestionamispensamientos?Si
setratadeunpie,culesladireccinquenoquierotomaryfrentealacualme
aletargo?Siestodomicuerpo,meadormezcofrenteaalgooaalguien:setrata
deunaformadehuida.Estoyconscienteque acumulo energaenestapartedel
cuerpo y que inconscientemente, me angustio. Es tiempo para m de ir haca
delante!Apartirdeahora,estoyconscientedemiserrores(omsbiendemis
responsabilidades) y de mis experiencias de vida y las reconozco. Acepto
volverahacerelmovimientoquedejtemporalmenteymovilizodenuevomis
pensamientosmantenindomeabierto.Manifiestounamentemscreativa.
ANSIEDAD (ver tambin: ANGUSTIA, NERVIOS [crisis de],
NERVOSIDAD, SANGRE HIPOGLICEMIA])
La ansiedad es cierto miedo a lo desconocido que puede acercarse del
estadodeangustia.Semanifiestaporciertossntomas:doloresdecabeza,calores,
rampas,palpitacionesnerviosas,grandestranspiraciones,tensiones,aumentodel
caudal de la voz, llantos e incluso insomnios. Si soy ansioso, puedo vivir el
estremecimiento de la angustia: este estremecimiento procede del fro y me
recuerdaquetengomiedo.Esunaenfermedadquemeaprietalagarganta,queme
hacerperdereldominiodemmismoyelcontroldelosacontecimientosdemi
vida,impidindomeusarel sentido comn yeldiscernimiento.Tambinpuedo
sentirobienundesequilibrio,obienunadesconexinentreelmundofsicoenel
cual puedo tener cierto control y mis percepciones con relacin al mundo
inmaterialparalascualesnosiempretengoexplicacionesocomprensinracional.
Yanotengoelcontrol:elcielomepuedecaerencimaencualquiermomento!
Puedo estar ansioso en cualquier situacin: ESTOY VOLVINDOME LO
SOBRE LO CUAL LLEVO MI ATENCIN. Si mi atencin est
constantementecentradaenelmiedodeestoodelootro,esciertoquevivir
47

ansiedadquepuedeestarrelacionada,decercaodelejos,conloqueseacercaal
miedoalamuerteoaloquepodrarecordrmela.Lamuerte,lascosasqueignoro
oquenoveo,peroquepuedenexistir,hacensubirenmestemiedo.Entonces,
inclusositemolodesconocidoysiniegoinconscientementelavidaysuproceso,
colocoahoramiatencinsobreesto:tengofeenquemeestsucediendolomejor,
param,enelinstantepresenteyenelporvenir.Lossntomasdesaparecern,as
comoelmiedoamorir.
ANTHRAX (ver: PIEL ANTHRAX).
APATA (ver tambin: SANGRE ANEMIA /HIPOGLICEMIA /
MONONUCLEOSIS)
Laapataesunaformadeinsensibilidadodeindolencia.Abandonofrentea
lavida,mevuelvoindiferenteynotengoningunamotivacinparacambiarloque
sea.Laapatapuedesucederdespusdeungolpe,untraumatismoocualquierotra
situacinnegativaquemequitatodamialegradeviviromirazndesereneste
mundo.Puedoquerersalirdeunasituacinhuyndolaporfaltademotivacinode
alegraopormiedoaestardecepcionado.Resistoyrechazoverosentirloqueest
sucediendo dentro mo y alrededor mo, lo cual me lleva a cierto grado de
insensibilidad para protegerme. La apata puede tambin estar vinculada a la
vergenzaprofundayalaculpabilidad.Intentoashacermeinsensibleamiser
interior. Acepto abrirme a la vida y a nuevas experiencias agradables que
mantengo,conelfindeencontrarunnuevoobjetivoamivida.Pongolaactitud
necesaria.
APENDICITIS (ver tambin ANEXO III).
La apendicitis se define como la inflamacin del CCUM (del latn:
ciegosituadoenlabasedelintestinogrueso.Estaenfermedadprocededeuna
cleravinculadaaunatensinoaunasituacinagudaquenoconsigoarreglar
y que me hace hervir interiormente. Lo ms frecuentemente, se trata de una
situacin en el plano afectivo que viene a desequilibrar mi sensibilidad y mis
emociones.Mimiedopuedehabersuscitadoesteacontecimientoporqueentretena
pensamientosnegrosymepreocupaba,locualhizoquesemanifestara.Mesiento
como en un callejn sin salida (es la forma del apndice) porque tengo el
sentimientodeestaroprimido,locualactivaenmmiedo,inseguridad,cansancio,
abandono.Lomsfrecuentemente,estacontrariedadestrelacionadaconeldinero
yparticularmenteeldinerodebolsillo.Puedesertambinalgooalguienqueyo
queraqueseaadieraoseincorporaraamividaperounacircunstanciaselo
impide.Porejemplo,quizsquieroquemicnyugevengaavivirenmicasa,pero
l o ella no quiere o no tengo bastante sitio para albergarlo, etc. Hay una
obstruccinalflujodelavidayinhibomultituddeemociones.Estopuedeir
48

incluso hasta el miedo a vivir. Ya no consigo filtrar eficazmente las nuevas


realidadesparaprotegermedeello.Noveootrasalidaamivida.Necesitohablarde
loquevivo,necesitovaciarmibolsaporquetengodificultadendigerirloque
sucede,encuentroqueestoesfeoydecepcionante.Lossntomashabitualessonel
calor,elardorvinculadoalainflamacin,yeldolorvinculadoalatensin.Siento
un sufrimiento intenso cuando el apendicitis se transforma en peritonitis
(reventn del apndice). Dejo fluir la vida y acepto las situaciones de mi
existenciacomoloqueesmejorparam.Memantengoabiertoalniveldelcorazn
ydejocaermisprotecciones(barreras)suavementeyarmoniosamente.
APETITO (exceso de) (ver tambin: BULIMIA, SANGRE
HIPOGLICEMIA).
Elalimentorepresentalavidayesttambinvinculadoal placer,acierta
alegra de vivir. El alimento colma pues mi(s) necesidad(es) fsica(s) y
emocional(es)yunexcesopuedesignificarloquequierocompensarparatenerms
vidaenm,teniendonecesidaddecolmarunvacointerior.Esunainsatisfaccin
interiorprofundafrentealamoryun hambredeamor (igualcomolasedde
amor),unanecesidaddedisminuirunatensinosimplementedeentretenerme
paranotenernecesidaddepensarenm.Evitomirarenmiinterioryhalloenel
alimentoestesentimientodelibertadysatisfaccinparacolmartodosmisdeseos,
sealaquesealacantidadabsorbida.Quizsseaelcasocuandoestoyenestadode
hipoglicemiaqueestvinculadoaunacarenciadealegraenmivida,oaundeseo
excesivodelodulce(vinculadoalamor)querevelaunanecesidadevidentede
ternura y afecto. En los nios, es fcil reconocer sus necesidades afectivas
carentes28:manifiestanfcilmenteelgustoportodoloqueesdulce.Seaunadulto
ounnio,siempreesmicorazndenioelqueestheridoydebodarmsamora
mishijosorecibirmsparacolmarmisnecesidades.Debomantenermeabiertoa
estabellaenergadeamorparahallarunequilibrio,unaverdaderacomunicacin,
unreconocimientodelyo,unintercambioentreloquesoyyloquenecesito.El
apetitoseequilibraenseguidacuandoestoymejorcolmadoemocionalmente.
APETITO (prdida de) (ver tambin : ANOREXIA)
Comoqueelalimentoestconectadoconlavida,unaprdidadeapetito
puedeatribuirseaculpabilidad(nomemerezcovivir,tengomiedo,meprotejo)o
bienaunaprdidadealegraomotivacinfrenteaunapersonaoaunasituacin.
Rehusoirhacadelante,tenerimpresionesnuevasyexperienciasexcitantesqueme
hacenanmsalegre.Rehusoabsorber,digerir,comerlonuevoquesemeofrece
enlavidaporqueestonomeconviene.Mantenindomeabiertoalnivelcorazna
laaventurayalavida,aumentomipropiaestimademypuedoaceptar las
nuevas sensaciones (nuevos gustos) y hacer un paso ms. El equilibrio del
28

Carentes:quefaltan.

49

apetito volver. Igual como el apetito viene comiendo, la VIDA viene con la
VIDA!
APOPLEXIA (ver: CEREBRO APOPLEXIA)
APRENSIN
La aprensin est relacionada con una duda, un temor referente a una
situacin o a una persona frente a la cual siento peligro. Interiormente, vivo
incomprensin con relacin a lo que me sucede. Mi mental empieza a crear
fantasmascontodotipodeideasycorroelriesgodeestardescentrado.Sitomi
atencinsobremiserinternoapartirdeahorayaceptoalniveldelcoraznlas
experienciasdelavida,mientrasmeprotejo.
ARRUGAS
Lasarrugassongrietascutneas.Puedenserdeexpresinodevejez.Hay
ruptura de las fibras elsticas del dermis y est afectado el resto del tejido
conjuntivo.Aparecenlas arrugas cuandovivoungolpeemocional,untrastorno
interior. Tambin puedo vivir una ruptura o un acontecimiento en que debo
desapegarmedeunapersona,deunasituacinodeunbienmaterial.Estomelleva
avivirpena,desesperacin,incomprensinydolorinterno.Siaprendoaaceptar
quecualquieracontecimientoenmividaestaquparaayudarmeacrecery
quemedianteeldesapegomanifiestoelamorincondicional,entoncesmisarrugas
yanonecesitarnexistirypodrndesaparecer.Lasabiduraaportalaautntica
juventuddelcorazn.
ARTERIAS (ver: SANGRE ARTERIAS).
ARTERIOSCLEROSIS O ATHEROSCLEROSIS (ver tambin: SANGRE /
ARTERIAS / CIRCULACIN SANGUNEA).
La arteriosclerosis es una enfermedad degenerativa que procede de la
formacindedepsitoslipdicos(especiedegrasa)enlasparedesdelasarterias.
La arteriosclerosis es tambin una enfermedad degenerativa que procede de la
destruccindelasfibrasmuscularesyelsticasquelaforman.Unauotradeestas
enfermedades se manifiesta por un endurecimiento de las arterias y arteriolas,
implicandosobretodounagotamientoyunaprdidadeelasticidadalniveldela
pareddestas,unacapacidadcadavezmsdbildedilatacinycirculacindela
sangre,unaumentodedepsitosgrasos,porlotantomenosamorexpresadoal
niveldel corazn.Esteestadoprogresivo semanifiestasiestoy endurecido,si
estoyomevuelvoinflexibleotensoenloqueserefierealacomunicacinyamis
pensamientos. Es la manifestacin de una resistencia muy fuerte y de una
estrechezmentalfsicaeinterior.Laexpresinylarecepcindeamorsevuelven
50

limitadasyrestringidas.Tengoideasfijasydespiadadas,sueloserintransigente,
rgidoysincompasin;tambintengotendenciaavernicamenteelladosombro
onegativodelavida.Puedoinhibirinconscientementemisemocionesydecirnoal
amor porque temo expresarme. Dnde y cundo ya viv una experiencia
traumatizantequemehizodetestarunapartedemmismoalpuntoderenegarde
ella, y en la cual me sent rechazado? Esta enfermedad est probablemente
conectadaconunaheridaamorosaoalnoreconocimientodeesteamorenmi
vida.Paraquverloqueesbuenoparam?Paraquexpresarmissentimientos?
Micuerpomeindicaquedebohaceruncambioconrelacinamicomportamiento
frentealavida.Aceptandotenerunaactitudmsabierta,toleranteydulcecon
relacinammismoyalasexperienciasquevivo,semanifiestamejortodoel
procesodeuninconelyointerioryeluniverso.Manifiestoalegra,serenidady
flexibilidadhacalosylasquemerodeanymeabandonoalaverdaderaexpresin
delamor.Lagentedemientornosentirnestecambio.Tambindebodesarrollar
mscreatividad(arteria=artetierra)enelplanofsicoyconlamateria.Lavida
cuidadem.
ARTICULACIONES (en general) (ver tambin: ARTRITIS ARTROSIS)
Unaarticulacinesunapartedelcuerpoenlacualserenendosovarios
huesospermitiendounmovimientoadaptado29 alaanatomadelcuerpohumano
(sinnimo: junta, unin, juntura). La articulacin representa la facilidad, la
movilidad,laadaptabilidadylaflexibilidad,dandoalmovimientograciayfluidez.
Todas estas cualidades simples son posibles con una articulacin en perfecto
estado.Sinembargo,ellatambintienesuslmites.Yaqueelhuesorepresentala
formadeenergamsdensa,lamsfundamentaldemiexistencia,losproblemas
articulares estn implicados en todas las componentes fisiolgicas del cuerpo
humano (tejido, sangre, etc.). As es que un trastorno articular indica una
resistencia,ciertarigidezenmispensamientos,enmisaccionesoenlaexpresin
demisemocionesfrecuentementeinhibidas.Unainflamacinseproducesitengo
miedodeirhacadelante:mevuelvoincapazdemoverme,tengodificultaden
cambiar de direccin, juego el juego del desapego emocional, no acto con
espontaneidad,dudoorehusoabandonarmealavidayhacerconfianza.Cuando
tengodolorodificultadenmoverme,micuerpoexpresaquenoquierocomprender
(oaceptarcomprender)algoquemelimitaenlaexpresindelYo.Conrelacin
amirigidezparacomprender,mirandolapartedelcuerpoafectada,puedoactivar
el proceso que consiste a aceptar que tengo algo que comprender. Por
ejemplo,lasmuecas,loscodos,loshombrosolasmanosdolorososindicanque
debocesaralgunaaccinoalgntrabajo.Quieroreplegarmesobremmismo
(codos)porqueestoycansadoohartodehacerloqueestoyhaciendoodeserlo
quesoy:yanoquieroserresponsable(hombros).Lascaderas,lasrodillasylos
pies (miembros inferiores) indican que ya no deseo seguir la vida con las
29

Loshuesosdelcrneojuntadosentres,seconsiderangeneralmentecomoarticulacionesinmviles.

51

dificultadesquecomporta.Deborecordarmequelaatencinsobreunsoloymismo
lugar ( es decir fijar inconscientemente la energa o la emocin en una sola
articulacin)puedehacercristalizarestaenergaeinmovilizarlaarticulacin.En
estecaso,elprocesodeaceptacinalniveldelcoraznesesencialparaintegrar
latomadeconscienciaconrelacinaestaenfermedadyasliberarsedeella.Una
juntura es un lugar en el cual dos huesos se encuentran. Una dolencia o una
enfermedadreferenteastarevelaunainflexibilidadconrelacinammismoo
hacaunapersonaounasituacin.Puedoencontrarelaspectodemividahacael
cual necesito mostrarme ms flexible mirando cul parte de mi cuerpo est
afectada.Sonlasjunturasdemisdedos,demismuecas,demistobillos,etc.?
ARTICULACIONES TORCEDURA.
Lastorcedurasseencuentranalniveldeunauotrademisarticulacionesy
se deben a una lesin de los ligamentos de una de stas. Las articulaciones
representanlaflexibilidadymicapacidadadoblarmealasdiferentessituaciones
demivida.Lamuecayeltobillosonlaexpresindelaenerga,justoantesde
quesemanifiesteenlofsico.Latorcedurameindicaqueaplicolosfrenos.Resisto
o vivo inseguridad frente a la direccin que tomo (tobillo) o en lo que hago
(mueca) actualmente o lo que podra hacer en una nueva situacin. Vivo
culpabilidadyquierocastigarmeporqueresisto.Vivounatensinmentalqueyano
puedetolerarse.Dependiendodemigradoderesistencia,ira,culpabilidadotensin
mental,tendrunatorcedurabenigna tambinllamada esguince,enlacuallos
ligamentossimplementeestn distendidos,ounatorceduragrave,enlacuallos
ligamentosestnrotosoarrancados.Tomoconscienciadeloquehacaysentaen
elmomentoenquesucedi.Puedopreguntarme:Estoyapuntodehaceralgoalo
cualseramejorrenunciar?Mecausatensinounarealangustiaelmodoenque
tratolasituacin? Estoysentadoenunabaseinestableymolestamentalmente?
Acepto tomar el tiempo de volver a orientarme o de hacer los cambios
necesarios para que pueda estar bien en mi piel e ir haca delante libremente.
Acepto lapresenciadeesta torcedura parallevarmeahacercambios.Sila
aceptacinesthecha,lacuracinserrpidaytotal.Perosi,porqueahorano
puedo andar o lo puedo hacer muy poco, me desvalorizo y me siento intil y
buenoparanada,lacuracinsermuchamslarga.Porestotengoventajaenver
estasituacin(latorcedurayloqueimplica)deunmodopositivoyconstructivo.
ARTRITIS (en general) (ver tambin: ARTICULACIONES [en general],
INFLAMACIN)
Sedefinelaartritiscomolainflamacindeunaarticulacin.Puedeafectar
cadaunadelaspartesdelsistemalocomotorhumano:loshuesos,losligamentos,
lostendonesolosmsculos.Secaracterizaporinflamacin,rigidezmusculary
dolorquecorresponden,enelplanometafsico,auncierre,crtica,pena,tristeza
52

o ira. Simblicamente hablando, la gracia y la libertad de movimiento son las


principales cualidades, vinculadas a la articulacin. Cuando se vuelve sta
inflexible,ocuandoseendurece,laartritisestasociadaaciertaformaderigidez
de mis pensamientos (pensamientos cristalizados), de mis actitudes o de mis
comportamientos, de tal forma que todas las emociones profundas que debera
expresarnormalmente,losonporlamanifestacinfsicadeestaenfermedad.As,
laartritisseproducesisoydemasiadoinflexible,demasiadoexigente,testarudo,
intolerante, muy moralista, criticn, restringido o demasiado orgulloso con
relacin a m mismo, a los dems o a las situaciones de mi existencia. Un
sentimientodeimpotenciaacompaahabitualmenteelsufrimientoquemefrena.
Vivoelsentimientoparticulardeestarmalamado,denoestaramadoyapreciado
amijustovalor,locualmetraemuchadecepcinyamargurafrentealaviday
malhumor.Manifiestoentoncesunesprituexcesivamenteracional.Criticocon
frecuenciatodoonadaporquetengomiedoalavidaysientofrecuentementeuna
forma de inseguridad crnica. Me siento explotado: hago acciones y pongo
gestosmsparacomplaceralosdemsqueporrealvoluntadeinters,detalmodo
que digo s por deber cuando, en verdad, es no. Quizs haya vivido un
traumatismo de infancia y me inhibo ahora mis emociones, sin admitir lo que
sucedi (ocultacin) porque sufr mucho en tal experiencia y me permito
inconscientementecensurar yquejarmeparaquelosdems puedancomprender
hastaqupuntopadec.Estamanifestacinserelacionaconelsacrificiodes.La
artritistambinpuedeprocederdelmodoenquemetratootratoalosdemscon
relacinalacrtica.Laartritistambinprovocaunaespeciedeaccinretrgrada;
tengolasensacindevolveratrsenelplanoenergtico,comosisemeindicara
haceralgomsenunadireccindiferente,envezdeirhacadelante.Yaquemi
miedo, mi dbil valoracin propia y mi rigidez hacen que se creen profundas
emocionesreferentesalporqu,elcmooaladireccindemismovimientosenla
vida, puedo tener el sentimiento de estar obligado, restringido, inmovilizado o
encerrado. Entonces, sentir una incapacidad a doblar (mi actitud), a ser
mentalmenteflexibleocapazdeabdicar.La articulacinartrtica meindicalo
quevivoymedamsinformaciones.Alniveldelasmanos(dedos),lapregunta
es:Estoyrealmentehaciendoloquedeseoyloquequierohacer?Mispropios
asuntosestnbienentremismanos?Haygenteaquienesyanotengoelgustode
darlamano?Milibertadymiespontaneidadenmanejarloquesucedeenmi
universoestnlimitadaspormirigidezymidureza.Aniveldeloscodos:Estoy
inflexiblealoscambiosdedireccionesportomarenmivida?Permitoalosdems
serlibresyexpresarsuplenopotencial?Enlasrodillas:Frenteaquinoqutengo
lasensacindetenerquearrodillarmeydelantedequinoqunoquierodoblar?A
partirdeahora,compruebomisverdaderasintencionesconrelacinalamor.Debo
cambiarmimododepensaryadoptarunanuevaactitudfrentealassituacionesde
mivida.Quedndomeabiertoalamorqueestomnipresente(portodaspartes)y
53

expresndolodemodomshonesto,libreyespontneo,micoraznserradiantey
respetaralosdemstantocomoammismo.Amistad,comprensinyperdn
sonahoradisponiblesparam.
ARTRITIS ARTROSIS (ver tambin: ARTICULACIONES, HUESOS)
Laartrosiseslamanifestacinintensificadadelartritis.Esunaenfermedad
dedesgastearticulardeloshuesos,deorigenmecnicoynoinflamatoriacomola
artritis,unaagravacinprofundadelaestructurasea,localizadaohabitualmente
generalizadaalconjuntodelcuerpo.Sinembargo,lasarticulacionessometidasa
importantesesfuerzosmecnicossonlasquemsestnafectadas,comolasdela
columna vertebral (vrtebras cervicales [del cuello], vrtebras lumbares [parte
inferiordelaespalda]),delascaderas,delamano,delasrodillas,delostobillos.El
dolor que provoca es de origen mecnico y no inflamatorio y aparece
habitualmente despus de un esfuerzo sostenido y desaparece en reposo (esta
enfermedadtambinllevaelnombredereumadedesgaste).Cuandopadezcode
artrosis, es como si aumentara ms mis actitudes, mis patterns y mis
pensamientos rgidos. Esta enfermedad est vinculada a un endurecimiento
mental, a una ausencia de calor en mis pensamientos (el fro y la humedad
aceleranlaaparicindelaartrosis),frecuentementeconrelacinalaautoridad.Es
lamotivacinexageradaporcumplirunaaccinsinbuscarelreposooelequilibrio
(medoyhastaelfindemislmites,sinpararmeparasabersimeexijodemasiado),
una impresindesoportar unapersonaounasituacinqueahorasehavuelto
intolerable,ounafuertereaccininhibidaconrelacinaunaformacualquierade
autoridad.Soymuyintransigenteyrgidohacammismo.Micuerpomehabla
ytengointersahoraenescucharle!Puedointegrarestaenfermedadempezandoa
aceptarconscientementequevivounairayquemispensamientossonrgidos.
La energa que fluye a travs mo es fluida, armoniosa, en movimiento.
Quedndome abierto de corazn a esta energa y reconociendo que tengo que
cambiaralgo,puedeinvertirelprocesoymejorarmisalud!Mevuelvomsflexible
yaceptoalosdemscomoson,sinquerercambiarles.Laflexibilidadalnivel
demicuerpofsicoentoncesreaparecer.
ARTRITIS DE LOS DEDOS (ver: DEDOS ARTRTICOS)
ARTRITIS POLIARTRITIS.
La poliartritis esunainflamacinllevandosimultneamentesobrevarias
articulaciones.Estaenfermedadvieneaindicarmeunadificultadenrealizarlos
gestos que era capaz de ejecutar antao con mucha destreza. Ahora, tengo la
sensacindesermstorpeopocohbil.Porlotanto,medesvalorizoconrelacina
estaactividadenlacualeraexcelenteytengolasensacindeperderdestreza,
fuerzaoprecisin.Estaenfermedadseencuentraenlamodistaporejemplo,quien,
54

despusdealgunosaos,tienelasensacindesermslenta,menoshbil.Los
deportistasfrecuentementeestnafectadosdepoliartritis,acausaprincipalmente
delsentimientodedesvalorizacinquepuedanvivirporquenosonptimosenun
100%oquesusrealizacionesptimashandisminuido.Aprendoaaceptarme
conmis fuerzas ymis debilidades. Incluso si tengo lasensacin de ser menos
buenoomenoseficaz,mirotodalaexperienciaqueadquiralolargodelosaos.
Reconozcoquefueundonpreciosoquehacedemunapersonaexcepcional.La
poliartritis puede producirse tambin si soy compulsivo, muy obstinado o
moralizador. Tengo tendencia a sacrificarme por los dems, lo cual resulta
frecuentementedeunaagresininhibida;perohastaqupuntoactoconamor,
respetndome? La rigidez tanto fsica como interior se agrava a causa de esta
profundaobstinacinanoquerercambiar.
ARTRITIS REUMATOIDEA (ver tambin: REUMA).
La artritisreumtica seconsideraactualmentecomolaafeccinarticular
msgrave.Sueleestar generalizadaalconjuntodelcuerpoenvez deunasola
articulacin. El sistema inmunitario est tan enfermo que empieza a auto
destruirse,atacndosealtejidoconjuntivodelasarticulaciones(colgeno),detal
modo que se puede temer el riesgo de una lisiadura generalizada con dolor e
hinchazn articular. Es directamente un achaque de mi propio yo, porque las
fuertes emociones de rencor y dolor no consiguen expresarse. La artritis
reumatoideestvinculadaaunprofundodespreciodes,aunodiooaunarabia
inhibidadesdehacetiempo,auna crticades tanintensaqueestoafectala
energamsfundamentaldemiexistencia.Vivexperienciasenlascualesmesent
avergonzadooculpable.Eslamanifestacindeunacrticamuchomsimportante
frentealaautoridadoatodoloquerepresentalaautoridadparam:individuo,
gobierno, etc. Rehso doblarme a esta autoridad, poco importan las
consecuencias! Es como si estuviese rumiando constantemente la autoridad,
criticndola.Mimovilidadsevuelvelimitadaynoconsigoexpresarmelibremente
(enparticularenelcasodeciertasdireccionesportomaryquedebocomunicarcon
mientornodeunmodofluidoygracioso)porquemisarticulacionessondemasiado
dolorosas. Mi cuerpo se vuelve rgido, igual como mis actitudes. No consigo
expresar mis fuertes emociones y tengo la sensacin de estar constantemente
oprimidoysubyugado.Entoncesadoptocomportamientosderecogimiento,auto
sacrificio, y rumio mis emociones sin poder expresarlas. Sirvo de vctima
propiciatoriasacrificndomeaunacausacualquiera;siempreestnencimamo.
Laaperturaanivelcoraznesesencialsiquieroliberartodaslasemocionesque
envenenanmiexistencia.Apartirdeahora,recobromiplenopodersobremivida,
empezandoporamarmeyporaceptarmetalcomosoy.Tomoellugarqueme
corresponde!
55

ARITMIA CARDACA (ver CORAZN ARITMIA CARDACA).


ASFIXIA ( ver: RESPIRACIN ASFIXIA)
ASMA (tambin llamado grito silencioso) (ver tambin: ALERGIAS,
PULMONES [dolores en los ], RESPIRACIN [dolores de])
El asma es una afeccin respiratoria caracterizada por la dificultad de
respirar,pudiendoirinclusohastalasofocacin.Duranteunacrisisdeasma,la
reaccin del sistema inmunitario frente a las sustancias causando alergias
(alrgenos)estanfuertequepuedeconllevarunbloqueodelarespiracincorporal,
silbidosrespiratoriosyavecesinclusolamuerte.Necesitotomarlavidaenm
(inspiracin)ynoconsigodar(expiracin)atalpuntoqueempiezoaserpresode
pnico (inspiro con facilidad pero expiro con dificultad) de tal modo que la
respiracin (es decir mi habilidad en respirar, se vuelve insuficiente y muy
limitadaporqueliberounmnimodeaire.Meenganchoaciertaspersonasoa
ciertascosasquerehusosoltar?Meahogoconlarabiaolaagresividadquerehuso
ver,alpuntoqueestomecogealagarganta?Tengomiedodecarecerdealgo,
sobretododeamor?As,el asma estfundamentalmenteligadoalaaccinde
ahogo.Mesientocogidoalagarganta,sofoco,meahogoconrelacinaunser
amadoounasituacin.Mesientolimitadoenmiespacio.Inclusopuedoviviruna
querellaquemellevaalaconfrontacin,alenfrentamientoyqueenvenenamivida.
Usoelasmaparaatraerelamor,laatencinounaformadedependenciaafectiva.
El asma siendosimilaralaasfixiayalaalergia,puedotenerelsentimientode
estarlimitadoydedejarmeinvadirporlosdemsenmiespaciovital,deestar
fcilmente impresionado por el poder de los dems en detrimento del mo, de
querercomplacer,decumpliraccionesquenomeconvienen,yendoinclusohasta
ahogarmeparasignificarunarebelininteriorvinculadaaunasituacin.Esun
medioexcelentedesentirmefuerte,deconseguirtodoloquequieromanipulandoa
losdemsComonadie,sinoquierovermislimitaciones,laconfianzaenmse
sustituirrepentinamenteporinquietudyangustia.Nosabrcomodealarconmis
emociones y sentir una gran soledad. Tendr que aprender con la vida y
permitirmegozardesta.Losdemsloharntodoporsalvarme!Tengolaimagen
deunapersonadbilqueexigemuchoamorsinestarlistaparaeldondeAMOR,
comounnioquegritaparasusnecesidadessintenerlamadurezdecompartiry
abrirselobastantealdondivino.Lavidaesunintercambiomutuo,equilibradoy
constanteentredaryrecibir.Todoesto,evidentemente,estrelacionadoconel
pasado, una especie de amor agobiante que interpret como tal (generalmente
materno), a una tristeza inhibida de la primera infancia. Es tambin un miedo
recordandolaprimerarespiracin,enminacimiento,enquemesentahogadoo
asustadopor mimadre (inconscientemente)oporunasituacinsimilar.As,la
respiracinsimbolizalaindependenciadelavida,laindividualidad,lacapacidad
56

derespiraryomismo.Noconsigomanifestarunsentimientodeindependencia,
vivirmipropiavida,mesientorechazadoporlallegadadealguienms.Siento
dificultadesentomarmeenmanoyasoltarmedemisatadurasconmispadres(una
dependenciarepresiva,sobretodofrenteamimadreoalcnyuge). Noconcibo
separarme de esta maravillosa imagen (mi madre) dulce y confortante,
casarmeovercmosedivorcianmispadressintenerningunareaccin!Estoy
enunacleraazul,estoyfuriosoderabiaysiguelacrisisdeasma.Compruebosi
ladolenciasepresentaperidicamenteycambiomiprogramacinmental.Ahora,
tomomividaenmano,doygenerosamenteytranquilamentesinforzar.Reconozco
humildementeloquesoycapazderealizarinclusosiestoparecepocoy,sobre
todo, acepto abrirme al nivel del corazn y trabajar con el proceso de
integracinquecorrespondealoquerealmentenecesito.Todosearreglarparalo
mejor,estarsatisfecho,colmadodeamor,ternuraydotadodeunarespiracin
normalyequilibrada.Aprendoaamarmeyaamarlavida.
ASMA DEL BEB
El asmadelbeb esanmspronunciadoqueel asmacomn.Elrecin
nacidotienetantomiedoalavidayavivir,queyamanifiestaenestafase el
rechazodeestaraqu.Esbuenoqueyolehableenpensamientooenpalabrascon
uncoraznabiertoparadecirlecuntoestamado,apreciadoycuntoestoyatento
asusnecesidades.
ASTENIA NERVIOSA ( ver tambin: BURNOUT)
La astenia nerviosa es similar al burnout, que es una forma de
agotamientoenergticoynervioso.Sinembargo,esdiferentedelcansancio,quees
unfenmenonatural,yaquenoprovienedeltrabajoodeunesfuerzoyqueno
desaparecenecesariamenteconeldescanso.Lamanifestacinseinstalaadiferentes
niveles(fsicoeinterior),diversosestadososentimientosfundamentalesvuelven
ensuperficie:miedo,tristezaprofunda,emotividadamplificada,remordimientosde
experienciaspasadaseinclusoamargura.Auncuandolaastenia,seastasomtica,
psquicaoreaccionaria,puedederivardediversascausas,comprueboloqueme
llevaamanifestaresteestado.Puedocambiarestoacondicindehallarlacausa
profundaquemellevaperdertodamihermosadeterminacinaseryhacery
tenerunaactitudpasivaydehuidadelantedelesfuerzo.

57

ASTIGMATISMO (ver: OJOS ASTIGMATISMO).


ATAXIA30 DE FRIEDREICH.
La ataxia de Friedreich es una enfermedad del sistema nervioso
caracterizadapordegeneracionestocandolamdulaespinalyelcerebelo 31.Suele
originarsedebidoaunesquemadepensamientoenm,comomadre.Esteesquema
estanpoderosoqueelfetoqueengendr,(nioengestacin)locaptayrespondea
steincondicionalmente(igualcomoelamordeunamadreporsuhijo).Estoy
esperandotantoquemihijorespondaamiomissueosqueacabaraporsentirse
totalmenteimpotenteparacolmarme.Siendoestenio,tengomiedodenopoder
cumplirtodoloquemimadremepideydenoestaralaalturadelmotivoparael
cualestoyprogramado.Tengomiedodenotenerelvehculofsico(Ataxia)
apropiadoenelmomentooportuno.Entonces,semanifiestaunbloqueoenloque
se refiere a mi desarrollo. Sea cual sea la edad del nio, debo, como madre,
explicarlequetengoquizsidealesparal,peroqueesporqueleamoyquequiero
lomejorparal.Cualesquieraseanlasdificultadesdemihijo,leamotalcomoesy
nohadevolverseunsuperman.Sielnioestenlafasedegestacin,puedo
hablarleinteriormenteporque,inclusoaestaedad,comprendetodoloqueledigo.
Siesalgomsmayor,tomoeltiempodehablarle:entoncessentirtodoelamor
quesientoporlyelprocesodecuracinpodrentoncesactivarse.Nadasuperael
amoryelperdnpararestablecerlaarmonaentredosseres.ATURDIMIENTOS
(ver:CEREBROEQUILIBRIO[prdidade])
AUTISMO
Elautismoeselrechazoltimodeenfrentarsealarealidadfsicadelmundo
exterior,locualtraeunaformadereplieguesobremimundoexteriorenelcual
reinanloimaginarioylosfantasmas.Huyounasituacinomientornoporqueme
dueledemasiado,oporqueveomisensibilidadmaltratada.Mipena,mitristezao
mi desesperacin son tan grandes que me corto de lo fsico mientras sigo
teniendoestemismocuerpofsico.Elmundoexteriormeaparececomohostily
amenazador. El hecho que yo, como persona autista, me haya encerrado
voluntariamente en mi burbuja hermtica implica que reciba miles de
informacionesaldaqueestnalmacenadasyguardadasenmimundointerior
envezdeintercambiarstasconotraspersonas.Mehalloenunagujeronegro,una
carreteraquemeparecesinsalida.Tengolasensacindequeloscriteriosquedebo
alcanzarsontanaltosqueesmsfcilretractarmedentrodeunmutismoenvezde
tenerquesuperarmeconstantementeytenerquerendircuentasaotros(padres,
profesores, autoridad, jefe, etc.) Es posible tratar este tipo de caso, pero las
curacionessernmuchomsinterioresqueexteriores,suponiendoqueexistan.De
30

Ataxia:significalanocoordinacindelosmovimientos.
Cerebelo:estsituadoenlabasedelcrneo.Esresponsabledelacoordinacindelosmsculosnecesariosal
equilibrioyalmovimiento.
31

58

cualquierforma,mientornodebesercapazdecomunicarapartirdelinterior(odel
mundo interior) conmigo para llevarme a conectarme de nuevo o ms con el
mundofsico.As,proyectndomeenmimundointerior,sepuedetomarcontacto
mejorconmigoyreconocermejormisnecesidadesymismiedosparaquepueda
luegomanifestarlaconfianzaylaaperturanecesariasparavolveraconectarconel
mundofsico.
AUTOMUTILACIN (ver tambin : AMPUTACIN)
La auto mutilacin es un comportamiento que me lleva a infligirme
heridasolesiones.Puedequeestaactitudpuedaprocederdeunestadomentalya
perturbadocomoenlossicticos,losesquizofrnicos,losniosdeficientes.Sin
embargo,estopuedeprocederdelhechoqueyovivaunagranculpabilidadenmi
vidaquepuedeestarasociadaaunagranirritabilidadvueltacontramyaqueno
mesientodignodeserloquesoy.Puedotambinservirmedeestasheridasqueme
inflijoparaatraermelaatencin,queidentificoconelamor.Escomosiquisiera
manifestarfsicamentemisufrimientointeriorparapoderliberarmeyponeralda
mi necesidad deser amado. Escierto que,en tales situaciones, necesito ayuda
exterior.Empiezopuesapedirayudainteriorymiroenmientornoquinpodra
ayudarmedirectamenteoindirectamentearecuperarlaestimadem,laalegrade
vivirque,yotambin,tengoderechoasaborear.
AUTORITARISMO.
La persona que manifiesta autoritarismo est fuertemente en reaccin,
conscientementeono,frentealaautoridad,bajolaformaquesea.Creofirmemente
queeselnicomediodehacermecomprenderydehacercaptaralosdemsel
cmofunciona:Esascomofuncionaenesteuniverso!Pordesgracia,sobre
todoparalagenteusandoestepodersobreunamasadeindividuos),manifiestoun
carcteregocntricoaultranza.Lacleraseencuentraenteladefondo,sobretodo
cuandosientounaresistenciafrentealoquepido.Tambinhagoelodosordoa
loquesemepuedadecir.Comopersonaautoritaria,podrtambinrechinarlos
dientesotenerproblemasderodillas.Noescuestinquemedobleguefrentea
quien sea!. Nada me para, ni situacin, ni circunstancia salvo quizs las que
alcanzandirectamenteyprofundamentemicoraznherido.Lanecesidaddeamor
esgrandeenmcomoindividuoysloexistelaaperturadecoraznparapermitira
laluzquealumbremitristevida.Elpeorsuplicioquepuedasufrircomopersona
autoritaria es ponerme de rodillas delante de alguien ms grande que yo;
habitualmenteesaestenivelquesemanifiestanlasdolenciasdeordenfsico.Sino
seabreelcorazn,seencargarlavida.Lanecesidaddeamoresgrande.Cuando
msconscienteest,mssercapazdebuscarlosmediosdecolmaresteamory
curarmicoraznherido.

59

BAZO
Elbazoesunrganoqueayudaalaproduccinyalmantenimientodelas
clulasinmunesdelasangre.Estvinculadodirectamentealhipotlamoyaltimo,
ascomoalpncreas,paralaproduccindelainsulina 32.Simibazonofunciona
bien,puedequeyotambintengadificultadenfuncionarbien,laraznmayor
siendoquemequedefijadoenideasnegrasynegativas.Estodisminuyeminivelde
energayyanotengoelgustodehacernada.Estanegatividadfrecuentementeest
vinculadaamimododeverme:feo,nocorrecto,nobueno,etc.Msbientengoel
gustodedormirydeserpasivo.Mealimentodeiraynohaynadamuyalegreen
mivida.Alguienoalgomecaeenelbazo.Lasdificultadesalniveldelbazome
danunaindicacinsobrelosmiedosquepuedavivirfrentealasangre,comopor
ejemploladecarecerdesangre,deperderdemasiadasangre(comoenelmomento
delasmenstruaciones).Puedopensarquemisangrenoesbuenaotanescasaque
dudoquesepodrasalvarmelavidaencasodeaccidentemayorenquetendra
necesidaddeunatransfusinsangunea.Elmiedodelamuertefrecuentementeest
presenteeneltrasfondo.Elbazovigilalacalidaddelosglbulosblancosysumal
funcionamientopuedeindicarmeunagranheridainteriorquequedaporcurar.Es
comounallagaquesangra.Lasangresignificalaalegradevivir,puedotenerla
sensacindequelavidaesunaluchatanduraquedeberaquizsbajarlabanderay
retirarme. En vez de siempre estar obsesionado por ideas negativas que tengo
tendenciaaexagerar,deberamsbiencambiarmelasideasencontrandomedios
paradilatarmeelbazo.Desdramatizomividayaprendoarerdemydealgunas
situaciones. Aprendo a comunicar mis emociones a medida para guardar mi
equilibrioylaarmonaentodomicuerpo.
BEBAZUL(ver:NIOAZUL)
BEBEDORES DE LECHE (sndrome de los ) (ver tambin: ACIDOSIS,
APATIA)
Cuandomisangreesdemasiadoalcalina(locontrariode cida)ycuando
tengoinsuficienciarenal,tengoloquesellamaelsndromedelosbebedoresde
leche o sndromedeBurnett.Normalmente,vienedelhechodetomarlecheen
cantidadexcesivayduranteunlargoperododetiempoobienporelconsumode
medicamentos anticidos. Intento colmar un vaco interior procedente del amor
maternodelcualnomesentcolmado.Elestadodecansancioyapatamerecuerda
hastaqupuntoestanecesidaderaimportanteparam.Estonoquieredecirque
hayatenidounamadrequenomequera,sinoqueyo,quizstenaunanecesidad
mayor.Puedetambinqueloquehalloamargoenmivida,intentocolmarloporlo
quemsmerecuerdaladulzuraenmividacomoenmiinfanciayloqueme
recuerdaelamordemimadre.Deboempezaryaahoraatenercuidadodem,como
32

Insulina:hormonasecretadaporelpncreasyqueayudaaregularizarlodisminuyendoelporcentajedeazcar
sanguneo(glucosa).

60

lo hara una madre. Acepto las dulzuras de la vida sabiendo que soy una
personaexcepcionalquemereceloquemejorhaya.

BOCA (en general) (ver tambin: ENCAS)


La boca representalaaperturaalavida.Esunrganosensorialsensibley
selectivo.Eslapuertadeentradadelalimento,delaireydelagua.Esacausade
ellaquepuedohablar(labios,lengua,cuerdasvocales),comunicaryhacersalirmis
emocionesymispensamientos.Esunaespeciedepuenteentremiserinterioryel
universoalrededordem(larealidad).La boca espueslamanifestacindemi
personalidad,demisapetitos,demisdeseos,demisesperanzasydemisrasgosde
carcter. Me permite abrirme a todo lo que es nuevo: sensaciones, ideas e
impresiones.As,esunava(voz)[enFrancs,vayvozsedicenvoieyvoix,
palabrasquetienenelmismosonido]dedoblesentidoylasdificultadesquevivo
tienenfundamentalmenteundobleaspecto,interioryexterior.
BOCA (dolor de)
[ver tambin: CNCER DE LA BOCA, CANCRO [en general], HERPES [
bucal],MUGUET)
Labocaeslapuertadelaparatodigestivoydelasvasrespiratoriasendonde
acepto tomartodoloqueesnecesarioamiexistenciafsica(agua,alimento,
aire,)emocionalysensorial(excitacin,deseos,gustos,apetitos,necesidades,etc.).
As las dolencias de la boca son indicacin de que hago muestra de cierta
estrechezmental,quetengoideasyopinionesrgidasyquetengodificultaden
tomary tragar loquees nuevo (pensamientos,ideas,sentimientos,emociones).
Hayunasituacinquenopuedotragar:generalmentesonpalabrasodasqueme
molestaron o hirieron o palabras que me hubiese gustado or y que no fueron
dichas.Porlotantoquieroreplicaroresponderynolohagoporquemesiento
incmodoenlasituacinosencillamenteporquelaocasinnosepresenta.Me
quedoporlotanto,cogidoconloquetengoquedecir.Micuerpomemandael
mensajequequizsmanifiestoideasmalsanaspormediacindemiboca,quedebo
cambiardeactitudconrelacinammismoyalosdems.Elejemplotipoesel
cancroolcerabucal(herpes) quesemanifiestahabitualmentedespusdeun
estrsodeuntraumatismoduranteodespusdeunperodonerviosointensoode
una enfermedad. Me revela el modo ms triste e irritable en que me tomo la
realidadcotidiana.Esposiblequemesientacogido,quemesientaencerrado
en la situacin (taponado), que rumie una situacin desagradable desde mucho
tiempo o que tenga verdaderamente necesidad de recuperar mi total libertad
diciendoloquehededecir,inclusosiestocorreelriesgodedisgustarme.Tambin
puedotenerhambredeamor,afecto,conocimiento,espiritualidad,libertad,etc.
61

Sitengolasensacinqueloquenecesitonoesaccesibleoespocorealista,miboca
hambrienta reaccionar a la sensacin de carencia que siento. Tomo mi lugar
quedndome abierto y flexible a lo que empieza para m, a lo que es nuevo,
mientrasseaenarmona.
BOCA AFTA.
El afta esunalesinsuperficialenlamucosabucal(boca)33 caracterizada
por una pequea protuberancia blanca. Aparece porque reacciono fcilmente
(sensibilidad)amientorno,alasvibraciones,alambientedeunasituacin.Sufro
silenciosamente con la boca cerrada. Es tambin el signo de que tengo
dificultades en coger raz y que no consigo expresarme, decir lo que pienso o
inclusoenreaccionarporquenocreotenerelpoderdehacerlo..Puedo,cuandoera
joven,habermeencontradoenunasituacinenquemehallincmodofrenteauna
situacinquellegamiconocimientoenlacualestuveincapazdereaccionarode
afirmarme.Sivuelvoavivirunasituacinsimilarhoyquemerecuerdo,incluso
inconscientemente,estaexperiencia,aparecen aftas.Mispalabrassonintilese
incompletasporquesoydemasiadonervioso.Mequedomudo,sinsiquierapensar
enrebelarme!Sivivounainjusticia,ascooinsatisfaccinocultada(enlaboca)si
tengoganasdevaciarmicorazn,puedohacerlomantenindomeabiertoyen
armonaconmigomismo.Sinembargo,estasprotuberanciasblancassonmuy
dolorosas,tanprontocomoabrolabocaparaexpresarme,lassientoyestome
duele.Siquieroevitarverlasvenirdeunmodomsgrave,empiezoaexpresarme
abiertamenteycalmamenteyadesdeahora.
BOCA ALIENTO (mal) (ver tambin: ENCA GINGIVITIS,
GARGANTA [dolores de] NARIZ [dolores de]
El mal aliento es la consecuencia directa de mi dificultad en tratar
interiormente y exteriormente las situaciones que vivo. Esta dificultad puede
procederdelhechoquemequedoenmisposicionesconrelacinaciertasideasque
noexpresoyquepudreninsitu.Ladificultadpuedeprocedertambindelhecho
quenoconsigosuperarlasdificultadesenperododegrancambioenmividayque
lasideasantiguasseestancandemasiadotiempoconrelacinalavelocidaddel
cambioquevivo.Compruebohastaqupuntopuedocogerlassituacionesdemi
vida.Esimportantequecomuniqueconlaspersonasrelacionadasparaparticiparlas
misemocionesymispensamientosafindequitarmeestemalalientomo.ste
est vinculado frecuentemente a pensamientos de crticas, odio, venganza que
tengocontrammismoocontraotrapersona,ydelascualestengovergenza.El
airequeinspiroyquenutremisclulasestcargadodetodosmispensamientos,
tantopositivoscomonegativos.Culessonlospensamientosquealbergoenmi
interioryqueinfestanmi aliento?Frecuentemente,dichospensamientospueden
33

Laaftaseencuentraavecesenlamucosagenital.

62

serinconscientes.Cuandounapersonaviveestasituacinconstantemente,sera
buenodecrseloparaquetomeconscienciadeelloyquepongaremedioadicho
problemaquepuedeexistiryadesdehacelargotiempo.Sabindolo,tendrocasin
de experimentar el perdn. Bien sea el perdn haca ella misma por haber
mantenidopensamientosmalsanos,oelperdnhacaotrapersonaporhabertenido
rencorhacaelladurantetantotiempo.Esbuenoquemerecuerdequecuandoel
amorylahonradezsoningredientesdebasedemispensamientos,mi aliento se
volverfresco.Meliberodelospensamientosmalsanosdelpasado.Ahora,respiro
elfrescordemisnuevospensamientospositivosdeamor,hacammismoyhaca
losdems.
BOCA PALADAR.
Elpaladareseltechoseodelacavidadbucal.steestarafectadocuando
mepensabahaberrecibidooadquiridoalgo(porejemplounnuevoempleo)pero
luegomeloquitaron.Vivirpuesunagranfrustracinydecepcinporquepensaba
que esta cosa ya me perteneca pero de hecho luego se me fue quitada. Debo
preguntarme porqu se ha producido esta situacin. Esperaba yo demasiado?
Deboinvestiresfuerzospararecuperarloqueperdoquizsesmejoras?Tales
sonlaspreguntasquepuedohacermeparaqueserestablezcalaarmonayquese
curemipaladar.
BOSTEZO
Elbostezoesunaenfermedaddeimitacinnaturalmsomenosaceptada
ensociedadyenrazndesusconvenciones(digonaturalporquehastalafecha,
nohaytratamientomdicoparacurarla).Digodeimitacinporquesemanifiesta
impulsivamente e inconscientemente en una persona que ve a otra hacer esta
accin.Eselsignodeiralacamaodedescansarcuandoestoycansado,agotadoy
quenecesitorehacermisfuerzas.Estambinunsignodeinsatisfaccinalimentaria
porquemesucedebostezarcuandonohecomidosuficiente.Meaburroalpuntode
expresarlodemanerainconsciente,cuandoestoyslomirandolatelevisinoen
compaadeunapersonaquenomeconviene!Quieroquesemedejetranquilo!
Bostezarformapartedelavidayloaceptoconamoryapertura.Esimportante
dejarirestaexpresincorporalcontestadaporlosprincipiosdeeducacinantao!
BRAZOS (en general)
Losbrazosrepresentanmicapacidadparaacogerlasnuevasexperienciasde
lavida.Losusoparatocaryapretar,paraexpresarmicreatividad,mipotencialde
accin y mi amor. Puedo entrar en contacto con la gente, acercarme a ellos y
acogerlosenmiuniverso.Lesenseotambinquelosquieroconalegrayarmona.
Acausadeellos,pasoalaaccin,hagomitrabajoocumploconmisobligaciones.
Misbrazoscomunicanyexpresanpuesmisactitudesymissentimientosinteriores.
Losbrazossonmuycercanosalcoraznyestnvinculadosastos.As,lagente
63

sientequeelamorylaenergaemanandemicorazncuandoestoyabierto.Cada
manoencierrauncentrodeenerga,situadoenlapalma,querepresentaunodelos
21centrosdeenergamenores(ochakras).Losdoscentrosdeenergadelasmanos
estn directamente conectados con el corazn; As que mis brazos permiten
extendermicorazneirallevaramorfsicamenteyenergticamente.Encambio,
sicruzolosbrazosinstintivamente,meprotejoomecierroaciertasemocionesque
nomeconvienen.
BRAZOS (dolores en los )
Losdoloresdelosbrazosestnvinculadosconladificultaddemanifestarel
amorenloquehago,enmitrabajooenmisaccionesdecadada.Esunbloqueode
energa,una inhibicin dehaceralgoparammismooparalosdems.Puedo
entonces sentir rigidez muscular, dolor o calor (inflamacin). Mis brazos se
vuelvenmenosmvilesymstensos,misarticulaciones(hombros,codos)ms
dolorosos.Squeelpapeldemisbrazosestensucapacidaddecogerlasnuevas
situacionesylasnuevasexperienciasdemivida.Quizsestenreaccinfrentea
unanuevasituacin;yanoencuentroquemitrabajoseamotivador;estoyfrustrado
o irritado porque no consigo expresarme convenientemente, o porque tengo
dificultadenrealizarunproyecto.Unasituacinquecalificodefracasopodr
exteriorizarseporundolorenlos brazos.Generalmentesonloshuesosdemis
brazos queestarnafectadoscuandonosoycapazdehacertanbiencomoantes
unaactividadprofesionalodeportivaenlacualeraexcelente.Noconsigocogerla
gente a quien amo en mis brazos; rechazo reconocer que estoy harto de una
situacinqueeranefastaparam(tenerlosbrazoscansados).Engeneral,tener
dolorenlosbrazossignificacojodemasiado.Obienesalgoquenocojooqueme
niegoacoger.Yanotengoganasdecomunicarconlosdemsenelniveldel
corazn,dudodetodasmiscapacidadesenrealizaralgo.Irhacadelanteenlavida
me parece difcil. Los dolores son pues un modo inconsciente de ensear que
padezco.Quizs,debasoltar,dejarir,unasituacinounapersonaquequiero
reteneratodacosta.Unadificultadconlaautoridadpuedemanifestarseenel
brazoderecho,mientrasquesermibrazoizquierdoelqueestarafectadosivivo
unconflictoparaexpresarmiamorymibondad.Loshombrestienenunatendencia
naturalaquererhiperdesarrollarlosmsculosdesusbrazosquesonunsmbolo
de fuerza y poder, lo cual denota su dificultad y su resistencia en expresar la
energadelcoraznyelladodulzura.Inversamente,losbrazosmsdelgadosy
dbilesmeindicanunatimidezenlaexpresindemisemocionesyunaresistencia
endejarcorrerlaenerga.Mefrenoparahundirmeenlavidayaprovecharmeal
mximo.Misbrazoscorrespondenmsamiexpresininterior.Misantebrazos,
encambioestnconectadosconlaexpresinexterior,elhacer.Mearremangoy
paso a la accin! La dulzura representa el lado interno de mis ante brazos,
manifiestamisensibilidadypuedotenerdudasantesdeexpresarfsicamentecosas
enelUniverso.Quizsdebacambiarmiscostumbres,omimododehaceryesto
64

meestandifcil,enrazndemirigidez,quemisantebrazostambinsepondrn
rgidos.Unairritacincutneaaniveldebrazoestconectadaaunafrustracinoa
unairritacinenloquehagoonohago,enelmododeexpresarmeyenloque
puedesucedermedespusdelaintervencindelosdems.Debomanifestarms
amorenloquehago,investirme,abrirmeconconfianzaalosdems,apretarenmis
brazosconamorycarioalagentequeamo(laimagendelpadrequeaprietaasu
hijo en testimonio de amor). Recuerdo que la accin de apretar a alguien
frecuentemente es teraputico. Estimo mis bellas cualidades de comunicacin,
ternurayapertura.Colocomiatencinenlasactividadesinteresantes.Meejerzoen
verlosbuenosladosdecualquiersituacin.Lohagorealizandoqueesmaravilloso,
queestoymejordeloquepensaba.Mecambiolasideasporquelonecesito.
BRIGHT34 (enfermedad de) (ver tambin: RIONES [problemas
renales])
La enfermedad de Bright se llama tambin nefritis crnica. Es una
dolencia,noesunaenfermedad35,inflamatoriagravedelosriones,acompaadade
edema36 (hinchazn) y de una insuficiencia en la eliminacin de las orinas.
Habitualmente, los riones degeneran o mueren bastante rpidamente. Es ms
profundaquelasenfermedadesderinengeneral(esclerosis).Padezcoyvivouna
frustracin ouna decepcin tanintensa frentea lasituacinenque tengoun
sentimientodeprdida,quellegoaconsiderarmividaomipropiapersonacomo
unfracasototal (losrionessonlasededelmiedo).Tengomiedodenoestar
bastante correcto, bastante bien, bastante bright (inteligente). Una apertura del
corazn es necesaria si quiero manifestar un cambio de actitud para curar este
estado.
BRONQUIOS (en general) (ver tambin: PULMONES)
Los bronquios son los conductos por los cuales entra el aire en mis
pulmones. Representan la vida. Una dolencia o un dolor en el nivel de mis
bronquios significahabitualmentequetengoelmaldevivir,quetengomenos
inters y alegra en mi vida. Los bronquios representan mi espacio vital, mis
delimitaciones,elterritoriomsparticularmentevinculadoamipareja,mifamiliay
mientornoprofesional.Sitengolasensacindequevoyaperdermiterritoriooa
alguienqueestvinculadoal,miinseguridadactivarunaenfermedadenlos
bronquios.Estomeindicaquedebotenerconfianza:aunquehayadelimitadomi
territorioylohagarespetartantocomohagorespetarmisderechos,nadiepodr
invadirmeporqueelespacio decadacualestarbiendelimitadoycadacual
34

Bright(Richard):MdicoIngls(17891858)quienfueelprimeroenestudiarlanefritiscrnicaoinsuficiencia
renal.
35
Curiosamente,lanefritiscrnicanoesunaenfermedadporqueesunaconsecuenciadeafeccionesquealcanzan
ciertaspartesdelosriones.
36
Edema:Retencinanormalmenteelevadadelostejidosdelorganismo.Sellamatambincomnmentetener
retencindeagua.

65

podrvivirenelrespetoylaarmona.Compruebocualeslapersonaolasituacin
asociadaaestedoloryloquedebohacerparacambiaresto.Tengonecesidadde
crearsituacionesquesonpropiciosalarisayalarelajacin.
BRONQUIO BRONQUITIS (ver tambin : PULMONES (dolencias de los
])
Labronquitis(itis=ira)secaracterizaporlainflamacindelamucosadelos
bronquios,conductosquellevanelairedelatraqueahastalospulmones.Esuna
enfermedadesencialmenteligadaalarespiracinyalaaccindetomarlavidayel
aire con deseo y gusto (inspiracin) para luego echarlos temporalmente con
desapego(expiracin).Lainflamacinsignificaquevivoira,frustracinorabia
conrelacinaciertasemocionesinhibidas,palabrasquenecesitoexpresarydejar
salir,unasituacinagobianteenlacualmesientooprimido,unconflictoteidode
agresividadycrtica(trastornosenelmediofamiliar,peleas,etc.).Siestasituacin
conflictualimplicapeleasyenfrentamientosmuyintensos,inclusopodrallegara
desarrollar un cncer de los bronquios. Existe un trastorno interior, una
perturbacin que me impide manifestar mi ser autntico, hacer respetar
convenientementemisderechos.Intentocomunicarconmisserescercanosperono
consigo cierta paz interior. La situacin familiar es demasiado difcil. Siento
entonces cierto desnimo frente a la vida y dejo de luchar para continuar mi
camino.Tengopocaalegradevivirytengounprofundocansanciointerior.Latos
indicaquequieroliberarmeexpulsandoalgooaalguienquememolestaymehace
enfadar.Sinodeseounabronquitiscrnica,debocambiarmimododeverlavida,
mi actitud. Nac en una familia en la cual cada uno de los miembros vive
experiencias similares a las mas. Mis padres, mis hermanos y mis hermanas
aprendencomopueden,ellostambin.Deboempezaraverlaalegrayelamoren
cada experiencia de mi vida. Acepto que mi felicidad personal sea mi
responsabilidad y dejo de creer que los dems me harn felices. Tomar mis
decisiones y respirar por mis propios medios, es el primer paso haca mi
independencia!
BRONQUIO BRONQUITIS AGUDA (ver: RESPIRACIN TRAQUEITIS)
BRONCONEUMONIA (ver tambin: PULMONES (dolencias de los ])
La bronconeumona es una inflamacin respiratoria que alcanza los
bronquiolosylosalvolospulmonares.Estdirectamenterelacionadaconlavida,
conelhechoquemesientodisminuidoylimitadoporlapropiavida.Lasiento
injustahacamyestomeirrita.Estoyenfadadocontralavida.Esunainfeccin
msgravequelasimplebronquitisolaneumonaporqueeldolorinterioresms
hondo.Deborespirarlavidadeunamaneranuevayconunenfoquediferente,
llenodeamorydealegra.
66

BRUXISMO(ver:DIENTES[crujirde])
BUERGER
(enfermedad
de)
(ver
tambin:
CIGARRILLO,
ADORMECIMIENTO, INFLAMACIN, SANGRE CIRCULACIN
SANGUNEA)
LaenfermedaddeBuergeresunaenfermedadqueimplicaunaobstruccin
msomenosacusadadelacirculacinenlosbrazosylaspiernas,causadaporuna
inflamacindelasparedesdelosvasossanguneos.Estaenfermedadserelaciona
principalmenteconlosfumadoresyfrecuentementesonagentesirritantes dela
sangreprocedentesdelcigarrilloquesoncausadeestainflamacin.Micuerpome
indicaporeladormecimientodebrazosypiernas,queintentohacermeinsensiblea
lassituacionesdelavida,locualestvinculadoconlosbrazos,yaloquepasar
paramenelporvenir,locualestconectadoconlaspiernas.Estiempodeteneren
cuentaestemensajequemedamicuerpoydeaceptardevermsclaroenmi
vida.Dejandodefumar,misaludmejorar.
BULIMIA (ver tambin: ANOREXIA, APETITO [exceso de], PESO
[exceso de])
La bulimia es una enfermedad compulsiva, necesidad incontrolable de
absorberalimentoengrancantidad,desequilibrionerviosoporqueestoyen total
reaccinfrentealavida.Labulimiapresentalasmismascausasinterioresquela
obesidadylaanorexia.Comoenexcesoparasatisfacermecompletamenteopara
recobrarunaformadeamoryafecto(elalimentosimbolizalavida,elamorylas
emociones).Intentocolmaremocionalmenteunprofundovacointeriorenm,un
odioenmtangrande(asco,desprecio)quequierollenarestevacoatodacosta,
prefiriendodejarmedominarporelalimento(lavida)envezdeabrirmealavida.
Niegounapartema,unasituacinyvivopenaoiraporquemesientoaislado,
separadoorechazado.Rechazototalmentemicuerpo;rehusovivirenestatierra.
Tengo miedo de perder lo que tengo y siento inseguridad porque estoy quizs
diferentedelosdems.Yanomesientomscapazdemorderenlavida.No
tengo todo lo que quiero o no domino suficientemente mis deseos y mis
emociones.Buscoconstantementelanecesidadvivadesentirmemsfuertequeel
alimento,quemissentimientosymisemociones.Prefieropueshacermevomitaren
vezdeestarenbuenasaludporquemedesprecioprofundamente.Generalmente
vivounaprofundadepresin,unadesesperacin,unaangustiaqueintentocalmar,
una frustracin que intento compensar, tengo una imagen de m que quiero
revalorizar.La bulimia estmuyvinculadaalamadre(fuentedevida),allado
maternal y a la creacin. Estoy en reaccin frente a mi madre? Tengo el
sentimientodehabersidocontroladoyoprimidocuandoerajoven,demodoque
comiendoas,quierohuirdemimadre,neutralizarla(enelsentidometafsico)o
67

dejaresteplaneta?Tengoalegracomportndomedeestemodo?Podraserque
denio,hayavividolaetapadedestetecomoun abandono?Comosiseme
arrancaseamimadre?Sisteeselcaso,tengolasensacinquevoyamorirme
dehambre,deaqulanecesidaddecomergrandescantidadesdealimento,para
colmar el vaco y hacer disminuir mi estrs. Como persona bulmica, debo
mantenerme abierta al amor. La necesidad de aceptar que tengo algo que
comprenderdeesteestadodepresivomellevaalamoryaprendoaamarmeya
aceptarme ms como canal de la energa divina. Estoy en esta tierra para
cumplirunamisinparam,conmimadreyconlagentequequiero.Porquno
apreciarlabellezadeluniverso?Acepto micuerpotalcomoes,elegoysus
lmites,elalimentocomodondevida.Aceptoelamorparammismoypara
losdemsydescubrolasalegrasdeestarenestemundo.Estodo.
BURNOUT o AGOTAMIENTO (ver tambin: ASTENIA NERVIOSA,
DEPRESIN)
Generalmente,elburnoutsemanifiestadespusdelabandonodeunalucha
enlacualhubiesequeridomanifestarciertoidealperosinxito.Eltiempoylas
energasvolcadasparalarealizacindeesteidealsontanimportantesquemeagoto
ymepongoenfermo.Esunvacointeriorprofundoporquerehusounasituacinen
lacualquieroveruncambioverdadero,concretoyduradero,bieneneltrabajo,en
mifamiliaoenmipareja.Soymuyperfeccionistaydedicado,quieroalcanzarmi
ideal.Quizstambinesunapartedemquenoacepto.Tengoelsentimiento
delucharcontralahumanidadenteraporquemeparecequefuncionaendesacuerdo
conmisesperas ymisconvicciones profundas.Porquseguir?Abandono,es
demasiado para m. Los burnout son muy frecuentes en los profesores y
enfermeros,enreaccinrespectivafrenteasusistemadetrabajo.Esunaformade
compulsinporquequieroatodacostacambiarelsistemaconunosenfoquesms
adaptadosalostiemposmodernos.Sitengolasensacindequerersalvaralmundo,
debocomprobarmiactitudahoramismo.Elburnoutestambinunaenfermedad
dehuida.Puedopreguntarme:quesloqueintentohuir,trabajandoenexceso?
Tengomiedodeencontrarmefrenteammismo?Necesitounaraznparano
estarconuncnyugequemeesinsoportable?Quesloqueintentoprobaral
mismotiempoquehuyoelmiedoalfracaso?Lossntomasdelburnout son
bastante claros: cansancio mental y fsico, disminucin de energa vital,
pensamientosincoherentes!Semanifiestaelagotamientoydespus,sepresentanla
calmayelreposoparaquepuedarehacermisenergas.Sobretodohayquedejarde
creerquedebocomplaceratodoelmundo!Esunsueoylaautnticarealidades
elsaberquecumplolomejorquesloquedebohacerdandoel100%dem
mismo,yvuelvoahallarlaserenidad,lapazinterioryelverdaderoamorenla
accin.
68

BURSITIS (ver tambin: ARTRITIS, BRAZO [dolores en los ], CODOS,


HOMBROS, INFLAMACIN, TENDN DE AQUILES)
La bursitis eslainflamacinoelhinchazndelabolsaenelniveldela
articulacindelhombro,delcodo,delartulaodelostendonesdeAquiles(cerca
delpie).Estabolsaquesepareceaunpequeosacocontieneunlquidoquereduce
lafriccinenelniveldelasarticulaciones.Labolsaaportapuesunmovimiento
fluido,fcilycongracia.Labursitisindicaunafrustracinounairritacinintensa,
iracontenidafrenteaunasituacinoaalguienaquienverdaderamentetengoganas
depegarenelcasodequesetratedelosbrazos(hombrosocodo),odedaruna
patadaenelcasodequesetratedelaspiernas(rtulaotendndeAquiles),tan
furiosoestoy!Mispensamientossonrgidosyalgonomeconvieneenabsoluto.!
Estoyhartoy,envezdeexpresarloquevivo,inhibomisemociones.Esposible
hallarlacausadeldeseodepegarmirandoloquepuedohaceronohacerconeste
brazo doloroso. Si me duele el lado izquierdo, hay una conexin con el lado
afectivo.Elladoderecho,sonlasresponsabilidadesyloracional(porejemplo:el
trabajo).Tengodolorancuandomereprimadepegaraalguien.Debohallarel
modomsadecuadodeexpresarloquesiento.Encuentrolacausademidolor,
quedoabiertoycambiodeactitudaceptando mejormissentimientosymis
emociones. Podr transformarles en amor y en armona para mi beneficio y el
bienestardelosdems.Labursitisgeneralmenteestvinculadaaloquevivocon
relacinamitrabajo.Micuerposlomedicedeadoptarunaactitudmspositiva
paraadaptarmealasnuevassituacionesquesepresentan.
CABELLO (en general)
Protegiendolapartecutneadelacabeza,loscabellossimbolizanlafuerza,
la libertad, la belleza y la potencia (pensemos a Sansn en la Biblia). Estn
directamentevinculadosaladignidaddelser,alaesenciadelpoder.Meponenen
contactoconlaenergaespiritual,csmicaysupracsmica.Miscabelloscrecen
cercadelsptimochakraocentrodeenerga,elchakracorona.Elestadodelos
cabellos es tambin la representacin del poder sexual, genital y reproductor.
Varios mitos existen referente a los cabellos (los rubios, los morenos, los
calvos).Esimportantesaberquemiscabellossonlaimagendelpoderquetengo
paradirigirmipropiavida.Quesloquequierorealmenteenlavida?Tengoyo
lasensacin quelosdemsdirigenmivida?Lafuerzayelvalor decoger las
riendas de mi vida aumentarn mi sentimiento de libertad y el vigor de mis
cabellos.Los cabellos reflejanlaalegradevivirdeunapersonaysulimpieza
indicaelintersquetieneenestarcuidada,enestaraqu.Observolosdiferentes
estados demis cabellos quecorrespondenaciertosestadosinteriores (cabellos
quebrados,sinbrillo,finosoqueserompen,espesos,etc.)Memantengoabiertoa
estemaravillosopoderdelcieloquesonmiscabellos!
69

CABELLOS (enfermedades de los )


Diversascausaspuedentraerlaaparicindeenfermedadesdeloscabellos.
Un gran impacto emocional, una reaccin excesiva de impotencia frente a una
situacin, un conflicto latente o varios sentimientos inhibidos tales como la
desesperacin,lasinquietudes,elaburrimiento.Seinstalalanerviosidad,crecela
inestabilidademocional,seagotanlasfuerzasylosrecursosinteriores.Vivoun
desordeninterior.Estainseguridadpuedeprocederdemimiedoalamuerteodel
hechoquenadaespermanente,quetodopuedecambiarrepentinamenteysinaviso.
Me cierro a las energas vitales y mis cabellos cambian de aspecto. Caen, se
vuelvengrasososecos,sevuelvenblancos(canas),pierdensubrillo.Aparecela
caspa,resultadodeunconflictointeriorrelacionadoconmigoymipapelsocial.
Necesitooxgeno!Eslaprimeracosaquesehadehacerpararestablecerlafuerzay
vitalidad de los cabellos. Tomo consciencia que necesito cambiar mis
pensamientos y mi actitud frente a las situaciones de la vida. Acepto
mantenermeabiertoyobservoloquesucedeenestemomento,sobretodoelmodo
que adopto para afrontar las diferentes situaciones de mi vida y dejo de
arrancarmeelpelo!
CABELLOS (prdida de) (ver tambin: CABELLOS CALVICIA).
Loscabellossonelespejodeciertafuerzainterior.PiensoenSansn(enlas
escrituras del Antiguo Testamento) que perda su fuerza con los cabellos
cortadosLoscabellosrepresentanelnexoentrelofsicoyloespiritual,locual
mevinculaalcosmosyalaenergaespiritual.Secomparanfrecuentementeauna
formadeantenaconelmsall.Sedicequelaherenciaeselfactorprincipalde
lacalvicie,msfrecuenteenelsexomasculino.Sinembargo,entrelosdiferentes
tiposde calvicie,seencuentraeltipo calvoconbarba,elcualestasociadoal
individuoqueusamssusfacultadesintelectualesquesusfacultadesemocionales.
Laprdidadecabellossignificaquemeheapartadodelodivinoenm.Soyuna
personamsenfocadasobreelplanomaterialquesobreelespiritual.Puedeque
tengamuchaintuicinperoprefierousar mslosaspectos msmateriales,ms
racionales.Intentolomejorquepuedocontrolarlotodoporquetengomiedode
abrirmeyperderelcontrol.Rehusoelfuncionamientodebasedelavida,conel
pretexto que puedo hacer mejor que ella. Todo temor interior conlleva la
incapacidaddeactuar,ladesesperacinytensionesquemecogendeimproviso.Es
unailusindecreerhacermejorquelamismavida.Nohedelucharcontralavida
porquesiempreestconmigoparaapoyarmeymeayudarsilaescuchoysime
mantengoabierto.Slohedepedircontotalquietudylavidamedarloque
merezco. Es el inicio; debo confiar en la vida y en mi ser interior y ver las
solucionesportodaspartesporqueexisten!Elmundoestaquparaayudarme.
Qumsnecesito?
70

CABELLOS CALVICIE (ver tambin: CABELLOS [prdida de])


La calvicie es la prdida definitiva (parcial o total) de los cabellos.
Frecuentemente,sipierdomis cabellos,vivounaovariassituacionesenquela
tensinestangrandequemearrancolospelos!Variasexperienciasestresantes
oinclusotraumatizantespuedenacelerarelprocesodelacalvicie.Unpartoquees
fuentedemiedoodeinquietud(lamujerpuedeperdersus cabellos),ungolpe
emocionalgrave,unaseparacin,muchatensineneltrabajooenelhogar,el
gusto de superarse en el plano material o una desvalorizacin en el plano
intelectual.Cuandovivounamultituddeinquietudesygrandesmiedos,pierdoel
contactoconmipoderinteriordivino.Aceptoconfiarenlavidaconlaactitud
quetodoserparalomejor.
CABELLO GRIS
Los cabellos grises simbolizan la sabidura. Sin embargo, la aparicin
repentinadecabellosgrisessevinculaconelestrs,unasituacinenquevivun
golpeemocionalintenso.Cuandosucedeestoalosveinteaos,estorepresenta
grandesinquietudes(tensinoestrs),conscientesoinconscientesconrelacinal
hechodedejarseguiarespiritualmente.Piensoyoquenecesitovivirbajopresiny
quelaspresionesenmividasonnecesariasparamibien?Esprobablementeun
pattern,enestavida,vinculadoconelquererobtenersiempreelmejorresultado.
Habitualmente,el cabellogris aparececonlaedadyestosignificaunabajadel
vigoryfuerzavital.Revisomisactitudesgeneralesyaceptoquelavidasigue
talcomoes,nimsnimenosymeliberodelpesodesercompetitivo.
CABELLOS PELADERA (ALOPECIA)
La peladera(alopecia) esunaenfermedaddelapielcaracterizadaporla
prdida de cabellos en placas redondas. Esto puede proceder de un golpe
emocional,delairaydeunarenunciacinamiparteespiritualoaloqueme
conectaconmisvaloresmselevados.Tengoventajaenhacerlapazconmigo
mismoycontemplarsolucionesquemepermitirnvivirmejorenarmonaconmis
objetivosmselevados.
CABELLOS SARNA (ver tambin: CABELLOS [prdida de] / CALVICIE
/ ALOPECIA)
Lassarnassonhongosparsitosycontagiososqueafectanlasuperficiede
mipiel,mispelos,micuerocabelludoymisuas.Medejoatacar,destruir,
molestarporlosdems,porquetengopocaconfianzaenm.Mesientofeoysucio.
Puedo tener la sensacin que pierdo el control de ciertas situaciones. As, mi
sombrerodejefe(miscabellos)estarnafectados.Puedosentirmemuymolestopor
lospropsitosdeotrosyestarafectadoporlaideaquetienenquesielsombrerote
71

hace,pntelo!Dejoquelosdemsdecidanporm.Micuerpomedicedetomarmi
lugar,hacermeconfianza.Soyelnicoquetengopodersobremivida.
CABEZA (en general)
La cabeza es mi centro de comunicacin, est vinculada a mi individualidad.
Frecuentemente se le llama el centro de mando. Por ella pasan todas mis
emocionesytodasmiscomunicaciones,por vademiscincosentidos. Sivivo
dificultadesoenfermedadesdela cabeza,debopreguntarmesivivounconflicto
referenteamispensamientosymividaespiritualomicrecimientopersonal.Esto
seexplicaporelhechoquelacabezaestconstituidaporhuesosqueestnhechos
deuntejidoduroyquesimbolizanmienergaespiritual,yqueestoshuesosrodean
eltejidoblandoylosfluidos,quesimbolizanmisenergasmentalesyemocionales.
Siambosaspectosestnenarmona,habrfusindemicuerpoydemimente.Sin
embargo,silasangrequeestenmicabeza,nocirculabienosiejerceunapresin,
estomeindicaquetengodificultadenexpresarorecibirelamorytodosentimiento
quemehabita(porquelasangretransportamissentimientosentodomicuerpo).Mi
cabeza recibiendoyexpresandolosdiferentesaspectosdemicomunicacin,lo
mismo que las sensaciones e impresiones del cuerpo que las manifiesta
exteriormente,aprendoamantenermeabiertofrenteamientorno,aaceptarlos
mensajesquelleganamissentidosyatravsdetodomicuerpoparaaprenderlas
leccionesdelavidaquemetraernundespertarespiritualmayor.
CABEZA (dolores de)
Hayvariascausasalos doloresdecabeza.Porejemplo,elestrsylatensin
cuandomeesfuerzotantocomopueda paraestarde ciertomodoodepara
hacer tal cosa. El dolor de cabeza aparece frecuentemente cuando intento
demasiadofuertederealizaralgoocuandoestoyobsesionadoporestoquevienee
inquietoporloquemeesperaenelfuturo.Vivoenestemomentomuchaansiedad
ypreocupacin.Aspuedoreaccionarafuertespresionesejercidasporsituaciones
oacontecimientosquemerodean.Puedovivirunsentimientointensodefracaso,
duda,odiodesquedavidaalacrticay,sobretodolaautocrtica.Estoycogido,
encajonadoenmi cabeza,nomegustaloqueveo,ymejuzgoconseveridad,
dndomeammismogolpesdecabeza.El dolordecabeza puedeprovenir
tambin de la negacin y de la supresin de mis pensamientos y de mis
sentimientosquecreoinaceptablesodesaprobados.Obiennotengoelvalorde
expresarlos,osencillamentenolosescucho,porqueracionalizo,intelectualizotodo
loquevivo.Estoestbien,estoestmal!.Quieroquizscomprenderdemasiado,
irdemasiadodeprisa,querersaberotenerrespuestaamispreguntasenseguida.
Peroeltiempoquizsnohallegadoanydebodesarrollar mipacienciaymi
confianzaenquetodosucedeenelmomentojusto.El dolordecabeza expresa
tambinemocionesnegativasqueestncogidasenlatrampa,enmicabeza,tales
72

como la inseguridad, el tormento, las ambiciones excesivas, la obsesin de ser


perfecto,quecausanunadilatacinsangunea.Finalmente,sitengomiedodehacer
frenteaciertarealidad,podrencontrarmeotrolugarendondellevarmiatenciny
huir,estosiendoeldolordecabeza.Undolordecabezaalniveldelafrentese
referirmsaunasituacinenmitrabajoovinculadaamipapelsocialperosise
sitalateralmente(cercadelassienes),msbienesmiladoemocional(familia,
pareja) el que est implicado. Cualquier sea la causa, el dolor de cabeza est
directamentevinculadoamiindividualidadydeboaprenderasermspacientey
msflexiblehacamylosdems.Misideassoncadavezmsclaras,yaprendo
adarellugarquecorrespondetantoamiintelectocomoamisemociones,para
alcanzarelequilibrio.Entoncesestarmsenarmonaconmigomismo,mesentir
lacabezamsliberadayligera.
CABEZA MIGRAAS
Lasmigraasfrecuentementeestnasociadasatrastornosdelavisinyla
digestin.Yanoquieroverynoquierodigerirloquesucedeenmivida.Son
angustias,frustracinfrenteaunasituacinenlacualsoyincapazdetomaruna
decisin.Puedotenerelsentimientodealgoquedebeestarhechoorealizadooque
meestpedido.Lamigraaexponemiresistenciavinculadaamiincapacidadde
cumplirloquemeespedido.Micabezasobrecalientaymehacedaoslocon
laideadelobjetivoporalcanzarquemepareceinaccesible.Micabezaseparecea
unpresto37,lapresinsiendotanfuertequeannosculsolucinoculactitud
adoptar.Hayconflictoentremispensamientos,miintelectoqueestsobrecargado,
misnecesidadesydeseospersonales.Mesientoalaalturaotengolasensacinde
serincompetente,sobretodoenelplanointelectual?Debotomarconscienciade
queestoyhuyendodeloquememolestaoquesientoincomprensinyunacarencia
deamorporpartedealguien.Las migraas puedentambinestarvinculadasa
problemassexualestalescomolarepresindesdelainfancia,yquevuelvenala
superficie. Es como una lucha adentro mo, que se desenvuelve entre mis
pensamientosymisexualidad,estomesubealacabeza.Puedotenerlasensacin
queescomosimi cabeza fueraaexplotar.Debocomprenderque,cuandotengo
unamigraa,tengounatomadeconscienciaporhacer.Debocambiarcosasydebo
sercapazdecambiarlas,esdecirdepasaralaaccin.Aldarmeuntiempodepausa
lamigraa,puedesertambinunmododelograrmsamoryatencin.Dejolos
acontecimientos fluir libremente en mi vida y recibo a cambio alegra, paz,
armona.
CADERAS (ver tambin: PELVIS)
Llevanmicuerpoenperfectoequilibrioyestnubicadasentrelapelvisyel
38
fmur . Mis caderas permiten a mis piernas moverse para hacer adelantar mi
37

id.notaanterior.
Fmur:huesolargoquesehallaalolargodelmusloyqueformasuesqueleto.

38

73

cuerpohacadelante.Ellasdeterminansivoyhacadelanteono.Representanmis
creenciasdebasefrentealoquesonoaloquedeberansermisrelacionesconel
mundo.Lapelvisylascaderasformanunconjunto,yrepresentanaselhechode
lanzarmeenlavida.Porlotanto,lascaderasrepresentarntambinminivelde
determinacinaprogresarenlavida.Aceptoavanzarconalegrayconfianza
en la vida, sabiendo que todo es experiencia para ayudarme a descubrir mis
riquezasinteriores.
CADERAS (dolores de)
Esenlascaderasqueseiniciaelmovimientodelaspiernas,oseaelandar.
Laspiernassirvenparaavanzarlibremente.Puedoretenermedeirhacadelante.
Deaqulaindecisinparaavanzarenlavida.Porlosproblemasdelascaderas,
micuerpomeindicaciertarigidez:porlotantovivoinflexibilidadfrenteauna
situacinoaunapersona.Estopuedeprocederdeunasituacinenlacualmehe
sentido traicionado por alguien o abandonado y esto me ha afectado tanto que
vuelvo a plantearme mis relaciones con los dems. Adems, tengo el gusto de
establecernuevasreglasparaprotegerme yevitarestarheridootravez.Puedo
tenerunainquietudporelporvenir:porlotanto,sientoangustiacuandodebotomar
unadecisinimportanteporquepuedotenerlasensacinquenovoyaninguna
parteoquenuncallegaranada.Cuandomeduelesmis caderas,micuerpome
mandaunmensaje.Meayudaadesarrollarmiconscienciaparaqueadelanteenla
vidaconconfianzayseguridadymeenseaasermsflexibleenmimodode
tomardecisiones,asegurndomeasunmejorfuturo.Cuandohayundolor,hay
alguna culpabilidad. As es como un dolor en las caderas o caderas que no
quieren moverse, pueden indicarme que bloqueo mi placer sexual por temor o
culpabilidad.Inclusopuedovivirimpotenciaanivelsexualcomoenmicapacidad
enaceptarme talcomosoy,conmisgustos,misdeseos,misplaceres.Estar
perturbado sexualmente y emotivamente, impidiendo as que mis caderas
funcionennormalmente.Estaimpotenciatambinpuedevivirseenelhechoqueno
mesientocapaz oyanomesientocapazdetomar milugarydeoponermea
alguienoalgo.Estasituacinmeobligaareflexionarsobreloslmitesquemedoy.
Estoyenequilibrioyandoenlavidaconconfianzayserenidad.Agradezcolavida
por todo lo que me hace experimentar en cada instante. Aprendo a vivir en
equilibrioconestasexperiencias.
CLCULOS (en general) (ver tambin: CLCULOS / BILIARES /
RENALES)
Elclculoesunaconcrecinptreaqueseformaporprecipitacindeciertos
componentes (calcio, colesterol) de la bilis o de la orina. El clculo es la
acumulacin(osisequierelaadicin)deideasfalsas,conceptoserrneosdela
realidad que puede ilustrarse con la expresin hacer un error de clculo,
74

emocionesysentimientosinhibidos;unaconcentracindepensamientoscomouna
masadeenergaquesesolidificaysecristalizaalpuntodeformarpiedrasmuy
durasenelrganoenelcuallacausadelaenfermedadsemanifiesta.Debohacer
confianza en la vida y saber que puedo contar con mi poder divino que me
permitirverlosacontecimientosconunaaperturamsgrandeyentotalseguridad.
CLCULOS BILIARES O LITIASIS BILIAR (ver tambin: HGADO
[dolores de] BAZO)
Elclculobiliaresgeneralmenteunoovariosdepsitosdecolesterolode
cal.Enellenguajepopular,sediceavecestenerpiedrasenelhgado.Vienede
labilis.Estelquidosecretadoporelhgadosirvealadigestindelosalimentos.
Labilispasaporlavesculabiliaryelclculo formadosevuelveaencontraren
esta misma vescula (un solo clculo gordo o varios pequeos). La bilis es
ligeramente amarga y viscosa y manifiesta la amargura interior, la pena, la
agresividad,lainsensibilidad,elrencor,lafrustracinoeldisgustoquetengoy
sientohacammismoohacaunaovariaspersonas.Losclculosrepresentanun
dolormsprofundoquelosmerossntomasenelniveldelbazo,delhgadoodela
vesculabiliar.Esenergacristalizada,sentimientosy pensamientosmuyduros,
amargura, envidia e incluso celos solidificados bajo forma de guijarros, que
estuvieronmantenidosyacumuladosalolargodelosaos.Los clculos pueden
estarocultosdesdehacetiempo,perounarepentinaemocinyviolentapuede
hacerlos brotar conscientemente, con dolores intensos. Frecuentemente, estoy
decididoairhacadelante,aprecipitarmeconfuerza,aabrirpuertasperomepara
algoquemelimita,meahogaymisaccionesserealizanfrecuentementepormiedo.
Entonces,estoyfrustradodelavida,manifiestoactitudesamargaseirritantescon
respectoalagente,noconsigodecidirmeporquecarezcodevalorymisfuerzas
interioresestnmalcanalizadas.Notengodominiodemmismo.Eselmotivo
por el cual tengo clculos biliares. Qu es lo que influencia mi vida? Soy
demasiado orgulloso? Por ms que los clculos son la expresin de una vida
endurecida, debo aceptar liberarme del pasado y tener una actitud y
pensamientosmssuaves,unaaperturadiferentehacalavidasoltandoelpasado,
lossentimientoslejanosylasviejasemocionesamargas,permitindomeaselamor
verdadero.Elprocesodeadaptacinalniveldelcoraznmeayudaraverms
claroenmividayamejordescubrirelcaminoquemejorarmisituacin.
CLCULOS RENALES o LITIASIS ORINARIA (ver tambin: RIONES)
Los clculos renales, tambin llamados piedras en el rin, estn
vinculadosconelrin,sededelmiedo.Eslaformacindelaspiedrasocristales
procedentesdecantidadesabundantesdesaldecidorico,residuohormonaldel
rin.Elcidoricorepresentaviejasemocionesporexpulsar.El clculo puede
formarse en las diferentes partes del sistema urinario. Es una masa de energa
75

solidificada,creadaapartirdepensamientos,miedos,emocionesysentimientos
agresivossentidoshacaalguienounasituacin.Aunqueseformenlosclculosen
losriones,noseengendranenellos.Elrinesunfiltrodeemocionesdelos
residuosdelcuerpo.Laabundanciadesalesdecidoricoindicalaabundanciade
sentimientos agresivos solidificados porque estuvieron largo tiempo retenidos.
Vivofrustracionesysentimientosagresivosenmisrelacionesdesdetantotiempo
quemiatencinestnicamentefijadaenello.Unapersonaequilibradatienelos
rionesslidos,perodiferentesrasgosdecarcterpuedencausarlos clculos:
soymuyautoritario,inclusoextremadamente, duroparaconmigomismoylos
dems, decido y hago mis elecciones en reaccin, me quedo seriamente
enganchado al pasado, carezco de voluntad y confianza. Los clculos renales
implicanamenudounestiramientointeriorentremivoluntadymisdecisionesque
llevanaunexcesodeautoritarismo:sabiendoquesoydbilyquetengomiedo,
movilizotodaslasfuerzasdisponiblesenunmismolugarparacumplirciertas
tareas,ycuandoelperododeestrshapasado,estaconcentracinseendurecepara
formarlos clculos.Deboempezar porvolveraencontrarciertapazinteriorsi
quierodejardetenerclculos.Deberapensarmenosensituacionesconflictivasy
en ciertos problemas porque, siguiendo as, me impido ir haca delante. Debo
resolverlosdefinitivamenteyverelfuturoconcalmayflexibilidad.Esunacuestin
deconscienciayactitud.
CALOR (golpe de) (ver tambin: FIEBRE)
Los golpes de calor (deshidratacin) pueden producirse despus de una
exposicin prolongada al sol, bien sea en la playa o durante otros deportes
exteriores.,despusdeunaexcesivacalefaccineninviernoocuandomeencuentro
en una habitacin muy pequea y mal ventilada. Puedo encontrarme con una
debilidad muscular general, la piel hirviente y seca, el rostro grisceo y tener
ojeras.Enelplanometafsico,elcalorpuedeasociarsebienalamorcuandosetrata
decuracinporquehaymsenergaencirculacin,bienalairacuandohayfiebre
y quemadura. Aqu, el golpe de calor representa culpabilidad frente al amor,
vinculadaaunsentimientodefaltadeestimades.Necesitoamaryseramaday
noconsigoencontrarelmododehacerlo,colmarestevacointeriorqueestenm
yneutralizarestainsatisfaccin.Todomicuerpomeindicalanecesidadurgentede
colmaresteamor.Buscocmoaumentarestaestimades,ocmointegraruna
situacinquemeafectenlainfanciayqueafloraahoraensuperficie.Amolavida
ylavidamelodevuelvemultiplicadoporcien.
CNCER (en general)
El cncer es una de las principales enfermedades del siglo veinte. Se
desarrollanclulasanormalescancerosasy,alnoreaccionarelsistemainmunitario
frenteaestasclulas,proliferanrpidamente.Lossereshumanosfrecuentemente
76

tienenclulasprecancerosasenelorganismoperoelsistemainmunitario,esdecir
elsistemadedefensanaturaldenuestrocuerpo,seencargadeellasantesdequese
vuelvancancerosas.Esporquedichasclulasanormalessedesarrollandemodo
incontrolado39eincesantequepuedendaarelfuncionamientodeunrganoode
untejido,pudiendoasafectarpartesvitalesdelorganismo.Cuandoestasclulas
invadenciertaspartesdelcuerpo,sehabladecncergeneralizado40.Elcncerest
principalmenteligadoaemocionesinhibidas,profundoresentimientoyaveces
muyviejo,conrelacinaalgoounasituacinquemeperturbaanhoyyfrentea
lacualnuncameatrevaexpresarmissentimientosprofundos.Auncuandoel
cncerpuededeclararserpidamentedespusdeundivorciodifcil,unaprdidade
empleolaprdidadeunserquerido,etc.,habitualmenteeselresultadodevarios
aos de conflicto interior, culpabilidad, heridas, penas, rencores, odio,
confusin y tensin. Vivo desesperacin, rechazo de m. Lo que sucede al
exteriordemsloeselreflejodeloquesucedeenelinterior,elserhumano
siendorepresentadoporlaclulayelmediodevidaolasociedad,porlostejidos.
Con mucha frecuencia, si estoy afectada de cncer, soy una persona que ama,
servicial,muyatentaybondadosaparamientorno,sumamentesensible,sembrando
amor y felicidad alrededor mo. Durante todo este tiempo, mis emociones
personalesestnrechazadasenlomshondodemmismo.Durantetodoeste
tiempo,mis emociones personales estn inhibidas en loms hondo dem. Me
confortoymeengaoencontrandosatisfaccinenelexteriorenvezdelinteriorde
mmismoyaquetengounadbilestimadem.Entonces,mecuidodetodoel
mundo,dejodeladomisnecesidadespersonales.Yaqueparecequelavidayano
metraiganada,captuloycarezcodelasganasdevivir.Dequsirveluchar!Si
vivomuchas emocionesfuertes,deodio,culpabilidad,rechazo,estarenmuy
fuerte reaccin (igual como la clula); incluso me sentir responsable de los
problemas y sufrimientos de los dems y querr auto destruirme. Estoy
resentidaparaconlavida,esdemasiadoinjusta.JuegoalaVctimadelaVida
ymevuelvoprontoVctimadelcncer.Sueleserelodiohacaalguienouna
situacinquemeroerelinterioryqueharqueseautodestruyanlasclulas.
Esteodioestprofundamentehundidoenelinteriordemiseryfrecuentementeno
tengoconsciencia dequeexiste.Esthundidodetrsdemimscaradebuena
persona. Mi cuerpo se desintegra lentamente porque mi alma se desintegra
tambin: necesito colmar mis deseos no satisfechos en vez de nicamente
complaceralosdems. Deboconcedermealegras,pequeos dulces. Cumul
resentimiento,conflictosinteriores,culpabilidad,autorechazohacamporque
39

SegnlostrabajosdeRykeGeerdHamer,elcncereseldesarrollodeclulasespecializadasyorganizadas
procedentesdeunprogramaespecialemitidoporelcerebroenrespuestaaunexcesodeestrspsicolgico.
40
Enelcasodecncergeneralizado,frecuentementeescuestindemetstasis,esdecirdeclulascancerosasque
procederandeotrasclulascancerosasdeotrapartedelcuerpoyquehubiesensidotransportadasporlasangreola
linfa.Pareceraqueexistapocooningunaevidenciadeestahiptesisdeclulascancerosastransportndosedeun
lugaraotro.Msbienpodratratarsedelhechoqueelprimercncerqueprocedadeunconflictohayallevadoa
lamanifestacinyalapuestaenevidenciadeotroconflictoque,l,provocaotrocnceryassucesivamente.

77

siempre actu en funcin de los dems y no en funcin de lo que quiero. La


paciencia ejemplar y presente en m se acompaa frecuentemente de una dbil
estima de s. Evito darme amor y aprecio porque creo que no lo merezco. Mi
voluntaddevivirsevuelvecasinula.Mesientointil.Dequsirvevivir?Esmi
mododeacabarconlavida.Meautodestruyoyesaquunsuicidiodisfrazado.
Tengolasensacindehaberfalladomividayveostacomounfracaso.Laparte
delcuerpoafectadamedaexplicacionessobrelanaturalezademi(s)problema(s):
estoindicacualessonlosesquemasmentalesoactitudesquedeboyoadoptarpara
hacerquedesaparezcalaenfermedad.Debovolveratomarcontactoconmiyo
interioryaceptarme talcomosoy,conmiscualidades,misdefectos,mis
fuerzasymisdebilidades.Aceptodejarcaerlasviejasactitudesycostumbres
morales.La aceptacin demienfermedadesesencialparaquepuedaluego
luchar.Siyorehusoaceptar mienfermedad,cmopuedocurar?Abromi
coraznytomoconsciencia detodoloquelavidapuedetraerleydeenqu
medidaformopartedeella.Recibiendountratamientoencuracinnatural,masaje
ocualquierotratcnicaconlacualmesientoagusto,tendrelefectodeuna
armonizacinquemepermitirabrirmiconscienciaatodaslasmaravillasdela
vidaylabellezaquemerodean,yfortalecerasmisistemainmunitario.
CNCER DE LA BOCA
El cncerdelaboca puedesituarsealniveldelsuelodelaboca,delos
labios, de la lengua, de las encas o del paladar. Al ser la piel la lnea de
demarcacinentreelexteriorymiinterior,laboca,ens,eslapuertadeentrada,el
vestbuloentreloqueentra(aire,alimento,lquido)yloquesaledeella(aire,
palabrastransportandolasemociones).Puedequeseaunapersonadequiensedice
quesecomeasuprjimo).Puedoalimentarsentimientosdedestruccinhacauna
ovariaspersonas,locualmehacedecir:al,melocomera!Queriendodecirque
ledeseomalosumuerteenciertosentido.Porlotantotengogrannecesidadde
dejarentrarenmsentimientosdeamor,yexpresarsentimientosdeamorhacala
gentequemerodeayhacam,dicindomepalabrasdeamor.
CNCER DE LOS BRONQUIOS (ver: BRONQUIOS BRONQUITIS)
CNCER DEL CUELLO DEL TERO ( ver tambin: TERO)
Elcuellodeltero(igualcomoeltero)representalafeminidad,lamatriz
originalyelhogarmaterno.Inhiboprobablementeciertasemocionesreferentesa
mi hogar,mi familia ocualquiersituacinvinculadaaambosaspectos.Puedo
sentirme culpable, rencoroso u odioso, pero no lo comento. El hogar suele
representarunidealporalcanzar,biensearespectodemiparejaodemifamilia.
Puedovivirgrandesmiedos,inseguridadoculpabilidadconlaideaqueestehogar
78

noseformarcomoloquisiera,obienquecorreelriesgodedisolverse,locual
representaraparamunfracaso.Seguirunadesvalorizacinconrelacinaquien
soyyloquesoycapazderealizar.Tengoyomiedodevolveravivirenmihogar
elenjuiciamientodeunfracasoquepuedequetuveenelhogarenelcualcrec?
Estetipodecncerestprofundamenteligadoalosprincipiosdelhogarnutricio,a
misactitudesymiscomportamientosconrelacinaste.Aceptomirarconotra
miradaestehogarqueeselmo!
CNCER DEL COLN (ver tambin: INTESTINO [dolencias en los ]/
ESTREIMIENTO.
Elcolnesunapartedelintestinogruesoenlacualdigierolosalimentos.Es
uno de los tipos de cncer ms frecuentes en Amrica del Norte a causa del
consumoexcesivodecarneycerealesrefinados,azcar,etc.Estosalimentosson
difcilesdedigerirydeasimilar.Sinembargo,existentambinotrasrazones:la
bsquedacontinuadesatisfacciones,placeresydeseosmateriales,sumadosalos
diferentes estados fsicos, emocionales y mentales que puedo vivir cada da
(alcancedelaexcelencia,ansiedad,angustia,etc.)sonlascausasprincipalesdeun
desordenalimentarioodigestivo.Tengopocaalegrainterior,estoymsomenos
satisfechodemividatalycomoes.Mesientomanchadoencuantoaunaspectode
m mismo. Me pongo a comer e inhibo mis emociones: es ms fcil y mis
necesidadessecolmanmuchomsrpidamente.Elijounaformaderecompensa
queme es accesible muyfcilmente. Busco cierta satisfaccin que meencanta
volverahallarenlaalimentacingrasaypesada.Elestrs,elmododevidayla
herencia son probablemente tambin factores que predisponen a este tipo de
enfermedad. El
cncer

del coln puede derivar de causas similares a las del


estreimientoperoconunfactoremocionalmsimportanteyprofundo.Enelcaso
del estreimiento, son las energas o las emociones ms superficiales las que
intervienen;encambio,enelcasodelcncerdecoln,hayquebuscarlacausaen
lasenergasyemociones situadasmsenprofundidad.Por esto,misintestinos
puedenfuncionarnormalmenteoregularmenteypuedosinembargodesarrollarun
cncerdelcoln.Misintestinoshacenpuesloquepuedenparaconservarmeen
buenasaludydeborespetarlespreservandosubuenestadolomstiempoposible.
Meabromsalasalegrasdelavidayexpresolasemocionesqueformanparte
demivida!Empiezoapracticardiferentesformasderelajacinfsicaeinterior
quemeayudarnatomareltiempodevivirunaexistenciamsequilibrada.
CNCER DEL ESTMAGO (ver tambin: ESTMAGO [dolencias del])
Sitengoelcncerdelestmago,debotomarconscienciadeltrozoodela
situacinquenosoycapazdedigerir.Estasituacinquenopasa,lavivodeun
modomuyintensoymuyfuerte.Esabominabletodoloquemehicieron,todolo
quemehicieronsufrir.Adems,novinadallegar!Estopuedeexpresarloque
79

vivo. Es importante que tome consciencia del porqu de esta situacin y cul
leccinhedesacarparadejarpasarlatormentayqueseresorbeelcncer.Slo
puedoganarsisueltomiiraymirencoryquelossustituyoporlaaceptaciny
elperdn.
CNCER DE LOS GANGLIOS (del sistema linftico) (ver tambin:
ADENITIS, ADENOPATIA, GANGLIO [linftico])
El sistemalinftico seencuentraenmicuerpoenparaleloconmisistema
sanguneo.Transportaunlquidotransparenteyblanquinosollamadolalinfaque
sirve a alimentar las clulas. La linfa contiene protenas y linfocitos (glbulos
blancos)yjuegaunpapelimportanteenelprocesodeinmunidadydedefensadel
organismo.Elsistemalinfticoestvinculadomsdirectamenteamisemociones,a
miladoafectivo.Losgangliossoncomopequeosrionesdelsistemalinfticoy
sirvenparafiltrarlalinfadesus impurezas, unpococomolosrionesparael
sistemasanguneo.Entonces,uncncerdelosgangliosmeindicagrandesmiedos,
culpabilidad y desesperacin frente a mis emociones en los planos amoroso y
sexual. Incluso si vivo actualmente una vida amorosa armoniosa, puede que
profundasdecepcionesvuelvanalasuperficiebajoestaformade cncer.Debo
aceptar que todo puede ordenarse en mi interior con armona y amor,
trabajandosobreminiointeriorherido.
CNCER DE LOS HUESOS (ver: HUESOS [cncer de los ])
CNCER DEL INTESTINO (delgado) (ver tambin: CNCER DEL
COLN, INTESTINOS [dolencias en los ])
Este cncer se encuentra habitualmente al nivel del intestino delgado.
Cuandodesarrolloestaenfermedad,debohacermelapregunta:Quesloqueno
puedodigeriryquepasadetravs?Puedeserunapalabraquemehasidodichay
que me parece mala o puede ser tambin una accin que hallo injusta y no
aceptable.Eltrozoestangordodetragarquenossivoyaconseguirdigerirlo.
Tambinpuedovivirungrantemoresdecirsabersisiempretendralgodecomer
enlanevera.Temomorirmedehambreporfaltadevveres.Sealaqueseala
situacin,desarrollounaactitudmspositiva,sabiendoquelavidaquierelomejor
paramyqueaceptovivirenlaabundancia.Aprendotambinaperdonaralas
personasquepuedenhabermedichoohechoalgoquemeparecedifcildedigerir.
Tomoeltiempodeexpresaraestapersonaelcmomesientoparatraerlaarmona
enestasituacin.Eliminoelrencorenmividaylosustituyoporlacomprensiny
laaperturadelamente.

80

CNCER DE LA LENGUA ( ver tambin: ALCOHOLISMO, CIGARRILLO)


Aunqueseadmitaqueel cncerdelalengua puedaserfavorecidoporel
tabaquismo o el alcoholismo, procede de un profundo sentimiento de
desesperacinsignificandoqueyanotengoelgustodevivir.Adems,puede
quenoexpreseestemaldeviviroqueinhibaasdichasemocionesadentromo.El
alcoholismoyeltabaquismonosonmsquelasampliacionesdelossentimientos
quevivo:porelalcoholismo,huyodemisemociones,poreltabaquismo,hago
pantalla a estas emociones que no quiero ver. Es con la lengua que busco el
alimentoparapodermascarloconmisdientes;porlotantositengouncncerdela
lengua,debopreguntarmesi,ensentidofigurado,tengolasensacindesercapaz
decogereltrozodealimento.Veoloquequieroalcanzarcomoalgovitalpara
m.Estopuedeseruntrabajo,alimento,unanuevarelacin,etc.Buscorecobrarel
gustodelavida,aumentarmiestimademyaprendoaexpresarmisemociones.
Descubrirastodoloquelavidatienedehermosoporofrecerme.Pasoalaaccin
yvoyabuscarloquenecesitoporquemelomerezco!
CNCER DE LA LARINGE (ver tambin: CIGARRILLO, GARGANTA,
[DOLORES DE])
Cuando un tumor maligno se instala en las paredes de la laringe, esto
significa que siento una gran necesidad de expresar mi pena interior. Tendra
necesidaddechillartodamipenaytengomiedodeexpresarmiperturbacin.Hay
algunapersonaosituacinquemeimpidaexpresarmeas?Puedequemediga:
Msvalecallarporqueseraintilquehable!.Tengolasensacindequeseme
caeencimayquisieraenfadarmeperonomeatrevo.Nomesientorespetadoporlo
quesoy.As,tengoqueaprenderatomarmilugaryexpresarloqueesparamla
verdad.Estomeayudaracomprendermejorellugarqueocupoenmientornoy
enelUniverso.
CNCER DE PECHO (ver tambin: PECHOS [dolencias de los ])
Lospechosrepresentanlafeminidadylamaternidad.Estetipodecncer
sueleindicarciertasactitudesypensamientosprofundamentearraigadosdesdela
tiernainfancia.Desdelosaos60,enciertoslugaresdelmundo,lamujerseafirma
ms,tomasulugarenlasociedadyquiereirhacadelante.Entoncespuedotener
dificultadenexpresarmisverdaderossentimientos,enencontrarunequilibrioentre
mipapeldemadreydemujercumplida.Estosconflictosinterioresprofundosme
atormentancomomujerquebuscaeljustoequilibrio.Sehadescubiertoqueeste
tipo de cncer generalmente viene de un fuerte sentimiento de culpabilidad
interiorhacaunomismoohacaunoovariosdesushijos:Porquhanacido.
Quhiceparatenerlo?Soybastantebuenamadreomujerparacuidarmedel?
Todasestaspreguntasaumentanminiveldeculpabilidad,llevndomearechazarme
yaumentandomitemoraquemerechacenlosdems.Deborecordarmequeel
81

amor por mi hijo siempre es presente pero que mis pensamientos son muy
poderososyquedebovigilarlos.Simejuzgocondemasiadaseveridad,todamiira
ymirechazoseamplificarn,ymisemocionesestarnexpulsadasalniveldemis
pechos,quesevuelvenelsmbolodemifracaso.Un cncerdelpecho quiere
puesayudarmeatomarconscienciadequevivounasituacindeconflicto,tantode
caraammismocomoaalguienms,queestvinculadaaunelementoque
formapartedemiespaciovital,deminido.Frecuentementesetratardemis
hijos,mispajarillos,odealguienaquienconsiderocomotal(porejemplouna
madreenfermaquesientodesprotegida,comounniopequeo).Puedotener
miedoqueminido(hogar)sederrumba.Tambinpuedotenerungranmiedoo
ungranestrsconrelacinalasupervivenciadeunodemishijosodetodosellos.
Enunsentidomsamplio,elnidopuedeagruparmicnyuge,mihogar,mis
hermanosyhermanas,particularmentesivivenbajoelmismotecho.Espuesfrente
alafamilia,loquehistricamentepodrallamarseelclan,quetengolasensacino
eltemordequehayaderrumbamiento,estallido.Loshombrescomolasmujeres
puedendesarrollarestetipodecncer,queesfrecuentementeelconflictointerior
masculino en aceptar su propia naturaleza femenina. Sucede que algunos
hombres manifiestan su lado femenino y materno casi tanto comolas mujeres.
Comohombre,nuncaserunamujerpero,energticamente,puedosertantooms
femeninoquesta.Porestoel cncerdepecho,enmquesoyunhombre,est
asociadoalaestimademmismoyamicapacidaddeexpresarnaturalmentemi
ladofemeninoinnato.Puedeestarvinculadoalhechoinclusodeserunhombreyal
deseoinconscientedeserunamujer.Esunaspectoquedeberequilibrarenmi
vida. El lado izquierdo corresponde al campo afectivo y el derecho, al campo
racional. El cncer en el pecho izquierdo designa pues todas las dificultades
afectivasylasemocionesinhibidasenmcomomujerymsmevaleaceptarla
mujerylamadreenm,ylossentimientosinterioresquevivoconrelacinacada
unodeambospapeles.Enelsenoderecho,elcncerindicalamujerresponsable
y lo que se espera de m (lo que pretendo hacer con esta mujer exterior).
Observenqueestoseaplicatambinaloshombres,aunqueelcncerdelpechoen
loshombresseamsescaso.Param,comomujereneluniversofsico,elvolumen
ylaformademispechospuedentenerciertaimportanciasegnlascircunstancias.
Seobservaquesimiladomasculinoesdominante(yang) 41,puedotenersenosms
pequeos y puedo considerarles frecuentemente como intiles o sin valor. El
cuerpohablaymis senos tambin;soyyolaquehededecidirlaimportancia
concedida a este smbolo femenino y sexual. La bsqueda de un equilibrio es
importante y el cuerpo se ajustar energticamente en consecuencia de las
decisionestomadasporlamujer(oelhombre)enelporvenir. Todoestenla
actitud,elamorylaaceptacindes.
41

Yang:EselnombrequesedaenmedicinaChinaalaenergaracionalomasculina.Laenergaafectivaofemenina
sellamaYin.

82

CNCER DE LOS PULMONES (ver tambin: CIGARRILLO, PULMONES


[dolencias de los ])
Alestarlospulmonesdirectamentevinculadosamicapacidaddevivir,el
cncer de los pulmones me indica mi miedo de morir. En efecto, hay una
situacinenmividaquemeroepordentroymedalasensacinquememuero.
Quizsesdespus deunaseparacinodeundivorcio,delamuertedeunser
querido,delaprdidadeunempleoqueesmuyimportanteparam.Dehecho,toda
situacinqueparamrepresenta,conscientementeoinconscientemente,mirazn
devivir.Cuandodesaparecemirazndevivirositengomiedodequedesaparezca,
estoponeenevidenciaquelaotraposibilidadqueamsemepresentaes,encierto
modo,lamuerte.Entonces,quhaydelarelacinquesehaceentrelosfumadores
yelcncerdelospulmones?Puedopreguntarmesieselhumodecigarrilloque
metraeelcncerdelospulmonesosieselmiedoamorirquemehacefumar
cigarrillosy,enconsecuencia, mehacedesarrollarel cncerdelospulmones.
Cuandofumo,pongounvelosobreemocionesquememolestanyquemeimpiden
vivir.Alnoresolverelconflicto, stepuedecrecerenmalpuntodehacerme
desarrollaruncncerdelospulmones.Entonces,deboaceptarlavidaypensar
queconcadainspiracinyexpiracin,eslavidaquecirculaenmmedianteelaire
querespiro.Decidoquequierovivirmsalldemismiedosyquelavidamerece
servivida,quemerezcovivir.
CNCER DE TESTCULOS
Enlostestculossehacelaproduccindelosespermatozoidesesencialesa
lareproduccin.Sidesarrollouncncerdelostestculos,debocomprobarsivivo
unsentimientointensodebidoalaprdidadeunhijo,oalgoenmividaqueera
para m tan importante o tan valioso como un hijo. Puedo haber vivido el
fallecimientodeunodemishijos,tantoporenfermedadcomoenunaccidenteo
despusdeunaborto.Puedesertambin,porejemplo,unodemishijosqueseha
marchado(deunportazoyquenuncavolvaver.Alhabersalidobruscamentede
mivida,puedovivirestasituacincomola prdida deunserquerido,comosi
hubieramuerto.Otroejemplopuedeestarvinculadotambinamcomohombrede
negociosque,acausademalasinversionesfinancieras,perdlaempresaquehaba
creadoyqueconsiderabacomomibeb.Sealaquesealasituacinvivida,
tomoconscienciadelossentimientosquemehabitan;losaceptoparaayudarme
acurarmisheridas,volveraaprenderarerymirarahorahacadelanteenvezde
rumiarelpasado.

83

CANCRO (en general) (ver tambin: LCERA [en general])


Elcancroseencuentraenunlugaraisladodelapielodelasmucosasbajo
formadelcera.Eslasealdeunaenfermedadcontagiosaensusprincipiosyque
sueleserdeorigenvenrea.Vivoiraqueserefiereamisrelacionessexuales.El
lugardondeelcancroaparecemeindicamsprecisamenteloqueestoyviviendo
enestasituacin.As,elcancropuedehallarseenlaspartesgenitales,enelano,en
el rostro, en las mucosas de la boca. Cuando un cancro bajo forma de lcera
conteniendopus,seencuentra enlaboca,esquemeimpidodecirciertascosas.
Estoydisgustado,desapruebociertassituacionesenmividaynomeatrevoahablar
deello.Guardociertaspalabrasyporlotanto,stas fermentan yproducenpus.
Aceptohablaryexpresarmepormuchoqueestendesacuerdoconlaviday
losdems.Debohacerlosiquieromantenermeabiertoalaenergaactivadela
palabraydelaexpresinde s.Me acepto enmisexualidad ymedoyel
derechodedescubrirelamorquemeayudaradesarrollarme.
CANCRO LCERA BUCAL (HERPES) (ver: BOCA [dolencia de la ]
CNDIDA (ver tambin: INFECCIONES)
Hayvariostiposdecndida.Laformamsfrecuenteenelserhumanoesel
cndidaalbicano.Aunquepuedaencontrarseenelhombreoenlamujer,sueleser
msfrecuenteenlamujer.Cndidaesunapalabralatinaquesignificablanca.Es
una infeccin vaginal procedente de la proliferacin de hongos bajo forma de
levadura.Separecealevadurablancayconcostraquesemanifiestadespusdeun
desordendelafloravaginal.Lasbacteriasdelavaginacontrolannormalmenteel
cndida pero esta vez, cambia la situacin. Esta infeccin est naturalmente
vinculadaamicompromisofrenteammismaoamiparejaconrelacinami
sexualidad, a situaciones, expresiones y emociones no expresadas despus de
ciertosconflictospersonalesanteriores.Vuelvoaplantearmiactividadsexualymi
sexualidad,miaperturaacompartirconmiparejaaspectosmsntimosdem
misma.Lainfeccincorreelriesgodeproducirsesi,porejemplo,tengounanueva
parejayquemirelacinconellaesmuyntima.Hayprobabilidadesdequeme
abramsalamor,alcompartiryalaentrega.Esnuevoparamynecesitounpoco
detiempoparatratarestarecientesituacinaunquesemanifiestaelcndida.El
cndidapuedetambinprocederdelsentimientodehabersidorebajadoodesero
sentirsesexualmenteabusadoporalguien.Esunaespeciedeproteccinfsicay
sexualporquelairritacinmeimpidehacerelamor.Quesloquetantomeirrita?
Compruebo cual es el aspecto interior de mi sexualidad que est molestado y
encuentrolaverdaderacausadelairritacinfsicaeinterior.Debocogermisitioen
lavidarespetndome.Deboserahoraelcandidatoqueservictoriosoyquetomar
laprimeraplaza.Tomoeltiempodeveryvalorarloquesucedeyacepto el
amor,laaperturaylapacienciainteriorestantocomolosdemipareja.
84

CANSANCIO (en general)


El cansancio me da la sensacin de estar sin pilas. Interiormente, estoy
vaco.Adndesefuemimotivacin?Misinquietudes,mismiedos,mispenasy
misheridasinterioresmellevanalucharyaresistir.Envezdecentrarmienerga
para encontrar el punto comn de mis dificultades, la esparzo en demasiadas
direcciones a la vez. Desespero incluso de encontrar una solucin. Vivo cierto
cansanciofrentealavida,uncansanciointeriorporquedebodebatirmeparaseguir
adelantando. La depresin incluso es posible. Siento un sentimiento de
incompetencia, de carencia y ausencia de inters. Esto indica una prdida de
direccinydeintencin,unanecesidaddereanudarconlaalegrainterioryelamor
de la vida. Necesito un tiempo de pausa, de descanso para hacer el balance y
recuperarmienerga.Dejodeengancharmealpasadoyaceptovivirelinstante
presenteporquecadainstantemetraelaenergaquenecesito.
CANSANCIO CRNICO (sndrome de) o ENCEFALOMIELITIS
FIBROMIALGICA (E.M.F.) (ver tambin: CRNICA [enfermedad])
El sndrome del cansancio crnico o ENCEFALOMIELITIS
fibromialgica puedesucederdespusdeunachaqueviralypuededurarvarios
aos.Tambinpuedequeestoseproduzcaporquemisistemadedefensanatural
del cuerpo, mi sistema inmunolgico, est debilitado. Tambin puede que mi
psiquismo est afectado, debido a una depresin, estrs, falta de motivacin,
agotamientoporcansancioexcesivo,etc.Mentalmente,estoyagotadoyesto se
reflejaenmiinestabilidademotiva.Fsicamente,padezcodoloresdecabezaymi
fuerzamusculardisminuyepocoapoco.Elmenoresfuerzomecausauncansancio
intenso. Perd el gusto de vivir. Dnde estn mis sueos y mis ambiciones?
Tambintengomiedodelavidaydelasresponsabilidades.Mesientoincapazde
responderaloqueseesperadem.Dehecho,laenfermedadmepermiteretirarme,
esmiexcusaparanoactuaryquizs,unmedioderecibirmsatencin.Asme
sientomsenseguridadenmienfermedadqueenmienfrentamientoconlavida.
Quesloqueestabaviviendoenelmomentodelachaqueviral?Habadecidido
dejar mi hogar? Acababa de vivir un deceso, una ruptura, un rechazo? Tomo
conscienciadequetodoestoestvinculadoconelamor,oseaelamorquetengo
hacam.Aceptoaprenderaamarmems.Soylapersonamsimportanteen
mi vida. Aprendiendo a amarme, hago las cosas para m y disfruto con cada
instante.Formopartedeluniversoendondelareciprocidadesley.Meamoyas
atraigoelamordelosdemsylosamotambin.Hagoconfianzaaluniversoque
meayudacadadaaadelantar.

85

CARRASPERA (ver GARGANTA CARRASPERA)


CATARATAS (ver: OJOS CATARATAS)
CEGUERA (ver: OJOS [dolencias de ])
CELOS:
Eldiccionariodefinelosceloscomounsentimientodefrustracinmezclado
deenvidiavinculadoalhechoqueotrapersonalograoposeeloquemehubiese
gustadoobteneroposeer.Eselresultadodeunainseguridadinteriorydeunadbil
estimadesydeunadbilconfianzaenmquemellevaadudardemicapacidad
decrearcosasenmividaoatenermiedodeperderloquetengo(enparticularami
cnyuge)Vengoadesarrollaragresividadyfrustracin.Tomoconscienciadeque
mistemoresmellevanaejercercontrolsobreunapersonaounasituacin.De
hecho,sonmisangustiaslasqueejercenuncontrolsobremivida.Aprendoatener
confianzaenlavidaytomolosmediosparacurarestasheridasinterioresporla
psicoterapiaindividualodegrupooporunenfoqueenergticoquemellevaraa
conectarmsconmipropiopoderinterior.Entoncesmesentirmslibre,ms
confiadoypodrtrasponerestalibertadyestaconfianzahacalosdemsparavivir
mejorenarmonaconmigomismoyconlagentequemerodea.
CELULITIS
Aveces,la celulitis estcaracterizadaporlainflamacindeltejidocelular
cutneoosubcutneo.La celulitis sueleserdenaturalezafemenina(aunquees
posibleenloshombres)ysemanifiestaporlaretencindeaguayunaumentodela
distribucinirregulardelastoxinasydelasgrasasenlasnalgas,piernas,abdomen,
nuca, espalda, etc. La celulitis se vincula con las ansiedades, aspectos de m
mismoqueretengo,emocionesreprimidas,pesaresyresentimientosqueguardo.
Est vinculada al compromiso de cara a m mismo u otra persona. Temo
comprometermeplenamente conlapersonaqueamoyrehsoirhacadelante.
Este miedo puede tener su origen en un acontecimiento en el cual viv un
abandono. Me niego a contemplar cierta parte de mi juventud, porque con
frecuencia,fuiheridoymarcadoporciertasexperienciastraumatizantesqueme
agredenanhoyyquefrenanmicreatividadymicorazndenio.Lacelulitisse
vuelveahallarmsenlasmujeresqueenloshombresporqueyo,comomujer,
empiezo muy joven a preocuparme de mi aspecto, con mi silueta que quiero
perfectasegnlasnormasdelasociedad. Elaspectoesttico esexcesivamente
importante. Compruebo cules son los sentimientos que me impiden ir haca
delanteyaceptointegrarlosdespacioenmividadiaria.

86

CEREBRO (en general)


Es la central energtica, la unidad central del tratamiento de todas las
informacionesdelamaravillosamquinahumana.Elcerebroestvinculadoconel
sptimochakra(chakradelacorona)ocentrodeenergayconlaglndulapineal
tambin llamada epfisis del cerebro. Posee dos hemisferios distintos. El
hemisferio derecho, el Yin de los Chinos, representa el lado femenino
(introvertido),lacreatividad,laglobalidad,laintuicin,laspercepcionesyelarte;
esel hemisferio receptor.Elhemisferioizquierdo,elYang,eselque da,que
domina,queesextravertido,agresivo,racional,lgicoyqueloanalizatodo.
Cada hemisferio controla la mitad opuesta del cuerpo (el hemisferio derecho
controlalamitadizquierdayviceversa).Elcrucedelosnervioscervicaleshacael
ladoopuestosehacealniveldelosojos,sededelchakraocentrodeenergadel
tercerojosituadoenlarazdelanariz,entrelascejas.Elcerebroeselrganoque
representaelcentrodeluniverso,laidentificacincontodaformadedivinidad.
CEREBRO (dolencias del )
Los problemas de mi cerebro me indican que tengo tendencia a querer
comprenderconmicabezaymiladoracionaltodaslasituacionesquevivo.Dejo
de lado mis emociones con las cuales temo entrar en contacto intentando
convencerme que no sirven de nada o que pueden ser ms nocivas que tiles.
Adquirunagranrigidezencuantoamimododepensaryquieroabsolutamente
tener razn! Es pues difcil para m cambiar de opinin y admitir que puedo
haberme equivocado. Por lo tanto tengo ventaja en poner de lado mi aspecto
demasiadoadulto,serioyracionalyarecobrarmiladonioqueamarer,
disfrutaryqueirradiaporsuingenuidadysudeseodeaprender.
CEREBRO (absceso del )
Cuandoelabscesoalcanzamicerebroporqueprocededeunainfeccinde
missenosodemiorejamedia,odecualquierotrapartedelcuerpo,estoindicami
ira frente al asumir mi vida y el miedo que siento de perder el control de mi
autonoma.Entoncesdebohacerconfianzaenelpoderdivinoquemehabitayque
meguahacasolucionesquemeayudanadescubrirmiplenopotencial.
CEREBRO (tumor en el )
El tumor es una proliferacin excesiva de las clulas anormales en el
cerebro.Eltumorestconectadoconemocionesreprimidas,pesaresprofundos,
sufrimientosdelpasado.Enelcerebro,eltumorprimitivo42quesedesarrollaa
partir de clulas del cerebro significa que mi central del tratamiento de las
informacionesregistraanciertasideas,creenciasoesquemasmentalesqueyano
tienen su razn de ser! El tumor resulta de un golpe emocional y violento
42

Verlanota37referentealcncergeneralizadoenlaseccinCNCER(engeneral).

87

vinculadoaunasituacinounapersonaaquienammuchooaalgoquemehizo
sufrirmuchoofrentealacualmantengoanhoyodio,rencor,miedos,cleray
frustraciones.Simitumorsesitaenlapartesuperiordelcerebro,enmediooen
lahipfisis,esfrecuentementedebidoaunimpactoemocionalobienporquetengo
miedopormiespiritualidad,miintuicin,etc.Soytestarudoyrechazocambiarmi
mododeveraquyahora,aceptar mividaytodoloquelaacompaa.Soy
rgido y fijado en mis pensamientos, interiormente estoy confuso. Transporto
energamentalqueyanocorrespondeamisnecesidadesmsprofundasyqueeslo
opuestodemisdeseosdivinos.Micuerporeaccionafuertementeybrotaentonces
unaproduccinfueradecontroldeciertasclulasdelcerebro.Esunestadocrtico
ypeligrosoydebotransformarmiactitudcerradaenunaaperturadecoraznsi
quieropararestetumor.Apartirdeahora,aceptoverlavidadeunmodoms
abiertoyflexible.Estenconstantetransformacinyevolucionasiemprehacalo
mejor.Miconfianzapersonalmepermitiralcanzaresteobjetivo.
CEREBRO ACCIDENTE CEREBRO VASCULAR (A.C.V.) (ver
tambin: INFARTO [en general], SANGRE / [en general] / ARTERIAS /
CIRCULACIN
SANGUNEA,
TENSIN
ARTERIAL

HIPERTENSIN).
Estetipodedolenciaestvinculadoconlacirculacinsanguneaylosvasos
sanguneos.Puedemanifestarseenvariassituacionesquetodasestnvinculadas
con el amor. Este tipo de accidente es una reaccin muy fuerte, un no
categrico a una situacin que me niego a vivir. Vivo

una resistencia

o una
amargurainteriorrelacionadaconelamor,elprocesodelavida,loscambiosylos
acontecimientos(incapacidad,vejez,muerte).Laprimeramanifestacindeeste
tipodedolenciaeslaaltapresincausadaporelencogimientooelestrechamiento
demisarteriasqueexpresanelamor.Lapresinsubeporqueintentoconservarlas
cosascomoson.La arteria afectadasesitaalniveldel cerebro,sededelos
principios fundamentales de mi existencia. Esta arteria puede encoger, hacer
rupturas y lastimar gravemente el tejido cerebral y la actividad general del
cerebro.Unachaquegrave(ouncoagulosanguneo)puedecausarlamuerteola
parlisis.Medueletantointeriormentequedeseodejaresteuniverso!Misdolores
interioresylasemocionesdisimuladasyreprimidasmeimpidenexpresartodomi
potencialdeamor.Todosmismiedosseamplan(laprdidadeunserquerido,la
entradaenunaresidenciadejubilados,lasoledadylaausenciadesostnafectivo,
lejosdelagenteaquienamo,menosatencinydecuidados,etc.)ymividayano
valelapenaservivida.Yanoconsigoadaptarmealoscambiosfuturosporquees
demasiado duro para m. El amor es el principio fundamental de toda vida.
Compruebolossntomasposiblesdeuntalaccidenteyestoyalaescuchademivoz
interior.Sinecesitoamoryatencin,lopidoporqueesimportanteparam.Acepto
88

estasituacinaccidentaloelachaquecardacopotencialporquemeindicaque
debomantenermeabiertoalamordivinoyqueesteamordivinocuidardecolmar
mis necesidades. Bajo el efecto de un cuerpo extrao o de un coagulo en una
arteria, o a causa de una pared interna ms espesa de una arteria, sta puede
obstruirse,impidiendoquelasangrenutraunapartedelcerebro.Estosellamaun
accidentecerebrovascularisqumico o infartocerebral.Unmiedoaperder
miautonomaasociadoaungolpeemocionalpuedehacermevivirestasituacin.
La parte del cerebro afectada as como las funciones que se vinculan a ella
(palabra,locomocin,equilibrio,etc.)meindicanbajocualaspectosemanifiesta
estemiedoamivida.Puedotenerlasensacindecogerlosmediosenloquequiera
vivir.Enelcasodeaccidentescerebrovasculareshemorrgicos,esunaarteria
queestalla,locualproduceunaprdidadesangreenunapartedelcerebro.Puede
quevivaunatensintangrandeenmimediofamiliarodetrabajoquelatensin
acumuladaseliberaporesteestallidodealegradevivir(lasangre)quesimboliza
todalapenaquevivoenestasituacin.Segnsielaccidenteseviveenlaparte
derechadel cerebro (ladointuitivo)odelladoizquierdo(ladoracional),podr
identificarmselmensajequemedamicuerpo,hacerlapazconmigomismoy
restablecermemsrpidamente.Visualizomicerebroinmersoenunlquidohecho
deluzblancaydoradaparapermitiratodasmisclulasnerviosasregenerarseo
repartir el trabajo de un nuevo modo para que pueda recobrar la salud ms
rpidamente.
CEREBRO APOPLEJA (ver tambin: CEREBRO SNCOPE, SANGRE
HEMORRAGIA)
La apopleja seproduceseguidamentealadisminucindeoxgenoenel
cerebroytraeunaprdidadelconocimientodecortaduracin,completaybrutal.
Resultamuyfrecuentementedeunahemorragiacerebral.Lacrisisdeapoplejaes
lamanifestacindelanecesidadextremaderesistiralavidayaloscambios,del
rechazoydelanegacindevariosaspectosdemividaydemiser.Elvehculode
mialegradevivir,lasangre,yanoconsigueirrigarconvenientementeunaparte
delcerebro.Estapartedejadefuncionarysiguelaparlisis.Siresistoalavida,
estoydeacuerdoconabandonarymantenermecerrado.Prefieromorir:esmsfcil
yladestruccinesminicasalvacin.Eselfracaso!Estaparlisismeimpide
expresarplenamentemienergavitalymipotencialcreativo.Misactividadesestn
ahoralimitadas.Siquierohallarlaalegraquealimentamivida,rpidamentedebo
abrirmealaintuicinyalamoryexpresarmsloquesiento.Empiezosobretodoa
tenermsconfianzaenlavida.
CEREBRO (conmocin) o CONMOCIN CEREBRAL
Laconmocincerebraleslasacudidadelconjuntodelcerebroduranteun
traumatismodelcrneo,conduciendoauncomaprovisional.Laconmocinesuna
89

formadehuida,unmediobruscoydirectodepararmeyobservarfrancamentelo
que est sucediendo en mi vida. La conmocin cerebral viene a hacerme
comprenderqueinconscientemente,meagarrotantoamisviejasideasoactitudes
quechocanconlasnuevasquequierentomarlugar.Indirectamenteestoyllevadoa
pararme,ahacerunexamendemividayverencualesdireccionesquieroahora
dirigirme.Vuelvoamisprioridades.Tambin,quizstengalacabezademasiado
llenadeideas,medispersodemasiado,necesitovolversobrelatierra.Haybullicio
ysigueelimpacto.Laconmocinsucededespusdeunaheridaenlacabezaode
un accidente que golpea la cabeza, el cerebro y lo mental. Mi cuerpo est
temporalmente ido e inconsciente. A dnde he llegado en mi vida? Cul
orientacinvoyatomar?Vamimentalentodasdireccionesalmismotiempo,sin
verdaderaorientacin?Probablementenecesitovolveralatierra,alarealidad,para
resolverenlarealidadydeunmodomsapropiadolassituacionesquevivo
actualmente. Es posible evitar la conmocin aceptando mantenerme muy
abiertoaloquesucedeenmivida.
CEREBRO DESMAYO
Un desmayo sediagnsticaporlaprdidadeconscienciatotal,reversible,
perobreve.Laprdidadeconscienciaprocededeunacarenciadeoxigenacindel
cerebro.Puedeserlaconsecuenciadeunparocardacoperononecesariamente.
Estopuedeprocederdeunaformadeasfixiaoestarvinculadoavasossanguneos
quesedilatanbrutalmentedespusdeungolpeemocional,dejandopocasangreen
elcerebro,porlotantopocooxgeno.Eslamentequedejamicuerpoduranteun
corto instante. Es como si eligiera replegarme sobre m y cortarme del mundo
fsico; estoyenrebelin,sinsaber cmoenfrentarmeconciertasituacin.Este
estadonopuedecompararsealdeunyogui43yaquesteestenplenodominiode
unadisciplinaquequiereliberarsumentedetodaslascoaccionesdelcuerpoenla
armonizacindelmovimiento,ritmoyaliento.Tomoconscienciadeloquemeha
llevadoahuirasmicuerpofsico,culeslaangustia,elsentimientodepnico
interiorqueprodujotalsituacin.Squeentodascircunstancias,estoyguiadoy
protegidoyaceptomantenermeplenamenteconscientedelavidaqueesten
m.
CEREBRO ENCEFALITIS
Elencfaloestconstituidoporelcerebro,elcerebeloyeltroncocerebral.
Elencfaloespueslapartesuperiordemisistemanerviosoquecontrolatodomi
organismo.Elencfalorepresentapuesmiindividualidadensumsaltonivel.Si
bien, en general, la cabeza representa tambin mi individualidad, el encfalo
representamiindividualidadinterior.Cuandohayunainfeccininflamatoria(al
43

Yogui:sedicedeunapersonaquehaalcanzadociertoestadioensuevolucinespiritual.Porlapracticadela
meditacin,puededejarsucuerpoconscientementeporuntiempovariable.Ciertaspersonasinclusopuedenfrenaro
prcticamentepararloslatidosdesucoraznparaactivarlosluegootravez.

90

nivel)delencfalo,llamadaencefalitis,estocorrespondeaunsentimientodeira
paraconquiensoyyo.Digonoalavidaparaloscambiosquemebrinda.Temo
perdermiindividualidad,misadquiridosdentrodeloquesoy.Tengomiedode
perderelcontroldemmismoydeloquemepuedasuceder.Mesientolimitado
enlaexpresindemmismo.Deboabrirmeanuevasfacetasdemmismo,
tenerconfianzaenlavida.Sustituyolarigidezporlaflexibilidad,elenmarcado
estrictode ciertas partes de m mismo por la apertura paradescubrir nuevas
facetasde m.Me doyamor ylacomprensinquenecesito ydejoquelapaz
interiorseinstaleenm.
CEREBRO EPILEPSIA
La epilepsia estcausadaporunamalacomunicacinentrelasclulasdel
cerebro. El influjo nervioso acumulado que resulta crea una sobrecarga y la
formacindeondasdechoquequeatacanlasdemspartesdemi cerebro.Las
crisisde epilepsiapuedenserdediferentesintensidades.As,puedoformarparte
delaspersonasquesimplementeestnenlalunadurantealgunosinstanteso
formarpartedelosquepierdenconscienciacompletamenteysufrenconvulsiones
bastantefuertesdurantecincoadiezminutos.Paravivirtalsituacin,seguramente
me parece que la vida slo me aporta rechazo, violencia, ira y desesperacin.
Tengolasensacindesiempretenerqueluchar.Mesientoperseguido.Mesiento
culpabledelaagresividadquesubeenmylarechazo.Estoyharto,estomeexige
demasiadosesfuerzos.Rechazoestavidaqueseesfuerzaenhacermesufrir.Quiero
volverme insensible replegndome sobre m mismo. Frecuentemente es la
desesperacinolairalasquemeincitanaello.Almismotiempo,voyasentirme
apaleadoporlavida,dejandoquestatraigaciertaviolenciahacam.Esextremo
elrechazodemmismoyresultaunconflictodeindividualidad.Durantelacrisis
de epilepsia,micuerposeponergidoparaprotestarcontraestasheridasylas
convulsiones irrumpen, tales muy fuertes olas que me permiten dejar salir mi
clera, mi amargura y mi agresividad largo tiempo reprimidas. No tengo otra
alternativaqueladedejarmeiralossentimientosintensosquemehabitan.Huyo
enloinconscienteestassituacionesquemehacentantosufrir,bienporquetengo
miedo,queestoymolestooquepadezco.Elmentalnotiene,enesemomento,
ningncontrol.Laepilepsiaavisaasmientornodemigrannecesidaddeamory
atencin.Lacausaprofundadelaepilepsiaremontafrecuentementealprincipiode
la infancia y puede incluso remontar al tiempo del embarazo: siendo nio,
culpabilicmucho:estomesiguealolargodemividayveostacomouncombate
detodoslosdas.Tambinsepuedetratardeunabuso,sexualuotro,opercibido
comotal,odeunrechazoanteriorovividoenlatiernainfancia,talcomouna
separacin. El hecho de sentirme separado de alguien implica una prdida de
contactoenelplanofsicoconste.Lacrisisdeepilepsiapuedeprocederporlo
tanto de un modo de obtener o ganarse ms atencin como de reforzar mi
91

sentimientodesuperioridad.Alindicarla epilepsia unasobrecargadel circuito


nervioso,estodemuestraqueloquehedetratarenmividadecadadaesexcesivo;
se produce una situacin en la que debo elegir. Este sentimiento de estar
sobrecargado puede ser el resultado de sucesos que aumento (exagero) en mi
mente.Estaexageracinpuedellevaralaarroganciallevndomeapensarques
msquenadie.Tambinpuedeexistirunatendenciaaunaabstraccindemasiado
grandeoincluso,unaadhesindemasiadograndealosreinospsquicos.Asevito
tratarconlarealidadobjetiva.Laepilepsiatambinpuedeserlaconsecuenciade
unmiedoatrozquetengo(porlamuerte,laenfermedad,elmiedodeperdera
alguien,etc.);Unacoloracindemotricidad,comoparaimpedirmeadelantar,se
sumaamimiedo(porejemplo;sideboiraunentierro(muerte)yquenoquieroir).
Tomoconscienciadeloquesucedeenmyaceptoconcentrarmisesfuerzosya
noexclusivamentesobrelonegativoydarmecuentadecuantoamorysaludme
brindatambineluniverso.
CEREBRO EQUILIBRIO (prdida de) o ATURDIMIENTOS
Enelplanofsico,el equilibrio seconservagraciasalareparticindemi
pesosobremicuerpo,locualmepermitemovermesininclinarledeunladoode
otro.Lasordenesdelmovimiento,encuantoaellas,vienendemicerebro:biende
misistemavisual,demisistemapropioceptivo44,biendemisistemavestibularde
miorejainterna.Cuandomi cerebro sesiente ajetreado y desbordado porlas
situaciones o los acontecimientos. Est estirado en todas direcciones al mismo
tiempo y pierde su equilibrio. La prdida de equilibrio o aturdimiento se
asocianfrecuentementeconlahipoglicemia45:carezcodedulzuraenmivida.Esta
huidapuedeservinculadaaunasituacinoaunindividuoquemedalasensacin
de tener una evolucin demasiado rpida para m. Estos vrtigos se producen
cuandomirealidadsehaceagotadora,porqueentretuveideaserrneasquehan
aflorado como consecuencia de mis esperanzas las cuales no necesariamente
estuvieronsatisfechas.Entoncespierdomisentimientodeequilibrioydearmona.
Aunqueelaturdimientopuedaprocederdediferentescausasdeordenfsicocomo
la hipoglicemia (faltadeazcarenlasangre),la hipotensin (presinsangunea
baja),unadisminucindelritmocardaco,estemalestarsevinculaalahuida.En
efecto,cuandomesientoestirado,conscientementeono,buscoaturdirmepara
olvidarloquevivo.Tomoconscienciadequevoyenexcesivasdireccionesalavez
y me concedo el tiempo necesario para recuperar mi equilibrio. Acepto
concedermetiempoydulzura.Tomoeltiempodesaborearloqueesbelloybueno
enmivida.

Sistemaproprioceptivo:hechodereceptoresmicroscpicosinformndomesobremisarticulaciones,deltono
muscularydelaposicindemisarticulaciones.
45
Hipoglicemia:faltadeazcar(glucosa)enlasangre(ver:SANGREHIPOGLICEMIA)
44

92

CEREBRO ESTADO VEGETATIVO CRNICO (ver tambin: CRNICA


[enfermedad])
Cuandoestoyenesteestado,notengoactividadconscientedetectable.Vivo
enunestadocomnmentellamadovegetativo.Micerebroestafectadodespus
de un paro circulatorio prolongado o a causa de un traumatismo craneal. Mi
cerebro corresponde a mi individualismo, vivo grandes miedos o culpabilidad,
hastaquererinconscientementehuirlavida.Elhechodequeanestvivopermite
a mis parientes cercanos amansar progresivamente mi salida de este mundo y
expresarmesuamormientrasqueyo,puedoempezaraprepararmeenlacalmapara
dejarestemundoporrealidadesyplanosdeconscienciasuperiores.
CEREBRO HEMIPLEJA (ver tambin : CEREBRO / [absceso del] /
ACCIDENTE CEREBRO VASCULAR [A.C.V.])
Lahemiplejaesunaparlisisdeunamitaddelcuerpo(izquierdaoderecha)
causadaporunalesindel cerebro.Puededarsedespusdeungrangolpe,tanto
fsicocomoemocional,comoporejemploelfallecimientodeunserquerido,lo
cualconllevarafrecuentementeunestadomuyprofundodedesesperacinyuna
sensibilidad altamente afectada. Una explosin de rabia puede tambin ser su
causa. Mi cuerpo me dice que una parte de m ya no puede actuar. Es un
sentimientodeimpotenciafrenteaunasituacinpreocupante?Elladoafectado
indicasielladoafectivo(ladoizquierdo)omiladoracional(ladoderecho)est
implicado.Medoytiempoparacurarmisheridas,sabiendoquetodaexperiencia,
pordifcilquesea,mepermitehacermemsfuerte.
CEREBRO MENINGITIS (ver tambin: INFLAMACIN, SISTEMA
INMUNITARIO, CABEZA).
La meningitis es una infeccin del lquido cerebral resultando de la
inflamacindelamembranaquerecubreelcerebroylamdulaespinal.Indicauna
debilidad del sistema inmunitario y una incapacidad en auto protegerse. La
meningitismesealaunadebilidadyunaincapacidadenlucharcontrapresiones
exteriores muy fuertes, sobre todo en el plano intelectual. Es frecuentemente
porque tengo dificultad en protegerme. Siendo hipersensible, vivo todo ms
intensamenteyestoyafectadomsprofundamenteinclusoporcosasqueparecen
comunesalosdems.Estaenfermedadmedaelmensajedepreservarmedelos
golpesquevienendelexteriorydenosentirmeculpabledelasactuacionesdelos
dems,responsabilizndome.Osea,eslarebelinqueruge,estoycontrariadoyel
miedoseapoderadem.El cerebro rigetodoelcuerpoyla meningitis implica
puesunaprofundadebilidadinteriorquemeatacaenlomshondodemiser.La
meningitis poneenpeligrolacentraldemandodemicuerpo,el cerebro,debo
imperativamentedecidirviviryasumirme,conservarlacabezaaltayhacerbrotar
93

enmestafuerzainteriorquemepermitirseguirunavidaenriquecedorayllenade
experienciasmaravillosas.
CEREBRO PARLISIS CEREBRAL
Laparlisiscerebralseproducefrecuentementeyaenelmomentodenacer
ysemanifiestaporunaanomalaalniveldelcerebro.Elmsculocerebralest
paralizado parcialmente o totalmente, segn la naturaleza del traumatismo. Me
preguntofrecuentementeporquyo,comonio,yaenelnacimiento,padezcoyade
esta parlisis. Puedosuponer una trama krmicaanterior46, unpattern ouna
experienciaantesdelnacimientotanviolento,untraumatismomentaltanintenso
que conlleva un cierre total, un paro de cualquier movimiento haca delante,
impidiendoelprogreso.Esanunestadoirreversible(digoanporquenosepuede
predecirlamedicinadelfuturo)ynopuedoliberarmedeestoapesardelamor
incondicionalydelaatencindelagentequemerodea.Lacuracinserms
sobreelplanoespiritualsisemanifiesta.
CEREBRO PARKINSON47 (enfermedad de) (ver tambin: NERVIOS
TEMBLORES)
LaenfermedaddeParkinsonesladeterioracindeloscentrosnerviososdel
cerebro, especialmente en las regiones controlando los movimientos. Aparecen
tembloresquesuelenafectarlasmanosylacabeza.Cuandotiemblo,esporque
sientooveounpeligroquemeamenazaoamenazaaunapersonaaquienquiero;
bien el temor a perder el control (el cual voy perdiendo cada vez ms!), la
inseguridadolaimpotenciadeprogresarenlavida.Tambinpuedohabervivido
untraumatismo:unabusoodificultadesquedejaronhuellasyfrentealascuales
vivolossentimientossiguientes:pena,frustracin,culpabilidad,rabia,depresin
quemellevanalagotamiento,aldesanimoyquequierohuirenvezdeenfrentarme
aellosyresolverlos.Meautodestruyolentamente,produciendoladeterioracinde
la funcin nerviosa actual. Una impotencia al nivel de la motricidad de mis
miembrossuperiores(enparticularmisbrazosymismanos)tienesuorigenmuy
frecuentementeenunasituacinquevivoenlacualquerarechazaraunapersona,
unacosaounacontecimientoo,alcontrario,laqueraretenerymesentincapazde
ello(bienfsicamenteomoralmente).Siestnafectadoslosmiembrosinferiores
(mispiernasymispies),esconellosquemehubiesegustadorechazarovolvera
traeramlapersona,cosaoacontecimientodereferencia.Tengoelplacerdehuir
esta situacin en la cual me siento desbordado y que percibo sin salida. Debo
reasumirme y aprender a controlar MI vida y no la de los dems, haciendo
confianzaenlaVidaydecirmequemerezcovivir.
46

Unatramakrmicaanterior:Paraquiencreeenlareencarnacin,estoquieredecirqueestopuedeprocederde
unacausavinculadaaunavidaanterior.
47
Parkinson(James)EstemdicoIngls(17551824)describilaenfermedaddelparlisisdeltemblorquelleva
hoysunombre.

94

CEREBRO TICS
Los tics, definidos como siendo la ejecucin repentina de movimientos
repetitivoseinvoluntarios,demuestranundesordendelatensinnerviosayun
desequilibrio al nivel del cerebro. Si tengo un tic o tics, hay muchas
probabilidadesdequeseaunsermuyemotivo,quereprimomuchaagresividady
que, de joven, haya percibido la educacin recibida como muy severa y
perfeccionista.Asescomoexteriorizomiinquietudylaamarguraquesientomuy
adentro mo. Si soy un chico, puede que haya sido afectado por acciones que
alguienquerepresentabalaautoridadparammepidihacer.Estoexplicarael
porquhay4vecesmschicosquechicasquepadecen tics.Lasmuchachas,en
general, suelen ser ms receptivas frente a la autoridad y por lo tanto, menos
afectadas, de un modo general por este aspecto. Puedo haberme sentido
contrariadodecaraaciertosmovimientosquemeimpidieronhacersiendoms
joven(comoporejemplo,sisemeprohibamovermeenlaiglesia)yahorami
cuerposemueve,muyapesarmo,comoporreaccin,rebelincontraloquese
me prohibi hacer. Incluso puedo haber tenido la sensacin de ser cobarde
delantedealguien.Tengointersentomarconscienciadeesteestadoyaexpresar
claramentemisnecesidades.
CITICO (el nervio ) (ver: NERVIO CITICO [el])
CIFOSIS (ver: COLUMNA VERTEBRAL [desviacin de la ], ESPALDA
[dolores de ])
CIGARRILLO (ver tambin: BUERGER [enfermedad de], CNCER DE
LA LENGUA, DEPENDENCIA, PULMONES)
El cigarrillo est vinculado a los pulmones, smbolo de vida, libertad y
autonoma,comunicacinentreyoyeluniverso.Estconsideradocomounaforma
deproteccin,unveloquemepermiteocultarciertasangustiasprofundas.Creo
protegermeporestapantalladehumoquemerodeayquemeimpideverlaverdad.
Inconscientemente, el cigarrillo colma tambin necesidades pendientes de la
infancia,primerastomasdepecho,calor,amor,afectodelamadre.Enciendoun
cigarrillosinpensarenello,esunacostumbre,ungestoautomtico,unamanaque
sehahechomuyimportanteparam.Necesitoequilibrarenmsoenmenosmi
nerviosidad,miexcitabilidadnerviosa.Quieroencontrarlapazdemimadre,la
seguridaddesta.Sifumo,esporquehuyounasituacindemasiadodesagradable,
mifamilia,mivida.Estehumohacequemisdecisionesestnanmsnebulosas.
Elcigarrilloaumentaelritmocardacoyactaattulodeestimulante.Culesson
lasdecisionesquenoconsigotomaryquemehacenlavidasosa?Identificomis
necesidades autnticas.Acepto comunicarmsydeunmodomsfcil.Si
quierodejardefumar,serabuenoquehallaralacausaemocionalalacualest
95

vinculada esta costumbre, lo cual facilitar mucho el cese. Entonces ver ms


claramenteloquerealmentequieroenlavidaymisnecesidadesestarncolmadas
enarmonaconmiserautntico.
CINEPATA (ver: MAL DE LOS TRANSPORTES)
CINETOSIS (ver: MAL DE LOS TRANSPORTES)
CIRCULACIN SANGUNEA (ver: SANGRE CIRCULACIN
SANGUNEA)
CIRROSIS (del hgado) (ver: HIGADO CIRROSIS [del hgado])
CISTITIS [ver: VEJIGA CISTITIS)
CLAUDICACIN (andar irregular) (ver tambin: SISTEMA LOCOMOTOR)
Laclaudicacinsecaracterizaporunairregularidadenelandar.Lacausa
puedesermuscular,neurolgica,vinculadaalaparlisisoalarigidezdeunpie,de
unarodillaodeunacadera.Esverdadqueenmivida,todonofuncionataly
comoquisiera.Quieroadelantarperomiedosmeimpidenadelantardemodo
armonioso.Identificandoestosmiedos,podrponermsarmonaenmivida,lo
cualmeayudararecobrarmsregularidadenmiandar.
CLAUSTROFOBIA (ver tambin: ANGUSTIA)
Claustrofobia viene de la palabra latina claustro que significa
encerrado. Es pues el miedo irracional de estar ahogado o cogido en una
situacinoenunlugarcerrado(ascensor,avin,cuevaytnel)endondenotengo
ningncontrolsobreloqueacontece.Porestemotivo,sufrodeclaustrofobia,la
angustiadevivirenlugarescerrados,solo oconotraspersonas.Estopuede
procederdelmomentodeminacimiento,cuandodebapasarporeltneldel
cuellouterino.Pudecaptarelmiedodemimadreenesemomento.As,elmiedo
puedeprocederdelmomentoenquemehallabaeneselugarcerradoyseguroque
eraelterodemimadreyquelascontraccionesmeobligaronadejar,locualhizo
nacer en m un gran miedo a lo desconocido, a lo que puede suceder. As,
encontrarmeenunlugarcerradopuederecordarmeestegranmiedoquegraben
m.Tengolasensacindeestarpresoycerradoenunasituacinenlacualestoy
totalmente in poder. Qu debo hacer? Comprobar primero si este miedo no
vendradeuncualquierpensamiento,unafijacinmentalcuyoorigensevuelvea
losprimerosperodosdemivida.Lamayoradeltiempo,estafobiaprocededeun
temor sexual que se habra dado ya en la infancia. Esto no necesariamente
significaquetuvieronlugarcontactosoabusossexualessinomsbienqueeltemor
96

fuegrabadoenlamemoriaemocionalyquemesentcogidooquetuvemiedode
sentirmecogidoenestasituacindecarctersexual.Aceptopasaralaacciny
liberarme de sta por el medio que mejor me convenga. Frecuentemente, una
psicoterapiapodrseroportunaparacambiarlamemoriaemocionalyllevarmea
vivirconmslibertadinterior.
CLAVCULA (dolor en la , fractura de la ) (ver tambin: HOMBROS,
HUESOS FRACTURA)
La clavcula esunhuesolargoenformadeSalargadoqueencuentroal
niveldelhombroyvinculadoalesternn,arribayenelcentrodelacajatorcica.
Al estar directamente unida al hombro la clavcula, un dolor en la clavcula
significamiiracontralasresponsabilidadesquemedanyfrentealascualespuedo
vivirunsentimientodesumisinyobligacin.Frecuentemente,unafracturaenla
clavculasucededespusdeunacadaenelhombroeindicaquevivounafuerte
presin por mis responsabilidades. La emocin engendrada puede llevarme a
pensar quevoy a romperme bajoel peso de mis responsabilidades. Mirolas
situacionesconobjetividadyempiezoacomprenderquelavidanopuededarme
msresponsabilidadesdelasquepuedotomar.Hagoconfianzaymeesfuerzoen
hallarlassolucionesuotropuntodevistaquemeayudaramejortomarlavida.
CLAVOS (ver: PIEL FURNCULOS)
CLEPTOMANA (ver tambin: DEPENDENCIA, NEUROSIS)
Si, de modo compulsivo, estoy llevado a cometer robos sin razones
utilitarias,entoncespadezco cleptomana.Vivounatensinqueprocededeun
vacointerioraliadoaunsentimientodeculpabilidad.Entonces,param,elfin
justificalosmediosyescomosimepresentaseelretodepoderapropiarmedelo
prohibido.Estomealivia,auncuandoelremordimientopuedamanifestarseam
luego.Puedequeinconscientemente,esperequesemevayaapillarlamanoenel
bolsoporqueesparamunmododeatraerlaatencin.Elhechodehacerungesto
prohibidopuedeserparamunmododedemostrarmirevueltafrentealaautoridad
ydeescupirsta.Laautoridadquenoacept dejoveneraobienlademi
padre,olademimadreodelapersonaqueseencargabademieducacin.Puedo
recorreralapsicoterapiaparapoderidentificarestevacointerioroestarebelin
frentealaautoridadypodervolveraponeramorenlasituacin.Vivirasunapaz
interiormsgrandeylosdemstambinsesentirnmejor.

97

COCAINA (consumo de ) (ver: DROGA)


CODOS (en general)
Loscodosrepresentanlalibertaddemovimiento,laflexibilidad,lafacilidad
paracambiardedireccinenlasnuevassituacionesolasexperienciasdevida.Es
la articulacin adaptable y flexible del brazo que permite la creatividad y la
expresingraciosademisgestoscotidianos.Undolororigidezenelcodosignifica
unacarenciadeflexibilidad,elmiedoasentirmecogidooarrinconadoenuna
situacindesagradable.Loscodossiendovinculadosalaaccin,puedoserrgidoy
juzgaralagentequetienenunmododehacerdiferentedelmoyquepueden
volveraplantearmispropiascostumbres.Resistoaunanuevadireccinportomar,
bloqueando inconscientemente la energa del corazn que va hasta esta
articulacin.Doscodosenbuenasaludpermitenapretaralguienentrelosbrazos.
Puedoponer ms energa a hacer todo loque quiero.Entonces encuentrofcil
aceptarlavidaysusnumerososcambios.Meabandonomsfcilmenteytomo
cuidadodemcomolomerezco.Auncuandotengoavecesmiedodesoltarmeo
sientoquealguienmedaconelcodo,deboapretarloscodosparaprotegerme.
Quedoabiertoalamor,locualmeayudaavivirmsfcilmentelasexperiencias
cotidianassinagresividad,conflexibilidadyaperturamental.
CODOS EPICONDILITIS
Msconocidabajoel nombrede tenniselbow enmedicinadeportiva,la
epicondilitisesunainflamacinalniveldelaarticulacindelcodo.Miscodosme
dan la flexibilidad necesaria en los cambios de direccin. En el caso de una
inflamacin,debotomarconscienciadelporquoaquopongoresistencia.Puede
queestdesarrollandofrustracindespusdeacontecimientosrepetitivosquese
presentanenmividaytengalasensacinquedeboconstantementeamortiguarlos
golpes.Aceptoluegosoltarmisviejasideasymisviejospatternsparatomarla
mejordireccinparamievolucin.Acepto tambindejarcircularelamoren
lossucesosquesemepresentan.

98

CLERA (ver: INTESTINOS DIARREA)


COLESTEROL (ver: SANGRE COLESTEROL)
CLICO (ver: INTESTINOS COLICOS)
COLITIS (mucosidad del coln) (ver: INTESTINOS COLITIS)
COLON (cncer del ) (ver: CNCER DEL COLN)
COLUMNA VERTEBRAL (en general) (ver tambin: ESPALDA)
Segn la clasificacin hecha en Occidente, se cuentan 33 vrtebras
empezandoporarriba,osea:
7cervicales48,msbiendelgadas,
12dorsales49,msbiengruesas,
5lumbares50,msfuertes,
5sagradas51,soldadas,formandountringulohacaabajo,
4coxgeas,soldadasyatrofiadas.
Lacolumnavertebral,talelpilardeunaconstruccin,representaelapoyo,
laproteccinylaresistencia.Porlotanto,lacolumnavertebralmesostieneyme
protegeentodaslassituacionesdemivida.Esmipilarfsicoeinterior.Sin
ella, me derrumbo. La columna vertebral simboliza tambin mi energa ms
fundamentalymsespiritual.Representamiflexibilidadymiresistenciafrentea
los diferentes sucesos de mi vida. Las desviaciones de la columna vertebral
(escoliosis,lordosis,etc.)estnvinculadasalaparteprofundadetodomisistema
energtico. Durante un bloqueo, dolores fsicos aparecen. Sentimientos de
impotencia, un peso demasiado pesado que llevar, una necesidad afectiva o
emocionalinsatisfecha,etc.,hacenquemesientaatacadoenmisolidezyenmi
resistencia.Tengolasensacinquesoyelpilarenelsenodemifamilia,demi
trabajo y con relacin a cualquier situacin u organizacin en la cual estoy
implicada.Qusucederaalosdemssinoestuvieraaqu?Sederrumbaratodo?
Lacolumnavertebralestvinculadaatodoslosdiferentesaspectosdemiserpor
elesqueleto,atravsdelsistemanerviosocentralyporladistribucinsangunea
central. Cada pensamiento, sentimiento, situacin, respuesta y sensacin est
grabado en la columna vertebral como en las partes pertinentes implicadas
48

Cervical:vienedellatncerebroquesignificanuca.
Dorsal:vienedellatndorsumquequieredecirespalda
50
Lumbar:vienedellatnlumbusquequieredecirrin.
51
Sagrado:estapalabrahacereferenciaaloqueesinviolableoaloquenosimponeungranrespeto.Enestecaso,se
trataradellugardedondesaldralaenergadelaKundalini,estaenergaespiritualquesaledelaparteinferiordela
columnavertebralysubehastalacumbredelacabeza,parallevaralailuminacin.
49

99

correspondientes del cuerpo. Miro la regin afectada e identifico la causa del


bloqueo.Pocoimportalarazn,acepto mantenermeabiertoalacausay la
integracinesmsarmoniosa.Vuelvoaedificarlanuevapersonaquequieroser.
COLUMNA VERTEBRAL (desviacin de la ) (en general).
Una desviacin de la columna vertebral simboliza principalmente una
resistenciaavivirplenamentemivida.Elmodoenquemeportoenlavida,mi
dificultadendejarlavidasostenermeydejarirlasviejasideassemanifestarnpor
unadesviacindelacolumnavertebralqueseinclinardelado,hacadelante,o
haca atrs Decido asumirme y mantenerme derecho frente a la vida, con
confianzaydeterminacin.
COLUMNA VERTEBRAL (desviacin de la ): JOROBADO (ver:
HOMBROS ENCORVADOS)
COLUMNA VERTEBRAL (desviacin de la ) LORDOSIS
La lordosis es una curvatura fisiolgica de la columna vertebral que se
ahuecahacadelante.Tengodificultadensujetarmedepieporquetengovergenza
deloquesoy,nomequiero.Frecuentementevivolasumisinfrenteamipadreo
aloquerepresentalaautoridadparam,porquemeinfravalorofrenteal,me
sientoinferioral.Mesientoaplastadoporlosdems,tengomuypocaconfianza
en m y soy incapaz de expresar mis ideas y mis opiniones. Estoy hirviendo
interiormenteyestairamecorroe.Deboaprenderaamarme.Aceptotomar
milugar porquecadacualtieneunpapelporjugareneluniverso.Aprendoa
expresar mis ideas y mis opiniones libremente y me siento mejor conmigo
mismo.
COLUMNA VERTEBRAL (desviacin de la ): ESCOLIOSIS.
Laescoliosisesunadesviacinlateraldelacolumnavertebral.Cuandosta
meafecta,tengolasensacindellevarenmishombrosunacargamuypesada.
Comoqueestosobrepasacualquieresperanzaderealizacin,vivoimpotenciay
desesperacin. Mis responsabilidades me dan miedo, estoy indeciso en mi
orientacin.Laenergasebloqueaylaescoliosisessumanifestacinfsica.Estose
presentafrecuentementeenlaadolescencia:comoqueestoyalabsquedadeuna
identidad,demasiadoviejoparaserunnioydemasiadojovenparaserunadulto,
lavidaylasresponsabilidadesparecenenormes.Tendrtendenciaacompararmea
mis hermanos, hermanas, primos y primas. Ya que tengo frecuentemente la
impresinquesonmejoresqueyo,medesvalorizaryestoseexpresarporuna
escoliosis.La escoliosis estpuesvinculadaaundeseodehuirunasituacino
alguien. Compruebo lo que sucede en mi vida que me impide sentirme bien.
100

Aceptovivirenpresente,esdecirundaalavez.Tomoconscienciadeestar
enlaescueladelavidaydevivirenarmonaconloquemerodea.Encuentrola
alegray,cadada,comprendoquetengolafuerzaylacapacidadderesponderal
reto!
COLUMNA VERTEBRAL DISCO DESPLAZADO. (ver tambin:
ESPALDA [dolores de], LUXACIN)
Vinculado a la columna vertebral (el soporte de mi cuerpo), el disco
desplazadorevelaquenomesientoapoyado.Nomesientoalaaltura,carezcode
confianza enm mismo.Tomoconsciencia dequecada vezquebusqu una
respuestaounapoyo,encontrlaconfirmacindeloquesabaosentaya.Acepto
escucharmivozinterior quesiempreestaquparaapoyarmeyguiarme.
Aprendoahacermeconfianza ydescubrotodalafuerzaqueestenm yla
felicidadqueestomeaportadetenermeenpie,libre,sintemores.Estoysoportado
entodoloqueemprendo.
COMA (ver tambin: ACCIDENTE, CEREBRO SNCOPE, DESMAYO)
Elcomaenlamayoradecasosseproducedespusdeunaccidente.Sucede
muyamenudoque,justoantesdeencontrarmeenelcoma,hayavistolamuerte
llegar,comosimehubiesellegadomiltimahora.Envezdeestarconscienteal
100% de este momento, el coma se produce justo antes. La consciencia se
desconecta. Frecuentemente, cuando me despierto despus de un coma, mi
memoriaborrlosmomentosdetraumatismosintensosquesevivieron.Loque
produce un accidente es una culpabilidad vinculada a la huida de cara a una
personaounasituacin.Sitengodificultaden"dealar"conestaculpabilidad,me
refugio en un coma. El coma viene del griego kma" que significa "sueo
profundo".Esteestadoestvinculadoaldeseointensodehuirdeunapersonaouna
situacin.Medueletantointeriormentequemerepliegosobrem,porquevivo
mucha desesperacin, soledad o frustracin. Quiero hacerme insensible a las
dificultadesdelavida.Meprotejoporestesueoprofundo.Mehaceinsensiblealo
quesucedealrededormo.Prefieroviviresteestadodeinconscienciatotal,hasta
que mi vida pueda ser ms agradable. Tengo una decisin por tomar: vivir o
marcharme.Eslamismadecisinportomarqueenun comadiabtico queest
causado por un exceso de glucosa (azcar sanguneo) en la sangre y ms
particularmenteenelcerebro.Mitristezaestangrandequetengoganasdehuirde
estemundoenelcualvivo.Aunqueelcomapuedadurarlargosperodos(semanas
yaos),esmuyimportanteparamisfamiliaresquemedemuestrenamor,afectoy
quemediganqueladecisindemarcharmeoquedarmemepertenece.Cuando
estoyenelcoma,micerebropuedeestaractivoatalpuntoquepuedooralagente
quehablaosentirsupresenciaylassensacionesqueemanandeellaaunqueyo,
actualmente,nopuedomovermeniexpresarme.Sucedequeelmiedodelamuerte
101

meretengaaquenlainconsciencia.Espuesnecesarioquemedenconfianzayme
diganquepuedomarcharentotalseguridadsitalesmideseo.Sipuedoverlas
energasdeunapersonaenelcoma,puedoobservarquehayuncorteimportantede
loslazosenergticos,segnlaprofundidaddelcoma.Serapuesadecuadoquese
mehagatratamientosenergticospararegularizarlasituacin.
COMERSE LAS UAS (ver: UAS [comerse las )]
COMEZONES (ver: PIEL COMEZONES)
COMEZONES VAGINALES (ver tambin: VAGINA [en general])
Las comezones vaginales estn vinculadas a la sexualidad y al principio
femenino.Sitengopicor,algomepreocupaenloqueamisrelacionessexualesse
refiere,miparejamehaceperderlapaciencia.Igualcomoloharaparaelcasode
irritacionesordinarias,mepreguntoloquemeirrita,mepicaymemolesta.Cuando
aparecenlospicores,encuentrolacausayaprendoacomunicar,adialogarconel
coraznabiertoparaexpresarloquesiento.
COMPULSIN NERVIOSA
Lacompulsin es untrastornodelcomportamientocaracterizadopor una
ganairresistibledecumplirciertosactos,alacualelsujetonopuederesistirsin
angustia.Estacompulsinpuedehallarseenlasexualidad,elalimento,labebida,
lascompras,elexcesodelimpieza,etc.Lacompulsinnerviosaserefiereaun
aspectodemipersonalidadqueconsideronegativo,quemedisgustaalpuntoque
rechazoverlo.Loinhiboenlomshondodem.Tantoymientrasmerehuseen
verloyaceptarlo,lavidamellevaavivircuantasmssituacionesenquedebo
afrontaresteaspectodemipersonalidad.Cuandovivocompulsinnerviosa,miro
loquememolest,aceptoenfrentarmeconelloenvezdehuir.Aceptoser
unhumanoconfuerzas,debilidades,cualidadesydefectos.Tomoconscienciaque
soymijuezmssevero,meperdonoyaprendoaamarme.Elhechodeaceptar
talcomosoymepermitirdesarrollarmearmoniosamenteyyanotendrms
quedesahogarmeatravsdelacompulsin.
CONGESTIN (DEL CEREBRO / DEL HGADO / DE LA NARIZ /
DE LOS PULMONES)
Lacongestineselsistemadedefensadelcuerpoinstaladopararespondera
agresiones repetidas contra cierta parte de mi cuerpo. Diferentes partes pueden
estarcongestionadas.Elhgado:representalacrticainhibida,lairritacininterior
que acumulo porque no consigo expresarla verbalmente. Puedo vivir disgusto,
amarguraodecepcin.Lanariz(senos):culeslasituacinolapersonaqueno
102

puedosentiryquemeprovocaira? Lospulmones:mesientoahogadopormis
relacionesfamiliares,bienseanmispadres,micnyuge,mishijos,etc.Sonmis
intercambiosfamiliarestanarmoniososcomolodeseo?Mepreocupodemasiado?
Elcerebro:mesientosuperado,yanoscmoactuarfrenteaciertaspersonaso
situaciones.Micerebroyanofuncionacontantaclaridadyrapidezcomoantes.Se
aconsejaapartarsedelabebidaodelasdrogas.Pocoimportaellugardelcuerpo
afectado,resultaunafrustracin,irritacinyrabiafrentealosdemsyam
mismo.Tomoeltiempodecomprobarloquememolestaactualmenteenmividay
asumo la responsabilidad. Acepto tomar el lugar que me corresponde, mi
lugar.Realizolaimportanciadeexpresarloquesientoylohagosinatacaralos
dems. Ya que expreso mis sentimientos, no acumulo ni frustracin, ni odio.
Cuandoestoyabiertoyreceptivo,losdemsloson.Mesientootravezenarmona
conmigomismoyconlosquemerodean.
CONJUNTIVITIS (ver: OJOS CONJUNTIVITIS)
CONMOCIN (DE LA RETINA] (VER: OJOS CONMOCIN DE LA
RETINA)
CONTUSIONES (ver: PIEL MORADOS)
CORAZN (en general) (ver tambin: SANGRE)
Elcoraznestvinculadoalcuartochakraocentrodeenerga.Representael
amor(misemociones,micapacidaddeamar),laalegra,lavitalidadylaseguridad.
Laenergadel corazn irradiaentodoelcuerpo,sobretodoentreelcuelloyel
plexosolar.Elcoraznesuntipodebombaenergticaquehacecircularlavida(la
sangre)atravsdelcuerpoentero.Estacirculacinsanguneadistribuyelaenerga
vitalnecesariaalafelicidad,alequilibrio,alaalegradeviviryalapazinterior.Es
puesesencialquemanifiesteelamordirigiendolaenergadelcoraznhacalas
msbellasenergasespiritualesdisponibles.Cuantamsatencinprestoalamor,la
compasinyelperdn,msmicorazntrabajarenlaalegra,lapazylaalegra.
Mi corazn ser afectivamente estable y protegido de cualquier decepcin. Un
coraznderitmosuaveyarmoniosoindicaunapersonainteriormentecalmada.Mi
ritmocardacovaracuandoestoydesequilibrado,perturbadoenamorosensiblea
misemociones.Aceptoabrirmealamor,entregocualquierreprochealcuidado
deluniverso,dejodecriticarmealpuntodeponermeenfermoysobretodoacepto
perdonarme.Esperdonndomecomopuedoaceptarmejorelamordelos
dems.

103

CORAZN ARITMIA CARDACA


El corazn representaelamory problemasdepalpitaciones sonparam
comounasealdealarma,unallamadadesocorroenloquealamorserefiere.Un
miedo profundo a perder o no tener el amor que necesito tanto hace que mis
problemasdepalpitacionesseancomoungritodesocorroconrelacinalamor.
Enelcasodequelosventrculosdelcoraznsecontraigandemodoanrquicoe
ineficaz,setrataentoncesdefibrillacinventricular.Esteestadopuedeproceder
deuntrastornocardaco,deunaelectrocucin,deunmomentodepnicoenelcaso
delfeto(alnacer).Siesteestadonoestsolucionadorpidamente,eslamuerte
repentina.Estodenotaunadecisinimportantequedebotomarenmividacon
relacinalamoryqueesvital.Empiezoadarmetodoelamorquenecesitopara
sustituirmisinquietudespormsseguridadinterioryhagoconfianzaalavida.La
taquicardia secaracterizaporlacontraccinrtmicairregulardel corazn.Sus
latidosseaceleranamsde90pulsacionesporminuto,yesteestadoesdebido
frecuentementeaemocionesfuertes.Unasituacinangustiosa,unesfuerzofsicoo
mental y el miedo provocan un desequilibrio afectando momentneamente mi
coraznquemelanzaunS.O.S..Encuantoalabradicardia,esundisminucin
del ritmo de los latidos cardacos. La acumulacin de penas profundas podr
traermeestadolencia,comosimi corazn yanopudierasufrirmsydecidiera
dejardelatir.Enunauotradeestassituaciones,tomoconscienciaqueelamorest
enjuego.Respirocalmamenteyprofundamente,estoyalaescuchademicorazn.
CORAZN INFARTO (del miocardio) (ver tambin: INFARTO [en
general])
Cuandooigohablardealguienquetuvouninfarto,enellenguajepopular,
esto significa habitualmente que la persona tuvo un infarto del miocardio.
Tambin esto se llama crisis cardaca o achaque cardaco. El rgano ms
frecuentementeafectadoporun infarto esel corazn,elcentrodelamorenel
interiordem,elncleodemisemociones.Elachaquecardacoesparaelcuerpo
un modo desesperado de ensearme que voy demasiado lejos, que presto
demasiadaatencinalosaspectosmateriales,externosyanodinosdemivida,mi
estatutosocial,envezdevolveraloesencialdemividaqueeslaalegradevivir
delcoraznenfamilia,deexpresarelamor,deamarseasmismo,desaborear
cadamomentoconintensidad.Estoytanatadoatodoloqueformapartedemi
territorio (mi mujer, mi trabajo, mis amigos, mi casa, etc.) que si tengo la
sensacindehaberperdidooqueestoyapuntodeperderalgooaalguienenel
interiordemiterritorio,puedoresistiraloquesucedeyharunacrisiscardaca.
Quisiera con todo mi corazn seguir siendo el jefe, el dueo a bordo. Los
achaquescardacostambinestnvinculadosamispropiossentimientosyaloque
vivo con relacin a stos. Hasta donde soy yo capaz de sentir el amor y de
expresarloalosdems?Hastaqupuntosoyyocapazdeamarmeyaceptarme
104

talcomosoy?Meobligoyoaseralgunaotrapersonayhacerdemasiadopara
probar a los dems lo que soy y lo que valgo? Es mi ira, mi frustracin, mi
agresividadque,demasiadotiempocontenidas,yanopuedenmsyexplotan?El
descubrimientodelosaspectosmsimportantesysignificativosdelavidanose
reducealacantidaddedineroganadooalxitoquetengo.Elcoraznpuedeestar
asociadoalacompasinyalamorperotambinpuedeasociarseasuopuestoque
eslahostilidad,elodioyelrechazo.Elachaquecardacoseproducegeneralmente
enunperododelavidaenque,bienesdemasiadofuertelacompeticin,bienvivo
unapresinfinancieraaliadaalafaltadecariocrecientedelafamiliaydemis
seresqueridoscercanos.Eslaseparacinentremissentimientos,miimplicacin,
mis relaciones y el Universo as como sus ritmos naturales que atrofian mi
corazn.Piensorechazaralosdemsperoenelfondo,merechazoammismo.
Necesitoirconlacorrienteytomareltiempodeaceptartodoloquelavida
debedarmeycomprender,paravolverahallarlapazinteriorysentirentodomi
cuerpolaternura,ladulzura,elamorquemehabitanyqueslopidennutrirmi
coraznyconservarloenbuenasalud.
CORAZN PERICARDITIS
La pericarditis es una infeccin del pericardio,membrana querodea el
corazn. Sirviendo a proteger el corazn, habr pericarditis si siento que mi
corazn va a estar atacado, tanto en sentido literal como figurado. En vez de
manifestar ira, conservo la calma y pido a estar protegido en todo momento,
sabiendoquetodoloquesucedeesparalomejor.
CORAZN PROBLEMAS CARDACOS
Elcoraznsimbolizaelamor,lapazylaalegradevivir;porlotanto,los
problemascardacos procedenfrecuentementedeunacarenciadeamor,deuna
tristeza,emocionesinhibidasquevolvernensuperficieinclusodespusdevarios
aos.Micoraznestendurecidoporlasheridasanteriores.Creosinceramenteque
lavidaesdifcil,estresanteyqueesunaluchadetodoslosinstantes.Mesiento
frecuentementeenposicindesupervivencia,enunestadoenquepiensoqueslo
miesfuerzoaportaralgunosdividendos.Estoyinquieto,sobreexcitado,angustiado
odemasiadofrgilparaconservarmiequilibrioemocional.Ahogoinconscientemi
niointerioryleimpidoexpresartodaestamaravillosaalegradevivir.Elcorazn
estasociadoalaglnduladeltimo;staqueesresponsabledelaproduccindelas
clulas T del sistema inmunitario se debilita y resiste cada vez menos a las
invasiones si vivo mucha ira, odio, frustracin o rechazo de m mismo. El
coraznnecesitaamorypaz.Lavidaesthechaparasertomadaconlaactitudde
unnio:apertura,alegra,curiosidadyentusiasmo.Inclusositengonecesidades
afectivasporcolmar,intentoquedarenunequilibrioarmonioso,conunaapertura
delcoraznsuficientecomoparaapreciarcadagestodemiexistencia.Acepto
105

amarmems,quedarmeabiertoalamorpor m ylosdems. Me divierto,me


relajo,tomoeltiempodeser.Dejodetomarmeenserio.Mesientolibredeamar
sinobligacin,sabiendoquesoyfelizapesardetodo.Existenvariasexpresiones
para describir el corazn y sus diferentes estados: ser sin corazn, tener
corazn,escucharsucorazn.Sialguienmehacelaobservacindeltipono
tienescorazn,comprueboestemensajequelavidameenva.Quizseselsigno
dequetendraquecambiaralgo.Vivoundesequilibrio?Tengopalpitaciones?
Estoyperturbadoenelplanoemocional?Pocoimportalarespuesta,noesperoa
estarenfermoparacomprenderyaceptarloscambiosenmivida.Memantengo
despierto,abromicoraznatodoloqueesbuenoparam.
CORAZN TAQUICARDIA (ver CORAZN ARITMIA)
CORAZN TROMBOSIS CORONARIA
Una trombosis coronaria es la formacin de un coagulo en una arteria
coronaria(alniveldelcorazn).Estebloqueodelacirculacindelasangrepuede
llevar a un infarto del miocardio. Este coagulo afecta el rgano principal que
representaelamor,oseaelcorazn.Debocomprobarloqueenmividameimpide
amarlibremente.Estopuedeserunenfado,unresentimientoviolentoquepude
tenerfrenteaalguienaquienamo.Enqumesientoyoatacadoenmiamor
propio? Recib una noticia que pareca quitarme mi razn de vivir, lo que me
permitamanifestarmiamor?Hagolapazconmigomismoyconlosdems.Para
arreglarestasituacin,tomoconscienciadelasfuerzasdeamorquemehabitan,me
abandonoydescubroqueelUniversomeaportaelsostnquenecesito.
CORONARIA (ver: CORAZN TROMBOSIS CORONARIANA)
CORTE
El corte indicaundesordenemocional,unprofundodolormentalquese
manifiestaenlofsico.Mehacetomarconscienciadeunallagainterior.Esun
aviso,unsignodequedebovolveraevaluarladireccinenlacualvoy.Quieroir
demasiadodeprisayhacerdemasiadorpidamente.Eselsignodeunconflicto
interiorprofundo.Empujomislmitesalgodemasiadolejos!Miroellugarenel
cualmecortoylaactividadqueestabahaciendoenesemomento;estomepermite
identificarelaspectoquedebointegrar.Porejemplo,uncorteenlasmanosindica
quizsquemesientoculpabledeexpresarmicreatividadenlassituacionesdiarias,
obienqueestoyirritadoporquehagounacosaquenomegusta;medoyprisayme
hagoculpable.Aceptoloquedebocomprender,asumomiseleccionesyhago
elcambioqueseimpone.

106

COSTILLAS:
Las costillas forman parte de la caja torcica. Protegen el corazn y los
pulmones(rganosvitales)contralosdaos,heridasexternasyagresiones.Una
costillarotaoquebradaindicapuesquemiproteccinestdisminuidayquesoy
vulnerable a las presiones exteriores frente al amor a mi autonoma y a mi
necesidaddeespacio.Mesientoarrinconadoentreyomismo(miscostados
espiritualyemocional)yelmundofsicoenelcualvivo.Mesientofrgilyabierto
atodasformasdeataques.Puedotenerlasensacinquenotengocontrolninguno
sobremivida,queestoysinrecursosyexpuestoalpeligro.Frecuentemente,sime
rompooquiebrounacostilla,vivounasituacinparticularfrenteaunmiembrode
mifamilia.Tendrunaindicacindelapersonaenreferenciasegnellugardela
costillaafectada.Sisonlascostillasinferiores,hayprobablementeunconflictocon
unhijoounnieto.Unacostillalateralrepresentamsbienunasituacinconflictual
frenteaunhermanoounahermanaoun/aprimo/aylascostillasaltasrepresentan
unpadreounabuelo.Identificolaolassituacionesquemecreantantapresin.
Aceptomirarelacontecimientoconsimplicidad,expresarfrancamenteloque
sientomientrasmequedoalaescuchadelosdems.Sahoraquelacomunicacin
esuninstrumentoquemepermiterespetarmealavezquerespetaralosdems.
COXS (ver: ESPALDA [dolores del] PARTE INFERIOR DE LA
ESPALDA)
CROHN (enfermedad de ) (ver: INTESTINOS CROHN [enfermedad
de])
CRNICA (enfermedad)
La palabra crnica viene de chronos que significa tiempo. La
enfermedad crnica puede tardar meses o aos en instalarse. Para una
enfermedad,eltrmino crnico sugierealgopermanente,irreversibleyqueenel
lmite,slopuedecorregirse.Desarrollouna enfermedadcrnicacuandorehso
evolucionar por temor a lo que me reserva el porvenir. Cualquier sea la
enfermedad crnica que me atraje, puedo preguntarme lo que me daba la
sensacin de no poder cambiarse. En cul aspecto de mi vida tengo yo la
sensacindedecirme:Detodosmodos,nosepuedehacernada,onosepuede
cambiarnada?Culessonlosregalosquemeaportalaenfermedadbajoformade
atencinporpartedemientorno,delaconfirmacindemiresignacinacambiar
mipuntodevistasobrelavida,etc.?Lasolucinfcilparamessindudanohacer
nadaporqueparecequelonicoquequedeporhaceresbajarlosbrazos.Elreto
quetengoqueresolveresasumirme,abrirmiconscienciaalaideadequetodoes
posible.Puedodocumentarmesobreresultadosobtenidosporpersonasquetenan
107

enfermedadescrnicasysehancurado.Qutipodeenfoqueutilizaron?Aveces,
cuandolosmediosconvencionalesnodieronresultados,puedoinvestigarterapias
alternativas, energticas u otras, con discernimiento, por saber cul podra
ayudarme. Saliendo con la idea de que todo es posible, podr mejor hallar
solucionesque,sibiennomecurantotalmentedemienfermedad,meayudarna
mejorarmisaludfsica,mentalyemocional.
CROUP (ver: GARGANTA LARINGITIS)
CUELLO (en general)
El cuello eslapartedelcuerpoquesoportalacabeza.Estenexoentreel
cuerpoylamenteestambinelpuentequepermitealavidamanifestarse,esla
expresin viva, el que autoriza el movimiento ms fundamental. Representa la
flexibilidad,laadaptabilidadyladireccinanticipada.Esmultidireccionaly
ampliamivisinexteriordeluniverso.Lopuedovertodoalrededormoy,gracias
alaflexibilidaddemi cuello,puedomirarunasituacinbajotodoslosngulos
(delante,atrs).Mipuntodevistasevuelvemsobjetivo.Uncuelloenbuena
saludmepermitetomarlasmejoresdecisiones.Todoloquedalavidapasaporel
cuello:elaire,elagua,losalimentos,lascirculacionessanguneaynerviosa.Unela
cabezaconelcuerpoypermitelalibreexpresindes,lapalabraviva(voz)yel
amor.Elcuelloseparapuesloabstractodeloconcreto,lomaterialdeloespiritual.
Esimportantemantenermicuelloenbuenasaludporquemepermiteverloqueme
rodeaconunamentaabierta,dejandodeladocualquierformade obstinaciny
estrechezmental(cuellorgido).Yaquelagargantasesitaenelniveldelcuello,
sitengodificultadentragarmisemociones,silasreprimo,estopuedecrearuna
tensin en el nivel de mi cuello en donde se halla el centro de energa de la
comunicacin.Alcorresponderel cuello alaconcepcin,tambinrepresentami
sentimientodepertenencia, miderecho deestar enesta tierra,dndome as un
sentimientodeseguridadydeplenitud.
CUELLO TORTICULIS (ver tambin: COLUMNA VERTEBRAL PARTE
SUPERIOR DE LA ESPALDA, NUCA [RGIDA])
El torticulis demuestra, entre otras cosas, que vivo inseguridad. Tengo
resistencias en ver todas las facetas de situaciones que estoy viviendo. Mis
msculosdel cuello secontraen,mi cuello seponergidoynoconsigogirarla
cabeza.Miinflexibilidadmeimpideapreciarlaayudaquedeseantraermeyque
ayudaraahacerevolucionarlascosasquemeparecendifciles.Prefieromantener
lacabezaderechayasociarmimalaunenfriamiento.Tengointersentomar
conscienciadequeestafrialdadmsbienafectmicorazn,provocandoasun
108

bloqueodeenerga.Puedotambinintentarhuirdeunasituacinincmodaqueme
pide afirmarme y tomar posicin. Tambin es importante que me pare para
constatarenculdireccinrechazomiraroculeslacosaquemeobstinoenmirar,
decirohaceryquemebeneficiaSiaceptaseabrirmeaunnuevomododever
lascosas oanuevasideas,mividaseraquizsmuymejoradaymi torticolis
desaparecera.Quizshayaunapersona,unacosaounasituacinquequisieray
que,almismotiempo,noquisieramiraracausademitimidez,mivergenzaomi
sentido moral que es muy fuerte? Si la rigidez impide que mi cabeza gire de
izquierdaaderecha,puedopreguntarmesisaquinoaqumeniegoadecir
no.Sialcontrario,tengodificultadparadecirsconmicabeza,esquizsporque
rechazodeentradanuevasideas.Micuerpomedicedeaceptarveryapreciarel
instantepresenteyreconocertodaslasnuevascosasqueformanpartedemivida.
CULPABILIDAD (ver: ACCIDENTE)
CUSHING52 (sndrome de) (ver tambin: SUPRARRENALES [dolencias
de las cpsulas])
Consecuencia de una sobreproduccin de una hormona de las glndula
suprarrenales,el sndromedeCushing semanifiestaporundesordenmentaly
fsico,undesequilibrioquetraeelsentimientodeestarinvadidoporlosdems,por
elhechoqueheperdidoprogresivamentetodocontactoconmipropiopoder.Se
vive un sentimiento de impotencia. As, por reaccin tengo tendencia a querer
aplastarconscientementeonoalagentealrededormo.Cuandoestasglndulas
funcionandemodoanormal,veoaparecerunaseriedesntomasconocidosbajola
denominacin de sndrome de Cushing. Me doy cuenta que ciertas partes del
cuerposevantransformando:elrostro,elcuello,eltroncoyconstatotambinque
los miembros inferiores adelgazan. Vivo un desequilibrio fsico y mental. Me
sientoimpotente,yanotengoconscienciadelpoderquemehabita.Estoyenestado
de supervivencia y es importante para m que vuelva a tomar contacto con la
realidadhaciendogestosquemeayudarn.Usoestepoderparamejorarmicalidad
de vida. Aprendo a hacerme confianza, acepto tomar mi lugar y vivir en
funcindeloquesientoydeloquesoy.
CUTICULAS (ver: DEDOS CUTICULAS)
CHALAZIN (VER TAMBIN: PRPADOS)
Es un pequeo tumor inflamatorio (ndulo rojo, blando) situado
habitualmenteenelbordeinteriordelprpado.Alestargeneralmentevinculadoun
52

Cushing(HarveyWilliam):Neurocirujanoamericanoque,en1832,describiciertostrastornosvinculadosconlas
glndulassuprarrenales

109

tumor a un impacto emocional, se produce cuando vivo una emocin intensa


delante de lo que veo o vi. Puedo comprobar de cul prpado o cual ojo est
afectado: el ojo izquierdo corresponde al campo afectivo y el ojo derecho
representaloracionalylasresponsabilidades.Memantengoabiertoaloqueveoy
estoymuchomscentradosobremmismo.
CHUPARSE EL PULGAR
Al chuparmeelpulgar,deseoasvolveracrearlasensacindebienestarque
sentacuandoestabaenelvientredemimadre.Tambinocurrequeelpulgarest
sustituidoporeldedomedio(mayor),elcualrepresentalasensibilidad.Elcalory
lahumedaddemibocameprocuranlaseguridad,lasensacindeestaralalbergue
delmundoexterior.Deboreforzarmisentimientodeseguridadinterior,cuidando
demydndomeplacer.
DALTONIANO (ver: OJOS DALTONISMO [no percepcin de los colores])
DEDOS (en general)
Losdedossonlaprolongacindemismanosyelinstrumentosirviendoala
manifestacindemisaccionesenmividadecadada.Representanlaaccinenel
momento presente, los detalles de la vida diaria. Por el tacto, puedo amar,
acariciar,reir,construirycrear.Misdedossonlamanifestacinconcretademis
pensamientos, mis sentimientos. Una herida en el dedo me indica que intento
quizshacerdemasiado,quevoydemasiadolejosodemasiadodeprisa.Llevomi
atencinendemasiadascosasalmismotiempoymisenergasestndispersas.Me
preocupodemasiadodelascosasporhacer.Pocoimportalanaturalezadelaherida
(corte, rasguo, verruga, etc.) me preocupo con mis acciones presentes.
Habitualmente,elniveldelaheridayeltipodetejidoimplicado(lapielolos
huesos)sonimportantes.Porejemplo,uncortehastaelhuesoimplicaunaherida
msprofundaqueunsimplerasguo.Comprueboel/los dedo/simplicado/syla
respuestaamispreguntasestarmsclara.Apartirdeahora,tomoeltiempode
hacer una cosa a la vez porque acepto mi dimensin humana y corto mi
impacienciaquemeincitaaadelantardemasiadorpidamente.
DEDOS PULGAR
Elpulgarestvinculadoalapresin,laquemecolocoenloshombrostanto
comolaqueexijodelosdems!Esundedopoderosoquesimbolizalafuerza,mi
necesidaddepoderyquesirveaempujar,juzgar,apresurarascomoapreciarlas
acciones de los dems (pulgar arriba o abajo) tanto como mis propias
intervenciones.Cuandoenseoel pulgar hacaarribateniendolamanocerrada,
doymiaprobacin;elpulgarhacaabajo,midesacuerdoomirechazo.Elpulgar
110

esta vinculado a mi intelecto, a mis intercambios inter personales y a mi


sensibilidad. El pulgar determina pues el tipo de contactos que tengo con los
demsyyomismo.Unniosechupael pulgar enlassituacionesenquese
siente inseguro, por lo tanto el pulgar representa la seguridad y la proteccin.
Todaslasheridasenel pulgar sevinculanaunexcesodeesfuerzomental,un
cmuloexcesivodeideasyde preocupaciones yunatendenciaaserpesimista.
Sonsanosmisintercambiosconlosdems?Empujodemasiadolosdemsome
sientoempujadoporunavidaacelerada?Elpulgarsimbolizatambinlavidayla
supervivencia,laganadevivirsuvidaynodemorir(siconservomipulgarenel
interiordeunamanocerrada,soyunapersonaintrovertidaquequizstieneganas
demoriroquesientelanecesidaddereplegarsesobresparaprotegersedelmundo
exterior). A partir de ahora, lo hago todo para estar en paz conmigo mismo.
Observolossignosvinculadosconmipulgarymemantengovigilantecuandoalgo
me sucede. Dejo subir la tristeza que me habita. Acepto la vida y las
situacionessinhacerdemasiadodramaporquesqueeluniversocuidadem!
DEDOS NDICE
El ndice representael ego bajotodosestosaspectos: autoridad,orgullo,
suficiencia En mis comportamientos no verbales, cuando activo mi ndice
apuntndoloconfrecuencia,estoindicaunrechazodeautoridad,bienseadelos
padresuotra.Intentoexpresarlaautoridaddemodoreactivoesdecirenreaccin
conlasdiferentesformasdeautoridadpresentes.Mimiedodelaautoridadpuede
incluso causarme trastornos de digestin. Tengo miedo de estar cogido en la
trampa,denoestarreconocidoenmijustovalor.Tengomiedodelaautoridadyno
aceptoqueseapresenteenmivida.Quierohacervalermicriterioatodacosta!
Cuandousomindiceparaimponermisideasdeunmodobastanteautoritario,es
mimododeafirmarmipoderpersonal.Tomoconscienciaqueamenudo,sonmis
llantos los que me hacen actuar de esta manera. Tengo una gran sensibilidad
emocionalynecesitosentirmeenseguridadenlavida.Comprendoquetenerrazn
poruntodoounanada,noesloquecuenta.Conservomisenergasparacosas
importantes.Esrealmentelaautoridadquememolesta?Quizssetratedeun
sentimientodeimpotenciaodeinseguridadqueremontaamiinfanciafrenteala
autoridaddelospadres.Apartirdeahoraaceptolasformasdeautoridadque
memolestansabiendoqueexistenparahacermeevolucionarpositivamente.
DEDOS MAYOR
Eldedomayor,eldedomslargodelamano,representalacreatividad,la
sexualidad y la ira. En suma, simboliza muchas cosas y debo prestarle una
atencinparticular.Unaheridaaestededosignificaquemividasexualnovacomo
lodeseooquemeinclinodemasiadofcilmentefrentealdestino.Vivounapenao
111

unatensinvinculadaconlainsatisfaccin,ylairaseinstalapaulatinamente.Esta
reaccinmeimpiderealizarmisdeseosconcretos.Miladocreativoestrestringido
por una falta de confianza. De ahora en adelante, identifico el aspecto de mi
sexualidad o de mi creatividad que est en causa. Acepto expresar mis
necesidadesenvezdedejarsubirlaira.Comprendoquenicamentemismiedos
(elorgullo)meimpidenexpresarme.
DEDOS ANULAR
Anular,delapalabraanillo,eselsmbolodelauninyrepresentamis
lazos afectivos. Cualquier herida a este dedo procede de una pena o de una
dificultadenmisrelacionesafectivas;puedeserfrenteamimarido,mimujer,mis
hijosy,enciertoscasos,inclusofrenteamispadres.Estaheridaeslamanifestacin
externadeunaheridainteriordelacualnohehabladoprobablementeconnadie.
Meesdifcilhacerlauninconmigomismo,vivirconestapenainteriorqueme
pesa.Quizstengotendenciaaexagerarlasituacin.Quesloquememolesta?
Acepto desprendermeparavermejorlasituacin.Quesloquemeimpide
expresarme?Quizsmeimaginolareaccindelotro?Aprendoacomprobary
comprendoqueentreimaginarysaber,hayunagrandiferencia.Comprobarme
permitetenerrelacionesmuchomsarmoniosasymeenseatambinadialogar.
DEDOS AURICULAR (dedo pequeo)
El auricular est directamente vinculado con el corazn. Representa la
familiaascomotodoslosaspectosfamiliaresdemivida,enparticularelamoryla
armonafamiliar.Cuandomehagounaheridaenestededo,estoindicaquevivo
emocionesfrenteamifamiliaquedeberaexteriorizar,unafaltadearmonaenel
interiordemiparejaounasimplecarenciadeamordes.Cualquierdaoaldedo
pequeo (rasguo, quemadura, etc.) denota seguramente una emotividad
demasiadogrande.Tengoseguramenteladesgraciadacostumbredepreocuparme
por pequeeces (dedo pequeo) y mi emotividad predomina. Me vuelvo
pretencioso y esto me desequilibra y me impide comprender a la gente y los
acontecimientosdemivida.Aceptomirarlosacontecimientosylassituaciones
con la simplicidad de un nio. Desdramatizando y revelando apertura mental,
aprendoaafirmarmeyacomunicar.Voyhacadelantemsalegremente.Necesito
muchomscalmainterior.Envezdejugarunpapelyvivirenunmundoenquelas
aparienciasimportanmsqueelser,tengoventajaenvolveralascosassimplesy
aseryomismo.
DEDOS ARTRTICOS
Elartritissimbolizalacrtica,elautocastigo,lareprobacin,unacarencia
profundadeamor.Aspues,losdedos(esdecirlosdetallesdelavidacotidiana)
artrticos indican el sentimiento de estar mal amado y de ser vctima de
112

acontecimientosenmividadecadada.Doyelpoderalosdems.Acepto
amarmeyperdonarmeporque,sinomequiero,cmopuedenamarmelosdems?
DEDOS CUTCULAS
La cutcula esunacapamuyfinadepiel,unaespeciedepelculaquese
formaenlabasedelaua.Cuantomsgruesaeslacutculaymsrpidamente
crece,mstendenciatengoaserdurohacam. Mecritico constantementepor
futilidadesporquesoyperfeccionista.Acepto verquesoyunserhumanoen
evolucinyquesiemprehagomiposible.Dejodejuzgarmetanseveramenteyme
aceptotalcomosoyparapoderseguiradelantandoarmoniosamente.
DEDOS DE LOS PIES
Los dedos de los pies representan los detalles del porvenir. Si vivo
inseguridadfrenteaesto,tengorampasysivivoculpabilidad,puedodarmegolpes
aldedo, cortarme(sihayprdidadealegra)o herirmemsseveramente(dedo
roto,quebrado).Sitengounjuanete,queesunadeformacindeldedogordo,hay
unconflictoaunnivelmuyprofundo.Estapartedelpiecorrespondealperodode
algunassemanasdespusdelaconcepcineindicaunadebilidadenelcompromiso
deestarrealmenteaqu(envida).Eljuaneteaparecegeneralmenteenelmomento
de vivir una relacin con una pareja o uno de los padres que encuentro muy
dominante.Aldejaralotroquetomelasdecisiones,huyomiresponsabilidadfrente
amispropiasdecisiones.Laexpresincudatedetusasuntosexpresabienel
hechoqueencuentroquepersonasdemientornosecuidandemiscosasyqueesto
nolesincumbe,amenosdequeseayoquienmecuidedelosasuntosdelosdems.
El juanete puede desaparecer si me asumo, asumo mis responsabilidades,
permitindomeasvivirplenamentemivida.Losdedosdelospiessonlapartede
micuerpoquevaprimerohacadelante, dedoshacaabajo puedenindicaruna
inseguridad en ir haca delante, un deseo de agarrarse al suelo para evitar
adelantar.Tengopuestendenciaaquedarmeenelmismolugar.Meimpidoentrar
enlavida.Losdedoshacaarribaindicanelintentodeescaparmedelavida,de
elevarme haca las realidades ms abstractas que terrestres. Los dedos como
ganchos indicanunagranconfusinenladireccinportomaryunaausenciade
libertadydeclaridadinteriores,locualmellevaaquererhuir.Eldedoenmartillo
meindicaunestrsyunarepugnanciaairhacadelante.Tambinestopuedeserel
miedodeunmododeserabstractoypocoestructurado.Paraconocerelsignificado
metafsicodecadaunodemisdedos,puedoreferirmealsignificadodecadaunode
misdedos,empezandoporelpulgarparaeldedogordo,paraacabarconeldedo
pequeo, el auricular, para el dedo pequeo del pie. Basta con transponer el
significadodelosdedosdelamano,quesonlosdetallesdelavidacotidianaalde
losdedosdelospiesquesonlosdetallesdelporvenir.
113

DELGADEZ (ver tambin: ANOREXIA, PESO [exceso de])


Una infra alimentacin o un consumo excesivo puede conllevar la
delgadezotransformarseenobesidad.Lanerviosidad,laansiedad,elconsumode
medicamentos,losgrandesmiedosomuygrandesalegrassonfactoresquehacen
queunindividuoseengordeoqueotroadelgace.Lapersonadelgadageneralmente
es emotiva, con una gran sensibilidad y no siempre sabe cmo expresar sus
sentimientosporquehabiendosidoheridaya,quiereprotegerseparanotenerque
sufrirms.Estamismasensibilidadseencuentraenunapersonaconunexcesode
peso,crendosestaunaproteccinyunabarreraporsufsicomsimponente.La
genteanorxicarechazavivir,prefieremorirqueaceptarelamor.
DEPENDENCIA (ver tambin: ALCOHOLISMO, CIGARRILLO, DROGA)
Una dependencia est vinculada a un profundo vaco interior, a una
tentativaexteriordequerercolmarprincipalmenteunacarenciadeamordesouna
carencia afectiva vinculada a uno de mis padres. Mediante la dependencia
(alcohol,droga,alimento,cigarrillo,deporte,sexo),quierocolmarestevaco,esta
desesperacin yestatristeza.Mividaestprivadadesentido,nosatisface mis
deseosmsprofundos.Mesientoenrebeldacontraelmundoexteriorytengo
dificultadenpreservarmiego.Noconsigoamarmetalcomosoyyestaincapacidad
temporalsemanifiestaporirayrencorfrentealuniverso.Ladependenciaespues
un tipo de sustituto que me ayuda a vivir temporalmente en un mundo sin
problema.Elalcoholmetraeciertaxtasisyunletargofrentealoquevivo,las
drogasnoprescritas(cocana,haschich,herona,LSD,PCP,marijuana,etc.)me
dirigenhacanuevassensacionesconeldeseodealcanzarcumbresdesconocidasde
la consciencia. Cualquier dependencia conlleva pues reacciones del cuerpo
humanomsomenosconocidas.Estasformasdeabusosonfundamentalmente
negativasydiversostiposdemiedosincontrolados(neurosis)puedensurgirsila
dependenciaesfuerte(porejemplo:drogas).Finalmente,unadependenciapuede
manifestarseatravsdeciertatendencia(porejemplo:sexual)queesdifcilmente
controlable. El primer paso importante por hacer es tomar consciencia de mi
situacin.Estorequieremuchoamoryvalorparaafrontaroromperestaesclavitud
quedesordenamivida.Aceptoestarabiertoalodesconocido,alavaqueme
llevaraamisobjetivosdeRealizacindes.Elamorincondicionaleselprincipio
demicuracin.Preguntoalosdems,busco,compruebo,hagolosprimerospasos.
Busco cul mtodo de curacin natural puede ayudarme a centrarme, a
armonizarmeyaaumentarmisfuerzasinterioresafndepermitirmeintegrarcon
amorlasdiferentescarenciasvividasdurantemijuventud.Lasresponsabilidadesya
nomeasustanyvuelvoatomarcontactoconelserdivinoquesoy.

114

DEPSITOS DE CALCIO.
Elcalcioesunmineralcorrespondientealaenergamsrgidadelcuerpo
humano,esdecirelhueso.Elcalcioestpuesconectadoalaenergamental,ala
estructuramentaldemiser.El depsito seformacuandolaenergasefijayse
cristaliza(parecidaalaspiedrasdelhgado)enunlugardadoconllevandodolore
inflamacin. Porqu es as? Porque los depsitos de calcio proceden
generalmente de pensamientos inmutables, de la carencia de flexibilidad con
relacinalaautoridad querehusoaceptar .Consideroquedoblarmeaesta
exigenciasuplementariaenmividameimpidesertotalmentelibre.Unmodode
cambiarestosdepsitosdecalcioenamorespracticarlaaperturamentalyponer
elacentoenlacomunicacin.Aceptoque,estandoabiertoalosdems,sufro
menosautoridadyvivomuchomselcompartir.As,mevuelvoautnomo,librey
adquierolasabidura!
DEPRESIN (ver tambin: NEURASTENIA)
La depresin implicauna profundatristezainterior,unaacumulacinde
emociones inhibidas provocando un conflicto entre el cuerpo y la mente. Esta
enfermedadestconectadaconunsucesosealadodemivida.La depresin se
traducepor desvalorizacin y culpabilidad quemecorroenpordentro.Sisoy
depresivo, me siento miserable, menos que nada. Vivo en el pasado
constantemente y tengo dificultad en salir de l. El presente y el porvenir no
existen. Es importante efectuar un cambio ahora en mi modo de ver las cosas
porqueyanoescomoantes.Ladepresinfrecuentementeesunaetapadecisivaen
mivida(porejemplo:laadolescencia)porquemeobligaavolveracuestionarme.
Quieroatodacostatenerunavidadiferente.Estoytrastornadoentremisideales
(missueos)yloreal(loquesucede),entreloquesoyyloquequieroser.Esun
desequilibrio interior (quizs qumico y hormonal) y mi individualidad es
irreconocible.Mesientolimitadoenmiespacioyvoyperdiendodespacioelsabor
de vivir, la esencia de mi existencia. Me siento intil. En otras palabras, la
depresintieneensuorigenunasituacinquevivofrenteamiterritorio,esdecir
lo que pertenece a mi espacio vital, sean personas (mis padres, mis hijos, mis
amigos,etc.)animales(miperro,mispeces,etc.)ocosas(mitrabajo,micasa,mis
muebles,etc.).Elconflictoquevivopuedeestarvinculadoaunelementodemi
territorioquetengomiedodeperder:aunapeleaquetienelugarenmiterritorioy
quememolesta(porejemplo:laspeleas entrehermanosyhermanas).Heaqu
expresiones que revelan cmo me puedo sentir: Me ahogas!, Me chupas el
aire!;Aire!.Avecestambin,sientodificultadendelimitaromarcarmiespacio,
mi territorio: Qu es lo que me pertenece en exclusividad y qu es lo que
pertenecealosdems?Laspersonasdepresivasfrecuentementesonpermeablesa
su entorno. Siento todo lo que sucede alrededor de m y esto incrementa mi
sensibilidad,deaquunsentimientodelimitacinylaimpresindeestarinvadido
115

pormientorno.As,abandonoporqueencuentrolacargademasiadopesada,yano
tengoelgustodevivirymesientoculpabledeserloquesoy.Inclusopuedotener
tendenciaalaautodestruccin.Tambinpuedotenernecesidaddeatencin
paraayudarmeavalorizarme;ladepresinsevuelveenestemomento,unmedio
inconscienteparamanipularmientorno.Larisayanoformapartedemivida.
Pocoimportalarazn,comprueboyaahoralacausaolascausassubyacentesami
estadodepresivo.Vivyounapresindejoven?Culessonlosacontecimientos
sealadosvividosenmiinfanciaquehacenquemividaparezcataninsignificante?
Eslaprdidadeunseramado,mirazndeviviroladireccindemividaqueya
noconsigover?Huirlarealidadymisresponsabilidadesnosirvedenada(por
ejemplo:suicidio)pormsqueestoparezcaserelcaminomsfcil.Esimportante
constatar las responsabilidades de mi vida porque necesitar otra cosa que
antidepresivosparahacerdesaparecerladepresin:deboiralacausa.Apartirde
ahora,comprendoquesoyunsernico.Tengovaloresinterioresexcepcionales.
Puedoretomarelcontroldemmismoydemivida.Tengoeleccindesoltaro
de luchar. Tengo todo lo necesario para cambiar mi destino.
Responsabilizndole,adquieromslibertadymisesfuerzosestnrecompensados.
DERMATITIS (ver: PIEL DERMATITIS)
DESMAYO o PRDIDA DE CONOCIMIENTO (ver tambin: CEREBRO
SNCOPE, COMA)
El desmayoesuna prdidadeconscienciatemporaldeduracinvariable,
yendodeuncortoinstanteamediahora.Sitengounaprdidadeconocimiento
total,brutalydecortaduracin,sehabladesncope.Silaprdidadeconocimiento
duraunperodomslargodetiempo,setratadeuncoma.Encualquiercaso,una
prdida de conocimiento me permite huir la realidad. Me niego
momentneamente porque estoy tan cansado que mi resistencia es nula. Soy
incapazdeenfrentarmeconlassituacionesdemivida.Alternoentreestadosde
miedo,angustia,desnimoeimpotencia.Frecuentemente,tengomiedodeperder
elpoderydenoestar alaalturadealgunaspersonasoalgunassituaciones.
Cuandomeagarro,bloqueotodaslasenergasylasfuerzasqueestnenm.Tomo
conscienciaquedebocesardeagarrarmealpasadoyamisviejasideas.Dejoquela
vidasigasucurso.Aceptoconfiareneluniversoyaquetodoestaquparami
evolucin.
DIABETES (ver: SANGRE DIABETES)
DIAFRAGMA
El diafragma es la gran pared muscular que separa la parte superior
(pulmones,corazn)delaparteinferior(hgado,estmago,intestinos,etc.)demi
116

ser. Representa la respiracin, la capacidad de abandonarme totalmente


respirandoprofundamente.Necesito estar relajado para poder respirar bienla
vida.Eldiafragmaeseficazcuandomeabandonoalavida.Siaparecenalgunas
tensiones,esporquemereprimo,meinhiboobloqueoenergasliberadorasque
sonbenficasparam.Puedoviviralgunassituacionesquemeimpidenexpresar
librementemissentimientosymispensamientosmsprofundos.Quizsmimodo
devidameimpideserrealmenteloquesoy,locualmellevaarespirardeunmodo
superficial y limitado. El diafragma est vinculado al perodo de los primeros
movimientosdelfeto,dondedescubroquealgomsexisteademsdem.Porlo
tanto,unavezadulto,estareasebloqueacuandolosintercambiosentremimundo
interiorymimundoexteriormeprovocanconflictos,porejemplosihagomuchas
cosasquesonvacasosuperficiales,sinprofundidad.Debotomarconscienciade
que la vida me trae mucho bien. A partir de ahora, no necesito reprimirme
intilmente.Eldiafragmaesunmsculodegranimportanciaque,cuandorespiro
plenamente,mepermiteentrarencontactoconmiyointerioryvolveraconectar
conlaenergadeluniverso.Yaahora,veomividadeunmodomuydiferente.
Expreso libremente, aqu y ahora, mis pensamientos, mis sentimientos, mis
emocionesprofundas
DIARREA (ver: INTESTINOS DIARREA)
DIENTES (en general)
Los dientes simbolizanlas decisiones,lapuertaslidadeentradaqueme
permitemordercontodosmisdientesenlavida!Realidadinterioryexterior
pasanpormisdientesquesonunodelosmediosparaexpresarmeenteramenteen
esteuniverso.Eldienteesunodelosrganosanexosmuydurosquerepresentala
energafundamentaldemiser.Lacapacidadinteriordeacogerlasnuevasideas,el
amoryelalimentointeriorsemanifiestaporlosdientessanosyduros.Losdientes
son,enparte,elespejodelser.Cuandoelalimentopasaatravsdemiboca,sta
transmitetambinsentimientosquepuedenafectarmis dientes ams omenos
largotrmino.As, dientes alterados(porejemplo:concarie)indicanunadbil
afirmacindes,unarealidadinaceptableparamyelmiedoacogermilugarenel
universoconlasresponsabilidadesqueestoimplica.Aunquetengadificultaden
tomarciertasdecisionesbenficasparam,deboquedarmeabiertoalosmedios
disponiblesquemepermitensuperarlassituacionesmsdelicadas.Los dientes
representantambinmivoluntaddeirhacadelante,dehacerbienlascosas,mi
capacidad en dar vida a mis pensamientos y a mis emociones. Un conflicto
profundo,culpabilidadconectadaconunasituacinemocionaltransportadaconlas
palabras,ocualquierdesarreglointeriorpuedenmanifestarseporunareaccinen
los dientes e incluso en las encas. Puedo pues apretar los dientes para
117

defendermedeunaagresinexteriorenunasituacinquemehacefuertemente
reaccionar.Cierrolapuerta,resistiendoaloquequiereentrarenmo,alcontrario,
aloquenecesitasalirdem.Los incisivos (losdientesdedelante)serelacionan
conelhechodenohacertalaccin,etc.Loscaninossevinculanmsconelhecho
depoderejercerciertaautoridadsobrelasdecisionesquehedetomar.Puedenestar
afectadoscuandomesientoestiradofrenteaunadecisinquehedetomar.Las
premuelas meindicanmigradodeacuerdoconmisdecisiones.Encuantoalas
muelas,representanmigradodefelicidadfrentealasdecisionesquesetomarono
que debo an tomar. El esmalte del diente estar afectado cuando tengo la
sensacindequenotengoelderechodemorderenunasituacinyla dentina
estarafectadacuandopiensonopodersercapazdemorderenunasituacin,
dudandodemmismo,demiscapacidades.Aceptoquedarabiertoalamor,
sintenermiedodeperderlagratituddelosdems.Meamotalcomosoy,contodas
miscualidades.Debocuidardemisdientes,vistenmipersonalidad.Losdientes
notienenmscara!Memantengoyomismo,sinjuzgarmeyquedandoabiertoa
las crticas exteriores. Transformo mis pensamientos en amor autntico y mis
dientessemantienenenbuenasalud!
DIENTES (dolor de o de muelas)
Losproblemasdentalesestnvinculadosconlasdecisiones,especialmente
cuando me duelen los dientes. Aplazo la toma de decisiones, porque las
consecuencias de estas elecciones me asustan, me hacen perder seguridad. Se
asociaalaresponsabilidadpersonal,amicapacidaddetomardecisiones,sintener
miedodeloquesucederdespus.Sitengoundolordemuelas,puedeserqueme
sientadolidoporquemeculpodenoconseguircomunicarloquequiero.Tengoel
gustodeensearlosdientesparacogermisitioymostrarqueexisto.Quieroque
me escuchen, que me respeten. Tomo consciencia que comunicando mis
necesidadesymisdeseos,los doloresdemuelas yanotendrnrazndeexistir.
Cuandosetratade sarroenlosdientes,esunaformadeagresininterior,una
reaccin que no ha sido resuelta y vuelve a aflorar. Esto me puede llevar a
endurecermeenmisposicionesfrentealasdecisionesquehedetomaroquetom.
Miscomportamientospuedencambiar.Sabiendoquenoesbenficoparamestara
disposicin de mi imaginacin, desarrollo ms bien el lado creativo de las
circunstancias.Intentoencontrarunmediodeestructurarmejormipensamientoy
misideas;as,mesermsfciltomariniciativasjuiciosasvinculadasaloquevivo
actualmente.Aceptoserconscientedeloquesucedeenmivida,comprenderla
esenciadeladeterminacinquerigemiuniverso.Comprueboelladoafectadopor
losproblemasdentalesyaportolasolucinqueconviene.Siestarriba,piensoen
laintuicinyenelinstinto;ysiestabajo,setratadeunadecisindelcampo
racionalylgico,algoqueridofsicamente.
118

DIENTE (absceso del)


Esteabscesosehallaenlostejidosquecubrenlarazdental;estodemuestra
miirafrenteaunadecisinquehedetomar.Lainfeccinestsituadaenlacavidad
centraldeldiente,estoindicalacontrariedadquevivoenrelacinconunadecisin
quemeroepordentro(dientro).Entoncesestiempoquetomeladecisincon
todoelamorylaarmonaposibleteniendoencuentavaloresmselevadosque
gobiernanmivida,enelrespetodemmismoydelosdems.
DIENTE (carie dental)
Lacariedentaleslamanifestacindeundolorinteriorextremo.Algome
roehastalomshondodemiser.Noconsigoexpresarestemalquemecorroeyla
inflamacinhacesuaparicin.Eldienteempiezaaablandarseygeneralmentees
doloroso, debido a la sensibilidad nerviosa presente en el nivel del diente. La
estructuradeldienteeslamsrgidadelcuerpohumano.Lacariedentalserefiere
alaspectomental.Esodioorencorfrenteaalguien?Puedeserqueenseelos
dientescuandomesientoatacado.Culeslaverdaderacausademidolor?La
razn primera aumentar Mis probabilidades de invertir este proceso de
destruccin.Tambinpuedohabervividounasituacinenquetenaelgustode
morderaalguienensituacindeautodefensayquenolohiceporqueunnio
bieneducadonohaceestetipodecosas.Frecuentementetenacariesdenio,
porque tengo un diente contra una persona. Tambin es posible que viva un
conflictofamiliaroqueasumadifcilmenteloquerecibodemientornoyquedeba
filtraresteconflictoconmis dientes porelprocesodemasticacin.Porquemis
dientesmepermitenfiltrarydiscriminarloqueentraenelinteriordemicuerpoy
porelmismohecho,enmiUniversoengeneral. Dejodebuscarlacausafsica
(alimentacin, azcar, etc.) Mejor dejo que mis pensamientos evolucionen y
cambiomimaneradeverlassituacionesdemivida.Tomolavidaconungrano
desalypermitirasamisdientesdeljuiciodesarrollarseyfortalecerse.Ser
muchomsprovechosoparami!
DIENTES PROTESIS DENTALES O DIENTES POSTIZOS.
Laprtesisdentalmedalailusindeunafuertevitalidad.Enefecto,similar
alos dientes verdaderos,dalasensacindeserverdadera,desersinceracomo
dientesdeverdad!Estotalmentefalso!Yaquedeseounarespuestaclara,voyal
fondodelascosas.Soyyocapazdevivirmisexperienciasconvalorysinceridad,
igual como con mis verdaderos dientes? Estoy decidido a ser lo que soy
realmente,aafirmarme,amorderenlavida?Dejodevivirenfuncindelos
dems.Aceptoseryomismoy,afirmndome,encuentrolasatisfaccinyla
felicidad.

119

DIENTES (chirrido de) (ver tambin: AUTORITARISMO, MNDIBULAS


[dolores de]
Los dientes representan las decisiones y cierta forma de agresividad. El
chirridodedientesespuesunairainconscientequeafloraenlasuperficie,una
rabiareprimida queseexpresafrecuentementedenoche.Estoymuynervioso
interiormente,meretengoynodigoonohagociertascosas.Comoquenoconsigo
tomardecisionesclarasyprecisas,elchirridodedienteseslaexpresinfsicade
mitristezaydemiagresividadreprimida.Comounapuertamalengrasada,el
chirridodedientesmeindicamimiedoaabrirmeparatomardecisionesyelruido
expresaunaformadegemidointerior.Aceptotomarconscienciadeesteestado
sininhibirloyexpresarlocomolovivoactualmente.Aceptomisensibilidady
lasemocionesqueafloranycomprendoquemisincertidumbresmellevanavivir
muchamstensininteriorqueelhechodetomarlasiniciativasqueseimponen.
Cuandotomounadecisin,meliberoymesientomsdesarrollado.
DIENTE DEL JUICIO INCLUSO;
Eljuicio,esunagrancualidad.Tengolaalegrademanifestarloenestavida.
Me permite abrirme al universo y me procura bases slidas en todo lo que
emprendo.As,undientedeljuicioquenoquieresalir,cogersusitio,significa
enelplanomentalquerechazoantomartodoelespacioquemepertenece.Debo
hacerloconscientementeparadesarrollartodaslascualidadesdivinasesencialesa
mievolucin.Aceptodejarlanaturalezaseguirsucursoyabrirmiconsciencia
paracreceryverloscambiosenmi!Medarnbeneficios!
DIFTERIA (ver tambin: GARGANTA, LARINGE)
Ladifteriasecaracterizaporlaformacindemembranasenlalaringeyla
faringe(garganta)provocandohinchazn.Tengodificultadentragar.Yaquela
garganta me permite hablar, comunicar e intercambiar, esto me indica que me
reprimo cuando hay intercambios con los dems. No consigo expresar lo que
siento, inhibo mis emociones y mis necesidades. Tengo miedo al rechazo e
imagino lareaccindelosdems.Comprendoqueesesencialquehagaconocer
mis necesidades y mis sentimientos en vez de ahogarles. Debo cambiar. Debo
aceptarmetalcomosoyyaprenderaamarme.Simeamoysimerespeto,los
demsmeamarnymerespetarnasuvez.
DISENTERA (ver: INTESTINOS DIARREA)
DISGUSTO
Noestoysatisfechodeloquesucedeenmivida.Sinembargopodraestarlo,
pero siempre hay un pero. Quizs soy demasiado perfeccionista. Reprimo
120

presin, tengo un deseo de venganza no expresado verbalmente. El disgusto


frecuentemente se ve en la expresin del rostro. Debo buscar la causa de este
disgusto para as permitirme aportar cambios positivos tomando los medios
apropiadosparallegaraello.Entoncesserelprimeroengozardemsalegraen
mivida,locualsereflejarenmientorno.
DISLOCACIN (ver HUESO DISLOCACIN)
DISTROFIA MUSCULAR (ver: MSCULOS DISTROFIA MUSCULAR)
DIVERTICULITIS (ver: INTESTINOS DIVERTICULITIS)
DOLENCIA
Una dolencia noesunaenfermedadsinomsbienunaincomodidadque
sientoycuyaintensidadpuedevariar.Elmododedescifrarladolenciaeselmismo
queparaunaenfermedad.Sinembargo,lossntomasclnicossonmsdifusosy
puedenirdesdelaindisposicinhastaeldesmayo.Igualcomoparalaenfermedad,
ladolenciaprocededeunconflictoodeuntraumatismoconscienteoinconsciente.
Ladolenciapuedeserpasajeraperopuedeindicarunconflictointeriorporresolver
antesdequeelmensajeseamandadomsfuertementebajoformadeenfermedad.
DOLOR
Cualquierseaeldolor,estvinculadoaundesequilibriodeordenemocional
omental,aunsentimientoprofundodeculpabilidadodepena.Esunaformade
angustiainternay,alsentirmeculpabledehaberhechoalgo,dehaberhabladoo
incluso de haber tenido pensamientos malsanos o negativos, me castigo
manifestandoinconscientementeundolordeintensidadvariable.Lapreguntapor
planteares:Soyrealmenteculpable?Ydequ?Eldolorvividoactualmenteslo
disimulalacausaverdadera:laculpabilidad.Mispensamientossonmuypoderosos
y debo mantenerme abierto para identificar bien estas culpabilidades. No debo
evitarlas,sinoafrontarlas,porquesonmiedosquedeberintegrarprontootarde.El
dolorenloshuesosindicaquelasituacinmeafectaenlomshondodemiser,
mientras que en los msculos, es ms un dolor de nivel mental. El dolor me
conectainstantneamenteymeobligaasentirloquesucedeenmicuerpo.Enun
sentido,espositivoporquemepermiteconectarmeconmigomismo,comoalma
ydevolvermeconsciente.Cuandoeldolorescrnico,estosignificasimplemente
que,desdelaaparicindeldolor,nomeheencaradoconlaverdaderacausadeeste
dolor.Cuantomstardoentomarconscienciadel,msvuelveregularmenteel
dolorhastahacersecrnico.Esimportantequeaceptecomprobarelorigen
demi dolor yquememantengaabiertopararesolverlaverdaderacausademi
121

dolor.Ellugardondeestubicadoeldolormedaindicacionessobrelaautntica
causadeste.
DOLOR DE ESPALDA (ver: ESPALDA [en general])
DOLOR DE GARGANTA (ver: GARGANTA FARINGITIS)
DOLOR DE MUELAS (ver: DIENTES [dolores de])
DOLOR DE VIENTRE (ver tambin: INTESTINOS, VIENTRE)
Paraelniocomoparaeladulto,elmaldevientredemuestraunsentimiento
deabandono,desoledad.Eselrehusodecomunicar,eltemoranoestarescuchado.
Puedoarreglarmeparahablarmedemodoadarmeseguridadycogermsconfianza
enm.Acepto ,adems,comunicarconmientornodejandocircularelamor
hacalosdems.
DOLORES DE CABEZA (ver: CABEZA [dolores de])
DROGA (ver tambin: DEPENDENCIA)
Verdaderaplagadelahumanidad,lasdrogasconstituyenunadelaspeores
huidasdelserhumanoparasusupervivencia.Extradasdeplantasodesustancias
fabricadas sintticamente, las drogas llamadas blandas (marihuana, haschich,
etc.)oduras(PCP,cocana,herona,etc.)frecuentementeestnutilizadaspor
uno o varios de los motivos siguientes: desesperacin, vergenza, suma huida,
miedoalodesconocidoydelasresponsabilidades.La droga esmirefugio, me
protejo contra m mismo. Si rehuso vivir y ser responsable, mis debilidades
interiores corren el riesgo de llevarme haca las drogas. Tengo miedo de
enfrentarmealarealidadydedeberhaceresfuerzos.Mivoluntadseadormecey
tengocadavezmenostendencia atomardecisiones.MedejovivirDiversas
drogas conllevan frecuentemente grandes dependencias que slo reflejan mis
propiasdependenciasinteriores:delincuencia,padre(s)ausente(s),introversin,
neurosis,compulsividademocionalosexualqueintentoinhibirdopandomimental.
La sensacin de estar separado, incluso arrancado o bien de un ser querido
(padre,hermano,hermana,animal,etc.)odeunlugarodeunasituacinqueme
dabamuchafelicidadpuedellevarmeavivirunvacointeriorquequierohuirporla
droga. Estas

drogas

quesonestimulantesmepermitenflotar,alcanzarciertas
cumbres y vivir una experiencia que me da la ilusin de estar por fin feliz
escapndome.Yanopuedoprescindirdeellasymidependenciaseacentayse
agravaconel tiempo.Elprimer pasoes latomadeconsciencia, francay sin
mscara:porqurecurroaestassustancias?Mevuelvoconscientedequesiempre
existe una razn. Poco importa la naturaleza de sta, acepto descubrir la
122

autnticarazn.Meaceptotalcomosoyyaprendoaexpresarmisnecesidades.
Dejardeconsumirmepidemuchovalor,perolabsquedadelapazinterioresmi
motivacin. Llegar a ser yo mismo en cualquier circunstancia me permite
alcanzar y vivir la verdadera paz interior y sentirme en mi lugar en este gran
universo.
HaschichMarijuana:alabsquedadeunmundosinproblemas,huida.
Anfetamina,cocana:estimulalaproductividad:bsquedadelxito,delamor,del
reconocimiento.
LSD,mescalina,hongosmgicos,herona:bsquedadesensacionesyexpansinde
laconsciencia.
Opio:traegozo,perezaydaunafalsaaparienciadepazinterior.
DUDA
La duda est directamente relacionada con lo mental.. Es un estado
obsesivoquemeimpideconectarmeclaramenteenlofsico.Ladudapuede
resultardeplanteamientosdeltipo:lohehechoono?Mehagopreguntasmuy
pragmticasoalcontrariobajoformametafsica,llevandosobreelvalordelavida,
de la religin, del deber, de la verdad, etc. Cuestiono constantemente mis
decisiones,mepreguntosihicelabuenaeleccinfrentealassituacionesdemi
vida.Ladudapuedeperturbar yenvenenar miexistencia. Elmejor remedioes
empezar a escuchar mi voz interior y hacer ms confianza a la vida. Dando
seguridadamiyointerior,acepto quedarlibredelasatadurasmentalesque
frenanmievolucinespiritual.Cuandosetratademisrelacionesconlaspersonas
de mi entorno, en vez de envenenarme la existencia con la duda, aprendo a
comprobar mis necesidades, mis impresiones, mis intuiciones cerca de dichas
personas.
DUDENO (lcera del ) (ver: ESTMAGO [DOLENCIAS del ])
ECLAMPSIA (ver: EMBARAZO ECLAMPSIA)
ECZEMA (ver: PIEL ECZEMA)
EDEMA
El edema esunhinchazncausadoporunaretencindeagua.Causaun
abotargamientoyesmuyfrecuenteenlostobillosylospies.Puedeencontrarse
tambinenotrasarticulacionesotejidosconjuntivos.Loslquidosenelcuerpo
representan mis emociones, puede que retenga o reprima mis sentimientos
interiores.Tambinpuedonegarmisimpulsososentirlimitacionesybarreraspara
concosasquedeseo,quemetraendesnimoydisgusto.Tambinpuedequequiera
reteneraalguienoaalgo,obiendemipasadoodelpresenteymeagarroaloello
123

comoaunsalvavidas.Sino,mevoyaahogarenmipena,enmidecepcin,enmi
amargurafrentealosacontecimientos.Lafuncindelapartedelcuerpoafectada
poreledemaaadeotrasinformaciones.Alniveldepiernasypies,puedovivirun
muygrandeseodeirenunadireccindiferente,peromesientoemocionalmente
cogido en la direccin en la cual voy y me siento incapaz de afirmarme y de
liberarmedeella.Cuandoseformaeledemadespusdeungolpe,unaheridaoque
unapartedemicuerpointentareconstituirse,estosellamaeledemadecuracin.
En ciertos casos, mi cuerpo trae entonces este lquido como para disminuir la
friccin y ayudar al entorno inmediato de la parte afectada a reconstituirse. El
edematraelanecesidaddereconocerydescubrirlaexpresindemisemociones
embotelladasyencerradas.Aprendotambinasoltarparapermitirmeadelantary
realizarcambiospositivosenmivida.
EGOCENTRISMO
Cuando soy egocntrico, tengo tendencia a relacionar todo lo que me rodea
conmigo.Meconsideroentoncescomoelcentrodelmundo.Aladiferenciadela
personaegosta,podrpensarenlosdemsyayudarlessiestoesconformeami
propiointers.Sivivodeestemodo,esquenecesitoequilibrarmiinseguridad
interiorparaimpedirmevivirsumisin.Debotomarconscienciaquemsallde
m, hay los dems. Conservando el lugar que me pertenece en la vida, puedo
considerarelpuntodevistadelosdems.
EMBARAZO (dolores del) (ver tambin: PARTO, SANGRE
DIABETES)
Sibienelembarazosueleseralegreyenriquecedor,tambinpuedeprovocar
temor por sus inquietudes secretas, sus dudas, sus miedos y sus angustias,
especialmentecuandoeslaprimeravez.Estossentimientosnoexpresadoshallarn
una manera de salir si, como futura madre, no soy capaz de expresarles
verbalmente.Avecespuedotenerlasensacindequelosretosporaceptarsontan
grandesconrelacinaloquesoycapazdetomarqueinconscientementepuedo
rechazaralnio.Heaqualgunosejemplosdedolenciasquepuedavivirduranteel
embarazo:ardoresdeestmagomeindicanunadificultadentragarlarealidadde
loquesucede;el estreimientorevelamimiedoasoltar,queintentoguardarlas
cosascomosonahoraaunquesepaquelallegadadeunnioconllevacambios
mayoresenmivida;un nerviociticodoloroso manifiestamimiedoairhaca
delante,enlanuevadireccinquemetraelavida,unadiabetesgestacionalesla
consecuenciadelatristezaquevivoduranteesteperodo.Tambinpuedequeest
descontenta,quetengamiedodevivirrechazoalvercmocambiamicuerpoyque
deseequeceseelhechodeestargordaoembarazada.Aprendoatenerconfianza
yacepto quetengotodoslosinstrumentosnecesarios parapoder viviresta
maravillosaexperienciaenlaalegraylaarmona.
124

EMBARAZO53 (prolongado)
Cuando se prolonga un embarazo ms all del perodo habitual, como
madre, puede que desee inconscientemente seguir llevando a este hijo lo ms
tiempoposible,apreciandoesteestadoenquesientoamihijoenseguridadyenel
cualelvnculoentremadreehijoestanfuerte.Quieroguardarloprotegidodela
intemperie de la vida de cada da. Puede que tenga miedo de estas
responsabilidades nuevas que me esperan con este nuevo hijo que va a nacer.
Estaralaalturadelasituacin?Estocambiaralgoenmividadepareja?Ser
buenamadre?Misinquietudesdecaraaestenacimientopuedenhacermeretrasarla
llegadadelhijo.Puedetambinquemihijosesientatanbieneneste entorno
tranquilizadorquequieraquedarseenleltiempomximoposible.Entoncespuedo
entrarencontactoconsuaspectodivino,confortarlo,asegurarlequehartodolo
quemeesposiblehacerparacuidarmedel,queseguiramndoleyquetengo
prisadetenerleenmisbrazos.Debodesapegarmedemihijoyconvencermedeque
tiene todos los instrumentos necesarios para afrontar los retos que encuentre.
Necesitanicamentemiamoryafecto.
EMBARAZO ECLAMPSIA (ver tambin: CEREBRO EPILEPSIA,
TENSION ARTERIA HIPERTENSIN [demasiado alta])
Alfinaldel embarazo,puedeocurriruna eclampsia queesunaafeccin
gravecaracterizadaporconvulsionesasociadasaunahipertensinarterial.Suele
producirseenlamujerquevivesuprimer embarazo.Essimilaraunacrisisde
epilepsia, caracterizndose por una prdida de consciencia, una rigidez de los
miembrosseguidadeconvulsiones.Laeclampsiamealcanzasisoyunamujerque,
por inseguridad o culpabilidad, rechaza el embarazo o todo lo que puede
representarlallegadadelhijo.Tambinpuedovivirrencorparaconmicnyuge
porquelohagoculpableyresponsabledelembarazo.Enotroscasos,puedoseryo
quien,comomadrequealtenerdificultadenaceptardarinminentementealuz
a mi hijo, voy a rechazarme, sintindome incapaz de asumir mis nuevas
responsabilidades.Aprendoamirarlallegadademihijoconunaactitudpositiva
sabiendoquetengotodolonecesarioparaayudarleacaminar.
EMBARAZO ECTOPICO O EXTRA UTERINO (G.E.U.)
Un embarazoectpico sedesarrollaafueradelacavidaduterina.Eneste
caso,puedequecomomadre,vivaunaangustiafrentealpartoyquemeinhibade
procrear.Deboaprenderadejarfluirelprocesonormaldelavidayadejarquela
energacirculelibrementeenelinteriordemparaqueloselementosdelavida
tomenellugarquelespertenecesegnelplanodivino.

53

Elembarazoduraaproximadamente9mesesosea273dasapartirdelafechadefecundacin.

125

EMBARAZO NERVIOSO.
Puedo vivir en mi cuerpo fsico los mismos estados que una persona
embarazadainclusosinoloestoy;estosellamaentoncesembarazonervioso.Un
embarazonervioso manifiestaunaincertidumbre,unainseguridaddecaraamis
responsabilidadesfrenteamisdeseos.Puedequedeseetenerunhijoperonossi
mesientoalaaltura,si tengolasensacin depoder asumirycubrir todaslas
necesidadesdelnio.QuizsnoSielembarazonerviososemanifiestaenuna
mujersoltera,tambindeboconsiderarsivivodificultadesparaconmisexualidad.
Quizstengaelgustodetenerunhijo,peronotengoelgustodetenerunarelacin
afectiva con otra persona. Tambin puedo tener miedo de todas las
responsabilidadesqueimplicaelhechodeteneruncnyugeapesardequedesee
teneruno.Aunqueel embarazonervioso semanifiestasobretodoenlamujer,
puedesucederqueestefenmenoseproduzcaenunhombre.Puedopreguntarme
cmoestopuedeser.Deboacordarmeque,seayohombreomujer,poseoambas
facetasenmiinterior,elladoYIN(mujer)yelladoYANG(hombre).Aunquesea
unhombre,puedodesarrollarmiinstintomaternoyciertosmiedosqueleestn
vinculadosyas,desarrollarlossntomasdeunembarazonerviosoporempatao
simbiosis energtica. Compruebo entonces cules son los temores que vive
actualmentemihijointerior.Aspodrtranquilizarlo,darleelamorylaatencin
quenecesitaparaquetodovuelvaalorden.
EMBOLIA (ver: SANGRE CIRCULACIN SANGUNEA)
EMOTIVIDAD
La emotividad o ms bien la hiperemotividad, hace que todas mis
emocionesestnaflordepiel.Unnadametrastorna.Cuandoestoyenesteestado,
mesientoparalizado,mivistaseturbaeinclusopuedollegaraperderelequilibrio.
Vivo inseguridad, miedo y ansiedad y tengo tendencia en dramatizarlo todo.
Tambintengotendenciaaestarmenosenlaaccin,amenosderealizartareas,
realizar muy pocos proyectos porque me paraliza el miedo. Me vuelvo
emocionalmente y fsicamente frgil. Entonces tengo el reflejo de aislarme del
mundopara protegerme.Lossntomas fsicos vinculadosala hiperemotividad
son:aceleracindelritmocardaco,gargantaapretada,digestindifcil(hastatener
lceras de estmago), estreimiento, diarrea y rigideces musculares. Teniendo
miedodelodesconocido,voypuesatomarcostumbresparadisminuirlaangustia
vinculadaaestedesconocido.Dedondevieneestaagitacin?Puedeserelresultado
deuntraumatismo(afectivoomaterial)etc.Aceptovolveratomarelcontacto
conmipropiaesencia,considerarmiemotividadcomounmododecomunicacin
conlosdems.Lameditacin,larelajacinocualquiertcnicaquemellevea
calmarmepuedeayudarmeavolveratomarcontactoconmiserinterioryavolver
a equilibrar mis emociones. De este modo, vuelvo a descubrir mis verdaderas
126

necesidadesyaprendoahacermeconfianzaporquesquetodomevienedemodo
perfectoparamievolucin.
EMPIEMA (ver: ABSCESO)
ENCEFALITIS (ver: CEREBRO ENCEFALITIS)
ENCEFALOMIELITIS FIBROMIALGICA (ver: CANSANCIO CRNICO
[sndrome de ])
ENCAS (dolores de )
Lasencassirvendesoportealosdientes,alasolidezdestosysuestado
depende mucho del estado de las encas. Un dolor en las encas puede estar
vinculadoo bien auna decisin que hubiese tenidoque tomar hace ya mucho
tiempoyqueaplazoamstarde,teniendomiedodelasconsecuenciasqueesta
decisinpuedetenerenmivida;obiensetratadeunadecisinqueyahetomado
pero que no ejecuto. Estoy en un estado pasivo de miedo, inseguridad,
incertidumbre frente a mi porvenir. Si, adems sangran mis encas, tengo una
prdidadealegraconrelacinaestasdecisionesfrentealascualesmesiento
estirado, atormentado. Unas encas sensibles manifiestan mi gran sensibilidad
emocionalymivulnerabilidadporquenecesitomuchoamorytengolasensacin
denorecibirloobientengomiedodeperderlo.Necesitoafirmarmeytenerms
confianzaenmporquelasencassoportanlosdientesyquestasserefierenalas
decisiones. Aprendo a hacerme confianza en las decisiones que tomo y hago
confianzatambinalavidaquemetraetodoloquenecesito.Asmevuelvoms
yomismoyaprendoaafirmarmelibremente.
ENCAS GINGIVITIS AGUDA
Unainfeccinenlasencasindicaquevivomiedo;estopuedeserdecaraa
mmismoparaconunadecisinquetomeyquemesabemalhabertomadoouna
decisintomadaquevuelvoaplantear;oinclusopuedetratarsedemiindecisin(a
tomar una decisin). Este miedo tambin puede referirse a otra persona (por
ejemplo,mijefeomicnyuge)cuyasdecisionespuedenafectarmedirectamentey
frente a las cuales no tengo control ninguno. Vivo frustracin y disgusto, esto
pudiendollevaraconfrontacionesquequizssonintiles.Aprendoacanalizareste
miedo,aexpresarloparaevitarquemis encas seinflamen.La gingivitis suele
implicarunahemorragiaenlaencaquemeindicaunatristezaounaprdidade
alegraporelhechodenosercapazdeexpresarme,bienporquenomelopermiten
obienporqueyomismomeimpidodecirciertascosas:puedotenerlasensacin
dequeloquedigonotieneimportanciayquenosemeescuchar.Comoquelas
encassonlasbasesenquedescansanmisdientes,puedovivirtambinira,tristeza,
127

teniendola sensacin de quemis bases se caen y medejan unsentimiento de


impotenciafrentealosacontecimientosdelavidaofrentealosdems.Puedo
tomarunmomentodesilencioconmigomismopararehacermisfuerzas.Tomo
conscienciadequecadasucesodemividaestaquparahacermecreceryquetodo
cambioimportanteesnecesarioparaquepuedaalcanzarlosobjetivosquemehe
fijado.
ENCAS (hemorragias de las ) (ver tambin: SANGRE
HEMORRAGIAS
Las encasquesangrandemuestranunainseguridad,unadudafrenteauna
decisinquetomarenmivida.Estoyacertadoendudarosentirpesar?Tomola
responsabilidad y acepto los cambios que se producen enmi vidaen total
serenidad.Mehagoconfianzaporquesquelaseleccionesquehagoestnaqu
parahacermecrecerms,parapermitirmeproseguirmievolucin.
ENDOMETRIOSIS
Laendometriosiseslaformacindefragmentosdemucosasenelexterior
delapareduterina.Sevinculaconelrechazoinconscientedelamaternidad.Me
hacentemermisaspiracionesymividadeparejaqueunniolocambietodoenmi
vida?Dudodemiscapacidadesdeserunabuenamadre.Tambinpuedesuceder
quenoacepteelmundoenelcualvivo.Sinoaceptoestemundo,cmo
puedotraeralmundoaotroser?Sinembargo,inclusoantesdenacer,elegvenira
estemundo.Tomoconscienciadelarelacinentremistemores,misdudas,mi
incertidumbreylasituacinquevivoyacepto expresarabiertamenteloque
siento.
ENFERMEDAD(ES)
Cuandoestafectadalasaluddeunservivo,hacefrentealaenfermedad.
Sin embargo, la enfermedad implica una causa, sntomas, signos clnicos, una
evolucin,untratamiento.Esunsignoquememandamicuerpoparainformarme
de un conflicto o de un traumatismo que vivo para conmigo y/o mi entorno.
Descifrarelmensajemeayudararecobrarlasaludmsrpidamente.
ENFERMEDAD DE BECHTEREWS (ANCYLOSING, SPONDILITIS)
La enfermedad de Bechterews es el resultado de una rigidez y de una
carenciadeflexibilidadenmimododepensar.Pongomiegodelado,tomandoste
demasiado sitio. Debo aceptar, en cuanto al amor, ser ms flexible (conmigo
mismo),hacerconfianzaenlassituacionesdelavida.

128

ENFERMEDAD DE CROHN (ver: INTESTINOS CROHN [enfermedad


de])
ENFERMEDAD DE DUPUYTREN (ver: MANOS DESVIACIN DE
DUPUYTREN)
ENFERMEDADES DE LA INFANCIA (ver tambin: ENFERMEDAD EN EL
NIO, PAPERAS)
La rubola, el sarampin, las viruelas, la tos ferina, las paperas, la
escarlatina,lavaricela,enbrevetodaslas enfermedadespropiasalainfancia
suelen coincidir con perodos de evolucin del nio. Estas enfermedades
frecuentementesucedendurantelasdificultadesescolaresocuandoviveelnioun
conflictoconlospadresycuandoestansiosofrenteaunasituacin.Puedeserun
tiempodereposoqueexigeelcuerpo.Dandoalnioternura,amor,atencin,esto
lepermitirfortalecerseparaadelantarenlavidaconmsconfianza.
ENFERMEDAD EN EL NIO (ver tambin: ENFERMEDADES DE LA
INFANCIA)
Demodogeneral,serefiereadolenciaso enfermedades descritaseneste
diccionario.As,sisoyestenioqueviveundolenciaouna enfermedad,hay
probabilidaddequelaexpresindelaenfermedadmanifiesteladolenciainterior
deunoodeotrodemispadres.Puedequemispadresnodesarrollenninguna
enfermedad pero mi gran sensibilidad me conecta a la realidad interior de mis
padres. Entonces, estoy en resonancia con el nio interior de mis padres. La
enfermedadquetengoactualmentesloponeenevidencialatomadeconsciencia
quetengoquehacertambin.Mispadresnosonculpablesdeloquevivo.
ENFERMEDAD DE FRIEDRIECH (ver: ATAXIA DE FRIEDRIECH)
ENFERMEDAD DE HANSEN (ver: LEPRA)
ENFERMEDADES HEREDITARIAS
En el sentido mdico del trmino, las enfermedades hereditarias se
transmitenporlosgenesprocedentesdeclulasreproductorasdeunoodeambos
padres. De hecho, si quiero hablar de herencia, se trata en general de los
pensamientos,emocionesoconflictosinterioresdelospadresoabuelosqueno
fueronarreglados.Porejemplo,sidigoqueladiabeteseshereditariaenmifamilia
porquemiabueloeradiabtico,mipadreeradiabtico yquesoydiabtico,es
sobretodoporquemiabuelovivaunatristezaprofunda(latristezaprofundaesla
causametafsicadeladiabetes)quemipadrevivaunatristezaprofundayqueyo,
129

vivo tristeza profunda. Entonces, en vez de pensar que mi enfermedad es


hereditariayquenopuedocambiarnada,podrempezarabuscarcmocambiar
mispensamientos,misemocionesoresolverelconflictointeriorquemelleva
vivirestaenfermedad.Guardandoenmentequelaenfermedaddebefavoreceruna
toma de consciencia personal, s sin embargo que la razn metafsica de mi
enfermedadenloqueamispensamientosymisemocionesserefiere,sevuelvea
hallarenunouotrodemispadresoenambos,aunqueellosnoforzosamentehayan
desarrolladolaenfermedad.
ENFERMEDADES INCURABLES
Incurable significaquenopuedecurarseporningntipodemedicina.
Debo preguntarme si me conviene esto de tener una enfermedad llamada
incurable.Dequpuedeservirme?Deboyofiarmedeunaetiquetaincurable
quesignificaqueyanohaynadaquehacerpararemediarlo?Debointeriorizarme
paraencontrarlacausaprofundadeestemal:elmiedo,laira,loscelospueden
sersucausa.Deboaceptarqueelamorfluyelibrementeenm,porquesloel
amorpuedecurarlotodo.
ENFERMEDADES KRMICAS
Vengo en la tierra para proseguir una evolucin. Tengo experiencias por
haceryvivirparallegaraunatransformacininterior.Sillegoalmundoconuna
lisiadura,esquehaycosasquenofueronresueltasenotrasvidas(paralosque
creenenello).Tomarconscienciadeelloyaceptarvivirlaexperienciasonlos
primerospasoshaciaunacuracin,tantofsicacomoemocional.Enesemomento,
todoesposible,porquelatransformacininteriorllevaalacuracinfsica.
ENFERMEDAD DE PARKINSON
[enfermedad de])

(ver: CEREBRO PARKINSON

ENFERMEDAD PSICOSOMTICA
Lapalabrapsicosomticaindicalarelacinquepuedehaberentrelamente
(psico) y el cuerpo (soma); Originalmente, se pensaba que la mente tena una
influenciaenelcuerpoe,inversamente,queelcuerpotenaunainfluenciasobrela
mente.Sinembargo,estainfluenciaqueseatribuyealcuerposobreelespritupoco
a poco fue archivada, de modo que el trmino psicosomtico, en el lenguaje
mdico,significasobretodolarelacindelamenteconelcuerpo.Adems,cuando
medicenquemi enfermedad es psicosomtica,esunpococomosituvierauna
enfermedadimaginariayqueestosloocurrieraenmicabeza.Desdeelpuntode
vistametafsico,todaslasenfermedadestienensuorigenmsalldelofsicoypor
130

lotanto,podradecirquetodasson psicosomticas.Debotratarmicuerpo con


todomisaber,utilizandoelconocimientodelosprofesionalesdelasalud,yala
vez buscando la causa real que hizo que se manifestara la dolencia o la
enfermedad.Elsubconscientetieneunpoderenormederegeneracindelostejidos
olacapacidaddeproducirefectosfsicossegnlainterpretacinquehace.Heaqu
algunos ejemplos. Se encuentra a una persona muerta en el departamento
frigorficodeuntren,yellasehabaencerradoallaccidentalmente.Laautopsia
revel que la persona haba muerto helada, cuando el sistema de refrigeracin
estaba parado, lo que ignoraba probablemente la vctima. Las personas andan
descalzassobrebrasasynodesarrollanniquemadurasniampollasdeaguaenlos
pies,elsubconscientenohabiendoregistradoningnpeligroporsugestin,etc.
TODAS LAS ENFERMEDADES APARECEN DESPUS DE UN
CONFLICTO,DEUNIMPACTOEMOCIONAL,DEUNTRAUMATISMO
CONSCIENTE O INCONSCIENTE. El cerebro activa entonces un
mecanismo de supervivencia biolgica segn el conflicto o el traumatismo
vivido.Luego,setratadedescifrarelmensajeparamodificarelprogramaque
elcerebromandapararestablecerlasalud. Alsaberesto,debosinembargo
seguircuidandomicuerpofsicoparatraersteaunestadorepresentandomejorla
salud.
ENFISEMA PULMONAR (ver: PULMONES ENFISEMA PULMONAR)
ENFRIADO
Elenfriadoseproducecuandomimentalsevuelvergido.Mesientocuestionado
yamenazado.El enfriado medalaexcusaparaestarsolo.Tomoconscienciade
quemevuelvorgidofrentealosacontecimientosdemivida.Culeslaraznpor
lacualmesientoamenazado?Comprueboloquecausestatensin(personao
acontecimiento)ycomprendoquesonmismiedos,mistemoresyminecesidadde
complaceralosdems.Necesitosentirmeamadoyapreciado.Aceptosoltary
nojuzgarme.Actoconmsflexibilidaddecaraam;losdemsslosonelreflejo
demmismo.Enlavida,todoloquemellegaestaquparaaprendermea
superarmeyhacermecrecer.
ENSIMISMAMIENTO
El ensimismamiento puedeserunamaravillosamaneradepararme,tomar
tiempo para m, descubrir mis necesidades. Tambin esto puede llamarse
introspeccin.Sinembargo,siesteperodoseprolongayqueenvezdeserun
momento de crecimiento o de conocimiento de s, se vuelve una ocasin de
cerrarmealmundo,deremoverideasnegativas,compadecermedemidestinoy
jugaralavctima,corroelriesgodevivirunprofundomalestar,tantopsicolgico
131

como fsico. Me quedo abierto frente al Universo mientras me respeto en mis


necesidadesafndevivirenlaalegraylaarmona.
ENURESIA (ver: INCONTINENCIA)
ENVEJECIMIENTO (dolores del)
Al envejecer, sucede que mi cuerpo pierda su flexibilidad. Ando ms
difcilmente,midestrezasedeteriora.Ququieredecirmemicuerpo?Esprobable
quesientapesarporloselementosdemipasado,quecreaqueyanotengomilugar
enestemundo,queestiempoparamdepararme.Creotambinquelavidaera
mejorantes.Rehusoverlasbellascosasdehoy.Mispensamientosestnorientados
haca el ayer y critico el presente. Esta rigidez en mi modo de pensar est
transmitidaatodomiser.Aceptoabrirmealoscambiosypiensoquetengoan
poraprenderydar.As,miestadomejoracadadams.
ENVENENAMIENTO (, por el alimento)
Elenvenenamientoointoxicacinseproducecuandounasustanciatxica
seintroduceenmicuerpo:sigueunconjuntodetrastornosfsicos.Cuandohay
envenenamiento,debomirarquinoquesloqueenvenenamiexistencia.No
estantoelalimentocomolanaturalezademispropiospensamientos.Porcierto,
todas las personas que han cogido el mismo alimento no padecern de
envenenamiento.Tomoconscienciadelasituacinodelapersonaquememolesta
aestepunto.Buscohacaquinoquestoyatradoyculessonlospensamientos
envenenadosqueentretengofrenteaestapersonaoaestasituacin.Quesloque
envenena mi existencia? Qu debo comprender de esta situacin? Acepto
traerlaasumssencillaexpresinylaresumoenunapalabra:pena,frustracin,
celos,etc.Yaquetodoloquenoaceptovuelveenmividayesto,cadavezms
fuertehastaqueloacepte,tengointersenabrirmeaquyahorayaaceptar
conmicoraznestasituacin.Entonces,comprendoqueestapersonaoesta
situacinestaquparaayudarmeasuperarmeyadelantar.
EPICONDILITIS (ver: CODOS EPICONDILITIS)
EPIDEMIA
Una epidemia es la propagacin de una enfermedad contagiosa. Lo ms
frecuentemente,serefiereaunaenfermedadinfecciosa.Puedeserfcilparam
pensarquesicontraigolaenfermedadalmismotiempoquevariasotraspersonas,
noesacausadelasemocionesquevivosinoporquelaepidemianoseolvidade
nadie.Dehecho,ladiferenciaentreelhechoquecontraigolaenfermedad,sloo
conotros,essencillamenteporquesomosvariosviviendosituacionessimilares.Del
132

mismomodo,puedovivirinseguridadpersonalycolectivareferentealapoltica,la
economa,elentorno,igualcomopuedovivirunairapersonaligualcomootras
personas.Lanaturalezadelaenfermedadmeindicarelaspectodemividadelcual
hedetomarconsciencia.Asvuelvoadarelamoralapartemaqueloreclama
paraencontrarmspazyarmonaenmivida.
EPILEPSIA (ver: CEREBRO EPILEPSIA)
EPISTAXIS (ver: NARIZ [hemorragias de ])
EQUIMOSIS (ver: PIEL MORADOS)
ERUCTACIN o ERUCTAR (ver tambin: ESTMAGO)
La eructacin es la emisin ruidosa por la boca de gas procedente del
estmago. Aunque, en nuestras costumbres, esto se considere como muy poco
educado,losorientalesvenenellolasealdeaprecioyagradecimientoporuna
buenacomida.Laeructacinestvinculadaconmivoluntaddeirdemasiadode
prisa.Deestemodo,tambinevitoenfrentarmeconmismiedos.Latensinsube
porelhechodetenerquedigerirnuevasideasysientolanecesidaddeliberarmede
estatensin.Aprendoairmsdespacioyatomarmeeltiemponecesarioparamis
comidas.Tomoconscienciaquealirdemasiadodeprisa,pasoalladodemilcosas
bellasquehacenlavidaagradable.Aceptotomareltiempodevivir,yanovoy
escasodealientoparaelritmoaceleradodelavidaymesientomejor.
ERUPCIN (de granos) (ver: PIEL ERUPCIN [de granos])
ESCARLATINA (ver: ENFERMEDADES DE LA INFANCIA)
ESCLERODERMIA (ver: PIEL ESCLERODERMIA)
ESCLEROSIS (ver tambin: INFLAMACIN, SISTEMA INMUNITARIO)
Laesclerosisesunainflamacinqueendureceeltejidoconjuntivo,elcuales
necesarioypresenteenelcuerpoentero.Unapersonaafectadadeesclerosistiene
su sistema inmunitario atacado, porque hay deterioro del tejido conjuntivo. Es
importantetomarconscienciadequesiestoyafectadoporestaenfermedad,me
atacoammismo,locualpuedehacerquelaesclerosisseextiendaalamayora
demisrganos.Estainflamacinprovocaunaespeciedeenergaardientequehace
brotarlarabialargotiemporeprimida.Endurecindoselostejidos,estosugiereel
endurecimientodemispensamientos,actitudes,creandoasundesequilibrioenel
planoenergtico.Todomicuerpoocualquieradesuspartespuedeestarafectada
133

por la esclerosis. Es pues importante tomar consciencia de lo que vivo


interiormente.Cerrndomealamor,estopuedeindicarquemesientoindignode
esteamor,quemesientoculpableyquetengovergenzadevivir.Acepto
abrirmealamor,reconozcomivalordivino,losoytodo,lopuedotodo.
ESCLEROSIS EN PLACAS
La esclerosisenplacas sedefinecomounainflamacindelasenvolturas
querodeanlasvasnerviosasdelcerebroydelamdulaespinal.Todoelcuerpo
estafectadoyesteestadosepuededarendiferentesmomentosdelavida.Es
comosimicuerpoestuvieracogidoenunatrampa,colocadoenunajaulaycada
vezmslimitadoenelencadenamientodesusmovimientos.Siestoyafectadode
esclerosisenplacas,generalmenteestoyafectadoporgrandessufrimientosqueme
hacenverlavidacondesanimo.Unaprofundarebelinanimatodomiser.Me
sientoobligadoadeberhacerlotodopormmismo.Siendomuyperfeccionista,
rehsoequivocarmeyaceptodifcilmenteayuda.Elpensamientodelfracasome
aterroriza.Temoestarolvidado,estarplacadoah.Tengomuchomiedoqueme
abandonen.Tambinpuedequetengamiedodecaerme,tantoensentidopropio
comofigurado,ytemerqueestacadacauselamuerte.Todosestosmiedosque
implicanundesplazamientoverticalyquepuedenllevarmeacreerquemividaest
en peligro, pueden activar la esclerosis en placas. Puede ser la cada de una
escalera,elriesgodecaerenunprecipicio,laprdidaabruptadealtitudenun
avin,algoquemecaesobrelacabeza,etc.Muyamenudo,mejuzgoopuedo
juzgar a los dems muy severamente, lo cual conlleva un gran sentimiento de
desprecio, desvalorizacin y disminucin de mi persona. Cuando me siento
disminuido,tengolasensacindequemeaplastalavida.As,esprimeropormis
piernasquemanifestarlaenfermedadsusprimerossignosyquepodrtenerla
sensacindeaplastar.Midefensacontratodosestosmiedosquemehabitanser
querercontrolarlotodo,quererquetodosucedacomoquiero.La crtica,que
frecuentemente se dirige haca m, envenena mi vida. Creo que el sufrimiento
formapartedemisuertedetodoslosdasyquenomemerezcoeldescanso.Mis
esfuerzosparasuperarmesonconstantesy,apesardetodo,siempreinsuficientes.
Micuerpocansadorehsaasproseguirestaluchadelmsfuerteyquierehacerme
comprenderquepuedetambintenernecesidaddelosdemsyquedeboaprendera
tener confianza. La inflamacin implica una rabia ardiente y muy emocional,
pudiendo afectar toda mi existencia. Puedo preguntarme: deseo realmente ser
libre?Inconscientemente,puedequedeestemodomeestoyvengandodealguien
quenomehabamanifestadobastanteamor!Estaformadejaula,enlacualsehalla
micuerpo,meprotegequizsdedeberadmitirmisautnticossentimientos!La
represinemocionalpuedellevarmeaunaincapacidaddeirhacadelanteenmis
emociones,conllevandoasunaconfusinmuscularymental.Micuerpomedice
desoltar,liberarmedemiscadenas.Laclavesehallaenelinteriormo.Acepto
hacerconfianzaamiguainterioryreconozcoencadacuallapresenciadeeste
134

gua,quellevaacadapersonaaactuarlomejorquesabe.Entoncesmanifestar
msflexibilidadycomprensin.
ESCOLIOSIS
(ver:
ESCOLIOSIS)

COLUMNA

VERTEBRAL

[desviacin]

ESCRPULO
El escrpulo se halla en una persona que vive preocupacin frente a su
consciencia.Tenerdolordelalmaoquemarselasangre.Elijovivirenarmona,
aceptodigerirlasnuevasideas,recuperomientusiasmo.
ESGUINCE (ver ARTICULACIONES TORCEDURA)
ESFAGO (el)
El esfago eselpasoparalosalimentosparaquestosestndigeridos.Si
tengoemocionesoideasquepasanmal,el esfago secrispayelpasoesms
difcil,pudiendoinclusoprovocarirritacin,stamanifestandomiirritacininterior
frenteaalgooaalguienquemecuestatolerar.Misaprensiones,miangustia,mi
pena harn que se contraiga mi esfago, pudiendo ir incluso hasta obstruir
totalmenteelpaso.Alserelesfagoelpasoentremibocaquerepresentalaentrada
denuevasideasymiestmago,lasideasquedebodigerir,sisientounafuerteirau
odio para algo en mi vida que no pasa, puede que desarrolle un cncer del
esfago.Debosoltarcualquieramargurayvercadaexperienciademividacomo
unaocasindecrecerparaquemenutranlasalegrasdelavida.
ESPALDA (en general)
Laespaldarepresentaelsostnyelsoportedelavida.Esellugarqueme
protege si me siento impotente frente a una persona o una situacin (doy la
espalda)encasodenecesidad.Simipesoesexcesivo,sicarezcoderespaldoosi
no me siento bastante respaldado (afectivamente, monetariamente, etc.), mi
espalda reaccionar en consecuencia y ciertos dolores (agujetas) pueden
manifestarse.Puedotenerlaespaldaanchaysercapazderecibirobieninclinarme
humildemente,inclinarmeporrespetooaceptacin.Pocoimportaelmotivo,un
dolordeespaldaindicaquequieroquizssalvarmedealgocolocndolodetrsmo,
porqueesconmiespaldaqueolvidolasexperienciasquemecausaronconfusino
pena.Pongotodoloquenodeseoverodejarveralosdems,jugandoasala
avestruz. Estoy profundamente herido, incapaz actualmente de expresar estas
emocionesbloqueadas.Rechazoverloquemeconviene!Aceptoliberarahora
lasenergasretenidasenloslugaresque meduelen!Unaespaldaflexiblepero
fuerteindicaciertaflexibilidadmentalyunagranaperturamentalcontrariamentea
lasrigidecesdorsalesquesignificanorgullo,poderynegacinaceder.Sentado
135

biencmodamente,puedotenerlasensacindeestarprotegido,entotalseguridad.
Sinembargo,auncuandomiespaldasirvaparasoportarestascosasindeseablesy
jugaralaavestruz,aceptoverloquememolestayexpresarlo.Actuandode
estemodo,meliberodelpesoquellevaba.La postura adoptadadaindicaciones
sobreloquevivoysobremimododetransigirconlassituacionesdemivida:si
estoyenreaccinfrentealaautoridad,siquierotenerraznfrenteaalguieno
frenteaalgo,voyatensarlaespaldapororgullo.Si,alcontrario,vivosumisin,
sitengomiedo,simesientodbil,voyacurvarlaespaldaycuantasmsgrandes
seanmispreocupaciones,msmedolerla espalda.Ciertaspersonasintegran
mslasdificultadesdelavidaenlaescritura,eldilogooelintercambio.Elijoel
medioquemejormeconvieneydejoquelavidafluyaenm paraaprendera
expresarme ms y afirmarme cuando lo necesito. Acepto que la vida me
sostengaencadainstanteylevantoloshombros,sabiendoquetengolafuerza
necesariapararealizartodosmisproyectos.
ESPALDA (dolores de) PARTE SUPERIOR DE LA ESPALDA (7
vrtebras cervicales)
La partesuperiordelaespalda correspondealaregindelcoraznyal
centroenergticocardaco.Losdoloresdeespaldaserefierenalosprimerasfases
delaconcepcin,alasnecesidadesdebaseyalaestructuramsfundamentaldel
ser.Las7vrtebrascervicalesestnparticularmentereferidasenestesector.Las
vrtebrascervicalesserefierenalacomunicacinyamigradodeaperturafrentea
lavida.Miingenuidadpuedehacermevulnerableaestenivel.Sitengolasensacin
quesemequierejuzgar,criticarmeoherirme,podrestarafectadoenesteplanoy
tendrtendenciaaencerrarmecomounaostra.LascervicalesC1,C2,yC3estn
particularmente afectadas si me desvalorizo al nivel de mis capacidades
intelectualesylascervicalesinferioresreaccionarnalainjusticiaquepuedotener
lasensacindevivirenmividaoalaqueveoalrededormoyquemerepugna.
Adems,cadavrtebramedalasinformacionesadicionalessobrelafuentedemi
malestar.
C1=primeravrtebracervical quesellamael ATLAS yquellevaelnmero
C1,sirvedesoportealacabeza.EsunpilarquemantienelacabezaenequilibrioSi
mepreocupodemasiado(=merompolacabeza)frenteaunasituacinoauna
persona,micabezasehacemspesadahastadarmedoloresdecabezayC1podr
tenerdificultadensoportarlacarga.Simanifiestoestrechezmental,sirehusomirar
todas las facetas de una situacin, si soy rgido en mi modo de pensar, C1
reaccionardejandosusactividades,dejandodepoderpivotar.Estarparalizada
pormimiedo,midesesperacinfrentealavida,minegatividad,midificultaden
expresar mis emociones. Un mal estado de C1 se acompaa generalmente de
doloresqueafectanlacabeza,elcerebroyelsistemanervioso,etc.Deboaprender
aescucharmiinterior,aguardarmimenteabierta,atraermscalmaenmivida
136

paradisminuirmiactividadcerebral,permitindomeasverlarealidadbajounda
nuevo,conmsconfianza.
C2=LasegundavrtebracervicaltrabajaenestrechacolaboracinconC1.Sela
llama AXIS.Eselpivotequepermitea C1 moverse. C2 estconectadaconlos
principalesrganosdelossentidos,esdecirlosojos,lanariz,lasorejas,laboca
(lengua).Porestoestarnafectadosstoscuando C2 tengaunmalestar.Sisoy
rgidoenmimododepercibirlavida,sirehusosoltarmisviejasideasparadejar
sitioalonuevo,simepreocuposiempreporeldasiguiente, C2 correelgran
riesgodevolversetambinrgida.Frecuentemente,mislgrimassonsecasporque
reprimomisemociones yquemispenas,misdecepciones, mispesares quedan
hundidosdentromo.Ellubricante(mislgrimasdepenaodealegra)siendo
carente, C1 no se articular sobre C2 tan fcilmente. Habr irritacin,
calentamiento,igualcomoenmividacotidiana.Estoseproduceparticularmenteen
el caso de la depresin, de una emotividad excesiva (si por ejemplo, hay un
conflictofamiliar),deira,derevueltaytodoestosiendogeneralmentecausadopor
el miedo de ir haca delante, de cambiar, de tomar sus responsabilidades; del
enjuiciamientodelosdemsydesmismo,porlanoestimadesquepuede
llevaraundeseodeautodestruccin(suicidio).Deboaprenderatomarcontacto
conmisemocionesyaasumirlas,atomarmilugarexpresandoloquevivoparaque
el flujo de energa empiece a circular en mi cuerpo y que C2 pueda volver a
funcionarenarmonaconC1yquetodobaeenaceite!
C3 = la Tercera vrtebra cervical C3 es una eterna solitaria. A causa de su
posicin,nopuedocontarconnadieotrabajarencooperacinconotrasvrtebras.
SimiC3noseencuentrabien,yotambinpuedotenerlasensacindequedebo
despabilarmesolo.Tambinpuedoreplegarmesobremmismo,vivirenmi
burbujayevitartodaformadecomunicacin(tantooralcomosexual)conmi
entorno.Paraquperdermitiempo?Detodosmodos,nuncasemehacecasoy
nuncaseentiendenmisideasomisestadosde nimo!Entoncesseproducela
rebelin,eldesanimo,porquemisensibilidadestafectadaenlomshondodem.
Inclusopuedeapoderarsedemlaangustia.Eldesgastedeltiempohacesulabory
missueosymisdeseosmsqueridossedesvanecen pocoapoco.Mevuelvo
irritable, amargo con una persona o una situacin que no consigo digerir. La
soledadpuedetantoserbenficapararecuperarme,hacerbalance,verclaroenmi
vida,comopuedeserunmediodehuirmisemociones,larealidadhacalacual
vivo mucha incomprensin. La eleccin me incumbe! Tomo nota de que una
dolenciaen C3 puedeconllevardaosenmirostro(piel,huesosonervios)as
comoenlasorejasylosdientes.
C4,C5,C6=lasvrtebrascuarta,quintaysextacervicalesC4,C5,C6 se
ubicanalniveldelatiroidesyestnenestrecharelacinconsta.stajuegaun
papelmayorenellenguaje,lavoz,(cuerdasvocales)ycualquierdesarmonaenlo
queacomunicacinserefieretantocuandomeexpresoyocomocuandootras
137

personasmecomunicanharquereaccionenC4,C5yC6.Puedequemehaya
ofuscado con lo que haya odo, causando indignacin e ira. C4, C5 y C6
reaccionananmsfuertesiademsnoexpresomisopiniones,misfrustraciones.
Miporcentajedeagresividadcorreelriesgodeincrementarse,locualcierralos
canalesdecomunicacinalniveldeestas3 vrtebrascervicales. Tragomal lo
queamsemepresenta.Tengotendenciaarumiarciertosacontecimientosparaun
largoperododetiempo.Frecuentementeaparecendolenciasydoloresqueafectan
todomisistemadecomunicacinverbal:boca,lengua,cuerdasvocales,faringe,
etc.ytodaslaspartesdemicuerpoquesesitanentreelniveldemibocaydemis
hombrospuedenestarafectadas.Tengoventajaenaceptarquecadaexperiencia
esunaoportunidaddecreceryquehayunaleccinporsacardetodo.Debodejar
fluirenvezdeobstinarmeydeestarenfadadoconlavida.Sino,micabezasepone
ahervirymesientosobrecargadoportodaslastareasquerealizaryqueme
parecenopoderllegararealizar.Necesitoexpresarme,obienporlapalabra,la
escritura, la msica, la pintura, o cualquier otra forma de expresin que me
permitirvolvermeaconectarconmicreatividad,mibellezainterior.Todosmis
sentidos entonces estarn estimulados, activados, lo cual activar mi tiroides y
permitirque C4,C5yC6 funcionennormalmente.Losdoloressentidosenesta
reginpodrnasdesaparecer.
C7,laltimavrtebracervicalC7estinfluenciadaaltamenteportodomilado
moral,miscreenciasymiladoespiritualtambin.Sivivoenarmonaconlasleyes
delanaturaleza,siescucholosmensajesquemicuerpomemandaylavidaen
general, C7 vaafuncionarmejor.Alcontrario,sivivoira,siestoycerradoalas
opinionesyalosmodosdeverdelaspersonasconquienesmerelaciono,sime
elevoymeenfrentoconotrasideologasdiferentesdelamasinunamenteabierta,
C7reaccionarfuertementeypodrafectarmismanos,codosybrazosquepodrn
inflamarseotenerdificultadesenmoverse.Elfuncionamientodemitiroidesestar
afectado. Del mismo modo, remordimientos de consciencia con relacin a una
palabradicha,unactohechoounpensamientomandadohacaunapersonatambin
vanaafectarC7.Sivivoemocionesintensasenmivida,siestoydecepcionado,si
tengomiedodeestarrechazado,simeescondodebajodemiconchaparaevitar
estarheridootravez,C7podrestarafectada.Deboaprenderadiscernirloque
esbuenoparamyloquenoloes.Deborespetarlospuntosdevistadecada
personainclusosisondiferentesdelosmos.Abriendomisbrazosalosdemses
comovoyaaprendermejorypodrrealizarmejorlaseleccionesquemepermitirn
sentirmemslibre.
ESPALDA (dolores de ) PARTE CENTRAL DE LA ESPALDA (12
vrtebras dorsales)
Lapartecentraldelaespaldarepresentalagranregintorcicadelcuerpo
comprendida entre el corazn y las vrtebras lumbares. Es una regin de
138

culpabilidad emocional y afectiva. Las 12 vrtebras dorsales 54se relacionan


principalmenteconestaregin:
D1=laprimeravrtebradorsalD1 puedereaccionarfuertementecuandovoy
hastamislmitesbienseaenmitrabajo,bienseaeneldeporte,ensuma,entodas
las situaciones en que voy hasta el final de mis fuerzas mentales, fsicas o
emocionales.Noapreciatampocoundopajequeseabajoformadealcoholode
droga, la que sea. Su sensibilidad en ese momento estar a flor de piel. Me
construyoentoncesmediosdeautoproteccinparaprotegermedemientornoy
evitarestarherido.Estopuedemanifestarsesobretodoenmisgestosoenmis
palabras:porejemplo,tiendoaapartaralosdemspormifrialdadoporpalabras
hirientes.Estopuedeinclusomanifestarseporunatomadepesoimportante,ste
siendomi proteccinnatural yfsica, porquequieroinconscientemente ocupar
mssitioydejarmenosalosdems.Tambinestopuedeescondertimidezactual
yconlacualtengodificultadparatransigir.Sepondranmsenevidenciasi
temoperderelamordelagente.Debovigilaryevitaracurrucarmesobrem
mismorumiandonegatividadconstantemente,siendosiemprefijadoenlasmismas
ideasyfrustraciones.UnmalestadodeD1puedetraerdolenciasencualquierparte
demicuerposituadaentremiscodosylapuntademisdedosascomodificultades
respiratorias(tos,asma,etc.)
D2 = la segunda vrtebra dorsal D2 reaccionar fcilmente cuando mi
emotividad est afectada. Si cumulo y ahogo mis emociones, entonces D2 me
mandarunmensajeyaparecereldolorde espalda.Sitengolasensacinde
quenotengomilugarenlavidayenlasociedad,quelavidaesinjustayqueme
siento vctima de los acontecimientos, D2 estar afectada. Puedo ser
particularmentesensibleatodoloquetocaamifamilia,yvivosituaciones de
conflicto o desarmona de un modo intenso. Puedo haber almacenado viejos
rencores.Tambinpuedoremoverconstantementeexperienciaspasadas,recuerdos,
queriendofijarmirealidadenacontecimientospasadosenvezdemirarelporvenir
conconfianzayviviendointensamenteelmomentopresente.Puedo contemplar
una nueva situacin que me trae un miedo a lo desconocido. Voy a tener
demasiadasresponsabilidades?Voyaestarsostenidoodeberdespabilarmesolo?
Cmo van a reaccionar la gente alrededor mo? Si dudo de m, de mis
capacidades,podrreaccionarjugandoelpapeldelosdurosderoervolvindome
muyautoritario;tendraslasensacindecontrolarlasituacin,sabiendomuy
bienquetiemblodemiedo,yendoinclusohastatenerangustia.Tambinpuedo
volverme irritable frente a una persona o un suceso y reacciono por saltos de
humor.UnaD2enmalestadosueleestaracompaadademalestarydoloresenel
coraznylosrganosquesevinculanaellos,ascomoalospulmones.Aprendoa
pedir y a hacer confianza en mi capacidad de aceptar nuevos retos. Suelto mi
54

Vrtebrasdorsales:elmododeidentificarcadaunadeellasesporlaletraDquedesignadorsalseguidadel
nmerosecuencialdelavrtebra.OtromodotambinesusarlaletraTparadesignarlasvrtebrastorcicas,yeslo
mismo.

139

pasadoymegirohacaelfuturosabiendoqueahorasoycapazdetomarmilugar
enarmonaconmientorno.Puedotambinleerlaseccinreferentealcoraznpara
tenerotraspistas.
D3 = la tercera vrtebra dorsal D3 est esencialmente relacionada con los
pulmonesyelpecho.Puedoiraconsultarloreferenteaestosdostemasparaver
culessonlascausasquepuedenafectarlesytendrunapistaparasaberporquD3
memandatambinmensajes.Adems,todoloquepuedopercibirpormissentidos
yquenomeconvienedeltodoharreaccionarD3.Yaquesoymuysensibleami
entorno,meheconfeccionadounsistemaconelcualsloqueestbienyloque
estmal,loqueesaceptableono.Puedoestarfijadoyrgidoenmimodode
pensaroverlascosas.Tengotendenciaajuzgarcualquierpersonaosituacinque
noentreenmidefinicindecorrecto.Puedoreaccionarfuertementefrentealo
que considero ser una injusticia. Incluso puedo volverme colrico, incluso
violentomientrasnoestdeacuerdoconloqueveo,percibouoigo. Tambin
puedo construirme un escenario en mi cabeza, disfrazando la realidad,
frecuentementeacausademimiedoaverlarealidaddefrenteytambinporquela
realidadquemerodeamedeprime.Entonces,tengomenosgustodevivir,yano
tengoelsentimientodeestarenseguridad.Puedeinvadirmelatristeza.Yanotengo
elgustodeluchar.Ladepresinsevaapoderandodemprogresivamente,yquerr
cortarme de este mundo que slo me trae pena, frustracin, ansiedad. Debo
aprenderaverlavidabajounnuevoda.Aceptar quenopuedavivirenun
mundoperfectoperoquecualquiersituacinesperfectaporquecadasituacinme
permitesacarunaleccin.
D4=lacuartavrtebradorsalD4 serefierealosplaceres,alosdeseos,alas
tentacionesfrecuentementeinsatisfechos.Avecesmisesperassondesmesuradas,
careceninclusoderealismoymevuelvoirritable,colricoporquemisdeseosno
estnrealizados.Estoyenfadadoconlavida,mientorno.Enelfondodem,siento
unvacotangrande,generalmenteafectivo,quetengotendenciasdepresivasyel
nicomodoqueconozcadeequilibraresteestadodeserytraeralgopicanteen
mividasercrearunestadodeexcitacin,bienseanaturalmenteoartificialmente.
Puedopracticardeportesdeemocionesfuertes(paracaidismo,alpinismo,etc.)o
puedotomardrogasparaponermeenunestadodextasisydebienestartemporal.
Merefugioasenunmundoimaginario,protegidodetodos.Sinembargo,noestoy
alalberguedelasemocionesqueheinhibidoydelascualesheintentadoescapar.
Enaparienciapuedosermuylibre,peroenrealidad,estoyencarceladoenmiira,
mispenas,misfrustraciones,ypormimiedoaestarasfixiadoporelamordelos
dems,porquenuncasupereconocerloyaceptarlo.Entonces,tengotendenciaa
rechazaralosdems.Meopongo,memantengodistanteyalimentoestacunetacon
mimalhumor,miactituddepresiva.Esimportantequereconozcayqueacepte
mis emociones para poder integrarlas y permitirme vivir plenamente mi vida.
Cuando D4 est afectada, tambin puede seguir una dificultad con la vescula
biliar.
140

D5=laquintavrtebradorsalD5esttocadacuandomevuelvoaencontraren
unasituacinenquetengolasensacindeperderelcontrol.Mesientoentonces
desestabilizado.Inclusopuedohallarmeenunestadodepnico.Estoseproduceen
particular en el plano afectivo con relacin a mi cnyuge, un miembro de mi
familia,unamigocercano,etc.Estecontrolseescondeavecesbajounaapariencia
dequererayudaraalguien,guiarlo,ayudarleensusdificultades,peroenel
fondo de m, ejerzo un control para con esta persona, estando en posicin de
fuerzainclusoinconscientemente.Silascosasnosucedencomolodeseo,puedo
volverme frustrado, crtico, impaciente e incluso colrico, y D5 reaccionar
violentamente.Quierodarmeunaimagendeduroderoerquetienelaespalda
anchayqueescapazdecargar.Pero,enelfondo,squemecargodemasiado
loshombros,locualmellevaaestarinseguro,angustiado,enrebelincontrami
entornoquehagoresponsabledemimalestar.Tengograndesambiciones,locual
mehaceavecesapartarmedemisvaloresprofundosyactuarencontradiccincon
stas.Entonces,meechoenrelacionesartificialesconlagente,viviendodecepcin
tras decepcin, porque el amor verdadero, sencillo, noes bastante presente. Es
importantequeestalaescuchademiinterior,quetomecontactoconmiesencia,
conmisverdaderosvaloresparaquevuelvalacalmaenmividayqueveaclaroen
losacontecimientos,desarrollndomeysiendocapazdevivirelamorverdadero.Se
debe observar que el mal estado de D5 frecuentemente est acompaado de
diversosmalestaresafectandomihgadoymicirculacinsangunea.
D6=lasextavrtebradorsalD6,vaareaccionarcuandomecriticoyqueme
juzgoseveramente.Puedohaberestadoeducadoenunentornomuyestrictoenel
cuallosvaloresylaslneasdeconductadebanseguirsealpiedelaletra.Habiendo
crecido en este clima autoritario y no permisivo, ahora puedo tener casos de
conscienciaenloscualesquisieradarmegusto,cogertiempoparamperojuzgo
queestonoescorrectoyquenomelomerezco.Mecreopreocupaciones
intilmenteporquenodejodeanalizarcadaunodemisgestos,cadaunademis
palabras,cadaunodemispensamientos,paraestarsegurodequeestoycorrecto.
Mecorroelaculpabilidadpordentro.Laangustiaestmuypresenteymeauto
castigo cortndome del mundo. Tengo dificultad en aceptarme . Me siento
vctimadelavida,impotentefrentealosacontecimientos.Juzgoseveramentestos
sin querer aceptar que estn aqu para hacerme crecer, pero vindoles
preferentementecomocastigos, injusticias.Vivoentoncesenlafrustracinyla
incomprensin,elresentimiento,envidiosoycelosodelosdems.PorestounaD6
en mal estado se suele acompaar de malestar al nivel del estmago. Tengo
necesidaddeestarmsflexibleypermisivoparaconmigoyaprendoaverpositivo
encadaacontecimiento,sabiendoquecadaexperienciamellevaaconocermems
yavolvermemejor.
D7=lasptimavrtebradorsalD7esunatrabajadoradetrabajosforzados.Sien
mivida,meempujoallmiteenlascosasquedebohacer,sinescucharmicuerpo
141

cuandonecesitadescansarorelajarse,D7vaaecharungritodesocorro.Esposible
queasquieraolvidarohuiraalguienounasituacincualquiera.Puedequequiera
olvidarmisproblemasfinancieros,afectivos,etc.Parndome,esmuyposibleque
afloren el desnimo y la insatisfaccin frente a mi vida, cosa que no quiero.
Acumulomuchairayagresividad:todorugeadentromoporquelavidanotiene
nadabuenoparaofrecerme.Meobstino,inclusomebloqueosobreciertasideas
quemeobsesionan.Deboaprenderaapreciarloquetengoyloquesoyyvertoda
laabundanciaqueespresenteenmivida.Tengoelderechodetomartiempopara
m,tengoelderechodeviviremocionesenvezdedejarlasherviradentromo.Me
concedoelderechodevivirmipena,midecepcin,mismiedosporqueesascomo
podraceptarlosycambiarlosenpositivo.Puedohacermilimpiezainteriora
medida y dejar que D7 funcione normalmente. Es as como los males que
acompaanfrecuentementeuna D7 enmalestadoyquetocanfrecuentementeel
pncreasyelduodenopodrntambinirse.
D8yD9=lasoctavaynovenavrtebradorsalD8&D9quehalloalaalturadel
diafragmayqueestnestrechamentevinculadas,separecenentodo.Poresto,se
tratanjuntas.Seafectanprincipalmentecuandovivoinseguridaddebidoaunmiedo
quetengodeperderelcontrolenunasituacinoconunapersona.Mesientoms
segurodemcuandodirijoperfectamentetodoslosaspectosdemivida,cuando
orquesto perfectamente cualquier situacin para saber exactamente qu debo
esperar.Meescondoenmi burbujadecristal, sinhacermepreguntasnihacer
esfuerzosparacambiarloqueseaenmivida.Vivotodasmisemocionespara
dentro. Pero este supuesto equilibrio est trastornado, D8 y D9 asustadas
reaccionan fuertemente, acurrucndose de miedo. La desesperacin puede tener
lugarytengoelmaldevivir.Tengodificultadenverlaluzalfinaldeltnel.Puedo
sentirdesprecioporlavidaymedirijohacaunabismoqueslopuedovencer
haciendo confianza en la vida y dejando ir el control que ejerzo. Porque es
soltandocuandoganoeldominiodemivida.Tomonotaqueuna D8 lastimada
puedeacompaarsededoloresdeldiafragmayelbazo(incluyendolostrastornos
delasangre)mientrasqueD9enmalestadoestaracompaadadealergiaodeun
malfuncionamientodelasglndulassuprarrenalesodeurticaria.
D10= Cuando ladcimavrtebradorsalD10 estafectada,estosuelereflejar
unaprofundainseguridadfrentealacualmesientosinarmas,sinrecursos.Mi
confianzaestensunivelmsbajoynecesitounpequeotnicoparaayudarme
adarmemsvaloryaolvidarmispreocupaciones.Frecuentemente,estopuedeser
unconsumomsgrandedealcoholodedrogaquedecostumbrequemedarun
pequeo estmulo. Sin embargo, cuando vuelvo a mi estado normal, las
inseguridadesanestnpresentesymividaseoscureceporquesloveoellado
negativodelascosas.Loveotodoennegro,rechazandolavida,compadecindome
demimismo.Estoypreocupadoporpequeecesymeenfadosinsercapazde
manifestarlosinembargo,locualafectamisensibilidadquevuelveaflordepiely
que hace que me irrito por futilidades. Una D10 en mal estado se acompaa
142

frecuentementededoloresenlosriones,reconocidoscomolasededelmiedo.
Aprendoahacermeconfianzayaprendoaverlabellezaalrededormoylaque
existedentromo.Tengoelvalordepedirayuda.
D11 = las anomalas en la onceava vrtebra dorsal D11 se hallan tambin
cuandomisistemanerviosotienedificultadenfuncionar.Migransensibilidada
todoslosniveleshacequeD11sedesformeporquetambindesformolarealidad
parasufrirmenos.Lacambioavoluntadparaqueseacomoquiero.Mecorto
voluntariamentedemientorno.Peroestoslopuededurarciertotiempoydebo
prontootardeenfrentarlarealidad.Enesemomento,unatensininteriorsehabr
instalado, y tendr dificultad en transigir con ella. Esto puede volverse tan
insoportable que incluso puedo tener ideas de suicidio ya que vivo en la
incomprensin y que tengo miedo del porvenir porque me siento impotente en
cambiarlascosasenmivida.Meconsiderovctima,heridoenmissentimientos.
Rumiolonegativoyhagopocosesfuerzosparasacarmedeestasituacin.Debo
aprenderamovermeeirhacadelanteenvezdeestancarmeenunestadodeser
comatosoycomplacermeenlapasividad.LasdolenciasenlaD11seacompaan
frecuentemente de dolores en los riones as como de enfermedades de piel
(eczema,acn,etc.)Empiezoacreertambinqueesposiblecambiarcosasenmi
vidaperoquedeboestarlistoparainvertiresfuerzosypedirayuda.
D12=ladoceavavrtebradorsalD12estafectadasobretodocuandovivoenun
lugarcerrado.Tengotendenciaacriticar,juzgar,saltarfcilmenteaconclusiones,
no porque haya comprobado sino solamente porque mis observaciones pueden
darmefalsasimpresionesyquelasinterpretoamimodo.Estomellevaavivir
muchairaquemeroeinteriormente.Mimentalesmuyactivo.Misensibilidad
estaflordepiel.Meconstruyocastillosdearena. Meinventotodotipode
escenarios. Ya que tengo dificultad en transigir con mi entorno, vivo mucha
inseguridad.Puedoentretenerideasmrbidas,yaincapazdeabsorberloqueseade
loqueveo,sientooperciboyenvidiandoloquetienenlosdems.Unaafeccinen
elniveldelaD12seacompaafrecuentementedemalesintestinales,doloresenlas
articulaciones,unacirculacinlinfticadeficienteyasavecesafeccionesenlas
trompas de Falopio. Aprendo a comunicar, a ir a comprobar con las personas
relacionadasparaeliminarladudaylainseguridadquemehabitan.Asveoms
claroenmividayseestablecenenmlacalma.
Tantoesasquelosdoloresen mediodelaespalda sonlasealclaradeuna
relacindifcilconlavidaylassituacionesdemiexistencia.Estaregindela
espalda correspondetambinalmovimientodeexteriorizacindelaenergade
vivirquefluyeporm.Estosignificaqueenperododemadurezinterior(cuando
adquieroexperiencia),variascualidadesdivinastalescomolaconfianza,elamor,
el desapego (es decir el libre albedro) sobre todo en el plano afectivo) estn
puestasaprueba.Mis doloresdeespalda einclusola espaldacurvada pueden
significardiversascosas: culpabilidadenunassituacionesenque nomehede
143

sentirculpable,amarguraounadbilconfianzaenmvinculadaaunavidaque
siento muy pesada por llevar. Puedo tener la sensacin de que estn siempre
pegadosamiespalda.Sitengodolordeespalda,estodenotaungransentimiento
de impotencia, frente a una situacin presente difcil de tratar y en la cual
necesitaraayuda.Ladesesperacinpuedeaparecerporquenomesientobastante
apoyadoenelplanoafectivoypadezcotambininseguridad.Tengotendenciaa
retenermisemocionesyvivomuchoenelpasado.Mequedovinculadoadicho
pasado. Me siento inestable y ansioso. El objetivo por alcanzar reside en una
expresin ms activa de la energa divina. Necesito ser transparente en todo,
conmigomismoylosdems,dejandodetransportarsentimientosdeunpasado
cojoparadarpasoaunaquyabajotranquiloysereno.Necesitoayudaynimo,
conectarme con mi ser interior que vela sin cesar sobre m. Mi cuerpo me da
sealesimportantes.Nohayvergenzaningunaenpedirayuda.Alcontrario,esun
signo de inteligencia ya que esta ayuda me permite ir haca delante. Veo
importancia en mi propia identidad y soy prudente con mi ego y mis miedos.
Aprendoacomunicarconmiserinteriorporlameditacinylacontemplacin;con
lhallarmuchassolucionesyrespuestas.Estarconectadoconmiserinterior,es
elegirvivirmejorlassituacionesdelavida.
ESPALDA (dolores de) PARTE INFERIOR DE LA ESPALDA.
Frecuentementeconfundidaconlosrionesycomnmenteasociadaal dolorde
riones,estareasesitaentrelacinturayelcoxis.Esunapartedelsistemade
sostenimiento.Doloresenestareginmanifiestanlapresenciade inseguridades
materiales(trabajo,dinero,bienes)yafectivas.Tengomiedodecarecerde!
Nunca lo conseguir!, Nunca conseguir realizar esto! expresan bien los
sentimientosinterioresvividos.Estoytan preocupado portodolomaterialque
sientotristezaporquehayunvacoyestevacomeduele.Inclusopuedofundarmi
valor personal en el nmero de bienes materiales que poseo. Vivo una gran
dualidad,porquedeseotenertantolacalidadcomolacantidad,tantoenloque
arelacionesinterpersonalesserefierecomoaloqueposeo.Tengotendenciaa
tomar demasiadas cosas sobre mis hombros y tengo tendencia a dispersar mis
energas.Intentohacerlotodoparaseramadoymeentretengoconlaopininque
tienendemlosdems. Tambinpuedetratarsedeunainquietudfrenteaunau
otraspersonas.Estoypreocupadoporellasyquizstengotendenciaencogerlos
problemasdelosdemssobrelaespaldayquerersalvarlos.Miimpotenciafrente
aciertassituacionesdemividamevuelveamargoyrehusosometerme,perotengo
miedo. Este sentimiento de impotencia que puede llevarme hasta la rebelin,
podrconducirmeaunlumbagooundolordecintura.Nomesientosostenido
enmisnecesidadesdebaseymisnecesidadesafectivas.Tengodificultadenhacer
frentealoscambiosyalanovedadquesepresentanamporquemegustasentirme
enseguridadenmirutinaymisviejascostumbres.Estorevelafrecuentementeque
144

soyinflexibleyrgidoyquequisierasersostenidoamimodo.Siaceptoque
losdemspuedanayudarmeasumodo,voyadescubrirytomarconscienciadeque
tengoelapoyoquenecesito.Asmevuelvomsautnomoyresponsable.Sise
tratadeunpinzamientodelosdiscoslumbares,pongoprobablementedemasiado
presinsobremmismoenhacercosasparaquemeamen.Yaqueserevela
necesariounperododereposo,aprovechoparamirarloqueestsucediendoenmi
vida y volver a definir mis prioridades. Al no sentirme sostenido, me vuelvo
rgido(tieso)hacalosdems.Tiendoaculparalosdemsdemisdificultades?
Metomoeltiempodeexpresarmisnecesidades?Aceptoquemenicosostn
vienedemmismo.Volviendoatomarcontactoconmiserinterior,establezcoun
equilibrioenmisnecesidadesyrenotodaslasfuerzasdeluniversoqueestnen
m.Estasfuerzasmedanconfianzaenmyenlavidaporquesquemetraentodo
loquenecesito:fsico,emotivo,espiritual.Estoysostenidoentodomomento!Las5
vrtebraslumbaressesitanenestarea.
L1=laprimeravrtebralumbarL1estafectadacuandovivounsentimientode
impotenciafrenteaalguienoaalgoquenomeconvieneyquetengolasensacin
denopodercambiar,quehedesoportar.Entonces,mevuelvoinerte,sinvida,
gastomuchaenergaconcosasfrecuentementemenoresperolasaumentotantoque
tomanentoncesproporcionescatastrficas,locualpuedeinclusohaceraparecerun
sentimientodedesesperacin.Puedovivirinseguridadfrenteaaspectosdemivida,
perono tiene realmente razn de ser. Quiero controlarlo todo, peroesto no es
humanamenteposible.Puedotambinvivirconflictosinterioresentreloquequiero
hacery quenomepermito.Estohacesubirenmfrustracin,agresividadeira.
Estossentimientosendurecenmicoraznsinomeliberoyamarganmivida.Una
vrtebraL1enmalestadopuedetraerenfermedadesrelacionadasconlasfunciones
de digestin (intestino y coln) o eliminacin (estreimiento, disentera, etc.).
Tomoconscienciadelpoderquetengoparacambiarelcursodemivida,yslola
ma!Vuelvoaestablecermisprioridadesparacanalizarbienmisenergas.
L2 = El estado de la segunda vrtebra lumbar L2 depende mucho de mi
flexibilidad frente a m mismo y a los dems. La soledad y la amargura
generalmente causadas por una timidez pronunciada son tambin factores
importantesquepuedenafectarL2.Soypresodemisemociones:alnosabercomo
vivirlasyexpresarlas,yalserstasavecesvivasyexplosivas,pongomscaras
paraprotegermeyevitarquesepuedaverloquesucedeenmiinterior.Mimalestar
puede hacerse tan grande que quiero adormecer mi mal con bebida, drogas,
trabajo,etc.yL2harentoncesunallamadadesocorro.Tengotendenciaaverlas
cosasennegativoyavivirenunestadodepresivoqueveomuypocoporqueestoy
enunpapeldevctimaquenomeobligaapasaralaaccinoacambiarcosasen
mivida.Igualcomo L1,unsentimientodeimpotenciaytambinmuchatristeza
afectarn L2.Soybastanteamargofrentealavidaporqueestarasupuestamente
disfrutandodelosplaceresdelavidapero,frecuentemente,nomeautorizoaelloa
145

causa de mis obligaciones o por deber, para mostrar el buen ejemplo. Debo
aprenderquenohedeserperfecto.Avecespuedosentirmeincapazoimpotente
frenteaunasituacin.Nohedeculparmeporellooestarenfadado;solohedeser
autntico conmigo mismo y los dems y expresar simplemente mis penas, mis
alegras,misdudas,misincomprensiones,misfrustracionesparaestarmsabierto
frentealosdemsyparaqueL2recuperevidatambin.Sedeberecalcarqueuna
vrtebra L2 enmalascondicionespuedeconllevarenfermedadesdelabdomen,la
apndiceolaspiernasendondepodraveraparecervarices.
L3 = la tercera vrtebra lumbar L3 se ve sobre todo afectada cuando vivo
situacionesfamiliarestensasotormentosas.Meimpidodecirohacercosasparano
herirynomolestaralosdems.Peroalhaceresto,mehagodaoammismo.
Juegoelpapeldebuenchicoobuenachicamanifestandounagranflexibilidad.
Peromevuelvobonachnlocualmecausafrustracin,sobretodosideboponer
misdeseosdelado.Yquizs,tambin,mepongadelado,particularmenteacausa
demigransensibilidad,sinsabermuchocomodichasemocionesestarnrecibidas.
Mevuelvoparalizado,inclusoimpotente,enmisemociones,enmicuerpo,en
mis pensamientos, lo cual impide que se manifieste mi creatividad y todo lo
vinculado a ella, en particular la comunicacin y la sexualidad que se quedan
rgidasyfrgidas.Parasuperareldesnimo,debotenderlosbrazoshacalos
demsyatrevermeaexpresarmisemocionesparaquemiplenopotencialcreativo
sedespierteysemanifieste.LamalacondicindeL3puedeconllevardolenciasen
losrganosgenitales,eneltero(enlamujer),enlavejigaoenlasrodillas,tales
comolaartritis,lainflamacinodolores.
L4=CuandolacuartavrtebralumbarL4serebela,esfrecuentementeporque
tengodificultadentransigirconlarealidaddetodoslosdas.Puedocomplacerme
enunmundoimaginarioyestopuedellevarmeavivirenlapasividad,estandoun
poco cansado de ver lo que ocurre alrededor mo. Se instala cierta dejadez.
Porqupreocuparsedetodosmodos?Sufrolosacontecimientosynoloscreo,lo
cual me puede dejar un sabor amargo. Igual como L4, necesito protegerme
cerrndomeporquepuedofcilmentedejarmedistraeroinfluenciarporloqueme
rodea,sobretodoporloquelagentepuedadecirdem,ymisensibilidadpuede
estar altamente afectada. Tambin me rompo la cabeza exageradamente y mi
discernimientoestaveceserrneoocarenteporquemimentalesmuyrgido,lo
cual me impide tener una visin global de una situacin y en consecuencia
soluciones o posibles vas frente a ella. Entonces quiero controlar en vez de
escucharmivozinterior.Deboaprenderaescucharstapararecuperareldominio
demivida.Recuperomipoderdecrearmivacomoquieroyrecuperoelgustode
realizargrandescosas!SedebeobservarqueunavrtebraL4enmalestadopuede
conllevardoloresenlaregindeminerviociticoydelaprstataenelhombre.

146

L5= Puedopreguntarmeloquesucedeenmividacuando laquintavrtebra


lumbarL5 estafectada.Tendraporcasualidadunaactituddedesprecioode
pereza frente a una persona o una situacin? Puedo vivir un poco de celos,
disgusto,frustracin,perosinembargoyatengomucho,lavidamehamimadoy
tengo dificultad en reconocerlo. Mi vida est teida de lujuria (en todos los
niveles) y debo aprender a apreciar lo que tengo, y a cultivar mis relaciones
interpersonales:tengodificultadsobretodoenelplanoafectivoaserautnticoya
sentirme bien porque en el fondo de m, vivo una gran inseguridad y tengo
dificultad en expresar lo que vivo. Por lo tanto, tendr tendencia a ser algo
depresivoyaquepasarfrecuentementedeuncnyugeaotrosinsaberdemasiado
porqu sucede esto, sintindome correcto dentro de lo que estoy viviendo.
Inventar toda clase de guiones y mi atencin siempre estar centrada en los
pequeosdetallesanodinos,locualmeimpediradelantar ypasar aotracosa.
Cierta amargura puede ensombrecer mi vida e impedirme disfrutar de sta.
Aprendoasaborearcadainstantequepasayaapreciartodalaabundanciaque
formapartedemivida.Unmalestadode L5 puedeocasionarmedoloresenlas
piernas,desdelasrodillashastalosdedosdelospies.
La parteinferiordelaespalda tambinformapartedelsistemadelcentrodel
movimiento.Sitengodificultadentransigirconlasociedad,tantodesdeelpunto
devistadelasorientacionesportomarcomodelsostnqueesperodeella,puedo
vivir frustracin o resentimiento. No quiero dealer con ciertas personas o
ciertassituaciones.Mis relacionespersonales conmientorno padecen deello.
Tambinpuedotenerdificultadenaceptar quevoysumandoaos.Mehago
viejoydeboamansarlentamentelanocindemortalidad.Finalmente,laparte
inferior de la espalda est muy estrechamente vinculada a los dos centros de
energainferiores,elcoxisyelsegundocentrodeenergaqueestvinculadoms
especficamentealasexualidad.Sivivoconflictosinterioresoexterioresparacon
sta,sihereprimidomienergasexual,puedemanifestarseundolordeespalda.
Las4vrtebrassagradasylas5vrtebrasdelcoxisestnrelacionadasconesta
regin.Cuandolas vrtebrassagradas estnafectadas,puedotenerlasensacin
dequenotengocolumnayquenecesitoaotrapersonaparasostenerme.Estoy
constantementeprobadoporlavidaparaverculesminiveldeintegridadyde
honradez.Tengounenormepotencialperoestoylistopararealizarlosesfuerzos
necesariosparacumplirmisobjetivos?Lasvrtebrasinferioressonlassiguientes:
S1,S2,S3= Yaquelas 3primeras vrtebrassagradas estnsoldadas
juntas, se tratarn juntas. Constituyen un todo. Reaccionan con la rigidez que
manifiesto, con mi estrechez mental en relacin a ciertas situaciones o ciertas
personas,amimentecerradaquerehusaorloquelosdemshandedecir.Quiero
tenerelcontrolparasentirmefuerteyenseguridady,silopierdo,voyaestar
147

enfadado,furiosoypuedotenerganasdepegarunapalizaaalguienporestartan
frustradoyllenodeamargura.Todosestossentimientosgeneralmentetienensu
origen en mis relaciones afectivas que no siempre van como lo deseo. La
comunicacintantoverbalcomosexual,esdeficiente,pornodecirinexistente,y
estoyconstantementevolviendoaplantearestetema.Tengolasensacindetener
quenadaracontracorrienteymesientoenuncallejnsinsalida.Tengointersen
parar unmomentoyverclaroenmivida,areflexionar sobreloquequieroy
edificarunabaseslida.
S4, S5 = Todos los deseos tienen su origen en las vrtebras sagradas
cuarta y quinta. Si soy capaz de administrarlas bien, si tomo el tiempo de
descansaryhacerlascosasquemegustan,S4yS5funcionarnbien.Sinembargo,
sivivoculpabilidad,tratndomedeperezosoyconfrontndomeamisdeberesymi
moralidad, juzgando mi conducta no correcta, S4 y S5 pueden reaccionar
fuertemente.Tengoelderechodehacercosasparamyavecesevadirmepero
deboevitarqueestosevuelvaunmediodehuida,evitandoquemeenfrentecon
misresponsabilidades. Enesemomento,laperezapuedenoestarbenfica:me
mantieneenunestadopasivodecansancioquemeimpideirhacadelante.Por
esto,encasosextremos,tambinestarnafectadosmispies.El nicomodode
curarelsacroquebradooroto,eslainmovilidadfsicayeltiempo.Elsacroest
vinculadoalsegundocentroenergticoquesesitaalniveldelaprimeravrtebra
lumbar.Undesequilibriodeestecentroenergticopuedeaparecerenlasdolencias
fsicas siguientes: referente a los rganos genitales, puede haber infertilidad,
frigidezoherpes;encuantoalosriones:cistitis,clculos;enloreferenteala
digestinylaeliminacin:incontinencia,diarrea,estreimiento,colitis,etc.Las
desviacionesdelacolumnavertebral(escoliosis)nacengeneralmenteaestenively
conllevan conellas dolores de espalda. Elsegundo chakra ocentro energtico,
influencia mis relaciones con mi entorno y un malfuncionamiento de ste, que
afecta mi sacro, ser el signo de mi estrs, mis angustias, mis miedos y mi
tendencia depresiva que debo aprender a administrar. En cuanto al coxis, est
vinculado al primer chakra, o centro de energa, sede de la supervivencia.
Representa el fundamento de mi sexualidad, la realizacin adecuada de mis
necesidades de base (sexualidad, alimento, proteccin, techo, amor55, etc.). El
coxis est formado de cinco vrtebras coxigianas que estn soldadas juntas.
Representa mi dependencia frente a la vida o a alguien ms. Hay muchas
probabilidadesdequemicuerpomedigaquetengoquepararmecuandomeduelo
elcoxis.Esmiinseguridadlaquesemanifiestaenrelacinconmisnecesidadesde
base,desupervivencia,enparticularelhechodeteneruntecho,alimento,vestidos,
etc. El alimento aqu se refiere a las necesidades fsicas como emocionales y
55

Amor:Elamoraqureferidoescomoelamordeunamadreparasuhijo.Cuandoestafectadomicoxis,puede
quevivaelmiedoaperderonotenercomomnimounamorsimilaralqueunhijoestenderechoesperardesu
madre.Setrataaqudeestetipodeamorynodeunarelacinamorosaentreadultos.

148

sexuales. Cualquier persona necesita amor en su vida. Tambin necesita


comunicacinmedianterelacionessexualesconunoosupareja.Estasnecesidades
generalmentesenieganyreprimen,sobretodoacausademisprincipiosmoralesy
religiosos,locualmellevaaestarinsatisfecha.Puedosentirmeentoncesimpotente
entodoslossentidosdeltrminoyhayunairaincubandodentromo.Quierohuir
cualquiersituacinquehacedaoamisensibilidadyfrentealacualpuedovivir
culpabilidad.Deboponermiorgullodelado,esdecirmismiedos.Deboconfiaren
lavidaysobretodohacerconfianzaenmicapacidadporexpresarmeyasumirme.
Cuandosientodificultadesvinculadasconesteaspectodemmismo,compruebo
interiormentehastaqupuntoestoy(quieroser)dependientedeunapersonaque,
conscientemente o no, satisface ciertas necesidades de mi vida. Soy capaz de
cumplirmispropiasacciones,deserautnomo.Esposiblequelaspersonasconlas
cuales me vinculo sean mucho ms dependientes afectivamente que yo y que
tengannecesidaddeestetipoderelacin.Acepto verhastaqupuntohago
muestradeindependenciayvigorenmivida.Debosoltarcualquiersentimientode
inquietud frente a mis necesidades de base y tomar consciencia ahora de las
fuerzasquemehabitanyafirmarquesoylapersonamejorcolocadaparagarantizar
mi propia supervivencia. Al estar vinculado el coxis con el primer chakra, un
desequilibrioalniveldeestecentrodeenergapuedeconllevardesordenesfsicos,
losmscorrientestocandoelanooelrecto(hemorroides,irritaciones),lavejiga
(trastornos urinarios, incontinencia), la prstata. Tambin se puede encontrar
doloresenlabasedelacolumnavertebral,unatomaoprdidadepesoconsiderable
(obesidad, anorexia) y una mala circulacin sangunea al nivel de las piernas
(flebitis),manosypies.Estosmalesmedanunaindicacinquetengonecesidadde
volveraequilibrarestecentrodeenerga.
ESPALDA FRACTURA DE LAS VRTEBRAS (ver tambin: HUESO
FRACTURA).
La fracturadeunavrtebra esgeneralmenteelresultadodeunarebelin
interior,unareaccindeinflexibilidadmentalvinculadaalaautoridad.Veolavida
con tal estrechez mental que me atraigo esta fractura. Mis pensamientos son
demasiado rgidos,rehuso doblarmeaciertas ideas nuevasque meapartandel
amoryquemeaportandolor.Soyintransigenteyfrecuentementemuyorgullosoy
tendraventajaendesarrollarmshumildad.Laespaldaesmisostnymisoporte;
el verla herida es incmodo. Acepto mis actitudes presentes sabiendo que
puedomodificarlasdesdeahora.Eshermosovivirlavidaconsuflujodecambiosy
esimportanterespetaresto.Memantengoabiertoalavidaporquesqueesbuena
param.Medejollevarporelflujodelavida.

149

ESPASMOS
Uno o varios msculos se contraen de modo involuntario y no rtmico;
entonces tengo un espasmo. Los espasmos forman como un nudo. Me crispo,
quieroretenerelamor,tengomiedodeperderaestapersonaaquienamotanto.
Estosespasmoscreanenmunsentimientodeinquietud,impotencia.Estenudode
dolor que no consigo controlar procede de una multitud de disgustos o cosas
irritantes que dan un sabor amargo a mi vida. Hace vivir en m emociones,
culpabilidadvinculadaamisexualidad.Reconozcoquelosnudosahoganyque,
paraconservarelamoralrededormo,aceptodesapegarme.
ESQUIZOFRENIA (ver: PSICOSIS ESQUIZOFRENIA)
ESTADO VEGETATIVO CRNICO
VEGETATIVO CRNICO)

(ver

CEREBRO

ESTADO

ESTERILIDAD
La esterilidad sedefinecomolainaptitudareproducirse.La esterilidad
puedeindicarunrechazo,unaresistenciainconscientealaideadetenerunhijo.
Tambin puede que desee un nio nicamente para colmar las esperas de las
personas que me rodean pero que, para mis adentros, no lo deseo realmente.
Teniendomiedodedaraluzodeserincapazdecumplirconmipapeldemadreo
padre(miedodelaresponsabilidad,problemasfinancieros)onodeseandohacer
viviramihijo,lossufrimientosqueviv,provocolaesterilidad.Puedoassentirel
temordevolveraviviratravsdemiembarazo,losrecuerdosdelosmomentosen
quemellevabamimadreyquepudieronafectarme.Debocomprenderqueeldeseo
detenerunhijopuedesermuygrandeperoelmiedotambin,queseaconscienteo
no;esladiferenciaquepuedepesarenlabalanzaparaqueelprocesodeembarazo
seactiveono.Deberacomprobarsipudevivirexperienciasenelpasado,quesea
hombreomujer,quepudieranhabermehechovivirciertosbloqueossexuales.Un
trabajoenpsicoterapiaoenergticopuedeestaradecuadoenestecaso.Tambin
puedesucederquenotengaquevivirestaexperienciadeserpadre.Porlotantoes
muyimportantequemepreguntesobrelanaturalezademideseodetenerunhijoy
quehagaconfianzaamiyointeriorenmidecisindedarlavidaono.
ESTMAGO (en general)
El estmago recibe el alimento y lo digiere para colmar las diferentes
necesidadesdemicuerpoenvitaminas,enprotenas,etc.Alimentomicerebrodel
mismomodoporlassituacionesylosacontecimientosdemivida.Cadaestmago
tienesupropiofuncionamiento.Pormsquelaformageneralsealamisma,la
digestinpuedeserdiferentedeunapersonaalaotra.As,laformademiestmago
estenrelacinconmipersonalidad.Miestmagoreflejaelmodoenqueabsorbo
150

eintegromirealidadymi capacidadendigerirlasnuevasideasolasnuevas
situaciones.Puedecompararseaunbarmetroindicandomigradodeaperturaymi
mododereaccionarenlavida.Losproblemasde estmago aparecencuandomi
realidad cotidiana est en conflicto con mis deseos y mis necesidades. Estos
conflictos se vuelven a encontrar habitualmente al nivel de mis relaciones
familiares,amicalesoalniveldemisrelacionesdetrabajo.
ESTMAGO (dolores de ) (ver tambin: ESTMAGO ARDORES DE
ESTMAGO)
Conozcoeltrabajoefectuadopormiestmagoysquerepresentamimodo
dedigerir,absorbereintegrarlosacontecimientosylassituacionesdemivida.
Losestironesenelestmagoestnvinculadosconfrecuenciaaunanecesidadde
amor,dealimentoemocionalydealimentos.Elalimentorepresentaelafecto,la
seguridad,elpremioylasupervivencia.Sivivounvacocualquieraenmivida,
querr colmarlo con el alimento, en particular en los momentos de separacin,
muerte, prdida o escasez de dinero. El alimento tambin puede ayudarme
artificialmentealiberarmedelastensionesmaterialesofinancieras.Sientocomo
unacarenciaindispensableparamisupervivencia.Lafermentacin,porsuparte,
procededelhechoquenoquieroenfrentarciertasemocionesquevivoconrelacin
apersonasosituaciones.Pongoestasemocionesdelado,perostassiempreson
presentes,seacumulan,fermentan,bajoelefectodemiactitudcida.Rumio
constantementeciertassituacionesquevivyquenodigiero.Porlotantotengo
tendencia a rumiar situaciones pasadas y a vivir las mismas actitudes y las
mismasemocionesnegativas.stasmequedanpuesenelestmago.Esmuydifcil
paramiestmagodigeriremocionesnovividas.Alestarmirealidadenconflicto
conmissueosymisnecesidades,estomellevaavivirdiversasemociones.No
expresomiscontrariedades,estoyirritado.La ira yla agresividad rugenenm,
perolasreprimo.Yaest!Lalceraylosardoresdeestmagoestnaqu.Tengo
grandesmiedos,midigestinsehacelaboriosaporquemiestmagoesnerviosoy
frgil. Culeslasituacindemividaquenodigiero?Vivograninquietud,
sobretododebidoamidbilconfianzaenm,locualhacedifcillaaceptacin
de mis emociones. Los dolores de estmago se producirn cuando vivo una
contrariedadenelcampodemisfinanzaspersonalesodemividaprofesional.
Ciertassituaciones sontanrepugnantesyasquerosas quemi estmago rechaza
digerirlas.Reaccionofrenteamirealidaddeunmodonegativoycidoypadezco
indigestionesynauseas.Ladigestinesmuylentasiel estmago esttensoy
rgido,evitandoquecambiosseproduzcanenmivida.Tomoconscienciaquedebo
revelar ms apertura en la vida y acepto que las situaciones y los
acontecimientos estn aqu para hacerme crecer. La aceptacin permite
transformarlosenexperienciasylapresinolatensindesaparece.
151

ESTMAGO (cncer del ) (ver: CNCER DEL ESTMAGO)


ESTMAGO ARDORES DE ESTMAGO.
Comoloindicasunombre,elardordeestmagoessealdequealgo,una
situacin, un suceso, una persona me quema, me acidifica, me enfurece. La
situacinmepareceirritante,injustayvivointeriormenteimpotencia.Cuandotal
situacinmesucede,puedopreguntarme:quesloquemequemaomepone
furioso?Quesloqueamnomegustayquenoconsigodigerir56?Tambines
muyposiblequemeengancheaestairadeunmodoinconsciente,porquetengo
miedodeafirmarme,desoltarmeyexpresarmisnecesidades,misdeseosymis
intencionesalniveldelcorazn.Soynicoentodoylosdemssondiferentesde
mentodo.Debopuesquedarmeabiertoyatentoamispropiasnecesidades y
aceptar la entera responsabilidad de mis actos, por ms que la gente sea
diferentedem.Elhechodevolverareprimir,inhibirunaemocin(ira,pena,
rabia)aumentalaacidezdelosgasesgstricosy,almismotiempo,meimpide
tragarcualquiercosa(porquelosardoresmanifiestanuntipodepresininternaen
elreadel estmago).Deboverelnexoentremisautnticossentimientosylos
ardores de estmago. Conservo la calma y observo mi modo de ser, mis
reacciones frente a las situaciones que vivo as como mi actitud frente a los
acontecimientoscotidianos.Centrandomiatencinenmiconviccinquelavidaes
buenayquemisnecesidadestodassecolmanenelmomentoadecuado,miestima
personalaumentaymisprximasclerassernmenosintensas.Tomoeltiempode
apreciarcadamomentodemividaymiestmagosellevamejor!
ESTMAGO GASTRITIS (ver tambin: INFLAMACIN)
Lagastritisesunainflamacinagudaocrnicadelamucosadelestmago,
lugardondeempiezaelprocesodedigestin.Sihayinflamacin,hayirritacine
ira frente a algo o a alguien a quien no digiero: ciertas cosas no pasan como
quisiera,opuedeserunaopersonasquenoactancomolodeseo.Puedotenerel
sentimiento de haber sido engaado y de estar cogido en una situacin. Estoy
irritadoporalgoqueabsorbimisistemadedigestinylarealidaddigeridame
molestaenaltogrado.Aprendoaaceptar lassituacionesyalosdemstales
comoson,sabiendoqueelnicopoderquetengoeselpodersobremmismo.
ESTORNUDOS
El estornudo estcausadoporlaexcitacinoelcosquilleodelasparedes
interiores de las ventanas de la nariz lo cual provoca la expulsin brusca y
simultanea de aire por la nariz y por la boca. Estornudar significa que algo o
56

Noconsigodigerir:Aqu,laexpresindebetomarseensentidofigurado.Podratratarsedeunapersonadequien
digo:Aestapersona,nolapuedodigerir.Estosignificaquenoaprecioaestapersona,estoyfuriosocontraella
poralgo,etc.

152

alguienmemolesta.Miroloqueestoyhaciendoyquienestconmigo.Queslo
que me indispone, la situacin o la persona? Estoy criticando a alguien o
criticndomeammismo?Inconscientemente,sientolanecesidaddeextirparme
deciertasituacin,apartarmedeunapersona.Quesloquequieroexpulsardemi
vida?Dequinodeququieroyodeshacerme?Identificolacausayacepto
tomarellugarquemecorrespondeyactuardemodoarestablecerlaarmona,bien
explicndomeconlapersonareferidaorectificandolasituacin.
ESTRABISMO (ver: OJOS ESTRABISMO)
ESTREIMIENTO (ver: INTESTINOS ESTREIMIENTO)
ESTRS
Cualquiersituacinquecreaunademandamsgrandeamiorganismome
llevaavivir estrs.El estrs puedeserpsicolgico(lapresindemientorno),
fsico(unafuertedemandaparamicuerpovinculadaaltrabajo,aldeporte,alcalor,
alfro,etc.)qumicoobioqumico(tomademedicamentos,quimioterapia,cambio
hormonal).Elestrsensesdehechomenosimportantequemireaccinfrentea
ste.Puedeserpositivo,estimulanteycreativotantocomoamenazadorparami
cuerpo. Segn mi reaccin frente a las situaciones, sucesos, sentimientos y
dificultades, elefectoestresanteserbenficoonocivoparam.Esimportante
constatar que incluso un acontecimiento feliz puede llevarme a vivir un estrs
importante.As,puedoganarunmillndedlaresalalotera,locualpuedetener
comoconsecuenciaelhacermevivirunadepresinporquetendrlasensacinde
tenertantascosasquecambiarenmividaquetendrmiedodenopoderhacerlo.
Voyaconservarmiempleojuntoalagentequeaprecio?Semantendrnmis
amigos como son en su trato conmigo? Deber mudarme? Ser capaz de
adaptarmeatodosestoscambios?Necesitomirarenmiinteriorypreguntarmemis
reacciones,mismotivosymisactitudesenvezdeecharlaculpaalassituaciones
exteriores.Aprendoarelajarmeyaconsiderarlosbeneficiosdelestrs.
EUTANASIA (ver tambin: MUERTE [la])
La eutanasia no es una enfermedad sino un acto por el cual queremos
ahorrarsufrimientosjuzgadosintolerablesparaunapersonaincurable.Puedeque
vivaunmalestarmoralsihededecidirparalaotrapersonasisedebeponerfina
susdas.Esimportantequemequedeconectadoconmiconviccinquelavida
existedespusdeloquesellamalamuerte,siestoformapartedemiscreencias.Si
noesel caso,puedopreguntarmesilapersonaqueestfrenteam realmente
manifiesta la vida. Tomo consciencia de que esto forma parte de una eleccin
individual.Puedoinformaramispersonascercanasverbalmenteoporescritodela
153

decisinquepodrantenerquetomarpormenelcasodequenoestconsciente
parapodertomartaldecisinenelfuturo.
EWING (sarcoma de ) (ver: HUESOS (cncer de los ] SARCOMA
DE EWING)
EXCESO DE APETITO (ver APETITO [exceso de])
EXCESO DE PESO (ver: PESO [exceso de])
EXHIBICIONISMO
El exhibicionismo se refiere a la exhibicin de rganos genitales. El
exhibicionismosevinculadirectamenteconlaeducacinquerecibyelmodoen
quevivomisexualidad.Enefecto,simeensearonquelasexualidaderabestial,
sucia y envilecedora, seguramente intent reprimirla y, si no lo hice, acto en
funcindeloqueaprend.Sientoaslanecesidaddeliberarmedeestacoaccinque
vivoparaconlasexualidad.Elhechodedarmeal exhibicionismoesparamun
mododerehusarmispropioslmitesparahacermeaceptar.Tomoconsciencia
dequeelserhumanohasidocreadoconnecesidadessexuales.Aceptoquela
sexualidad es algo bello y sano a travs de lo cual puedo desarrollarme. La
sexualidadformapartetambindemievolucinenelplanofsico.
EYACULACIN PRECOZ
Laeyaculacinprecozoeyaculacinprematurapuedeestarvinculadaamis
primerasexperienciassexuales.Cuandomemasturbo,mesientoculpableporque
losientocomosiendomalooprohibido.Medoyprisaporlotantoenalcanzar
laeyaculacin. El placer deloprohibidosiempre hatenidounaatraccinmuy
fuertee,inclusodemodoinconsciente,intentovolverloavivir.Tambinpuedeque
me imponga presiones y nerviosidad en mi deseo de resultado ptimo. Quiero
probarmeamyamiparejaloquesoycapazdehacer,conresultadosopuestosy
frecuentementeinesperados.Deborelajarmeyvolveraaprenderelplacersexual
vinculadoalamasturbacinenunclimalibredecoaccionesyculpabilidad.Soloo
conmipareja,vuelvoadescubrirelgozodelamasturbacinretrasandocadavez
mselmomentodelaeyaculacin.Estosevuelveunjuegoenelcualencuentro
muchoplacer.Aspuedoemprenderunapsicoterapiaquemeayudaradisminuir
estaculpabilidadquepudevivirenmiinfanciayquehardisminuirmiansiedaden
quererserelmejordesarrollandomsconfianzaenm.

154

FARINGITIS (ver: GARGANTA FARINGITIS)


FEMENINO (principio) (ver tambin: MASCULINO [principio])
Que yo sea hombre o mujer, el cerebro derecho y el lado izquierdo del
cuerporepresentanel principiofemenino(elyin),sededelacreatividad,dones
artsticos, compasin, receptividad, emociones e intuicin, y se refiere a mi
naturalezainterior.Semanifiestatambinporlaternura,lasensibilidad,ladulzura,
laarmona,labelleza,lapureza.Mevinculaaminaturalezafemeninayaladelos
dems. Las principales dificultades sentidas se vinculan a la expresin de los
sentimientos.Mesientobiencuandoanimoaalguien?Soycapazdedecirte
quiero,tengopena?Nomesientoamisanchascuandosoyelolaquerecibe,en
particularcuandosetratadeamor.Loquieraono, elprincipiofemenino forma
partedem.Laactitudquedesarrollfrenteaminaturalezafemeninatieneunnexo
directoconlasrelacionesqueentretuveconlasmujeresdemivida:madre,hija,
amiga,esposa,etc.Elmodoenquevoyaexpresarmifeminidad(sealafacilidado
la dificultad) depender en gran parte del modelo de los padres y de mi
identificacinconunouotrodelospadres.
FEMENINOS (dolores)
Losdoloresfemeninosmeindicanquesientodificultadesenaceptarser
mujer.Nisiquierascomoexpresarmifeminidad.Tengomiedodesometerme.Sin
embargo,crecenelentornodemujeresquedebanserfuertes,tomardecisiones,
etc.Dehecho,llevabanlospantalones 57.Vivenunentornoenquelasmujeres
estabansometidasyhabanabdicadosupropiapersonalidad?Tomoconsciencia
quedebidoalaeducacinquerecib,desarrollmuchomsmiladomasculinoo
bienmecomprometaserlocontrariodelasumisinyseryomismaasumiendo
miladomasculinoendetrimento demifeminidad.Acepto sermujerporque
comomujer,soyenterayexpresomissentimientos.Puedoserfuerteysaberdar
dulzura,amor,comprensin,etc.Cadamujertienesumodobienpropiodeexpresar
sufeminidad,deboyoelegirlama.Comprenderaqupuntosoyfelizdeser
mujer.

57

Llevarlospantalones:Sedicelapersonaquedirigeoposeelaautoridad,porejemploenelhogar.As,cuandoes
lamujerquellevelospantalonesenelhogar,estosignificaqueesellalaquedirigeytomalasprincipalesdecisiones
enelhogar.

155

FIBRILLACIN VENTRICULAR (ver: CORAZN ARITMIA CARDACA)


FIBROMATOSIS (ver: MSCULOS FIBROMATOSIS)
FIBROMAS Y QUISTES FEMENINOS (ver tambin: QUISTE)
Con gran frecuencia, los fibromas aparecen en el tero, sede de la
maternidad,demifeminidadydemisexualidad,porlotantodetodoloquese
refiereamihogar,mifamiliayconrelacinaloscualespuedohabervividoun
golpeemocional(heridaoabusospasados).Quizsmehayasentidoheridapormi
parejaynosupeexpresarmepararestablecerlaarmona?Mehabitansentimientos
de culpabilidad, vergenza o confusin interior reprimidos desde hace mucho
tiempoyformaronestamasadetejidosblandos?Estaltimapuedeprocederdeun
golpe emocional ligado a mis primeras experiencias sexuales o a un paro de
embarazo que me hubiese perturbado. Soy consciente que los tejidos blandos
representanlospatternsmentalesinconscientes.Haypuesacumulacindeestos
patternsmentalesyactitudesnegativasqueahorahancogidounaformaslida.
Estiempoparamdecomunicarconmicnyugeoconcualquierotromiembrode
mi familia y expresar lo que siento. En cuanto a la vergenza, culpabilidad y
confusin,aceptoelhaberactuadocomomejorsabaysegnmievolucinde
esemomento.Meperdonoymeliberodeestacarga.Mesientomuchomsligeray
cadadaquepasamehacecomprenderquemeaceptoyquesoycadavezms
felizcomomujer.
FIBROSIS (ver: ESCLEROSIS).
FIBROSIS QUSTICA (ver: MSCULOS FIBROSIS QUSTICA).
FIEBRE (en general) (ver tambin: CALOR [golpe de ])
Cuandolatemperaturademicuerposeelevaamsde37C,tengofiebre.
La fiebre es sintomtica de emociones que me queman. Estas emociones se
transformanen ira contramylosdems,ocontraunsuceso.Invademicuerpo
entero.Porqunecesitoyoirhastaesteextremo?Esmimododecompensarpara
hacerreposoyrecibirmsamoryatencin?Necesitoestetiempodeparopara
ajustarmeaunarealidadquecambiamuyrpidamente?Generalmente,setratade
una emocin quemadora que surge o bien de la vida que se vuelve de trato
demasiadocalienteparatratar(dealer)yquetomalaformadeunairaintensa,
deunaindignacin,deunadecepcin,deinquietudes.Sisoyunnio,la fiebre
repentina puede relacionarse con conflictos interiores, rabia, o una herida
reprimida.Yo,comonio,notengolacapacidaddecomprendermentalmentemis
emociones,lasexpresopuespormicuerpo.Sealoquesea,deboidentificarla
156

causadeestafiebreyencuentrounaacumulacindeirritacinydeira,quebrotaa
menudo cuando rumio las desgracias pasadas. Tomo consciencia de mis
necesidadesyacepto aprenderacomunicarparaexpresarloquesiento.De
ahoraenadelante,yanoacumulo:squelasolucineseldilogo.
FIEBRE (botones de) (ver tambin: HERPES / [en general] / [bucal]
Laaparicindegranosdefiebreestenrelacindirectaconmistomasde
consciencia. No hago muchas preguntas frente a m mismo y a mi vida en
general. Estoy en conflicto entre mi identidad propia y mis relaciones con los
dems. El nico modo que encontr mi cuerpo para exteriorizar mi conflicto
emocionalyliberarmedel,sonestosgranosacompaadosdefiebre.Queslo
quemeimpideseryo?Mitemoralrechazo!Cuandoestosucede,debohallarla
raznporlacualnoestoyenarmonaconmigomismo.Tomoconscienciademi
necesidaddeseryomismoencualquiercircunstancia.Acepto tambinde
expresarmeporquemientornonopuedeadivinarloquemepreocupa.Alaceptar
alosdemstalescomoson,meatraigolacomprensin.Volviendoaseryo
mismo,laarmonarecobrasulugarenmivida.
FIEBRE DE LOS HENOS (ver: ALERGIA FIEBRE DE LOS HENOS)
FISURAS ANALES (ver: ANO FISURAS ANALES)
FSTULA
La fstula es la formacin de un canal que conecta directamente y
anormalmente dos vsceras (fstula interna) o una vscera con la piel (fstula
externa).Paraqueseformetalcanal,debehaberunbloqueoimportanteaeste
nivelqueperduradesdehaceciertotiempo.Inconscientemente,estabatanansioso,
meretuveybloquelavadeevacuacinnormal.Quesloqueseescondedetrs
de mi ansiedad? Tengo miedo de estar rechazado o abandonado, de estar
ridiculizadoodeengaarme.Tengoreticenciasasoltarme.Tomoconscienciaque,
detrsdecualquieremocin,hayorgulloycuantomsorgullohaya,msesgrande
mimiedo.Necesitovolveracentrarmeeneltiempopresenteyaestaralaescucha
de mi intuicin. La vida es una escuela en la cual aprendo. Si bloqueo mi
aprendizaje,tambinbloqueomievolucin.

157

FSTULAS ANALES (ver: ANO FSTULAS ANALES)


FLATULENCIA (ver: GAS)
FLEBITIS (ver: SANGRE FLEBITIS)
FRACTURA (ver: HUESO FRACTURA [sea])
FRENTE
La frente est situada al nivel del cerebro y, ya que forma parte de mi
cabeza,representamiindividualidadyelmodoenquemeenfrentoconmividay
conlosacontecimientos,racionalmentemsqueemotivamente.Puedodecirquela
formademifrenteysuscaractersticasparticularesmeindicanelmodoenqueme
enfrentoconmisresponsabilidades.Miaperturamentalestreveladaporelancho
de mi frente: ms estrecha es sta, ms rgido soy y ms siento miedo o
culpabilidadfrenteamispropiasideasymispropiaopinionesquesondiferentesde
lasdelosdemsyquemecuestaasumirplenamente,sabiendoquecorroelriesgo
demolestaramientorno.Miintegridadpersonalesmuyimportanteyesprimordial
quemerespeteenloquesoy,quedandoabiertoalasopinionesdelosdems,y
sabiendoquetengoelderechodetenerunaopinindiferente.
FRIGIDEZ (ver tambin: FEMENINOS [dolores])
La frigidez consiste en unainsatisfaccin sexualen lamujer durantelas
relacionessexuales.Generalmente,hayuntraumatismoprofundoounconflicto
interior.Elmiedoestenelcentrodeesteestado:miedodemisimpulsossexuales
ydelplacerquepodranhacermeparecerindecente,miedodeabandonarmeyde
perderelcontrol.Tengomiedodeperderalgosometindomealasexualidad.
Enrealidad,setratadelmiedoaafrontarloqueescondoenelinteriormo.Cuando
est presente este miedo, frecuentemente creo que soy fea y sin valor. Tengo
vergenza y me culpabilizo profundamente. Esto frecuentemente resulta de un
abusosexualvividoenlainfancia,odelacondicionamientodelospadresdiciendo
queelsexoesmaloodelacreenciaqueamorysexonovanjuntos.Estas
percepciones estando escondidas en el inconsciente, deseo retirarme de toda
participacin,rechazarlasexualidadsinsaberporqudeunmodoconsciente.La
educacinquerecibtieneungranimpactosobremifrigidez.Estabaconsiderada
la sexualidad envilecedora y representativa de los instintos ms bajos del ser
humano?Ohablarderesignacinysumisinfrentealasrelacionessexuales,con
elsobreentendidodequenohabaningnplacer?Abusarondemsexualmenteen
miinfancia?Siesas,rechazoinconscientementemisexualidadysientodificultad
endejarmetocarsinsentirmiedoyasco.Tomoconscienciadequenohaynada
indecente en la sexualidad. Al contrario, cuando est expresada entre parejas
158

consintientesquevivenunarelacindeaceptacinydeprofundoamor,esbella
y sana. Acepto abrirme a mi pareja, expresarle mis miedos, mis temores.
Aceptodecirlemisnecesidades.Comprendoquelasexualidadformapartede
midimensinfsicayqueesunafuentededesarrolloparamievolucin.
FRIOLENCIA
Soyunapersonafriolerasitemoelfroositengounagransensibilidadal
fro.Estafriolenciafrecuentementeaparecedespusdeunsucesoenquevivuna
separacinconunapersona,unanimaloinclusounobjeto(unanimaldepeluche
porejemplo)queapreciabamuchoyquesquenuncajamsvolveratener.Vivo
ungranvaco,ungranfroporqueperdelamor,laatencin,elcontactofsicocon
elobjetodelaseparacin.Sobretodocuandosoynio,creoomeensearonque
cuandoalguienseva(muere), sevaalcielo.Perohace fro enelcielo!Yme
pongoaserfrioleroporque,siestoyencontactoconelfro,loestoytambinconla
personafallecida!As,tomoconscienciaquenecesitomscalorenmivida,osi
sequiere,msamor,oreconciliarmeconloquemesepardeloquerepresentaba
para m el amor. Es importante tomar consciencia del suceso que activ la
friolencia yaceptarrealmente lamarchadelapersona(objeto,animal)dela
cualestuveseparadoparahacerlapazconmigomismoyconlasituacin.
FURNCULOS (ver: PIEL FURNCULOS)
FURNCULOS VAGINALES (ver: PIEL FURNCULOS VAGINALES)
GANGLIO (linftico) (ver tambin: ADENITIS, ADENOPATIA, CNCER
DE LOS GANGLIOS [del sistema linftico])
Unganglioesunpequeocuerpodeformaredondasituadoeneltrayectode
unvasolinfticoodeunnervio.Sitengodificultadenenfrentarmeaunasituacin
yqueenvezdehablardeelloydepedirayuda,guardotodoparam, guardo
secretomidesanimoymidesesperacin,tengoganasdedejarlotodo,lanostalgia
frenteami vidase vaamanifestar alcabo deciertotiempopor unoovarios
ganglios.Miestimademdisminuyymimiedodelfuturomeharvivirangustia.
Vivoenladefensiva.Puedequetengatambindificultadesdecomunicacincon
los dems y que esto me afecte emocionalmente o me cause miedos en mis
relacionesconlosdems.Esimportanteverenculpartedelcuerpoaparecenlos
ganglios porqueestomedaunapistasobreelmotivodeestamanifestacin.Por
ejemplo,simepreocupoconrelacinalalgoquequieroexpresarperoqueguardo
enmiinterior,hayprobabilidadesdequeunoovarios ganglios aparezcanenla
regindelagarganta.Sihaycosasquenoquieroor,entonceslosganglioscerca
de mis orejas pueden molestar mi audicin. Tengo inters en comunicar mis
159

necesidadesatodoslosnivelesparaquedesaparezcamidesesperacinyquedeje
sitioalaesperanzayalaalegradevivir.
GANGRENA (ver: SANGRE GANGRENA)
GARGANTA (en general)
Lagargantacontienecuerdasvocales(lalaringe)ylafaringe.Mepermite
expresar quien soy y me permite tambin intercambiar con personas que me
rodean. La garganta est vinculada al centro de energa de la laringe tambin
llamado chakra de la garganta (quinto chakra), centro de la creatividad, de la
verdadydelaafirmacin.Trabajatambinenestrechacolaboracinconelcentro
deenergasagradoosegundochakra,elcentrodelaenergasexual,lasexualidad
siendo un modo de comunicar con otra persona. Este centro de energa es
importanteparalaafirmacindelyo.Tambinsedice:Elpensamientocrea,el
verbomanifiesta.As,porlapalabra,hagoquemispensamientossematerialicen
en el mundo fsico. Entonces, aunque pensamientos negativos puedan tener
repercusiones enmisalud,palabrasnegativaspodrntenerlasanms.Estoes
verdadparaelladopositivotambin.Porlotantotengoventajaenhablardemodo
positivo,respetandoasmitemplodecarnequealbergamipartedivina.Cuanto
msexpreselaverdadporestavadecomunicacin,mspodrintercambiarcon
mientorno.
GARGANTA (dolores de) (ver tambin: AMGDALAS, MUGUET)
Con mi garganta, trago la realidad, ah en donde tomo la vida por la
respiracin,elaguayelalimento.Tambinesaqudondeliberomissentimientos
del coraznhasta lavoz.Eselpuenteendoble direccinentrelacabeza yel
cuerpo,elesprituyelfsico.Simeduelelagarganta,puedoculpabilizarmepor
haberdichociertaspalabras,opensarquehubiesedebidoexpresaralgo.Escomosi
meautocastigaseporeldolor.Quizshallegadoelmomentodedecirloque
estoyviviendoparaliberarmedeello.Tambinmi garganta puedeinflamarsesi
inhibolarabiayqueestaemocinmesubaalagarganta.Sinodigorealmentelo
quequierodeciroqueexisteunconflictoenmiexpresindemmismo,entonces
migargantasienteesterechazo.Alserlagargantalaexpresindelaafirmacin
demmismo,sitengodificultadenafirmarme,puedoquerercompensaresto
volvindomeautoritariohacammismoyhacalosdems,locuallimitami
energaenesteplano.Lainfeccinenlagargantaporlabacteriaestreptococoes
una de las formas de infeccin ms frecuentes. Esto implica la irritacin y
retencin de energa. La garganta representando tambin la concepcin, la
aceptacindelavida,sitengodificultadesalniveldelagarganta,puedovivir
unprofundoconflictoenlaaceptacin demiexistencia.Teniendodificultad
160

paratragar,puedopreguntarmeculpersonaoculsituacintengodificultaden
tragar,oculrealidadmesientoobligadoatragarauncuandoestonomeconvenga
(quizsseaestoporejemploalgoqueestencontrademisprincipios).Entonces
puedointentarcortarmedelarealidadfsica,queriendoquizshuirlaobligacinde
afirmarquiensoy,misnecesidadesyporelmismohecho,ladeaportarcambiosen
mi vida. El chakra de la garganta y el chakra sexual estn conectados muy
directamente.Losdostienenrelacinconlacreatividad:elchakradelagarganta
serefierealacreatividaddemispensamientosmientrasqueelchakrasexualse
refierealacreatividadenlamateria.As,amboscentrosdeenergatienenrelacin
conlacomunicacin:pormivoz,comunicomispensamientosypormisexualidad,
comunicofsicamentemissentimientos.As,sitengoproblemasde garganta,es
buenoquemepregunteloquehedeexpresarsobremmismoydeboinvestigar
sivivofrustracinencuantoamisexualidad.Deboaprenderquelafelicidadyla
libertadvienende micapacidadaexpresarmeenlaVerdad,acercndomeas
cadavezmsamiesenciadivina.
GARGANTA (tener carraspera en la )
Tenercarraspera enla garganta manifiestamuyapesarmoquedeseo
expresaralgoperoqueloguardoadentromo.Tengomiedoqueserandem,que
mecritiquen,quemerechacen,deestarincomprendido?Seguramenteestemiedo
se relaciona con mi sensibilidad conscientemente o inconscientemente. Debo
hacermeconfianzaydecirlascosastalescomoson,siguiendoautnticoconmigo
mismo;adquiriraselrespetodelosdemsydemmismo.
GARGANTA APRETADA
Tengo la garganta apretada cuando vivo ansiedad. Entonces me siento
cogidoala garganta.Puedosentirmeinseguroperodebohacerconfianzaala
vida.Aprendoaexpresarmelibrementeyasuperarmismiedos.
GARGANTA FARINGITIS (ver tambin: ANEXO III: RESFRIADO)
Lafaringitisesmuchomsconocidabajolaexpresindolordegarganta.
Todaslasemociones,lossentimientosolasenergasquebloqueanmigargantase
debendeentrarporlanarizolaboca.Otambin,vienendelasprofundidadesde
miserinteriorybloqueanalniveldelagarganta.Frecuentementesonemocioneso
situacionesquevuelvoatragaryquetengodificultadenaceptar.Porlotanto,
siento(nariz)quealgovamaloquenoabsorbo(boca)unaovariasenergasquese
presentanam.Aveces,sonlasmismasemocionesquesehanampliadodespus
deunresfriado.Estasemocionesmeafectanmsprofundamente,mscercademi
interiorqueunsimpleresfriado.Hedeanalizarestesentimientoqueseenganchay
bloqueaalniveldelagargantaparapoderaceptarloydejarloir.
161

GARGANTA LARINGE (ver tambin: AFONA, CNCER DA LA


LARINGE, ENRONQUECIMIENTO)
Lalaringeeslapartedelasvasareassuperioressituadaentrelatraqueay
lafaringe.Unaafeccinalniveldelalaringeseproducegeneralmentedespusde
unsucesoenelcualtuveelsoplocortado.Tenatantomiedoqueningnsonido
podasalirdemiboca.Estuvepilladoporsorpresayfrecuentemente,mesientoen
peligro,alpuntoquetengolasensacinquemividaestenpeligro.Esimportante
que recuerde y vuelva a vivir en pensamiento este suceso que probablemente
sucedijustoantesdequemilaringeestafectadaporlaenfermedad.Aspodr
eliminareltraumatismoquesequedenganchadoenmi laringeylepermitir
curar.
GARGANTA

LARINGITIS
(ver
tambin:
ANEXO
III,
ENRONQUECIMIENTO, INFLAMACIN)
Lalaringitisesunainflamacindelalaringe,acompaadadetosyronquera.
Estainfeccinestcausadaporladificultadenexpresarmeportemoralridculo,
frecuentementefrentealaautoridad.Estopuedevincularseconelhechodevivir
rechazoporpartedelosdemsysimeafirmo,estar incomprendidopor ellos.
Reprimorebelin,mesientoahogado.Cuandomecalloenvezdeexpresarme
porvergenza,portemoroporculpabilidad,estossentimientosqueescondoporel
silenciocausanunbloqueodeenergaquesetraduceporunalaringitis.Unagran
resistencia entonces puede manifestarse cuando las emociones intentan luego
expresarse.Lalaringeestinflamadayexisteunaltoniveldeenergaemocional
vinculadaalavozyalaexpresindes.Micreatividadintentaencontrarsupropia
afirmacin: quiere ser libre de hablar y vocalizar hbilmente sus emociones.
Deboaprenderadecirlascosas,aexpresarmissentimientos,locualpermitira
estaenergacircularlibremente.Si,enmipersonalidadpresente,tengodificultad
en expresarmediciendolascosas,entoncespuedo expresarmeescribindolas.Al
estar la laringe vinculada al centro de energa de la garganta que es la
comunicacin, puedo comunicar mis sentimientos escribindolos, incluso si
conservoestosescritosparam.Estopermitirunamejorcomunicacinconmigo
mismo.
GASES (dolores causados por ) o FLATULENCIA (ver tambin:
HINCHAZN / [EN GENERAL]/ del abdomen])
Cuandomeenganchooquequieroreteneraunapersonaounasituacin,es
comosiconservaracosasindeseablesynobenficasparamyquesemanifestaran
bajoformadegases.Tengomiedoymeenganchoporqueestoyansiosoytengola
sensacindequevoyaperderalgooaalguienimportante,tantoenlosplanos
afectivo, intelectual, material como espiritual. Tambin quiero esforzarme en
162

tragar(ensentidofigurado)unasituacin,aunapersonaounaemocinquevaal
encuentrodemisprincipiosydemiconsciencia.Consecuenciadeesto:mehincho.
Aprendoahacerconfianzayasoltarsabiendoquesiempretengoloquenecesito.
GASTRITIS (ver: ESTMAGO GASTRITIS)
GASTRO ENTERITIS (ver: INTESTINOS GASTRO ENTERITIS)
GAY58 (ver: HOMOSEXUALIDAD)
GELINEAU (sndrome de) (ver: NARCOLEPSIA)
GENITALES (rganos) (en general)
Los rganos genitales diferencian a los hombres de las mujeres. Estn
vinculadosal principiomasculino59 yal principiofemenino60 encadaunode
nosotros. Tambin estn vinculados a la sede de la energa sexual, gonadas y
chakradebase61.Sivivodificultadesenloqueamisexualidadserefiere,mis
rganosgenitalessuelenestarafectados.
GENITALES (dolores de los rganos) (ver tambin: FRIGIDEZ,
IMPOTENCIA, VENERIANAS [enfermedades])
Lasdificultadesquesientoconmis rganosgenitales memanifiestanun
miedo,ouna culpabilidad,vergenza,desconfianza,pesares, ira,conrelacina
misexualidad,locualcorreelriesgodetraducirsecon enfermedadesvenreas,
frigidez,impotencia,etc.Estareaestvinculadaamisgonadas(lostestculosen
elhombre,losovariosenlamujer)ylaenergasexualvinculadaalasexualidades
muypoderosayaquetieneporprimerobjetivoperpetuarlaespecie.Sinembargo,
puedequeuseestaenergaconmalasintenciones.Lanocindeplacervinculadaa
lasexualidadmeponeencontactoconunademisnecesidadesfundamentales,el
placer, y me conecta con mi nio interior herido. As, mi sexualidad puede
llevarme a poner en evidencia estos miedos, estas heridas, estos rechazos que
formanpartedem.Puedonoaceptarme enelcuerpo(sexo)quesoy,puede
quevivaunconflictointeriorentremisdeseosfsicosylosdeordenreligiosoo
espiritual;simedamiedodecirnoysitengorelacionessexualesparaevitarestar
rechazado,miedoaperderelamordeunapersona,sloconunobjetivoegosta,
etc.,todasestassituacionespuedenllevarmeatenerdificultadesaestenivel.Existe
una confusin o un conflicto interior, una dificultad en la comunicacin y el
58

DelinglsGAY.
Principiomasculino:(ver:MASCULINO[principio])
60
Principiofemenino:(ver:FEMENINO[principio])
61
Chakradebase:Vinculadoalcentrodeenergaalniveldelcoxis.
59

163

compartir. Siempre me siento respetado, considerado y tengo dificultad en dar


confianzaalagente.Adems,simispadresdeseabanaunahijayquesoyunnio
oviceversa,obienqueammismo,mehubiesegustadomsserdelotrosexo,
estomepuedeconduciravivirproblemasgenitalesporquerechazounapartede
misexualidadypuedequemesientaculpabledeserquiensoy.Deboquitartoda
culpabilidad para que mi sexualidad se vuelva la expresin de mis cualidades
amantesydelaatencinquellevoalosdems.Esimportantequeelamorsea
presenteenmisexperienciassexualesytambincadavezquememireenunespejo
paraaceptarmecadavezmstalcomosoy.
GINGIVITIS (ver: ENCIAS GINGIVITIS AGUDA)
GLNDULAS
Las glndulas son rganos secretadores cuyo producto est excretado al
exterior por un canal. Por ejemplo, las glndulas endocrinas (tiroides,
suprarrenales,etc.) secretansuproductoenlasangre.Alsercadaunadeellas
vinculadaauncentrodeenerga(chakra),unmalfuncionamientodemisglndulas
endocrinasmanifiestaundesequilibrioounadesarmonademiscentrosdeenerga.
Lasglndulas,lasquesean,inyectanproductosenmicuerpoqueseaparentana
carburantes necesitados por ste para funcionar, para poner en accin a otros
rganos.
GLNDULAS (dolores de)
Un mal funcionamiento de una o de las glndulas me indica que tengo
dificultadenencontrarunamotivacin,uncarburante,paraarrancarunnuevo
proyectoopasaralaaccinfrenteaunasituacin(tengotendenciaaaplazarams
tarde).Estopuedesituarsetambinenelplanoracional,enelcualvivoconfusiny
porquetengodificultadenver conclaridadloquedebohacer.Estomanifiesta
ciertainseguridadinterior.Aprendoahacermeconfianzaporqueposeotodaslas
cualidadesnecesariasparairhacadelanteypasaralaaccin.
GLNDULAS LAGRIMALES (ver: LLORAR)
GLNDULA PITUITARIA O HIPFISIS
Laglndulapituitariaesunaglndulaendocrinasituadadebajodelcerebro,
pordebajodelhipotlamoyque,secretandolasestimulinasqueactansobreotras
glndulasendocrinas,juegaunpapelmayorenlaregulacindelassecreciones
hormonales.Actapuescomo granmaestra conrelacinalasdemsglndulas
delcuerpo.Juegaunpapeldejefedeorquesta.Subuenfuncionamientoayudaal
equilibriodemisfacetasracionaleintuitiva.Sisemanifiestaundesequilibrio,osi
sesobrecalienta mi ladoracionalsinquedejelugaramisaspectos intuitivo,
164

creativo y emocional, tambin mi lado intuitivo, mis dones psquicas se


sobrecalientanasuvez,porquequieroirdemasiadodeprisa,tomandoclases,
leyendo todo tipo de libros, ensayando todo tipo de tcnicas, etc., y creo un
desequilibrio porque mi cuerpo fsico no puede soportar todos los cambios
interiores que se producen. Ya que la glndula pituitaria controla el buen
funcionamientodemiorganismo,measeguroquemicuerpoymimenteestnen
equilibrioevitandolosexcesosymeaseguroeldominiodemispensamientosyde
mis emociones. Si mi hipfisis est afectada por un tumor, puedo vivir un
sentimiento profundo de impotencia, teniendo la impresin de no ser capaz de
alcanzarlosobjetivosquemehabafijado.Ensentidofigurado,escomosime
alargaseelbrazocuantomsparaalcanzarlamanzanaqueestenelrbol,perono
loconsigo.Elobstculopuedeserfsicooemocional.Tengolasensacindeser
demasiadopequeo(ensentidoliteralofigurado)paraalcanzarelobjetivoy
puedotenermiedodelosmediosquedebautilizarparaconseguirmispropsitos.
Cmopuedoalzarmehastalacumbre?Tomoconscienciadequelosobjetivosque
mehefijadoquizssondemasiadoaltos.Aprendoasercomprensivoypaciente
hacammismo,sabiendoquehagosiempremiposibleyquequieroloqueest
mejorparamyparalosdems.Siendoverdadero,siempreestarorgullosodem,
cualesquieraseanmisrealizaciones.
GLNDULAS SALIVARES (ver tambin PAPERAS, SALIVA)
Un mal funcionamiento de mis glndulas salivares, las cuales producen
muypocaodemasiadasaliva,meindicaquevivounainseguridadfrentealhecho
dehallarelalimentonecesarioamisupervivencia.Quizsnotengadineropara
comprarme alimentos o puede que tenga alimentos pero que no sepa cmo
emplearlos.Porlotanto,hayalimentodisponibleperonopuedocomprarlo,no
tengoaccesoal.Semeharlabocaaguayvivirunsentimientodecarencia.
Aceptoestasituacintomandoconscienciaqueyotambintengoelderechode
alimentarmebienyquelavidameprocuratodoloquenecesito.

165

GLNDULAS SUPRARRENALES (ver: SUPRARRENALES [dolencias de


cpsulas])
GLAUCOMA (ver: OJOS GLAUCOMA)
GLBULO OCULAR (ver: OJOS [en general])
GLBULOS SANGUNEOS (ver: SANGRE)
GOTA (ver tambin: ACIDOSIS, CLCULOS RENALES)
Lagotaesunaenfermedadmetablicacaracterizadaporlaacumulacinde
cido rico en el organismo y que se traduce por afecciones articulares
particularmenteeneldedogordodelpieyavecesporunalitiasisrenal(clculos
renales). Afecta tambin frecuentemente las manos, muecas, dedos, rodillas,
tobillosyaveces,loscodos.Laacumulacindecidoricosignificaqueretengo
emocionesnegativasquedeberannormalmenteestarsoltadasenlaorina.As,me
fijoenactitudesypatternsmentalesquehacenquemifacultaddemovimientose
vuelva un acto doloroso y torpe. Mi cuerpo se vuelve rgido como mis
pensamientosymiactitudfrenteammismoylosdems.Puedomanifestar
muchaimpacienciacuandolascosasnosucedencomoquiero.Necesitodominar,
controlartotalmentemivida,locualavecespuederesultardifcil.Porlotanto,la
gotasepresentaenalguienmuyambiciosoyrgidoo,alcontrario,enunapersona
quenotieneobjetivo,ningnentusiasmoparaelfuturo.Tengoambicionesmuy
limitadasynosemetienequepedirdemasiado.Sino,eslagotaquehacequeel
vasosederrama!Entonces,seapoderademladesesperacin.Lagotasepresenta
frecuentementeenhombresdeedadmadurayporlotantoquizsdebaaprendera
dejarquelosdemsseancomoson,envezdedominar;hacerconfianzaalavidaen
vezdecontrolar;sermsflexiblehacammismoolosdemsenlugardeser
rgido.Yanotengoquevivirningnconflictointeriorentrelosplaceresdelavida
ylosdeberes:meveoobligadoaestarinactivoyaapreciarundescansobien
merecido!Necesitodejarentrarmsamordentrodemparaequilibraryliberar
lasemocionesnegativas,dolorosas,hirientesydeira,pararecuperarmovimiento,
libertad,bienestar.
GRANOS (, en todo el cuerpo) (ver: PIEL GRANOS)
GRASA Y GORDURA (ver tambin: PESO [exceso de])
Sisoyunapersonaquesufrede gordura,soyalguienhipersensibleyque
necesitaprotegerse.Estanecesidaddeprotegermesehallaprincipalmentealnivel
delsegundochakra,eldelasexualidadydeltercerchakra,eldelasemociones.
166

Loshombresparecentenernecesidaddeprotegersemseneseplano.Aprendoa
tenerconfianzaenmmismoyenlavida,parapermitirquedesaparezcaesta
grasaprotectora.Expresomisemocioneslibrementeyaprendoaamarmetalcomo
soy.
GRIPE (ver tambin: CEREBRO ENCEFALITIS, AGUJETA,
ESTORNUDO, FIEBRE, MSCULO, RESPIRACIN [dolores de],
CABEZA (dolores de])
Setratadeunestadovinculadoconunvirusquecausafiebre,escalofros,
doloresdecabeza,doloresmusculares,estornudos,problemasrespiratorios,etc.La
gripequeafectamicuerpomsviolentamentequeunresfriadopuedeobligarmea
guardarcamaduranteciertoperododetiempo.Alserla gripe unaenfermedad
infecciosayquestaserelacionaconlaira,puedopreguntarmeaquientomotirria
uojeriza,expresinquesignificacontraquinestoyyoenfadado?Lossntomas
quesemanifiestanmuyparticularmentemeindicanloquevivoactualmente:la
fiebreest vinculadaala ira,los estornudosconla crtica,alhecho dequerer
sacarseaalguiendeencimaounasituacin,etc.Frecuentementesetratadeuna
situacinconflictualenelplanofamiliar:sedijoalgooseviviunasituacinque
nopuedotragarporquenormasolmitesestuvierontransgredidos.Haypuesuna
peleaenlacualtuvelasensacinquemiespaciovitalestabavioladooquecorrael
riesgodeperderalgooaalguienquemeperteneca.Muchoscasosde gripe se
puedenatribuiracreenciasarraigadasenlasociedad,elmiedotambin,comopor
ejemplo:Tuvetantofrohoy,estoyseguroquevoyapillarla gripe!.Hede
preguntarmeporqutengolagripe.Necesitoreposo?Meobligoaguardarcama
paranoenfrentarmeamisresponsabilidadeseneltrabajoolafamilia,etc.?La
gripe tambin puede nacer despus de una situacin en la cual viv una gran
decepcin,ungrandisgustoofrustracinquemellevaaquererdejardesentirlo
que sucede alrededor mo (nariz congestionada) y que conlleva tambin una
respiracinmsdifcil.Tengointersenexpresarmisemocionesydejarcorrermis
lgrimasparadescongestionartodomicuerpoyqueserestablezcalaarmona.
GRIPE ESPAOLA (ver: CEREBRO ENCEFALITIS)
HALITOSIS (ver: BOCA ALIENTO [mal])
HEMATOMA (ver: SANGRE HEMATOMA)

167

HEMIPLEGIA (ver: CEREBRO - HEMIPLEGIA)


HEMORRAGIA (ver: SANGRE HEMORRAGIA)
HEMORROIDES (ver tambin: AMPOLLAS, ANO, EMBARAZO,
INFLAMACIN, INTESTINOS ESTREIMIENTO, SANGRE /
HEMORRAGIAS/ VARICES, PRESIN ARTERIAL HIPERTENSIN)
Las hemorroides sonvarices,dilatacionesensanchadasdelasvenas,una
especiedeampolla.Estnsituadasenlaregindelanoydelrecto.Vistoquelas
hemorroides pueden producirse en los casos de estreimiento, presin alta,
embarazo,voyacomprobarenestasenfermedadessivivounaosituacionesquese
vinculan a ellas. Cuando hay dolor, esto se relaciona con estrs; cuando hay
hemorragia,serelacionaconunaprdidadealegra.Lashemorroidesmeindican
unatensinyundeseointeriordeforzarlaeliminacin,comosiintentasedehacer
saliralgomuyfuertemente;almismotiempo,laaccinderetenersemanifiesta.El
conflictoentreempujaryretenercreaundesequilibrio.Lasvenaspermitensuponer
unasituacinindicandounconflictoemocionalentrelaaccinderechazaryde
repulsarylaaccindequererretenerybloquearlaemocinenelinteriorsuyo.Por
ejemplo,esteconflictopuedebrotarenlosniosquesesientenemocionalmente
abusadosporsuspadres(quequierenrechazarles)yqueapesardetodolosquieren
yquierenquesequedenconellosretenindoles.Otrascausasserelacionanconlas
hemorroides:unsentimientointensodeculpabilidadounaviejatensinmalono
expresada,quefrecuentementeprefieroguardarparamyquevivofrenteauna
personaounasituacinquemeparteeltrasero.
Elcuerpomeavisaconestaseal.Algoenmividanecesitaestaraclarado.
Seguramentevivoestrs,sobrecargadepresinconrelacinalacualmesiento
culpable. Quizs tengo plazos que respetar y tengo mucha dificultad en soltar,
hacer confianza y puedo sentirme obligado a cumplir mis obligaciones y mis
responsabilidadesinclusosiloquequiero,eshablaryexpresarmisnecesidades
pararectificaroajustaralgunassituaciones.Adems,llevoestepesosoloporqueel
orgulloquevivomeincitaranopedirayudaanadie.Tambinpuedequevivaun
sentimientodesumisinconrelacinaunapersonaoaunasituacinenqueme
sientodisminuido,comosifueraunanulidad.Cuandohallolacausametafsicade
midolencia,tomoconscienciayaceptoestasituacintemporalquemeayudar
ahallarlaayudaparaliberarme.Mispensamientosymisaccionesestnsostenidos
porelamor.Todosearmonizaenmylashemorroidesdesaparecen.

168

HEPATITIS (ver: HGADO HEPATITIS)


HERNIA
Laherniaesunahinchazndetejidosblandosounrganosalienteatravs
delaparedmuscular,ah dondeexiste unpuntodbilquepermiteesta salida.
Puedetratarsedeuntumorformadoporunavsceraquehasalido,atravsdeun
orificionaturaloaccidental,fueradelacavidadquelocontienenormalmente.La
herniaestprovocadaporunapresindeltejidoblandodebajodelmsculoenel
momentoenqueestdbileinfrautilizado.Lasherniaspuedenvariardelugar.
Son ms frecuentes a la largo de la pared abdominal (hernia de la pared
abdominal).Enel diafragma, sellama hernia diafragmtica.Ellugar indica la
naturalezaysumensaje.Porejemplo,lasdelosbebssuelenestarvinculadascon
unamalacicatrizacindelcordnumbilicaldespusdesucorte.Estahinchazn
puedeexpresarmirechazocomobebdedejareltiernonidomaternoomirehuso
denacer.Eneladulto,puederepresentarungrandeseonoexpresadoderomper
conunasituacinounapersonaquemeesdesagradableyconlacualmesiento
comprometido.Estopuedereferirseaunarupturademiparejaprovocadapormo
micnyugeyquetengodificultadenaceptar.Meparecepesadalavidaque
llevo?Tambinpuedeexpresarunautocastigoporquemeculpo,sintindome
impotenteoincapazderealizarciertascosas.Vivoasmuchafrustracinfrentea
mmismo.Porelcontroldemicoaccin,alcanzounnivelenelcualtodoexplota
o ms bien implota dentro mo. Visto que no he liberado exteriormente mi
desamparo,debehallarunmododesalir.Laparedabdominalprotegemisrganos
internosylosmantieneensulugar.Porconsiguiente,la herniaenelmsculo
puedeestarvinculadaaldeseodeguardarmiuniversoensulugarsinpermitirla
liberacindelaagresividadoexpresionesmsfuertes.Mepermiteliberarlas?
Puedosentirmeculpabledeestarenesteestadoymesientoempujadoyforzadoa
irdemasiadolejos,ointentocumplirmiobjetivodeunmodoexcesivo.Hayun
impulsomental(estrs)queintentabrotar.Quierosalirdeunestadoodeuna
situacinquenoesagradableyenelcualmesientoobligadoaquedarme.Setrata
deciertaformadeautocastigo.Hallegadoelmomentodeunanuevasalida.
Necesito expresar mi creatividad. Ahora, me permito ser yo mismo
exteriorizndomemslibremente.Vivomsamorhacamylosdemsporques
QuienSoy.
HERNIA DISCAL (ver tambin: ESPALDA [dolores de])
Undiscoesunaestructuraredondayllanasituadaentrecadapardevrtebras
delacolumnavertebralyrodeadadeunasustanciasimilaralajalea(algocomo
unagelatina)quesirveparaamortiguar.Enunaherniadiscal,lapresinviniendo
deunaovariasvrtebrascomprimeestamasagelatinosaylahacesalir,reduciendo
el efecto amortiguador y creando dolor en los nervios vecinos. En una hernia
169

discal,ademsdeloquesignificauna hernia,hayunasolturaanormaldelos
lquidos, implicando, desde un punto de vista metafsico, las emociones. Hay
tambindolorenlosnervios,implicandolaenergamentalylaculpabilidad.Todo
estoindicaunprofundoconflictoafectandotodoslosaspectosdemiser.Enla
situacindela herniadiscal,lapalabraclaveaques presin.Puedosentirlaal
niveldemisresponsabilidadesfamiliares,financieras,demitrabajo,etc.Escomo
siejercieraunapresinsobremmismosobrepasandomislmites,tomndome
poralgunaotrapersona.Estapresinpuedevenirdem,delosdemsodealgn
otrositio.Tengolasensacindeestarsoloenlavidaydenotenerningnapoyo,
dudandoenconfesarloalosdemsy,sobretodo,ammismo.Locualmedala
sensacindeestarpresoeindeciso.Esimportantequemerefieraalaparteafectada
de la espina dorsal para comprender mejor lo que me pasa. Ahora me siento
sostenidoporlavida.Meliberodecualquierculpabilidadopresin;Meamotal
comosoy.HagolomejorquesydejoelrestoaDios.
HERPES (en general, bucal) (ver tambin: BOCA)
El herpes,tipodeerupcincutneaagrupadadevesculasinflamatoriasse
llamacomnmente fuegosfieros.Estevirusinfectaunacantidadinnumerablede
genteyadems,sequedaenelcuerpoparasiempre.Inclusoaparecedespusde
variosaosdesueo.Elvirusherpessimplex(HSV)puedebsicamentebrotar
bajoformadelcerasafectandosobretodolaboca,loslabiosolaspartesgenitales.
Variascausasestnvinculadasconelherpes:
- Estopuedeserfrustracinporquenopuderealizarciertosdeseosymesiento
algoimpotente,incapaz.
- Quieroapartaraalguienparanodejarmebesar;obienporquelojuzgoobien
porquequierocastigarlo.
- Puedoestarenfadadoconmigoporhaberdichopalabrasofensivas.
- Puede que haga un juicio severo contra una persona del sexo opuesto y
generalizndoloatodoelconjunto(Ex:loshombrestodosson).
Sonmodosdemantenermeadistanciadelosdemsporquelasregionesen
las cuales se desarrolla el herpes son habitualmente los labios y las partes
genitales,lugaresbsicosparalacomunicacinpersonal,verbaloafectivaconlas
demspersonas. Las lceras puedenindicarmequevivounapenaemocionaly
mental(porqueestnimplicadoseltejidoblandoylosfluidos),quevivountipode
erupcinoungrandolorinterior.Yaquebesoconloslabiosalaspersonasamadas
(cnyuge,hijos,padres,etc.),elherpesbucalmeindicaquepuedequevivauna
situacinenlacualhayunaseparacindeunapersonaquesolabesar.Elcontacto
alniveldelapieldeloslabioshasidoquitadoporalgnmotivoysemanifiestael
herpes.Enlanariz(msescasamente),elherpesmeindicaquepuedovivirrabia
vinculadaconelhechoquesepiensa,enmientorno,quemetolanarizportodas
partes. Las erupciones parecen estrechamente vinculadas al estrs y a las
170

situacionesconflictuales,especialmentecuandohagoalgocondesganaocuando
voyalainversademissentimientosinteriores(ex.:cuandotengounaexperiencia
sexualconunapersonaconlacualnoquieroestar).Aspues,el herpes puede
darmeelmensajequevivounapena,uncansanciofrentealavida,unafaltade
amor propio. Este virus plantea todo los temas de vergenza, culpabilidad,
compromiso y negacin de s frecuentemente vinculados con la sexualidad
(observandolapartedelcuerpoafectada,podrhallarlacausa).Cesodejuzgarme
ydejuzgaralosdemsconseveridad.Aprendoaabrirmealosdems.Mehago
msconfianzaenmisrelacionesntimas.Meamomsyvuelveelsolenmivida.
Estoyorgullosodeserquiensoy.
HERPES GENITALES o HERPES VAGINAL (ver tambin: PIEL
COMEZONES, VAGINA VAGINITIS)
El herpes vaginal,segnla creencia popular,procede delaculpabilidad
sexual y del deseo inconsciente de auto castigarse. El herpes genital puede
aparecersihayausenciadecontactosexual.Puedequetuvierauncnyugeynos
separamos.Obienpodemosestarseparadosfsicamenteporejemplosiunodelos
dossehamarchadodeviajedenegociosporciertoperododetiempo.Careciendo
decontactofsicoconlapieldemisrganossexualesyviviendodifcilmenteesta
separacin,manifestarmimalestarconunherpesvaginal.Tambinpuedeque
mifrustracinseavivaenloqueamisrelacionessexualesserefiere,bienporque
no son satisfactorias o al contrario, son plenamente satisfactorias y me hacen
recordaralgodoloroso.Osea,puedopreguntarmeporquheestadotantosaos
viviendoinsatisfaccincuandohoy,estofuncionatanbien,porqunoheconocido
estoantes?Enlaeducacinreligiosapopular,seibahastapretenderqueestoera
queridoporDiosparacastigarnos.Elsentimientodevergenzamellevainclusoa
querernegar,anoaceptarmisrganosgenitales.Laspartesgenitalesfueronlas
cabezas de turco de muchas religiones. Amo mi cuerpo y me alegro de mi
sexualidad.Diosmehizoasuimagen.Estoyasombradodelabellezaquesoy.
HIDROFOBIA (ver: RABIA)
HGADO (dolores de ) (ver tambin: CLCULOS BILIARES, ICTERICIA)
Los dolores de hgado proceden de mi propia actitud. Mis frustraciones
acumuladas, mis odios, mis celos, mi agresividad contenida son factores
activadoresdelos problemasdelhgado. Estossentimientosescondenmiedos
quenopuedenexpresarsedeotromodo.Tengotendenciaacriticaryjuzgaralos
demsconfacilidad.Mequejoconstantemente.Resistoaalguienoaalgo.Vivo
muchodisgusto.Acepto difcilmentetalescomoson. Laalegradevivires
frecuentemente inexistente porque tengo envidia de los dems, lo cual me
171

perturbaymeponetriste.Sinembargo,hastaqupuntoestoylistoparahacer
esfuerzos,tantoenelplanomaterialcomoenmicaminarespiritual?Annohe
comprendidoque loqueyoreprochoalotrosloeselreflejodemmismo.
Sloesmi espejo.Mequejoconstantementeypidoalosdemsquecambien.
Dnde est mi buena voluntad? cul es el esfuerzo por mi parte? Tambin
carezcodealegradevivir,simplicidad.Podrdesarrollaruncncerdehgadosi
todaslasemocionesquemesonnefastas meagobiandesdeunbuentiempo.
Frecuentemente, resulta de un conflicto con relacin a la familia o al dinero,
especialmente cuando tengo miedo de carecer de algo. Es tiempo que tome
conscienciaquedeboaceptarme talcomosoyyaprenderaamarmems.Ser
capazdeamorycomprensinhacamabrelavaamicomprensinyalamorde
losdems.Recobrolaalegradevivir.
HGADO (absceso del)
Elhgadoestrelacionadoconlacrticayunabscesodelhgadoindicauna
gran insatisfaccin en mi vida, que puede proceder del hecho que los
acontecimientosnosedesarrollancomoquiero,quemepreocupodemasiadopara
ciertas situaciones o que la alegra y el amor que alimentan mi vida son
insuficientes.steesunmensajequemedalavidaparadesarrollarmiflexibilidad
ymiaperturayhacerqueyobusqueelamorylacomprensinquenecesitopara
descubrirmsesteamorqueestenm.
HGADO (crisis de) (ver tambin: INDIGESTIN)
Elhgadometabolizalosalimentos,eliminalosexcesosdeprotenas,grasay
azcarypurificalasangredesusimpurezas.Esesencialalavida.Esconocido
comolasededelairaydelacrtica.Elhgadotambinestvinculadoconmi
comportamientoyrepresentalafacilidaddeadaptacinalosacontecimientosya
lascircunstanciasdelavida.Lasemocionesnegativasquesiento(pena,odio,celos,
envidia,agresividad)trabanelbuenfuncionamientodelhgado.Mihgadotienela
capacidaddeacumularestrsytensininterior.Estambinenmihgadodondese
depositanmispensamientosymissentimientosamargoseirritantesquenohan
sido expresados o resueltos. Por esto, cuando limpio mi hgado por medios
fisiolgicos,(porlafitoterapiaodeotromodo)oenergticos,entoncesmesiento
mscalmadoyenmejorcontactoconmigomismo.Los desrdenesdelhgado
puedeninclusollevarmeavivirladepresin,stasiendopercibidacomodecepcin
frenteammismo.Puedovivirenesemomentotristeza,cansancio,unadejadez
general.Cuandomihgadoestsucio,afectalosnivelesespiritualeseinterioresde
miconsciencia.Puedoperdermivayladireccinquedebotomar.Elhgadodala
vidaytambinpuedealimentarmimiedoaestamismavida.Deboyoactuarpara
quemedelavida.
172

HGADO CIRROSIS (del hgado)


Lacirrosisesunaenfermedadinflamatoriadelhgadocausada,entreotras
cosas,porelconsumoabusivodealcohol.LaCIRROSISseencuentraenelquese
siente empujado por la vida, por acontecimientos o ciertas situaciones que le
obliganaavanzar.Sintindomeempujadocontramivoluntad,resistoymeagarroa
misopiniones.Vivoconrencoryagresividad.Estaenfermedadeselreflejodemi
ira,miresentimientofrentealavidayaloquemesucede.Estoyllenodeuna
agresividadinteriorlatenteymeculpoconstantementeporquetengolaconviccin
dehaberequivocadomivida.Pasomitiempoculpndomeycriticandoalos
dems.Meendurezcotantoqueyanoconsigoverlaluzalfinaldeltnel.Para
ayudarmeareanudarconlavida,aceptovivirelinstantepresenteyvertodolo
buenoquemeestsucediendoahora.Abromicoraznyprestoatencinacada
gesto,encadaaccinaquyahorayaprendoanosertampocounjuezsevero.
Siendomstoleranteconmigomismo,losertambinhacalosdems,locualme
traer muchoms armona yfelicidad enmi vida.Compruebo mis intenciones
verdaderas,memantengoabiertoalamorymeperdonoenloquesoy.
HGADO HEPATITIS (ver tambin: ALCOHOLISMO, INFECCIN,
INFLAMACIN)
La hepatitis esunainfeccindel hgado causadaobienporunvirus,por
bacterias,porelalcoholopormedicamentos,yafectatotalmenteelcuerpo.Los
sntomassonladebilidad,laictericia,laprdidadeapetito,lasnauseas,lafiebrey
elmalestarabdominal.Elhgadoeseldadordevida,limpiandolasangredesus
venenosyexcesos,yconservandonuestroestadoemocional(lasangre)enunjusto
equilibrio.Elhgadoesellugarendondepuedoacumularemocionesintoxicantes
yexcesivoodio.Eslasededelaira.Laspalabrasoenfermedadesacabandopor
itis,como hepatitis,indicanirritacin,ira. La hepatitis puedeestarvinculada
con mis relaciones personales o con una situacin difcil. Este conjunto de
emociones negativas trae debilidad y desesperacin y causa ira, culpabilidad y
conflictosdeprioridades.Cuandomequemolasangrepornada,estomellevaa
vivirmuchaira,rencor,rabiaeinclusoodioquepuedellevaralaviolenciacontra
unomismo,ocontralosdems.LahepatitisviralAtienesuorigenenunrencor
quepuedotenerfrentealmismoalimentoofrenteaunproblemadeconnotacin
alimenticia.La hepatitisviralBmanifiestaunrencorvivido conalgooalguien
quemehasidoimpuesto.Escomosihubieseestadoproyectadodentrodeuna
situacinquerechazaba.Porejemplo,mepuedenhaberobligadoaparticiparaun
concursodedanza.LahepatitisviralCseproducedespusdeungranrencoren
relacinconlodesconocido.Porejemplo,Quienessonmispadres?Dndenac?
Puedo sentir mucha resistencia frente a nuevas situaciones en mi vida que me
llevanaaportarcambios.Puedodesearengancharmeamisprejuiciosyamisideas
173

preconcebidas. Aprovecho el tiempo de reposo que debo tomar para hacer el


balancesobremivida.Meliberodelosprejuicios,irasqueentretenaenm.
HGADO (piedras en el ) (ver CLCULOS BILIARES)
HIGROMA (ver: RODILLAS [dolores de])
HINCHAZN (en general)
Lahinchaznaparecegeneralmentecuandovivounaresistenciaemocional
yquereprimomisemociones.Acumuloemocionesporquevivoimpotenciaoque
noscomoexpresarlasparaevitarheriraalguienosencillamenterecibiryomismo
una herida. La hinchazn tambin puede ser un medio de proteccin y puedo
preguntarme:Porqusientoyolanecesidaddeprotegerme?Yfrenteaquinoa
qu?Aprendoaexpresarloquevivoparaliberarmeyashacerdesaparecerestas
hinchazones.
HINCHAZN (del abdomen)
Lahinchazndelabdomenmepermitetomarconscienciadequevivouna
frustracinparaconmicnyuge,mishijosomifamilia.Probablementemesiento
limitadoenelplanoafectivooenlaexpresindemissentimientoshacapersonas
demientorno.Sitomoeltiempo,medoycuentaquecambiandomimododever
las cosas y teniendo una actitud ms positiva, tomo consciencia de toda la
abundanciaqueestenmivida,tantoenlosplanosafectivo,intelectual,emotivo,
material,etc.
HINCHAZN, ABOTAGAMIENTO
Lahinchaznyelabotargamientoprocedendelhechoquemisrionesno
funcionanbien.Limitacineslapalabraclave.Retengotodoloquequieroparam
porquemesiento bloqueado,limitado.Inclusomimecanismodepensamientos
estfijado.Tomotantoenconsideracinlossentimientosdelosdemsquehago
abstraccindelosmos.Tengomiedodeexpresarloquesiento.Mesiento sin
poder y vivo melancola, tristeza y un gran cansancio. Pienso que estoy
destinadoafracasar,locualmeimpideirhacadelante.Desarrolluncomplejode
inferioridadytengomuchomiedo.Puedotenerelsentimientoquelavidaesmuy
injusta,viviendoungranvacointeriorymuchamelancola.Nopuedoactuarpara
m,demuestropuesmuchaautoridadhacalosdemseintentotomardecisiones
porellos.Yaqueescondoatodoelmundoloquememolesta;tomoconsciencia
quemeesurgenteexpresarmisnecesidades.Aceptoaprenderacomunicarmis
necesidadesycomprendoqueesposiblehacerlosinquelaotrapersonasesienta
atacada. Autorizndome a ser yo mismo, recupero la alegra de vivir y en
174

consecuencia,unrenuevodeenerga.Micomprensinhacalosdemssehacems
grandeporquemeexpresoymecomprendomejoryomismo.
HINCHAZN de vientre (ver tambin: ESTMAGO / [en general] / [dolores
de], GAS)
Lashinchazonesdevientresedebenaunahinchazndeaireodeaguaal
nivel del estmago y de la barriga. Se vinculan a una frustracin afectiva, al
sentimientodeestarinsatisfechoenelplanoafectivo.Digosentimientoporquees
unacreacindemimental,laimpresincerebralquemiestmagosiemprequiere
ms,quequieroanmsatencinyafecto.Noconsigorealmenteverloquelavida
me da que sea tan bien. Verifico sinceramente en qu punto estoy realmente
colmadoafectivamente.Siempreescuestindepercepcininterior.Ahoraestoy
conscientequelavidamedaexactamenteloquenecesitoenelmomentopresente.
Acepto serunapersonasonriente,viviryverlosladosbellosdelaviday
quedarmeabierto
HIPERACTIVIDAD (ver tambin: AGITACIN)
Lahiperactividadsevuelveaencontrarfrecuentementeenlosnioscuyas
actividades son intensas y constantes. Est bien hacer la distincin entre un
comportamientodinmicoe hiperactivo.Sisoyun niohiperactivo,tengoun
comportamientoturbulentoymolesto,inclusoextrao. Eselmodohabitualque
tengodeignorarlassituacionesylascircunstanciasalrededormovolvindometan
implicado en lo que hago que no debo poner la atencin en mi realidad
inmediata,quizsporqueestarealidadnoesalentadoranimesostiene.Esunmodo
derebelarmecontralascircunstanciasylossentimientosquenoseexpresansino
que son ms sentidos (como los miedos haca los padres y las inhibiciones).
Sabemosquelahiperactividadestcausadaporlosaditivosartificiales:elexceso
de azcar, los colorantes y el fastfood. El alimento de este tipo suele ser el
smbolo del padre que intenta colmar el amor del cual pueda yo carecer. Por
ejemplo:medachocolatecuandomsnecesitaraunabrazo.Cuandosoyunnio
hiperactivo,sueleserporquenecesitoestarmscentradoenmiyointeriorymi
corazn.Comopadreomadre,antesdeponeramihijobajomedicacin,ms
valdraintentartratamientosqueactanenelplanoenergticocomoporejemplola
relajacin,laacupuntura,lahomeopata,etc.Puedeserqueelnioseahiperactivo
porqueestenresonanciaosisequiere,encontactointeriorconloquesellama
nuestroniointerno(elniointernodelpadre)elcualviveunagrantensinouna
graninseguridad.Sinosotrosmismoscomopadres,noestamosenergticamente
centrados,cmopediranuestrahijoqueloest?Convendramejorquemeasuma
primero,parammismoyelbienestardemihijo.

175

HIPERCOLESTEROLEMIA (ver: SANGRE COLESTEROL)


HIPEREMOTIVIDAD (ver: EMOTIVIDAD)
HIPERTIROIDIA (ver: TIROIDES HIPERTIROIDIA)
HIPERVENTILACIN (sobre- oxigenacin) (ver tambin: ACIDOSIS,
ANSIEDAD, FIEBRE)
La hiperventilacin consiste en una inspiracin rpida y una expiracin
corta,trayendounexcedentedeoxigenoenelorganismo.Lascausaspuedenserla
acidosis, la ansiedad, la fiebre, un ejercicio fsico intenso. Padezco
hiperventilacin porque no acepto el cambio. Por lo tanto, siento un
sentimientodeinquietudfrentealonuevoydudoenhacerconfianzaalasituacin
actual;rehusoabandonarme.Micuerpomedaunmensajeytomoconscienciade
l. Respiro normalmente, me suelto, me abandono. Mi vida se transforma, me
alegro.Meliberodetodosmistemores.Respiroconalegraenlavida.
HIPO
El hipo est provocado por contracciones espasmdicas repentinas e
involuntariasdeldiafragma.Puedovivirunarebelininterior,unaculpabilidad,un
autoenjuiciamiento.Estoperturbamiorganismo.Siempreel hipo?Puedeser
frecuenteyduradero.Esunaexperienciamuyincmodaydesagradableparala
personaquelotiene.Hayalgoquemeincomodaymedesagradaenloqueestoy
viviendooenloquequisieravivirperoquenosemanifiesta,yquemecausa
frustracin? Hay ruidos, pensamientos que no puedo parar? Est el hipo
programadoEjemplo:cadavezquebebounabebidagaseosa,tengohipo?Tomo
la vida con ms calma. Aprendo a saborear y a apreciar plenamente mi vida.
Aceptoquetodoestensulugar,enelplanodivino,quetodoestO.K.y
desaparecerelhipo.
HIPOACUSIA (ver: OREJAS SORDERA)
HIPOCONDRA (ver tambin: AGORAFOBIA, ANSIEDAD, DEPRESIN,
ALUCINACIONES)
Soy hipocondraco simepreocupodemodoexcesivodemisalud.Puede
volverse para m una obsesin el pensar que podra estar enfermo. Vivo una
profunda inseguridad frente a esta prdida de control que podra representar la
llegadadelaenfermedad.Noaceptopadecerporlaenfermedadporquesenel
fondodemqueyapadezcoenmiser interior.Estetemorpuedevolversetan
176

grandequepuedoabstraermedelarealidadyteneralucinaciones.Necesitovolvera
tomar el contacto conmigo mismo. Utilizando un enfoque energtico o de
psicoterapia,estomeayudaratenermsconfianzaenmyenmicapacidaddivina
deaperturaquepuedomanifestarfrentealavida.
HIPOGLICEMIA (ver: SANGRE HIPOGLICEMIA)
HIPOFISIS (ver: GLNDULA PITUITARIA)
HISTERIA (ver tambin: DESMAYO, NERVIOS [crisis de], NEUROSIS.
Soyhistricocuandovivounaneurosisyqueexpresomiconflictopsquico
demodocorporal,queseabajolaformadeunacrisisdenervios,convulsiones,
prdidasdeconsciencia,etc.Cuandohagounacrisisdehisteria,pierdoelcontacto
conlarealidad,merefugioenloimaginarioypuedotenertendenciaaexpresarmi
conflictointeriorenpblico.Vivounaprofundainsatisfaccinpersonalencuanto
amisexualidad,locualmellevaajugareljuegodelaseduccin,amantenerala
genteadistanciaoinclusoatenerunafrialdadaparenteparaprotegermedemigran
sensibilidad. Cuando vivo tal estado, se pone de manifiesto el dolor y la pena
interiorquepuedasentir.Tengonecesidaddecurarmiheridainteriorparaque
puedarecobrarunmayorequilibrio,unamayorarmonayunapazinteriorms
grande, para acallar mis tormentos. Pido ser guiado para elegir el enfoque
teraputicoquemepermitiralcanzaresteestadodemejorestar.
HODGKIN (enfermedad de) (ver tambin: CNCER de los GANGLIOS
[del sistema linftico], SANGRE LEUCOPENIA)
La enfermedad de Hodgkin es una afeccin cancerosa tocando
esencialmentelosganglioslinfticosascomoelbazoyelhgado.Semanifiesta
porunaprdidadefuerzascausadaporunadisminucindelosglbulosblancos.
Serelacionafuertementeconuna granculpabilidad queestoyviviendo.Tiene
otrascausasimportantes.
- Nomejuzgolo bastantebueno,laestimademestensupuntomsbajo
yendoinclusohastarechazarquemehagancumplidos.
- Temoestardesaprobado.
- Puedovivirungrandesanimo,unaprdidadelsabordevivir(lasangresignifica
laalegra),unaprdidademisdefensas(glbulosblancos).
- Mesientoenunacarrerafrentica;sientolanecesidaddedemostraralosdems
oammismoquesoyalguienyquepuedocumplirgrandescosas.
- Puedo alimentar sentimientos de odio, rencor contra alguien o contra una
situacin.
177

Migranalegra,esamarmeporloquesoy.Mehagoconfianzayvoyamiritmo.
MicuerposeregeneraporquemeconectoconLaFuentequeestenm.
HOMBROS (en general)
Los hombros representanmicapacidaddellevarunacarga.Mis hombros
llevan mis alegras, mis penas, mis responsabilidades y mis inseguridades.
Comocualquierotrapersona,noestoyexentodellevarunacarga.Simehago
responsabledelafelicidadydelbienestardelosdems,entoncesaumentoelpeso
quellevoymeduelenloshombros.Tengolasensacindetenerdemasiadopor
hacer y de nunca ser capaz de realizarlo todo. Puede tambin que tenga la
sensacindequemeimpidenactuar,bienacausadeopinionesdiferentesoporque
simplemente no quieren asistirme y apoyarme en mis proyectos. Tambin me
duelen los hombros cuando vivo grandes inseguridades afectivas (hombro
izquierdo)omateriales(hombroderecha)oquemesientaaplastadoporelpesode
mis responsabilidades., tanto afectivas como materiales. Tengo tanto miedo al
maanaquemeolvidovivirhoy.Lasdificultadesqueencuentro,laresponsabilidad
dedebercrear,hacer,perfeccionar,todoestopuedeaplastarme.Puedoquerer
probarmeque,apesardetodo,puedoenfrentarmeconlassituacionesechandolos
hombroshacaatrs,poniendoelpechomsenevidencia,perolarealidadesque
miespaldaesdbilydistorsionadaporelmiedo.Silaparteafectadademihombro
se refiere a los huesos (fractura, ruptura), esto se relacionar ms con mis
responsabilidadesfundamentales.Silaparteafectadademihombroesmuscular,
estoserelacionarmsconmispensamientosyemociones.Aprendotambina
dejarcircularlaenergademicoraznhastaloshombrosydespus,enmisbrazos,
locualevitarlarigidezyeldolor,porquemishombrosrepresentanlaacciny
tambinelmovimiento,desdelaconcepcinhastalamateria.Pasanatravsde
ellosmisdeseosinterioresdeexpresarme,crearyejecutarporquenacieronalnivel
demicorazn.Laenergaemocionaldebedirigirsehastaenmisbrazosymis
manos para realizar dichos deseos. Si me freno en decir o hacer cosas, si me
encasillo62 en vez de hundirme en la vida, si llevo mscaras para tapar mis
miedosymisaprensiones,mishombrosestarntensosymsrgidos.Sielhueso
demihombrovahastaquebrarseoromperse,existeenmividaunconflictoquees
muyprofundoyquetocalaesenciadeloquesoy.Latensinocualquierotro
malestarquesientaenlareadeloshombrosmedaunaindicacinsegnsetrate
delhombroderechooizquierdo.Simihombroderechoestafectado,setratade
miladomasculinoactivo:puedovivirunconflictoounatensinconrelacinami
trabajo,amimododeactuarfrentealaautoridad.Eselladorecioycontrolador
quegana;encambiosiesmi hombroizquierdo elqueestafectado,latensin
que pueda vivir est relacionada con el aspecto femenino de mi vida, es decir
62

Meencasillo:vienedelapalabracasa,quequieredecirencerrarseenunlugar.Ensentidofigurado,esto
significareplegarsesobres.

178

creativo y receptivo, a mi habilidad por expresar mis sentimientos. Tomo


conscienciadeloquemeaplasta,aceptoquesoyresponsabledeMydejoque
losdemssecuidendeocuparsedesupropiafelicidad.Aprendoadelegar.Un
hombroheladosignificaquesevuelvefroydolorosoyqueestmolestadoensu
completautilizacin.Mevuelvofroeindiferenteconrelacinaloquehago(justo
parahacerlo?)opuedorealmentehacerlo?Existeunaprofundatensinqueme
indica que quiero realmente hacer algo diferente de lo que hago actualmente.
Tambinaceptoaprenderavivirelinstantepresente,locualmepermitealiviar
elpesoquellevoenmis hombros.Hagoconfianzaaluniversoqueatiendemis
necesidadescotidianas.
HOMBROS ENCORVADOS
Los hombros encorvados dan comnmente lugar a expresiones como
JorobadeBisonteoJorobado.Ademsdetodoloqueserefierealdolorde
hombro,loshombrosencorvadossimbolizanquedejodelucharfrentealaviday
supeso.Yanopuedollevarlotodosoloycreoqueessinesperanza.Ademsde
llevartodosmisnumerososproblemas,tengolasensacintambindetenerque
llevar el peso de la gente que me rodea. Su destino est entre mis manos!.
Arrastromuchaculpabilidadfrenteamipasado.Siademsmis hombros estn
crispados,hayunconstanteestadodetensininteriorenm.Estoyconstantemente
al acecho, listo para resolver cualquier situacin imprevista, tomando as la
responsabilidaddelafelicidaddelosdems.Acepto queestiempoquecuida
demyquedejequelosdemssecuidendesufelicidad.Estetipodedesviacin
pronunciadademicolumnavertebraltambinpuedeindicarmeunaobligacinala
humildad.Pocoimportalaraznanteriordemiestado,deboaprenderadesarrollar
lahumildadporqueestebloqueoenergticoprocededegrandesiraspasadasque
an me afectan hoy y que se acompaan de mucha irritacin frente a ciertas
personas o ciertas situaciones. Soy responsable al 100% de lo que me sucede,
aceptomieleccin,conscientementeono,ysoyresponsable.Esprobablemente
elretomsgrandedemivida.Estoyalaescuchademivozinterior,meguaenlo
quedebohacerparasermsfeliz.Unmasajeountratamientoenergticopuede
ayudarmeacentrarmeeneltiempopresenteyatomarcontactoconmiyosuperior
parareconocermispropiasnecesidades.
HOMICIDIO
Puedo tener el deseo de matar a alguien. Si alimento este deseo con un
resentimientoyodio,meexpongoalaegregora 63 deenerganegativareferentea
estaformadepensamientoquemeempujarquizsapasaralaaccin.Queslo
quequieromatarenm?Misufrimiento,mirabia,miodio?Miheridainteriorme
63

Setratadeunaenergabajoformadeconsciencia,formadaporelpensamientodevariasounamultitudde
personas.

179

pareceinsoportable.Elsufrimientoquevivoenelinteriormepidevalor.Elvalor
depedirayuda.Elvalordehacerconfianzaaunapersonaquepodracogerme
incondicionalmente.Unapersonaenquienpodrconfiar.
HOMOSEXUALIDAD
Hay una exclusin al Amor? Es una enfermedad la homosexualidad?
Algunosintentanprobarquelahomosexualidadpodraestar inscritaennuestro
patrimoniogentico.Lahomosexualidadesunlenguajedeamorqueestcadavez
msaceptadopornuestrasociedadcontempornea.Puedeserunaetapaenla
bsquedademiidentidadounaeleccindevidaparamievolucinoparahacer
evolucionaralasociedad.Cuntospadressehansuperadoensuamorparaincluir
asuhijogay(nombredadoalahomosexualidadmasculina)olesbiana(nombre
dadoalahomosexualidadfemenina).Elladofemenino(YINointuitivo)yellado
masculino(YANGoracional).Puedequealnoaceptarmiidentidad ,intente
volver a encontrar enuna persona del mismo sexo el lado querechac. Puede
tambin que busque a un padre, una madre. Cualquier sea mi eleccin de
orientacinsexual,esimportantequelohagaenarmonaconmiser.Sielijola
homosexualidadporquerechazoalaspersonasdelotrosexoporunmotivouotro,
volveravivirsituacionessimilaresalasquehubiesetenidoquevivirconpersonas
del otro sexo, porque tengo que hacer estas tomas de consciencia. Cuando mi
eleccindeorientacinsexualesclaraparam,seayohomosexualoheterosexual,
nodeberasentirmeamenazadoporlosquetienenunaorientacindiferentedela
ma.Siestoyenreaccinconlosquetienenunaorientacindiferentedelama,
entoncesdebopreguntarmeseriamentedequtengomiedoenestasituacin.De
qunecesitoprotegermeestandoencontra?Tendrayomiedodetenerunaspecto
mo que es homosexual y de confesrmelo? Debo tomar consciencia que la
importanciadebeestarpuestaenelamorquedospersonastienenentresyqueeste
amordebeserverdaderopocoimportasuorientacinsexual.Puedopediramigua
interiorquemeayudeacomprenderalniveldelcorazn,deaceptarme tal
comosoyyaceptaralosdemstalescomoson.
HORMIGUEO
El hormigueoesunasensacindepicorenlasuperficiedelcuerpoquese
producehabitualmentedemodoespontneodespusdeunacompresinmecnica
deunnervioodeunvasosanguneo.Ellugarenelcualseproduceelhormigueo
enmicuerpomeindicalacontrariedadolairritacintemporalquepuedequeest
viviendofrenteaunaspectodemivida.Tomoconscienciadeelloydejocircularla
energalibremente.

180

HUESOS (en general)


Los huesos son el armazn slido del cuerpo, los pilares. En el mismo
interiordelhuesoexistelamdula,elncleomshondodemiser,ahendonde
nacenlasclulasinmunesqueposeenlahabilidaddeprotegerme.Los huesos se
refierenamiestructura,elarmaznfundamentalenelcualestconstruidomiser
entero.Porlotanto,serefierentambinalaestructuradelasleyesyprincipios
fundamentalesconloscualesdebotransigircadadayqueestnaplicadosporla
autoridad(polica,maestros,padres,etc.)parapermitirmetenerciertoapoyoy
paraquereineelorden.
HUESOS (dolores de los )
Dolenciasoenfermedadesdeloshuesosreflejan,incluidoelcncerdelos
huesos,unarebelinfrenteaestaautoridadalacualresistoyfrentealacual
incluso puedo ir hasta rebelarme, sintindome incapaz o impotente para actuar
frenteaciertasituacindictada,sometidaaciertasleyesoprincipiosexistentes.
Puedo preguntarme si me siento profundamente trastornado o perturbado con
relacinamiscreenciasbsicas,amisconviccionesntimas.Siunadolenciaouna
enfermedadafectamishuesos,debopreguntarmefrenteacualfacetaoaspectode
mi persona me desvalorizo. Si miro y analizo cul parte del esqueleto est
afectada,tendrunabuenaindicacinencuantoalaspectodemiexistenciaque
esttocada.
HUESO (cncer de los ) (ver tambin: CNCER [en general]
Sitengouncncerdeloshuesos,vivounconflictomuyprofundoenelcual
tengolaimpresinquenovalgonada,quesoymenosquenada.Tengolasensacin
deno tener ningn valor yestoy tan lleno deemociones queguardopara mis
adentroslasquememojanhastaloshuesos.Puedequevivaunasituacinenque
misestructurasymisprincipiosestnfundamentalmentequebrantados,opuestos
en entredicho. Esta situacin puede haberme pillado por sorpresa y me siento
alcanzadohastaelhueso.Deboaprenderareconocermiscualidades.Hacindome
msabiertoyflexiblepodrmsfcilmentetransigirconloinesperadoylono
convencional. Aprendiendo a expresar lo que vivo, las emociones que vivo
frecuentementemuyintensamente,podrcurarymishuesospodrnregenerarse.
HUESO (cncer de los ) sarcoma de EWING (ver tambin: CNCER
[en general])
Esunaformadecncerdeloshuesosqueesmssusceptibledesucederme
entrelos10ylos15aos,aunqueseaescaso.Estecncerafectaloshuesosdemis
piernas,estosignificaungranmiedodeandarporlavida.Temonotenertodolo
necesario para afrontar el futuro. Mi cuerpo grita de dolor delante de la
inseguridadquemehabita.Meparecequenotengolatallaparainsertarmeenel
181

mundodelosadultos.Aprendoaconfiarenlavidasabiendoquestameaportar
lasocasionesquenecesitoparavivirensociedad.
HUESO ACROMEGALIA
La acromegalia secaracterizaporuncrecimientoexageradodeloshuesos
delasextremidadesydelrostro.Lahormonadecrecimientosesecretarpuesen
cantidadmuchamsgrandequelonormal.Siestoyenestasituacin,mepregunto
culeslasituacinenquemehesentidomspequeoparaalcanzarorealizarun
proyecto.Dndemesentdemasiadopequeo,demasiadodiminutoydemasiado
dbilparapodertomarmilugaryhacermerespetar?Larespuestademicuerpofue
elcrecerdesmesuradamenteparaayudarmeatomarmsfcilmentemilugar.Le
doylasgracias!
HUESO FRACTURA (sea) (ver tambin: ESPALDA FRACTURA DE
LAS VRTEBRAS)
Loshuesosrepresentanlaestructuradelasleyesyprincipiosdelmundo
en el cual vivo. Cuando hay fractura, sta es la indicacin de que vivo
actualmenteunconflictointeriorprofundo.Puedeestarenrelacinconrebelin
oreaccionesfrentealaautoridad(delacualquierocortarme).Estafracturame
sealaquenopuedoseguirasyqueseimponeuncambio.Lalocalizacindela
fracturameinformaencuantoalanaturalezadeesteconflicto.Silafracturatuvo
lugarenunaccidente,hayqueverculeslaculpabilidadquevivoconrelacina
esta situacin. Los huesos representan tambin el sostn, la estabilidad y una
fracturapuedeserunavisodequehedesepararmedemipasado,dejarloircon
flexibilidadparaevitarunestrsintilypasaraotraetapademievolucin.Me
condicionanmisnormashacammismoolasociedadalpuntodequeexija
cierta perfeccin e incluso sea rgido? Prest ms atencin en las actividades
fsicasendetrimentodelosaspectosespiritualesdemivida?Pararecobraresta
libertad interior, tomo consciencia de lo que me molesta. Acepto amarme
suficientemente para expresar lo que siento. Encontrando otra vez mi libertad
interior,recobrolalibertaddemismovimientos.
HUESOS DEFORMIDAD
Loshuesospuedendesformarseacausadelapresinquemeimpongooque
tengolasensacindetenerquesoportar.Soymsrgidomentalmente.Tengoque
aprender a ser ms flexible conrelacin amis principios devida. Mi apertura
mentalmepermitirapreciardiferentesfacetasdelavidaydescubrirqueelamor
espresentebajodiversosaspectos.

182

HUESOS DISLOCACIN
Lapalabra dislocacin (dislocacin)significaunaprdidadelocacin),
comosiestuviesefueradecircuitooenunavatotalmentecontrariaaloqueest
sucediendo. Una dislocacin est vinculada a un profundo sentimiento de
desequilibrio.Alniveldelaarticulacin,elhuesosedesplazaysaletotalmente
delsitiodesta.Ladislocacinmerevelahastaqupuntonoestoyonomesiento
enlabuenadireccin.Elhuesoestvinculadoalncleodemiser,alaenerga
fundamental,ladislocacinindicaunprofundocambioenlaenergamsprofunda
demiser.Antengomilugareneluniverso?Quesloquememolestaalpunto
de sentirme tan confuso? Compruebo y acepto hacer la(s) toma(s) de
conscienciaqueseimponen,locualmepermitirsuperarmeyveralgonuevoen
mivida.Ladislocacineslobastantedolorosacomoparaquetomeconscienciade
quedebocambiarparanovolveravivirla.
HUESO OSTEOMIELITIS
La osteomielitis esunainfeccindelhuesoydelamduladelhuesoque
sueleafectarunapartesituadacercadeunaarticulacinyseproducegeneralmente
enlosniosolosadolescentes.La osteomielitis seencuentrasobretodoenlos
huesos largos tales como la tibia, el fmur, el hmero. Las articulaciones dan
movimiento y expresin a la energa contenida en mis huesos. Una infeccin
implicaunairritacinquecreaunadebilidadinterior.Vivoirayfrustracinfrentea
laautoridadyfrentealmodoenquelavidaestestructuradayregimentada.
Tambinpuedotenerlaimpresindenoestarbastantesostenidoysoportado.Pero,
debo aprender a hacer confianza, a soltar y a aceptar que el Universo me
soporta. La infeccin slo quiere evidenciar ciertos conflictos que vivo
actualmente.Sila osteomielitis vienedeunaheridaanterior,esposiblequelas
causasoriginalesdeestaheridanohayansidoantratadas.
HUESO OSTEOPOROSIS
Laosteoporosisimplicaunaprdidadelatramaproteicadeloshuesosque
sevuelvenporosos.Implicaunaprdidaenlaintencindeldeseodeser,una
prdidadeintersydemotivacindeestaraquenelnivelmsprofundodes.
Vivodesanimo.Estoycansadodesiempretenerquelucharcontralaautoridado
contralasleyesdelserhumano.Laosteoporosisaparecenormalmenteenlamujer
despusdelamenopausia.Alestarafectadosloshuesos,esdecirmisestructurasy
creencias debase, puedopreguntarmecules son lascreencias alas cuales me
enganchoyquequizsdeberacambiaryaqueahora,yanopuedotenerhijos.An
puedosertilyproductivanoenloqueaprocreacinserefieresinoaotros
niveles, tanto personal como social o profesional y esto se revela igualmente
valorizadoryenriquecedor.Debopuessuperarestatendenciaadesvalorizarme,
183

pensandoquesoyintil,buenoparanada.Hedeconfiarenlavidayhallarme
nuevasfuentesdemotivacin.
ICTERICIA (ver tambin: HGADO [dolores de], SANGRE / [dolores
de]/ CIRCULACIN SANGUNEA)
Laictericiaestcausada:
- porunexcesodebilirrubina,subproductodelhgadoquedescomponelas
viejasclulassanguneasrojas.
- Porelexcesodebilisqueentraenelflujosanguneo.
Elresultadoesunacoloracinamarilladelapielydelaparteblancadelojo.
Esto se relaciona con la limpieza del sistema sanguneo, y tengo dificultad en
limpiar mis emociones. Siento emociones amargas muy intensas de envidia,
disgusto,frustracin,hastaelpuntodetenerunaictericiadeestasituacinyme
vuelvoamarillo.Vivomuchorencor.Mevuelvotancortanteyexcesivoenmis
ideas y mis opiniones que me agarro a ellas, creando un desequilibrio en mi
interior.Deboaprenderaabrirmealagentequemerodeaporquetengomuchoque
aprenderdeellos.
IMPACIENCIA (ver tambin: NERVIOSIDAD, SANGRE HIPOGLICEMIA)
Laimpacienciadenotaunestrsinterior,unainseguridadounatensinque
mehacetambalearyafectamisistemanervioso.Mevuelvomsirritable,ms
expeditivoenloquehededecirohacer.Necesitotomaralgunosmomentospara
relajarmeyparaencontrarlafuentedemiirritacin.
IMPOTENCIA (ver tambin: ANGUSTIA, ANSIEDAD, MIEDO)
Comohombre,sisoyincapazdeobteneromantenerunaereccindurante
unarelacinamorosa,entoncespadezcoimpotencia.Estomellevaseguramentea
vivir insatisfaccin en mis relaciones sexuales. En el nivel mdico, aunque la
impotenciapuedaserorgnica,esdecirprocederdeunacausafsicaoprocederde
unaspectopsicolgico,deboconsiderardesdeelpuntodevistametafsicoquela
causaprocededeunfactorpsicolgicoometafsico(msalldelofsico),incluso
inconsciente. La impotencia frecuentemente est vinculada al miedo de
abandonarseaunamujer64 ytambindeperderelcontrolfrenteasmismoo
frente a la otra persona. Siendo hombre, frecuentemente tengo muchas
responsabilidadesypuedovivirmuchatensinyestrseneltrabajo,ylasociedad
engeneralmepidequetengaexcelentesresultados.Transponiendoestapeticinen
misexualidad,puedosentirunapresinsexualquemeempujaaoptimizarycrea
unagrantensininteriorquemehaceperdermismedios.Alnoatrevermea
hablardeelloconmipareja,mepongoavivirmuchaculpabilidad,confusinhasta
64

Oaunhombresimisrelacionessexualessehacenconunhombre.

184

tenermiedodeperderalaotrapersona.Unagranangustiasentidadurantemis
relacionesamorosaspuedeprovocarestebloqueoquemehacevivirimpotencia.
Estaangustiapuedeprocederdelhechoque,duranteunarelacinsexual,estoyms
en contacto con mi aspecto afectivo. Como hombre, no estoy acostumbrado a
maniobrar con mis emociones. Estoy en contacto ms consciente con mi hijo
interiorheridoquepuedevivirinseguridad,miedo,rechazo,incomprensin.As
quesienmisrelacionesamorosasanteriorestuvelasensacindevivirfracasosque
me parecieron desvalorizantes, entonces podr no sentirme a la altura de la
situacinduranteunaprximarelacinsexual.Miinseguridad,misentimientode
incapacidad y fracaso, de odio de m, de culpabilidad o de negligencia puede
llevarmetambinavivirimpotencia.Puedovivirlamarchademimujercomouna
separacintantoenelplanoemocionalcomofsico.Comoqueelcontactosexual
ya no es posible, mis rganos sexuales pierden su sensibilidad. Tambin la
impotenciapuedetenersuorigenenunsucesopasadoquememarc:puedenhaber
abusadodemfsicamenteopsicolgicamenteenlatiernainfancia;puedoguardar
rencorfrenteaunarelacinafectivaanterior,teniendolasensacindequehesido
vctimadeunatraicin.Tambinlaimpotenciaesunmododetenerpodersobreel
otroreteniendosexualmenteaunaparejaqueabusaopidedemasiado.Puedotener
lasensacindequemiterritorio(misposesiones,mientornoinmediato,loconlo
cualmeidentifico)estenpeligro.Puedotenerunaprdidadeintersparalas
mujeres en general, lo cual se transpondr en el plano fsico si perdura el
desinters.Finalmente,siidentificomiparejaconmimadre,sistaocupaunlugar
demasiado importante en mi vida, sometindome a ella y teniendo miedo de
disgustarle, sintindome impotente en hacerla feliz y complacerla, esto podr
transformarseenimpotenciasexual.ElcomplejodeEdipo65nosehavividobien
probablemente.Debovolveradefinirmilugar,tomarcontactoconmisemociones
ysoltarelcontrolparaquecirculelaenergalibrementeentodomicuerpo,envez
dequedarseenmicabezaparatraerunarelajacinfsicaymental.
INCONTINENCIA (fecal, urinaria) (ver tambin: VEJIGA [dolencias
de])
Silaincontinenciaesfecalincapacidadenretenerlashecesourinaria
prdidas involuntarias de la orina ambas situaciones se refieren al control.
Puedequelavidaquieraensearmeasermsflexibleyasoltaralagenteylas
situaciones.Laprdidadecontrol,biendemishecescomodemiorina,meobligaa
hacer una toma de consciencia en este sentido. Debo dejar de lado mis
pensamientos rgidos que slo son una proteccin que me impongo para
protegermedemisensibilidadahdondenopuedocontrolarlasituacin.Eneste
casodeincontinenciafecal,puedopreguntarmeculeslapersonaolasituacin
quemejoroba.Puedequeestenfuertereaccinfrentealaautoridadyelhecho
65

ComplejodeEdipo:Secaracteriza,eneldesarrollodelnio,generalmenteentrelos3ylos6aos,porunfuerte
lazoafectivoparaelpadredelsexoopuesto:elhijohacasumadre,lahijahacasupadre.

185

dedebersufrirestaautoridadmellevaavivirestasituacindeincontinencia.Para
m,laautoridadpuedeserlapropiavidaquemellevaarealizarcambiosqueno
quierohacer.Puedoiraverenmiinfanciaquienrepresentabalaautoridadparam
ysiestuveenreaccincontraella.Enelcasode incontinenciaurinaria,esta
liberacinincontrolableeinconscientedeemocionesnegativasquerepresentala
orinapuedeserunmedioderecibirmsatencinyafecto.Lacausasubyacentede
esto puede ser un sentimiento de rechazo, de no tener ningn mrito, de
inseguridad,detenermiedodelfuturo.Laorinarepresentaemocionesnegativas
normalmente soltadas cuando ya no son necesarias o deseadas. Esta liberacin
frecuentementenocturnaindicaunconflictoaunnivelmsprofundoydelcualni
siquieratengoconsciencia.Siendoincapazdecontrolarlaprdidadeorinaode
heces, soy incapaz de controlar lo que sucede en mi vida, en particular las
emociones,yestomedamiedo.Esimportantequeestosmiedoseinseguridades
interiores se expresen. Tambin puedo dejar ir demasiado fcilmente cosas o
personas que amo, sin tener el valor o la fuerza de ir a buscar lo que quiero.
Teniendomuchasesperasfrentealavida,estoydecepcionadoymedejoir,esto
puedesertantoconrelacinamicuerpocomoamimente.Ungranmiedoo
nerviosidadpuedetambincausarlaincontinencia,sobretodoenlosnios.Tomo
conscienciaqueesimposiblecontrolartodoloquesucedeenmivida.Aprendoa
hacerconfianzayaprendoaamarlonuevoyloinesperado.
INCONTINENCIA PARA EL NIO (ver: PIPI EN LA CAMA)
INDIGESTIN (ver tambin: ENVENENAMIENTO [, POR LA
ALIMENTACIN],
DOLOR
DE
BARRIGA,
NAUSEAS,
SALMONELLOSIS)
Elestmagoesellugarporelcualmicuerpofsicoasimilaelalimento.Si
tengo una indigestin, mi cuerpo expulsa este alimento y estoy afectado por
nauseas, vmitos o dolores abdominales. Es lo mismo para la realidad, los
pensamientos,lossentimientos,lasemocionesquevivoyquevantambinacausar
una indigestin sitengodificultadentransigirconstas.Hayundesorden,una
desarmonaenelinteriormo.Culeslasituacinolapersonaquemeresulta
difcildigerir?Quesloquesucedeenmividayqueyanoquierosoportar,
porquetodoestoalavez,esexcesivo?Inclusopuedollegaraestarenrebelin
contraestasituacinocontraestapersonaquecriticoseveramente.Estopuede
tambinseralgoquehevistouodoquemeeradesagradableyquenopasabien.
La ansiedad, la inseguridad me pondrn el estmago al revs y al no poder
realizarsenormalmenteladigestin,voyaecharfsicamenteelalimentocomoecho
las nuevas ideas o situaciones que vivo. Aprendo a poner el amor en la o las
situaciones porque tengo una toma de consciencia por hacer. El amor es el
186

ingredientequemeayudaradigeriryadejarpasarlassituacionesenmivida,en
armonaconmiser.
INFARTUS (en general)
Demodogeneral,uninfartoeslamuertedeunapartedelostejidosdeun
rgano,tambinllamada necrosis,originadaporlaobstruccindelaarteriaque
traalasangreenestarea.Aunquereascomoelintestino,elbazo,loshuesosy
las venas puedan estar afectadas, las reas ms expuestas son el cerebro, los
pulmonesyelmiocardioqueesunaenvolturadelcorazn.Alestarinterrumpida
bruscamentelacirculacinsanguneaporuncoagulooundepsitodelpidos(una
especiedegrasa)enunaarteria,estoimplicaquelaalegrayanocirculaenesta
rea, trayendo incluso la muerte de los tejidos. Segn la rea afectada, puedo
preguntarmeloquehallevadomicoraznadecirme:basta,yanopuedoms,
unapartemaseestmuriendo!.Debocomprobarculessonlasnecesidadesque
pudedesatenderydequmodopodravolveraponerlascosasenordenenmivida
paraayudarmeavivirplenamenteexperienciasllenasdealegraysatisfaccin.
INFECCIONES (en general) (ver tambin: ANEXO III, DOLOR, FIEBRE,
INFLAMACIN, SISTEMA INMUNITARIO)
La infeccin se define por el desarrollo localizado o generalizado de un
germenpatgeno66enelorganismo,bienseanbacterias,virus,hongosoparsitos.
Estasituacinseproducecuandoelsistemainmunitarionoconsiguecombatireste
germeninvasor.Enmivida,estegermenpuedeestarvinculadoaunasituacinoa
unapersonaconquienvivounconflicto,generalmenteinterioryquenoexpresa
nadie.Alnohaberseresuelto,stebrotarbajoformadeinfeccin.Elhechode
vivirirritacinountrastornodebilitamisistemainmunitarioquenopuedeimpedir
quesemanifiesteunainvasin.Debopreguntarme:Quesloquemeirritaome
afectatanprofundamente?Puedovivirundesordenountraumatismoemocional,
una crisis familiar o en el entorno profesional, o vinculado al hecho que vivo
demasiadoestrsconlavida.Deboaceptar loscambiosencurso,dejandode
lado la gran ira que pueda vivir. La significacin de esta ira ser tanto ms
importante si la infeccin est acompaada de dolor o fiebre. Es importante
observar cul parte de mi cuerpo est afectada. Se trata por ejemplo de una
infeccindemisrganossexuales,vivounasituacinconflictualquemeirritay
mehacevivirmuchairafrenteamisexualidadoalmodoenquepercibosta.La
infeccinsubsistirmientrasnohearregladolasituacin,ypuedotardarenhallar
unasolucinporquetengomiedodelasconsecuenciasydeloscambiosqueesto
traer en mi vida. La infeccin se produce generalmente despus de un
debilitamientodemisistemainmunitario,locualimplicaqueeselamordemlo
queestenjuego.Debopreguntarmeculessonlasactitudes,pensamientosque
debocambiarolasaccionesquedebotomarparaponermsamorenmivida.S
66

Patgeno:cualificaloqueconducealaenfermedad.

187

quelagentefeliztieneunsistemainmunitariofuerte,entoncestomolosmedios
paraquecrezcaelamorenmyqueas,elamorseamiescudo,miproteccin.
INFLAMACIN (ver tambin: ANEXO III)
Una inflamacin es una reaccin local del organismo contra un agente
patgeno, caracterizada por el color rojo, el calor, el dolor y la tumefaccin
(hinchazn). Es la expresin corporal de una inflamacin interior. Estoy
encendidoy rabioso por algooalguien,yestoseexpresapormicuerpo.Debo
preguntarmeculaspectodemividameestvolviendorojodeira,hirviendo,
y finalmente me llevar a vivir culpabilidad, si sta an no es la causa de la
inflamacin.Esimportantemirarculpartedelcuerpoestafectadaparateneruna
informacinsuplementariasobrelacausadela inflamacin.Esimportanteira
comprobar si se ha vivido una dificultad sexual en el pasado, reprimida y no
resuelta,obiensivivunsentimientodeprdidaquenoaceptyhacaelcual
vivomuchairritabilidad.Entoncesserposibletomarconscienciadeestasituacin
ytenerunacomprensinnuevaypositivadesta.
INQUIETUD
Lainquietudsemanifiestaporagitacin,angustia,aprensin.Miinquietud
puedetenersufuenteenmiinfanciaprincipalmentesivivinseguridadfsicao
social, o si tuve la sensacin de carecer de algo en el plano afectivo, de mi
educacinosimesent abandonado enciertomomento.Esta inquietud puede
reapareceralaedadadultacuandovivounasituacinsimilaralaquevivenmi
infanciaycuandoreactivaestesentimiento.Deboaprenderaconfiarenlavida.
Debo aprender tambin a hacerme confianza. Debo estar ms fuerte que mis
angustiasparacontrolarlasenvezqueseanellaslasquemecontrolenyalimenten
misentimientodeimpotenciafrentealavida.
INSOLACIN (ver tambin: ACCIDENTE, CALOR [acaloramiento], PIEL)
Si me expongo demasiado tiempo al sol, corro el riesgo de tener una
insolacinquesetraducirporunaquemaduradelapielyunacaloramientoquees
unasubidademitemperaturaenmiscentrosnerviosos.Bienporaccidente(me
dormalsol),bienporunclculoerrneodeltiempodeexposicin,oporcualquier
otra razn, vivo probablemente una culpabilidad para hacer que la vida me
castigue de este modo. Si estoy de vacaciones, puedo preguntarme si pienso
merecer realmente dichas vacaciones. La piel est en relacin con lo que vivo
interiormenteyloquevivoexteriormente.Puedequevivafrustracinvinculada
conelhechodetomarconscienciadequemivida,exteriormente,noessiemprelo
quequisieraqueseainteriormente.Laintensidaddelaquemaduradelsolodel
acaloramiento me indica la importancia de cierta forma de desesperacin que
188

albergo.Necesitoaumentarmiestimadem,reconocerquiensoy,apreciarmeen
mijustovalor.Pidoalavidaquemeenseeymeayudeaapreciarlascosasbellas
quemeda.Asirradiarmsyyanotendrnecesidaddequeelsolmepique
pararecordarmequetomemilugarenlavida.
INSOMNIO
Laincapacidaddedormircorrespondeaunprofundomiedoaabandonarse
ysoltarse.Vivoinseguridadyquierotenerelcontrolsobretodoloquesucedeen
mivida.Sinembargo,cuandoduermo,misfacultadesmentalesduermentambin
y soy ms vulnerable, porque mis sentidos son ms alertas y abiertos a lo
desconocido.Poresto,guardandomimentalocupadocontodotipodeideas,todo
tipodesituacionesinclusoficticiaseinventadasporm,impidoquemeganeel
sueo.Mividaestcoloreadaconlatensin,laansiedad,laculpabilidadyaveces,
incluso,ciertaparanoia.Estopuederesultardeunsentimientodequemiegoomi
supervivenciayahansidoamenazadosenciertomodo,locualescomprensiblesi
experimentciertostraumatismosprofundos,talescomounrobo,unaviolacin,
etc. Hay probabilidades de que sienta una nerviosidad extrema y que tenga
dificultadencolocarmeytomardecisiones.Estambincomosimuriesecadavez
quemeduermoyestodespiertatemoresalodesconocidodelanocheenparticular.
Elinsomniopuedeestarfuertementerelacionadoconlaculpabilidadconscienteo
inconsciente.Porunmotivouotro,puedotenerlasensacinquenomemerezco
descansar.Quizsporquemesientoculpabledenotenerxitoenlavida,nohacer
todo lo necesario para mis hijos, etc. Tambin puedo haberme programado
pensando que dormir es una prdida de tiempo. La glndula del timo est
estrechamente vinculada al sueo y, a la vez con la energa del corazn. El
insomniopuedeestarvinculadoamiaptitudaamarme,ahacerconfianzaalamory
porelmismohecho,alavida.Aprendoarelajarmeyasoltarelcontrolparadejar
queelsueorecuperesulugarenmivida.
INTESTINOS (dolores de los) (ver tambin: CNCER DEL COLN /
DEL INTESTINO, INTESTINOS / COLITIS / ESTRENIMIENTO /
DIARREA, INDIGESTIN)
El intestino eselcentrodeabsorcineintegracindelalimentoydelos
alimentoscomoeldelospensamientos,lossentimientosydemirealidadactual.
Todoloquemecausatristeza,temor,confusin,rebelin,vergenzaocualquier
otropensamientoosentimientodiscordantespuedeencontrarunaliberacinycrear
problemas intestinales. La digestin se hace a este nivel, por lo tanto si tengo
contrariedadesyquemesientovctimadeungolpebajo,deunamalajugada,o
que tengo la sensacin que alguien me ha hecho una mala pasada, tendr
malestarenlosintestinosporquenodigerirsencillamente!Estarparticularmente
afectadosisetratadeunmiembrodemifamiliaqueeselcerdo.Alpoderdigerir
189

estasituacin,semanifestarporunproblemaalniveldemis intestinos.Siest
afectadomiintestinodelgado,puedotenertendenciaajuzgarlassituacionesque
sepresentanamteniendoopinionesmuymarcadasconrelacinamisnocionesde
bien y mal. Tambin tendr tendencia a tener la sensacin de carecer de
muchascosasenmivida.Losintestinos(enparticularelintestinogordo)tambin
estn vinculados con mi habilidad a dejarme ir, a sentirme suficientemente en
seguridadinteriormenteparaserespontneo.Misintestinossimbolizanelhechode
dejar circular los acontecimientos en mi vida. Puedo tener una necesidad muy
fuerte de retener y controlar lo que me sucede. Me agarro a ciertas cosas, a
personasosituaciones,inclusohastavivircelosyposesividadymis intestinos
estncongestionadosportodoloqueretengoyqueyanoestil,pudiendocausar,
entreotrascosas,elestreimiento.Aprendoaserautnomoyadecirmequetengo
todoslosrecursosnecesariosenelinteriordemparacrearloquequiero.Lanica
personasobrequienpuedotenercontrol,soyyomismo!
INTESTINOS CLICO (ver tambin: GAS)
Elclicoesunacontraccinocontraccionesresultantesdeunagrantensin
interior,unasituacinquemehaceperderseguridadyquemeponetannervioso
que aparecen la congestin intestinal, los dolores del estmago, de los canales
glandularesydelasvasurinarias.Dudodemiscapacidades,carezcodeconfianza
enm,tengomiedodenoestaralaaltura,ignorocmohacerpararesolverun
problema.Unejemplotpicoqueserefierealos clicosdelrecinnacido,esel
mo cuando, como madre, tengo miedo de no cuidar bien de mi beb
correctamente, de no hacer suficientemente. El beb siente interiormente mi
ansiedadysevuelve,asuvez,inquieto(elnioquesufrede clico debeestar
rodeadodecalma,pacienciayamor).Aceptoqueenlavida,todosucedapara
lomejor.Porlotanto,suelto,hagotodomiposibleconamor.Loqueveacomo
problemaseinseguridadessevuelvesencillamenteexperienciasquemeayudana
proseguir mi evolucin y a crecer. Ejercicios de respiracin, relajacin y
meditacinpuedenayudarmeatomarcontactoconmiserinterior,arealizartodas
las fuerzas que estn en m y hacer desaparecer mi impaciencia frente a una
personaounasituacinquemeirrita.
INTESTINOS COLITIS (mucosidad del coln) (ver tambin:
INFLAMACIN, INTESTINOS)
La colitis (itis = ira) es una inflamacin a veces ulcerosa del coln, el
intestinogordo.Elpapeldelcolnpuedecompararseamimododecomportarme,
detratarconmipropiouniverso.Cuandosoyincapazdeseryomismofrenteala
autoridadyfrenteamisrelacionespersonales(cnyuge,padres,profesores,jefes,
etc.)controlomisgestosymisaccionesporquetemolareaccindelapersonade
190

quien puedo recibir la aprobacin y el amor. Las colitis frecuentemente se


presentan enlosniosquetemenlasreacciones desus padresquemanifiestan
muchaseveridadyquesonmuyexigenteshacaellos.Necesitotantoafecto,amor
y valorizacin que quiero complacer a toda costa (incluso hasta ahogar mi
personalidadymisnecesidadesfundamentales).Nosoyyomismoynomeatrevo
aexpresarmisemociones;lasinhibo.Reprimovariasvecescosasqueencuentro
indigestas. Esta dependencia afectiva me lleva a vivir ira que me roe
interiormente,frustracinyhumillacin.Sivivoestossentimientosensumogrado,
brotarunalcera.Misreaccionesemocionalesmeadvirtieronquedebacambiar
miactitudperonohecomprendido.Ahoraeslasealfsica.Cmoactuar?Acepto
quevengalafelicidaddeloquesientoenelinterior.Aprendoaamarme,aser
yomismoytomomilugar.Adquieroindependenciayautonomaycomprendo
que soy cada vez ms feliz y que acto ahora en conformidad con mi propia
naturaleza.
INTESTINOS ESTREIMIENTO (ver tambin: CNCER DEL COLN)
El estreimiento toma lugar en el interior del intestino cuando los
movimientosmuscularesquepermitenlaeliminacinsehacenenralent,locual
provoca un atascamiento de residuos. Estos residuos slo son la manifestacin
fsicademisideasnegativas,mispreocupaciones,miira,celosquemeentorpecen.
El estreimiento generalmente est asociado a una dieta pobre en fibras
alimentarias. Esto es la indicacin de una gran voluntad de controlar los
acontecimientos de mi vida y que resulta de una inseguridad interior. Soy una
persona muy trastornada que necesita la aprobacin de los dems. Por mi
inseguridad, incluso llego a ser mezquino. Las situaciones favoreciendo el
estreimiento pueden producirse cuando experimento una situacin financiera
difcil,cuandotengorelacionesconflictualesocuandosalgodeviaje,porquees
cuandosoymsvulnerableasentirmeinquietoysinanclaje.Meagarroamis
viejasideasyamisbienespersonales.Loqueyaconozcomepermitecierto
controlymedaunailusindeseguridad.Tengotantomiedoaestarjuzgadoque
rechazomiespontaneidad,meimpidoadelantar.Rechazotambinmisproblemas
ymisemocionespasadas,pormiedoaquevuelvanaafloraryaquetengaque
enfrentarmeaellas.Cundomeautoricatomarmilugaryaseryomismo?
Culeslaltimavezquemesentlibreyllenodeentusiasmo?Quesloqueme
detiene?Deboabsolutamente abandonar todoloqueyanomeconviene, soltar.
Acepto ,aquyahora,liberarmedelpasado,irhacadelanteyvivirunavida
msexcitante.Mesientomsrelajadoyhagoconfianzaenlavida.

191

INTESTINOS CROHN (enfermedad de) (ver tambin: APENDICITIS,


INTESTINOS DIARREA)
La ileitis sedefinecomounainflamacindelaltimapartedel intestino
delgado,elleon,caracterizadaporfuertesdolores.Enelcasodeenfermedades
bacterianas o virales, puede tomar el aspecto de una crisis de apendicitis. Las
infecciones consecutivas al SIDA, y a la tuberculosis pueden provocar una
inflamacindelilenperoloscasoscrnicosagudosserefierenalaenfermedad
deCrohn.Puedetratarsedeunaformadeautocastigodespusdeunsentimiento
intensodeculpabilidad.Estoserefiereamiestimapersonal;nomesientoala
altura,mesientonocorrecto,nosirvoparanada,soymenosquenada.Me
despreciotantoquevengoapensarquenadiemequiereyquequierenquesiento
inferior. Estos sentimientos se aadirn a una situacin en la cual vivo una
carencia,bienalnivelmaterialoafectivo.Tengolasensacindequeelobjetode
estacarenciamehasidousurpadodeunmododespreciable,repugnante.Aesto
puedesumarseelmiedoamorir.Entonces,rugelarebelinmuyprofundamente
adentromo.Estoslopermiteaumentarmitemoraserrechazadoporlosdems.
Altenerlasensacindenovalernada,estaenfermedadmepuedeayudararecibir
laatencinquenecesitoyquenotengolasensacinderecibir.Miestimapersonal
esbajay soydemasiadoabiertoenergticamente,alniveldelabdomen,yrecibo
cualquiercosa incluidolonegativodemientornoyquemepuedeafectar.Me
rechazoalpuntoqueescomosi,energticamente,miabdomensevolvierauna
basuraycomosipermitieraquelagentedemientornovertieraenmsuenerga
negativa.Medejoinvadirporquenoocuposuficientementemilugaryrechazolas
situaciones,locualmehacevivirdiarreas.Estoyenprofundainvestigacindemi
identidadpersonaloespiritualylagravedaddelaenfermedadmeindicahastaqu
puntoestotocaaunaspectodemividaqueesfundamental,inclusoesencial.Los
medios que podra tomar para aumentar mi estima personal y permitir hallar
verdaderamentemiidentidad,ellugarqueocupoenmifamiliaoenlasociedad,me
ayudaranarecobrar lacalmaylaarmonaenmivida.Elhechodeencontrar
verdaderamenteellugarquemecorrespondemedarunaproteccinnaturalfrente
amientorno.Lavidaesbella,yotambintengoderechoavivir!
INTESTINOS DIARREA
La diarrea se manifiesta por un desplazamiento tan rpido del alimento
desde el estmago hasta el intestino que no tiene tiempo de estar totalmente
asimilado.Generalmente esteestadoestcausadoporelmiedooeldeseode
evitarohuirunasituacinounarealidadtotalmentedesagradableo nueva
param.Llegauncaudaldeideasnuevasynotengotiempodeintegrarlas.Me
sientocogidoenlatrampaporalgonuevoparamyestoponemisensibilidad
interioralrevs!Merechazo,meculpoammismoyestoydesesperado!Tengo
unaimagenmuyfeademenelmomentopresente.Meculpabilizo.Estoyvencida
192

por estos acontecimientos. Verdaderamente, necesito algo diferente. No es el


alimentosinomispensamientoslosqueyanovalen.Siconstantementetransporto
laideadelrechazoodelossentimientosderechazo(elmiedodesentirserechazado
oeldeseoderechazaralosdems)ounasituacinenlacualmesientocogido,hay
muchasprobabilidadesdequetengadiarrea.Sinoescucholavidaysusseales
(igual como viven ciertas personas), tambin puede manifestarse tambin la
diarrea.Aceptotomareltiempodever,sentiryescucharmicoraznparaverlo
queocurreen mi vida. As, integroy asimilolas situaciones de miexistencia.
Cuando freno realmente, realizo como iba pasando directo (igual como los
alimentos)sintomareltiempodeverlasbondadesylasbellezasdelavida.Mi
cuerpomeadviertequedebohacerconfianzaalavida,queestoysoportado,que
nadiemeabandona.
NOTA:AlgunosviajerosenvisitaenlospasespobresdelTercerMundotienen
diarrea.Eldescubrimientodeunainmensapobrezaydelamiseriaabreelcorazn
ymolestainconscientementelomentalcomoelorganismofsico.Frecuentemente
esunareaccininconsciente.
INTESTINOS DIVERTICULITIS
La diverticulitis (itis = ira) es la inflamacin de pequeas cavidades
(diverticulos)delasparedesdelcoln(elintestinogordo).Estadolenciasevincula
airareprimidaenmividacotidiana.Actualmentevivounasituacinenlacualme
sientopresoydelacualnopuedoverlasalida;estomecausatensinypresin.
Mesientopilladoenunatrampa.Estomecausamuchodolorypena.Elprimer
pasohacalasolucineslaaceptacin .Cmopuedoarreglarunacosacuya
existenciameniegoaaceptar?Aceptolasituacincomosiendounarealidady
memantengoabiertoalcanaldivinoquemeaportaelamornecesarioparaintegrar
estaexperiencia.Pormiaceptacinymiapertura,diversassolucionesmeestn
ofrecidasporqueyanoestoycegadoporlaira.
INTESTINOS GASTRO ENTERITIS (ver tambin: ESTMAGO /
[DOLORES DE], GASTRITIS, INTESTINOS DIARREA, NAUSEAS)
Lagastroenteritisesunainflamacinagudadelasmucosas gstricase
intestinales caracterizadaporvmitosyunadiarreadeorigeninfeccioso.Puede
quesepuedadeterminarlacausaexternayvincularlaalaingestindeaguao
alimentoscontaminados.Sinembargo,hayqueverlacausainteriorquemeha
hechovivirestesuceso.Aqu,loirritanteesmuchomsimportantequeenuncaso
degastritis,porqueestoafectanosloelpuntoendondeentranlosalimentossino
tambinelpuntodesalidadelprocesodeintegracin,locualindicaqueestoytan
irritadoytanfrustradoporloquemesucedequenopuedoabsorberloquesea.Por
lotantoquierorechazar unasituacinoaunapersonacuandonoeslavida
193

mismayestoyrojodeira,locualmellevaavivirladiarreayelvmito.Tengo
dificultadenaceptar losacontecimientos.Puedoretenerciertosesquemasde
pensamientomentalesahorahechosintiles.Unapersonaounasituacinmees
indigesta yse vuelvecontra m encendindome emocionalmente. Me invade la
desesperacinymisensibilidadesaltamenteperturbada.Deboabrirmeaunanueva
realidad,anuevasideasyavolveraaprenderatenerconfianzaenlosdemsyen
la vida, siendo capaz de manifestar mi disgusto en vez de dejarlo rugir en mi
interiorycrearmemalesdetodotipo.
INTESTINOS RECTO (ver tambin: ANO)
El recto es el segmento terminal del intestino gordo que sigue al coln
sigmodeyllegaalorificioanal.Sialgooalguienenmividamepreocupayjuzgo
estodemalafamaocerdo,quieroexpulsarestacosaoaestapersonademis
pensamientosodemivida.Sinoloconsigo,doloresohemorragiasaparecernen
elrecto.Lasituacinvividaimplicamuygeneralmenteaunoovariosmiembrosde
lafamilia.Aprendoaquedarmeabiertoyaintentarcomprenderelporqudela
situacinquememolesta.Veoque,inclusosiyotengolasensacindequealguien
actumal,estapersonatenaprobablementebuenasrazonesdeactuardeestemodo
enquelohizoyquesusmotivosestabanbienfundados.Estasituacinimplica
frecuentementequemepregunteculesellugarquemecorresponde,adndevoy
en la vida. Mi orientacin sexual podr estar otra vez planteada. Hay un gran
replanteamientoparasaberquinsoy,culdireccindebotomar.Puedosentirme
muysoloyabandonado. Aprendoa reconocer mis cualidades ycreoquepoco
importanlasdecisionestomadas,loqueresultesiempreserparalomejor.
INTESTINOS TNIA o TENIA
La tenia esungusano parasitarioqueseencuentraenelintestinoyque
puedeteneralgunosmilmetrosovariosmetrosdelargo.Tambinllamadogusano
solitario,la tnia sedesarrollaenunapersonaquetienelasensacinquesele
imponen ideas o modos de pensar contrarios a las suyas. Me siento triste e
incomprendido, abusado y sucio. Puedo tener la sensacin que parsitos
merodeanalrededormo.Comoquetengodificultadenafirmarmeyadecirqueno.
Medejorobarmienerga.Laspreocupaciones,laspenasquetengodificultaden
soltarvanafavorecertambinlaaparicindela tnia.Estegustoamargohace
difcilmidigestin.Mispulmonesdejanpasarunaenergacorrompidayseinstalan
gusanos parsitos, conllevando irritacin y nerviosidad. Para curar mi interior,
cuido mis ideas, dejo lugar al placer y a la alegra. Tomo el lugar que me
correspondeenlavida.

194

INTOXICACIN (VER: ENVENENAMIENTO [, por el alimento])


IRA (ver tambin: ANEXO III, DOLOR, HGADO, INFECCIONES)
La ira (clera) es la exaltacin del estado afectivo y un modo de
exteriorizacinbrutaldeste,traducindoseporunaexcitacintantofsicacomo
verbal, progresivamente creciente, yendo hasta gritos, ruptura de objetos,
agresividad, temblores, etc. La ira es un grito de alarma espontneo, la
manifestacin de una rebelin interior, un violento disgusto acompaado de
agresividad.Antesdelosdosaos,esunsimplemediodereaccionaroexteriorizar
unadolenciainterior(fro,hambre,etc.)peroluego,essobretodounmediode
oposicin y de reaccin a las prohibiciones, pudiendo volverse un medio de
chantajeafectivoydedominacin.Estasemocionesquemeinvadensemanifiestan
generalmente al nivel de mi hgado, por la aparicin de toxinas que pueden
engendrar una crisis de hgado. Los pensamientos enloquecen, se atropellan,
crecentantoqueyanoveoclaro.Subemipresinymevuelvorojodeira.Qu
esloquememolestatantoymehaceexplotar?Siestoyiracundo,esimportante
que busque la razn que provoca este estado. Puedo vivir un sentimiento de
debilidad, injusticia, frustracin, incomprensin, impotencia, etc. que puede ser
exagerado o crecido por mi gran emotividad y mi impulsividad. Cuando lo
identifico,comprendoqueelconflictoserepiteinconscientementeyqueincluso
puedeprocederdesituacionesquenoheresueltoandesdelainfancia,yentonces,
laintegracinsermsrpida.Aceptoabrirmealamorquepuedomanifestar
aquyahora.Memantengoatentoy vigilo todaslassealesindicandouna ira
eventualynomesublevointilmente.
ITIS(enfermedadesen)(ver:ANEXOIII)
JOROBADO ( ver: HOMBROS ENCORVADOS)
JUANETE (ver: DEDOS DE LOS PIES JUANETE)
LABIOS
Porloslabios,puedocomprenderlaaperturaolaestrechezmental,loque
quiero o lo que no quiero decir. Puedo percibir tensin, inquietudes, penas o
temoresatravsdelos labios agrietadososecos.Puedensercarnosassitengo
alegra, placer, amor en el corazn, o ms bien delgadas cuando estoy ms
reprimidoeinclusorgidofrenteamisdeseosylosplaceresdelavida.Enuna
mujer,los labios dela vagina sufrenlasmismasrepercusionescausadasporlos
mismostrastornossalvoqueesmsprobablequecualquiermalestaroenfermedad
vinculadaastasserefieraalaexpresindesusexualidadydesufeminidad.El
labio inferior representa mi lado masculino, racional, la razn, y el labio
195

superiorrepresentamiladofemenino,receptivo,emocional.Esimportanteque
expresemissentimientos,tantolosnegativoscuandoestoydisgustado(encaso
contrario,puedenhincharsemislabios)comolospositivostalescomocumplidos,
miafecto,mi aprecio,etc.Porqueesconmislabiosquepuedodar unbesoy
demostrarmiamoralagenteaquienamo.
LABIOS SECOS
Tengolos labiossecos cuandosientoungrancansancio,cuandomesiento
soloocuandotengopreocupaciones.Sevamialegradevivirysientopocoplacer
enmisintercambiosconlosdems.Estaprdidadealegrasercuantomsgrande
si,adems,mislabiosvanhastasangrar.Mepermitoaumentarmicomunicacin
conlosdemsyabrazarlavidaconmsamor.

LADILLAS
Cojoladillasnormalmente,porcontactovenreo.Me sientoculpable,me
sientosucioporhabertenidorelacionessexualesfueradelosmarcospermitidosen
nuestra sociedad o bien puedo tener la sensacin que slo tienen por objetivo
colmarmisnecesidadespersonalessinqueestcomprometidoconlaotrapersona.
Aceptoquetodasituacinvividaesunaexperienciayaprendoareconocermis
necesidadesyloqueesbuenoparam.
LADO DERECHO (ver: MASCULINO [principio])
LADO IZQUIERDO (ver: FEMENINO [principio])
LAGRIMAS (ver: LLORAR)
LARINGE (ver: GARGANTA LARINGE)
LARINGE (cncer de la ) (ver: CNCER DE LA LARINGE)
LARINGITIS (ver: GARGANTA LARINGITIS)
LASITUD (ver tambin: CANSANCIO [en general], SANGRE
HIPOGLICEMIA, PRESIN ARTERIAL HIPOTENSIN [demasiado
baja])
Sientolasitudcuandomicuerpoestcansado.Tengoganasdeabandonar.El
fastidioyeldesnimoseapoderandemicerebro.Frecuentemente,misangrese
196

empobrece,laalegradeviviryaestandocarente.Quierorecuperarelgustodevivir
haciendolascosasqueamo,hacindomeplacer.Estomeayudaraalentarme.
LENGUA
Lalenguaesunrganomuscularalcualestvinculadoelgusto.Siquiero
expresar un pensamiento verbalmente, necesito mi lengua. Si me muerdo la
lengua, debo preguntarme si me culpo por lo que acabo de decir., si vivo
culpabilidad.Tengolalenguadormidaohinchadacuandoquierosaborearmsla
vida, o que tengo disgusto frente a una persona, una cosa o una situacin.
Aprendoasaboreartodaslasalegrasqueseofrecenam.
LENGUA (cncer de la ) (ver: CANCER DE LA LENGUA)
LEPRA (ver tambin: CRNICA [enfermedad], NERVIOS, PIEL / [en
general] / [dolores de])
La lepra es una enfermedad infecciosa crnica que afecta la piel, las
mucosas,losnervios.Lapersonaafectadaporellasesientesucia,impura,nose
estimaalaaltura.Seautodestruye.Sitengolalepra,tengolasensacinqueno
tengolonecesarioparaasumirmivida,misresponsabilidades.Detodosmodos,
memerezcovivir?Tengotendenciaahacermefrecuentementeestapreguntaya
dejarmeir,sintindomeincapazdecambiarnadaenmivida.Aceptodeahora
enadelantealimentarmeconpensamientosdeamoryarmonapararehacermeuna
nuevapielquereflejarmejorelserdivinoquesoy.
LEUCEMIA (ver: SANGRE LEUCEMIA)
LEUCOPENIA (ver: SANGRE LEUCOPENIA)
LEUCORREA (ver tambin: CANDIDA, INFECCIONES, PIEL
COMEZN, SALPINGITIS)
Laleucorreatambinsellamaprdidasblancasoprdidasvaginales.Esuna
infeccinvaginalquedemuestraobienunrechazodetenerrelacionessexuales,o
bien culpabilidad o agresividad haca mi pareja, o bien el hecho de no tener
ninguna.Suelesercausadaporlasensacinquetengodeserimpotentefrenteami
cnyuge, y al tener la sensacin de no tener ninguna influencia sobre l, esta
enfermedadsevuelvecomouninstrumentodemanipulacinquemeharsentir
quecontrololasituacinyporlotantomicnyuge,porquesoyYOquiendecidesi
puedotenerrelacionessexualesono.Debotomarmilugar,reconocermiverdadero
valoryconvencermequesoylapersonaque puedetenerelcontrolsobremy
sobremivida.
197

LINFA (dolencias linfticas) (ver tambin: CNCER DE LOS GANGLIOS


[del sistema linftico], GANGLIO [linftico], INFECCIONES,
SISTEMA INMUNITARIO)
La linfa contieneglbulosblancos,protenasylpidos(formasdegrasa).
Luchacontralasinfeccionesyrechazaloqueesmaloparaelcuerpo.Lasglndulas
hinchadasolosnudoslinfticosbloqueadospuedenimplicarunbloqueoemocional
ounanegacinde lasemociones, dejndomeas sinproteccinyvulnerablea
todoslostxicosinvasoresodainosdeciertossentimientos.Medicequevigile
mispensamientos,queadministrebienmisemocionesyqueaceptequecircule
laalegralibrementeenm.Debovolveraloesencialyponermiatencinenlos
verdaderosvaloresdelavidaenvezdelomaterialylascosasque,enmiopinin,
mefaltan.
LINFATISMO
El linfatismo secaracterizaporunapalidezanmica,unablanduradelos
tejidosyunapielfina.Enotraspalabras,nohacerseviolencia,nohacer nada,
demostrarunadejadez,unacarenciadeaudaciayvitalidad,noencontrarninguna
motivacinenlavida.Esunasealquedebovolveraasumirme,moverme,poner
cosasenmarchaparahacercircularlaenergaysalirdeesteletargoquelellevaa
actuarcadavezmenosyahundirmecadavezmsenlanegatividad.
LISIADURAS CONGENITALES
Unalisiaduraesunadebilidad,unaausencia,unaalteracinolaprdidade
unafuncin.Lapersonapresadeunalisiaduracongnitatendrgrandesretosque
aceptarensuvida.Esimportanteexaminarculeslapartedelcuerpoqueest
afectada.Estoserunaindicacindelretoparticularquesediolapersona.Esta
lisiadura tambin puede resultar de situaciones conflictuales no resueltas que
vivanmispadrescuandoerafetooantes,odemisabuelosobisabuelos,yque
vuelvoavivirparaintegrarlasyaprenderlaleccindevidareferida.
LITIASIS BILIAR: (ver: CLCULOS BILIARES)
LITIASIS RENAL (ver: CLCULOS RENALES)
LOCURA (ver tambin : PSICOSIS)
Lalocura,tambinllamadaalienacinmentalopsicosis,seproducecuando
yanopuedomsyquerechazoelmundoenelcualvivo.Mesientoagredidoy
perseguidodetodaspartes,sobretodopormipropiafamilia.Param,lavidaslo
essufrimiento.Meencierroenmipropiouniversoenelcualmesientomuybien.
Nadamepuedealcanzar.Esmimododecortarmedefinitivamentedemifamiliay
del mundo exterior. Es la huida y la evasin. Puedo liberarme de esta locura
198

recibiendoelamorylacomprensin;sipiensoquemeestalcanzandolalocura,
deboasumirme,aceptarquetodoloquemesucedetieneunarazndeseryque
esto me permite volverme ms responsable, ms libre, ms dueo de mi vida.
Puedoastransigirmsfcilmenteconlasnuevassituacionesqueseofrecenam.
LOMBRICES, PARSITOS (ver: CABELLO SARNA, INTESTINOS
TNIA, PIES MICOSIS)
LORDOSIS (ver: COLUMNA VERTEBRAL [desviacin de la ]
LORDOSIS)
LMBAGO: (ver: ESPALDA [dolores de] PARTE INFERIOR DE LA
ESPALDA)
LUMBALGIA (ver: ESPALDA [dolores de] PARTE INFERIOR DE LA
ESPALDA)
LUXACIN (ver tambin: ACCIDENTE, IRA, DOLOR)
La luxacin serefierealdesplazamientodelasdosextremidadesseasde
unaarticulacin.Puedeserelhombro,elcodo,losdedos,larodilla,lasvrtebras,
la cadera. Frecuentemente, una luxacin se produce despus de un golpe, un
impacto,unmovimientoforzado.Conozcolaexpresinquedice:larodillaseme
hadesencajadooelhombrosemehadesencajado.Segnellugardondesehizo
laluxacin,debopreguntarmeculmiedoogolpeemocionalmedalasensacin
deestarcogidocomosimepusieranenunacaja.As,micuerporeaccionala
inversa,asumiendoelcontragolpeemocional.Tomoconscienciadelalibertadque
tengo en el interior mo y dejo entrar luz interior en todas las situaciones que
parecenlimitarme,paraquepuedadesarrollarmsarmonahacalavida.
LLORAR
Laslagrimassonunderramedelosojos,unaliberacindelasemociones.
Vinculadoconlaalegra,elamor,elmiedo,ladecepcin,elhechode llorar me
liberadeunexcesodesentimientos,pensamientosmuyfuertes.Puedetambinque
misojoshayansidofascinadosalverunaescenaqueerainsoportable,horrorosa,
peromesentaempujadoamirarlacomoparacogercadadetalle.Puedo llorar
tambinporquemesientoincapazdecomunicarloquesiento.Misllantossonuna
evacuacindetristeza,decepcin.Porlotantotengounareaccinquehacebajarla
presin.Tambinpuedousarmislagrimasparaatraerlaatencin,lasimpataafn
dequesecuidendem.Losconductoslacrimalesbloqueadosmeindicanquehay
199

unaresistenciaencuantoamilibreexpresin,vinculadaquizsaestacreenciaque
llorar,sloescosadebebs.Mislagrimas,alsalirdemisojos,metraencon
ellascosasquemeimpidenver,quizspormiedoanopodervercmoserealizan.
Debo dejarlas salir libremente, lo cual me libera de emociones trastornadoras,
conllevandolacuracinylarecuperacindeenergavital.
MAL ALIENTO (ver: BOCA ALIENTO [mal])
MALARIA o PALUDISMO (ver tambin: COMA, FIEBRE, SANGRE (males
de])
La malaria semanifiestaconfiebresfuertes.Escrticaorepresincontra
alguienocontraunasituacin,generalmentedecaraaunasituacinenqueme
sentseparadodealgoodealguienaquienamo.Elrencoryelresentimientosehan
amparadodemymimentalsedivierterumiandoestossentimientosnefastos
param.Paraliberarmedeestafiebre,debointeriorizarmeparadejarsalir esta
tensin,arreglarestasituacin.
MAL DEL AIRE (ver: MAREO DEL MAR)
MAL DE LAS MONTAAS (ver tambin: APETITO [prdida de],
HINCHAZN DE VIENTRE, OREJAS ZUMBIDOS DE ODOS,
NAUSEAS, CABEZA [dolores de], VRTIGOS)
Cuando voy en altitud, puede producirse un conjunto de trastornos que
procedendelhechoqueeloxgenoestahmsescaso.Cuandosuboas,cambio
deniveldeconsciencia,locualpuedeprovocarunimpactoparam.Lostrastornos
quevivoslosonelreflejodemisangustiasydemisheridasinterioresconscientes
oinconscientes.Esciertoquecuantomsenformaestmicuerpofsico,msme
serfcilsoportar,hastaenlofsico,estoscambiosdeconscienciainterior.Debo
aprenderaconservarlacalmayaconfiarenmyenlavidaascomodesarrollar
msestesentimientodelibertadquemehabita.
MAL DE LOS TRANSPORTES (ver tambin: ANSIEDAD, MAREO,
NAUSEAS, VRTIGOS)
Vivoinseguridad,incomodidad.Estomolestamiscostumbresestablecidasy
puedotenerlasensacindeperderelcontroldeloquesucedeenmivida.Me
asustalodesconocido.Debotenerconfianzaenelfuturo,deboaceptar vivir
nuevasexperiencias,sabiendoquesaldrcrecidodestas.

200

MALDAD (ver tambin: RAZN [tengo])


Lamaldadesundeseoenfermizo,odioexpresadoconelfindehacerdao,
bienseaenpalabracomoenaccin.Asquieroprobarmequesoycorrectoyque
tengorazn.Estopuedeprocederdegrandesheridas,locualmellevaavolvermi
resentimientoymifrustracinhacalosdems.Estoyenfadadoconlavidaocon
personasporelsufrimientoquevivo,quierovengarme,pensandohallarenello
algunasatisfaccin.Esunmodoparamdehacersalirmiagresividadparaira
buscarmspazinterior.Cuandopuedoidentificartalcomportamientoenm,puedo
pedir ayuda para estar mejor conmigo mismo. Porque aunque expreso mi
irritabilidadpor maldad,medoybiencuentaqueestoslocalmamisufrimiento
temporalmente.Aspodrdesarrollaractitudesdeaperturaydebondadhacala
gentequemerodeayvivirunapazinteriormsgrande.
MALES DIVERSOS
Cuandovivomalesdiversosmsomenosdefinidos,estoesfrecuentemente
elsignodeunanecesidaddeamor.Necesitoestarconfortado,apretadoenunos
brazosenloscualespodrsentirmecomprendido,aceptadotalcomosoy.Hago
confianza en la vida y voy a buscar este amor que necesito a travs de las
situacionesdelavida,losanimalesylaspersonasqueestnlistasparaprodigarme
esteamor.
MANCHAS EN LA PIEL (ver: PIEL MANCHAS EN LA PIEL)
MANDBULAS (dolores de)
Lasmandbulassonhuesosesencialesparacomer,paraempezarelproceso
dedigestinyasimilacindeloquetomo,bienseaelalimentoolarealidadqueme
rodea.Losproblemasdemandbulapuedenproducirsecuandoaprietolosdientes
porquereprimocosaseinhibotodalaenergarelacionadaconlaira,obstinacin,la
testarudezyquizsentoncesunaganainconscientedevengarmedealguienode
algo. Cuando chirran mis dientes, vivo inseguridad. Tambin pueden estar
descalcificndoseoablandndosemis mandbulas.Merevelancmoyotambin
puedoserblandoenalgunassituaciones,enparticularcuandotengolasensacin
dequeserendemyquenoseprestabaatencinaloquedeca.Sigueunagran
desvalorizacin de m mismo. Tambin puedo sentirme dominado, siendo
impotenteenexpresarme,bienacausademitimidezodemismiedos.Tambin
puedequemeestprohibidohablar,locualinterpretocomoloquehededecir
debesermuypocointeresante!!!.Cuandosebloqueanmismandbulas,estoyen
la incapacidad de expresarme, de controlar lo que me rodea, reprimo mis
emociones.Deborelajarme,dejarlaenergafluirlibremente.

201

MANA (ver tambin: ANGUSTIA, ANSIEDAD)


Las manas soncostumbresqueescondenangustiayansiedad.Esteestado
deagitacintraeunasobreexcitacinenlosmovimientosyunhumorexaltado.Es
unmododebuscarlapazylacalma.Puedeserunaformadehuidayaqueme
obligo a evolucionar siempre en el mismo marco, impidindome as explorar
nuevasavenidas,parasentirmesiempreenseguridadydueodelasituacin.Debo
determinarculeslafuentedeestaansiedadafindeencontrarmscalmainteriory
msarmona.Asverlavidaconmspazyserenidad.Misgestosymisactitudes
estarnmsdeacuerdoconmisabidurainterior.
MANOS (en general)
Lasmanosrepresentanmicapacidadparacoger,darorecibir.Sonlantima
expresindemenelUniversoyelpoderdetocarestangrandequemesiento
impotentecuandoestn lastimadas mis manos.Tienenuncarcter nico:igual
comomishuellasdigitales,representanmipasado,mipresenteymiporvenir.Entre
las manos tengo las situaciones de mi vida diaria y el estado de mis manos
manifiestaenqumedidacaptomirealidad,cmoexpresoelamortantocomoel
odio(bajoformadelpuo).Sitengolasmanosfras,meretiroemocionalmentede
unasituacinodeunarelacinenlacualestoyimplicado.Tambinpuedorechazar
cuidardemisnecesidadesbsicasydecomplacerme.Las manoshmedas me
indicanunacantidadexcesivadeangustiaynerviosidad.Estoydesbordadopormis
emociones,sintindomequizsdemasiadoimplicadoodemasiadoactivoencierta
situacindemividacotidiana.Sitengo dolor o rampas,esquemeniegoaser
flexiblefrentealassituacionespresentes.Debopreguntarmeloquememolestao
loquenoquierorealizar.Puedotenerunsentimientodeincapacidadovivirungran
miedoal fracaso. Estomellevaaquerer controlarlotodocon mis manos,a
quererposeerlotodoporelcasoenquealgooalguiensemeescurrieseentrelos
dedos. Si, adems, mis manos sangran (ex: manos secas, eczema, etc.)
seguramentehayunasituacinenmivida,unsueo,unproyectoquetengola
sensacindenopoderrealizaryestomellevaavivirtristeza.Entonces,laalegra
devivirseva.Siseparalizanmismanos,puedosentirmeparalizadoenloquese
refierealos mediospor tomar pararealizar ciertatarea ocierta accinyvivo
impotencia con relacin a esto. Tambin, la parlisis de las manos puede
producirse despus de una actividad mental muy intensa en la cual me siento
sobreexcitado,contrariadoyenquelapresinhierveadentromo.Quizsincluso,
tengoelgustodetorcerelcuelloaalguienconmis manos.Sime hierolas
manos, quizs resista al tacto, evitando cierta intimidad, bien sea el tacto que
puedo dar o recibir de otra persona. Este temor a entrar en contacto puede
vincularseaunsucesopresenteparticularquemerecuerdaunabusovividoenel
pasado. Aprendo a soltar y a tender las manos haca el cielo, tomando
202

conscienciadequeelnicopoderquetengoessobremmismoynosobrelos
dems.
MANOS (artrosis de las ) (ver: ARTRITIS ARTROSIS)
MANOS DESVIACIN DE DEPUYTREN (VER TAMBIN: DEDOS - /
ANULAR/ AURICULAR).
Ladesviacinde Dupuytren esunaafeccindelamanocaracterizadapor
unaflexindeciertosdedoshacalapalma,sobretodoelanularyelauriculary,
esto, de modo permanente. Esta enfermedad denota una crispacin en mis
actitudes,dejandotraslucirciertocierrefrenteamicnyugeoamishijos.Tengo
intersenhacermemsflexibleyabiertoexpresandomejormisestadosdenimo.
MAREO (ver tambin: MAL DE LOS TRANSPORTES)
El mareo eslasensacindenotenerelcontroldelasituacin,dedejarse
llevarporlosacontecimientosdelavida,lasensacindeperderlotodo.Alnotener
losdospiesenelsuelo,vivociertainseguridadquecogeproporcionesanms
grandes cuando tengo aprensiones de cara al futuro y frente a todo lo que es
desconocido.Estosemanifiestapornauseas.Debopreguntarmeloquenodigieroo
loquetengoganasdeechar,quenoacept .Tambinsucedefrecuentemente
quecualquiermaldelostransportes(barco,avin,auto,tren,etc.)estvinculadoa
mimiedo(conscienteoinconsciente)delamuerte.
MASCULINO (principio) ver tambin : FEMENINO [principio])
Elprincipiomasculinoestrepresentadoporelladoderechodelcuerpoyel
ladoizquierdodelcerebro.TambinsellamaelladoYANGenmedicinaChinao
elladoracionalenOccidente.Lascualidadesdominantessonelvalor,lapotencia,
lalgica.Eselladoracional,autnomo,materialistadelser.Representatambinel
aspectointelectual,elladoactivodemipersonaquetomalasideaseintuicionesde
miladofemeninoyquelasponeenprctica. Cadaserhumano,tantohombre
comomujer,poseeunladomasculino(YANG)yunladofemenino(YIN).Al
haber desarrollado mi lado masculino analizando y queriendo volverme igual
comomipadre,haymuchasprobabilidadesdequetengamosambospuntosmuy
similaresencuantoalascualidadesylascaractersticasnombradasenelprincipio.
Debo recordarme que cuando puedo equilibrar mi lado masculino y mi lado
femeninoescuandopuedoalcanzarmiplenarealizacin.

203

MASTITIS (VER: PECHO MASTITIS)


MASTOIDITIS (ver tambin: FIEBRE, INFLAMACIN, ODOS OTITIS)
La mastoiditis es la inflamacin que se produce en la base del hueso
temporal, llamado mastoides, justo detrs de las orejas. La mastoiditis puede
producirsecuandomeniegoaescuchar.Mepreocupaloqueacabodeorencuanto
a alguien o algo que me molesta. Vivo pena, y cuando soy nio, puedo no
comprenderloquesedice,locualmeprovocainseguridad.Mitemormehace
deseardejardeorloquesedice.Estoyenpaz.Laarmonaylaalegracirculanen
m.GRACIAS!.
MEDICINA
Lapalabra medicina vienedeenfermedad.Porlotanto,aunqueexistauna
medicinapreventivaypredictiva,lamedicinasecuidamsdelasenfermedades,
traumatismos,lisiadurasymodospararemediarlosCuandounmdicopuedodar
undiagnsticosobreunaenfermedadquetengo,entoncesleesmsfcilelegirel
tipodetratamientoquepuedeseraplicado.Estesiglopermitiquela medicina
hicierasaltosgigantescosconimportantesdescubrimientosenqumicaybiologa,
conayudadenuevastecnologas.La medicina,enmuchoscasos,serevelmuy
eficazahdondesepodallegarahacerundiagnstico.Sinembargo,cuandomi
dolencia o mi enfermedad no puede identificarse, sucede que la medicina es
impotenteparaayudarme.Entoncespuedoinvestigarlascausasdeestadolenciao
deestaenfermedadconayudadelairidologa,lapsicoquinesiologa,lecturas
energticasuotrasformasdeinvestigacionesrelevantesdepersonasresponsables
conunaticaprofesionalreconocida.
MDULA ESPINAL (ver tambin: ESCLEROSIS EN PLACAS)
La mdulaespinal eslapartedelsistemanerviosocentralcontenidaenel
canalraqudeo,enelinteriordelacolumnavertebral.Sigueelbulboraqudeoyse
terminaal nivel delasegundavrtebralumbar.Yaquetransmitelosdatosdel
cerebroalaspartesdelcuerporeferidas,unadolenciaaestenivelmeindicaque
puedotenerdificultadenponerenprcticaenelmundofsico,mispensamientosy
toda mi creatividad. Tengo tanta necesidad de calcular y planificarlo todo a la
perfeccin,sinjamsequivocarme,quelaespontaneidadnotienesulugarenmi
vida.Yaquelamdulaespinaltrabajadeestemodo,mirigidezdemasiadogrande
conllevar dolencias y disfuncionamientos. Aprendo a escucharme, a hacer las
cosasporintuicinsabiendoquesiemprehagoparalomejoryqueelerrorno
existe:todoesexperienciaparaayudarmeacrecer.

204

MELANCOLIA (ver tambin: ANGUSTIA, PENA, DEPRESIN, PSICOSIS,


SUICIDIO)
Lamelancolaesunestadodetristezaprofunda.Mesientoculpable,vivoun
estado depresivo grave y tengo dificultad en soportar este dolor moral. Mis
desplazamientos,inclusofsicos,estnafectados.Meenfrentoaunainsatisfaccin,
aunacontrariedad,aunapenaquemellevanaunacarenciadealegra.Estatristeza
mellevaasentirmeturbadoenmisemocionesquesevuelvencadavezms
oscuras.Tengolasensacindeirdandovueltassinllegaranada.Afirmoquela
alegraviveentodomiser.Mefijoobjetivosrealizablesquemeayudarnahallar
mejorestaenergaquemoraenm,borrarlatristezaydejarsitioparamsalegra
ysatisfaccin.
MEMORIA (con fallos) (ver tambin : ALZHEIMER [enfermedad de],
AMNESIA)
La memoria tiene la facultad de almacenar ideas, emociones y traer al
conscienteloqueunoquiererecordar.Puedo,despusdeunimpactoemocional,
ocultarenmi memoria miedos,temores,pena.Eselsubconscientequeniegael
recuerdoalconsciente.Paramesunmodoinclusoinconscientedehuirunaforma
de realidad que hallara difcil de vivir. Acepto tomar plenamente la
responsabilidaddemivida,tomandoconscienciadequecadasituacinestaqu
paraayudarmeaconocermemejoryasentirmemslibre.
MENINGITIS (ver: CEREBRO MENINGITIS)
MENOPAUSIA (dolencias de )
Enelotoodelavida,elcuerpodelamujercambiaydeboaceptarlo.Es
un perodo altamente emocional que alcanza particularmente mis sentimientos
vinculadosalhechodeestaranamableydeseableysobretodoamadaydeseada.
Hagoelbalancedemividaypuedotenerpesarespornohaberhechoestooello,
tener la sensacin deno haber aprovechado plenamente lavida. Enla primera
mitad de mi vida, generalmente llamada perodo activo, estoy en la accin,
hago, procreo, construyo. Es mi lado racional, activo organizador, tambin
conocido comomi lado masculino, o Yang, quepredomina. Pero, ahora, me
sientodisminuidaypuedoquererseguirtodasmistareasdomsticasymistareas
sociales en vez de dejar brotar mi feminidad, mi dulzura, mi creatividad que
pertenecen al lado femenino, Yin. Los acaloramientos que experimento en la
menopausiamanifiestanunconflictointeriorymiladofemeninosehaceahogar
por estos sntomas que provocamiladomasculino. La nicamaneraeficazde
hacerlosdesaparecerconsisteenrecuperarlamujertil,experimentadayllenade
sabidura porque mi testarudez a no seguir la corriente de la vida podr
205

transformarseendolor decabeza omigraa.Aunquenoseaprocreadora,debo


hallarmidireccinespiritual.NecesitoencontrarlaMujerenm.Esunpococomo
enlajubilacin:ahoratengotiempodetrabajarcontotallibertad,elaborarplanes,
otros retos. Descubro un nuevo sentido a las palabras Libertad e
Individualidad,permitindomerenaceraunanuevavida.Miatencinestahora
llevadasobremysobremicnyugeenvezdeestarnicamentellevadasobrelos
hijos(enmuchoscasos)ylafamilia.Descubrounanuevarazndevivir.Esun
pococomounempezardenuevo,puedohacercosasquemegustanyqueeleg.El
temoraenvejecerpuedehacersemspresenteyreal.Inclusoinconscientemente,
puedo hacer reaparecer menstruaciones para ayudarme a volver al pasado y a
engancharme a una juventud fsica ya desaparecida. Es pues importante que
acepte yquehagaellutodemijuventudparavivirplenamenteelmomento
presente.Acepto lastransformacionesqueseproducen,tantoenmicuerpo
comoenmividainterior,espiritualascomomividasocialyfamiliar.Vivoenla
simplicidad.Saboreocadamomentoytengoelpoderdecrearmivida,merceda
todaslasexperienciasquevivhastaahorayquehacenqueposeeunasabiduray
untesoroextraordinarios.
MENSTRUACIN (dolores de)
Lasmenstruacionessonelflujo,porlavagina,desangreprocedentedela
mucosauterina.Seproducenperidicamenteenunamujernoembarazada,entrela
pubertad y la menopausia. Los dolores menstruales pueden estar vinculados a
culpabilidadeira.Estossentimientospuedenhallarsufuenteenunaexperienciaen
lacualestuveabusadasexualmente,sobretodoantesdelapubertad.Sitengola
sensacintambinquemispadresestndecepcionadosporhaberdadoaluzuna
nia,podrhacerlotodoparatenerelaspectodeunnioyasseramadademis
padres. Inconscientemente puede que retrase o haga parar mis menstruaciones.
Rehusmifeminidadypuedequetambinmisexualidad,creyendoqueessucioo
pecadoporqueeslaprdidadesangre(vinculadaalaprdidadealegra)queindica
generalmentesiestoyembarazadaono.Estadecepcindenoestarembarazada
procededelamemoriainclusa,ladelaespecie,quequierequeesthechaparala
procreacin que garantiza su supervivencia. As, las prdidas de sangres,
relacionadas desde una perspectiva metafsica con la prdida de alegra, me
indican, en cierta medida, mi pena, incluso inconsciente, de no haber estado
embarazada, vinculada a mi programacin gentica para la preservacin de la
especie. Si mis prdidas salen de mi normalidad es decir que disminuyen,
pudiendoinclusoirhastapararmenstruaciones,osialcontrario,aumentan,debo
entoncescomprobarunouotrodelosaspectos mencionadosanteriormenteque
puedavivirenmividayqueexplicaraestecambio.Cuantomsaceptequese
tratasencillamentedeunarespuestademicuerpoaunaprogramacin,mseste
perodosedesarrollarenarmona.Deboaceptarquesiendomujer,hedevivir
enarmonaconestecuerpoquefuncionasegnciclos.
206

MENSTRUACIN AMENORREA
La amenorrea es la ausencia o supresin de las reglas en la mujer,
comnmentellamadasmenstruaciones.Laamenorrea,queseproducecuandola
mujer est en edad detener sus reglas, puede estar vinculadaal rechazo dela
feminidad o a los inconvenientes de ser una mujer; a culpabilidad pudiendo
proceder delaspalabrasyacciones delaparejasexual;asentimientos vividos
duranteciertasreglas.Lamujerviveciertotemor,unadolenciaoculpabilidad.Para
remediaraesto,seprogramamentalmenteyhacecesarsusreglas,rechazandola
vida,decidiendocesardeprocrear.Rehsoquizsvivirloquemimadreyavivi
conrelacinamipadreyrehsoservirinconscientementedegentica(instrumento
dereproduccin)enmiactualrelacin,porquerecuerdoeldolorquesentaalvera
mimadretristeensurelacinamorosa.Rehsovivirestaexperiencia.Lamujer
tieneungranintersenaceptar alniveldelcoraznasuparejayhacerle
confianza,sobretodosielhombreestmuyabiertoalamujeraquienama.
MENSTRUACIN MENORRAGIAS (ver tambin FIBROMAS)
Lasmenorragiassonelaumentoanormaldelaabundanciaydeladuracin
delasreglaspudiendosercausadaporlapresenciadeunfibromauterino.Estn
vinculadasalanoaceptacindetenerhijosoagrandesprdidasdealegra
frentealhechodequenoquieroprocrear,bienporquesoyestriloporqueusoun
mediocontraceptivoparaevitarestarembarazada.
MENSTRUACIN SNDROME PREMENSTRUAL (SPM) (ver tambin:
DOLOR)
Seobservael sndromepremenstrual duranteelperodoqueprecedelas
menstruaciones.Setraducepornerviosidad,doloresdeespalda,decabezaode
vientre.Estosedebeaundesequilibriohormonal.Eselprocesoderechazoyde
culpabilidad que empieza a aflorar. El perodo menstrual es para la mujer el
recuerdodequeestviviendoenununiversodominadoporloshombres.Esto
indicapuescmoel sndromepremenstrual traesituacionesquemeincitana
preguntarmesobremipercepcincomomujerenmirelacinconmifeminidad,
sobretodosiquierotenerxitoenunacarreraprofesional.Puedoestarturbada,
confusaymedejoinfluenciarporlosestereotiposimpuestosporlasociedad.Me
amoymeaceptotalcomosoyydejositioalaevolucin.

207

MIASTENIA (ver: MUSCULOS MIASTENIA)


MICOSIS (entre los dedos de los pies) o PIE DE ATLETA. (ver: PIES, MICOSIS)
MICOSIS (del cuero cabelludo, pelos y uas) (ver: CABELLOS
SARNA)
MIEDO (ver tambin: RIONES [problemas renales])
El miedo es un temor o aprensin que siento frente a un peligro real o
imaginario.Cuandotengomiedo,micoraznlateendesorden,mevuelvotenso.
Elmiedotomalugarenmiinteriorcuandomesientoinquieto,pocosegurodem,
desanimado,queestoymuyemotivo,etc.Elobjetodemimiedopuedeserelmiedo
alfracaso,abandono,rechazo,elmiedodeestarherido,etc.;sevuelvetanreala
misojos,quetodomicuerporeaccionaasteyenparticularlosriones.Mimiedo
sloaumentalasprobabilidadesdequesucedatodoloquetemo.Elmiedoala
enfermedadmismapuedeserunfactordeterminanteparalaaparicindesta.Es
importantequetomeconscienciaaququesonmismiedoslosquecontrolanmi
vidaynolagenteolassituaciones.Entrelosseismiedosfundamentales,hay:(1)el
miedoamorir,(2)elmiedoalaenfermedad(3)elmiedoalapobreza,(4)elmiedo
aperderelamordeunserquerido,(5)elmiedoalavejez,(6)elmiedoalacrtica.
Decidopuesahorasustituirelmiedoporlaconfianza.Pidoestarsiempreguiadoy
protegidoenlasaccionesquedebotomaroenlaspalabrasquedebodecir,parael
bienestardetodos.

208

MIGRAAS (ver: CABEZA MIGRAAS)


MIOMA UTERINO (ver: FIBROMAS Y QUISTES FEMININOS)
MIOPATA (ver: MUSCULOS MIOPATA)
MIOPA (ver: OJOS MIOPIA)
MIOSITIS (ver: MUSCULOS MIOSITIS)
MONONUCLEOSIS (ver: SANGRE MONONUCLEOSIS)
MUCOSIDADES EN EL COLN (ver: INTESTINOS COLITIS)
MUERTE (la) (ver tambin: AGORAFOBIA, ANSIEDAD, EUTANASIA)
La muerte noesunaenfermedadsinounestado.Sucedecuandocesanlas
funciones vitales de mi cuerpo tales como latidos del corazn, respiracin,
actividadescerebrales:micuerpoyanopodrreanudarsusfuncionesamenosque
sepuedanusarmediosmecnicosuotrosparareactivaralgunasfunciones.Enel
casodeenfermedadesgravescomoalgunoscnceres,elSIDA,lasenfermedades
incurables, etc., sucede a veces que cure justo antes del momento llamado la
muerte. En efecto, cuando integro en mi corazn y en el amor la toma de
conscienciaquedebohacer,puedequeestliberadodetodosufrimientofsicoy
moral. Si la enfermedad ha progresado mucho, puede que mi cerebro me
desconecte despus de que est hecha la toma de consciencia. Por esto es tan
importantequeentiendaenmicoraznyqueacepte elmotivoquehizoque
vivaestaenfermedad.Cuantomsacepteloquemeensealavida,mspodr
marchar67 enarmona,enlaluzyenelamor.Misparientescercanostienenun
papelimportantequejugarenesteprocesodecuracinaceptandoalniveldel
coraznmimarchaparaquepuedaseguirmicaminoentotallibertad.Cuantoms
integresituacionesantesdedejarmicuerpofsico,mshabradelantadoeltrabajo
quemequedarporhacerdespusdemimarcha.Yaquesiguelavida(paralosque
creenenello!)prefieroquesehabledemdiciendoquememarch,quedejmi
cuerpofsico,quepasalosdemsmundos.Elusodeestasexpresionesme
parecemsrealquedecirquehemuerto.
MUGUETE (ver tambin: BOCA [en general] / [dolencia de],
GARGANTA / [en general] / [dolores de], INFECCIONES [en general])
El muguete es una enfermedad contagiosa debida a una levadura, y
caracterizadapor lapresenciadeplacas deunblancocremosocausado por las
67

Marchar:Eslapalabrapreferidaparamorir.

209

mucosasbucalesyfarngeas,esdecirenlabocayenlagarganta.Estaenfermedad
esmuyfrecuenteenlosnios.Aparecedespusdegritosyllantosincesantesdemi
nioquedeseatenercaricias,contactosfsicosconnosotros,suspadres.Sime
pongo en el lugar del nio, un beb en particular, me recuerdo que necesito
contactoconmimadreomipadreparasentirmeenseguridadyfueradepeligro
porquesquesoyvulnerable.Elnicomodoquetengoparaatraerlaatencinde
mispadres,paraquemecojanensusbrazos,eschillaryllorar.Eselnicomodo
de que me sacien con calor humano. Ya que mis padres pueden interpretar
errneamente mis gritos y pensar que tengo hambre, sed, fro, etc., no voy a
conseguirloquenecesito.Ymilaringe, rganoesencialdelafonacin,siendo
incapazdecumplirminecesidaddecontactofsico,activarelmuguete.Paramis
padres,handecogermeensusbrazoslomsfrecuentementeposible,acariciarme,
paraquedesaparezcael muguete.Cuandoapareceenmel muguete,eladulto,
puedequeestoseproduzcadespusdeunainfeccindemispulmones,demisvas
respiratorias. Entonces, mis necesidades son las mismas que las del nio
mencionadasanteriormente,sloquesetratademiniointeriorquienrequiere
atencinysentirseguridad.Miparteadultapuedereconfortarestenioqueesten
mytranquilizarle.Laarmonaseinstalarmejor,locualpermitirqueserecupere
lasalud.
MUECA (ver tambin: ARTICULACIONES)
Lasmuecassonlasarticulaciones,lospivotesquepermitenlamovilidady
laflexibilidaddemismanosyquemevinculanamisantebrazos.Unarigidezen
las muecas meimpidepuestomarconarmonaoelegirtodoloquelavidame
presenta. Hay pues una obstruccin, un bloqueo o una negacin frente a las
accionesquedeberahacer.Lasactividadesquepedanhabilidadestnafectadas.
Eldolorenlasmuecaspuederepresentarenergareprimidareferenteaalgoque
debehacerseperoqueretengoynohago.Lafracturaolatorcedurameindicaun
profundoconflictodeexpresinfrentealavidaycmostasesirvedempara
hacersuobra.Deboinmovilizarmeynomoverlasmanos.Deboreflexionarsobre
estosdoloresdemodoatomarconscienciadelhechoquenecesitoliberarestas
energasconamoryconfianza,porquesulibrecirculacinmepermitiractuarde
modoconstructivoatravsdeestasacciones.
MSCULO(S) (en general)
Losmsculosestncontroladosporlafuerzamental;eslavida,lapotencia
ylafuerzadenuestroshuesos.Eselreflejodeloquesomos,creemosypensamos
transformarnos en la vida. Los msculos representan el esfuerzo por dar y el
trabajo por hacer para seguir adelante. Los msculos, que corresponden a mi
energa mental, son necesarios para mover, pasar a la accin. Cuando hay
enfermedadesmusculares,deboreferirmealaspartesdemicuerpoafectadaspara
determinar la causa que se expresa. Voy a consultar con cuales situaciones
210

mentales,culespatternsoculescomportamientosserelacionadichapartedel
cuerpo.
MSCULOS DISTROFIA MUSCULAR
La distrofia muscular es una enfermedad en la cual los msculos se
debilitanydegeneranavecesrpidamente.Estvinculadaaundeseotangrande
decontrolarsituacionesygente quepierdotodocontrol.Tengoelsentimiento
que,param,todoestperdidodeantemanoyquemicuerpoesttancansadopor
esteestrsqueseabandonayautodestruyeprogresivamente.Nosoybastante
buenoobiennomecreocapazdeestaralaaltura.Mividaesfea,yanome
interesa.Tengorealmentemiedodequemividanoseaun xitoyyanohago
esfuerzos.Porconsiguiente,mis msculos,querepresentanlaaccin,sevuelven
enfermosyesahoramipropiomiedoquetomaelcontrolymedejocontrolarporla
sociedad. La distrofia muscular es una enfermedad grave y frecuentemente
incurable,perosuestadosepuedeestabilizarsipongolosesfuerzosnecesarios.
Acepto soltar, mantenermeabiertoyafrontarmispropiosmiedosaquy
ahora!Cuandomeenfrentoamistemoresylosidentifico,yanonecesitodirigirlo
todo.Acepto irhacadelante,liberarmedelanecesidaddecontrolarque,de
hecho,sloeslaproyeccindemismiedos.
MSCULOS FIBROMATOSIS
Lafibromatosisprocededetumoresfibrosos(fibroma)odelaumentodelas
fibrasenuntejido(fibrosis)quetraerigidezalniveldemismsculosydemis
tejidosfibrosos,locualprovocaundolorintenso.Lostejidosblandosserefierena
mimododepensar.Losdoloresquesientomeadviertenquevivomuchoestrsy
tensin,deaquuncansanciomentalintenso.Mehacenrealizarque carezcode
flexibilidad,quesoyrgidoyangustiadosobretodoenloqueamispensamientos
yactitudesserefiere.Debidoamispropiosconflictosinteriores,impidoquela
energacirculelibrementeenmismsculos.Tomoconscienciadeestastensiones:
dedndevienen?Esuncansanciomentalvinculadoaloquehago,amimodode
serydeexpresarme?Lapartedemicuerpoafectadameayudaahallarlacausa.
Puedequedebacambiardedireccin.Acepto estar abiertoysentircomo
desaparecen los nudos de tensin. Estoy aqu para evolucionar. El hecho de
ponermergidomecausatodosestosdolores.Vivoelinstanteyaprendoahacer
confianza.
MSCULOS FIBROSIS QUSTICA
La fibrosis qustica es la formacin de masas de tejidos blandos en mis
msculos y mis tejidos fibrosos. Mi modo de pensar rgido y mis patterns
mentaleshacenquerehusadelantarenlavida.Meenganchatantasideasviejas
211

quenosegulacorrientedelavida.Losdoloresquesientomeparalizan.Estoy
desanimado, nada funciona en mi vida. Puedo tener la sensacin de siempre
habermefrenadoenhacerodecircosas,teniendomiedodelasconsecuencias.Por
estomispiernasymisbrazosfrecuentementeestnafectadosporqueestosimboliza
mimiedoacogerlassituacionesdelavida(brazos)ymimiedoaprogresarenla
vida (piernas). Me quejo, me compadezco sobre mi destino y quisiera que los
demshaganlomismo.Aceptoabrirmemsalavidaydejoirmisideasviejas.
Deestemodo,tomounnuevodesarrolloenlavidayellugarquemeestdadoen
eluniverso.
MSCULOS MIASTENIA
La miastenia es una afeccin crnica neurolgica caracterizada por una
fatigabilidad,esdecirundebilitamientomuscular.Inclusosiesraroquevivatal
enfermedad,cuandoestosucede,esqueestoydesanimado,carezcodemotivacin
yestoycansadodelavida.Tengolasensacindequejamspodrhacerloque
quierooquejamspodrrealizarmissueos.Tomoconscienciadeloqueme
desanimaalpuntodedejarmeperecer.Cuandolohayaencontrado.Sinohallola
causa exacta de mi conflicto, puedo a pesar de todo buscar las fuentes de
motivacinquemellevarneventualmenteahallarlasolucinamiconflicto.
MSCULOS MIOPATIA
Eltrminogeneraldemiopataserefiereatodaslasafeccionesquetocanlas
fibrasmusculares.Desdeelenfoquemetafsico,losmsculosestnestrechamente
vinculadosconlomental,conmimododepensar.Medesvalorizoconstantemente.
Quieroimpedirqueunasituacinprogrese,quieropararcualquiermovimientode
caraaalguienoaalgoqueformapartedemividaenestemomento;porestomis
msculosquemepermitenhacermovimientosydesplazarme,sevanadeteriorar.
Esmirandolaparteafectadademicuerpoyloqueestomeimpidehacercomo
tendr una buena indicacin de la naturaleza de los pensamientos que debo
cambiar.Reconozcosinembargoqueestosiempreseproduceparaayudarmea
crecer,aampliarmicampodeconsciencia,parapermitirmevivirconmsamor,
libertad,sabidura.
MSCULOS - MIOSITIS.
Lamiositisesunainflamacindelosmsculosqueprovocaunadebilidady
unarigidezmuscular,losmsculossiendovinculadosconelesfuerzo.Procededel
estrs frente a esfuerzos que debo hacer, que sea frente a un trabajo fsico,
intelectualoemocionalquenonecesariamentetengoelgustodehacer,porqueesto
me pide mucha energa, pero frente a lo cual me siento pillado. Tengo la
sensacindequeestoyobligadoahacerloyrealmentenotengoelgustodehacerel
esfuerzo,sintiendomuypocamotivacin.Tomomitiempo,pidoayudaomedoy
212

mstiempopararealizarmistareasparahacerreposarmismsculosyrehacermis
energas.
MSCULOS TETANOS (ver tambin: MUSCULOS TRISMUS)
Unapersonaafectadaporeltetanosverenprimerlugarcomolosmsculos
desumandbulasecontraendeformamuydolorosa.Luego,sonlosmsculos
respiratoriosycardacosqueestarnafectados.Estodemuestraunagranirritacin
interior provocada por pensamientos nocivos para mi bienestar. En vez de
expresarlos,losreprimoylosahogoenm.Acepto dedejarqueelamorme
purifique,dejolugaralaarmonizacin.
MSCULOS TRISMUS (ver tambin: MUSCULOS TETANOS)
El trismus secaracterizaporelapretarinvoluntariodelasmandbulas,el
cualsedebealacontraccindelosmsculos.Generalmenteeselprimersignoque
meindicaqueestoyafectadoporelttanos.Estasituacinpuedeproducirsecuando
sientoagresividad.Alrehusar expresar missentimientos, tengolasensacin de
guardar el control. Rehso abrirme por temor a estar juzgado, rechazado,
incomprendido.Alcerrarme,tambincierrolapuertaalamor.Tengointersen
hacerconfianza,enexpresarclaramentemisdeseosyendejarlugaralamor.
MUSLOS (en general) (ver tambin: PIERNAS / [en general] / [dolencias
de ])
Elmusloesunmsculoquerepresentaelmovimientoylafuerzadeirhaca
delante.Muslosfuertesypotentesindicanunapersonabienarraigadaenelsuelo,
con grandes reservas energticas utilizables para su autoridad y su evolucin
espiritual. Estas reservas naturales indican tambin el estado mental. As, al
quedarmeinactivademasiadotiempo,corroelriesgodeacumularreservasintiles.
Estodenotaquetengomiedodeperdermisitio,queencuentro injustas varias
situacionesdejuventudvividasprincipalmenteconmispadres,quenoacept
yfrentealascualesalimentomuchoresentimientointerior.Param,carecer de
algopuedeserespantoso!Porlotantohagoreservas.Sigotransportandoenmis
muslos estos pensamientos inconscientes y a transportar todo este material
excedente.Vivoclera,resentimientoyfrustracinporquetengolasensacinde
trabajarsinmuchoxito.Teniendo muslos gordos,bienllenos(ymuyapretados
entre las piernas), bloqueo inconscientemente la energa en este lugar y mi
sexualidadcorreelriesgodecambiarporquelaenergasemantieneestancadaal
niveldelapelvis.Puedequehayaunabarreraderesistenciasmentalesqueme
impidaexpresarplenamenteoencontrarmidireccin.Estiempodeliberarmey
dejarpasarestaenergadeamorqueslodeseaexpresarse.Dejofluirestaenerga
haca bajo, haca mis muslos y mis piernas que la necesitan ms, lo cual me
213

ayudar a arraigarme a la tierra, a estar mejor groundado y as, traer un


equilibriomuchomejorentremisfacetasespiritualyfsica.Estoayudaraexpulsar
ladepresinquevivo.Micuerposeequilibraymequitorencoracumuladoenmi
juventud.Sibien,aveces,tengolasensacindeestarcerrado,miromisbienes
materialesylosaceptoporloquesonenestemundo,esdecirservidoresdel
universo.
MUSLOS (dolores de) (ver: PIERNAS PARTE SUPERIOR)
NACIMIENTO (el modo en que se desarroll mi ) (ver tambin:
PARTO.
Durantelosnuevemesesdemigestacin,cuandosloeraunfeto,todosmis
sentidosyaestabandespiertosytuveconocimientodetodoloquemimadre,mi
padreylagentealrededormopudieronverbalizar.Delmismomodo,podasentir
lasemociones,losestadosdenimodestos,enparticularmimadreconlacual
entretenalazosprivilegiadoseintensos.Elmodoenquepuedohaberinterpretado
lo que o o sent durante este perodo tendr una repercusin sobre mis
comportamientosenelporvenir.
Porejemplo,puedohabertenidolasensacindequehicepadeceramam
duranteelpartocuando,frecuentemente,ellamismacontribuyaaumentarelnivel
de dolor por su ansiedad, sus miedos y tambin por el hecho que reviva
inconscientementesupropio nacimiento elcualpudohabersidomuydoloroso.
Pudeinterpretartambinque acausadem,casisemurimimadre.Entonces
arrastrartodamividaestesentimientodeculpabilidaddehaberhechodaoa
mamylovolveravivirdecaraaotraspersonas.
Adems,elmodoenquesedesarrollminacimientoolosmediosutilizados
parafacilitarsteinfluenciarntambincomportamientosquereproduzcoenmi
vidadecadadayquehacenprecisamentereferenciaalmodoenqueseprodujo
mi nacimiento. A continuacin, algunas situaciones ms frecuentemente
encontradas.
Sinac prematuramente,frecuentementemanifestarimpaciencia:quiero
haberterminadounatareaantesdehaberlaempezado.Ademssiestuvecolocado
enincubadoraduranteciertoperododetiempo,frecuentementevolveravivirla
misma soledad profunda y una sensacin de vivir impotencia frente a ciertas
situacionesociertaspersonas,locualmellevaaaislarmeyatenerunnivelde
energamuybajo.Puedovivirunsentimientoderechazointensoporelhechoque
tuvelasensacinquemimadremedejdespusdeminacimiento.
214

Alcontrario,sinac conretraso,voyatenerdificultadenserpuntualya
entregar los trabajos a tiempo. Tomo mi tiempo y me siento frecuentemente
desbordadoenlascosasporhacer.Tambinmegustaquelascosasestnhechasa
mimodo.Podrdemostraragresividadfrentealaspersonasquequierenhacerme
sentir culpable de mis retrasos, porque tendr la sensacin que estoy retrasado
debidoaacontecimientosexteriores.
Un nacimiento quedebeestar provocado frecuentementesignificaqueno
estaba listo para nacer; entonces puedo vivir muchas frustraciones que me
acompaarnalolargodemivida.Tambinpuedodesarrollarunadesconfianza
paraconmientorno.
Simimadrenecesituna anestesia paraponermealmundo,puedotener
tendenciaadormirmeencualquiermomentoyanestesiolarealidad,nopercibo
claramenteeinterpretolossucesosamimodo,segnlosmiedosqueentretengo.
Simeencuentroconel cordnumbilicalalrededordelcuello,mesiento
ahogadoporlagenteolassituaciones.Puedosermsfrgilaniveldegarganta,
tengodificultadenexpresarme,encomunicar simpleyafirmativamente.Tengo
tendenciaasentirmecogidoalagarganta.PatrickDrouotmencionenunode
suslibrosqueunfuerteporcentaje(msdel60%)depersonasnacidasconel
cordnumbilical alrededordel cuellotuvieronconscienciaduranteregresiones
queenunauotradesusvidaspasadashabansidocolgadas.
Sinacporcesrea,generalmentetengodificultadenllevarmisproyectosa
trmino;unesfuerzoprolongadoyconstantemeesdifcil.Eldesnimomeinvade
fcilmente.Tambinpuedequetengalasensacindequelavidaolagenteme
trataninjustamenteo,sisequiere,quenotengoeljustopagoporlosesfuerzosque
cumplopararealizarunatarea.DevolvedaCesarloqueesdeCesar!
Si nac por el asiento, frecuentemente vivo culpabilidad, en particular
porque tengo la sensacin de hacer padecer a la gente alrededor mo. Retengo
muchoytengodificultadensoltaryhacerconfianza.Entoncesvivomuchatensin
interior.Todoloquevivoesdifcilyparecedurarunaeternidad.Tambinpodr
tenerlasensacindesentirmelimitadoenmisaccionesyenmisproyectos.Es
comosilagenteylascircunstanciasdelavidaselasingeniaranparaquecedaen
nuevasaccionesquequieroemprender.
Silautilizacindeforcepsserevelnecesaria,stoscogiendoyprotegiendo
micabezaparafacilitarmiexpulsindurantemi nacimiento,puedequepadezca
doloresdecabeza,doloresenelcrneoytengalasensacindeencontrarmuchas
dificultadesenmivida,enparticularalprincipiodeunproyectoodeunanueva
215

relacin.Tendrlasensacindequedeberaguantarlascircunstanciasquese
presentanparallevarabienminuevoproyectoominuevarelacin.
Puedopreguntaramispadreslosdetallesdeminacimiento.Elmerohecho
de tomar consciencia de la dificultades vividas en ese momento me ayudar a
comprender y a cambiar los comportamientos que derivan de l y pueden
disgustarme.
NALGAS
Las nalgas sonlapartecarnosadelcuerposobrelacualmesiento,tomo
lugar, MILUGAR (elpoder).Cuandoaprietolas nalgas ocuandoandoconlas
nalgasapretadas,mesientoamenazado,tengomiedodeperderelcontrol,retengo.
Nodeseoestarobservadoporqueestopodrallevarmeacambiar,aaceptar
cosas,acontecimientososituacionesquenoestoydispuestoaasumir.Inclusocon
las nalgasapretadas,puedopretenderquetodovabienyseguirsonriendo.En
cambiosiandoconlas nalgas muysueltas,conunbalanceodelascaderasmuy
pronunciado, tomo el lugar, el mo y el de los dems. Amo el poder porque
dirigiendo,measeguroelcontrol.Nohedecambiar:intentoobligaraquecambien
losdems!Tomoconscienciadequeestoyenganchadoamipasado,amisideas,a
misviejasheridasyqueinclusopuedovivirrencoroira.Acepto soltareir
hacadelanteyabrirmeanuevasexperienciasdelavida.
NARCOLEPSIA o ENFERMEDAD DEL SUEO (ver tambin: COMA,
DESMAYO, INSOMNIO, SOMNOLENCIA)
La narcolepsia es una tendencia irresistible a dormirse. Me duermo
repentinamenteyestopuededurardesdealgunossegundosamsdeunahora.Si
esto se acompaa de una disminucin de mi tonus muscular, tambin llamada
catalepsia,entoncessehabladelsndromedeGelineau.Elsueosevuelveuna
escapatoriafrenteamiedosyresistencias.Digonoalaevolucinyrehsoaceptar
loquesucedeenmivida;Entonceshuirporqueyanotengoelgustodevero
sentirciertaspersonas,ociertassituaciones.Sinsabercomoresolverestasituacin,
siendoincapazdeafirmarme,voyaretirarmeenmisueo,porqueeslasolucin
ms fcil. En ese momento, tengo tendencia a actuar en vctima, sintindome
impotenteopensandonotenerlosinstrumentosnecesariosparaenfrentarmealo
quemeasusta.Porlotantotengoventajaenasumirmeyenapresurarmeaunque
tengaquepedirayudaaunamigoounpariente,paraestarenlaaccinycrearmi
vidacomoquiero.

216

NARIZ (ver tambin: OLOR CORPORAL)


La nariz eselrganoporelcualelaire(lavida)pasaparaalcanzarmis
pulmones.Elaireesmuyimportante.Ademsderecorreranuestrasdosventanas
delanarizpararespirar,sepuedehacerporlaboca.Unadificultadderespiracin
puedeinformarmesobrelasdificultadesquetengoenmivida.Sirechazovivirosi
tengodificultadentransigirconmientornoporqueloquesientooexperimentono
meconviene,micapacidadderespirarporlanarizestardisminuida.Escomosi
quisieraexpulsarunasituacinconflictualporminariz.Sila ventanaizquierda
mecausaunproblema,debobuscarelmensajedelladoemocionalyafectivo;ysi
la ventana derecha est afectada, sta me informa de una dificultad a nivel
racional. En cualquier caso, puedo incluso deber remontar al momento de mi
nacimientoparadescubrirlafuentedemimalestarenlanariz.Situvequeestar
operadoparapermitirmerespirarmejor,escomosidijesesamiintuicin,ami
experimentado,alavida.Siadoptoestaactituddeaperturayconfianzaenm,
podrcurarcualquiermalestarrelacionadoconlanariz.
NARIZ (dolores de)
Lanarizeselrganodelolfato.Eselsentidoquemepermitevivir,estaren
contactoconlaatmsfera,conelexterior.Elolfatoesunodelossentidosms
poderosos que tengo y est vinculado a mi primer centro de energa (chakra)
situadoenel nivel delcoxis.La nariz esladobleaperturasobrelavida!Las
ventanas derecha e izquierda son los canales del interior y del exterior. Si mi
cuerpoponeunabarreraenelcanaldelarespiracin,esparaindicarmequeme
aslodealguiendemientornoodealgunasituacinquemeafecta,quememolesta
oquenoacepto,deaqulaexpresinpopular:asta,yanolapuedooler!Deseo
cortarmedealgopudiendotocar miladosecretoe ntimo,tantodecaraamis
pensamientoscomoenelplanofsicooemocional.Esunapersonaosituacinque
critico, que juzgo como oliendo mal y frente a la cual puedo tener rencor e
inclusodisgusto.Inclusopuedeserunolorquenomegusta,quizsporqueme
recuerdaunsucesoquequisieraolvidaryquecualificodemaloliente.Miolfato
estestrechamentevinculadoamimemoriahologrfica(entresdimensiones)de
lossucesos.Mediantemiolfato,puedesermuyfcilrecordarmeacontecimientos
agradablescomosucesosdesagradables.Esimportantequetomeconscienciade
este estado de restriccin en mi respiracin para liberar a los dems de sus
decisionesquenohedejuzgar,nicriticar.Cesopuesdejuzgaralagente,las
situaciones, sus decisiones y elecciones como me libero yo mismo de mis
eleccionesydemisdecisiones.Estopermitequelavidafluyalibrementeenmy
quecrezcaelamor.

217

NARIZ (hemorragias nasales)


Lanarizsiendoelrganoporelcualcirculaelaireparairamispulmonesy
la sangre siendo el vehculo del aire, del oxgeno en todo mi organismo, la
hemorragianasalmerevelaquedejoqueseescapendemicuerpo,demiser,la
alegra,elamordelavida.Tengopuesunaprdidadealegraparaconalgoque
experimento.Estoindicaseguramenteunagrandecepcinenmivida.Sientoun
sentimientoquemedicequenoestoyreconocidooamadoamijustovalor.Debo
puesaprenderareconocermeyomismo,porlotantoacomprenderquedebomi
felicidad nicamente a lo que pienso de m mismo. Una antigua creencia
procedentedelanochedelostiemposmedicequeunamalaemocinounamala
situacinsevafuerademivida.
NARIZ KILLIAN (plipo de) (ver tambin: TUMOR[ES])
ElplipodeKillianesuntumorbenignoquesedesarrollaenunsenooenla
fosa nasal correspondiente y que tiene por efecto el obstruir ms o menos
totalmente el lado afectado. Como con los tumores en general, sufr un golpe
emocionalfrentealoqueexperiment.Eldolormehizocerrarmeymellevaa
sentirotravezsituacionesquepodranafectarme.Sitoelplipo,estabolade
carneypodrencontrarloquepudoperturbarmeobiendelladoizquierdo,el
aspectoafectivo,emocional,obiendelladoderecho,elaspectoracionaloligadoa
lasresponsabilidades.Sidebohacermequitarelplipo,doygraciasamicuerpo
paralainformacinquemedioyaceptoenmicoraznlatomadeconsciencia
quetenaquehacer.
NARIZ: LIQUIDO QUE CORRE EN LA GARGANTA
Cualquierlquidoenmicuerporepresentaunaspectodemisemociones.Si
minarizcorreenmigargantaenvezdequeellquidosalgaporelexteriordemi
cuerpo,estoindicaquereprimomisemocionesomislgrimas.Tengotendencia
areplegarmesobremmismoyallorarsobremisuerte.Esimportantequeme
asuma,quehagacosasparam,paravolverasaborearlavidaycumplirmimisin.
NARIZ SINUSITIS
Cuandoestoyafectadode sinusitis,vivounbloqueoenlanarizyaquse
trata de los senos del rostro. Esta infeccin de los senos est vinculada a la
impotenciafrenteaunapersonaounasituacin:nopuedoolerlaolamostazame
subealanariz.Imaginolasensacindetenermostazafuerteenlanariz,estome
ahoga,mequemaTambinpuedequeolfateeconanticipadounpeligroouna
amenaza que hace brotar un miedo adentro mo. El peligro puede ser real o
imaginario:elresultadoserelmismo.Puedotenerlasensacinquealgonohuele
218

bien,quehayalgodudoso.Enmensajequedebocomprenderessentirelamor
alrededormoeinspirarenlomshondodem.
NAUSEAS o VMITOS
La nausea se define como una gana de vomitar y se acompaa de una
sensacindemalestargeneral.Experimentounsentimientodepenaysientodolor
frenteaunarealidadquecausaundesarregloenmividayquequisierapoder
evitar.Lanauseaesunsignodequesientodisgustoyquerechazounacosa,una
persona,unaidea,unasituacin,oquizsinclusounaemocin.Vivounarebelin,
ira,miedo,disgusto,frustracinoincomprensinfrenteasta.Cuandoesterechazo
se vuelve suficientemente importante, puede producirse el efecto de vmitos
porquetiendoamanifestarfsicamenteesterechazo.Tengoquetomarconsciencia
que absorb algo de mi realidad o de mi ser que crea el deseo de expresarlo
inmediatamente.Ysiestonosehaceconlapalabra,semanifestarpornauseas.Un
principiodeembarazoseacompaafrecuentementedenauseasy,enestasituacin,
deboaceptarloscambiosenmividaquetraerlallegadadelbeb.Pidolapaz
yaceptodigerirlasemocionesylosconflictosqueestesucesoproduceenmi
vidadiaria.
NEFRITIS CRNICA (ver: RIONES, BRIGHT [enfermedad de])
NERVIOS (en general)
Los nervios son rganos que reciben y quedan informaciones a todo el
cuerpo procedente de sentimientos, pensamientos y sentidos. Las actividades
conscientesestncontroladasporlosnerviosperifricosquetomansufuenteenla
espinayqueeslamoradadelsistemanervioso.Lasactividadesinconscientes,por
ejemplo,loslatidosdelcoraznolarespiracin,estncontroladosporelsistema
nervioso automtico. Por la meditacin o por una profunda relajacin, puedo
conseguir un control consciente sobre este sistema. Puedo estar afectado de
diversosmodosporqueelsistemanerviosocubrevariasactividadesfuncionales.
Los nervios soncomoelsistemaelctricodemicuerpo.Simiscircuitosestn
sobrecargadosporquehaydemasiadatensin,estoafectaelfuncionamientode
miorganismo.Estatensinpuedeprocederdelhechoquetengoinquietudesfrente
alporveniryquetengomiedotambindequelosproyectosquequierorealizarno
lleguenatrmino.Losnerviosestnpuesenlabasedelacomunicacinysino
funcionanadecuadamente,puedopreguntarmeenculesferademividatendra
intersencomunicaryrecibirloquelosdemsmehandedecir.Sitengounabola
denerviosolosnerviosaflordepiel,estomerecuerdamigransensibilidady,
aunque pueda haberme sentido herido en el pasado, puedo aprender a hacer
confianzaalosdemsyalavida.
219

NERVIOS (crisis de) (ver tambin: HISTERIA, NEUROSIS)


Lacrisisdenerviostambinsellamaumbilismo.Setratadeunasubidade
energa,devibracinenelinteriormoquebloqueaobienaniveldelapalabrapor
carenciaoincapacidaddecomunicarmipuntodevistaoalniveldeunaactividad,
cuando me es imposible realizar, cumplir una accin. Entonces, el bloqueo se
vuelvetanfuerte,tangordoquenopuedoliberarlaenergaenlaarmonay hay
explosin.Estomellevaadecirpalabrasextremasoahacergestosextremos.Es
buenoduranteestosmomentosdetensinpararmeytomar conscienciadeello
mientrashagograndesrespiracionesymerelajoprofundamente.Deboaceptar
lasituacinytomoeltiempodehacerbajarlatensinmientrasvuelvoaequilibrar
misemociones.
NERVIOS NEURALGIA (ver tambin: DOLOR)
La neuralgia puededefinirsecomounmalcontactoenelrecorridodeun
hiloelctrico.Loshiloselctricosrepresentantodosnuestrosnervios.Esundolor
vivosobreunnerviocausadoporunatensindemasiadofuerteensurecorrido.Si
estcortadoelnervio,esquelacomunicacin,lalibrecirculacindelaenergaen
m est cortada. El lugar en el cual el dolor est ubicado indica el gnero de
emocinimplicada.Unsentimientodeculpabilidadyeldeseodeestarsiempreen
las normas establecidas por la sociedad frecuentemente sern la fuente de una
neuralgia.Sisesitaenunbrazooenunamano,estomeindicaqueunapresin
(tal como un compromiso) u otra emocin (tal como impotencia) me impide
tomarunadecisinounadireccinarmoniosaenmivida.Silaneuralgiaesten
unapierna,enunapantorrillaoenunpie,esunpasomsenunanuevadireccinlo
quebloquealaemociny,enconsecuencia;lalibrecirculacindelasenergasen
mivida.Altomarconsciencia delaspectodemivida(porlapartedelcuerpo
afectada)queestafectadoporlaansiedadoporlainseguridad,podrremediarlo
msfcilmenteyhallarlassolucionesytodoelamorquelasituacinmepide.
NERVIO NEURITIS
Una neuritis es la inflamacin de uno o varios nervios. La parte de mi
cuerpoqueestafectadaporelolosnerviosmeindicaencualaspectodemivida
debohacerunatomadeconsciencia.Aunquelaneuritispuedaparecertenersu
origenenunainfeccin,elalcoholismo,enciertasenfermedadesoenlosefectos
secundariosdeciertosmedicamentos,esaconsejablequedescubraloquemelleva
a vivir ira en la comunicacin que tengo conmigo mismo y dndome la
comprensinquenecesito,encontrarmejorlacalmaenmividayenmicuerpo.

220

NERVIO CITICO (el) (ver tambin: DOLOR, ESPALDA PIERNAS / [en


general] / [dolores de ])
Elnerviociticoempiezaenlapartelumbar(parteinferiordelaespalda)de
lacolumnavertebral;atraviesalanalga,elmusloylapiernaybajahastaelpie.El
dolorsentidomeparaliza.Puedequeeldolorsemanifiestemsenunapiernaque
en otra. Entonces estoy preocupado financieramente. Si mi pierna derecha est
afectada,quizsesporquetengomiedodecarecerdedineroydenopoderhacer
frenteamisresponsabilidadesenloqueamrespecta.Sieldolorsesitaenmi
piernaizquierda,mifaltadedineropuedeintensificarmisentimientodenopoder
darlotodo,enelplanomaterial,alagenteaquienamo.Temoquesuamorparam
est afectado. Me hago ilusiones, me creo muy espiritual y desapegado de los
bienesmateriales(unaespeciedehipocresa).Sinembargo,elmiedoacarecerde
dinero me persigue y me vuelve muy ansioso. Trabajo mucho, tengo grandes
responsabilidadesy,apesardetodosmisesfuerzos,sientoapesardetodociertas
dificultadesfinancieras.Micuerposeponergido:mesientopillado.Mevuelvo
constantementeacuestionar.Quesloquenohago?Poseolosconocimientosyel
talentonecesariosparahacerfrenteaunanuevasituacin? Mi inseguridad me
lleva a rebelarme. Estoy rencoroso contra la vida. Llego a desarrollar un
sentimientodeinferioridad.Puedorehusardoblarmedelantedealgunapersonao
situacin. Insidiosamente, la agresividad se instala y mi comunicacin conlos
demsseresiente.Tengointersencalmarmisnerviosporque,enestemomento,
tengolasensacindetenerunnudoenlosnervios.Tomoconscienciademi
confusininteriorydemidolor(tantointeriorescomoexteriores)frentealaolas
direccionesdemivida, aquyahora.Estedolorresultafrecuentementedemi
obstinacinaquereragarrarmeaviejasideasenvezdeabrirmealcambioyala
novedad. Esta situacin es frecuente en la mujer embarazada que vive una
confusininterioryundolorreferentealadireccinahoratomadaensuvida:
dudas,temoreseinquietudespuedenaflorar.Nodebojuzgarme,sinoaceptarme
talcomosoy.Aceptoquelafuentedemiverdaderaseguridadesten
mynoenlosbienesqueposeo.Sueltoyhagoconfianzaeneluniverso,porquees
abundanciaparatodosentodoslosplanos:fsico,mentalyespiritual.Haciendo
confianzaaluniverso,hagoconfianzaalavida.Elijoaceptar laflexibilidad,
descubrolaverdaderariqueza,laquetengoenmiinterior.Elverdaderovalordeun
sersemideasunoblezadealma.Aceptomislmites,tomoconscienciademis
temores,losintegro.Decidoadelantarenlavida,medejoguiarentodaseguridad
pormibienmsgrande.
NERVOSIDAD
Lanerviosidadesunsignoindicandoquecarezcodeconfianzaenm,enmi
entornoyenelporvenir.Elhechodequererirdemasiadodeprisaodehablarmuy
rpidamente traicionar mi nerviosidad. Esto me demuestra que debo hacer
221

confianzaalavidaparasaberquenoesnecesariocontrolarlotodoalaperfeccin
paraquelavidaseabellayamorosa.Tomoconscienciadequeminerviosidad
disimulalainestabilidad,eltemordeunacontecimientoquemedisgustara.Porlo
tanto debo liberarme de ello confiando en mi ser interior y relajndome con
regularidad.
NEUMONA (ver: PULMONES NEUMONA )
NEURASTENIA (ver tambin: BURNOUT, DEPRESIN, CANSANCIO [en
general])
Laneurasteniaesunestadodefatigabilidadfsicaypsquicaextrema.Sus
sntomas se traducen por la dificultad en tomar decisiones y por la confusin.
Aunquenotenganingntrastornoorgnico,puedotenerdificultadesparadigerir,
doloresfsicos,unaemotividadextremaysermuydbil.Laneurasteniaseparece
enmuchospuntosaunadepresin.Entoncestendrtendenciaaretirarmeenla
soledadyaalimentar ideas negativas. Esmiactitudnegativaqueproduceesta
enfermedad.Envezdeponermiatencinsobretodoloquenovaenmivida,
tengo inters en dar las GRACIAS por lo que tengo. Debo asumirme, hacer
proyectos y aceptar que tengo todo el potencial para alcanzar todos los
objetivosquemefijo.Laalegraylafelicidadpodrnentoncestomaranmucho
sitioenmivida.
NEURALGIA (ver: NERVIOS NEURALGIA)
NEUROSIS (ver tambin: ANGUSTIA, HISTERIA, OBSESIN)
Igualqueladepresinylapsicosis,laneurosisestcausadaporemociones
nocontroladasoporlainvestigacindeunaidentidadquesustituiralaquerehso.
Aunque guarde contacto con la realidad y pueda seguir viviendo en sociedad,
puedovivirunsentimientodeangustia,mijuiciopuedeestaralteradoymivida
sexualpuederesentirsebajoformadeimpotenciaofrigidez.Intentotomarellugar
que me corresponde y necesito que se me preste atencin para valorizarme.
Tambinnecesitohallarunsentidoamividaquemepermitirliberarmedelas
tensionesquevivo.Serlibreporquellevarmiatencinsobreelobjetivofijado,
fuente de felicidad y satisfaccin. Por lo tanto debo aceptar mi naturaleza
profundaqueesamaralosdemsyamarmeammismosinnecesariamenteestar
obligadoacomprendertodalavidadesdeAhastaZparaaceptarmetalcomo
soy.
NIO AZUL
Lallegadadelnioazulsevinculaconlamalformacindesucoraznenla
faseembrionaria,lacualtienecomoconsecuenciaelvolveraponerencirculacin
222

lasangrepobreenoxgeno(sangreazul)enlagrancirculacinartificial,sinpasar
porlospulmonespararecibirallmsoxgeno(sangreroja).Sisoyunnioazul,
tambinllamadobebazul,pudecaptarenelsenodemimadreungranmiedo,que
ellallevabaens,deabrirsealamordelmundoexterior.Estopodaprocederde
unagranheridaydeunrepliegosobresconrelacinalamorcausadosporun
acontecimientoquelehubieserotoelcorazn.Nodeboresponsabilizaramimadre
demiestado.Porlaleydelasafinidades,hellegadoenestefamiliaporquetena
retos similares por aceptar con relacin al amor. Slo manifiesto ms
concretamenteenlofsicolatomadeconscienciaquedebohacery,mimadreyyo,
podremosayudarnosmutuamenteenesto.Yaahora,tomoconscienciaqueelamor
eslamismavidayquemipoderincrementadodeamorconstituirunescudode
amorquemeprotegerdurantemisintercambiosconelmundoexterior.
NDULOS
Un ndulo esunalesincutneaomucosaqueestbiendelimitada,casi
esfrica y palpable y que puede ubicarse a diversas profundidades de la piel
(dermis,epidermisohipodermis).Seencuentracomnmenteenlascuerdasvocales
oenlaoreja. Este ndulo meayudaatomarconscienciaquevivodecepcin,
rencorfrenteaunproyectoquenopuderealizarporquegolpeunnudoqueme
hizoapartardemiobjetivoonomepermitialcanzarlo.Estopuedeserenelplano
profesional como afectivo. Mi comunicacin (cuerdas vocales) puede estar
afectada;hubiesequeridodecircosasynomeatrevotengolasensacindehaber
habladodemasiadoydehaberpuestolospiesenelplato.Puedetratarsetambin
dealgoqueo(nduloalniveldelaoreja)yquememolestalpuntodedemorar
laobraqueestabaenrealizacin.Loimportanteesdecidirquetodosucedeensu
buenmomento.Elndulosueleaparecerenellugardemicuerpoenquenoquiero
hacermetocarporqueelhechodehacermetocarporalguien(inclusoalguiena
quienquierooenquientengoconfianzacomoporejemplounmdico)merecuerda
miprimergolpe,unsucesodoloroso.Tomoconscienciadeloquefrenmiimpulso
parapoderlosuperar.Loimportanteesalcanzarelobjetivofijado,cualesquiera
queseanlosobstculosylosretrasosquesehallanenmicamino.Estarentonces
msorgullosoycontentodem!
NOSTALGIA (ver tambin: MELANCOLA)
Lanostalgiaesunamelancolacausadaporunpesar.Habitualmente,cuando
estoy nostlgico, esto implica que miro a travs de una nube turbada por las
emociones,fueradeltiempopresente,conelsentimientodequemefaltaalgo.Es
untipodeensoacin.Sinembargo,estesueonohadeserunahuidaregular
delmomentoactual.Esta nostalgia puedenohacermedaoacondicindeque
slolaexperimentealgunasvecesysinexageracin. Deboaprenderasaborear
223

plenamenteelmomentopresenteparaquecadasegundoquepasaestvividocomo
unaexperiencianicayricaenenseanza.
NUCA (tiesa) (ver tambin: COLUMNA VERTEBRAL, CUELLO)
La nuca eslaregindemicuerpopor dondetodaslasenergas (ondas)
debenpasarparairarepartirseentodomicuerpo.Lanucaestenlacumbredemi
columnavertebral.Micolumnaeselsoporte,laestructurademicuerpo.Minuca
espueselpivotedemicabeza.Unanucatiesaesunademostracindeunrehusoo
deunaobstruccindeenerga.Lacabezayanopuedegirarendiversasdirecciones.
Puedo tener la sensacin de carecer de apoyo y tengo tendencia a mostrarme
obstinadoyrgidoenmimododepensar.Estomellevaaestarpasivo,evitando
ponercosasenmarchayponermeaactuar.Debodejarcircularestospensamientos
diversosquebloqueanmicabezayqueslopidenestarpuestasenprcticapormi
cuerpofsico.Tengolasensacindenotenertodaslascualidadesnecesariasala
realizacin de mis deseos e ideas que corren el riesgo de estar al estado de
proyectoodesueoirrealizable.Porlotantoestarigidezmedicequedebo
estarmsflexibleenmispensamientosymisemociones.Deboaceptar las
diferentessensacionesquevienenamydejarlasfluirlibremente.Lanucapermite
amicabezacontemplardiferentesopcionesdelavidaodiferentespaisajes,sin
crticanijuicio,entodalibertad,comounropermitealaguacorrerenlenunva
yvenperpetuo,sincoaccinnirestriccin.Ahoraqueaceptotodaslasriquezas
quetengoenelinteriormo,yanometengoquepreocupardeloquelosdems
piensandemporqueestoyahoraplenamenteconscientedetodoelpotencialque
mehabita.
OBESIDAD (ver: PESO [exceso])
OBSESIN
Laobsesinesunaenfermedaddelpensamiento.Cuandoestoyobsesionado
poralgooporalguien,todamiatencin,todamienerga,estndirigidashacaste.
Estas ideas me vienen de modo repetitivo y amenazador. Sin embargo me
mantengoconscientedelcarcterirracionalquetienenestasideas.Nocuentanada
ms.Sitengounapersonalidad obsesiva,haymuchasprobabilidadesdequesea
unapersonallenadedudas,conmuchadificultadparatomardecisionesydeque
vivauna ambigedad amor odio, de caraa m mismoo a los dems. Las
obsesionespuedentenerformasmuydiversas:puedetratarsedeunafobiafrentea
algo o a alguien, pueden ser rumiaciones mentales sobre lo que se podra
producirsi,lalocuradeladudaounacompulsinacometerciertosactosque
pueden ser sin consecuencia o que pueden tambin ser criminales, incluso
suicidarios,peroquenuncaprcticamenteestnseguidosdelacto.Lamayorade
veces, tengo un temor angustioso frente a algo que podra suceder por
224

negligenciaoporerrorpersonalyquesedebeevitar.Miprioridadeselmantener
mi obsesin, incluso inconscientemente. Mi sistema de pensamiento est
paralizado. Estoy alimentado por el objeto de mi obsesin. As lleno un vaco
interioryunagraninseguridad.Paravivirobsesin,hedetenerunaespeciede
tensininterior,inquietud;entonces,seraoportunoparamencontrarunpuntode
inters en mi vida que me traiga ms calma y ms paz interiores. As podr
aprovecharmsdeloquemetraelavida.
ODIO
Muchasenfermedadestienenporcausaelodio.Alimentarelodionoshace
detestaralaspersonas,hacevolvermalos,nosincitaalanzarpalabrasofensivas
conlarabiaenelcorazn.Cuandovivoodio,rabia,tengolasensacindequealgo
quemaenm,endiversossistemas:digestivo,pulmonarytambinenrelacincon
lavesculabiliaryelhgado.Enlaevolucindeestossignosquemanifiestael
cuerpo,seanunciandolenciascadavezmsgraves.Puedoatraermeinclusoun
cncer.Elamoreslabasedetodavida.Aprendoaperdonarmeyaperdonaralos
dems.Acepto comprenderalaspersonas,lassituacionesdeotromodo,con
amor.
OJERAS (ojos) (ver: OJOS OJERAS)
OJOS (en general)
Mis ojos sonelespejodelalma.Mepermitenveralexteriory,graciasa
ellos, puedo expresar todas las emociones y todos los sentimientos que vivo
interiormente.Segnsuprofundidad,esposibledescubrirmisrelacionesconel
mundoexterior.Elfuncionamientodemisojosreflejaelmodoenqueveolaviday
mirelacinconsta.Cada ojo representaunaspectoparticulardemiser.El ojo
izquierdorepresentaelaspectointerior,emocionaleintuitivo.Mesirvedeviga,
permitindomequedaralacechofrenteatodoloquepuedeconstituirunpeligroy
reaccionarprontamente.El ojoderecho,l,trataracionalmenteeluniversoylas
situacionesexteriores.Esel ojo delreconocimientoquemepermitemoldearmi
identidad.Problemasenlosojossonlaindicacindequeexistencosasquerehuso
veryquevuelvenaplantearfrecuentementemisprincipiosfundamentalesymis
nociones de justicia. Girando adentro mo mi mirada antes de fijarla haca el
mundo,encontrarasunanuevavisindeconjuntoyunamiradanuevasobreel
caminodemiexistencia.Mimiradaesautnticaysinenjuiciamiento.
OJOS (dolencias en )
Dolenciasenlosojos,entreotraslaceguera,sonunmododecerrarmealo
queveo.Elijoignorarloquesucedealrededormo,renuncioalasimpresiones
visuales que me vuelvena poner en tela dejuicio. En vez deaceptar una
225

realidadquepodraserdolorosa,repugnanteoconfusa,prefierocerrarlosojos.La
ceguerapuedeestarcausadaporladiabetes(verestaenfermedad)otambinporla
acumulacin de cosas que rehso aceptar , aportndome confusin y un
sentimientodeyanosaberadondeir.Frecuentementeheridaporunimpacto,por
untraumatismooporungranmiedointerior,mivistaseretiraylaenergadelos
rganosvisualestambin.Enparticularpuedetratarsedeltemordeperderaalguien
oalgoquequiero.Sinembargo,laoscuridadexteriorparecegeneralmenteaportar
unaaperturainterior,ununiversoprivado,secretoycoloreado.Entoncesmeabro
ms a mi mente interior. Una deformacin del ojo (astigmatismo, miopa,
presbicia) indica que busco de modo desmesurado encontrar respuestas en el
exteriorenvezdedentromo.Cuantomsbuscoafueradem,msmeapartode
mincleointerior.Unavisinvelada(cataratas,glaucoma)indicaquemiversin
delarealidadescontrariaalaqueveo.Estomeindicaquepongodifcilmentemi
atencinsobreloesencial,querechazoloqueveo.Tomoconscienciadelabelleza
quemerodeaymedoytiempoparamirar.
OJOS (dolencias en los nios)
Unproblemadelosojosenunniojovendejapresagiarunestrsfrentea
sufamilia,unrechazodeverloqueenellasucede.Cuandosedesarrollaenla
escuela,estodemuestraquevivoansiedadfrentealodesconocido.Unproblema
delosojosqueseproduceenlaadolescenciarevelaunmiedodelasexualidad.Es
importantequeyo,comounodesuspadres,ayudeamihijoaquecomuniquesus
miedosparadarleseguridadyayudarleasuperarlos.
OJOS ALEXIA CONGNITA
La alexiacongnita se llama tambin ceguerade las palabras o ceguera
verbal.Esunaincapacidadpatolgica68deleer.Obienpuedoleerlasletrassinlas
palabras,oleerlaspalabrassinleerlasletrasoinclusonoleotodaslaspalabrasde
unafrase,todolocualmeimpidecomprendersusentido.Siestoyafectadoporesta
enfermedad,puedovivirunagran preocupacin ounaatencinexageradapara
con los pensamientos que vehculo. Cuanto ms atencin presto (de modo
exagerado)aaspectosdemividaquelonecesitanpoco,msmearriesgoapadecer
quedndomeencerradodentrodepensamientosquefrenanmievolucin.Necesito
abrirme interiormente a mi intuicin y a mi imaginacin, dos facultades
maravillosasqueelalma69quesoyposeeparaexpresarse.Siquieroresolveresta
enfermedad,debomirarloquetrastornamivida,loquelaenfermedadmeimpide
omeevitahacer,decirover.Abriendomicorazn,arregloestasituacindeun
modo consciente.Esmsfcilparamcomoniomanifestarlaescuchainterna
porqueestoymsconectadoquelosadultos.Leomsfcilmentelosmensajes
68

Patolgico:unaenfermedad,cientficamentehablando.
Elalma:lachispadivinaquesoy,miconsciencia.

69

226

deamordemicorazn!Entoncesmeabroamiintuicinymanifiestomsmi
creatividad.
OJOS ASTIGMATISMO
Elastigmatismoesundefectodeesfericidad70delacorneaodelcristalino.
Lacurvaturaverticaldelacorneaesmsimportantequelacurvaturahorizontalo
inversamente. Esta malformacin denota generalmente un miedo a mirarme de
frente,talcomosoy.Unamalacoordinacindelosojospuedesignificarquemi
mododeactuarymispensamientosestnendesacuerdoconmientorno,causando
as conflictos interiores.Puedoquerer crearme unarealidad diferenteeintentar
liberarmedelainfluenciademispadresodecualquierotrapersonaqueencuentre
abusiva. Frecuentemente confrontado con la rabia, la ira o miedos durante mi
juventud, misojos hanconservadoestaexpresindemiedoylosmsculosque
rodean elojo sehanquedadoenestadoconstantedeimpacto. Misojos podrn
estarirritadossiloqueveofueraodentromeirrita.El astigmatismo tambin
puedeserelresultadodeunagrancuriosidad.Minecesidadinsaciabledeverlo
tododesgast misojos.Deestemodo,micuerpomedicequetomeeltiempo
necesarioparaapreciarlascosas.Tambinestopuedesignificarquetengointers
enreconocermipropiabelleza,elsermagnficoquesoy.
OJOS CIEGO
Estoyconsideradocomociegositengo10%devisinomenos.Sivivoesta
situacinpuedopreguntarmeloquenoquieroveroloquemedamiedoverenmi
vida,unapersonaounasituacin.Siestoseprodujodespusdeunaccidenteouna
enfermedad,puedobuscarlacausaquepodraestarvinculadaaestaprdidade
visin. Entonces, puedo trabajar para integrar esta causa para la toma de
conscienciaquedebohaceryaceptarotravezdever,dejandoquemivisin
internasedesarrollecadavezmsenelamorylacomprensin.
OJOS ceguedad
Rehusando abrir los ojos, ver el mundo exterior, slo me queda la
alternativa de mirar dentro mo y tomar consciencia de mi Universo interior.
Aceptoverlariquezaquemehabita,laluzqueestenm.
OJOS CATARATAS
Lascataratassonunaenfermedadenlaqueelcristalino(lentillabiconvexa
del ojo)sevuelveprogresivamenteopacoatalpuntoquelavisinsevelayse
distorsiona,locualllevaalaceguera71amsomenoslargoplazo.Estaformade
70

Esfericidad:queserefierealacurvatura.
Ceguera:sinnimodeciegoodeprdidadelavista

71

227

incapacidad fsica llega en mi vida en el momento en que ya no deseo ver


interiormenteloquesucede delantemo,loqueseguiroloqueamenazacon
influenciarmividaylasdecisionesquedeberatomar.Loquevioveoparael
futuromellevaadecirme:Nocreomis ojos!.Mivisindisminuyeporquela
energayanobaaestelugar.Pierdebrilloyseoscurece,veoelfuturoconunojo
oscuroyvelado,sinalegranialegradelcorazn.Esposiblequetengaunaactitud
egocntricayquequieraverlavidasloamimodosintenerencuentalarealidad
ajena.Esunaactitudegostaquepuedeinclusohacermecreerquesoysuperiora
losdems.Esta catarata meapartadelpresente,meretiradeluniversoqueme
rodea.Estomedisgustaaciertosnivelesydebotomarconscienciadelosaspectos
exterioreinteriordelascosas.Lacatarataaparecenormalmentehacaelfinalde
la vida, en el momento en que se instala el miedo de envejecer y volverme
impotenteosinpoder.Yanoquieroverlafuturaimagendemsiannoestaqu,
portemoraquemedisgustedemasiado.Pierdomiflexibilidadmentalydeaccin.
Mevuelvomenostoleranteyolvidofrecuentementelossucesos queacabande
sucederme.Entoncesnotengointersenverelfuturoquepuedeparecermemuy
oscuro (las cataratas son frecuentes en los pases en va de desarrollo). Sin
embargo,puedolevantarelveloquemeimpidevermiautnticarealidadponiendo
miatencinenmiluzinterior.Aceptohacerelesfuerzodemiraradentromoy
vertodalaluzylabellezaquemerodean.
OJERAS
Generalmente, ojos fuertemente marcados por ojeras son el signo de
cansanciofrecuentementecausadoporunaalergia,lacualeselresultadodeuna
dependencia haca un producto. Mi cuerpo me indica as que debo ser ms
independienteyquemifelicidaddebedependerdemsolo.Laaprobacindelos
demsentoncessevuelveunplusenvezdeserunacondicinamibienestar.
OJOS CONMOCIN DE LA RETINA (ver tambin: CEREBRO
CONMOCIN)
Enelplanofsico,la conmocin seproducedespusdeungolpeviolento
(directooindirecto)enunapartedemiorganismoqueconllevalesionesocultas,
necesitandounexamenmsprofundo.Enelcasodeunaconmocindelaretina,
rehsoverloquemesaltaalavistaporquetengodificultadencambiarmivisin
delascosas.Aceptoliberarme,soltarmisantiguospensamientosomisantiguas
manerasdeverydejositioparanuevospensamientosqueyaestnaqu.Apartirde
ahora,estoyalaescuchaymedejoguiarpormiintuicinypormissentimientos.
Mesientomslibreysereno.

228

OJOS CONJUNTIVITIS
Laconjuntivitiseslainflamacindelamembranatransparentequerecubre
el interior del prpadoyel glbuloocular.Existe unarelacindirecta entre la
conjuntivitis yloqueveo.Inconscientemente, rehusoverunasituacinoun
suceso conel cual estoy endesacuerdo oquemehiere.Estomellevaavivir
frustracin,irritacinyrebelin.Nopuedosoportarloqueveo!;Mequemael
vertalcosa!Escomosimis ojos quisieranlavarseincesantementela suciedad
queveoenlasituacinquemehaceenfadar.Elresultadoconllevaunahinchazn
yunaturdimientomentalascomoundesmadreemocionalsimilaralaaccinde
llorar.Prefieroestartemporalmenteciegoporqueloqueveomehacesufrir.Tomo
eltiempodepararmeyaceptocontemplarestasituacinquememolestay
mepreguntoporquesas.Memantengoabiertoyreceptivo;asmeevitovolver
avivirconjuntivitis.
OJOS DALTONISMO ( no percepcin de los colores)
Ser daltoniano,esverelmundosinsuscolores,grisceoeindiferenciado.
Puedesucederquesloseancoloresprecisoslosquenopuedaver.Entoncesme
puedopreguntarencualsituacindemividaconocuninmensoestrsyquehaca
referenciaaestecoloroaestoscoloresquenopuedodiscernir.Porejemplo,sino
puedoverelrojo,quizsdejovenestuveapuntodemorirporqueuntrenrojose
dirigacontram.Ahoraasociadoaunaltoniveldeestrsysimbolizandolamuerte
quemeespera,inconscientementeyanoquisieraverelrojo.Sinopuedodistinguir
ningncolor,sepuedeaplicarelmismoprincipio.Tambinunda,puedohaber
decididonosoarencoloresparaevitarestardecepcionado.Yaquenuestros
sueosdehoycreanlarealidaddemaana,voyadejardeverloscoloresenmi
vidadiaria.Apartirdeahoravoyadecidirloscolores,dejarsitioamiimaginacin.
Imaginoelrosa,elverde,elazul.Comounartista,decidolamezcladecolores.Me
impregnodeestaunidadquemeofreceelmundo.Dejolibrecursoamifantasa,
expresomialegradevivirdemilyunmodos.
OJOS DESPRENDIMIENTO DE LA RETINA
El desprendimientodelaretina esunaafeccindel ojo causadaporla
separacindelaretinaydelahojasubyacente,bajoelefectodelpasodellquido
vtreo debajo de la retina. El desprendimiento de la retina procede de una
situacinenquevialgoquesucedaenmyprovocunestrsinmenso.Tengola
sensacin de que esta imagen de un acontecimiento que encuentro horrible se
quedar impregnada en mi memoria toda mi vida! Es importante que haga
frenteaestaimagenenvezdequereresconderlaenelfondodeunacajaonegarla.
Puedopedirlaayudadeunterapeutaquemeayudaraencontrarporqudebver
estesucesoperturbadoreidentificarlaleccindevidaquedebosacar.Esteproceso
229

hecho, voy a evitarme otras situaciones en las cuales podra desarrollar otro
desprendimientodelaretina.
OJOS ESTRABISMO (en general)
El estrabismo denota contradicciones e incertidumbres frente a mis
relacionesconmientorno,unaluchaperpetuaentreunanecesidaddesoledadyla
deestaradmirada,undeseodeindependenciaconfrontadoconelmiedoaestar
solo. La dulzura del silencio est constantemente en contradiccin con esta
necesidad de preguntar. Aprendo a discernir mis autnticas necesidades y a
sentirmebienencualquiersituacinquesea.
OJOS ESTRABISMO CONVERGENTE
Elestrabismoconvergente(oserbizco)esunadesviacindelosojoshaca
lanariz.Implicageneralmentequemeniegoaverlascosastalescomosonen
realidad,frecuentementeacausadelainseguridadquerepresentanparam.Puede
que,deestemodo,deseeescaparapersonasqueconsideroamenazadorasparam.
Segnelojoquesedesva,puedodescubrirciertosaspectosdemipersonalidad.Si
setratadelojoizquierdoquesegirahacaelinterior,soyunapersonatemerosa
padeciendounfuertecomplejodeinferioridad.Si,alcontrario,esmiojoderecho,
soyprobablementemuysusceptibleyrencorosa.Esunmododecentrartodami
atencinymiinteligenciasobremosobreunacosaosobreunapersonaquehede
vigilar constantemente. Un ojo izquierdo bizqueando en sumo grado haca
arribarevelaquesoyunsoador,irracionalysinnocindeltiempo.Sisetratade
mi ojo derecho, soy una persona indisciplinada y dotada de una inteligencia
irracional.Elestrabismotambintieneporefectoelverlascosassolamenteendos
dimensiones.Paraunificarmipercepcin,tengointersenobservarlascosasbajo
todoslosngulosyaceptarlarealidad.Mevuelvoatentoatodoslosmensajes
quemetransmitemicuerpoyvuelvoadescubrirlosplaceresdeunavisindela
vidaensuglobalidad.
OJOS ESTRABISMO DIVERGENTE
Comoparaelestrabismoconvergente,elestrabismodivergenteestambin
unadesviacindelosojospero,estavez,hacaelexterior.Revelatambinun
miedoamirarelpresentedecara.Cuandoeselojoderechoqueestafectado,esto
revelaunesfuerzointelectualpuestoenaccinparafacilitarlarelacinentrela
inteligenciaylasituacin.Tengolasensacindequemiinteligenciadavueltas,lo
cualpuedeinclinarmeatenertendenciaaladepresin.Sisetratamsbiendemi
ojoizquierdo,soyunapersonadeunagransensibilidad.Hagolasaccionesen
funcindeestasensibilidad.Acepto vivirelmomentopresenteymirarcada
situacin de cara. Mi sensibilidad me permite de ahora en adelante tomar las
decisionesinteligentes,sabiendoqueestoyconstantementeguiadoyprotegido.
230

OJOS GLAUCOMA
Elglaucomaimplicaunbloqueodelcanaldesalidadelojo,impidiendoas
que se liberen los lquidos. Estos lquidos representan todas las lgrimas que
hubiesentenidoquecorreralolargodemividayque,habindoseacumulado,
provocanunapresinsobrelaretina,causandoaseldeteriorodelavista.Afecta
msfrecuentementelagentedemsdesesentaaos,quefrecuentementetieneel
sentimientodehabervistolobastante.Puedeserelsignodeviejosrencoresyde
unanegacindeperdonarme.Puedotenerlasensacindeestarfueradecarrera,me
damiedoelfuturo.Sintindomefcilmentecansado,lavidasevuelvediferentey
msdifcildeaceptaremocionalmente.Meniegoavermeenvejecer;lasimgenes
delfuturonopuedenverseyestomeconvieneperfectamente.Elijoquitarelvelo,
aceptoverconamoryternura.Unojoafectadodeglaucomaactacomouna
lupa;porlotanto,hayalguienoalgoenmividadelocualquisieraacercarmelo
antesposible.Puedotenerlasensacindehaberpasadoalladodeciertascosasen
mividaytengoresentimientohacaellas.Escomosiocasionesmecorriesenentre
losdedosjustocuandoestoyapuntodelograrorealizaralgo.
OJOS - HIPERMETROPA Y PRESBICIA
La presbicia esunestadoqueimpideverlosobjetosdecerca.Revelaun
miedodelpresente.Culeslacosademivida,cercadem,quemeniegoaver?
Puedetratarsedemiincapacidadaponerlascosasapuntoyaverconclaridadlo
quemeesaccesibleycercamo.Pongomsintersenlosdems,enmisrelaciones
personalesyenlosacontecimientosexterioresenvezdemirarenmydesarrollar
cadavezmsmiyointerior.Esteestadopuedehabersidocausadoporunimpacto
o por un traumatismo que me hizo creer que el presente no era para m.
Volvindomeextravertidoymirandolejos,elijoignorarloquesucedecercadem,
missueosestnorientadoshacaelfuturo.Misojossevuelvencomounvigaque
estcontinuamentealacechodeloquesucedelejos.Vivoinquietudporqueloque
mepreocupaahorameinquieta:envejezco,losniosdejanlacasa,mevuelvoms
triste.As,mivisinsetransformaenfuncindeloquequieroydeloqueno
quierover.Enelcasoenqueslounodeambosojosestafectado,esimportante
queconsiderelassituacionesvinculadasconelladodelcuerpoafectado(izquierdo:
intuitivo;derecho:racional).Aceptoverlavidahoy,contodassusbellezasys
queestoyseguro,AQUYAHORA.
OJOS MIOPIA
Lamiopadificultadmivisinlejana.Miinseguridadfrentealporvenirme
hace ver los acontecimientos ms gordos y ms inquietantes de lo que son de
verdad.Escomosinoestuvieralistoparaenfrentarles.Puedoverloqueestcerca
moperomivisinlejanaesconfusaacausadelosmsculosocularescontradosy
tensos.Ensuma,puedotratarconmirealidadinmediataymividadiaria,con
231

gran facilidad. Pero me es difcil crear mi propia visin del futuro y ver las
posibilidadesfrenteam yaquedebosuperarelmiedoaloqueviene.Sisoy
miope,puedotenertendenciaaestarmolestoeintrovertido,locualpuederesultar
deexperienciasdemiinfanciaquevivcomopavorosasoabusivas(porejemplola
miradahostilorabiosadeunodelospadres).Porejemplo,siunmaestroounto
mepegaba,mevolvmiopeporquetenamiedodel,ynoqueraverloporqueasu
sola vista, me pona nervioso, inquieto sabiendo lo que me esperaba.
Habitualmente, a menos de haber vivido otro conflicto, mi visin cercana ser
mejorquelamedianaporques,inclusoinconscientemente,queesimportanteque
veabienloquesucedecercamoparapoderdefendermeoparahacerlosbuenos
gestoscuandoestaamenazaestarcercademyparaquenomehiera.Lamiopa
indicageneralmenteunasubjetividadexcesiva.Laexpresinnovermslejosque
sunarizdescribebienestamaneradeser.Noquererveralolejosporcansancioo
perezao,an,afuerzadedecepcionesdelavida.nocreomisojosilustrabien
cmomesiento.Compadecermedemmismoesavecesmsfcilqueactuar.
Aceptando ver el mundo exterior, esto me permite aprender sobre m. Se
ensancharmivisinysedesarrollarmiespaciointerior.Elijonuevoscaminos,
mehagoconfianza.
OJOS NISTAGMUS
El nistagmus esunasecuencia demovimientosbruscos yrpidosdelos
glbulosoculares,independientesdelavoluntad,frecuentementesintomticosde
unaafeccindelcentronervioso.Simisojospadecendenistagmus,esquestos
estn constantemente en movimiento de barrido. Debo preguntarme cuando
aparecielnistagmusenmivida.Estoconcordargeneralmenteconunperodoen
quevivaunasituacinenlacualexistaunpeligroyquebusqu,sinparar,barr
todas las posibilidades que se brindaban a m para poder salir adelante. Es
importantequevuelvaadibujaresteacontecimientoparatomarconscienciadela
fuentedeestaenfermedadyaspodercurarla.Tomoconscienciaqueelpeligro
podaserrealparamenelpasadoperoque,ahora,steyanoexisteyqueestoy
constantementeguiadoyprotegido.
OJOS QUERATITIS (ver tambin: INFLAMACIN, LCERA)
La queratitis es una inflamacin de la cornea, acompaada de dolores
importantespudiendopresentarsebajoformadelceras.Seproducecuandovivo
penaenrelacinconalgooalguienqueveoyquemeponeenfadado.Estomepone
enunosestadostalescomollegarapegaraunapersonafsicamenteo,ensentido
figurado,podraquererqueladesgraciacaigaenlaspersonasolassituaciones
referidas para darme cierta satisfaccin. Tambin puedo ser yo quien quiera
escondermedealgooalguienparanoservisto.Lacorneasiendolaventanadel
ojo, deber hacerla ms opaca para que se sustituya por una pared que me
232

proteja.Micuerpomedicesimplementequedeboaprenderamirarlavidacon
otrosojos,conunanuevaactituddeaperturaycomprensin.Puedovercosas
quenomesatisfacen,quenomeconvienenydebodesapegarmedeloqueveo.
Debo aprender a soltar el control que quiero ejercer sobre las cosas, sobre las
personasosobrelassituacionesquemerodeanysobrelascualesnotengoningn
poder.
OJOS RETINITIS PIGMENTARIA o RETINOPATA PIGMENTARIA
La retinitis pigmentaria, tambin llamada retinopata pigmentaria, se
consideraunaenfermedadhereditariaquehacequelasclulasvisualesreceptoras
de la luz degeneren. Suele afectar a los nios. El ojo no puede adaptarse a la
oscuridadydisminuyeelcampovisualconeltiempo.Porlotanto,yanoveolaluz.
Estaenfermedadsedesarrollarsitengovergenzademipersona,dequiensoy,
tantoenelplanofsicocomointelectual.Quisieraquelosdemsdirijansumirada
enotraspartesquesobrem.Puedequeseaperfeccionistayqueelhechodever
grandedelantemomecauseungranestrs.Puedotenermiedodenoacabarcon
todoloquemeesperaenlavida.Micuerporespondeaesteestrsdisminuyendo
micampodevisin,esperandoasdisminuirmiestrs.Deboaprenderaaceptarme
talcomosoyyallevarunamiradapositivaconrelacinaquiensoy,siendo
unapersonanicayexcepcional.
OLOR CORPORAL (ver tambin : NARIZ)
Engeneral,todosloslquidoscontenidosenelcuerpohumanorepresentan
misemociones.Enestecaso, unolorcorporal desagradableeselsignodeque
desbordan emociones nefastas y que las debo expresar en vez de todo guardar
dentro de m. Esto puede ser irritabilidad, disgusto, odio, frustracin, rencor,
disgustoporunapersonaounasituacin,etc.Estotambinpuedeserelsignode
quesesueltaunaemocinintensaqueestconectadaalapartedelcuerpoadonde
llegalatranspiracin.Unapersonaquetengaunbuenolorcorporalgeneralmente
tendrbellospensamientosyestarenarmonaconsuentorno.Ocurrequesoyuna
personaquerecibiunavidaconunamisinespiritualalta,quemueroenolorde
santidad.Realmentesepuedeolercomosiemanaradelcuerpounperfumedeflor.
Tambin, si leo textos espirituales, estoy en un estado en que soy muy feliz,
entoncespuedoemanarunoloraclavel,rosa,sndaloymuchosotrosperfumes.
Laspersonaspodrnoleronoelperfumequedesprendo.Aunqueestoesescaso,
puedo ser una persona que es capaz de oler las enfermedades e incluso los
sentimientos de otra persona. As, cada enfermedad tiene un olor particular,al
mismo ttulo que las enfermedades tienen un color particular en el campo
magnticoquesellamaaura.Siesabundantelatranspiracin,essealdeque
vivomuchanerviosidadinterior,inseguridadoquetengograndesangustias.Dejo
salirporlosporosdemipieltodoloquereprimoymemantengopresodentrode
m.Deboaprenderaafirmarmeyexpresarmissentimientostantopositivoscomo
233

negativos para liberarme, dejar sitio para lo nuevo y que me nutran bellos
pensamientosdeamor.
OLVIDO (prdida de las cosas) (ver tambin: ACCIDENTE)
El olvido se manifiesta por un fallo momentneo o permanente de la
memoria.Puedeserunsignodequemeagarroaciertossucesosoapersonas,del
pasadoengeneral,yfrentealoscualesdebodesvincularme,porquevivoenel
pasado en vez de disfrutar con el momento presente. Tambin puede que est
inquietoreferenteaunaovariassituacionesdemividayestomeimpideestar
totalmentepresente.Siolvidoopierdomisllaves,micartera,omibolso,entonces
puedequeestbuscandomiidentidad.Puedosentirmeculpableporconcederme
algndescanso,ofrecermedulces,reclamaratencin(porquenoesrazonable)y,
as,meautocastigoperdiendomiscosas.Aprendoadejarfluirlascosasylas
personas,dejoelpasadoenpazymeabroatodaslasbellezasdelavidaqueestn
aquyahora.
OMBLIGO
Elombligoeslaaperturadelaparedabdominaldelfetoporlacualpasael
cordn umbilical. Poco tiempo despus del nacimiento, se vuelve cicatriz y es
comnmentellamado ombligo.Undoloraestenivelimplicaquemehedeabrir
msalosdemsenvezdequedarmecentradosobrem.Puedequeestcortando
elcordnumbilical,esdecirmidependenciahacamimadre,mimediofamiliar.
Porelombligorecibtodoelalimentoesencialamicrecimientoymisupervivencia
cuandoerafeto.Unaanomalaounadolenciaenestenivelpuedepuesdarmela
indicacindealgoqueesdevitalnecesidadparamyquenoreciboo,alcontrario,
algoquequisieraexpulsar,evacuarporqueestconsumidoorecibidoenexcesiva
cantidad y puede que ya no sea beneficioso para m. El ombligo tambin es
consideradoporalgunaspersonascomouncentrodeenergamuyimportantepara
la apertura porque existe incluso un grupo de se llaman los adoradores del
ombligoloscualespracticanejerciciosdemeditacinenestapartedelcuerpoque
representalaaperturadelpasodelavidacuandoeraunfetoenelvientredemi
madre.Aprendoareconocermiscualidadesconhumildad,evitandoastomarme
porelombligodelmundoypermitindomevertodalabellezaqueexisteencada
seryencadacosa.
OMOPLATO
El omoplato es un hueso llano, largo y delgado formando parte del
esqueleto.Conlaclavcula,elomoplatosirveparaunirelbrazoconeltronco.El
sentirdolorenestelugarpuedeindicarunarebelinfrentealaautoridad,porque
mesientocogidooaplastado por sta. Las dificultades (fracturauotras) enel
234

omoplatopuedenprocederdeunacontrariedadentreloquesoy,representadopor
el tronco, y lo que quiero expresar, representado por mis brazos que son la
prolongacin de la energa del corazn. Acepto considerar que estoy en
plenamenteyoparamanifestararmonaenmivida,enlasaccionesquehago.
OPRESIN:
Cuandomesientoahogado,tengolasensacindeunpesoenelpecho,por
lotantoalniveldelospulmones.Tambinpuedotenerlasensacindeahogo.Esto
puedensermisemocionesquemesobrecargan,misinquietudesquepesanmucho,
mirebelinqueruge.Puedosentirmeagobiadoporlaautoridadyelpoder,que,
en mi opinin, abusa de m. Puedo sentir presin frente a una persona o una
situacincausadaporunainseguridadinteriorprofundaquehacequequisieraver
la situacin resuelta rpidamente. Recobro el poder que me pertenece. Tomo
conscienciadelalibertadqueposeo.Liberomissentimientosnegativosparadejar
sitioalacalmayalamor.
OPRESIN PULMONAR
Talestadodemuestraquehayundesequilibrioentrelapresindemiinterior
yladelexterior.Esunsentimientomuyfuertequebloquealalibrecirculacinde
lavidaenm.Debopuestomarconscienciaypreguntarmesiestafuertepresin
vienedemiinterioryloque,enestesentimientoprobablementemuyfundamental,
meimpiderespirarregularyprofundamente.Inspirolaluzquealumbrayelamor
quepurificaestasemociones,lascualesasestarnequilibradas.
OREJAS (en general) (ver tambin: OREJAS SORDERA)
Lavistayelodomepermitensituarmeenelentorno.Puedovercosassin
quehayasonido,puedoorsonidossinvernecesariamentededondeprocedeeste
sonido.Ambossentidosformanunaespeciedetresdimensionesdemientorno.
Aslasorejas(odos)mepermitenortodoslossonidosquemerodean,tantolos
quesonarmoniososcomolosquenoloson.Lasorderatotaloparcialpuededarse
cuando no puedo tratar o aceptar lo que oigo. Si soy sordo es que se ha
instaladounprocesoselectivodeinformacionesyquequieroorsloloqueme
convieneymecortodetodoloquesediceyloquenomeconviene.Esteproceso
selectivoesmuyeficazporquemepermitirreconocer,porejemplo,lavozdemi
hijoquebuscoentreunamuchedumbre.Delmismomodo,esteprocesoactuara
la inversa por lo que no quiero or. De un modo indirecto, las orejas (odos)
permiten un mantenimiento del equilibrio cuerpo mente evolucionando en el
Universo. Este equilibrio me aguanta de pie, en alerta, permitindome estar
centradoyseguirmiva.

235

OREJAS - ODOS (dolores de) (ver tambin: OREJAS / ACUFENOS/


ZUMBIDOS DE OIDOS / OTITIS
Doloresdeodos seproducencuandovivounapena,estoyirritadoome
sientoheridoporcosasqueo.Tambinpuedotenerlasensacindequenadie
escuchaloquehededeciroestoydecepcionadoporloquemegustaraqueme
digany nodicen jams (cumplidos, agradecimientos, etc.) Es comosi quisiera
encerrarmeyyanoestarencontactoconloquemerodea.El dolordeodos se
produce despus de una critica que ha llegado a mis odos y que me estaba
destinadaoestabadestinadaaotrapersona.Loqueoigomeangustiaymeduele,
tantofsicamentecomoemocionalmente.Sisetratadeunainfeccinenlaoreja,
probablementeopalabrasquemecausanirritacin,untrastornoemocional,un
conflictoodesarmona.Sitengootitis,vivomuchaimpotenciafrentealoqueo.Si
unnioviveunadolenciadelosodos,estopuedeexpresarunconflictovinculado
conelentornofamiliarolaescuela.Losdoloresdelosodossonfrecuentesenlos
niosqueoyentodoloquedicenlaspersonasmayores,laspeleasdesuspadres,sin
poderdarsupuntodevista.Aprendoaconservarmisodosabiertosencualquier
momento,desarrollandoalmismotiempomicapacidaddedesapegofrentealoque
oigo.Asmicoraznpuedemantenerseabiertoentodoinstante.
OREJAS OIDOS ACFENO (ver tambin: OREJAS ZUMBIDOS DE
LOS OIDOS)
El acfeno es el fenmeno que hace que oigo sonidos como silbidos,
zumbidos,chisporroteossinqueestotenganingunarelacinconmientorno.Esto
puede ser pasajero o permanente y puede producirse con intensidades sonoras
diferentes.Cuandosucedeestodebotomareltiempodepreguntarmesiestuveala
escuchademivozinterior.Escomosinoestuvieraperfectamentesintonizadocon
miaparatoderadiointerno.Cuandosintonizounaparatoderadioqueesten
ondasyquenoemitemsicanipalabra,puedoorelsilencio.Encambio,si
desplazoelreceptorsobreunafrecuenciaenlacualnoemiteningunaestacin
emisora,oigounchisporroteoosilbidos,comosiutilizaseunpuestodeondacorta.
Existiranemocionesquehubiesereprimidoportemoraperturbarmiequilibrio
interior?As,lavidamerecuerdaquehedeestaralaescuchademivozinterior,de
misnecesidadesydemisdeseos.Deboasumirmeparadisminuirelnivelderuido
olasinterferencias que puedanexistir enmispensamientos ymis emociones.
Porqueelhechodeorsilbidosoestoszumbidosmeindicaquizstambinquehay
algoqueyanoquierooryqueestossonidosvanaahogarparaevitarqueesto
llegueamisodos.Aceptoabrirmsmisodosinterioressituadosa8o10cm.
detrsdemisorejasfsicas)paraestarenmedidadecaptarmivozinterior.Puedo
pedirtambinormsconscientementelossonidosdelanaturalezaylasmelodas
celestes para beneficiar de ms paz y descanso en m mismo. Cualquier
acercamientoholsticocomoelyoga,relajacionesdirigidas,acupuntura,osteopata,
236

vitaminoterapia, energa, etc., puede ayudar a disminuir el nivel de estrs y a


devolverlatranquilidadinterior.Puedequeoigatambinalgocomoelsonidode
unriachuelo,untorrente,eltaidodecampanas(pequeas,medianasogordas),
gaita,vientoenlosrboles,zumbidodelasabejas,milesdeviolines.Estossonidos
correspondenasonidosquepuedoorendiferentesplanosderealidadesinteriores
ypuedenpermitirmedeterminarenculplanoestoysintonizado.Estosignifica
entoncesquemiodointernoestabiertoparaormslarealidaddeestosmundos.
OREJAS ZUMBIDO DE LOS ODOS
Los zumbidos serelacionanconelrehsodeescucharsuvozinterior,los
signosinterioresqueguanmivida.Hagoamiantojo,rehsoorciertaspalabras
queencuentrodesagradables.Inclusopuedoestarobstinado.Resistoporquetengo
miedodesaberlaverdad,deestaralcorrientedeunasituacinoinclusodetomar
eventualmenteunadecisin.Estopuedeinclusoponermeendesarmonayactivar
unzumbidodeodosparanoorTengolasensacindequeunapersonapiensa
enmcuandoenrealidadgeneralmente es locontrario.Puedoestarentensina
causadelasideasquemeandanporlacabeza.Aceptandoquedarmeabierto
al nivel del corazn, puedo or las palabras con ms desapego. Ya no estoy
obligadoahacermeelsordo.
OREJAS OTITIS
La otitis esunainflamacinenunaorejaoambas orejas,yquetienesu
causa en la incomodidad que puedo vivir frente a algo que oigo o que o
ltimamente.Laotitisesfrecuentecuandosoyniosobretododebidoaloquese
puedendecirmispadresentresoaloquemedicenporquefrecuentementenosoy
capazdeexpresarmidisgustoomifrustracin.Adultoonio,sibienestapena
puedeprocederdeloqueoigo,puedeprocedertambindeloquenooigocomopor
ejemplo:tequiero,Enhorabuenaporloqueacabasdehacer,etc.Engeneral,
cuandotengounaotitis,haylquidoqueaparecedetrsdeltmpano.Loqueoigo
debeentoncespasaratravsdeestaaguaantesdeserodo.Estasituacinesla
mismaquecuandoerabebenelvientredemimadre.Porlotanto,busco,incluso
inconscientemente, por una otitis, volver a este entorno privilegiado. Prefiero
quizs hacermeelsordo, taparmelosodos,parayanotenerqueor.Paramis
padres es un signo de que vivo un conflicto interior y es importante que me
permitanexpresarloquevivoparaaportarunarpidacuracin.Comoadulto,la
otitismepermitehacermepreguntasencuantoamivozinterioryver:laoigo?,
Recibomensajesquememolestanymehacenenfadarconrelacinaloque
debohacerofrentealoquesemepidehacer?Esporlaescucha,tantointerior
comoexterior,quepuedoprogresarenlavida,stapermitindomeestarcentradoy
evitarobstculosintiles.
237

OREJAS SORDERA
Msvaleestarsordoqueoresto!.Elijodejardeor,decidoaislarmede
losdems.Sintindomefcilmenterechazado,metapolosodosporqueyano
quieroestarmolestado.Sinsaberavecesqucontestar,mehagoelsordo.Tengo
miedodeestarmanipuladoynoaceptolacritica,noquieroentrarenrazn.Por
lotantocreandoestabarrera,measlocadavezms,meobstinoanoor.Sin
embargo,loquieraono,eltiempohacequelosproblemasnoresueltosdemivida
vuelvantodosundayquedeberenfrentarmeaellos.Tendraintersenprestar
elodoyescucharmivozinteriorqueeslamejorconsejerademivida.Elacto
ms bello de amor que pueda hacer es abrir mi corazn. Acepto or los
mensajesymeabroalosdems.
ORINA
(infecciones
urinarias)
o
CISTITIS
(ver
tambin:
INCONTINENCIA [ URINARIA], INFECCIONES [en general],
LEUCORREA, VAGINA VAGINITIS)
La orina representamisviejasemocioneslascualesyanonecesitoyque
elimino de mi sistema. Una inflamacin de la vejiga o del conducto urinario
(cistitis)provocadolorcuando orino (inclusoenpequeacantidad).Estoesms
frecuente en las mujeres jvenes, los diabticos, las mujeres embarazadas.
Tratndose de una infeccin, esto implica que esta dolencia se vincula
frecuentemente a ira acumulada. Tambin puede ser resentimiento, irritacin o
cualquierotrosentimientoardientequeafectanuevosaspectosdemmismoode
misrelacionespersonales.Comoenelcasodeunavaginitis(oleucorrea),puedo
vivirunsentimientodefrustracinconrelacinamisrelacionessexuales.Alestar
encomunicacinmisistemaurinarioymisistemareproductor,unopuedeafectaral
otro.Puedequemisrelacionessexualesfuncionenadmirablementebienyqueno
entiendaelporquvivirayofrustracin.Precisamenteporquetodovabien,puede
que me pregunte porqu espere tantos aos para tener relaciones sexuales
satisfactorias?Deaqupuedenprocedermifrustracinymienfadonoexpresados.
Tambin,porejemplo,unacistitispuedemanifestarsedespusdeunaseparacin.
Alnohabersidocapazdeexpresarmisemocionesnegativas,afloranmiedosas
como conflictos interiores con relacin a lo que ser de m. Teniendo grandes
esperasporcolmar,culpoalagentequemerodeadeestevacoy,lamayoradelas
veces,amicnyugeenprimerlugar.Pasodefrustracinenfrustracinporquedejo
alosdemslaresponsabilidaddemibienestar.Espuestiempodeasumirme,de
aceptar laresponsabilidaddemivida.Tomoladecisindeseguiradelante,
estoyrenaciendo,independientementedelasrelacionespresentesyanteriores.
ORZUELOS (ver tambin: FURNCULOS)
El orzuelo esunpequeofornculorojoydolorososituadoalbordedel
prpado, en la base de una pestaa. Se manifiesta cuando vivo tristeza,
238

resentimientofrenteaalgooaalguienqueveoyquenomeconviene.Puedeque
unapersonatengaunaopinindiferentedelama,quehagalascosasdemodo
diferenteyqueestoestpercibidocomoalgosucioamisojos.Ladiferencia
entrelaconjuntivitisyelorzueloesqueenste,encuentroquehayalgofeoenla
situacin.Envezdereprimirmisemociones,tengointersenexpresarlasporque
podranaparecerbajoformadeorzuelos.
OTITIS (ver: OREJAS OTITIS)
OVARIOS (en general) (ver tambin: FEMININOS [dolores ])
Losovariosrepresentanmideseodeprocrearytambinmicreatividad,mi
destrezaencrear,mifeminidad,porelhechodeserunamujerydeestarcolmadao
satisfechacomomujer.
OVARIOS (dolores de los )
Los problemasdelosovarios indicanunprofundoconflictoencuantoal
hechodesermujer,alaexpresindemifeminidad,oalhechodesermadre.Puedo
tambinhaberdejadodeladoelladocreativoqueestpresenteenm.Escomosi
mecortasedeunapartedemmisma,porquelosovariossonelprincipiodela
creacindelavidaysesitanenlapelvis,queeslareginendondepuedodara
luzaunnio,perotambinanuevosaspectosdemmisma,ahendondepuedo
descubrirmeotravez.Puedepuesexistirunconflictointeriorfrentealacreaciny
aldescubrimientodemipropiava.Unquistedelosovariosindicalaacumulacin
deenergaemocionalosentimientoscontrarios,vinculadosconlaenergadelos
ovarios.Encuantoal cncerdelosovarios,sepuededesarrollardespusdeun
acontecimientoenquevivlaPRDIDAdeunserquerido.Elparaleloalcncer
delosovariosenelhombreeselcncerdelostestculos.Frecuentementeelser
queridoesunodemishijosmuertoenunaccidente,despusdeunaenfermedado
de un aborto. Puede tratarse de una persona con quien no tengo vnculos
sanguneosperoqueamotantocomosifueramihijo.Elsentimientodeprdida
puedevivirseconunelementoabstractocomoporejemplo:Desdequetieneeste
nuevo trabajo, mi marido ya no est en casa, vuelve tarde, ya casi no nos
hablamos,siempretienesutrabajoenlamente.Heperdidoamimarido!Siesto
sigueas,eltrabajodestruirnuestromatrimonioPorlotanto,heperdidoal
hombrequeconocaantesyconquienerafeliz,locualhoyyanosoy.Puede
tratarsedelaprdidadeunproyectoqueamabayqueabort.Ydehecho,sierael
instigadordedichoproyecto,cuandohablabaalosdems,setratabademibeb.
Cualquiersealasituacin,esimportantequeaceptetodoslossentimientosque
mehabitan,quelosexpreseparaquemiheridainteriorpuedacuraryquepueda
girarme haca el futuro con una mirada ms positiva y llena de proyectos por
realizar.
239

PALABRAS (ver tambin: AFONA)


Las palabras que pronuncio hoy crean mi porvenir. Se dice que el
pensamiento crea, que el verbo (la palabra) manifiesta. As, cuando hablo, ya
traigomispensamientosaconcretizarseenelplanofsico,comosilapalabrafuera
material.Delacalidaddemispalabras,delaeleccindelaspalabrasdependela
armonaolafaltadearmonaenlacualSOYomevoy.Siesmeldicoelcanto,si
hablodecorazn,silaalegra,elpositivismo,losnimossalendemiboca,atraigo
el sol. Si mis palabras slo son crtica, negatividad, ira, destruccin, atraigo
entoncesnubesgrises,tempestadeseintemperies.Laeleccinmepertenece!
PALADAR (ver: BOCA PALADAR)
PANADIZO
El panadizo eslainflamacinagudadeundedoomsescasamentedeun
dedodelpie.Siestnafectadoslosdedosdelasmanos,tengodificultadenponer
cosasenmarchaenelcontextodelosdetallescotidianos,mientrasquesisetratade
losdedosdelospies,serefierealosdetallesdelporvenir.Soypasivo,indiferente
ymienergadeaccinquenecesitaestarexteriorizadasalepormisdedosomis
dedos de los pies. Necesito sacar de m todas estas emociones y todos estos
pensamientosnefastosreprimidos.
PNCREAS (ver tambin: SANGRE / DIABETES / HIPOGLICEMIA)
Esenelpncreasdondesemantieneelporcentajedeinsulinaqueayudaala
estabilizacindelporcentajedeazcarenlasangre.Siestendesequilibrio,se
produceentoncesladiabetesolahipoglicemia(consultarestasenfermedadespara
msdetalles).Elpncreasrepresentamicapacidadparaexpresareintegrarelamor
dentrodemymicapacidadparatransigirconlossentimientosopuestos(ejemplo:
laira)sincreardolor.Frecuentementesetratardeunasituacinqueponeencausa
aotromiembrodelafamiliaycuyoretoconsisteenadquirirmspoderodinero
(porejemploenelcasodeunaherencia).Sivivounasituacinquemecuesta
muchotragaryque mepareceinnoble,podrirhastadesarrollarun cncerdel
pncreas.Elpncreasestrelacionadoconlaalegradeviviryconelcentrode
energa (chakra) del plexo solar que est situado en la base de mi esternn, a
algunos centmetros encima de mi ombligo. Debo tomar consciencia de mis
necesidadesyponerlascosasenmarchaparairabuscarloquequiero.Nonecesito
buscarestimulantesartificialesparanutrirme(drogas,alimento,sexualidad,etc.,
slohedeaprenderaamarmecomosoy.Necesitobrindarmealgunosdulces

240

PNCREAS PANCRATITIS (ver tambin: ANEXO III)


Vivomucharabiafrentealavidaporqueyanomeofrecedulces.Quiero
rechazarla.Envezdeesperarquevenganamlosdulces,hedebrindrmelos
sabiendoquemelosmerezco.
PAPERAS (ver tambin: GLNDULAS SALIVARES, INFECCIONES [en
general], ENFERMEDADES DE LA INFANCIA)
Las paperas son una infeccin viral contagiosa que se manifiesta
generalmenteporlainflamacindeciertasglndulas,enparticularlasglndulas
salivares. Hay algo o alguien en mi vida frente a quien vivo irritabilidad.
Escupiraencimacongustotangrandeesmidesprecio.Amenosqueseaalguien
msquequisierahacerlomismoparaconmigo!Laspaperasafectangeneralmente
alosniosmsquealosadultos,sosteniendomuchamsdificultadenexpresar
su ira y su frustracin. En vez de despreciar a una persona (o una situacin),
deberapreferentementemirarloquedeboaprenderdesta.
PARLISIS (en general)
Laparlisisesunaimposibilidaddeactuar,unparodelfuncionamientodela
actividaddeunoovariosmsculos.Puedeafectarunrgano,unsistemadergano
otodoelcuerpo.Estaenfermedadestvinculadaconlahuida:intentoevitaro
resistir a una situacin o a una persona? Frecuentemente es el miedo que me
paraliza. Lo que vivo puede parecer tan insostenible e insuperable que deseo
cortarme, volverme insensible, teniendo la sensacin que no hay solucin
posible, siendo incapaz de asumir plenamente mis responsabilidades. Tambin
puedovivirohabervividountraumatismoprofundoquemepidedejardevivir
porqueestoesdemasiado.Esposibletambinqueunodiointensoounafaltadefe
enmseatalquelanicaseguridadcontralamalaaccinsealainaccintotal!
Tambinpuedoestarmuyrgidoencuantoamimododepensarysitodonose
trazacomoprevisto,mireaccinesretirarme,evadirme.Esimportantequetome
conscienciadelapresinquemeobsesiona,decaraaloquesucedeovaasuceder,
paracontrolarlaypermitiralaparteparalizadaempezarotravezavivir.Puedo
sentirmeparalizadoenunasituacinenquenopuedomovermeoquemeofrece
ningunalatitudfrentealaseleccionesoalasaccionesportomar.Lapartedel
cuerpo afectada me da indicaciones suplementarias en cuanto al origen de mi
dolenciaydemimiedo.Siporejemplo,estparalizadamipiernaderecha,esto
puede ser el miedo frente a lo que ser de m en mi nuevo trabajo, en mis
responsabilidadesfamiliaresoenmisresponsabilidadescomociudadano.

241

PARKINSON (enfermedad de ) (ver: CEREBRO PARKINSON


[enfermedad de])
PARTO (en general)
(ver tambin: EMBARAZO / [dolores de]/ [prolongada])
Elpartoesquizsunadelasexperienciasdetransicinmstraumatizantes
queexistaparaelnioquenace.Esunfenmenonatural;yo,comomujer,entrego
alnioaquienllevo.Losdoloresdel parto puedenestarconectadosadiversos
miedos,sobretodolosdesufrirydedaraluz,aldoloracumuladoconrelacina
mipropioniointerior.Lasdolenciasolossufrimientostambinpuedenproceder
delhechoqueelnioquevaanacermerecordarconstantementelarealidadyla
responsabilidadquequierotenerconrelacinaminiointerior.Puedoalimentar
inquietudesfrenteaestapartemacompuestademicarneydemisangredequien
tomolaresponsabilidad.Enestasituacin,comoenmuchasotras,elpartotrae
diversascreenciasmsomenosfundadas,porejemplo,elquehayquesufrirpara
parir(igualcomoparaserguapa!)Locualnonecesariamenteesverdad,sobretodo
enlosplanosdeconscienciasuperiores.Losdolorespuedenmsbientraerenm,
sobretodoinconscientemente,elrecuerdodolorosodehaberpasadodelmundo
delaluzalmundomslimitativodelamateriaenuncuerpofsico.Varias
preguntaspuedenbrotartambin:Qupasardespusdelnacimientodeestehijo?
Seguirsiendotandeseableparamicnyuge?Soyunabuenamadre?Tienemi
hijotodoloquenecesita?Esposiblequenodeseedaraluzporqueestoyenun
estadodefelicidad,amadaymsmimadapormicnyuge?Decualquiermodo,dar
aluz esuna experiencia formidable.Permite mostrar realmentemihabilidada
enfrentarmealosmomentosdetransicinycambiosfuturos.Tengofesabiendo
quetengotodalafuerzaylaenerganecesariasparatraermihijoalmundoy
cuidarmedeladecuadamente.
PARTO ABORTO, ABORTO ESPONTNEO.
Elabortoespontneoesunparodelembarazoantesdelda180(6,5meses
aproximadamente)degestacin.Engeneral,sehablarde aborto enelcasode
interrupcinvoluntariadelembarazo(I.V.E.)Cuandoelabortoesespontneo,es
decircuandosetratadelaprdidanoprovocadadelfeto,sehablarentoncesde
abortoespontneo.Cuandotengounabortoespontneo,mepreguntoparasaber
quiendeseabaunhijo,yoomicnyuge.Inconscientemente,tengomiedoqueel
nioanacercambiemividadepareja,mitrabajo,miscostumbres.Temonoposeer
las cualidades necesarias para ser una buena madre y esto puede remontar a
momentosvividosenmipropiainfancia.Puedetambinqueelalmaquedeba
encarnarse haya cambiado de idea. Entonces debo quedarme abierta al nivel
corazn y poner en marcha las energas necesarias para resolver esta situacin
242

inmadura; sino, los embarazos futuros corren el riesgo de ser complejos e


incompletos.Amor,responsabilidadyrespetomutuodeloscnyuges(sisedael
caso)sonlossentimientosesencialesquedebenmanifestarsesiquieroquemihijo
llegueatrmino.
PARTO PREMATURO.
Un partoprematuro eselquetienelugarentrelasemanaveintinuevey
treintayochodelaausenciadelasreglas.Cuandosucedeste,puedequenome
sientasuficientemaduraparallevaraestehijoatrminoyquedeseedeunmodo
no consciente, librarme de l antes que llegue a trmino. Puede que quiera
rechazar inconscientemente a este hijo, igual que yo misma puedo sentirme
rechazada a veces. La angustia, incluso inconsciente, de tener que asumir una
responsabilidadparalacualnoestoylista,oelhechodenosentirmepreparada,
puedehacermedesearardientementedaraluzloantesposibleparaacabarcon
estaangustiadelaespera.Detodosmodos,quequieroterminarconestaangustiao
querenieguedeestehijo,esteestadodeconscienciaseniegaconscientemente.Me
imagino el guin, yo, una mujer que renegase conscientemente a mi hijo? Es
posible, pero esta situacin se transforma la mayora del tiempo en rechazo
inconscientedeestamaravillosaexperiencia.Decualquiermodo,acepto que
todosucediparalomejor,paramyparaelniopornacer.
PRPADOS (en general)
Losprpadoscubrenyprotegenmisojos.Prpadoshinchadossonelsigno
dequevivotristezaqueseexpresaporlgrimas,peroquieroretenerme,guardarmi
dolorenmiinterior.Debocerrarlosojoscuandoquierodescansarodormir,este
movimiento hacindose voluntariamente. Pero si mis prpados estn
permanentementecerradosamedias,hayalgooalguienenmividadequienquiero
huiroquenomeatrevoamirardefrente.Si,adems,vivounagrantensin,mis
prpadostienentendenciaaparpadearmsrpidamente.Mecierrolosojospara
centrarmemejor,interiorizarmeperoestambinmuyimportantequelosabramuy
grandesparavertodaslabellezasdelUniversoyvertodaslasposibilidadesquese
mepresentan.
PRPADOS (parpadeo de los)
Mis prpados tienen tendencia a parpadear ms rpido cuando vivo un
estrsounatensinmsgrandequedecostumbre.Estoyensobrevoltajepara
conloqueveo.Traigoenmividamomentosdecalmaydedescansoyaprendoa
verelladopositivodetodo.

243

PECHO
Elpechoestvinculadoconmisentidodelaidentidadylaparteinteriorde
miser.Aestenivelsesitanmicoraznymispulmones,rganosesencialesal
funcionamientodeunavidaautnoma.Sitengounadolenciaoundoloraeste
nivel, puedo preguntarme: Mi sensibilidad frente a mis relaciones familiares
estuvoheridaoafectadaltimamente?,tengomiedodecomprometermefrentea
una persona o una situacin, lo cual me lleva a evitar las ocasiones de dar e
implicarme?.Tomoconscienciadequeesmuybenficorevelarmisverdaderos
sentimientosymivulnerabilidad:siempreganocuandosoyautntico!
PECHOS (en general)
Unapersonaquetiene pechos gordos(hombreomujer), frecuentemente
empezmuyjovenasentirseobligadaacuidarmaternalmentedelosdemspara
sentirse amada. Por ms que tenga esta habilidad de cuidar de los dems,
comprendoque,frecuentemente,actoasporquetengomiedodelrechazoyque,
sintindomeadmiradoporesteladomo,meatraigoaselagradecimientodelos
que me rodean. Al revs, si tengo pechos pequeos, puede que dude de mis
capacidades de madre y que sienta constantemente la necesidad de probar que
puedoserlo.Elpechoizquierdorepresentaelaspectomsemocional,msafectivo
demifacetamaternal;encambioel pechoderecho seasociaalpapelyalas
responsabilidadesdelamujerenlafamiliaoenlasociedad.Simispechosson
blandosycolgantes,tengointersenaprenderasermsfirmeenmimodode
hablar o de actuar. Los pechos representan tambin la feminidad en la mujer.
Frecuentemente son exageradamente admirados. La aparicin de los pechos
significavolversemujer.Provocanmuchasreaccionesparalamujer.Puedotener
miedodevolvermeun sexsymbol,deestarridiculizada.Puedovivirvergenza,
confusin, sentirme rebajada. Puede que no quiera tener hijos porque esto me
recuerda,conscientementeono,unimpactopasado.Esposiblequevivaciertos
temoresdeseralavezmadreymujer.Elijoaceptar recibirtantocomodoy,
aceptomifeminidad.
PECHOS (dolores de los) (DOLOR, QUISTE) (ver tambin: CNCER
DEL PECHO PECHO MASTITIS)
Cuandosientodoloresenlospechos,debointerrogarmeparasabersiadopto
unaactitudsobreprotectoraodominantehacamishijosohacamicnyuge.Un
quistepuedeproducirsesimesientoculpablefrenteaunamaternidadosisufrun
impactoemocional.Alquererprotegerexcesivamentealagenteaquienamo,les
impido vivir, tomo las decisiones en su lugar, me vuelvo madre protectora.
Necesitodejarquelosaquienesamosevuelvanautnomosparaqueellostambin
seanpersonasresponsables.
244

PECHO MASTITIS
Lamastitisqueeslainflamacindelpecho,lohacemuydolorosoypuede
producirsedurantelalactancialacual,entonces,debeinterrumpirse.Siempreen
relacinconlamaternidad,provocounadolenciaquemeobligaradejardedarde
mamar sin vivir ninguna culpabilidad. Tambin puedo ser yo quien tenga la
sensacindeestardemasiadoprotegidamaternalmente,bienpormicnyuge,opor
alguiendemientorno.Estosdoloresenlospechospuedendemostrartambinque
soydemasiadodurahacam.Asqueacepto dejaralosdemslibresdesus
elecciones,aprendoaamarme.Reconozcoquecadaunodenosotroscrececonsus
experiencias.
PELADERA (ALOPECIA) (ver CABELLOS PELADERA[ALOPECIA])
PELCULA (ver tambin: CABELLOS [enfermedad de los])
Las pelculas sonlacapacallosaysecadelapiel,teniendoelaspectode
coposblancos quesehallangeneralmenteenelcuerocabelludo.Tratndosedel
cmulodepielmuerta,haytambincmulodeactitudesypatternsmuertosque
yanonecesito.Micuerocabelludoestvinculadoalomental,aloabstracto;son
esquemasdepensamientosmentalesquedebosoltarparadejarsitioamsapertura
y ms flexibilidad. Que est muy activo o al contrario muy inactivo
intelectualmente(porejemplo,sidejoquelosdemspiensenenmilugar),ambos
pueden producir pelculas ya que existe en ambos casos un desequilibrio con
relacinamifuncionamientoracionalymental.Meabrocadavezmsanuevos
modosdefuncionarenlavidaymesientocadavezmsflexible,dejndomellevar
porelflujodelavida.
PELVIS (ver tambin: PELVIS PEQUEA, CADERAS)
Lapelviseslaaperturadelazonadelapelvissostenidaporlascaderasyla
columna.Losdoloresenestazonafrecuentementesepercibencomopunzadas.La
palabraestmuyadecuadaporqueestacomarcadelapelvis,soportadaporlas
caderas,meayudaaandar,aestarenmovimiento,yporlotantoalanzarmeen
la vida o en un nuevo proyecto (como punzado por una lanza). Este
proyectopuededarnacimientoaalguien,perotambinammismo,sobretodo
enloqueserefiereanuevasactitudesonuevoscomportamientos.Estoimplicauna
comunicacintantoenelplanosexual,comointerpersonal.Esimportantequeme
hagaconfianzaenlasdecisionesportomarfrenteanuevasdireccionesporelegir,
quepongacosasenmarchaparadescubrirtodalariquezademimundointeriory
todaslasposibilidadesqueamseofrecen.

245

PELVIS (ver tambin: CADERAS [dolores de])


La pelvis es la parte sea que rene y separa al mismo tiempo la parte
inferiordelapartesuperiordelesqueletohumano.Esellugardeorigendetodos
losmovimientosdedesplazamiento,locomocinyaccindelcuerpo.Corresponde
alhechode lanzarmeenlavida.La pelvis representael poder bajotodassus
formas.Eselrecipientequeacogelasenergasdelpoderquemantienenelego.Si
tengouna pelvis anchaomuyancha(connalgasgordas)creoinconscientemente
quelavidaolassituacionesdemividalimitanmipoder.Intentopuesrecogerlo.
Intento compensar fsicamente, bloqueando de un modo involuntario todas las
energasenestelugar(miedo,inseguridad,clera).Seguirquizsunmalestaroun
conflicto en lo que se refiera a mi sexualidad. Es importante que las energas
circulenmsarmoniosamenteenmicuerpoyquecreasinceramentequehicelo
conveniente.Inclusosiquierocogerpoder,puedotomarconscienciayaceptar
conelcoraznque nohaypoder porcogersalvoeldelplanomental.Siquiero
liberartodasestasenergasyencontrarunmejorequilibrioenergtico,empiezoa
amarmetalcomosoy,amanifestarmialegra,confianzayfeentodoloquehago.
Vacoesterecipientedepoderydejocircularlavida.Porotraparte,sisiento
algunasdificultadesalniveldemipelvis,esposiblequeaprecielaimportanciade
misnecesidadesfundamentalescomolavivienda,laalimentacin,lasexualidad.
Deboreconsiderarlaimportanciaquedeboatribuiralosdiferentesaspectosdemi
vidaparaqueestsentadaenbasesslidasysanas.
PENA (ver tambin: MELANCOLIA)
Lapenaestvinculadaalaformadeansiedad,unainquietudounatristeza
quesemanifiestaporllantos,sonidosdedolores,soledad.Micoraznestheridoy
enfermodespusdeunaexperienciapasadalastimosaydolorosa.Mipenapuede
serlargaoduraruninstante.Buscalaverdaderacausageneralmenteprofundao
inconsciente.Despusdeaos,variasheridasdeinfanciapuedenvolverabrotaras
comociertastomasdeconsciencia.Memantengoabiertoaloquevivoeidentifico
rpidamentelaverdaderafuentedemipenaparapodercambiarla.Aceptomi
tomadeconscienciaylaintegro.Deestemodo,vuelvoaencontrarmialegray
salgodeestocrecido.
PEREZA
Laperezaesunatendenciaaevitarcualquieractividad,arechazarcualquier
esfuerzo. Est vinculada al cansancio frente a la vida en general, una dejadez,
porquenotengoelgustodehaceresfuerzosodeobligarmeahacerloquesea.
Empiezoaactuar,ahacercosasparavolveradarmeenerga,entusiasmo,alegrade
vivir.

246

PERICARDITIS (ver: CORAZN PERICARDITIS)


PESARES
Simealimentode pesares,alimentomicuerpodepena,tristeza,disgusto
frentealoquehubiesepodidohacerono,deciropensar.Mispesaresmeroenen
elinteriorybajanminiveldeenerga.Creanunterrenopropicioalaenfermedad.
Aprendoatenerunaactitudpositivasabiendoquesiemprehagolomejorques.
Aprendoapartirdemipasadoyestomepermitemejorarme,tomarexperiencia,
volvermemssabio.
PESO (exceso de) (ver tambin: GRASA)
Elexcesodegrasaquemicuerpoalmacenaentremiserinterioryelmedio
exterior meindicaqueinconscientemente busco,quieroaislarme,obienenmi
comunicacinconelexterioroincluso,queexisteunaemocinounsentimiento
preso,aisladoenmiinterior,yqueyanoquierover.Pormiobesidad,buscouna
formadeproteccin quecumulocontinuamenteenmispensamientosinteriores.
Hayunvacoentreyoyelmundoexterior.Asescondomiinseguridadalestar
expuesto, al ser vulnerable y as, quiero evitar estar herido o bien por
observaciones,criticasobienporsituacionesenlascualesestaraincmodo,en
particularfrenteamisexualidad.Aspuedointerpretarmi excesodepeso como
siendo el hecho de que lo quiero poseer todo. Mantengo emociones como el
egosmoysentimientosquenoquierosoltar.Estopuedeserundesequilibrio,una
rebelinfrentealentorno,unareaccinagestos,situacionesqueyanoquierovero
delascualesyanoquieroacordarme.Elalimentoterrestrerepresentatambinun
alimento emocional. Por lo tanto, como excesivamente para colmar un vaco
interioroparacompensarelxitoquemedejaemocionalmenteaislado.Puedo
vivirunagraninseguridadtantoanivelafectivocomomaterialeinconscientemente
necesitoalmacenarparaevitarcualquierpenuriaocarenciaquepodraocurrir.
Estafalta puedehaber sidovividaenla infanciayfrecuentementeparaconla
madre,yaqueeraminexodirectoconelalimentoylasupervivencia(mamada).
Frecuentemente,laobesidadseproducedespusdeungrangolpeemocionalouna
prdidaimportante,yelvacovividosevuelvemuydifcildesoportar.Vivoun
gran sentimiento de abandono, un vaco interior. Frecuentemente me siento
culpabledelamarchaodelaprdidadeunserquerido.Buscounobjetivoenmi
vida, busco realizar algo bien. Tengo dificultad en tomar mi lugar con mis
palabras y mis gestos. Lo hago pues tomando ms sitio con mi cuerpo fsico.
Adems, me desvalorizo con relacin a mi aspecto fsico: una ligera
imperfeccin o algunos kilos ganados tendrn a mis ojos unas proporciones
gigantescasyyanopuedoverniapreciarmiscualidadesomisatractivosfsicos.
Poniendotodamiatencinenloquecarecedegracia,micuerporeaccionara
estoaadiendoanmspesoparahacermecomprendercuantosoydurohacami
247

mismoycuantomeautodestruyo,aunqueslofuerapormispensamientos
negativos.Elhechodeefectuarejerciciosyseguirunadietanosersuficientepara
adelgazarydebotomarconscienciadelverdaderoorigendemiexcesodepesoque
resultadeunasituacindeabandono.Seaniooadulto,tomoconscienciaqueme
rechazoammismoPuedotenerlasensacindesentirmelimitadoconrelacin
adiferentesaspectosdemividaoaloquequierorealizar.Estesentimientode
limitacin, har que mi cuerpo tome expansin, y absorba un exceso de peso.
Tambinsisoyunapersonaque cumulapensamientos,emocionesocosas, mi
cuerpocumularltambinperobajoformadegrasa.Aprendoaexpresarmis
emociones,areconocermivalorytodasmisposibilidades.Sahoraquecualquier
vacoquemeparecevivirenmividapuedellenarsedeamorydesentimientos
positivoshacam.Conmiaceptacindemmismoydelosdems,conel
amorquemerodea,meliberopuesdeestapenaydeestanecesidaddeproteccin.
PIEL (en general)
Lapielrecubretodomicuerpoydelimitaloqueestenelinterioryloque
estenelexterior,esdecirmiindividualidad.Porsusuperficie,mipielesel
rgano msimportante demicuerpo.Esunacapaprotectoraquedelimitacon
precisinmiespaciovitalyquedejatranslucirfielmenteeinconscientementemi
estadointerior.Sisoyunapersonadulce,tambinlosermipiel.Siesmuygrande
misensibilidad,tambinmipielsermuysensible.Alcontrario,sisoymsbien
duroconmigomismooconlosdems,mipielsertambinmuydurayespesa.Si
est irritada mi piel, hay algo o alguien en mi vida que me irrita. Una gran
inseguridad hace quemi piel sea hmeda mientras que una piel quetranspira
muchoevacualasemocionesqueretengoyquenecesitoevacuar.Lacalidaddemis
relacionesconelmundoexteriorestarpuesrepresentadaporelestadodemipiel.
PIEL (dolores de )
La piel es como la corteza de un rbol. Nos revela que hay problemas
exterioresointeriores.Aslalasclulasdemicuerpo,miscomponentesencuantoa
mientornoexterior.Simipieltieneanomalas,haymuchasprobabilidadesdeque
seaunapersonaquedamuchaimportanciaalaopinindelosdemsyaloque
puedendeciramirespecto.Estandopocosegurodemmismoyteniendomiedo
deestarrechazadoodehacermeherir,voyacrearmeunaenfermedaddepielque
se volver una barrera natural que permitir guardar cierta distancia con mi
entorno.Lapielesuntejidoblandoqueestrelacionadoconlaenergamentaly
porlotantoexpresamisinseguridades,misincertidumbresdeaqulaexpresin
estarrojodeira.Mipielpuedecambiardecolorcuandoestoymolestoocuando
puedosentirvergenza.Espueslalneadedemarcacinfsica,mimscaraentre
miinteriorymiexterior.Simipielesseca,esquecarecedeagua.Elaguaesel
248

segundoelemento(despusdelaire)necesarioalavida.Misrelacionesconlavida
sonpuessecas,ridas.Mebloqueointeriormenteenmisrelacionesconelentorno.
Puedotenerlasensacindesecarme.Debobuscarlaalegraenmicomunicacin
conlosdems.La pielmuerta quehacecoposindicaquemeabandonoaviejos
esquemasmentales.Sitengo granos enlasuperficiedela piel, esqueexpreso
exteriormenteproblemasderelaciones,comunicacinconmientorno,referentea
puntosconcretos.Simipielmuestrasignosdeinflamacin,entoncesnodeboestar
menosirritadofrenteaciertassituacionesdeconflictointerioroexterior.Simipiel
esgrasa,esqueretengo,conservodemasiadasemocionesparam.Puedodesear
huirdeunasituacinopersonacomositratasendeatraparme,comolapequea
bolacubiertadeaceitequesequierecogeryqueresbalaentrelosdedos.Debo
dejarfluirlaenergaparaquemispensamientos negativos puedandesaparecer.
Debomirarconcalma,framentelasfrustracionesquealimentoparaquemi piel
seamsclaraymenosespesa.Cuantomsmevuelvotransparenteyverdaderocon
losdems,mstransparentesermipiel.Unairritacinmemuestraquehayunoo
variospensamientosirritantesquesubenenlasuperficiedemipielyquehede
mirarlasdefrenteparaquedejendeatraermiatencinymolestarme.Cuantoms
seacapazdeapreciarmiscualidadesyofrecermepequeosdulces,msmipielva
atranspirarestebienestarporsudulzuraysuclaridad.Cuantomsseacapazde
comunicarlibrementemisemociones,msserelajayresplandecemipiel.
PIEL ACN (ver tambin: PIEL / GRANOS / PUNTOS NEGROS,
ROSTRO)
En el rostro, el acn se relaciona con la individualidad (cabeza =
individualidad)ytienerelacinconlaarmonaquevivointeriormenteyaloque
sucedeexteriormente.El rostro esestapartemaquedalacaraalosdemsen
primerlugar,laquemepermiteestaraceptado orechazado.El acn puede
producirsecuandoestoyemocionalmenteymentalmenteenconflictoconmipropia
realidad.Esteconflictoestvinculadoconlaexpresindesymipropianaturaleza
interior. As, el acn es una expresin visible de irritacin, resentimiento,
rechazo, miedo, vergenza o inseguridad frente a m o a los dems y
demuestraunanoaceptacindemmismo.Meencuentrofeoyaveces
inclusoasqueroso!Estasexpresionestodasestnunidasalaafirmacindemi
identidad,alamoryamiaceptacinincondicionaldemmismo.Elacnse
manifiestafsicamenteporlesionescutneas(delapiel)situadasenelepidermis.
Squeel fastfood (restauracinrpida)puedefavorecerlaaparicindel acn y
afectarelfuncionamientodelhgadosededelaira.Comoadolescente,el acn
frecuentementeestrelacionadoconcambiosinterioresquevivo,enelmomentoen
quedeboelegirentreelmiedodeabrirmeammismoyalosdems(resistencias,
elecciones, decisiones) y as romper (de un modo frecuentemente inconsciente)
249

todocontactoconlosdems,obien,encararmeconcambiosenmivida,conlos
ajustesrelacionadosconmimundointeriorymivisindelmundoexterior.Alya
noserunnioyannoadultodeltodo,puedosentirmeenunaposicinincmoda
conrelacinamipropiaimagen.Puedeinclusoquetengamiedoinconscientede
perderprestigiodelantedeloquepuedapensardemmientorno.Aselacnse
manifiesta por un miedo inconsciente de mi sexualidad, por una tentativa de
exteriorizacin de lo que soy verdaderamente. Como adolescente, mi
comportamiento es entrar en contacto con los dems, incluso si quiero
ardientementehacerlocontrario.Mepongomsfeoparafiltraralagentequeno
deseoenmicampomagnticooenmientorno;establezcofronterasyslodejo
entraralagenteconquienestoyverdaderamentebien;quieroestarenpazsinestar
molestadoporlosdemsqueapartoinconscientemente;merepliegosobrem
mismoyquieromantenermeas:noconsigoamarmesuficientemente;entonceslos
demsnopuedenamarmeysquealgomemolestaycreanegatividaddebajode
mipiel;mecomparoalosdemsymeencuentrotodotipodedefectos(demasiado
gordo,demasiadoalto,etc.)mesientolimitadoenmiespaciovitalymerechazo;
mesientocontroladoydirigidopormispadresdeunmodoexcesivo;meidentifico
conunodemispadresparacomplaceralosdems,envezdeguardarmipropia
identidad.Aceptandoalniveldecoraznloscambiosquesehacenenm,me
mantendralaescuchademisnecesidadesfundamentales(sexualesuotras)deuna
manera sana y natural. Descubrir un da la persona que corresponder a mis
esperanzas.Elacnpuedesituarseendiferentespartesdelcuerpo.Enlaespalda,
serefiereamipasado,miscostumbres,mismiedosanterioresymisangustias.Es
unmododerechazarme.Obienpuedodirigirelrechazohacalaspersonaspor
partedequienesmeparecerecibirpocoapoyoosostnamirespecto.Cuandose
sitaenla partealtadelaespalda,representalairareprimidaoirritacinque
intentahallarunalivio.Enelpecho,representaelporveniryloqueestprevisto
param.Elacnsignificala bsquedademiespaciovital ydel respetodelos
dems frenteaste.Debotomarmilugarconelcorazne,inclusosinecesario,
expresaralosdemsculesmiespacioyellugarquepuedentomarconrelacina
miespaciovital.Meaceptoymeamotalcomosoyydejodequerercomplacer
alosdemsatodacosta!
PIEL ACRODERMATITIS
Laacrodermatitisesunaenfermedaddelapielqueafectaesencialmentela
palmadelasmanosylaplantadelospies,ahdondesesitancuatrodelosveinte
y uno centros de energa (chakras) menores del cuerpo. Esto me indica una
necesidaddedarmsamorconmismanosyaqueelcentrodeenergasituadoenla
palma de cada mano es una extensin del centro de energa del corazn que
representaelamor.Puedoaprenderunatcnicadecuracinporimposicindelas
250

manos,locualmeayudaradejarfluirestaenergadeamorquebloqueoparam
mismo.Puedotambinhacertrabajosmanualesdecreatividad,pinturaodibujo
parahacerqueestaenergapasemslibrementepormismanos.Enloquealos
piesserefiere,deboconsiderarmecomoandandoenunterrenosagradoydejarque
la energa que albergo corra libremente haca la tierra, sabiendo que recibo
constantementealdejarfluirdichaenerga.
PIEL ACROQUERATOSIS (ver tambin: PIEL ACRODERMATITIS)
Igualquepara laacrodermatitis,la acroqueratosis afectalaplantadelos
piesylapalmadelasmanosvolvindoseelepidermismsespeso. Utilizomi
energamentalparaprotegermedetenerquedarpormismanosysentirmeen
mejorarmonaconlatierra;Liberomimentaldeestasangustiasypuedoteneren
cuentasugerenciashechasparalaacrodermatitisparahacercircularlaenerga.
PIEL- AMPOLLAS
Laampollaesunaacumulacindeaguaqueseformaentredospartesdela
piel,osealadermisyelepidermis,acausadeunafriccinrepetidaenelmismo
lugar.Laacumulacindeaguaasformadaactaattulodeproteccinnaturaldel
cuerpo.Ponepuesenevidenciamifaltadeproteccin,enparticularenelnivel
emocional,omifaltaderesistencia.Laampollaeselrecuerdodeunadebilidad
emocionalyellugarenqueseubicadaunaindicacindelniveldeladebilidad.
Unaampollaalospiesestrelacionadaconminocindeseguridad,elsueloenel
cualando,ladireccinquetomo. Siestdetrsdel tacn,estvinculadaami
madre,amispropiascualidadesmaternas.Unaampollaenlasmanosmellevaa
verlairritacinylafrustracinenloquehagooenelmodoenquellevomivida.
As,mirandoendondeestsituadalaampolla,puedopreguntarmeloquemeirrita
enmivida,loquemecausaunafriccinyprovocaenmpena(agua)incluso
inconsciente.Laampollaestaquparaaportarmemsluzsobreloquevivo.
PIEL ANTRAX (ver tambin: FURNCULOS)
El ntrax esunainfeccindelapiel,constituidaporlareunindevarios
furnculosyqueseextiendealtejidoconjuntivosubcutneo.Vivoentonces
agresividaddainaprocedentedelhechoquetengoelsentimientoquesemeha
privadodelibertadpersonaldemodoinjustoeinaceptable.Tomoconscienciaque
tengoqueaprenderelmododehallarellugarquemecorrespondeyquetengoel
poderdecambiarcualquiersituacinenmivida.Slomehacefaltadecidirlo.
PIEL BROTE (de granos) (ver tambin: PIEL COMEZONES)
Una erupcin de granos es la aparicin de pequeas zonas rojas
acompaadasdeexcrecenciasenlasuperficiedelapiel.Mipieleslaprimeraparte
251

demqueentraencontactoconeluniverso.Elcolorrojoestconectadoconmis
emocionesylacomezneselsignodemicontrariedad.Estoyirritadoporretrasos
yfrustradoporunasituacinoporalguien.Estebroteoerupcintambinpuede
estarvinculadoconlavergenzaylaculpabilidadquesiento.Engeneral,hayun
estadodeestrsintensofrenteamisemocionesyestoesloquehaceaparecerlos
granos.Igualcomolatierramanifiestaerupcionesvolcnicasporqueseacumula
unatensindemasiadofuertedebajodelasuperficiedelacostraterrestre,lapiel
manifiesta erupciones causadasportensionesinterioresquequierenliberarse.Si
mehalloenunasituacinanlogaenelfuturo,micuerposeacordarybrotaruna
nuevaerupcin.Interiormente,mesientocontrariado,puedosentirmeamenazado,
inclusopuedorechazarmecomopersona.Miinseguridadmellevaaretirarme
conlaesperanzaquizsdequenadiesemeacerque.Inconscientemente,incluso
puedousarestemedioparaatraerlaatencin.Lazonadelcuerpoafectadame
indicaaqunivelsesitamicontrariedad.Tomoconscienciadelacausayacepto
expresarloquesiento.Estomeliberaymipielotravezseaclara.
PIEL GRANOS (ver: HERPES / [en general, bucal], PIEL ACNE)
Los granos frecuentementeestnrelacionadosconelacn.Elacnsuele
estarlocalizadoenciertaspartesdelcuerpo(rostro,espalda,etc.),ylos granos
puedenhallarseenelconjuntodelcuerpo.Sonpequeasbolsasencarnadasque
puedencontenerpus,segnlainfeccinencausa.Tengogranosporqueexpreso
impaciencia,quieroanticiparmealascosasyrpido.Sisemanifiestaelpus,estoy
enfadado,hiervoenmiinterior.Mesientocontrariadoypreocupado.Quizsvivo
unapequeatristezainteriory,enelcasodegranosenelconjuntodelcuerpo,un
desanimogeneralizado.Losgranosenelrostrosevinculanalaindividualidad.Es
elmismosignificadoqueelacndelrostro.Merechazo,filtrolaspersonasque
pasanmisbarreras,quierolapazsinquesemeacerquen.Tomoeltiempoantes
dedecirohaceralgo,recordndomequeestoyplenamenteguiado!
PIEL CALLOSIDADES (ver tambin CALLOS)
Lacallosidadesunadensificacinyunendurecimientodelapiel,ligadosa
frotamientosrepetidos,porlotantoaactitudesyciertosesquemasdepensamientos
rgidos que transporto actualmente. Varias regiones del cuerpo pueden estar
afectadas.La piel sevinculaalaenergamentalycuandoseacumulastaose
cristaliza,enreaccindemiedoconrelacinaunasituacincualquiera,sobreviene
entonces unainmovilidad ounainercia queimpideneldesplazamiento deesta
energa,sinflexibilidadenmispensamientos.Memantengoabiertoaunquetenga
miedo.Estemiedomellevaacerrarmeyestrecharmivisinobjetivadelavida.
Descubrolacausademimiedoyentonces,laenergabloqueadayacumuladaenel
epidermisempezaradifundirseenarmonaconmigo.Mipielsevolverblanday
joven.Lareginenlacualsemanifiestalacallosidadpuededarmeinformaciones
252

suplementarias:porejemplo,enelniveldelhombro, endurezco misideasymis


actitudesfrentealasresponsabilidadesdemividayetc.
PIEL COMEZONES (ver tambin: PIEL ERUPCIN [de granos])
Lacomeznestvinculadaalapiel,elrganosensorialmsextendidodel
cuerpohumano.Lacomeznesunairritacin,algoqueseresbaladebajodela
pielyquemeafectaenunlugarparticularoquemeirritainteriormente.Mesiento
preocupadopordeseosinsatisfechosyciertaimpacienciaseinstalayhacequeme
rasco,rasco,rascoEstosrascamientosmeindicanquelassituacionesdemivida
novansegnmisdeseos.Lascosasnoandanbastanterpidamenteparam.La
vidameempujaarealizarcambiosrpidos.Vivoinseguridadyremordimientosa
causadetodoesto.Qudebohacerparacambiaresteestado?Identificolacausa
delairritacin.Estvinculadaamipadre,mimadreoalguienqueamo?Esuna
situacinquequierocambiarinteriormente?Siestgeneralizadalairritacinal
conjuntodelcuerpo,afectatodomiserdeunmodomuyintenso.Siestenun
lugarparticular,encuentrolarespuestasegnlapartedelcuerpoafectada.Poco
importalarespuesta,laaceptoporquesqueesbenficaparam.Yanotengo
necesidaddehuirodejarloquevivoparaquedesaparezcanlas comezones.En
cambio,sidealergiassetrata,miroaquoaquienestoyalrgico.Yanonecesitar
sentirme mal para rascarme sin parar. En mis adentros, s que la apertura del
corazncuramuchosmales!
PIEL - DERMATITIS
Ladermatitiseslainflamacindemipiel.Eslapartedemiserquetoma
contacto en primero con el universo y por consiguiente, refleja varios de mis
miedos y de mis inseguridades interiores. Una inflamacin es una irritacin
reprimidaqueintentaexpresarse.Esteenfadopuedeserhacammismocomo
hacalosdems.La dermatitis esunmododereaccionarsialguienseresbala
debajodemipiel,metrastorna,memolestaosiunasituacinmecausafrustracin.
Poneenevidenciaunanecesidaddecontactofsico(habitualmenteporeltacto)que
pideestarcolmadaolanecesidaddeevitaruncontactoquemeestimpuestoyque
rechazo.Teniendoladificultadonoatrevindomeadeciralaotrapersonaque
pare,mipielhiervedeira,oalcontrario,puedotenerdificultadenmanifestar
mi necesidad de contacto humano, caricias, etc. Lo importante es respetar mis
necesidades, participarlas a las personas interesadas y la dermatitis podr
desaparecernaturalmente.
PIEL ECZEMA
El eczema es una infeccin de la piel superpuesta con zonas rojas que puede
aparecereneladultocomoenelnio.Soyunapersonahipersensible.Noaprend
aamarme y,altemerestarherido,vivomuchoenfuncindeloquelosdems
253

esperandem.Tengomiedodeestarabandonado.Sitengo eczema,yavivuna
situacindeseparacinmuyintensa.stapudoinclusoocurrircuandoestabaenel
vientredemimadre.Enmivida,tendrtendenciaavolveracrearsituacionesen
que me sentir separado, particularmente de la gente a quien amo. El eczema
afectandolapiel,loqueammefalta,inclusoinconscientemente,eselcontacto,
eltactodelapersonaantesdelaseparacin,queahoraperdoqueslotengoraras
veces.Espuesmipielquehacacontactoconelotroy,alhabrsemequitadoeste
contacto,mipielexpresasunecesidaddeestartocada,bajoformadeeczema.Esto
mellevaaaislarme,aretirarmeyadespreciarme.Meolvidoconstantementeen
detrimentodelosdems.Concedomuchaimportanciaaloquelagentepuede
pensardemoalmodoenquemeperciben.Laimagenqueproyectoesmuy
importante.Tengodificultadenseryo.Nosaberadondemellevamidestinome
creamuchainquietudyentonces,meganalaansiedad.Pasodeladesesperacina
larebelinoalaira.Estadesesperacinqueincubairrumpirporolas.Todos
estos factores reunidos mellevan a vivir una frustracin e irritacin.Si bien
intento complacer a todo el mundo, olvido tener en consideracin mis propias
necesidades;todoestoparahacermeamarporlosdems.Actoenfuncindelas
esperasdelosdemsenvezdehacerloqueammegusta.Rechazoaquiensoy
yo.Nomeamocomosoy,porlotantoelhechoquelapielqueesaparenteyque
todalagentepuedever,estenmalestado,inclusofea,confirmarenlofsico
cmo me percibo interiormente. Cuanto ms me rechazo, ms atraigo gente
alrededordemquemedarnlasensacinderechazarme;mimiedodelrechazose
manifestar!Estomellevaaemprenderlaretiradayacortarmedelarealidad
exterioraunque,paramisadentros,loquedeseoesacercarmealagente.Aspuedo
estar irritada emocionalmente son queest consciente. Con la eczema voy a
erigirunabarrerafsicaentreyoylosdemsparaprotegermeyevitarsentirme
amenazadooherido.Sinembargo,enelcasodeunbeb,voyadesarrollaruna
costradelecheporquenecesitomscalorhumanoycontactofsicoconlagentea
quien amo. Sintindome aislado, manifestar eczema para acercarme a los
dems.Necesitoamoryatencin.Enelcasodeunnio,minecesidaddeestar
tocadosemanifiestaconeldeteneruncontactopielconpiel(enelsentidoliteral
deltrmino)conunapersonaquemeamaynouncontactoenelcualhabrauna
mantaoprendasqueimpediranestecontactofsico.Seayounadultoounnio,
esta costra representa lo que debo soltar para por fin volverme yo, este yo
escondidodesdehacetantotiempo.Debodejarciertasactitudes,ciertosesquemas
mentalesparadesprendermedemipasadoyconcentrarmesobrelasaccionespor
tomarpararealizarmipotencial.Deboaceptarmetalcomosoyyamarme.LO
QUEAMINOMEDOY,NOPUEDESERMEDADO,TALESLALEYDE
LARECIPROCIDAD.Identificopuesmisnecesidadesrealesyactoenfuncin
destas.Aprendoavivirplenamenteelinstantepresente,sabiendoquecadagesto
quehagohoyformamimaana.Adelantoenlavidaconconfianza.
254

PIEL EPIDERMITIS (ver tambin: ANEXO III, HERPS, PIEL- ZONA)


La epidermitis es una afeccin inflamatoria de la epidermis, esta parte
externadelapiel.Seguramenteexisteunatensinentreloquevivointeriormentey
loquesucedeenmividaexteriormente.Estudiandoestoaloqueestvinculadala
pielylosproblemasdepielenelplanometafsico,conseguircomprendermejor
loquevivopararemediarlo.
PIEL ESCLERODERMIA (ver tambin: SISTEMA INMUNITARIO)
Laesclerodermiasecaracterizaporelendurecimientodelapiel,laprdida
de su movilidad y de su flexibilidad. Siendo una persona afectada por esta
enfermedad,soyunapersonaduraconmigomismo,yfrecuentementemesiento
herido.Viviendounagraninseguridad,creodeberconstantementeprotegermedela
gente que me rodea. Para conseguirlo, me endurezco tanto que me vuelvo un
bloquedehielo.Lacuracinsehallaenlaaperturaconlosdems.As,acepto
abrirmicoraznalamor,sentirelcaloryelbienestarquesehallanalrededormo,
estecalorquedesciendeenlomshondodemyhacederretirestebloquequeme
hiela.
PIEL FURNCULOS (ver tambin: INFLAMACIN)
Unfurnculosedefinecomosiendounainflamacindelapielcausadapor
una bacteria, caracterizada por una masa blanca de tejido muerto. Tengo la
sensacindequealguienoalgoenvenenamiexistenciayalreprimirenelinterior
todamiira,misangustias,estarhartoyelexcesosemanifestarporunoovarios
furnculos. Ya que los furnculos afectan la piel, la ira vivida suele ser la
resultante de una situacin en que estuve separado de alguien o de algo que
apreciabayconlocualyanopuedotenercontactofsico(poreltacto).Ellugarde
micuerpoenquesemanifiestael furnculo medaunaindicacinreferenteal
aspectodemividaquesuscitaenmtantairaysobreelmotivoporelcualesto
hierveadentromo.Porejemplo,unfurnculosobreelhombroizquierdomeindica
frustracin con relacin a mis responsabilidades familiares y las de mi pareja.
Puedotenerlasensacindeestarsobrecargadoydequemicnyugenohacelo
bastante.Meinteresaexpresarlairaquevivoysolicitarayuda,siconviene,para
evitarenvenenarmeasconfurnculos.
PIEL FURNCULOS VAGINALES
Cualquier furnculo indicafrustracinnoverbalizada.Sisemanifiestaal
niveldemisrganossexuales,esposiblequevivairahacamicnyuge(opareja
sexual) y al modo en que la sexualidad est vivida (por ejemplo: puedo estar
frustrado por la duracin, la frecuencia, la intensidad de nuestras relaciones
sexuales)?Ysinotengoparejaenelmomentoenqueaparecenlos furnculos,
255

puedoviviriraporelhechoquenovivomisexualidadcomoquiero,pornotener
cnyuge. Cualquier sea mi situacin, si tengo cnyuge, es importante que
comuniquemisnecesidades,mifrustracinparaqueambosaportemosloscambios
necesarios a una sexualidad ms completa. Si no tengo pareja, acepto mi
situacin presente como siendo la mejor de momento. Teniendo una actitud
positiva,aumentomisprobabilidadesdeencontraraunapersonaconquienpodr
desarrollarunabellarelacinyquesabrsatisfacermeatodolosniveles.
PIEL GRIETA
Lasgrietassoncortadurasdolorosasquesesuelenencontrarenlasmanosy
lospies.Vivoprobablementeirritacinpronunciadafrenteaalguien,algoouna
situacin.Las grietas salensobretodoeninvierno,siendocausadasporelfro,
puedotenerlasensacindehabersidoquemadovivoporunapersonaosituacin
porqueelfrointensopuedequemartantocomoelfuego.Sisetratadegrietasen
lasmanos,estoafectamsmividadiaria;encambiosiestnenlospies,puedeque
temeloqueserdemenelfuturo.
PIEL LUPUS
Existendiversostiposde lupus.Sinembargo,el lupus sueleserunaenfermedad
inflamatoriaquepuedetocargrannmeroderganos.Seatribuyesuorigenal
sistemaautoinmunitario.Desarrolloun lupus cuandovivoungrandesanimo,
odiootengovergenzadem,locualhacequesedebilitemisistemadedefensa.
Mimalestarmuyfrecuentementetienesuorigenenunaculpabilidademocional
profundaquemeroeinteriormente.Prefierocastigarmeenvezdeafirmarme.Bajo
los brazos, captulo porque tengo la sensacin de que no hay salida posible,
ningunasolucinypuedovivirfrustracinfrenteamiimpotencia.Lamuertees
unaescapatoriayrehsoaceptarelamoryelperdnhacammismoohaca
losdems.Volveraaprenderaamarmeconstituyeunaetapaimportante,incluso
esencial, a mi curacin. Puedo pedir ayuda interiormente o pedir a personas
competentesquemeayudenparaempezarelprocesodecuracininterior.
PIEL MANCHAS EN LA PIEL
Estasmanchasenlapiel72tambinllamadasantojossonmalformaciones
muy frecuentes de los pequeos vasos sanguneos, tambin llamados capilares,
localizadasenlapartesuperficialdelapiel.Si,alnacer,tenaunamanchaenla
piel,puedoempezaraexaminarenculpartedemicuerpoestlamancha.Esto
correspondenormalmenteaunaemocinfuerte,generalmenteiraopena,vivida
pormimadrecuandomellevabayquemeafecttambin.Yaquelacirugaoel
tratamientolserpermitehacerdesaparecertodoopartedeestasmanchas,voya
72

Enelplanomdico,sellamanangiomasmaturosoangiomasplanos.

256

tomarconscienciadelarelacinqueestotieneconmigoparaintegrarloyllevarme
asermsyomismo.
PIEL MELANOMA MALIGNO
El melanomamaligno tambinsellamacncerdellunar.Setratadeun
tumor,muyfrecuentementemaligno,alniveldelapielyqueprocededelasclulas
queestnencargadasdepigmentarsta(melanocitos).Elmelanomaapareceenel
lugardemicuerpoquepuedorelacionarconunsucesoenquemesentensuciado,
manchado.Vuelvoaplantearmiintegridadfsica.Tambinpuedohabervividoun
sucesoenquemesentarrancadodealguienodealgoqueapreciabamucho(las
enfermedadesdelapielfrecuentementeestnrelacionadasconunaseparacin).
Aprendoavolveraponeramorenlasituacinqueeslafuentedeestemelanoma.
Aunquepudosermuydifcilenelmomentoenquevivesto,aceptovercul
elementopositivooculsabiduraresultdeello.
PIEL MORADOS
Los morados llevan tambin el nombre de contusiones. Se trata de un
cardenaldecolorrojo,azuladoonegro,queseproducecuandomepegoconun
objetoduroqueaplastalapiel.Estacontusinestrelacionadaconunaexpresin
reprimida, un dolor mental o una angustia profunda que no verbalizo. Pueden
sobrevenirenlosmomentosdegrandefatigacuandoestoydescentrado.Mesiento
culpable poralgunarazn,quiero castigarme,adoptolaactituddeunavctima,
carezco de resistencia a los acontecimientos de la vida (predisposicin a las
contusiones).Lavidameavisapuesinstantneamentequegolpeandoesteobjeto,
nomedirijoenlabuenadireccin(pocoimportasta).Habitualmente,elobjetoes
inmvilaunquelogolpeoyendohacalenvezdelocontrario.Porlotanto,me
autocastigo.Miroadndevoy?Memuevocondulzuraenlavidaotengo
tendenciaaactuarbruscamente?Estoybastanteatentoparaseguirodemasiado
dbilycansadopormiscontusionesyheridasinternasquesemanifiestanahoraen
mifsico?Tengobastantecalmainterior?Deboquizsrevisarmisposicionespara
sercapazdeevitarlosobstculosquesepresentanenmicamino.Debotomarel
controldemivida.Esmuyimportantequeelijayqueasumadecisionesqueestn
enarmonaconmigomismoymievolucin.
PIEL PUNTOS NEGROS (ver tambin: ROSTRO)
Los puntos negros o comedones son pequeas protuberancias en la
superficiedelapiel,negrasensucumbreycausadasporunahipersecrecinde
sebo73.Sonlaexpresin exterior demisentimientointerior de estar sucio,no
limpioynovalergrancosa,eindicaquemedesprecio.Aprendoaamarmetal

73

sebo:Unaformadegrasa,enpartetrigliceridosqueseformansobretodoenlasuperficiedelaepidermis.

257

comosoyyaestarorgullosodemyentonces,latezdemirostro(endondesuelen
hallarseloscomedones)sevolverbrillante.
PIEL PSORIASIS
La psoriasis consisteenunasuperproduccindeclulascutneas,creando
unamontonamientodeclulasmuertas,unapielmsespesa,placasrojasgruesaso
engotasyqueestncubiertasdefragmentosdesustanciascrneasblanquinosas.Si
tengo psoriasis, estoy entre los 2% de la poblacin del globo que padece esta
enfermedad.Tambin,sueloserhipersensibleytengounagrannecesidaddeamor
ycarioquenoestcolmada,recordndomequizsotroperododifcildemivida.
Enesemomento,tengoprobablementeunmuygransentimientodeabandonoode
estarseparadodealguienodealgoquequeramucho.Porquelapsoriasisimplica
que hubo doble

separacin74, es decir frecuentemente frente a dos personas


diferentes.Podraserquemehayanseparadodemisdospadrescuandoeranio.
La piel est afectada porque, para m, siendo nio, lo que ms necesito es el
contactofsicoconmispadresoconcualquierotrapersonaaquienamoycon
quienmesientoprximo.Ladobleseparacinpuedeserconmimadreyconuno
demishermanosohermanas,oconmicnyugeyunproyectodetrabajo(mi
beb), o cualquier otra combinacin que implique una separacin con dos
personasodossituacionesqueamoyquemeamomucho.Elhechodeestarode
sentirmeseparadomeimpidetenerestecontacto,sobretodoconrelacinaltacto,
por lotantodemi piel
,conestas personas aquienes amo.Habrpor lotanto
aparicindela psoriasis.Ahora,tengotantomiedodeestar heridoquequiero
guardarciertadistanciaentremylosdems.Lapsoriasisesunabellamaneraque
tiene mi cuerpo de protegerse contra un exceso de acercamiento fsico y de
protegerse contra mi vulnerabilidad. Vivo pues un conflicto interior entre mis
necesidadesdeacercamientoymimiedoelcualmehaceponerdistancias.Debo
puesliberarmedeciertospatternsmentalesyactitudesquesehanacumuladoy
que,ahora,yanotienenrazndeser,yaqueestnapagadosymuertos.Acepto
ahoramisensibilidad;aprendoahacercosasparamynosloenfuncindeloque
los dems esperan de m. Y aunque la psoriasis haya ocurrido probablemente
despusdeunsucesodolorosoodeungolpeemocional,aceptoqueestoforme
partedelprocesonaturaldelavidaydemicrecimientoyquemevuelvamsfuerte
ymsslidointeriormente.
PIEL QUERATOSIS
Enlaqueratosis,lacapasuperficialdelapielsevuelvemsespesa.Enla
piel, esto puede representar una superficies rojizas, rugosas, pudiendo formar
costra.Lapieleslauninentreelmundoexterioryelinterior,porlotantopuedo
tener tantos miedos que, en mi entorno, siento la necesidad de protegerme
formandounabarreramsespesa.Elcolorrojizomeindicafrustracinreprimida
74

Dobleseparacin:Enelcasodeleczema,setratadeunasimpleseparacin,conunasolapersonaosituacin.

258

frentealoquevivo.Ellugarendondeseformala queratosis,losbrazos,los
muslos,elrostroolasmanos,meindicaculaspectodemividanecesitoproteger.
Puedomandarpensamientosdeamorenmicuerpoenellugardondeseformala
queratosis para integrar la toma de consciencia que debo hacer. La confianza
frentealavidaaumentarenmypodrhallarlaflexibilidadnaturaldemipiel.
PIEL SABAONES (ver tambin: FRO [enfriamiento])
Los sabaones sonzonasrojascausadas porelfroquesehallanenlas
extremidadestalescomolasorejas,lasmanos,lospies.Estaszonasrojomorado
songruesas,frasyavecesmuydolorosas.Los sabaones constituyenaveces
pequeasampollasdeaguaenlasuperficiedelapiel.Lavidamequema,yhel
misreacciones.Cuandoelsabansehallaenlasmanosyenlostacones,estome
permite moverme ms despacio. Me impido experimentar. Por otra parte, me
enganchoasituacionesynoveonadams.Fsicamente,doylasensacindeserun
atrevidocuando,interiormente,mesientovaco,agotado.Yanotengogustode
adelantaryseparaoinmovilizamigustodevivir.Inclusomepreguntoporque
vivo.Envezdesloverlosaspectosnegativosdemisexperiencias,acepto
soltarelpasadoyabrirmealavida.Cuandomeabroalavida,estoyotravezen
medidadevertodoelamorquemerodeayvivirenarmonaconloquesoyycon
mientorno.
PIEL SARNA
Lasarnaesunaenfermedadcutneacausadaporparsitos,caracterizadapor
comezones. Qu es lo que me come al punto de suscitar tanta impaciencia e
irritacin? Hay una situacin en mi vida que deseo ver cambiar desde algn
tiemposinquenadaocurra?Quizslascosasnosucedentalycomolodeseoyala
velocidad que quiero. Me dejo molestar, infestar, por una persona, una cosa o
situacinymeinteresasoltarynoquerercontrolarlotodoenmivida.Miraen
dondesesitalasarna,enculpartedemicuerpo,paradescubrirlafuentedemi
dolencia.Debodejarlavidafluirydecirmequehayunmomentoparatodo.Tengo
feenquetodoestensulugaryenarmona.
PIEL URTICARIA
La urticaria se caracteriza por la aparicinde placas rojas en diferentes
partesdelcuerpo.stas,ligeramentebombeadas,provocancomezonesvivos.La
urticariaprocede,segnelcaso,deunaintoxicacinalimentaria,vinculadaconla
tomadeciertosmedicamentosuotrassustancias,peroesteestadopuedeagravarse
conelestrsylastensiones.Sipadezco urticaria,muyprobablementesoyuna
personaquevivomuchorechazo.Nomegustaelserquesoyymitemordeestar
heridoestanfuerteque,paraseramado,hagolascosasenfuncindeloquela
genteesperadem.Mimiedodeestarrechazadoseconcretizayaquemerechazoa
259

m mismo. Mi piel estropeada por estas placas rojas me hace sentir feo e
indeseable. Soy como una bestia marcada con hierro incandescente; soy
dependientedemipropietario.Yaquevivoenfuncindelosdems,meimpido
hacercosasparam;nomeatrevoarealizarnuevosproyectos,locualaumentami
sentimientodeimpotencia.Elijosereldueodemivida,mevuelvolapersonams
importanteparam.Adelantoymehagoconfianza.
PIEL VERRUGAS (en general) (ver tambin: TUMORE[S])
Las verrugas sonunainfeccinviraldelapielquecausaunexcesoenla
produccindeclulas,creandounamasaduraeindolora(tumorbenigno).Esta
masaeselcmulodebarrerasqueerijoenmicamino.Barrerasdepenas,rencores,
vinculadosaciertasfacetasmasquemeparecenfeosydetestables,provocandoun
sentimientodeculpabilidad.Siporejemplo,tengo verrugas eneldorsodemis
manos,mejuzgomuyseveramenteconrelacinamiletrayaladelosdems.La
aparicinde verrugas colmaunvacoafectivo.Consideroquenomerezconada
mejor que esta cosa fea. Si pienso que soy feo, mi cuerpo se volver feo,
simplementeeselreflejodemisactitudesinteriores.Sitengovergenzadeloque
hago, o bien si deseo algo pero creo que no me lo merezco, es posible que
aparezcan verrugas.Esimportanteiraverenculpartedelcuerpohanacidola
verruga,paraconocerelaspectodemicuerpoodemividaqueestafectado.
Aceptando loquesoy,unserdignodeamor,yanonecesitarverrugaspara
recordrmelo,ydesaparecern.
PIEL VERRUGAS EN LA PLANTA DE LOS PIES (ver: PIES
VERRUGAS EN LA PLANTA DE LOS PIES).
PIEL VITILIGO
El vitiligo es una despigmentacin de lapiel, lacual se considera como
siendolamsfrecuente.As,mipielsevuelveblancaenciertoslugaresdemi
cuerpoyporplacas.Estopuedeproducirseencualquierpartedelcuerpo,incluido
elrostroylasmanos.Puedoestarafectadosinomesientorelacionadoconlas
cosasolaspersonasquemerodean.Tengolasensacindeyanoteneridentidad.
Notengoelsentimientodeperteneceramifamilia,amicomunidad,amiscolegas
detrabajooamipueblo.Tendrlasensacindehabersidomanchado,locual
puede representar un sentimiento de impureza, querr que esta mancha
desaparezcayenvezdeunamanchaoscura,meencontrarconunamancha
blanca. Estopuede estar vinculadoa un sentimiento dequerer desaparecer o
volverme transparente para pasar desapercibido. Puedo haber vivido una o
diversasexperienciassexualesenlascualesdestacarestesentimientodemancha.
As,puedotenerlasensacindequesemehaseparadodeunoodevariosseres
queridos y esto me parece feo. Puedo haber tenido la sensacin de haber sido
260

incapaz de parar o impedir esta separacin. Por lo tanto, voy a culpabilizar y


desvalorizarme, sintindome manchado, sucio con relacin a esta situacin. El
lugarparticulardelcuerpoqueestafectadomeindicaculaspectodemest
relacionado.Tomoconscienciadelaimportanciademivida.
PIEL ZONA
El zona se reconoce en la erupcin que conlleva en la piel, la cual se
manifiestaunilateralmenteyenfranja,segneltrayectodeunnervio.Losnervios
siendo nuestros medios de comunicacin interior, el dolor que provoca esta
erupcinindicaunarupturadecomunicacinenlacomarcaafectada.Mesent
agredidoyvivounaprofundaamargura.Unasituacinounapersonamehaherido,
provocando tensin cuandodehechonecesito atencin.Ademspodrtenerla
sensacin de estar ensuciado, manchado. Mi primer reflejo es retirarme,
encerrarme,creyendoevitarasotrasheridas.Tengoestecomportamientoporquela
situacinmehaceviviruna graninseguridadinterior.Actuandodeestemodo,
girohacamestaagresindelacualcreohabersidolavctima;doyraznamis
agresores.Laerupcinabotargadatieneporobjetivohacermetomarconscienciade
quevivounareaccinounairritacinemocionalintensafrenteaalguienoalgoque
mecausaunestrsexcesivoyquedificultamisdecisiones.Micuerpomedicede
confiarenelflujodelavidaqueestenm.Acepto misensibilidadyaque
formapartedem.

PIERNAS (en general) (ver tambin: SISTEMA LOCOMOTOR)


Laspiernasmetransportanhacadelanteohacaatrs,medanunadireccin
propia,estabilidad,solidezyunabasefirme.Representanpuesmicapacidadde
adelantarenlavida,deirhacadelante.Mispiernasmepermitenironoiral
encuentrodelagente,acercarmeoapartarmedeella.Mispiernasreflejanpues
todoslossentimientosquepuedovivirconrelacinalmovimientoyaladireccin
por tomar y representan as todo el campo de las relaciones con mi entorno.
Piernas dbiles me indican quehay poca energaque circulaen stas, locual
denotaenmunafaltadeseguridad,unaincapacidadenquedarmedepieyaestar
fuertedelantedeciertasituacinociertapersona.Entonces,tengotendenciaaser
dependientedelosdems.Buscomiapoyoymimotivacinenlosdemsenvezde
hallarlosenmiinterior.Elgrosordelaspiernasmedatambininformaciones:si
tengo piernaspequeas,tengomsdificultadenconectarconelmundofsico,
materialymegustaramsdelegarlasresponsabilidadesqueestnvinculadasa
elloenvezdeasumirlas.Alcontrario,sitengopiernasgordas,stassoportanun
peso excesivo: las responsabilidades que decid tomar (sobre todo en el plano
261

material) y no slo las mas, las de los dems que a veces acept por
obligacin.
PIERNAS (dolores de las )
Cuando hay dificultad con mis piernas, debo pararme y preguntarme lo
siguiente:Culeslasituacinactualoquveovenirquemehacetenermiedodel
porvenir?Resistoalcambio,mesientoparalizadoypuedoestartanasustadoque
tengoelgustodetomarlasdeVilladiego;peroesstalaverdaderasolucin?
Conquientengodificultadesracionalesquesonfuentedetensinydeconflicto?
Adelantoyevolucionocadada,cadamomento,yproblemasenlaspiernasslo
manifiestan que existe actualmente obstculos que debo quitar para seguir mi
caminohacaunafelicidadmsgrandeyunaarmonamsgrande.Sealaquesea
lanuevasituacinquesepresenteam,puedohacermeconfianzaeirmsallde
miresistenciaalcambio.
PIERNAS PARTE INFERIOR (pantorrilla)
Laparteinferiordemispiernassehallaalniveldelapantorrilla,lacual
estsostenidaporloshuesosdelatibiaydelperon.Laspantorrillasmepermiten
avanzar. Representan as una proteccin con relacin a mi pasado mientras
adelantoenlavida.Simeduele,ositengorampasenlaspantorrillas,debofrenar
mi ritmo. Quiero yo parar ciertos acontecimientos que me esperan o me dan
miedo?Tengoyolasensacindequeseatropellanlosacontecimientos,quetodo
va demasiado de prisa? Mi cuerpo me dice que puedo tener confianza en el
porveniryquelavidasecuidadem.
PIERNAS PARTE SUPERIOR (muslo)
Lapartesuperiordemispiernas,alaalturadelmusloqueestllevadopor
el hueso del fmur, refleja mi tendencia a retener cosas, ms frecuentemente
vinculadas a mi pasado. Si vuelvo a vivir constantemente el pasado o si vivo
culpabilidad frente a ciertos acontecimientos, esto tendr por efecto que se ira
almacenandoenmismuslos,stosseengordarn.Tambinpuedohaberguardado
rencoroamargura.Escomosimipasadomeretuviesehacaatrsymeimpidierair
haca delante. Mis heridas y mis traumatismos me hacen arrastrar la pierna.
Piernas gordas pueden significar que almaceno demasiado (tanto en el plano
material,emocional,comointelectual),queguardocoasparaelcasoenque!,
por inseguridad, por miedo a carecer de algo o de alguien. Igual como los
esquiroles, hago reservas en previsin de una hambruna posible, pero
frecuentementesinfundamento.Esbuenoquehagalimpiezaparaguardarslolo
queesbenficoparam.

262

PIERNAS VARICES (ver: SANGRE VARICES)


PIES (en general)
Lospiesrepresentanmicontactoconlatierradeenergaalimenticia.Estn
relacionadosconlasrelacionesquevivoconmi madre ascomolosconflictos
frenteasta,loscualespuedenremontartanlejoscomomiconcepcin.Mispies
me dan estabilidad en mis desplazamientos haca un objetivo, un deseo o una
direccin. Me ayudan asentirme en seguridad en mi relacin con el universo.
Representanlaposicinquetomofrentealassituacionesquesepresentanam.El
hechodetenerunpieizquierdomsfuertequeelpiederecho(oviceversa)puede
informarme en las diferentes tendencias que debo privilegiar en mis
desplazamientos o contactos con el suelo tanto fsicos como mentales o
espirituales.Ademssiandoconlos pies giradoshacaelexterior,puedovivir
confusinfrentealadireccintomadaotenerunadispersindemisenergasen
diferentesproyectos,mientrasquesimispiesestngiradoshacaelinterior,vivo
uncierreounaresistenciafrentealasdireccionesportomarenmivida.
PIES (dolencias de)
Graciasamis pies,medesplazoenelcaminodelavida.Micerebroesla
centraldemandodemispies.Lacienciadelareflexologanosinformaquetodo
nuestrocuerpoestrepartidoenlasuperficiedenuestrospies.Porlotanto,todos
losproblemasquepuedovincularamispiesmepermitensabercullugardemi
cuerpo me est hablando. Un problema vinculado con mis pies me indica un
conflictoentreladireccinyelmovimientoquetomo,ymanifiestaminecesidad
demsestabilidadyseguridadenmivida.Elfuturoytodossusimprevistosme
dan miedo. Cuando me duelen los pies, debo ralentizar el paso. Se debe al
aburrimientooaldesanimofrenteatodaslasresponsabilidadesyfrenteatodaslas
cosasquedebohaceryquemeparecenimposiblesderealizar?Oalcontrario,
puedequevayaa300kilmetrosporhoraymicuerpomedicedeirmsdespacio
antesdetenerunaccidente?Unarampaenelpieizquierdooenelpiederecho
meindicaaqunivelsesitaladudaoelrechazodeadelantarobienculesla
direccinquemeasustacoger.Elbloqueoestadentromoofueramo?Debo
tomarposicinenunasituacindadaypuedotenermiedodeperderpieyyano
sencul pie hedebailar.Un piellano meindicaunacolumnavertebralmuy
recta,muyrgida,yporlotanto,tengounaestructuramenosflexible.Yaqueno
hayningnespacioentretodomipieylatierraenlacualando,estodemuestraque
misfronteraspersonalesestnmaldibujadas.Mesientopuesvulnerabley,para
protegerme,sobrevolarlasuperficiedelascosasenvezdecrearuncontacto
msprofundoycogerrazadecuadamente,tantoenunarelacinafectiva,como
enuntrabajo,oencualquierotrocampo.Estotambintieneporconsecuenciaque
mitrabajoestarentremezcladoconmividaprivada,ambassolapndose, poco
263

importaloquesucedayendetrimentodelrestodemisrelaciones.Alcontrario,si
tengo elpuentedelpiealto,estomerevelaquetengoundesplazamientoms
pesadoyunacolumnavertebralmuycargada.Estorevelatambinqueclaramente
separ mi vida pblica de mi vida privada. Esto me lleva a estar apartado y
silencioso, teniendo dificultad en iniciar una comunicacin y anticiparme a los
dems.Unfrenoamisemocionesfrentealadireccinquehedetomarenmivida
setraducirporunospieshinchadosyelexcesodeestasemocionesqueseliberan
setraducirportranspiracin.Lospiesfrosmellevanacuestionarmesobremis
relacionesconmimadreyverloquepuedellevarmeatenerlospiesfros,incluso
helados.Muysencillamentepuedetratarsedemisrelacionesconellaqueencuentro
distantesyfros.Porlotantodeboamarmis pies porquesonellosquellevan
todomiserenelcaminodelavida.Cuantomslosamoylosacepto,msfcil
sereltrabajoquecumplan.
PIES CALLOSIDADES o CALLOS EN LOS PIES (ver tambin: PIEL
CALLOSIDADES)
Voyhacadelanteconmispiesperoalgomedicequehayalgoquerascaun
pocoEslacallosidad,estepequeobultoquemeindicaunaactituddeaprensin
enmividapresente.Eseltemoraandarhacalodesconocidoconconfianzaporque
noconsigoquedarnatural,haciendolascosassimplemente.Ammecuestair
hacadelante.Melanzohacaelfuturoperodudoyempujodemasiadooquizsno
losuficiente. Buscoprimerolacausa.Quesloquemehaceviviresto?La
tristezaylapena,eltemoranotenerxito?Naturalmente,puedoreducirelgrosor
demiscallosperoesinsuficientesinotrabajoconlaverdaderacausa.Acepto
verloquememolestaaestepuntoyquemeimpideirhacadelante.Asestarms
deacuerdoconlavida.Miconfianzaenelporvenirslosermayor.
PIES MICOSIS (entre los dedos de los pies) o PIE DE ATLETA (ver
tambin: PIEL / [en general] / dolores de], SISTEMA INMUNITARIO)
La micosis aparecebajoformadecomezn.Unapielconcostrayhendida
queindicaquemi mental estirritadoocontrariado,quemesientolimitadoo
incapazdeandardelmodoquequisierayconrelacinaloquemeesperaenel
porvenir. Tengo dificultad en aceptarme tal como soy y quisiera tener la
aceptacinylaadoracindelagentequemerodea,igualcomoelatletaque
tiene xito y est adorado. Esto me produce un estrs y un dolor interno. La
irritacindelosdedosdelospiesestvinculadaconlosdetallesylasdirecciones
demividafutura,conloabstractoylosconceptosenergticos.Sonmiedosyuna
faltadecomprensin.Puedovisualizarmeenuncaminoenelcualesagradable
andaryenelcualmesientoentotalseguridad.Estomeayudarasoltarlosmiedos
ymeaportarmsarmonaenlavida.
264

PIES VERRUGAS EN LA PLANTA DE LOS PIES (ver tambin: PIES


CALLOSIDADES)
Una verrugaenlaplanta delospiessemanifiestahabitualmenteporla
aparicindeunapequeapartculatransparentedebajodelpie,alrededordelacual
seformaunacallosidad,provocandodolorcuandoestbajopresin.Unaverruga
en el pie me indica que vivo temores frente a mi porvenir y frente a mis
responsabilidades.Eldolorqueprovocapuedehacermecomprenderquesientoira
enmimododeconcebirlavida.Esprobablequemedejefcilmentepararporlas
pequeasdificultadesquesecolocandelantemo.Puedetambinquevivauna
desvalorizacin con relacin a mis capacidades o habilidades fsicas en los
deportes. Puedo ser muy buen deportista por encima de la media y vivir
desvalorizacinporquemeobligoasiempreserelmejoroasiempreestartan
excelenteencualquiercircunstancia.Puedetenerlasensacindequemispiesno
hacentanbiencomolospiesajenos.Tambintengolasensacindejugaral
hockeyconlos pies,locualsignificaquemecomparoalosdemsyqueme
sientomuyinferiorconrelacinasucapacidadfsica.Micuerpomedicequees
intilhacermetantodaoyquepuedoadelantarenlavidacontotalconfianza.
Deboaceptar tantomisfuerzascomomisdebilidadesyperseverando,podr
tenerxitoyotambin.
PIPI EN LA CAMA (ver tambin: INCONTINENCIA [fecal, urinaria])
Elhechodedejarseirduranteelsueomeinformasobreciertasemociones
detemoromiedoquevivemihijofrentealaautoridaddelospadresoescolar.Si
soyestehijoquevive incontinencia,puedequeparam,setratedeunmodode
liberarlasemociones(representadasporlaorina)quereprimodurantetodoelda,
frecuentementeporquetengomiedoquemecastiguenopormiedoadisgustaralos
demsyayanoseramado.Igualcomolosanimalesquemarcansuterritoriocon
su orina, lo mismo yo, como nio, puedo sentir inconscientemente la misma
necesidad de operar igual, como para definir mi pequeo territorio de nio
porque tengo miedo que me lo quiten o lo transgreden, viviendo as mucha
inseguridad. Mi inseguridad ser tambin incrementada si me hacen dormir a
oscuras.Siendonio,puedovivirunsentimientodeseparacinintensafrentea
alguienoaalgoqueamo,yescomosi,durantelanoche,pidierasocorroporque
necesitocalor.Porlotanto,comopadreoeducador,debotomarconscienciadela
sensibilidaddelniofrentealaautoridad,ayudarlealiberarsedemiautoridad
demasiadograndeconpalabrasdeamorquesetransformanenlenunaconfianza
incrementada.
PLEURESIA (ver: PULMONES NEUMONA)

265

POLIOMIELITIS
Lapoliomielitisesunaenfermedadcontagiosaproducidaporunvirusquese
fijasobreloscentrosnerviosos,enparticularsobrelamedulaespinal,provocando
parlisisquepuedensermortalescuandoalcanzanlosmsculosrespiratorios.La
poliomielitis anterior aguda es comnmente llamada poliomielitis. Al ser una
enfermedadqueseencuentrasobretodoenlosnios,selallamatambinparlisis
infantil.Siestoyalcanzadoporestaenfermedad,elvirusquemeparalizaesla
impotenciayloscelos. Sientoenvidiadeloqueotroolosdemspuedenser
capacesderealizar.Quisierafrenarlesperomefrenoammismoymeparalizo.
Estaenfermedadpuededecirmequenodeboenvidiaralosdems:soyunapersona
extraordinariaconcapacidadesinmensas.Tengotantascalidadesyfuerzascomo
losdemsydeboaceptarstas.Envezdehuiryponermiatencinavejaralos
dems,recuperoaquyahoraelplenopodersobremividayacepto quela
abundanciaformaparteintegrantedemivida.
PLIPOS
Elplipoesuntumorbenignoquesedesarrollaapartirdeunamucosa,por
ejemplounamucosabucal,nasal,intestinalyuterina.Laexcrecenciaqueresultaes
unsignofsicopararevelarmequehayunapersonaounasituacinenmividaque
memolestayquequisieraevitarohuirperomeresultaimposible.Alcontrario,me
sientocogido,pilladoynopuedosustraerme.Tengoemocionesquesesolidifican
en m. Para m, sera ventajoso aceptar que algo o alguien me molesta y
preguntarmequeesloquedeboaprenderentodoesto?Dequmodoquisiera
sentirme ms libre? Enfrentndome a mis responsabilidades, el o los plipos
desaparecern.
PRESBICIA (ver: OJOS PRESBICIA)
PROBLEMAS CARDACOS
CARDACOS)
PROBLEMAS DE
CARDIACA)

(ver:

PALPITACIONES

CORAZN

(ver:

CORAZN

PROBLEMAS

ARITMIA

PROLAPSO (cada de matriz, de rgano).


Elprolapsoindicaundesplazamientopatolgicodeunrganohacaabajo,
vinculadoconlasolturadeloselementosquelomantenanensusitio.Esfrecuente
enelcasodelaprstata,tero,vagina,recto,urterovejiga.Vivoentoncesuna
grandejadez,unabandono,unafaltadecontrol.Losmsculossedebilitanporque
miniveldeenergaestanbajoquenopuedemantenerlaelasticidaddelrgano?
266

Estoycansado,vivouna desesperacininterior inmensa,stasiendovinculada


msparticularmenteal aspectodemividaqueestrepresentadaporel rgano
afectado.Esimportantequeencuentrelosmediosderetomarmividaenmanoy
que est activo. Puedo buscar lo que amo verdaderamente, bien sea el arte, el
deporte,unpasatiempo,paravolveradarmevitalidadyelgustodevivir.
PRSTATA (en general)
Laprstataesunaglnduladelaparatogenitalmasculinosituadadebajode
lavejigayquesecretaunlquidoconstituyendounodeloselementosdelesperma.
Representapueselprincipioylapotenciamasculinos.
PRSTATA (dolores de)
Laprstataestvinculadaamisentimientodepotenciaycapacidadsexual.
Yaquesonfrecuentementeloshombresmayoresquepadecendetrastornosdela
prstata,debopreguntarme:Estoysatisfechoyagustoenmisexualidad?Vivo
frustracin, impotencia o quizs incluso confusin de cara a mi sexualidad y
tambinfrenteamibsquedadeunaparejaquizsmsjoven?Seramejordejarlo
todo? Quizs ahora me siento intil, ineficaz, incapaz de ser un hombre
verdadero.Vivoelmiedointensodenoestarenlasnormassexualesimplantadas
porlasociedad.Deboaprenderadesculpabilizarmeyadejardeestartensoen
cuanto a la excelencia que requiere la sociedad por parte ma. Debo tomar
conscienciademivalornosegnmishazaassexualessinomirandotodaslas
bellascualidadeshumanasqueposeo.Sitengounadificultadenlaprstata,debo
preguntarmesivivodificultadyculpabilidadfrenteamisnietosofrenteamis
propios hijos que, incluso adultos, son an para m, unos pequeines y
frgiles. Tengo miedo de que stos estn en peligro, bien moralmente bien
fsicamente,ysobretodofrenteacualquiersituacinquepuedeestarvinculadacon
la sexualidad y que aparece a mis ojos como sucia o que sale de las normas
habitualesyestablecidasporlasociedad.Sinotengohijosninietos,ladificultad
puedevivirseconunsobrinoounniodelbarrioqueconsiderocomoformando
partedelafamilia.Deboaprenderahacerconfianzayelhechodetenermiedode
quesucedaalgograveoalgndaoalagenteaquienamosloatraemselobjeto
de mi temor. Tengo confianza en que todos estamos guiados y protegidos
interiormente,incluidoslosporquienesmepreocupo.Asevitareldesarrollodel
cncerdelaprstata.
PRSTATA (cada de) (ver tambin: PROLAPSO)
Cuandocaelaprstata,ejerceunagranpresinsobrelavejiga.Indicaque
tengo dificultad en soltar los sentimientos de inutilidad que me he construido
interiormente, la orina representando la liberacin de mis emociones negativas.
267

Reconozco cada vez ms mi vala y s que mi contribucin a la sociedad es


inestimable.
PRSTATA PROSTATITIS (ver tambin: ANEXO III, INFECCIN,
INFLAMACIN)
La prostatitis es la inflamacin de la prstata. Puedo vivir decepcin o
frustracin,bienfrentealoquemiparejaesperademisproezassexuales,bien
frenteammismoporquemeculpopornosermsviril,msexcelente.
Opinoquesoyviejo,intil,acabado.Espuesimportantequeaceptequemi
sexualidadpuedehabercambiadoyevolucionadoconeltiempo,peroquepuede
serigualdeexcitanteycompleta.
PRURITO (ver: PIEL COMEZONES)
PSICOSIS (en general).
La psicosis esunaenfermedadmentalmayor,quetrastornagravementela
existenciapsquicadelapersonaensusrelacionesconsigomismayconelmundo
exterior, conllevando la alteracin de la consciencia de s, de los dems y del
mundoexterior,delaafectividad,delainteligencia,deljuicio,delapersonalidad,
loquesetraducirporuntrastornomarcadodelcomportamientoexterior,yaqueel
sujetovivecomosifueraextraoaestemundo.La paranoia yla esquizofrenia
sonpsicosis.Sipadezcoestaenfermedad,quierohuirdequiensoyyescaparmede
estecuerpoquenoacepto.Mesientotanmalquetengolasensacindeyano
teneridentidad,habindomedejadoinvadirporlagentequemerodea.Tengouna
dbilestimademybuscoportodoslosmediosquemequieranymedediquen
atencin.Lapsicosispuedetambinestarcausadaporunacontecimientoenelcual
vivunimpactoemocionaltangrandequequisecortarmedelarealidad,yaquemi
mental no entiende porqu esto me poda suceder a m!. Y ocult estos
acontecimientos,emocionesenmisubconscienteperoanestnahyprontoo
tardedeberenfrentarmeconellosparaintegrarlosyaprenderlaleccindevida
vinculadaaellos. Al liberar desu crcelmentalestos acontecimientos queme
controlan inconscientemente y que me hacen actuar de modo impulsivo como
podrretomarelplenocontrolsobremividayvivirenpazconmigomismo.La
psicosisinfantil,porsuparte,puederesultardeunarelacinperturbadaentreel
nioysuspadres.Siendonio,puedovivirunrechazovinculadoalarebelin
inconsciente de mi madre o porque estoy sometido a revelaciones sexuales
demasiadoprecocesparaserintegradas,etc.Yo,comonio,meencierroenun
estadodeindiferencia,inerciayestancamientoencuantoamidesarrollomentalo
meencierroenunmundoapartequedejadesercomunicableyquesirvedemedio
de proteccin. Es como si fuera capaz de hallar mi lugar y de asumirme. Me
encierroenunaseparacinprotectorahabiendovividounprofundorechazoouna
268

sequedadafectiva,yteniendolaimpresindenopoderserloquemispadres
quierenquesea,stosestandocontroladosporsusmiedos,susdeseos,sustemores,
susfantasmashacam,suhijo.
PSICOSIS PARANOIA
El comportamiento paranoico puede considerarse como un sndrome que
nace de un sentimiento de inferioridad teniendo el valor de una protesta,
compensacin, revancha o castigo. La paranoia se define como una psicosis
caracterizada por la sobre estima de s, la desconfianza, la susceptibilidad, la
rigidez psquica, la agresividad y que provoca un delirio de persecucin. Sin
embargo, si soy paranoico, sigo conservando mis capacidades intelectuales. La
persona afectada de paranoia, tiene obsesiones, ideas fijas, en las cuales se
concentratodasuatencin.Siestoyafectadode paranoia,mesientovctimade
todo lo que me sucede y estoy constantemente en la defensiva. Mis heridas
emocionales, mi gran sensibilidad, los miedos que me habitan y mis pesares
tambin,particularmentefrenteamisexperienciasquejuzgocomofracasos,alno
haber recibido todo el xito que haba esperado, todo esto me lleva a huir y
cortarmedeunarealidadconlacualmeesdifciltransigir.Debotomarconsciencia
quemispensamientosnegativosobsesivossonnefastosparamyquetengointers
enasumircadavezmsmisresponsabilidadesfrenteamivida,siendocapazde
crearstacomolodeseo.
PSICOSIS ESQUIZOFRENIA
Laesquizofreniaesunmododeescondermeyesconderalosdemsmiautntica
identidad. Frecuentemente el esquizofrnico creci en un marco familiar muy
rgidoenelcualperdisuverdaderaidentidad.Alnosaberyaquiensoy,decido
entoncesvolvermeotro.Esunrechazototal75demiYOSOY.Loquevivoestan
intensoquemi estado esquizofrnicosevuelvesolucindedesesperacin aun
estrsdemasiadogrande;tengolasensacindequenohaysolucinamisituacin,
porlotantominicasuertedesupervivenciaeshuir.Comopersonapadeciendo
esquizofrenia,poseofrecuentementeunintelectomuyfuerteytengonecesidadde
comprender lo que me sucede en vez de aceptarlo simplemente. Como
esquizofrnico,suelovivirenunclimadeamenazayelmiedoseapoderadem.A
veces,ocurretambinquealtenergrandesdonespsquicos,losdesarrollodemodo
exagerado.Vivimostodos esquizofrenia enunporcentajemsomenoselevado.
Enefecto,siregistrunaheridainteriorenmiinfancia(sobretodoentre0y12
aos)bajoformaderechazo,sumisin,ira,incomprensin,abandono,etc.,tendr
tendenciaendesformarlarealidadcuando,enmividadeadulto,unacontecimiento
reactivarestaherida.Escomosidesarrollasemecanismos,avecesinconscientes,
paraimpedirmevolveravivireldoloroelrecuerdodeestedolorquepudevivir
75

haydiferentesgradosdeintensidaddelaenfermedad.

269

anteriormente.Entreestosmecanismosdedefensa,anotemoselhechodecambiar
inmediatamentedetemacuandoseacabadeabordarunasituacinenlaqueme
sentherido;puedoteneruncomportamientoincoherentecuandosetocauntema
como por ejemplo ir a buscar la sal en la nevera, lo cual pasar por ser una
distraccin,etc.Tendraintersenvolveradescubrirelsermaravillosoquesoyy
aaceptarlaresponsabilidaddemivida.
PSICOSOMTICA
PSICOSOMTICA)

(enfermedad)

(ver:

ENFERMEDAD

PSORIASIS (ver: PIEL PSORIASIS)


PUBIANO (velln)
Elvellndelpubisocultaparcialmentelosrganosgenitalesyelpubis.Si
es denso, esto revela un miedo referente a mi sexualidad, algo que quiero
disimular.Alcontrario,unvellnclarooausenterevelaunavulnerabilidadfrente
amividasexualofrenteamisrelacionesconmicnyuge.Merealizoplenamente
enmisexualidadexpresandomismiedosyteniendocadavezmsconfianza.
PUBIS (hueso del ) (ver tambin: ACCIDENTE, HUESO FRACTURAS
[SEAS], TENDONES)
El pubis esunapiezaseaqueformalaparteanteriordelhuesoiliaco,el
hueso ancho y llano que forma la pelvis. Sirve para proteger naturalmente los
rganosgenitales.Variosmsculosdelabdomenydelmusloseinsertaneneste
lugar,yavecessepuedeproducirtendinitisquerepresentaundisgustovinculado
conmisexualidad,yentreloquequieroyloquevivo.Unafracturaaestenivel
implica un miedo mayor o culpabilidad en las acciones que hago, o no hago,
referenteamisexualidad.Puedotenerlasensacindequemiresultadoptimo
deja que desear. Acepto aprender a reconocer mis verdaderas necesidades
sexualesparapermitirmedesarrollarmemsenloquesoy.
PULMONES (en general) (ver tambin: BRONQUIOS)
Esporlaaccindemisdos pulmones quecirculalavidaenm.Sonlos
filtrosdelaireentodomicuerpo.InhalolavidayladevuelvoalUniverso.Unbuen
funcionamientodemis pulmones permiteventilarcadaunademisclulas.Esa
travsdemispulmonescomotomoconscienciadequeYOexisto.Unmalde
existirpuedeporlotantoserreconocidoporellosyestomepermiteventilarestos
sentimientosnegativosquedebopurificarporelamorqueinhalo.

270

PULMONES (dolencias de los ) (ver tambin: ASMA, BRONQUIOS


BRONQUITIS, ESCLEROSIS)
Las afecciones del pulmn tales como neumona, bronquitis, asma,
fibrosis,etc.,sonelsignoquetengounmiedomuyprofundodeahogarmeode
morir.Mesientotanansiosoquemelimitoavivirenunterritoriomuylimitado
queltambinpareceincierto.Puedotenerlasensacindequeperdmiterritorio76
odequeloestoytomando.Silopierdo,escomosimuriese,yanoseranada!
Sientopuesciertadificultadenhallarmilugaryadministrarmisrelacionesconel
mundo que me rodea. Los pulmones sirven a mi respiracin, y un mal
funcionamientodestostraeunadificultadenloqueserefierealatransferenciade
oxgenodelairehacalasangre,funcinvitalparamisupervivencia.Estemal
funcionamientosloponedemanifiestoestamuertequemeasustayquedebo
amansar.Sitengoundolorounadificultadrespiratoria,debopreguntarmesitengo
lasensacindesentirmeahogadouoprimidoenmivida.Tengolasensacinde
que me falta el aire, sobre todo en mis relaciones con los miembros de mi
familia?Mesientolimitadootengolasensacindequenomemerezcoserfeliz?
Mesientotristeydeprimidoydeboaprenderareconocermivalorpersonalya
hacer las cosas que me gustan. En ves de tener gusto en entretener viejos
recuerdos que me hacen melanclico y que pueden ampliar mi sentimiento de
soledad y aislamiento, tengo inters en mirar todo lo que tengo y toda la
abundancia presente en mi vida. Tomo consciencia que soy constantemente
protegidoyguiado.Tengoelderechodetenerunterritorio,unlugarbienmoque
meespersonalyquenoperteneceanadiems,igualcomolosdemstienencada
unosuterritorio.Esascomopuedeexistirlaarmonayquepuedodesarrollarme
plenamente.Vuelvoatomarelpoderquemeperteneceyrespirolavidacon
todosmispulmones!
PULMONES (cncer de los ) (ver: CANCER DE LOS PULMONES)
PULMONES ENFISEMA PULMONAR
Cuando an soy feto y cuando se forman mis pulmones, esto indica mi
compromiso a estar aqu, mi acuerdo a decir s, esto hacindose merced a mi
respiracin.Sitengomiedodelavidaosiquieroquealguienmssecuidedemi
propia vida, mis pulmones podrn conocer algunas dificultades. Respirando
superficialmente,meprotejocontraelhechodetenerquetratarconlarealidad.
Vivo ansiedad y tengo miedo porque me siento amenazado. Mis pulmones se
dilatanysecontraenyestocorrespondeamicapacidadparaampliar,compartir,
entrarenlavidaoparacontraerme,aislarme,retirarmedelavida.Estarafectadode
unenfisemapulmonarsignificaquetengodificultadenrespiraryquemesiento
oprimidoporelesfuerzo.Graciasalarespiracin,aspirolavidaenm.Porqu
76

Miterritorio:Micnyuge,mifamilia,misamigos,mitrabajo,micasa,misideas,etc.

271

tengodificultadentomarlavida?Esmimododehuirlavida?Yanomeinteresa
lavida,yanotengoningn inters?Tengograndesmiedosyunodeellos,es
afirmarmeytomarmilugar.Porqulavidaperditodosusentidoparam?Me
sientoarrinconado.Noheaprendidoaseryomismoyatomarellugarqueme
corresponde;vivoenfuncindelosdems.Misfrustracionesymidisgustome
ahogan.Tengolasensacindequenomemerezcovivir.Tomoconscienciadeque
cada cual tiene su lugar y que debo tomar el mo. Acepto amarme ms,
afirmarmeyexpresarmisnecesidades,enunapalabra,serYO.Laopresinque
sentaestsustituidaporelsuministrodeaireydevidaenmispulmones.Veootra
veztodaslasposibilidadesquemeofrecelavida.Vuelvoasaborearlafelicidad.
PULMONES PULMONA Y PLEURESIA
Lapulmonaeslainfeccindelpulmnprovocadaporunabacteriaoporun
virus,mientrasquela pleuresa eslainflamacinagudaocrnicadelapleura,
membrana que envuelve los pulmones. Los pulmones siendo el rgano de la
respiracinendondesehace,endondeseproducelatransformacindemiaire
paratodomicuerpo,vivopuesunconflictointeriorquemedebilitagravemente.
Por lo tanto debo hallar la emocin o el sentimiento que irrita y limita el
funcionamientodemirelacinconelairedemividainterior,porqueesteoestos
bloqueosimpidenmiserdevivirplenamente.Estossentimientosprofundamente
anclados en el interior de mi ser, representados por la inflamacin, pueden
sealarmequeestoyprofundamenteimpactado,irritado.Mihabilidadpara
respirarestsiendomuyafectadapormisemociones,mimiedodeestarsoloode
estar agobiado, por mi rebelin frente a la vida. Tengo la sensacin de estar
enredadoenmisrelacionespersonales.Puedosentirmeahogadoportodasmis
responsabilidades y no s cmo salirme. El desanimo y la desesperacin me
invaden,alpuntodequemepreguntoculeselsentidodelavidaysivaleel
esfuerzodeservivida.Necesitotomartiempoparamyhacerlimpiezaenmi
vida.Sloguardolasresponsabilidadesquemeincumbenydevuelvoaquienle
pertenecelasqueasumenmishombrosyquenomepertenecen.Aslavidaser
msfcilymsbella.
QUEMADURAS (ver tambin: ACCIDENTE, PIEL [en general])
Laquemadura,pordiferentesfuentesfsicas(calor,fro,etc.),provocauna
lesindelapiel.Lapielesellmiteentreelinterioryelexterior,lafronteraentre
miuniversointerioryelmundoalrededordem.Hayalgoquemequemaenel
interior:unprofundodolor,emocionesprofundasyviolentasinhibidas(ira,pena,
desesperanza)detalmodoquegirotodoestocontrambajoformadeculpabilidad
ydeautocastigo(quemadura).Unaquemadurapuedeimplicarvariosniveles
del cuerpo(carne,tejidoblando,lquidos delcuerpo,aveces loshuesos). Una
quemadura emocionalomentalsemanifiestafsicamentedeunmodomuy
272

fuerteyagresivo.Compruebolapartedelcuerpoquemada.Paralas manos,es
probablementeporquemesientomuyculpablederealizaralgoqueestvinculado
con una situacin en el presente. Para los pies, se refieren al porvenir y la
orientacin prxima de mis acciones. Puede que viva un miedo a conocer una
nuevapersona ounanuevasituacinporqueestoy consumido por eldeseo de
conoceraestapersonaoestasituacin.Quizstemaquemisproyectossevayanen
humo.Tambinpuedotenerun deseoardiente dehallarmeconunapersonaa
quienamo.Tambinpuedocomprobareltipode quemadura:loslquidos(agua
hirviente,gas)puedenestarvinculadosconuna reaccinemocionalviolenta en
cambiounaquemaduraconunasustanciamsslida(brasa,metales,etc.)implica
ms una quemadura (combustin) en los planos mental o espiritual. Existen
diferentestiposde quemaduras queseclasificanenfuncindesuprofundidad.
As,todoloquehasidodichoanteriormenteesvlidoparaloquesigueconmso
menosintensidad,segnlaprofundidaddelaquemadura.As,lasquemadurasde
primergrado quetocanlapartesuperficialdelapieltalcomounainsolacin,
puedenimplicarlacontrariedadenlassituacionesdemivida.Lasde segundo
gradoserefierenmsaunapenarelacionadaconunoodiversosaspectosdemi
vidaquejuzgoimportante.Lasquemadurasdetercergrado,queafectanlapielen
todasuprofundidad,puedenatacarunmsculo,untendnounrgano.Dichas
quemadurascorrespondenaunairayunaagresividadintensasqueperforanmis
proteccionesnaturalestantofsicascomopsquicas.Nosepuedevolverfsicamente
atrsenloscasosdequemadurasgraves.Sinembargo,todaslascalidadesdivinas
(amor, ternura, respeto, etc.) pueden manifestarse para permitirme integrar la
experienciadeuna quemadura importante.Envezdesloverlasdificultadesy
losproblemasenmivida,acepto verahoraelamorencadasituacindemi
vida.Elamorestportodaspartesyquedoabiertoalsacarlasleccionesdelas
experienciasquevivo.Eselprocesonormaldeintegracinenelniveldelcorazn.
QUERATITIS (ver: OJOS QUERATITIS)
QUISTE (ver tambin: OVARIOS (dolores de los], TUMOR[ES])
Unquisteseformacuandoentretengoremordimientosfrenteaunasituacin
pasada, cuando guardo en m pena, afliccin, dolores; tambin pueden ser
remordimientos frente a un proyecto, a un deseo que no pude realizar. Me
hinch,acumulinformaciones,datosdetodotipoparaunproyectoquejams
pude llevar a cabo: se volvieron presos de mi cuerpo y de mi mente. Es una
negacindelperdn.Meperdono,meamo.Megirohacaelporvenir,estoyen
paz.El quiste puedecorrespondertambinalasolidificacindeactitudesyde
patternsmentalesqueseacumularoninconscientementeduranteciertoperodode
tiempo.stospuedenservirmedebarreradeproteccin,mantenindomeapresado
273

dentrodeunmarcobiendelimitadoyevitndomeenfrentarmeconciertaspersonas
ociertassituaciones.Estotambinmehacefrenarymeimpideirhacadelante
porquetengodificultadenabrirmeaotrasopinionesoaotrosmodosdepensar.Mi
ego puede estar profundamente herido y mi rencor se solidifica para hacer un
quiste. Acepto dejar circular la energa libremente a travs mo y tengo
confianzaenelhechodeponerpordelantemisproyectosypidoverlassoluciones
paraquetodofluyamejorenmivida.
RABIA
Larabiaesunaenfermedadepidmicaqueafectaciertosmamferos(zorro,
gato, perro, etc.) los cuales la transmiten al ser humano, generalmente por
mordedura.Eltemormrbidoalaguaohidrofobiaesunodelosprimerossignos
delarabia,igualcomoelmiedoalosmovimientosdelairequeeslaaerofobia.Si
tengolarabia,haymuchasprobabilidadesdequeestllenoderabiaydeira,
stas siendo dirigidas frente a m mismo o a una persona o situacin. Tomo
conscienciadequehayotrasmaneras,ademsdelafuerzaylaviolencia,para
arreglarmisdiferenciasymisdesacuerdos.Aprendoacomunicarcalmamentemis
necesidades,missentimientosmientrasmerespetoyrespetoalaotrapersona.
RAMPA(S) (en general)
Una rampa es la contraccin involuntaria, dolorosa y pasajera de un
msculoodeungrupomuscular.Lasrampasindicanunagrantensininterior(a
vecesexcesiva).Retengolaenergadivinaeimpidoquecirculeenmporqueestoy
arrinconado,limitado.Ciertosdemispatternsmentalesnecesitanintegrarsemejor.
Actualmente,vivomuchapresinytensinquepuedenestaracompaadasporun
sentimientodeimpotenciafrenteaalgooaunasituacin.Mepreguntoquhacery
culeslamejorsolucinparam.Tengomiedoymeagarro,mesujetoaideas
fijas.Aprehendolavidadesdeelpuntoenquebloqueoradicalmente(cierrocon
cerrojo)laenergaenunlugarpreciso.Segnellugardela rampa,tengoun
indiciodeloquedebocambiar:unarampaenelpie,ladireccinquetomo;una
rampaenlapierna,mimododeandarporlavida,una rampaenlamano,mis
accionesymisempresas.Estoyconscientedelosdoloresinterioresquemeasedian
ycomprendoquepuedocambiaresto.Acepto soltaryquedarmeabiertoala
energadivina.Tomoeltiempodepararmeyreflexionar.Esteinstantedepausame
permitevolverainiciarmsdespacioydeunmododiferente,deestarmejorenmi
piel.
RAMPAS ABDOMINALES (ver tambin: VIENTRE)
Elabdomenestvinculadoalchakradelaintuicinydelacreatividad.As,
la rampa abdominal indica el miedo a seguir mi intuicin, mi negacin de
dejarmeplenamenteiramicreatividad,bloqueandolaenergadivinaenestelugar,
274

esdecircercaomsabajoqueelombligo.As,parocualquierprocesoquemedeje
verloquemepuedeayudaraprogresarnormalmente.Tengomiedodedescubrirel
futurosiempreprovechosoparam.Acepto abrirmeyhacerconfianzaenla
vida.Deestemodo,puedodejarmeguiarmejorpormiintuicinypuedoutilizarmi
creatividadparairenladireccinquemeconviene,enarmonaconloquesoy.
RAMPA DEL ESCRITOR (ver tambin: DEDOS [en general], MANOS [en
general], MUECA)
Eslasensacindetenerlosdedosadormecidosounhormigueoenlosdedos,
causadaporlacompresindenerviomedianoenelcanalcarpiano,situadoenla
zonaanteriordelamueca.Estoyhabitadoporunagrantensininteriorycuando
escribo,pongomuchoesfuerzo.Aquinquieroimpresionar?Aquinquieroyo
convencer?Amoalosdems?Soypretenciosoymisideasdegrandezahacende
m una persona demasiado ambiciosa. Es posible que lleve una mscara,
escondiendoasmipersonalidadreal,loquemeprotegecontraeljuiciodelagente.
Eldolorpuedemanifestarsemsdenocheoporlamaanaaldespertar,cuandoan
estoyconectadoalosmundosinterioresyestedolormerecuerdalosreajustesque
deborealizarenmiinteriorparasermsflexible.Apartirdeahora,hagolascosas
naturalmente, tomandoel tiempodeser verdaderamenteyomismo.Nodebo
probarnadaanadie.Aceptoamarmetalcomosoy,sinartficesyquedndome
totalmentelibreenmisactitudes.Eselprimerpasohacaunagranrealizacin,la
Realizacindes.
RAMPAS MUSCULARES (en general)
Larampadeorigenmuscularindicaqueretengoalgoquenoquierosoltar.
Esunagran tensininterior queseexpresaporunbloqueodeenergaalnivel
muscular.Elmsculorepresentalaenerga,lavidaylafuerza.As,bloqueola
vidasinsoltarestasviejasideasquecambianyquesetransformanenelcuerpoen
evolucin.Tengoanviejosprincipiospreconcebidosylosplasmoenmisacciones
decadada.Esimportantecomprobarculpartedelcuerpoestafectadaporlas
rampas.Aprendoyaahoraasoltarmeaniveldelcorazn,aabrirmemsalas
nuevas posibilidades susceptibles de hacerme progresar. No puedo cambiar el
pasadoperosoyconscientedelasbellezaspresentes.Lameditacinyunatcnica
de recuperacin del equilibrio energtico ayudan a dejar ir estas tensiones
superfluasyaarmonizarmejormiscuerposenergticos.
RAQUITISMO
Elraquitismoesunaenfermedaddelcrecimientoqueafectaelesqueletoy
causada por un defecto de mineralizacin sea (trastorno del metabolismo del
fsforo y del calcio) por carencia de vitamina D. Si estoy afectado de esta
275

enfermedad,lamalanutricinquevivoenelplanofsicoevidencialaquetengola
sensacindevivirdesdeunpuntodevistapersonalyafectivo.Vivounvacoouna
faltadeternura,amor.Puedotenerlasensacindequeestoysoloenelmundoy
quenadiemeentiende.Porlotantonotengoelsostnquenecesitoymesiento
vulnerable.Estaenfermedadmeafectasobretodoalsernio.Deborecordarmeque
constantementeestoyprotegidoyqueelamoruniversalesomnipresente.Hede
aceptaresteamorydejarquemealimenteparaahuyentaralaenfermedadque
entonces ya no tendr necesidad de ser, porque habr comprendido que debo
primerodarmeamorantesdepoderdarloalosdems.
RASGOS CADOS, BLANDOS.
Misrasgosestncados,blandoscuandotengoelsentimientoquetodoyquetoda
lagentemedejacaer.Mipielsevuelvefofa,sinvida.Misprpadoscados
revelanlatristezademisojos.Medejoir.Culpolavida.Carezcodefirmezaen
misdecisiones.Tengonecesidaddelevantarlamoral,recobrarelgustoalavida.
Medoyelpermisodedisfrutardecadainstantedemivida,dejositioalnioque
estenm.
RAYNAUD (enfermedad de)
La enfermedad de Raynaud est caracterizada por una circulacin
constrictiva,brutalydolorosadelaspequeasarteriasdelasmanos,lospies,las
orejas,lanarizylospies,perosobretodolosdedos,creandopalidez,miembros
dormidosquepuedenvolverseazulesoprpura.Lasangrenocirculabienenlas
extremidades.Lasemocionesquedeberancircularenlasangreestnestancadas.
Cuandoestafectadounoovariosdemisdedospuedointentarhallarelsignificado
delodelosdedosencuestin,locualmealumbrarmssobreelaspectodemi
vida referido. Los miembros afectados se sienten abandonados y viven un
sentimientodeprdida.Entoncesdebopreguntarmelosiguiente:enmivida,estoy
yoviviendounrechazo?Tengomiedodeexpresarmeydetomarmilugar?Acab
conunarelacinamorosaalacualmesigoenganchando?Enciertamedida,estoy
cortadodelUniversoquemerodeaynecesitohallarmilugarytengonecesidadde
reintegrar este Universo en el cual juego un papel importante. Si voy a su
encuentro, mis extremidades estarn otra vez alimentadas de amor y de
comprensin.
RAZN (TENGO )
Si manifiesto una actitud de tengo

razn constantemente, debo


preguntarme:Porquestoycerradoalaopinindelosdems?Deququiero
protegerme? Debo tomar consciencia de que la gente de mi entorno puede
mantener la calma conmigo, guardar sus distancias, cuidar de no herirme e ir
incluso hasta pensar que ESTOY ENFERMO. Tomo consciencia de que
escuchandoalosdems,dndomelaoportunidaddecambiardeopinin,aceptando
276

quelosdemspuedantambinteneropinionesvlidas,aumentomigradodeamor,
apertura,libertadenelrespetomutuoylocomparto.
RECTO (ver: INTESTINOS RECTO)
RENCOR
Si vivo rencor frente a una persona o frente a una situacin, siento un
profundoresentimientoytengoganasdevengarme.Inclusovoyacultivarestos
sentimientos negativos, percibindome como la persona que estuvo oprimida,
herida y quees una vctima. Tengo inters enaceptar con micorazn los
acontecimientosyagirarmehacaelfuturoenvezderumiarelpasadosincesar;
sino,micoraznseendurecerymicuerporeaccionarconunadolenciaouna
enfermedad.
RESFRIADO
Elresfriadoesunaafeccinqueprovocatosyprdidasnasales.Datambin
agujetas,cansancio;lanarizseobstruye.Esmuyfrecuenteycontagiosa.Yaqueun
germenounvirusestafectandomiorganismo,estorevelaunfallodemisistema
inmunitario.Estopuedeprocederdelaconfusindemispensamientos,delhecho
que ya no s por donde empezar. Entonces me pregunto cmo hacer. El
resfriadomeaportaentoncesuntiempoderespiroenelcualpuedoprotegerme
de la gente durante cierto tiempo y conservar mis distancias. Ya que hay
liberacindesecreciones,vivoprobablementeunasituacinemocionalparticular
quemeafectayfrentealacualvivollenodeemocionesquesloquierenser
liberadas.Hayalgosobrelocualrealmentequierollorarsinadmitirlo?Yaquemi
narizestobstruida,hayunapersonaounasituacinquemehuelemalyque
quieroevitaroler?El resfriado puedeafectartantoelpecho(elcuerpo)comola
cabeza(mente)ypuedequehayaundesequilibrioporquepongotodamiatencin
enelunoignorandoelotro.Necesitountiempodepausaparapermitirmeverclaro
en mi vida. Necesito recuperar fuerzas. Adopto nuevas actitudes y nuevos
comportamientos.Hagolalimpiezaenmividaydejodedejarmeinfluenciarpor
las creencias populares (el resfriado golpea fuerte este invierno! o siempre
tengo un resfriado cuando llega el mes de diciembre). La armona as puede
instalarseymevuelvodueodemivida.
RESPIRACIN (en general)
Larespiracinesunafuncinquepresidealosintercambiosgaseososentre
yocomoservivoyelmedioexterior.Setratapuesdeunavadeaccesoparala
vidaparaquepenetreenelinteriordem.Sipuedorespirarprofundamente,esto
representamidestrezaendarvidayfuerzaamisemociones.Una respiracin
superficial me indica un miedo o una resistencia con relacin a la vida,
277

particularmente en momentos de destreza o de pnico y me indica que tengo


tendenciaareprimirmisemociones.Vivomividadelmodoenquerespiro,locual
puedeserunmodosuperficial,privadodesentidoobienquepuedoviviralritmo
delasestaciones.Elritmoentretomar(inspirar)ydar(expirar)seharen
armona;lasvasdecomunicacinentreyoyelmundoexteriorestarnabiertasy
libres.
RESPIRACIN (dolores de) (ver tambin: ASMA, GARGANTA [dolores
de], PULMONES [dolores de])
Misdificultadesenelplanorespiratoriodenotanunconflictoentreellugar
queocupoenlavidayel quemegustaraocupar.Estopuedesertambinun
conflictoentremisdeseosmaterialesyespiritualesoentoncesunconflictoentremi
deseodeviviryeldedejarlotodo.Puedosentirmeahogadoporlascosasqueme
obligoahaceroporlaspersonasquemesientoobligadoaencontrar.Ademssi
mis dificultades respiratorias son cclicas, debo preguntarme cul es el
acontecimientooculeslapersonaqueactivastas;quesloquemecortael
aliento a menos de que desee que me dejen respirar? Puedo volverme tan
exasperado que mis problemas respiratorios podrn volverse, frecuentemente
inconscientemente, un modo de manipular mi entorno para tener lo que deseo.
Puedosentirmelimitado.Astendrdificultadenrespirarsidudoendar,compartir
cosasosentimientos.Tengomiedodetomar,absorberofusionarenmnuevas
cosasoquizslamismavidacontodaslasalegrasquepuedetraer.Deboaprender
adejarirlasresistencias,adejarfluiryaabandonarmehaciendoconfianzaala
vida. Entonces estar ms en condiciones de hallar el lugar que tengo en el
Universo.
RESPIRACIN ASFIXIA (ver tambin: ASMA , RESPIRACIN [dolores
de])
La asfixia es un trastorno respiratorio manifestado por el paro de la
respiracinolaobstruccin(conscienteono)delasvasquetraenoxgenoalos
pulmones y que permiten la respiracin. Este estado muy espontneo est
vinculadoaunadesconfianzafrentealavida,asudesarrolloyfrenteaciertos
miedosprofundosmanifestadosdurantelainfancia.Esteestadopuedeprocederde
lainseguridadenquedarsearrinconadoofijadocomosimesintierafijofixo
(as fix ia) en una situacin en que me ahogo como si fuera incapaz de
moverme.Inclusoesposiblequelaasfixiaestvinculadaaunafijacinmental
conrelacinalasexualidad,porqueenestadode asfixia,frecuentementeesla
gargantalaquemanifiestaelbloqueo;estvinculadaalaexpresindes,ala
creatividad y a la sexualidad. Ahora estoy preparado para ver otra cosa, para
moverme,paradejardeestarfijadoytenerconfianzaenlavida!Debotomarmis
278

responsabilidades y cesar de poner una atencin fija en las frustraciones de la


infancia.Sonpresentesyhagolonecesarioparaintegrarlas.
RESPIRACIN AHOGOS
El ahogo indica que me siento pillado, que me falta aire y espacio. La
gargantacorrespondealcentrodeenergavinculadoalaverdad,alaexpresinde
s,alacreatividadeindirectamentealasexualidad.Puedosentirmecogidoala
garganta;unaideapasdetravs;mesientoaltamentecriticado.Reprimtanto
misemocionesquehayunexceso.Sinembargoestasemocionessonmuypresentes
enmividadiariae,inconscientemente,lasalimentohastaqueme ahoguen.Es
posiblequeciertassituacionesestntandifcilesdetragarquemeahogantambin.
Porqu tengo tanto miedo de ser yo y de expresarme? Sera por miedo del
rechazoporquecreoquenopuedoseramadosiendoyo?Deboabsolutamentesoltar
yaceptardejarsubirenmtodoloqueestdentro.Lasolucinesaprendera
comunicaryexpresarmisnecesidades.Cuantoaliviosientoya!Ycomprendoque
losdemsnosonadivinosyquenuestrasnecesidadesrespectivassiemprepueden
estarsatisfechasenelrespetodelotroyenlaarmona.
RESPIRACIN TRAQUEITIS
Tambinconocidabajoelnombredebronquitisaguda,la traqueitis es
unainflamacindelatraquea,esteconductopordondepasaelairedelalaringe,de
losbronquiosydelosbronquiolos.Misvasrespiratoriasasafectadasdemuestran
quemesientoahogado.Elaireeslavida,sientounagrantristezayfrecuentemente
ira.Mesientoincomprendidopormientorno,locualmellevaprogresivamentea
unestadodepresivo.Micuerpomedicederespirarlibrementeydedejarsitiopara
elamor.
RETENCIN DEL AGUA (ver tambin: HINCHAZN, EDEMA)
La retencin del agua frecuentemente est causada por un mal
funcionamientodelosriones.Micuerpohacereservasyestoponealaluzel
hechoquepuedaalmacenarcosasoemocionesporquetengohorrordeperderalgo
oaalguien.Tengotendenciatambinacriticarme,oacriticaralosdems.Esto
derivaobiendemidificultadenafirmarmeo,alcontrario,demiegoqueesalgo
demasiado grande y que me hace tomar mi lugar as como el de los dems.
Escondoas misangustias. Mirelacinfrentealaautoridadsertambinmuy
catica porque frecuentemente me siento vctima de injusticia. Debo tomar la
responsabilidaddemividayaprendermselrespetoylahumildad.Aprendoa
tomarellugarquemecorrespondeporderechodivino,sabiendoconconfianzaque
todoesdisponible,siempreycuandohagalapeticin.

279

RETINITIS PIGMENTARIA (ver: OJOS RETINITIS PIGMENTARIA)


RETINOPATIA PIGMENTARIA (ver: OJOS RETINITIS PIGMENTARIA)
REUMA (ver tambin: ARTRITIS REUMATISMAL , ARTICULACIONES,
INFLAMACIONES)
Lareumasedefineporunaafeccindolorosaagudaygeneralmentecrnica
quemolestaelbuenfuncionamientodelaparatolocomotor.Tendrrigidezenlas
articulaciones, esto haciendo los movimientos ms difciles. Esto manifiesta mi
rigidez, mi inflexibilidad y mi obstinacin frente a ciertas personas o ciertas
situaciones.Temoquemehieran,porlotantovoyaensearunaimagendiciendo
queestoyencimadetodo,quetodovabienaunqueenmiinterior,noesel
caso.Enmimundomo,meconsiderarcomolavctimadelasinjusticiasqueme
suceden.Pensarsinpararenmispequeasdesgracias,estollevandoacrtica,
bienhacammismoohacalosdems.Nomedoyningunaprobabilidad;soy
exigente y me parece que la vida que pruebo tiene un sabor amargo. Debo
preguntarme si estoy atormentado con relacin a una situacin en la cual vivo
ambigedad;Lohagoono?Lopegoonolopego?,etc.Vivounconflicto
deseparacinenmiinteriorenelcual,porejemplo,decaraaminio,quieroestar
cercadel,peronopuedo.Sipeguaminioyluegomesabemal,haymuchas
probabilidadesparaquelamanoqueefectuelgestoestafectadaporlareuma.Mi
estimapropiaestpuesensumsbajonivelporquemedesvalorizosincesar.Estoy
preocupadoporlosdems,sobretodocuandosetratademishijos.Meapoyoen
ellosporquefrecuentementesonmirazndeviviryelmotivoquemehaceandar.
Siestnheridos,sicaen,tengomiedodequenopuedanlevantarseymepregunto:
Qumshubiesetenidoquehacer,odequotraforma?Laculpabilidadyla
responsabilidadsongrandesyladesvalorizacintambin.Tomoconscienciademi
grannecesidaddeamor.Aprendoatenercuidadodemyaasumirmisemociones,
porquetodassonpositivasymepermitenconocermemejor.Mepongoalvolante
demividay,devctimaqueera,pasoasercreadordemivida.Squetodoes
posible.Bastacontenerpacienciayaceptar andaralpropioritmoevitando
ponermeentensinoapresurarme.
RIGIDEZ (articular, muscular)
Larigidezmuscularcausadaporlaacumulacindecidolcticoimplicaun
cmulo de energa mental rgida y bloqueada. Manifiesto as esquemas de
pensamientos rgidos y testarudez, as como un rechazo o una incapacidad en
rendirme.Resistoalmovimiento.Estopuedesertambindecaraalaautoridad.
Debocomprobarmisactitudesmentalesenrelacinconlapartedelcuerpoque
conocelarigidez.Sisonlasarticulacionesquesonrgidas,bienalniveldemis
miembrosobienalniveldemicolumnavertebral,hayunaresistenciaprofunda
280

manifestadaporelhueso,demostrandounarigidezprofundayunrechazodeir
hacadelante.
RINO FARINGITIS (ver: GARGANTA FARINGITIS)
RIONES (problemas renales) (ver tambin: CLCULOS [en general]
/RENALES, MIEDO)
Los rionesmantienenelequilibriodelmediointeriorlimpiandolasangre
de sustancias txicas y compensando las entradas en el medio interior por
salidas (secreciones de orina). Participan tambin en el control de la presin
arterial.Ensentidofigurado,yaquelosrioneslimpianelcuerpoderesiduos,es
como si limpiasen mi cuerpo de ideas negativas que le habitan. Un mal
funcionamiento de mis riones denota una retencin de mis viejos patterns
emotivosobienunaretencindeciertasemocionesnegativasqueslopidenser
liberadas. Se manifiestan frecuentemente por piedras en los riones, tambin
llamados clculosrenales.Constantemente estoyhaciendoclculos (renales!)
parasaberloquemeperteneceoloquecorroelriesgodeperder.Quieroimponer
mislmitesymisfronterasparanoperderniuncentmetro.Los
riones

tambin
se conocen como la sede del miedo. Cuando se debilitan o cuando estn
lastimados,puedeexistirunmiedoquenoquieroexpresaroqueincluso,quizsno
puedaconfesarmeammismo.Midiscernimientoasestafectado.Porlotanto
tendr tendencia a vivir extremos, o bien me vuelvo muy autoritario, con una
tendencia pronunciada para la crtica, o al revs, me vuelvo sumiso, indeciso,
sintindomeimpotenteyviviendodecepcionestrasdecepciones.Lavidaparames
injusta.Tendrdificultadentomardecisiones.Simis riones dejandefiltrar
sangre,escomosimicuerpoquisieraguardarlomstiempoposibleestelquido
paranoperderloopormiedoacarecerdel.Debopuespreguntarmeculsituacin
podrahaberprovocadounmiedoasociadoaunlquido(porejemplo:,siyatuve
miedodeahogarme,ellquidoaquseraelagua).Estopuedesertambinelhecho
dehaberestadoapuntodeabsorberunlquidotxico.Lostuboscolectoresdelos
rionesestarnafectadossitengolasensacindedeberlucharparamiexistencia.
Mesientoprivadodemisposesiones,abatido,despusdeunsucesoquemarcami
vida. Los problemas de riones frecuentemente se producen despus de un
accidenteodeunasituacintraumatizanteenquetuvemiedodemorir.Tengola
sensacindesloestarfrenteanada,lanada.Tengolasensacindehaberlo
perdidotodo,quetodomimundosederrumba.Tengomiedodeserincapazde
afrontarlavida.Losrionessimbolizantambinlacolaboracin(yaquehaydosy
que deben trabajar en estrecha colaboracin). Debo preguntarme cmo es mi
relacinconmiparejaactualmente.Lehagoresponsable detodosmismales?
Tengotendenciaavertermisresiduossobrelosdemsydeenvenenarsuvida
conmisproblemas?Sieselcaso,misrionestendrndificultadenfuncionare
281

inclusopodrtener insuficienciarenal.Entoncesdebocolaborarsinquetenga
eleccin,aunamquina,elgeneradordehemodilisis,quemeayudaralimpiar
misangre.Debovolverapensartodomisistemaderelacinconmientorno.Es
tiempodequemeasuma,queaprendaadescubrirmisverdaderasnecesidades.
Tomolaresponsabilidaddemividaydejodeculparalosdems.Soycapazde
asumir mis elecciones. Mi discernimiento ser seguro y preciso. Colaborar al
100%conlavidayentoncestendrnecesidaddeunosrionesslidos.
RIONES ANURIA (ver tambin: RIONES [problemas renales])
Laanuriaeselparodelaproduccindeorinaporlosriones.Sipadezco
anuria,puedosentirmedesnudo(nudo)ysinproteccinfrentealavida,mi
riesgodepasarmiedoaumentamsquedecostumbre(rin=sededelmiedo)y
tengotendenciaaagarrarmeamisviejascreencias.Adems,laorinarepresenta
viejas emociones que han de eliminarse del cuerpo. Si me agarro a mis viejas
posesiones, amiscreencias, amistemores,amisdudasoamismanas[muy
poderosasenelplanometafsico),manifiesto anuria, esdecirlasupresindela
secrecin urinaria ( se dice comnmente: los riones estn bloqueados). La
angustiapuedesertangrandequeescomosidebieraretenerme,portemora
dejar ir mis emociones de pena que frecuentemente estn representadas por el
lquidoquesetienequedejarfluir.Laintensidaddeesteparo(unparocompleto
significalamuerte)medarunabuenaindicacinsobreloviejoquedebosoltar
para abrirme a nuevos pensamientos. Hago limpieza y me libero de cualquier
emocin,relacinquenomeesbenfica,ylassustituyoporalgonuevo,positivo.
Tengoconfianzaenlavidaquesecuidadesuministrarmetodoloquenecesito.
RIONES NEFRITIS (ver tambin: IRA, INFLAMACIN, MIEDO)
Eltrminonefritisdesignademodogeneralelconjuntodeenfermedadesde
los riones. Sin embargo, se usa tambin este trmino para designar una
inflamacindelosriones.Estocorrespondealmiedoygrandesangustiasfrentea
la vida. Son frustraciones o decepciones que no han sido canalizadas sino
reprimidas en el fondo de m. Me vuelvo exageradamente en reaccin o
sobreexcitadofrenteaalgoquemepreocupayfrentealocualpuedosentirme
impotente,sinsaberquleccindevidahedesacar.Deboconfiarenlavida.
RIONES (dolor de cintura) (lumbago) (ver: ESPALDA (dolores de]
PARTE INFERIOR DE LA ESPALDA)
RODILLAS (en general) (ver tambin: PIERNAS)
Lasrodillassonlasarticulacionesenlascualesmearrodillo,meabandonoa
lajerarquanormaloaloqueestencimamoytambinalmovimientoyala
direccin que tienen lugar. Las rodillas manifiestan por lo tanto mi grado de
282

flexibilidadysirvenparaamortiguarlosgolpescuandolapresinesdemasiado
alta.Estnafectadoscuandomedesvalorizoconrelacinamifsicoomismarcas
deportivas.Sitengodificultadendoblarlas rodillas,demuestroconestocierta
rigidez.Puedeserporquemiegoesmuyfuerteyorgulloso.Unarodillaquedobla
fcilmenteesunsignodehumildadyflexibilidad.Lasrodillassonnecesariaspara
mantenermiposicinsocialymiestatuto.
RODILLAS (dolores de)
Si tengo problemas en las rodillas, debo interrogarme para saber si soy
testarudo, rgido, orgulloso. Si mis rodillas ya no responden, vivo quizs un
conflictoconlaautoridad(mijefe,mispadres,etc.)?Tengomiedodetomarcierta
accinparairhacadelante?Tengoyolasensacindequedebodoblarencierta
situacinodebadoblarmedelantedealguienoalgo?Sitengofluidosalnivelde
las rodillas( me inhibo emocionalmente contra el flujo natural de los
acontecimientos(resistenciaalmovimiento).Simis rodillas estnlastimadas,se
puede tratar de arrogancia, testarudez o una resistencia que hace quecualquier
progresoyavanceseargidoodoloroso.Tambinpuedequemedesvalorice,me
disminuya frente a mi fsico o mis marcas deportivas y entonces, hay muchas
probabilidadesdequemehagadaoalasrodillas.Lainflamacinoeldolorpuede
indicarunarigidezfrentealaautoridadoelsistemadeleyesvigentes.Puedotener
frecuentemente la sensacin que debo obedecer (ej.: delante de un padre, un
profesor,jefe,inclusoelcnyuge,etc.)yestonomeapeteceenabsoluto!Puede
quevivaunconflictomental,unaobstinacinegostaanodejarfluiroadarme.
Losdaosseosodelostejidosblandossevinculanconunprofundoconflicto
interioreimplicanelabandono,aunnivelmsprofundo,elabandonodemiegoy
demiorgullo.Poresto,siquieroeliminarlasdolenciasqueafectanmirodilla,debo
aceptar abrirmealmundoquemerodeayaceptar quepuedatenerque
cambiarmimododeserenciertosaspectos.Enelcasodelhigromaqueafectaen
particularalasmonjasymonjes,debopreguntarmeculeselconflictoquevivo
paraconmiespiritualidadylasimplicacionesqueconllevaenmivida.Eldolorque
sientocadavezquemepongoderodillas(pararezarporejemplo)merecuerdami
conflictointeriorylanecesidaddedecidirpormmismoloquequieroenmivida
y hacer los cambios apropiados. Acepto arrodillarme delante de alguien o una
situacin,oquizssimplemente,delantedelavidaengeneral,parapoderrecibir
ayuda y abrirme a una nueva realidad que no poda ver antes ya que estaba
encarceladoenmipropiouniverso.Ytengotodoelpotencialnecesarioparaaceptar
nuevasresponsabilidades.Sivivofrustracinyculpabilidadporquemedoy
cuentaquesiemprequierotenerraznyquemideseodepotenciasocialsuperiores
insaciable,meparoymecuestionosobremisverdaderosvaloresparavolveralo
esencialyparapermitirvolveramicoraznenvezdedejartodaslasdecisionesa
miladoracional.
283

RONQUERA (ver tambin: AFONA)


Cuandomitimbredevozsevuelvesordo,roncoocascada,escuandotengo
lavozenronquecida.El enronquecimientosignificaquepadezcodeagotamiento
mentalyfsico.Algoimpidequemisruedasgirensintropiezos.Vivounbloqueo
emocional,unaemocinviva,ydetengomiagresividad.Lagargantaserelaciona
conelcentrodeenergadelaverdad,delacomunicacinydelaexpresindes
(chakradelagarganta),puedosentirmecogidoporlaverdadquetengodificultad
enasimilarypormisconviccionespersonales.Recurroaciertospaliativosociertos
estimulantestales comoel caf,alcohol,cigarrillos,etc.Tomoconscienciaque
necesitountiempodeparoyacepto darmeelreposoyeltiemponecesarios
para regenerarme. Estando descansado, las situaciones y los acontecimientos
recuperansutamaoreal,estoymuchomsobjetivoymslcidoparatomarlas
decisionesqueseimponen.
RONQUIDO
El ruido que emito al respirar durante mi sueo y que procede de un
obstculoentremisvasnasalesylalaringesellama ronquido.Si ronco,debo
preguntarme:Meagarroyoamisviejasideas,actitudes,bienesmateriales?Me
obstino a mantenerme en una situacin o en alguna situacin que no me es
beneficiosa? Estoy cansado? Estn repletos mis senos? Cul es la cosa que
respiro difcilmente y que me sigue incluso durante la noche? (ej.: olor de mi
cnyuge,deunperfume,etc.)?Oquizsquierocogeramicnyugequeduerme
cerca de m y quitar la distancia que nos separa tanto fsicamente como
emocionalmente).Buscopuesacercarmedel.Deboaprenderasoltarydejarsitio
a lo nuevo. Acto de modo que mis comunicaciones sean claras y libres de
cualquiermalentendidoocualquierambigedad.
ROSTRO (ver tambin: PIEL / ACNE/ GRANOS/ COMEDONES)
Mi rostro eslaprimerapartedemiserqueabordaoacogeeluniverso.
Normalmente,ungolpedevistamedasensacionessobrealguiensegnquesu
rostroesradiante,luminoso,sonrienteo,alcontrario,sombro,irritado,triste.El
rostroserelacionapuesconmiimagen,miidentidad,miego.Siquieroesconder
unaspectodemipersonalidadosimeescondoalgoammismo,mirostrolleva
estamscaratambinalvolversetensoyconmuecas.Delmismomodo,sime
desvalorizo,sicritico,simesientoincompetente,sitengolasensacinquenadie
meama,mimalestarinteriorseexpresaporelaspectodelapieldemirostroque
se vuelve llena de granos o que se seca. Una irritacin mental hace la piel
imperfecta.Paraqueseaclaren,sesuavicenyselimpienporsmismoslosrasgos
ylapieldemirostro,esimportantequelimpieprimeromiinterioryquemequite
sentimientosypensamientosnegativosquemantengoyquedejesitioamsamor,
284

amscomprensin,msaceptacinymsapertura.Mirostroseiluminaran
msyyanotendrnecesidaddellevarmscara.
RTULA
Lartulaesunhuesodeformatriangularquepermitelosmovimientosde
flexinextensindelaarticulacindelarodilla.Laexpresinestarsobrelas
rtulas significa que estoy agotado. Si siento dolor o que mi rtula est
deformada,puedosentirira,decepcineirritacinconrelacinamissueosque
meparecenestarfueradealcanceoirrealizables.Flexionolasrodillas;mesiento
vencido.Hallegadoelmomentodetomartiempoparam,levantarme(ponermeen
pie)ytomariniciativaspararealizarmissueosmsqueridos.Creyendoenellos
podrncogerforma.
SADOMASOQUISMO
El sadomasoquismo implica una relacin en la que uno de los socios
expresasu dominacin(sadismo) yelotroexpresasusumisin(masoquismo).
Ocurrequepersonassumisashallenenestociertoequilibrioensurelacin.Sin
embargo,sisientolanecesidaddepracticarestaformaderelacin,seguramente
quieroliberarmedeciertoestrsinterior,bienpudiendocontrolarosometindome.
Meliberoasdeciertasangustiasquepuedatener.Debotomarconscienciaque
puedodesarrollar,enmisubconsciente,esteprograma:soylibrecuandocontroloy
mesientomejordespuso,enelotrocaso,mesientolibrecuandomesometo
voluntariamenteymesientomejordespus.Esteprogramacorreelriesgode
resurgir en mi vida en el momento en que menos me lo espero. As, en
circunstanciasdeestrsimportante,podridentificarquelasolucinsercontrolar
osometerme.Deboestaratentoalhechodequemevuelvolosobrelocualllevo
miatencin.As,estecomportamientoquepuedeparecernegativocorreelriesgo
deampliarciertasactitudesnegativasenm.Tomoconscienciademideseode
liberarmedemismiedosydemislimitacionesydelhechoquedebodesarrollar
mslahumildadquelasumisin,elhechodeestarguiadoquedecontrolar.As
podrbuscarunasatisfaccinparamimayordesarrollopersonal.
SALIVA (en general) (ver tambin: GLNDULAS SALIVARES, PAPERAS)
Hacrseleaunolabocaagua, tenerbabasdeenvidia poralgoopor
alguien.Lainflamacindelasglndulassalivaresesloquesellamalaspaperas.
Siestoyafectadoporestaenfermedad,vivofrecuentementefrustracinytengoel
sentimientodequeescupensobrem,sobremisideas.Mesientocriticadoyaveces
tengo ganas de escupir a mi vez al rostro de la gente. Si padezco depresin,
frecuentementeestoyllevadoacomerrpidamente,atragarmisalimentosenteros,
locualprovocaunacarenciadesalivaylasensacindeahogo.Lasalivatieneel
285

poderdeeliminareldesarrollodelosmicrobios.Permitetambin,porsupoder
humectante, facilitar los sonidos en la garganta, tragar mejor los alimentos.
Favorecelaprimeraetapadeladigestintransformandolosalmidones.Demasiada
salivaoinsuficiente salivalahaceineficaz,intil.Adquiriendoconfianzaenmis
decisiones,decidiendodejarentrarlaalegraenvezdelospesares,adelantandocon
confianza,vuelvoadartodosupoderamisaliva.
SALIVA HIPOSALIVACIN (ver tambin: BOCA)
Lahiposalivacinesunacarenciadesaliva.Lasalivaeselhumoracuoso
algoviscosoquehumectalabocaylosalimentos.Lasglndulassalivaressecretan
lasalivaqueayudaaladigestin.Puedequerespireporlabocaenvezdeporla
nariz. Estoconllevaunasequa delabocayde lasvas respiratorias. Laboca
representa mi apertura a la vida, puedo preguntarme en qu mis deseos o mis
apetitosestnactualmentesecosyporqunosemanifiestancomoquisierayoen
mi vida. Puedo encontrar que los acontecimientos de la vida no me nutren lo
bastanteyquepierdointersenmivida.Tomoconscienciadeldondelavida.La
vidamedatodoloquenecesitoparaintegrarbienlassituacionesquevivo.
SALMONELOSIS (ver tambin: ENVENENAMIENTO [, por la
alimentacin],
INDIGESTIN,
INFECCIONES
[en
general],
INTESTINOS DIARREA, NASEAS)
Lasalmonelosisesunainfeccinprocedentedeunabacteriaquesealberga
eneltubodigestivo.Estabacterianormalmenteesttransportadaporelalimento.
Lossntomasdelaenfermedadsondiversos:vmitos,diarrea,infecciones,puedo
preguntarmeloquemellevaavivirtantairritabilidad.Aunquefuesefcilparam
pensarquenosoyresponsabledeloquemeocurreporqueelalimentoeraloque
estabainfectado,porlotantounacausaexterior,deborecordarmequelacasualidad
noexisteyqueloselementosexterioressloexistenparaayudarmeaactivarla
dolenciaquevivoactualmenteenmividaconrelacinaunasituacinqueno
digieroyquemeprovocaunenfado.Cuantomsprontovuelvaaponerarmona
enestasituacinquepudeidentificar,msprontomisaludsehallarmejorada.Me
enriquecerconunaexperienciaquemeayudaadesarrollarmssabidura.
SALPINGITIS (ver tambin: CRNICA [enfermedad], FEMENINA(S)
[dolencias], INFECCIONES [en general])
La salpingitis es una infeccin aguda o crnica de las trompas. Esta
enfermedadfrecuentementeestvinculadaaimpotenciafrenteaunaparejasexual.
Tengoyolasensacin dequeunapersona queestcercadem talcomomi
cnyuge,mipadre,unodemishermanos,amigoetc.,meengaporsusactitudes
o por sus gestos y que esto me enfad mucho? Cualquier sea la situacin,
286

frecuentemente, sta implicar un aspecto de la sexualidad que encontr feo o


degradante.Aceptoponeramorenlasituacinparapoderpercibirlaverdad
enlaexperienciaquemetraelavida.Asmeencontrarmsfelizconmsalegra
deviviryserenidad.
SANGRE (en general)
Paraasegurarelbuenfuncionamientodesuvehculo,seledebedaruna
buenagasolina. Lagasolina

delcuerpoesla

sangre

que,parasereficaz,debe
circularlibrementeentodomicuerpo.Silagasolinacontieneimpurezas,correel
riesgodelastimarelmotorqueeselcorazn.Lasangrerepresentalaalegrade
vivirylasimpurezasquesehallanenellaprovocandolenciasentodomicuerpo.
Segnmialimento,elestmagoproducirunaenergaquefortalecermisangreo
laharanmica;igualcomomivehculo,deboelegirlagasolinabuena.Lasangre
representalaenergaquecirculaenm.Eselmismocentrodelcorazn.Unamala
circulacinmeindicaqueestbloqueadoelamor;yanoconsigoexpresar mis
sentimientos,estoyenconflictoconelamor.Elmensajedemicuerpoes:dejo
correrlasangreenmisvenas,dejoqueelamorlleguehastamicorazn,acepto
recibiryhallolaalegradevivir.Dejositoparalasideasnuevas.
SANGRE (dolencias de) (ver tambin: SANGRE / ANEMIA /
LEUCEMIA, etc.)
Unamalacirculacindelasangreindicaunafaltadealegradevivirenmi
vida.Mesientodormido,misideassonconfusas.Pararecobrarlaalegra,acepto
lasnuevasideas,reconozcolasbellezasquemerodean,sonroalavida.
SANGRE ANEMIA (ver tambin: SANGRE / CIRCULACIN
SANGUNEA / LEUCEMIA)
Lasangrerepresentalaalegradevivir,elamorylasemociones.Cuandolos
glbulosrojosdelasangresoninsuficientesoqueelnmerodeclulassanguneas
esdbil,frecuentementeseproduceunacarenciadehierroenlasangreyaqueel
hierroestenelcentrodelamolculaqueformalosglbulosrojos.Esteestado
estvinculadoaunacarenciadealegra,fuerzayprofundidadenelamorquetengo
paramylosdems;amiscreenciasenmicapacidaddeamarautnticamentecon
fuerzaydeterminacin;aundesanimoyunrehusodevivir;oalasensacinde
estarsinvalorydetenerresistenciasfrentealamor,deaquestadesvalorizacinde
mipersona.Inclusosepuedevivirdesesperacinyresignacin.Tambinpuedo
manifestar mucha rigidez frente a los acontecimientos de la vida. En resumen,
todosestossntomassonelresultadodeunagrandebilidadalnivelsanguneo.En
ingls, el Hierro se llama Iron y se puede hacer un juego de palabras
cambiandoIron(hierroporIrunquesignificaenespaolcorro.Delmismo
modo,enFrancs, sepuedesustituir lapalabrafer(hierroenespaol) porsu
287

homnimofaire(hacer).As,lapersonaanmicayanosientebastantealegray
motivacinpararealizartodoloquehayporfaire(hacer)[hayunacarenciade
faire(hacer)ounafaltadefaire(hacer)]yyanosesientecapazdecorrerpara
lograr lo que quiere. Pero porqu rehso usar la energa del universo que es
disponibleparam?Dequtengoyomiedo?Quesloquemehacecomermela
sangre?Slohededecir s aestabellaenergalistaparaservirmienergacon
amor.Apartirdeahora,miro,observoydescubrolaalegraalrededormo.Est
portodaspartes:familia,trabajoyamigos.Estosseresdeluzestntambinaqu
paraayudarmeacrecer.
SANGRE ARTERIAS
Las arterias son los vasos que conducen la sangre del corazn a los
rganos.Estosmismosvasossanguneos(ascomotodoslosdemsconductos
sanguneos, venas, capilares,etc.) son elmedioparaelamor demanifestar las
cualidadesdivinas.Seubicanportodaspartesenelcuerpoycomunicanconcada
partede ste.Las arterias estn tambinvinculadasatodoloquesellamala
vida.Hacencorrerlaalegradevivirymepermitencomunicar,expresarmis
emociones,guardarelcontactoconeluniverso.Silatensinnerviosasubems,
provoca un desequilibrio emocional que puede resultar de un conflicto interior
entre mi mundo fsico y mi mundo espiritual. Cuando tengo dificultad o
cuandodejodeexpresarmisemociones,mecierro(bloqueo)yaconsecuenciade
ello,puedenocurrirdiferentesenfermedadesvinculadasconelcorazntalescomo
laarteriosclerosis,latrombosis,laanginadepecho,lasvarices.Laalegradevivir
dejadecircularenm.Puedodesvalorizarmefrentealasaccionesquecumplo.Para
quelaenergafluyamsregularmenteeimpidaeldesarrollodeciertasesclerosis,
representando bloqueos energticos, debo hacer prueba de una apertura ms
constantealaalegrayalacirculacindeestaalegraquedandoabiertoalniveldel
corazn,aceptandocambiardeactitudyabrirmealamor,paraqueesteamorse
encamineportodomicuerpo.
SANGRE COLESTEROL77 (ver tambin: SANGRE / [en general] /
CIRCULACIN SANGUNEA)
El colesterol estvinculadoalasangre,smbolodelaalegradevivir.El
colesterol procededelosalimentos.Nuestroorganismolosintetizaapartirdel
hgado.Lubrificamisvasossanguneos,alimentaelsistemanerviosoylomantiene
equilibrado. Su funcin normal es impedir el desgaste prematuro de los vasos
sanguneosporelpasodelasangre,perosiespresenteenexcesoenelcuerpo,se
depositayreduceprogresivamenteeldimetrodelosvasossanguneos.Porqu?
Porqueyanotengoalegradevivir!Paramisadentros,creoquenomerezcoser
77

Colesterol:haydostiposdecolesterol:unoquesellamaLDL(procedentedeltrminoinglsLowDensity
Lipoproteins(lipoprotenasdebajadensidad),tambinllamadocolesterolmaloyelHDL(delingls:High
DensityLopoproteins[lipoprotenasdealtadensidad]),tambinllamadocolesterolbueno.

288

feliz,seralegreyestaalegracirculamal!Puedotenerunasubidade colesterol
despusdeciertosacontecimientoscomo,porejemplo,despusdehabertomadola
jubilacin,porqueyanosientolaalegradevivirquetenaconmiscompaerosde
trabajooconlagentequeencontrabaeneltrabajo.Estasubidatambinsepuede
darcuandosehaido alguienaquienamabayquemetraaalegraenmivida.
Aqu, en lugar de desarrollar una diabetes que es tristeza profunda, mi cuerpo
interpretarelsucesomsbiencomounacarenciadealegradeviviryharsubirel
porcentajede colesterol.Tambinpuedesucederlomismocuandopierdoami
animaldecompaayporfinenunasituacinquepuedecausar,conscientementeo
inconscientemente,quedisminuyamialegradevivirenmivida.Puedeserelcaso
tambincuandoquierorealizarunproyecto,construiroerigiralgoqueafecciono
especialmenteperonoconsigorecibirayudadenadie. Slopuedoporlotanto
contarsobremyestomeafectamucho.Sidejoqueempeoreestasituacin,hay
riesgo dequealgndatenga un ataquecardaco.Enefecto,sinoarreglola
situacinquemehacevivirestacarenciadealegra,estotocarelaspectodemi
vidaqueeselamor.Cuandodisminuyelaalegra,escomosisintieramenosel
amorenm,porestolacarenciadealegratendrporefectoafectarmicorazn.La
mayoradecolesterolanimal(procedentedelascarnesyproductoslcteos)forma
partedeladietademasiadoricadelosOccidentales.Losalimentosquecontienen
muchocolesterolrepresentanciertasatisfaccinegostademisapetitos.Mesiento
bien,sinpensaruninstantequeesteexcesocorreelriesgodecambiareincluso
destruirmisalud!Esunailusincreerquedoyungustoamicuerpo.Compruebo
quemeamodeunmodoalgodemasiadoegostaoegocntrico.Absorbiendo
alimentosquecontienendemasiado colesterol,reniegodelasalegrasdelavida.
Un da, deber pagar por esto. Deseo yo esta dolencia? Acepto cambiar
inmediatamente dejando fluir la alegra en m, igual como el nio maravillado
delantedelasbellezasdelavida!Neutralizomimiedodevivirenlaalegray
aceptoquestaformepartedemivida.
SANGRE - CIRCULACIN SANGUNEA (ver tambin: CORAZN)
Lacirculacinsanguneaestvinculadaalcoraznyalasangre,smbolode
vida.Lasangrepasaportodosloscanalesdelcuerpo:arterias,arteriolas,venas,
venillas,capilares.Estoscanalessonnecesariosaladistribucindelamor,dela
alegraydelavidaentodoelcuerpo.Micorazn(centrodelamor)aceptadar
la sangre (energa) a cada parte de mi ser, cualquier sea su importancia, sin
discriminacin.La sangre representamivigor,miplacerdeviviryloquesoy
actualmenteenesteuniverso.Todaslasdificultadescirculatoriasestnvinculadas
conla sangre ylatotalidaddemiser.Sivivounasituacindifcilenelplano
emocionalomental,laenergaqueanimamisersedebilita.Estadebilidaddela
sangreydelacirculacinsanguneasignificaquemeretiroemocionalmentede
unasituacinquemeafectaporelinstanteporquenotengobastanteenergapara
289

irhacadelante.Meprotejodemisemocionesdemasiadoenergticasporquees
dolorososentirlaspresenteshastatalpunto.Nodejocircularbastanteamorenmi
vida.Meautocriticoseveramente,estoyapenado,sientomuchatristezainterior.
Mialegradevivirymibuenhumordisminuyen,misideassevuelvenconfusas,
tengounavidasocialpocoexcitante,inspidayllana.Tengonecesidaddehacer
circularmuchosproyectos,ideas,sensaciones.Sino,todosecongelaracausa
demispreocupaciones,mispenas,micansancio,miira;unasobreexcitacinouna
obsesinquedesequilibrala circulacinsangunea tendrelmismoefecto.La
faltadealegramellevapuesahuirdemisresponsabilidades.Tengobloqueosque
me hacen evitar ciertas situaciones. Es un modo de decir no a la vida. As,
diversos patterns corren el riesgo de aflorar en superficie (el control, la
negligencia,laindiferenciafrentealavida,lanecesidadexageradadeatencin,el
deseo de querer morir) Los trastornos de la circulacin sangunea se
manifiestanprimeroenlasmanosylaspiernas,enlaspartesmsexternasyactivas
demicuerpo,lasquemedirigeneneluniverso.Unamalacirculacinqueafecta
mispiernasestvinculadaamidireccinemocional,alasemocionesenlascuales
puedocontaryqueamo.Cuandoestnafectadasmismanos,eslaexpresindemis
emocionesyundeseodecesarloqueestoyhaciendo.Enamboscasos,setratade
unaretraccinenelplanointerior,laretraccindelaplenaparticipacinemocional
a mi universo. Las diferentes aflicciones sanguneas son la aterosclerosis, la
arteriosclerosis,laelevacindelporcentajedecolesterol,latrombosis,etc.Acepto
mirarmealacaraysobretodoobservomiactitudfrentealavida!Noes
la vida bastante extraordinaria como para aprovecharla plenamente? Abro mi
coraznalamor,measumoymedejoguiarporlavida.Siempresucederloque
haymejorparam.
SANGRE COAGULADA (en las venas o en las arterias)
Lasangrerepresentalaalegraquecirculaenmicuerpo.Cuandocoagula,es
como si decidiese poner un tapn que tiene por efecto cortar toda circulacin.
Decidodejarcircularlaalegraenm,medespiertoanuevavida.
SANGRE

DIABETES
(ver
tambin:
ENFEREMEDADES
HEREDITARIAS, SANGRE HIPOGLICEMIA)
Ladiabetestambinllamadadiabetesdulce,semanifiestaporunasecrecin
insuficientedeinsulinaporelpncreasqueresultadeunaincapacidaddesteen
mantenerunporcentajedeazcarrazonableenla sangre.Unexcesodeazcar
sanguneoseproduceentoncesylasangreesincapazdeusaradecuadamentelos
azcares en el flujo sanguneo. Estos azcares en exceso causan un porcentaje
demasiado elevado de azcar en la orina que se vuelve dulce. El azcar
correspondealamor,alaternura,alafecto,ladiabetesreflejapuesdiversos
sentimientosdetristezainterior.Eselmaldeamor,unacarenciadeamorseguro
290

porquenecesito,acausademisheridasanteriores,controlarelentornoylagente
que me rodea. Pues, s! Si tengo diabetes, suelo vivir tristezas seguidas,
emocionesreprimidasteidasdetristezainconscienteyausentesdedulzura.
La dulzura desapareci dejando sitio a un dolor continuo. Empiezo entonces a
comerazcarbajotodaslasformasposibles:pastasalimentarias,pan,golosinas,
etc.paracompensar.Elplanoafectivo,socialofinancieropuederesentirse.Intento
compensarportodoslosmediosposibles.Melimitoenmuchoscampos.Mevuelvo
amargo(amargura)frentealavida,eslaraznporlacualencuentromivida
amargaycompensoporunestadomsdulce.Altenerdificultadenrecibir
amor,mesientoahogadoysobrecargado,pilladoenmisituacinincontrolabley
excesiva.Elexcesoesteliminadoenlaorina.Tengopuesunagrannecesidadde
amor y afecto, pero no s actuar ni reaccionar cuando podra recibirlo. Tengo
dificultadenrecibirelamordelosdemsylavidapierdegustoparam.Esdifcil
soltarmeyexpresarelamorverdadero.Misesperassonfrecuentementedesmedidas
(quieroquelagenterealicemisdeseos)ymeatraenfrustraciones,ira,frenteala
vidayelreplieguesobres.Vivomucharesistenciafrenteaunacontecimiento
quequieroevitarperoquemesientoobligadoasufrir.Porejemplo,puedeser
unaseparacin,untraslado,unexamen,etc. Aestaresistenciaseaadirun
sentimientodedisgusto,repugnancia,desdnfrenteaesteacontecimiento.La
hiperglicemia aparecer pues en ese momento. Necesito asumirme en seguida.
Necesitocambiarlassituacionesquemeafectanempezandoaverelamoryla
alegraentodaslascosas.La diabetes (o hiperglicemia,excesodeazcarenla
sangre)ylahipoglicemia(insuficienciadeazcarenlasangre)(ambasvinculadas
a la falta de alegra) estn vinculadas directamente al amor que soy capaz de
expresarparammismoylosdems.Enelcasodeladiabetesgestacional,que
se produce habitualmente despus de la segunda mitad del embarazo, debo
preguntarmelasmismaspreguntasquelasquepreguntoalaspersonasafectadasde
diabetes.Puedequelatristezaprofunda,repugnanciaoresistenciaserevelenami
consciencia.Esteembarazopuedeactivaryampliarenmelrecuerdomsomenos
conscientedeestossentimientosquepudevivirenmiinfanciaylaconsecuencia
serladiabetes.Despusdelparto,elregresoamiestadonormalmeindicaque
estos sentimientos han desaparecido o que su importancia ha disminuido
enormemente,locualtraeunrestablecimientodelacantidaddeazcarensangre.
(glucosa).Haytantoamordisponible;soyrealmenteconscientedelamorquela
gentetieneparam?Lagentemeamaydeboverloapartirdeahora.Aceptoel
pasadodeunmododesapegado,porloquees.Esabriendomicorazncomose
producenlosmilagros!
SANGRE FLEBITIS
Laflebitissedefineporelbloqueodelasangreenlasvenas,sobretodoal
niveldelosmiembrosinferiores.Estcausadaporuncoaguloprocedentedeuna
291

infeccinodeunaherida.Lasangrerepresentalalibrecirculacindelavidaenlas
venasdemismiembrosinferiores.Mimediodelocomocinestpueslimitado,
irritadoydefectuosoporqueestebloqueodelasangremeindicaunaprdidade
alegravinculadaalaspiernas,lascualesmetransportanhacadiferentesdestinos
demivida.Segnquelapiernaizquierda(miinterior)oderecha(miexterior)olas
dospiernasestnafectadas,laprdidadealegrapodridentificarmeculnivelo
cul sentidotengounadudaounanegacinaadelantar,aceptar unnuevo
destino.Mequemolasangrefrenteaciertassituacionesquemepresentalavida.
Vivopuesunparn,unfrenodebidoaunaemocin,unsentimientoquelimitami
alegradevivirparairhacadelante.Esimportantequesueltelapena,eldisgusto,
la frustracin que vivo y que me responsabilice de lo que sucede en mi vida.
Acepto quetengoelpoderdecrearmividacomoquiero;sinembargodebo
aceptarquetengoderechoalafelicidadyquemerezcoquelaalegraylapaz
iluminenmicamino.
SANGRE GANGRENA (ver tambin: AMPUTACIN, INFECCIONES)
Lagangrenaeselresultadodeunadisminucindevelocidadyfinalmente,
delparodelflujosanguneoenunaovariaspartesdelcuerpo,locualtraelamuerte
delostejidos.Elflujosanguneoestvinculadoconlaexpresinoalfrenodemi
amorporelUniverso,ytambinamialegradevivir.Porlotanto,si,porejemplo,
lagangrenaafectamispiernas,esporqueelfreno,oelcortedeamoradentrode
mestanprofundoqueparacompletamentecualquiermovimientohacadelante.
Frecuentemente,enestecaso,sonpresenteselmiedoalfuturoylainseguridad
frente a lo que ser de m. Me intoxico por mi culpabilidad arraigada, por la
vergenzaoporlapena,yunapartemaseestmuriendo.Lavidaseva,yanoest
laalegra.Enelcasodelagangrenaseca,lasangreyanoirrigalostejidos.Porlo
tantohedevolveratomarcontactoconmigoyconlaalegraquedebehabitarme,
enesteaspectodemividaquecorrespondealapartedemicuerpoafectada.Enel
casodelagangrenahmeda,queresultaademsdeunaafeccin,hagofrentea
pensamientosenvenenadores,apensamientosdemuertehacammismoohaca
la vida. La gangrena gaseosa (ms escasa), que se halla sobre todo en los
diabticos,estfavorecidaporunacoleccindesangreenuntejidooporuncuerpo
extrao. Gases nauseabundos procedentes de la proliferacin de grmenes
infecciososseformandebajodelapiel.Noslosonpresenteslasideasdemuerte
de una parte de m mismo sino tambin me lleva a vivir esta situacin un
profundorechazodeestamismaparte.Necesitoreintegrarlasangre,elamorenla
expresindequiensoy,enmivida.Aprendoaaceptarme talcomosoyya
volveradescubrirlaalegradelavida.

292

SANGRE HEMATOMA (ver tambin: ACCIDENTE, SANGRE / [en


general]/ CIRCULACIN SANGUNEA)
Unhematomasigueaunahemorragiaenlacualciertacantidaddesangrese
acumulaenuntejidoounrgano.Casisiempre,unhematomaseproducedespus
deuntraumatismo,ydebopreguntarmeculmiedooculculpabilidadmeimpide
dejarcircularlibrementelaalegraenmivida.Laacumulacindelasangreme
indicaquedeboponermsalegraenmividaylaparteafectadameinformaacerca
delaspectodemividaquedeberamanifestarestaalegra.
SANGRE HEMATURIA (ver tambin: ADENOMA, VEJIGA / [dolores
de] / CISTITIS, ORINA [infecciones urinarias])
Lahematuriaeslapresenciadesangreenlaorinademodomicroscpico78o
macroscpico79.Laorinarepresentamisviejasemocionesquedejoiryunaprdida
desangremeindicaunaprdidadealegra;porlotantolahematuriasimbolizauna
tristeza ms o menos viva frente a mis emociones pasadas que me destrozan
interiormente. Debo buscar cules son estos sucesos que me han destrozado
emocionalmenteparaquepuedaaportarmedulzuraycomprensinyqueseinstale
lacuracin.
SANGRE HEMOFILIA (ver tambin: ENFERMEDADES HEREDITARIAS,
SANGRE / [en general] / [dolores de] / CIRCULACIN SANGUNEA /
DIABETES)
La hemofilia esunaenfermedadhereditariavinculadaauntrastornodela
coagulacindelasangre.Yaquemisangretienedificultadencoagular,uncorte,
unaheridapuedentraerprdidasdesangrequeesdifcilparar,locualpuedeponer
mividaenpeligro.Aunqueestaenfermedadeshereditaria,sinembargovivoesta
situacinporquedeboefectuarunatomadeconscienciaconrelacinalaalegra.
Almenoraccidenteoincidente,mividacorreelriesgodeestarpuestaenpeligrosi
nointervengorpido.Debotomarconscienciaenmividadeloquepuedellevarme
avivirdesesperacinatalpuntoquepodramoriralagotarsemisangre.Puedo
mirarenquladiabetes,bajociertosaspectos,puedeparecersealoquevivo.Si
bieneldescubrimientodelacausanocambiaenmelhechodeserhemfilo,no
impidequepodratenerlasensacindequelosinconvenientesdeestaenfermedad
disminuyenenormemente,manteniendolavigilancia,yquecadavezmstengoel
sentimientodevivirunavidanormalconmsalegraenmicorazn.

78

Demodomicroscpico:quenoesvisibleasimpleojoenlaorina:quesedetectasolamenteconmicoscopio.
Demodomacroscpico:Quesepuededetectaraojoenlaorina,bienporsucolorrojizoolashuellasdesangre
quepuedenestarah.
79

293

SANGRE HEMORRAGIA
Una hemorragia se caracteriza por una prdida de sangre violenta y
repentina. Esta efusin incontrolada de sangre se asocia generalmente con un
trastornoountraumatismoemocional.Sonmisemocionesdemasiadolargotiempo
retenidas,talescomolaagresividadylaangustia,lasquesevuelvenincontrolables
interiormente,yquebrotanrepentinamente.Puedoviviracontecimientosqueno
suceden segn mis esperanzas o segn mis deseos. Al final de la resistencia,
agotadomoralmente,sueltoygranpartedelaalegradevivirdejarepentinamente
micuerpo.Siendoalaescuchademicuerpo,puedoreconocerunmensajequeme
ayudaravivirmejorenarmona.Aprendoasoltaryaexpresarmisemociones
mslibremente.Sintindomemsliberado,llevomiatencinsobrelaalegraque
hayenmyalrededordem.
SANGRE HIPOGLICEMIA (ver tambin: ALERGIAS [en general],
CEREBRO EQUILIBRIO [prdida de], SANGRE DIABETES)
Lahipoglicemiasecaracterizaporunadisminucinanormaldeglucosaen
lasangre.Lapartedelpncreasquesecretalainsulinaestsobreactivada.En
consecuencia,lasclulasylosmsculosestnprivadosdelaglucosaenergtica.
Estasituacinestopuestaaloqueseencuentraenlosdiabticos.Estcausadapor
unexcesodeinsulinaodeejercicio.Elazcarrepresentaunaformade premio,
afecto, dulzura y ternura. Es la manifestacin del amor, segn la metafsica.
Actualmente,estoyyobuscandoelamor?Loestoyesperandodelexterior?Como
azcar para colmar esta carencia? Varias manifestaciones se vinculan a la
hipoglicemia:
- puedemanifestarseporquedoytantoalosdemsqueyanotengonadaparadar.
Estomerevelalanecesidaddeempezarporamarme,porrespetarmeenmis
necesidades.Dndomems,luegopuedodarmsyamaralosdems.Nopuedo
daralosdemsloquenomedoyammismo.
- Puedetambinbrotarcuandovivounatensinounapresininteriorexcesiva
sobrelacualpiensoquenotengocontrolalguno.
- Procede de mis fuertes emociones, de una tristeza profunda, causndome
angustiaeinclusohostilidadfrentealosdems.Tengoyoesperanzasquean
estnsincontestar(quenoestnsatisfechas)?
- Tambinpuedovivirunmiedointensofrenteaalgooaalguienquemeasqueay
queprefieroevitar.Deboresistircontodasmisfuerzasparaintentarevitaresta
cosaquemerepugna.Tantopuedeserunobjeto,ungestocomounapalabra
dichaquemeprovocunasco.
- Unaalergiaalimentariatambinpuedeserlacausafsicadeestacadadel
azcarsanguneo.Porlotantodeborealizarlascomprobacionesfsicasquese
imponenyhallaraquinoaqusoyalrgico.
294

Aceptoloquemesucede.Decidohacermividamsalegre.Respondoa
misesperas.Micuerpoesunsabio,unamigofielalcualsoyreceptivo.
SANGRE LEUCEMIA (ver tambin: SANGRE / ANEMIA / CIRCULACIN
SANGUNEA)
Cuandoproliferanmisglbulosblancosdemodoincontrolado,tengoloque
sellamaelcncerdelasangreolaleucemia.Elcncerdelasangre,eslaalegra
quenocirculalibrementeenmivida.Tengoodiohundidoprofundamenteenm.
Meautodestruyo,rehsoluchar.Sisoyunnioafectadode leucemia,esque
sientounanegacinalrenacer,estoyprofundamentedecepcionadoporloqueveo
en la tierra. Quiero volver a marchar, dejar este cuerpo. La leucemia aparece
frecuentementedespusdelaprdidadeunseramado(puedeserinclusounanimal
alcualamabaespecialmente).Estaformade cncer estdirectamentevinculada
conlaexpresindeamorenelinteriordes.Tambinpuedeaparecerdespusde
un acontecimiento para m destacado, que me llev a desvalorizarme. Esta
desvalorizacin afectar mi ser entero y la vivir de un modo muy intenso y
profundo.Tomemoselejemplodeunniojovenaquienserehsaunsitioenel
equipodeftboldelpuebloodesubarrio.Esundrama!Escomosilavidayano
tuviera ningn sentido y que no valiera la pena ser vivida. Puedo tener la
sensacin de que debo sobre protegerme constantemente para lograr lo que
quiero.Puedohabervividounafrustracinintensayhaberviolentamenteahogado
misemociones.Simiamoromideseodevivirestuvoheridodeunmodouotro,
miactitudparaamarpuedevolversedesconfiada,confusayalienada.Entonces,
quieroaislarmedetodossentimientos.Deboaprenderairconlavidaenvezde
contraella.Tomolosmediosadecuadosparacambiarenmlasupervivenciaporla
vida. As estar ms en paz conmigo mismo y ya no sentir la necesidad de
defendermeexcesivamente.
SANGRE LEUCOPENIA
Laleucopeniaeslacadadeglbulosblancos,eldesequilibriodelasangre.
Losglbulosblancossevuelvensoldaditosquebajanlasarmas.Yanotengoel
valordeluchar.Puedeserunaformadehuidaquemeobligaevolucionarenel
mismoorden,impidindomeasexperimentarnuevascosas,parasentirmesiempre
enseguridadymaestrodelasituacin.Necesitocuidardempararehacermis
fuerzasinterioresyas,volveratenermssaboralavidacontodoloqueesto
comportadeexcitante.
SANGRE MONONUCLEOSIS (ver tambin: ANGINA, FATIGA, BAZO,
CABEZA [dolores de])
La mononucleosis es una infeccin caracterizada por el aumento de los
linfocitosqueformanpartedelosleucocitosoglbulosblancosdelasangre.Esta
295

enfermedadsehallasobretodoenlosadolescentesoenlosjvenesadultos.Se
llamatambinlaenfermedaddelbesoporquesepuedetransmitirporlasaliva.Si
soyadultoyquetengoestaenfermedad,intentoverloquepudoafectarme,comosi
fueraunadolescente,oloqueestomerecuerdacuandoestabaadolescente.Quiero
vivirplenamente,sientouncambioenmiinteriorytengolasensacindedeber
luchar constantemente para lograr lo que quiero. Mi sistema de defensa se
desarrollaparacompensarlosataquesylaslimitacionesquetengolasensacinde
recibirdelavida.Mesientosolofrentealosobstculosquesepresentanfrentea
m. Desarrollo una mononucleosis cuando me siento culpable frente a una
situacinocuandoquieromspermiso,cuandocriticoalagenteolavidaen
general.Lamononucleosistieneunnexoconlosproblemasdelbazoporquehay
unaumentodelvolumendeste.Debohacerlimpiezaenmividayponerms
amor haca m y haca los dems. Vuelvo a tener valor y confianza en m y,
entonces,recobrarlaenergaylaalegradevivirquemepermitirnexperimentar
msamor.
SANGRE SANGRAR
Sangrarpuedecompararseallorar,aunaprdidadealegra.Cuandosufro,
correnlaslgrimas,mipenaestanintensaqueescomosillorasesangre.Adnde
vamialegradevivir?Porquestapena,estaagresividadquemehaceverrojo?
Tomoconscienciadelasuertequetengodeviviryrecobrolaalegra.Meliberode
todamitristezayaceptorecibirloquemedalavida.
SANGRE SEPTICEMIA
La septicemia esunainfeccingrave(envenenamientogeneralizado)dela
sangre.Esloquesellama quemarselasangre o envenenarselavida.Debera
preguntarmeporquinoporqumedejoenvenenarlaexistencia.Decidoaceptar
quetengolatotalresponsabilidaddemiseleccionesytomoconscienciadelas
alegrasdelavida.
SANGRE TROMBOSIS (ver tambin: SANGRE CIRCULACIN
SANGUNEA)
La sangre circulando en mis venas representa la alegra de vivir. Una
trombosisquesedefineporunaformacindecogulosdesangreenunavenao
unaarteria,provocaunbloqueoqueimpidelalibrecirculacindelasangre.Este
estadodemuestraqueexistetambinunbloqueoenlaliberacinyenlacirculacin
del amor. Sintindome solo, estoy apenado y tengo la sensacin de que las
dificultadesalascualesmeenfrentosondemasiadopesadasdellevaryquenosoy
capazdesuperarlas.Pierdomialegradevivir.Mividamepareceestancada,me
sientoolvidado,abandonadoeincomprendido.Tengolasensacindeyanollevar
amorenm,mevuelvoinflexible;cadavezsoymsfirmeenmimododeactuary
296

pensar, lo cual provoca el endurecimiento de mis arterias. Esta manifestacin


alcanzatodomicuerpo.Cuandoapareceenmispiernas,meindicauntemorair
hacadelante,unatendenciaaquedarmefijado,sinmovimiento.Tambinesto
puedesignificarlainseguridadquesientoalverapartarseunamoryvercmome
apartodeesteamor.Intentandoasretenerlo,aumentolasprobabilidadesdeverlo
morir.Meabrocadavezmsalavidayaceptoloscambioscomosignosdemi
evolucin.
SANGRE VARICES
Lasvaricessesitanhabitualmenteenlaspiernas.Sonelresultadodevenas
hipertrofiadas.Mispiernasmepermitenandarporlavida,desplazarmedeunlugar
a otro. Varices en las piernas demuestran una mala circulacin. As, puedo
concluirqueellugarenelcualestoyyanomeconvieneoquenomegustaloque
realizoactualmente. Ya nole encuentro alegra. Puede tratarse de unarelacin
afectiva o incluso de un trabajo que se me ha hecho montono. La sangre
representalaalegradevivirylacirculacindelamorenmiUniversoymisvenas
sonelmediodelocomocin.Lasangreenmisvenasestenelcaminodevuelta
haca el corazn, llevando con ella todo el amor que recibi del Universo. La
varicosidadpuedeindicarqueunprofundoconflictoemocionalestdirectamente
vinculadoalacapacidaddeamarmeyderecibirtodoesteamor.Ladireccinque
tomo o el suelo en que estoy no me da lo que estoy esperando, en el sentido
emocional. Esto bloquea y alborota mi movimiento emocional. Tengo la
sensacin de arrastrar un peso enorme, como el preso que debe arrastrar
constantementesupeso.Frecuentementesetratadeunpesofinanciero,eldinero
causndomemuchosdoloresdecabezayacechndomela avaricia. Engeneral,
tengomslaimpresindesubirsituacionesquedecrearlas.Varicesenlaspiernas
aparecen frecuentemente durante un embarazo, lo cual demuestra que ciertos
temoresestnvinculadosaesteestado;comomujerembarazada,tengomiedode
compartiresteamorconotrapersona,perdermiindividualidadenminuevopapel
demadre.Mesientodesbordadoytengomiedodenorealizarlotodoporquetengo
tendencia a aumentar los pequeos detalles. Entonces puede producirse el
desanimo.Pararestablecerestasituacin,esimportantequeaprendaaamarloque
hago.Soylibredeelegirycircularlibremente.
SARCOMA DE EWING (ver: HUESOS [cncer de los ] SARCOMA DE
EWING)
SED (ver tambin: INSOLACIN, RIONES [problemas renales], SANGRE
DIABETES)
La sed esunfenmenonaturalquemellevaarestablecerelequilibriode
sustanciascomolasal,elazcar,entreotras,enmisistemasanguneo.Cuando
297

tengo sed exagerada, mis pensamientos son confusos, mi corazn late


aceleradamente,yanoconsigoverclaro,migargantasesecaytengo sed.Algo
falta a mi felicidad. Beber! Durante un corto instante, disminuye mi sed, pero
vuelverpidoporquevienedemimental.Porlotanto,debodescubrirsucausa:
quesloquememolestaenlavida?Mepareceaburridomitrabajo?Cul
pensamientooculmiedosecamibocaomimente?Cuandolohayaencontrado,
esta sed aparentemente insaciable estar controlada. Las especias fuertes son
conocidasporaumentareldeseosexual.Utilizadoadecuadamente,esteexcitante
puede permitir eliminar la sed. En cambio, una relacin sexual insatisfactoria
tendrporefectoelaumentarla sed,elaadiralsentimientodecarencia.Para
colmarestacarencia,estedeseodebeberrepresentaminecesidaddevida,yaqueel
aguarepresentalavida.Meabromsalavidayalamorparaencontrarporfinla
situacinqueapagarmised.
SENILIDAD
Cuandolas facultades fsicas ypsquicas estn afectadas cuandosoy una
persona mayor, se habla de senilidad. La senilidad es una enfermedad que se
puederelacionarconlahuida.Volviendoalainfancia,vuelvoalaseguridadque
metrae.Elijoasdejarquelosdemssecuidendem,quieroqueseencarguende
m.Siestoyafectadodesenilidad,debotomarconscienciadequenoesnecesario
huir. Si quiero cosechar esta atencin tan deseada, debo sembrarla yo mismo.
Beneficio de la proteccin divina, vivo en paz y en total seguridad. En cada
momentodemivida,tomoconscienciadelafuerzadelUniverso.
SENO PILONIDAL (ver tambin: ESPALDA / [dolores de]/ parte inferior
de la espalda, infecciones [en general])
Elsenopilonidalesunainfeccindemisistemavellosoalniveldelmsculo
prximoalcoxis,enlabasedelacolumnavertebral.Vivofrustracin,irritacino
rebelinfrenteaunasituacinenlacualveomisnecesidadesdebaseenpeligro,al
nopoder stasestar colmadascomolodeseo.Esteestadodecarenciapuede
recordarmeunasituacindemijoveninfancia,lacualpuedeinclusofechardela
pocaenqueeraunfetoyenlacual,entoncestambin,tuvelasensacindeque
carecadealgoodealguienqueeraparam,enaquelperodo,vital.Puedetratarse
deunelementofsicocomoporejemplounlugarclidoenelcualmorar,vestidos
cmodos;tambinpuedeestoestarvinculadoalplanoafectivo,comoporejemplo,
elamorylaternurademispadres.Cualquiersealasituacin,esimportanteque
pidaalUniversoayudarmeparaqueestncolmadastodasmisnecesidadesdebase
yquelehagatotalmenteconfianza.Deboaceptartambinelhabervividouna
situacindecarenciacuandoestabamsjoven,peroqueexistiparaaprendermea
desarrollarlafeyparaayudarmeaapreciarahoratodoloqueposeayposeohoyy
delocualdeberatomarconsciencia.
298

SEPTICEMIA (ver: SANGRE SEPTICEMIA)


SEXUAL (hostigamiento)
Si vivo hostigamiento sexual, es que vivo grandes miedos a veces
inconscientes,dedejarmemanipularporlaternurayporunaformadeamor.Es
ciertoquedebohacermerespetarcomopersonaperoprimerodeboidentificarlas
causasrelacionadasparapoderretomarelpoderqueeselmoyseguirviviendo
msnormalmente.
SEXUALES (desviaciones y perversiones en general)
Si, como individuo, estoy preso de una desviacin sexual, es que deseo
rechazar y reprimir una gran parte de mi ser, vivo constantemente una lucha
interior.Porestehecho,micuerpomedicequeaceptecadaaspectodemque
asocioaundefecto.Cadaserposeeunladomasculinoyunladofemenino.Cuando
soyunhombre,aceptomifeminidad,omimasculinidadcuandosoyunamujer.
Me vuelvo humilde, decido afirmarme. Elijo unificar todo mi ser porque cada
facetamapideexpresarse.
SEXUALES (frustraciones) (ver tambin: EYACULACIN PRECOZ)
Frecuentementevinculadasaunaeducacinmuyestrictahacatodoloquese
refierealasexualidad,creosinceramentequelosrganosgenitalessoninmoralesy
sucios, vivo culpabilidad. Es preferible que acepte vivir mi sexualidad
sanamenteyaqueformapartedemicalidaddevida.
SIDA (sndrome de inmunodeficiencia adquirida)
Sillevoelvirusdelsida(V.I.H.:virusdeinmunodeficienciahumana)yque
estoyenbuenasalud,sedirsimplementequesoyseropositivoypuedequenunca
desarrollelaenfermedad.Simisistemainmunitariosedebilitacomoconsecuencia
delvirusV.I.H.,entoncespodrdecirquetengoelsidaqueeslaenfermedad.Si
soy una persona afectada de sida, veo como mi sistema inmunitario se vuelve
deficienteenclulasT(linfocitosovariedadesdeglbulosblancosdelasangre
ydelalinfa),volvindoseas incapazdeprotegermecontraciertasinfecciones
comolaneumonayelcncer.Elvirusdelsidasetransmiteporlasangre(sangre
contaminada durante una transfusin sangunea, jeringuilla infectada, herida en
contacto con sangre infectada, etc.) o el lquido sexual. La glndula del timo
(situadadelantedelatraquea),estandoahendondeseformanlasclulasenT,
estasafectaday,porelmismohecho,laenergadelcorazntambinloes.La
glnduladeltimo(situadadelantedelatraquea)estandoahendondeseformanlas
clulasT,estasafectaday,porelmismohecho,laenergadelcoraznloest
tambin.Elsistemalquidodelcuerpo,queeslasededelatransferenciaviral,
corresponde a la energa emocional, es decir la sangre. La sangre vinculada al
299

coraznsimbolizaelamorylaspenas,lacreatividad.As,puedodecirquemi
sistemaemocionalestendesequilibrioeincapazdeexpresarselibremente. Vivo
una gran culpabilidad frente al amor, tengo la sensacin de no estar a la
altura.Misistemasevuelvedbilycadavezmsvulnerableatodasformasde
invasin.Tendraintersentomarconscienciaquereprimoemocionescomoel
miedoylaira,quereniegodelserquesoyhastaelpuntodedesearmidestruccin
total.Demiincapacidadaamarmeyaaceptarmetalcomosoy,resultaqueya
noconsigoprotegerme.Mifuerzainteriorque,normalmente,estapoyadaporel
amor,laaceptacin yundeseointensodevivir,sedebilitaysedesmorona
lentamente. Incluso inconscientemente, la muerte puede aparecerme como la
solucinamidesesperacin.Vivirunaexperienciasexualpuedemostrarsemuy
revelador emocionalmente. Incluso espiritualmente, esto puede llevarme a vivir
acontecimientosbenficostanprontocomobrotalaenergasexualdesdeelchakra
debase80queeslafuentedemiimpulsoespiritual.Encambio,siestaenergaest
malutilizada,esdecircomoautogratificacinycomplacencia,puedegirarseen
contra ma. Sin una sincera manifestacin de pureza, podr transformarse en
energaenfermizaomolesta.Aprendopuesareconocerlasenergasqueestnen
mylasusoparalomejordemievolucin.Aceptoquiensoy,unserdivinoy
magnfico.
SIFILIS (ver: VENREAS [enfermedades])
SNDROME81 DE BURNETT (ver: BEBEDORES DE LECHE [sndrome de
los])
SNDROME DE LAS UAS AMARILLAS (ver: UAS AMARILLAS
[sndrome de las])
SNDROME DE SOBRE UTILIZACIN (ver tambin: ESPALDA [dolores
de], INFLAMACIN, TENDONES)
El sndrome de sobre utilizacin es una enfermedad encontrada
principalmenteenlosmsicos.Secaracterizaporlainflamacindelostendonesde
losdedos,mueca,codosoavecesloshombrosoelcuello.Puedenproducirse
doloresdeespalda.Sedicequelasposicionesobligadaspuedenprovocarque
hasta el 53% de los msicos de orquestas sinfnicas padezcan de dolores de
espalda.Comomsico,frecuentementeestoyconfinadoenespaciosrestringidos,
disfrutandodeunacomodidadpocoadaptadaalempleo.Puedequelaslargashoras
deprcticameconduzcanapensarqueeltrabajoesunacargamuypesadacuando
80

Chakradebase:unodelossieteprincipalescentrosenergticosdelcuerposituadoenelcoxis,enlabasedela
columnavertebral.
81
Sndrome:unsndromenoesunaenfermedadpropiamentedichasinounconjuntodesntomascuyacausaprecisa
sedesconoce.

300

tengoloshombrosafectados.Lainseguridaddelempleoylacompeticinferozen
esteambientemehacenvivirgrandesmiedosynomesientolobastantesostenido;
deaquprocedenmisdoloresdehombros.Debomantenermeflexibleyarmonizar
mienergamentalyespiritualcuandoestnafectadosmistendones.Cadapartedel
cuerpomemandaunmensajeapropiadoenloquevivo.Pormsqueestopueda
parecer estar relacionado con mi profesin de msico, no hay casualidad.
Identificolaparterelacionadaparahacerlatomadeconscienciaquemeayudara
sentirmemejorenloquehago.
SINUSITIS (ver: NARIZ SINUSITIS)
SISTEMA INMUNITARIO (ver tambin: SIDA)
La defensa de mi organismo est asegurada por un sistema de auto
proteccin,elcualesesencialparaprotegermedelasagresionesquevienendel
exteriorcomolasbacterias,losvirus,loshongosmicroscpicosytodoslosdems
problemaspotenciales.Sinelfuncionamientototalycompletodeestesistema,esla
muerte.Estenrelacindirectaconmisestadosemocionalesyunprofundodolor
enmiexistenciapuedereducirsufuerzademododramtico.Lasclulasinmunes
sedesarrollanalprincipioenlamdulaseaylasquesevolvernclulasTestn
transportadas,asumadurez,hastalaglndulatimosituadacercadelcorazn.Su
localizacinenrelacinalcoraznmehacetomarmejorconscienciadelarelacin
cuerpoesprituqueexiste.Elsistemainmunitariorespondealossentimientosy
alconjuntodemispensamientos,seanstospositivosonegativos.As,todosmis
pensamientosdeira,amargura,odioyresentimientotendrntendenciaadebilitar
misistemainmunitario.Porotrolado,todoslospensamientosdeamor,armona,
bellezaypazinteriortendrntendenciaareforzarmisistemainmunitario.Eltimo
es la glndula endocrina que est asociada al chakra (centro de energa) del
corazn.Porlotanto,cuandomisistemainmunitarioestafectado,minecesidad
de amor es tambin muy grande. Mi mismo cerebro est muy vinculado a mi
sistema inmunitario y ciertos estados mentales tendrn un poderoso efecto
pudiendoafectarelfuncionamientodemisistema.
SISTEMA LOCOMOTOR (ver tambin: HUESOS)
El sistemalocomotor estvinculadoamimovilidadymiflexibilidad,lo
mismoqueamiaperturainteriorymiaperturaexterior.Reneloshuesos,los
msculos,lostendonesylosligamentos.Elarmaznquesostienetodomicuerpo
est formado de los huesos. stos son los que representan mis principios
morales,miestructura,mihonradez,mirectitud,miestabilidad.Cuandome
vuelvo demasiado rgido en mis pensamientos, mis huesos tambin lo hacen y
correnpeligroderompersemsfcilmente.Encuantoalasextremidadesdemi
cuerpoymismsculos, simbolizanlaaccinyelmovimiento.Graciasamis
301

manos, puedo coger las cosas, agarrarme a ellas. Mis piernas me permiten
avanzarenlavida.Unadificultadamovermemeindicaquetengomiedode
progresar.Unafaltadehumildadounanegacinadoblarmeoaadmitirmis
errorestendrporefectoquemecostardoblarlasrodillas.Mispiesrepresentanla
estabilidad.Conservoaselcontactoconlatierrafirme,tengoambospiesenel
suelo.Cadapartedemicuerpomeayudaatomarconscienciademiflexibilidado
demirigidez.Elijoestaralaescuchademicuerpoporqueeselguademiestado
interior.
SISTEMA LINFTICO (ver tambin: GANGLIO [linftico])
Elsistemalinftico estcompuestodegangliosyvasosquetransportanla
linfahastalacorrientesangunea.Juegaunpapelimportanteenelfuncionamiento
delsistemainmunitario.Elsistemalinfticoes,enciertomodo,enparaleloconel
sistemasanguneoEstvinculadomsdirectamentealladoemocional,afectivode
m mismo. Si mi sistema nervioso est vinculado ms directamente a mis
pensamientos con mi cuerpo energtico o astral, mi sistema linftico est
relacionadomsdirectamenteconelladoafectivodemicuerpoenergticooastral.
Elamoresseguramenteelmejormediodeguardarelsistemalinfticoenbuena
saludyeficaz.
SISTEMA NERVIOSO (ver tambin: NERVIOS [en general])
Mi sistema nervioso est compuesto de nervios y centros nerviosos que
sirvenalacoordinacinyalmandodediferentespartesdemicuerpo,ascomoala
recepcin de informaciones sensoriales, psquicas e intelectuales. De hecho, mi
sistemanerviosoestvinculadomsdirectamenteamispensamientosenrelacin
conlapartedemicuerpoenergticoomental.Eselsistemadeconexinelctrica
enelplanofsicoquepermitequemispensamientossevuelvanaccineneste
mundo.
SOMNAMBULISMO (SOMNAMBULO)
Cuando soy somnmbulo, vivo una gran tensin interior a veces
inconsciente.Puedequebusquehuirdeunasituacinquemepreocupademasiado.
Me expreso de este modo para dejar escapar esta tensin. Experimento
frecuentementeelhechodeestar(inclusoinconscientemente)fuerademicuerpo.
Cuandoseproduceesteacontecimiento,micuerpoastraldirigemicuerpofsico
apartirdeestaposicinfueradelcuerpo.Poresto,comosomnmbulo,puedo
andarlosojoscerradosyver,apesardeello,losobstculosporquelosveoconla
visindemicuerpoastral.Paradisminuirestesomnambulismoenmivida,sera
preferiblequecomuniquemsloquevivoconmicnyuge,conmispadres,conun
amigo,osimplemente,queloescriba.Podrentonceshallarmscalmainteriory
normalizarmishorasdesueo.
302

SOMNOLENCIA
Puedesucederquetenga somnolencia despusdehaberdisfrutadodeuna
buenacomida.Esunmodoagradabledeprolongarestemomento.Yanotengoque
pensar,medejovivir.Tambinesnaturalverunancianoqueseduermeduranteel
dayaquellegaalfinaldesuvida.Sequedaah,cansado,esperandolamuerte.
Pero,sisoyunapersonadeedadadultayqueregularmentetengo somnolencia
duranteelda,esqueinconscientemente,meniegoavivir,meescondo,huyopara
yanotenerqueelegir,decidir,actuar.Micuerpomedicequevuelvaatomar
contactoconlavida.
SORDERA (ver: OREJAS-ODOS SORDERA)
SORDO MUDO (ver tambin: OREJAS SORDERA)
Sisoysordoporunarazncongnitaosiperdelododurantemipequea
infanciayquenopudeaprenderahablar,entoncesdirndemquesoyunsordo
mudo.82 Mi gradodeaudicinpuedevariarsinembargode0%a30%.Enmi
experienciadevida,esciertoquehaycosasquenoqueraor,yesloquemelleva
avivirestasituacin.Paraaclararloquenoqueraor,puedoinvestigarcercade
mispadresymsespecialmentecercademimadreparaencontrarloqueellano
queraor.Puedeserunasituacinenlacualsehubiesedichoasmisma:Yano
quieroorhablardeesto,mientrasmellevaba.Soyresponsable deloqueme
sucedeysiestomeafectesporque,yotambin,tenaalgoquecomprender.Tomo
conscienciadeestasituacinydesarrollocadavezmselodointeriorqueme
permitirdisfrutardelasalegrasdelavidaymepermitirdesarrollarmeconla
gentequemerodea.
SUBLINGUAL (glndula) (ver: GLNDULAS SALIVARES)
SUICIDIO (ver tambin: ANGUSTIA, ANSIEDAD, MELANCOLA)
Sipiensoenel suicidio,tomoladecisindeautodestruirme.Mesiento
vaco de energa, esta idea ocupa mi pensamiento sin parar. Me vuelvo
melanclico,solitario,llenodeamargura.Yanoconsigocrearelcontactoconel
exterior.Misufrimientoestalqueyanoveolaluz.Elsuicidioestrelacionado
conlahuida.Entonces,puedopreguntarmequesloquequierohuir.:midolor
interior,misresponsabilidades,mivacointerior,mifaltadeamor,etc.Siconsumo
droga, alcohol y que mi alimentacin es pobre en ciertos elementos nutritivos
esencialesalequilibriodemisistemanervioso,entoncespuedotenermstendencia
atenerideasdesuicidio.Decidoconfiar,cierrolosojos:laluzeslademicorazn.
82

Sordomudo:EnAmricadelNortesobretodo,seusafrecuentementeeltrminosordoenvezdesordomudo,
porque,apesardequenooigalapersona,sinembargoescapazdeemitirsonidosoinclusopalabrasmercedala
ortofona.

303

Habloconalguienoescriboenunpapelladesesperacinquevivopidiendo
ayuda.
SUPRARRENALES (dolencias de las cpsulas) (ver tambin: CUSHING
[sndrome de CUSHING], MIEDO, ESTRS)
Lafuncinprimeradelasglndulassuprarrenalesesproducirunahormona
quesellamaadrenalina.EstnvinculadasalprimerCHAKRA(centrodeenerga)
quesellamacentrodelcoxis.Estasglndulastienenporfuncinelregularizarel
pulso y la presin sangunea y permiten al cuerpo experimentar situaciones
peligrosas. Cuando me siento en peligro, o si estoy realmente en peligro, mi
percepcinpuedeserdiferente,peromicuerpocontestarenseguidaacualquier
situacin de estrs y tensin que siente como peligrosa, manifestndose dicha
situacinono.As,sepuedeconstatarqueelcuerporespondeseriamentealos
avisos que un estrs puede provocar. Puedo relacionar este peligro con una
situacin en mi vida en la cual tengo miedo de perder o bien tiempo, dinero,
premio, cnyuge, etc., porque tom una mala decisin o una mala
direccinenmivida. Entonces,quieroirmuydeprisaymuylejosenunoo
varioscamposdemividaperoestoimplicaunagrandeterminacin,elecciones
juiciosas y no me concedo el derecho al error, lo cual slo es de hecho una
experiencia de vida. De aqu un nivel de estrs intenso. Las suprarrenales se
hallanencimadelosrionesqueseconsiderancomolasededelmiedoydela
pena.Laadrenalinaqueseliberacuandoestoyenestadodeexcitacintendrpor
efectoestimularmeymeharcreativoo,alcontrario,podrcausarmelesiones,
inclusodestruirme.Unaacumulacinexcesivadeestrsconllevaunagotamiento
total.Elsndromedeestopasaoserompepuedeentoncesmanifestarsedemodo
regular.Tengointersendeshacermedemiactitudpesimistaydecidofijarmeun
objetivoenlavida.Adoptounestilodevidasimpleymeabroms,recuperomi
equilibrio.
TABAQUISMO (ver: CIGARRILLO)
TACN
Elpadecerdeun doloreneltacn meindicaquevivoangustia,quemesiento
incomprendidoysinapoyoenlascosasporhacer.El tacn siendoelpuntode
apoyo de mi cuerpo, un dolor en este lugar demuestra que vivo incertidumbre
frentealfuturo.Mesientodubitativoeinsatisfechodemodemividaymeparece
quepierdolamaestrademicuerpo.Todomicuerpodescansaenmistacones,
entoncespuedequesientanecesidaddeunapoyoslidoenlavidaparapoder
seguirandandocontotalseguridad.Micuerpomedicequepuedotenerconfianzay
avanzarcontotalseguridad.
304

TLAMO
El tlamo esunpardevoluminososncleosdesustanciagris,situadosde
cadaladodeltercerventrculodelcerebroanterioryquesirvenderelparalasvas
sensitivas. Una disfuncin de ste me indica que estoy otra vez con grandes
planteamientosfrenteammismo,aloquesoyyacmosemepercibe.Puedo
tener tendencia a estar desesperado. Tengo miedo de la opinin de los dems,
miedodequesemesubestime.Estoyalabsquedademiverdaderaidentidad.
Aprendoaaceptarme talcomosoyycomprendoquesiendoautnticoconla
gentequemerodea,manifiestoasmuchomsamorymantendrrelacionessanas
yduraderas.
TARTAMUDEO (ver tambin: BOCA, GARGANTA [en general])
El tartamudeo es la manifestacin de un trastorno de elocucin, una
dificultad parcial o grave en el hablar, decir o expresarme claramente (esto va
desdealgunaspalabrasporcasualidadhastauntrastornoregular).Sevinculaala
garganta, al centro de la comunicacin y de la expresin de s. Puede que mi
tartamudeoprovengadeunbloqueoafectivoosexualderivandodemiinfancia.
Esto no necesariamente quiere decir que viv contactos pero pude registrar un
miedo,conscientementeono,conrelacinamisexualidadenrelacinconuna
personaounacontecimiento.Esunformadeinseguridadprofundaprocedentede
lainfanciavinculadaconunodelospadres(padreomadre).Esunaespeciede
inhibicin, una incapacidad a dominar adecuadamente mis pensamientos y mis
emocionesintensasyelintentofracasadodecontrolarlaexpresindemilenguaje
queyanoesespontneo(estetipodedesordenpuedellegartempranoenlainfancia
cuando el nio estuvo ridiculizado en su derecho a llorar; No llores!)
Transformoentoncesestaemocinen tartamudeo.Tengomiedodeserclaro,
dudo,noconsigodecirclaramenteloquesiento;inhiboydesformomispalabras
pormiedoalrechazooporansiedad.Sidigoclaramenteloquevivo,cmoselo
tomarn mis padres? Soy bastante correcto para ellos? Contesto a sus
esperanzas? Mepermitenser loquesoy?Sobrepasan mispensamientosmis
palabras?.Haymuchasprobabilidadesdequeunooambospadresmosseanmuy
autoritarios y dominantes. Me siento juzgado, controlado, criticado e incluso
ridiculizadosuficientementecomoparaacabarcreyendoquemispalabrasnovalen
nada.Siendonio,puedequemehayanimpedidoexpresarme.Entoncesmanifiesto
todo tipo de desrdenes de comportamiento, yendo desde la timidez hasta el
replieguesobrem.Elprimerpasoesaceptarabrirmealniveldelcoraznamis
pensamientos,mispalabras,misaccionesyquerespetelavelocidaddeserquees
lama.Merespetotalcomosoy,sinenjuiciamientonicrtica.Aceptoexpresar
mis ideas, mis alegras, mis penas y mis miedos. Entonces puedo empezar a
hacermeconfianza,asentirmisemociones,missentimientosyaabrirmealagente
305

queamo.As,encuentrounacalmainteriorquemepermiteexpresarmeconmucho
msseguridad.Evitaraslasfarfullas,elatrabancadodelaspalabrasacausade
una mente demasiado activa, o el retener ciertas palabras cuya repercusin me
asusta.
TAQUICARDIA (ver: CORAZN ARITMIA CARDIACA)
TEJIDO CONJUNTIVO (fragilidad del)
Untejidoesungrupodeclulasteniendounamismaformaocumpliendo
unamismafuncin.Elpapeldel tejidoconjuntivo eseldesostenerlosdems
tejidosdelcuerpo,asegurandolanutricindelostejidosmusculares,nerviososy
delepitelio83,ascomoelllenadodelosintersticios(delashendiduras)quese
encuentranentreestostejidos.Debopreguntarme:Quesloquenecesito,yo,para
alimentarme, tanto emocionalmente como fsicamente y espiritualmente? Me
sientoyobastantesostenidootengolasensacindedeberhacerlotodoporm
mismo,incluyendoelhechodedeberllenarlosagujeroseneltrabajo,encasa,
porejemplo?Yaquemedesvalorizofcilmente,debosertileimportante.Me
sientofrecuentementerestringidoenmilibertadytengotendenciaaponerenlos
demslaresponsabilidaddemismales.Tengotendenciaatenerrencoryperdono
difcilmente.Tengoventajaencomunicarmisestadosdenimo,misnecesidades:
estomeayudaradescubrirme,atomarmividaentremanosyabuscarlaayuda
quenecesitoyalacualtengoderecho.
TEMBLORES (ver tambin: PARKINSON [enfermedad de])
Los temblores afectanparticularmentelosmiembrossuperioresdelcuerpoyen
especiallasmanos.Sonmovimientosirregularesqueseproducenfrecuentemente
despus de un enfado excesivo o despus de un miedo o una debilidad fsica.
Sintindomecogido,mismsculossetensanyseponenatemblar.Estoycomoun
volcnenerupcin,larabiarugeenm.Tambinpuedequeeste temblor ocurra
despusdeunanoticiaoinformacindelacualmeniegoaverlasconsecuencias
conscientemente. Entonces, hay conflicto entre mi parte consciente y mi
subconsciente. Esta tensin que existe entre ambos provoca un temblor
involuntario de una u otra parte de mi cuerpo (brazos, rostro, piernas, tronco).
Puedeserdespusdeunapreguntaquemeestabahaciendodesdehacetantosaos
ydelacualtengolarespuestaperodudodesuveracidad.Laenergaquehaba
acumuladoenmiinconscienteafuerzadedesearmilugar,seliberabajoformade
temblores.Aprendoatomarmilugar,merelajoyvivoundaalavez.

83

Untejidoquecubrelassuperficiesdelorganismodelexteriorodelinterior.

306

TENDN de AQUILES
EltendndeAquilesuneelmsculodelapantorrillaalhuesodeltacn.Es
eltendnmspoderosodelcuerpo:puedesoportarhasta400kilos(880libras).
Permitequemispensamientosydeseos,tantofsicoscomoespiritualesserealicen.
Sirve tambin a expresar cualquier bloqueo en el movimiento del tobillo. Por
ejemplo,puedotenerungrandeseodeestabilidadperoestoesdifcilderealizara
causadeunasituacinfinancieraprecaria.Sigoponiendocosasenmarchapara
realizarmissueosyparaalcanzarlosobjetivosquemehefijado.
TENIA (ver: INTESTINOS TNIA)
TENSIN ARTERIAL HIPERTENSIN (demasiado alta)
La imagen representando a una persona padeciendo hipertensin es el
presto84.Soyestapersonaquecumula,durantelargosperodos,pensamientosy
emociones que no estn expresadas; frecuentemente soy hipersensible y me
controlo mal. Mis iras y contrariedades son reprimidas, haciendo hervir as mi
interior.Tambinpuedotenertendenciaalaprocrastinacinoaaplazaramstarde
lascosasquedebodecirohacerpormiedoofaltadeconfianzaenm,yacabopor
vivirunatensinnerviosaintensa,porqueveotodoestocomounamontaaynos
sisercapazderealizartodosmisproyectos.Aspuedohacerfbulas,aumentar
misproblemasymiculpabilidadaumentarrpidamentelapresin.Mideseode
controlarlotodoyresolverlassituacionesdemiaumentamipresinquepuede
hacerseinsostenible.Viviendounmiedoprofundodeestarrechazado,mesientoen
peligroymemantengoenguardia.Lahipertensinquevivopuedetambinhallar
sufuenteenmimiedodelamuerte,conscientementeoinconscientemente,yenmi
deseodesacarpartidoalmximodemivida,porquequierorealizarlosmltiples
objetivosquemehefijado.Deboaprenderadejarsalirelvaporsuavemente.Evito
laacumulacinqueprovocalaexplosin.Aprendoahacermeconfianza.
TENSIN ARTERIAL HIPOTENSIN (demasiado baja)
Contrariamenteala hipertensin,la hipotensin sehallaenunapersona
cuyapresinesdemasiadobaja(observarqueunapersonapuedetenerunapresin
pordebajodelanormalyhallarseenplenaforma.Supresinespuesadecuada
paraellayaquesucalidaddevidanoestafectada).Sisoyunapersonaquetiene
la presinbaja,estopuedeindicarquemideseodevivirestausente.Tengola
sensacinquenadafunciona,queparamesintilhaceresfuerzosporquedetodos
modos,tengoelsentimientodequelascosasnofuncionarn.Mesientovacode
energa y no consigo llevar el peso de los acontecimientos. Me abandono al
desanimo.Elalmayanoestenmisacciones.Vivoenvctimaytengolasensacin
dequemividasepareceauncallejnsinsalida.Lahipotensinpuedellevarauna
84

Presto:Ollacerrandohermticamente,conuncontroldevaporysirviendoacocerlosalimentosbajopresin.

307

prdidadeconsciencia.Eselsignodequequierohuirdemisresponsabilidades,de
ciertassituacionesociertaspersonasporqueelhechodehacerfrentemellevara
situarmeyahaceraccionesquequizsnomeapetecehacer.Elmensajequemeda
micuerpoeshacermeconfianzayapresurarme.Elijodejarmeguiarpormifuerza
interior.
TESTCULOS (en general)
Las glndulassexualesmasculinas representanelaspectomasculino.Un
problema en los testculos frecuentemente se relaciona con los miedos, la
inseguridad,lasdudasreferentesalhechodeserhombre.Puedeindicarunafaltade
aceptacindesusexualidad,desupreferenciasexual.Elmiedoaserjuzgado
segn mis resultados puede llevarme hasta la impotencia. Cuando vivo una
situacintensa,meocurretenerlasensacindeestar sujetoporlostestculos,
sobretodosimiparejaesunapersonadepoder.Debointerrogarmesobremis
sentimientos referentes a mi virilidad y revisar mi concepto del principio
masculino.
TESTCULOS (cncer de los ) (ver: CANCER DE LOS TESTICULOS)
TETANA
Latetanasecaracterizaporcrisisquehacencontraersemismsculosymis
nervios,principalmenteenlasextremidades.Sientocmosecrispanmismanos,
mispies,todosmismsculos.Esteestadoestcausadoporunahiperexcitabilidady
se produce cuando tengo contrariedades. En algunos casos, durante crisis
importantes,misdedosseaprietanymipulgarseescondedebajodemisdedos
doblndoseenelinteriordemimano,comosiquisieraaislarsedelmundoexterior.
Quizsyotambinquieroaislarme,cortarmedelmundo,teniendoquizsincluso
eldeseoinconscientedemorir,porqueyanotengoelgustodevivir,yanotengo
alegra de vivir. Debo aprender el control de m. Elimino los pensamientos
negativosyminimizoelefectodelacontrariedad.
TETANOS (ver: MSCULOS TETANOS)
TICS (ver: CEREBRO TICS)
TIMIDEZ
Latimidezhacequepasoalladodecosasmaravillosas.Evitoalagenteque
noconozco.Temiendoserjuzgado,renuncioalascosasnuevaspretextandoqueno
sonparam.Bajolosbrazos,rehsoluchar.Tengotendenciaaadquirirseguridad
conlarutina.Meamopocoymidbilestimademymipocaconfianzaenmme
incitanaquedarmeenunmarcobienestablecido,enelcualnomesientoniherido,
308

nirechazado,niincomprendido.Estaformadehuidademi timidez mellevaa


quedarmeapartado.Detodosmodos,esmuyposiblequeestfelizasporqueme
protejotambindesituacionesopersonasquepodranherirme.Tomolacostumbre
deactuarconcalmaymedoylaoportunidaddedescubrir,cadada,nuevascosasy
nuevaspersonas.
TIMO (ver tambin: SIDA SISTEMA INMUNITARIO)
Eltimoesunapequeaglndulaubicadaeneltraxyqueproduceuntipo
deglbulosblancos(linfocitosTquejueganunpapelesencialenlarespuesta
inmunitariadelorganismo.El timo eslaglndulaendocrinaqueestvinculada
directamentealcentrodeenergadelcorazn,tambinllamadochakradelcorazn.
Suactividaddisminuyeconlaedad.Unadificultadeneltimomeindicaquetengo
laimpresindequehanvenidoaquitarmealgoquemeperteneca.Puedeserun
trabajo,uncnyuge,unobjetomaterial,etc.Mehanquitadoelpandelaboca!
Entoncesmehesentidoelespaciodeunmomentosindefensa,sinsabercmo
reaccionar.Comprendocuantoestoyprotegidoenmividadecadada.Apreciolo
quetengoenelmomentoactual,porquelavidasloesmovimientoyloquetendr
maanapuedeserdiferentedehoy.Cuantomsmedesprendodelmundomaterial,
msgrandeesmisentimientodelibertad!
TIMPANISMO
Eltimpanismoeselaumentodelasonoridaddeltraxodelabdomen.Selopuede
detectargolpeandounazonadelcuerpoconlosdedos;estosuenacomoenun
tambor. Este estado puede ser el signo de que soy una persona de muy gran
sensibilidadyqueconservoenmmisemocionesenvezdedejarlasirlibremente.
Para protegerme de mi sensibilidad, razono mis emociones para tener la
sensacin,conmiintelecto,deconservarelcontrolsobreellas.Acepto vivir
plenamente mis emociones, porque son una riqueza para descubrir diferentes
facetasdemmismo.
TIROIDES(en general)
La glndula tiroides se halla en la base del cuello. Est vinculada
directamentealcentrodeenergadelagarganta,tambinllamadochakradela
garganta.Elpapeldeestaglndulaessecretardoshormonasmuyimportantes,bien
la tiroxina y la tiotironina que tienen como particularidad el contener iodo,
reconocidoporserunpoderosoantispticonecesarioalbuenfuncionamientode
todoelcuerpo.Sinellas,nopodravivir.Uncasodehiperohipofuncionamiento
delatiroidespodrpresentarsesitengoelsentimientodesiemprereprimirinsultos
oquelavidaesinjustaconmigo.Complacindomeenestepapel,llegoinclusoa
provocaralrededormosituacionesproblemticasparasercadavezmsunapobre
vctima.Elcuello,quejuntalacabezaconmicuerpo,hacedeestarealaunin
entreelcuerpoylamente.Simiorgulloesmuyfuerteyquecierramicorazn,
309

pasoalladodemisverdaderasnecesidades.Elcentrodeenergadelagarganta
representamicreatividad.Aprendopuesaexpresarmelibrementeyusotodosmis
medios.Desarrollomiespritucreador.
TIROIDES BOZO
El bozo suele indicar que mi glndula tiroides est sobre activa. Esto
proviene de una aceleracin de varios procesos corporales y mentales. Esta
glndulaesresponsable,entreotrascosas,delaregulacindelprocesorespiratorio.
Estestrechamentevinculadaamideseodevivir,amicompromisoaentrarenla
vida.Lahipertiroidaesunarespuestaestresantequerevelamiangustia,mipena,
en resumen emociones intensas no expresadas que hacen hinchar mi glndula
tiroides(garganta).Tengolasensacindequetodovademasiadodeprisa!Esto
tambinpuederesultardelsentimientodeestarahogadoporlavida.Miglndula
tiroides secuestiona,osea:Deboseguirmanteniendolavidaono?Necesito
expresarmisnecesidades,misdeseos,misemocionesenvezdereprimirlas,para
permitirquemiglndulatiroidesfuncionenormalmente.Enelcasodequeelbozo
resulte de la hipotiroida, es decir que la glndula tiroides trabaje
insuficientementeduranteunlargoperododetiempo,comosisedesmayase,esta
manifestacin deja ver mi personalidad pesimista y mi tendencia a la
desesperacin,porquetengopocoelgustoderealizarcosasyadoptounaactitudde
vctimafrentealoquemesucede.Vivoasmuchacontrariedadyamarguray
tengolasensacindequeelmundoenteroestencontrama.Debodesarrollaruna
actitudmspositivayasumirmeparapoderalcanzarmisobjetivos.
TIROIDES HIPERTIROIDISMO
Indicaunahiperactividad,unaactividaddemasiadograndedelaglndula
tiroides.Mimetabolismoaumenta.Porlotantotengocaloresytranspiro.Vivouna
grandecepcinpornopodercumplirloquequierorealmenteoexpresarloque
debodecirporquerespondoalasesperasdelosdemsenvezdelasmas.En
consecuencia, vivo rencor, frustracin, odio haca todo lo que no corresponde
realmenteamisesperas;Tambinpuedoescucharlosconsejosdelosdemssin
escucharmeinteriormente.Adems,medoyplazosmuycortosenlascosaspor
hacer,locualmepidesiempreapresurarmeparaterminaratiempolosproyectosen
curso. Siemprehayqueirmsdeprisa! Cuandomitiroidesesthiperactiva,
frecuentemente tengo dificultad con el tiempo y con el hecho de hacer tarde.
Entonces,micuerpomedaunmensaje.Tomoconscienciademipoder.As,tomo
mis decisiones y creo mis acciones segn mi discernimiento interior. Soy co
creadordemivida.

310

TIROIDES HIPOTIROIDISMO
Elhipotiroidismoesunsubfuncionamientodelaglndula tiroides,una
insuficiencia de la tiroides. Puede provocar una prominencia de los ojos. Las
causasfsicasson:undesarreglodelsistemainmunitario,unadestruccindela
tiroides por una tiroiditis formando anticuerpos que atacan la glndula y una
carenciadeiodolocual conduceaunincrementodelporcentajedecolesterol,
cansancio, dolores musculares, un hormigueo y fro en las extremidades,
estreimiento y una disminucin de los reflejos. Incluso puede aparecer el
desanimo hacindome triste, pesimista y suscitando el sentimiento de estar
incomprendido. Mi cuerpo me transmite un S.O.S. Las causas metafsicas son
tambinimportantes.Elchakradelagargantaestvinculadoamicomunicaciny
amicreatividad.Cmoesmicomunicacinconmigomismo,conmisfamiliaresy
losdems?Cmoesqueejerzomicreatividadenloquehago?La hipotiroida
tambinpuedeprocederdemiincapacidadaafrontarunasituacinquereaparece
repetidasvecesenmividafrentealacualnoscmoreaccionar.Soycreadorde
mivida.Comunicolaarmonaportodaspartesalrededormo.Tengofeyveola
vidaconunanuevamirada.
TOBILLOS(vertambin:ARTICULACIONES)
Eltobilloesunapartedelcuerpomuyflexibleymvil.Sirveparasostener
el cuerpo y,por su posicin fsica, sufregrandes presiones. Esuna especie de
puente,nexoentreyoylatierra.Esacausadeellasiestoygroundado 85 enel
suelo,silaenergaespiritualviajadesdearribahacabajoyviceversa,siestoyen
contactoconlatierramadre.Tambinesellugarenelcualexpresomicapacidad
deadelantar,delevantarmeydemantenermedepie,estableyanclado.Eltobillo
ejecutaloscambiosdedirecciny,porconsiguiente,representamisdecisionesy
miscompromisosquesetomanteniendoencuentamiscreenciasymisvalores.
Cualquier herida o dolor en los tobillos est vinculado con mi capacidad en
mantenermeflexible,mientrasvoycambiandodedireccin.Sitengomiedodelo
quederiva,sisoyinflexiblefrenteaunadecisinquetomar,sivoydemasiadode
prisasinreflexionar,sitengomiedodemisresponsabilidadespresentesofuturas,si
tengolasensacindeserinestable,corroelriesgodefrenarlaenergaenmis
tobillos.Segnlaintensidaddelbloqueodeenergaydemicierrealflujodevida,
puederesultarunesguince,unatorceduraounafractura.Nopuedotenermeenpie
sinmistobillos.Quizsdebaapoyarmeennuevosmodosdeverlascosas,nuevos
criteriosquesonmsabiertosyflexibles.Tomancuidadodemydemiser
interior,mesoportanenlavida.Siuntobillocedeoserompe,yanotengobase
slida,necesitocambiardedireccin,vivounconflictomental.Mitobilloyano
puedesoportarmeyeselcuerpoenteroquecedefsicamente.Enciertosentido,mi
vidasederrumbatambin,peroesmslaimagendequehayalgoquenovaenvez
deunderrumberealdelapersona.Referentealatorcedura,eltobillotorcido,es
85

Groundado:Anglicismoquesignificasentirseconectadoalatierraoalmundomaterial.

311

laenergaquesetuerceeneltobilloymiestructuradesoporteestdesformada.
Yanohaynadaclaroydefinido.Cuandoestoyconfrontadoaalgomuyprofundo,
uncambio obligado paramiestarmejor,semanifiestala ruptura o fractura.
Verdaderamente, debo cambiar de orientacin. Estn en juego mi honor, mi
seguridad,miobjetivoymiorientacinenlavida. Pocoimportaladolencia,el
perododeinmovilidadquesigue,permiteamicuerpoyamiserinteriorintegrar
adecuadamenteelaspectodemividaquedebocambiarypermitetambinala
maravillosatransformacinquesigueparamdeinstalarse!Acepto laviday
todoloqueellaponeenmicamino.Estomeayudaraabrazarlavidadelbuen
lado!
TORTICOLIS (ver: CUELLO TORTICOLIS)
TOS: (ver tambin: GARGANTA / [en general] / [dolores de])
La tos es un estado frecuentemente minimizado, incluso negado. Sin
embargo, demuestra una irritacin; bien sea a nivel de la garganta o de los
pulmones,vivounatensinnerviosaquemeirritaydelacualmequieroliberar.
Puedo sentirme ahogado por una situacin, por una persona. Vivo frustracin,
tendraganasdegritar,deescupirmipena,peromieducacinmeloprohibe.
Tosiendo, logro liberarme de mis emociones. Puede ser tanto la soledad, la
amargura, la tristeza, la incomprensin, la frustracin, el aburrimiento, etc.
Aceptandoreconocerloquemeirrita,mitosseir.Puedeserperfectamenteun
aspectodemmismoquetengodificultadenaceptar .Sipersiste,esqueno
consigoliberarme.Serabuenoquetomeuntiempodepausaparadescubrirlas
causas demi irritabilidadparapor finllegaracorregirlassituaciones queson
irritantesyparasentirmebienconlasquedeboaceptar.
TOS FERINA (ver: ENFERMEDADES DE LA INFANCIA)
TOXICOMANIA
(ver
tambin:
ALCOHOLISMO,
CIGARRILLO,
COMPULSIN NERVIOSA, DEPENDENCIA, DROGA, PULMONES [en
general]
La toxicomana se caracteriza por el consumo abusivo de diferentes
productostxicos,regidosporlaleyono,entreloscualesseencuentraneltabaco,
losmedicamentos,elalcoholylasdrogasbajotodassusformas.Desarrolloasuna
dependencia psquica o fsica. Esta necesidad irresistible de consumir
demuestra un gran miedo a verme tal como soy. Prefiero la huida, la
inconsciencia.Sinsabercmoamarme,nopuedoconcebirquelagentequeme
rodeameameymeaprecie.Meescondoenunmundofantsticoenelcualcreo
quenadapodralcanzarme,jams.Meduermosuavementerechazandomisheridas
en lo hondo de m mismo. Me duele e incluso yo, ya no lo veo. Dndole la
312

oportunidad de ser yo mismo, puedo descubrir el ser maravilloso que soy y


abrirmealamor.
TRANSPIRACIN (ver OLOR CORPORAL)
TRAQUEITIS (ver: RESPIRACIN TRAQUEITIS)
TRISMUS (ver: MSCULOS TRISMUS)
TRISTEZA (ver tambin: PENA, MELANCOLA, SANGRE /
COLESTEROL / DIABETES / HIPOGLICEMIA)
La tristeza se define como un estado natural o accidental de pena,
melancola.Unatristezaprofundapuedellevarmeavolvermediabtico.Estodo
micuerpoelquerechazalaalegradevivir.Tengolasensacindequenadame
sonre,sientolapenaquecorreatravsmo,micoraznsedesgarra;esteinmenso
vacoparecequerercreceradentromoparadejarsitioaestapelotadepena.Quiero
questaexplote,tengonecesidaddepicanteenmivida,decalorquepondren
ebullicintodaslaslgrimasqueestnenmyquedejarntambinmicuerpo,
comoelvaporquesereneconelcielo.Aspodrcolmarestevacodedulzuray
ternura.Ylasideasoscurassedesvanecern;encontrarmidinamismoymialegra
devivir.
TROMBOSIS (ver: SANGRE TROMBOSIS)
TUBERCULOSIS (ver tambin: PULMONES [dolencias de los ])
La tuberculosis es una infeccin por el bacilo de Koch que se ubica
frecuentementeenelinteriordelospulmonesperoquetambinpuedealcanzarpor
vasangunealosriones,elsistemaurinario,etc.Losprincipalessntomasson,
entre otros, bronquitis repetitivas, un cansancio anormal, fiebre prolongada,
escupidodesangre.Cadaunodeellosmerevelaquesientoiradentrodemyque
no hay alegra en mi vida. Tengo la sensacin de estar olvidado, abandonado,
perdermisfacultades.Desearaguardarparamsoloalagenteaquienamo.Mi
egosmomellevaaestarcelosodeloqueposeenlosdemsymesientovctima,
con rencor haca el resto del mundo y buscando vengarme de l. Ya que los
pulmones estn afectados, la tuberculosis evidencia tambin mi miedo de la
muertequeesmuypresenteyqueinvademispensamientos.Esporestemotivo
quedespusdelasguerras,hayunaumentodelatuberculosisporque,enmuchos
casos,pudehallarmeensituacionesenlasquecayeronbombascercadellugaren
dondeestaba,queelenemigopodamatarme.Dehecho,vivvariassituacionesen
quehubiesepodidomorir.Esmuyimportantequetomeconscienciadelobjetode
313

estemiedoyquesepaqueestoyprotegidoentodomomento.Debosuperareste
miedoalamuerteyvivirelmomentopresente,saboreandocadainstante.
TUMOR(ES) (ver tambin: QUISTE)
Untumorescomparableaunmontndetejidosinformes,pudiendohallarse
endiferenteslugaresdelcuerpo.Seproducegeneralmentedespusdeunimpacto
emocional.Guardandoenmviejasheridas,pensamientosnegativosfrenteami
pasado,stasseacumulanyformanunamasaqueacabaporhacerseslida.Me
convienetomar conscienciaqueestamasa bloqueaelpasodeunapartedemi
energa que quiere circular libremente. Es importante que pueda expresar esta
desesperacinqueestdentromo;debotomarenserioestemensajequemedami
cuerpo. Dejo sitio al presente, expreso mis sentimientos. Si rehuso, tendr la
sensacindequeunapequeavozinteriordentromomedice:tmueres86 a
fuegolento.
TUMOR EN EL CEREBRO (ver: CEREBRO [tumor en el ])
LCERA(S) (en general)
Unalcerapuedehallarseenlapielenelexteriordelcuerpo(brazo,piernas,
cornea del ojo, etc.) o en la pared de un rgano interno (estmago, intestino,
hgado,boca,etc.).Unalceramellevaratomarconscienciadequevivograndes
miedoseinseguridad.Meindicaquemehabitaunestrsintensoyquemesiento
corrodo, molesto, comido. Segn el lugar del cuerpo donde se desarrolle mi
lcera,meesposibledescubrirloqueprovocaesteestado.Porejemplo,sisehalla
en mi boca, puedo preguntarme lo que debo decir. lceras de estmago
demuestranquehayalgoquedigieromal.Reglageneral,unalcerameindicaque
dejoquelascosasolagentemeirriten.Aprendoadejarfluir,acalmarme.
LCERA PPTICA o GSTRICA (duodeno o estmago)
lcerasdeestmago puedenproducirsesitengounadbilestimadem.
Quierotantocomplacer alosdems queestoy listoparatragar cualquier cosa.
Actuandoas,reprimomisemocionesymispropiosdeseos;nomerespetoyacabo
por reprochar a los dems de no respetarme. Me siento embaucado para mis
adentros y llego hasta dramatizar cualquier suceso de mi vida. Adems tengo
dificultad en digerir todas estas contrariedades, estas inquietudes. Es como un
exceso de irritantes que se transforma en lcera. Este irritante puede ser una
personaounasituacinquequieroevitarveroafrontarperoestoesimposibley
estomequedaenelestmago!Quisieraexpulsaresteirritantedemiespacio
86

Delverbomorir;sonidocasiidnticoatumores.

314

vital,demiterritorio.Tengotendenciaacriticarmeseveramenteeinclusoquiero
llegaraautodestruirme.Micuerpomeindicaqueestiempodequedescubralas
cualidadesqueestnenm,quemeaprecieamijustovaloryqueacepte mi
necesidaddeamor.
UMBILICAL (hernia) (ver tambin: HERNIA)
La hernia umbilicalpuedeserunamanifestacindemidisgustoodemi
pesarporhabermetenidoquedesprenderdelentornotiernoyseguroqueerael
vientredemimadre.Ahora,tengolasensacinquedeboarreglarmesoloydebo
haceresfuerzosparaalcanzarlosobjetivosquemehefijadoyquesevuelvende
golpemuchomenosexcitantes.Acepto quetengotodoelpotencialnecesario
paraalcanzarmisobjetivosyquelavidamesoportatotalmente.
UAS (en general)
Lasuasrepresentaneltejidoduroymienergalamshondayespiritual.
Se manifiestan en mi cuerpo en los lugares ms prolongados. Pueden estar
afectadoscuandomiactividad(omidestreza),midireccintiendenacambiary
quetengodificultadenenfrentarmeaestoscambios.Las uas representanasel
sentimientodeproteccinquetengoconrelacinatodoloquesucedealrededor
mo. Tengo eleccin para usar mis uas negativamente (para agredir, para
defendermeyparahacerdaocomolohaceelanimal)opositivamenteusndolas
paramidestrezaymicreatividad.Cualquieraquesealaenergaempleada,puedo
descubrirelestadodestadefiniendoelestadodemisuas.
UAS (comerse las)
Si me como las uas, esto indica una nervosidad interior muy grande.
Tambinestopuedeserunainseguridadprofundadenosentirmecapazdesero
hacer loquese esperadem.Sise tratade unnio,esto puedemanifestar la
presenciaderencorofrustracinfrenteaunodelospadres,estasituacinpudiendo
tambin producirse cuando me he vuelto adulto. Puedo sentirme incapaz de
asumirmeydeserautosuficiente,yquieroquelosdemssecuidendem.
Tambinpuedocomermifrenoreprimiendomiagresividad;poniendoaguaen
mi vino, puedo dejar entrever un desbordamiento inminente de emociones no
expresadas.Porlotanto,tengoventajaenexpresartodasmisemocionesyponerme
abuscarmiseguridadymiconfianzaenmiinterior.
UAS AMARILLAS (sndrome de las)
Elsndromedelas uasamarillas semanifiestacuandolas uas demis
dedosdelasmanosodelospiestienenuncoloramarilloverdoso,cuandoson
gruesasyencorvados.Bajoelngulomdico,estoseproducecuandolacirculacin
315

demisistemalinfticoesinadecuada,estoatribuyndoseatrastornosrespiratorios
crnicos.Misuassonunaproteccinparamisdedosdelasmanoscomodelos
piesymicuerpomemanifiestaquedeboaumentarmisproteccionesporqueme
sientofrgilynohagofrentealosacontecimientosdelavida(pulmones=vida)
enlospequeosdetallesquesepresentanamhoyomaana.Mividameparece
apagada. Busco en mi interior lo que puede aportar ms pasin en mi vida.
Aumentoenmlaenergavitalparaquesemanifiestehastaelfinaldemisdedos.
UAS BLANDAS Y FRGILES
Las uas representan mi vitalidad, el estado de mi energa vital. Uas
frgilesexpresanundesequilibrioalniveldemienergayreferentealautilizacin
quehagoconella. Uasblandas expresanelcansancio queestoyviviendo,la
indiferenciaquemehabita.Mividaesttanapagadacomomisuas.Soyyoquien
deboponerpicanteycuidardeusarbienmienerga.
UA ENCARNADA
Una uaencarnada indicaculpabilidadonervosidad frenteaunanueva
situacin. Tambin puede representar un conflicto entre mis deseos mentales y
espirituales.Sisetratadelauadeundedo,setratadeunasituacindemivida
diariay,msfrecuentemente,sisetratadelauadeundedodelpie,setratade
unasituacin odecisin de caraal futuro. Si se tratadel dedo gordo,la ua
encarnada puede representar mi inquietud frente a la presin que creo deber
afrontarenelporveniryfrentealacualmesientoyaculpableporquemetemono
podervivirestefuturoconarmonayxito.Esimportanteverculdedodelamano
odelpieestafectadoparatenerinformacionescomplementariassobreelaspecto
demividaalcualhedeajustarmeeliminandoalavezmiculpabilidad.
UREMIA (ver tambin: RIONES [problemas renales])
Lauremiaesunporcentajedeureaanormalmenteelevadooanormalmente
bajoenlasangre.La urea eselcomponenteprincipaldela orina.La uremia
procede habitualmente de una insuficiencia renal en el caso de un porcentaje
elevado o de una insuficiencia heptica (del hgado) grave en el caso de un
porcentajeanormalmentebajo.Laorinaestvinculadaconmisviejasemociones
quequierensereliminadas.
URETRITIS (ver tambin: ANEXO III)
La uretritis es una inflamacin del canal que conduce la orina desde el
cuellodelavejigahastaelorificiodelurter.Esteestadomeindicaqueacepto
difcilmentedejarelpasoaunasituacinnuevayquedejolugaralaagresividad.
Tengointersendejarcircularmslibrementelasnuevasideasyguardarlamente
316

abierta frente a mis opiniones que pueden cambiar, sabiendo que soy
constantementeenevolucinyencambio.
URTICARIA (ver PIEL URTICARIA)
UTERO (en general) (ver tambin: CNCER DEL CUELLO UTERINO,
FEMENINO [dolores])
El terosimbolizamiestadodemujer,eselhogardemicreatividad.La
nidacinseoperaenestesantuarioclidoyseguro.Problemasde ovarioso de
teromeindicanqueestiempoquedesarrollemicreatividadquemedarelpoder
deadministrarmivida.Tengointersenpreguntarme:Cmomesientocomo
mujer?Mesientoculpable,avergonzadaotraicionadaenelhechodehabertenido,
ono,hijos?Encuentroqueesdifcilsermujer,esposa,madre,mujerdenegocios,
amante?Puedequetengalasensacinderetroceder!Enestaregindelapelvis,
meesposibledaraluzotravez,hacerrenacernuevosaspectosdemiser;puedoir
hacadelanteenmibsquedademmisma.Sisedesarrollaunaenfermedadenmi
tero, tal como un tumor por ejemplo, puedo preguntarme cmo percibo la
sexualidaddelosdemsyparticularmentelademishijosydemisnietos.Tengola
sensacinquenoescorrecta,quesaledelanormalidad,queestonosehace?Los
sientoenpeligromoralofsico?Hayalgnriesgodequeestnheridos?Hay
algoqueencuentrofeoenrelacinconmishijosyasuvidadepareja?Estoy
molestadofrentealpapeloellugarquetomacadamiembrodelafamilia?Todas
estasinterrogacionespuedenreferirseamishijosomisnietosverdaderosoaun
sobrino,unvecinoounalumnoqueconsiderocomotal.Cualquiersealasituacin,
tomoconscienciaquenotengopodersobrelavidadelosdemsyquecadacual
vivesuvidaasumodo.Dilamejoreducacinamishijos,delmejormodoposible
ypuedoestarorgullosadeello!
TERO (cncer del cuello del ) (ver: CNCER DEL CUELLO
UTERINO)
VAGINA (en general)
La vagina esestamembranamuscularqueestsituadaentrelavulvayel
tero en la mujer. Las enfermedades que estn vinculadas con la vagina
frecuentementetendrnsuorigenenmifrustracinpornopoderrealizarelactode
unincarnal,bienporquenomelopermitomoralmenteoporquenotengoeste
hombreconquienpodravivirnuevasexperiencias.Acepto abrirmealamor
bajotodassusformasparadesarrollarmeplenamente.

317

VAGINA COMEZONES VAGINALES ( ver: COMEZONES VAGINALES


VAGINAL HERPS (ver: HERPS VAGINAL)
VAGINALES (espasmos) (ver: ESPASMOS)
VAGINALES (prdidas) (ver: LEUCORREA)
VAGINITIS (ver tambin: CNDIDA, LEUCORREA, ORINA [infecciones
urinarias])
Lavaginitisesunainfeccindelavagina(similaralacndidaoahongos)con,
adems, olores nauseabundos. Enlamayoradecasos, demuestra quealimento
frustracinhacamiparejasexualotambinquevivoculpabilidad.Siusoelsexo
paraejercer unpoder ouncontrolsobremicnyuge,esposiblequeconozca
regularmenteproblemasdevaginitis.stapuedeserlaexcusaidealparanohacer
elamoryas,castigaramicnyugeprivndoledesexo.Laintimidadqueengendra
una relacin sexual puede desencadenar varios sentimientos vinculados a la
memoriaoalmiedo:miedodesentirmeincomprendidaoheridaotravez.Adems,
laemisindeoloresdesagradablespermiteliberaremocionesnegativas,penasy
angustiasacumuladas,lascualesestnprofundamentehundidasenelmismotejido
vaginal.Lavaginaesellugardedondeemergentodosmissentimientosreferentea
la sexualidad: si stos son positivos, vivir placer sexual. Al contrario, una
infeccinaparecesivivoculpabilidad,miedos,vergenza,conflictos,confusin,
ascomomisrecuerdosdeexperienciasabusivasosiquieroautocastigarme.Me
quedoabiertaparavivirunasexualidadarmoniosa.Estoformapartedelavidayde
lafelicidadalacualtengoderecho.
VARICELA (ver: ENFERMEDADES DE LA INFANCIA)
VARICES (ver: SANGRE VARICES)
VEGETACIONES ADENOIDES (ver tambin: AMGDALAS)
La enfermedad de las vegetaciones adenodes, comnmente llamadas
vegetacionesesunainfeccinafectandomsparticularmentealosnios.Estose
traduceporlahipertrofiadelasamgdalasdelafaringesituadasdetrsdelasfosas
nasalesprovocandounaobstruccinalniveldelanariz,queobligaasalnioa
respirar por la boca. Teniendo una sensibilidad muy grande y dotado de una
intuicinmuydesarrollada,bloqueominarizparaevitar olerlascosas queme
daan.Puedeserundetallemuycomnyanodinoalcualdarproporcionesyun
amplitudelefantescas.Avecesmesucedesentirquenotengomilugarenesta
familia;vivorabiaymesientorechazado.Tensionesoconflictosfamiliaresson
318

propiciosalaaparicindelasvegetaciones.Acepto tomarellugarqueme
correspondeenlaarmona,participomissentimientosyreconozcolosbeneficios
delaintuicin.
VEGETATIVO CRNICO
CRNICO)

(estado)

(ver:

ESTADO

VEGETATIVO

VEJIGA (dolores de) (ver tambin: ORINA [infecciones urinarias])


La vejiga eslareservaendondelaorinaestenesperadeestarsoltada.
Representa tambin las esperas que alimentofrente a lavida. Problemas de
vejiga meindicanquepuedotenertendenciaaagarrarmeamisviejasideas,que
meniegoasoltar.Resisto alcambioacausa demiinseguridad.Lasdolencias
demuestranquevivoansiedaddesdehacemuchotiempoyqueestiempoparam
de soltar libremente mis emociones negativas indeseables. As, mi vejiga me
impedir ahogarme en mi propia negatividad. Infecciones urinarias son la
indicacindequevivomuchasfrustraciones,penaeinseguridadnoexpresadas.
Puedocuestionarmeparaconocerloqueretengoenmividayquemeinteresa
soltar.Estossentimientospuedenestarvividosenunasituacinenqueestnen
causaloquemeperteneceyloqueconsiderocomoformandopartedemiterritorio.
Puedeser,porejemplo,unasituacinenquetengonauseacadavezenquellego
acasayqueestsuciaydesorden.Lavejigarepresentatambinelcampodelas
relacionespersonales.Ocurrefrecuentementeporlotantoqueestasinfeccionesse
manifiestenenelperodocercanoalalunademiel,duranteunarelacinmolestao
conflictualoincluso,conocasindeunaruptura.Lalunademielounaprimera
experienciasexualpuedetraerdiversosproblemas,inclusodecepcionespudiendo
traer ira o resentimiento frente a mi pareja, como si fuese responsable de mi
insatisfaccin.Unarelacinenrupturaesgeneralmentelaconclusindelosno
dichos,emocionesreprimidasenmiinterior.Escomosihundieseenlomshondo
demmisproblemaspsicolgicos,provocandounapresinconstante.Tengoque
comprenderquealliberarmedeestapresin,sentirinevitablementeunalivio.Me
liberodemisviejascreenciasydejositioparalonuevoenmivida.
VEJIGA CISTITIS (ver tambin: ANEXO III)
Lacistitisesunainflamacindelavejiga.Ciertosacontecimientosociertas
situaciones me llevan a retener mi irritacin y mis frustraciones. Estoy tan
preocupado en mis esperas que mi vejiga se inflama. Vivo un estado de gran
presin.Tomoconscienciadequeesesencialsoltarparaliberarmedeellasporque,
retenindome,bloqueomienergasloporquetengomiedo.Eldisgustofrentea
losacontecimientos,elcualproduceunatensinnerviosa,inflamarmi vejiga.
Aceptovivirelinstantepresentealmximoycomprendoquesiendoabierto,
mepermitosaborearmaravillosasexperiencias.
319

VENAS (dolencias en las) (ver tambin: SANGRE CIRCULACIN


SANGUNEA)
Unavenaesunvasosanguneoquetraelasangredelosrganosdevuelta
hacaelcorazn.Cuandolasvenasvienendelospulmoneshacaelcorazn,traen
lasangrerojapurificada,cargadadeoxgeno.Cuandolasvenasvuelvendelos
demsrganoshacaelcorazn,traenlasangreazulvacadeoxgenoycargada
dexidodecarbonoCO2.Enlavida,nuncatuvebuenavena!(=suerte).Escomo
decirquenuncapudeencontrarlaalegradevivir.Lasangrecirculaenmisvenas;
lasangre,eslavida,laalegradevivir.Estoyconstantementeencontradiccincon
mivozinterioryloquehagoenmivida.Mesientodecepcionado,superado.Vivo
en un estado de inercia, ya no veo siquiera las bellas cosas que me suceden.
Carezcodeenerga,mesientovaco.Nomesientoapoyadoporlavidanipormi
entornoyveotododecolornegro.Misvenascoronariasestarnparticularmente
afectadassitengomiedodeperderaalguienoaalgoqueposeoyquemeresisto
asoltar.Lovivocomounpeligroqueacecha mi territorio,esdecirobien mi
cnyuge,micasa,mifamilia,mitrabajo,misideas,etc.Aceptodejarfluirla
alegraenm.Reconozcolosbuenosmomentos,aprendoarelajarmeyrecobrola
pazinterior.
VENAS VARICES (ver: SANGRE VARICES)
VENREAS (enfermedades)
Una enfermedad venrea puede sugerir que subsiste un sentimiento de
culpabilidad frente a mi sexualidad. Frecuentemente, la educacin religiosa me
revellasexualidadcomoalgosucioeimpuro.Sintindomeavergonzado,creoque
debocastigarmerechazandomispartesgenitales.Meautocastigoymeauto
destruyo. La energa sexual es sumamente importante y poderosa, forma parte
integrante de mi programa gentico para la supervivencia de la especie. En
consecuencia, una enfermedad venrea implica una afeccin o una infeccin
vinculadaaestaenerga.Siladesestimo,tendrtendenciaagirarsecontram,a
volverseenferma,dndomeaslaocasindedescubrirqueloquehagoesten
desarmonaconelflujonaturalyelequilibriodeestaenerga.Esimportanteque
aceptequelasexualidadesunmododeexpresarmiamorymideseodeunirme
alotro.
VERRUGAS (en general) (ver: PIEL VERRUGAS [en general])
VRTIGO, DESMAYOS (ver tambin: SANGRE HIPOGLICEMIA)
Tenervrtigosodesmayosesunmododehuirunsucesoounapersonaque
meniegoaveruor.Puedotenerlasensacindequeunasituacinevoluciona
demasiadorpidoparamytengomiedodeloscambiosquetraerenmivida.Es
320

como si no tuviera referencia para dirigirme y por lo tanto puedo tener la


impresinquemipadre,oelquerepresentalaautoridad,estausenteoque
deberaayudarmemsencuantoalasdireccionesportomar.Prefierocerrarme,
huyo.Quisieracontrolarlotodo,tantoloquesucede enmiinterior comoenel
exterior mopero,siendoesto imposible,mevuelvoinestable yansioso. Enla
mayora de los casos, si padezco de vrtigos y desmayos, puedo sufrir
hipoglicemia. Es importante que descubra la alegra de vivir, que me ofrezca
algunosdulcesyquehagaconfianzaalporvenir.
VESCULA BILIAR (ver tambin: CLCULOS BILIARES, HGADO
(dolencias de])
La vesculabiliar esunareservamembranosasituadadebajodelhgadoy
dondeseacumulalabilisquesecretaste.Lasdificultadesaestenivelsevinculan
a patterns emocionales y mentales que estn llenos de amargura e irritacin,
frente a mi vida o frente a los dems. Si stos se fijan y endurecen, se
transformarnenclculosbiliares.Simivesculabiliarnofuncionabien,puede
queestoprocedademiinseguridadodemisinquietudesfrenteaalguienaquien
amoyquiero.Elhechodevivirapegoparaconestapersonapuedellevarmeavivir
emocionesquemecuestaadministraryasumir.Tambinpuedotenerlasensacin
desiempretenerquejustificarmisactosyfrecuentementepercibirlassituaciones
demividacomoinjustas,loquemellevaavivirmuchaira.Tengopuesintersen
liberarmedeestossentimientosamargosirritantes.Debomsbienconsiderarcada
experienciaquevivocomounaocasindeconocermemejoryusarmisensibilidad
demodopositivoycreador,envezdecontrolaromanipularalosdems.
VIENTRE (ver tambin: HINCHAZN [DEL ABDOMEN], INTESTINOS
[dolencias de los])
El vientre o abdomen eslaparteinferioryanteriordeltroncohumano,
conteniendoprincipalmentelosintestinos.Igualcomoenmividadecadada,sime
lleno demasiado rpido de alimento, tengo el vientre lleno, tengo ganas de
dormiryvivociertaincomodidad.Deboaprenderatomarmitiempo,aingerircada
situacinnuevaunadespusdelaotra,paradejarmetiempodeadaptarmealos
cambios que tienen lugar en mi vida, evitando as de vivir impaciencia y
frustracin. El niocrece dentro del abdomen yah se preparapara pasar del
estado solitario a un estado ms social; el abdomen es pues la regin de las
relaciones.Todaslasdificultadesdeestareginestnvinculadasconlosconflictos
obloqueosentremmismoyeluniversoenelcualestoy,stossiendoexpresados
atravsdelasrelacionespersonalesquehacenmirealidad.Tengointerspuesa
aprenderareconocermispensamientos,missentimientosatravsdelosdemsy
eneluniversoquemerodea.Enelabdomenresidemimsprofundaintenciny
misentimientodeloqueestbienoestmal,enfermedadesaestenivelmedan
321

unabuenaindicacindeloquesucedeenmividainterioryenelniveldemis
emociones.
VIOL ACIN (ver tambin: ACCIDENTE, MIEDO)
La violacin estrelacionadaconunagranculpabilidadparaconlapropia
sexualidad,sobretodoenpensamiento,pormiedoaloquepodrasuceder!.Por
lotanto,la violacin aquplanteadase vinculaalasexualidad, esdecirauna
relacinsexual impuesta, sinelconsentimientodelapersona.Aunquenohaya
tenidoquevivirtalexperienciaanivelsexual,puedequesinembargo,hayatenido
quevivirlaenotrosaspectos.Enefecto,siyamerobaronenmicasa,alentrar
puedequetengaunsentimientointensocomosimehubiesenviolado.Elmodoen
quedejoquemetratelagentereferenteamisgustospersonales,misideas,mis
valorespuedepercibirsecomounaviolacin.Puedovivirunaviolacindentrode
mimatrimoniotambin.Situvequevivirunaviolacinounabusosexual,puedo
mirarsimiignoranciadelasexualidad,inclusoinconsciente,eraatalpuntogrande
que pude atraerme (energticamente hablando) esta situacin como para
liberarme de mi miedo. Conscientemente, no quise esta situacin, pero debo
comprenderelfuncionamientodelsubconscienteparadarmecuentadequepuede
programarunsucesoparaliberarmedemimiedo.Debovigilaryyanopensarque
soyculpabledeloquemehasucedido,sinomsbienmirarelporquestome
sucedi,paraayudarmeacurarlaheridadejadaenm.Sicreo,pormmismoo
porquemelohandicho,queestarmarcadoelrestodemisdasportalsituacin,
entonces deber empezar por considerar seriamente que ESTO ES FALSO.
Existenmediosparacurarsetotalmentedetalsituacin.Slomequedarel
recuerdo del acontecimiento, histricamente hablando, pero ya no habr pena,
tristeza,ira,amargura,niodiodecualquiertipoporquetodohabrsidocurado
porque latomadeconscienciaalniveldelcoraznhabrsidohechaconla
comprensinqueestasociada.Hagoconfianzaenlasinfinitasposibilidadesque
metraelavidayaprendoatomarellugarquemecorresponde,atomarmilugar!
As,estarenmedidadeserplenamentedueodelosacontecimientosdemivida.
VIRUELAS (ver: ENFERMEDADES DE LA INFANCIA)
VITILIGO (ver: PIEL VITILIGO)
VMITOS (ver NAUSEAS)
VOZ RONQUERA
Cuandomitimbredevozsehacesordo,roncoocascado,entoncestengola
vozronca.Laronquerasignificaquepadezcoagotamientomentalyfsico.Algo
322

impide mis ruedas de girar sin tropiezos. Vivo un bloqueo emocional, una
emocinvivayreprimomiagresividad.Lagargantaserelacionaconelcentrode
energadelaverdad,delacomunicacinydelaexpresindes(chakradela
garganta);enconsecuenciapuedequemesientacogidoporlaverdadyquetenga
dificultad en asimilarla y por mis convicciones personales. Recurro a algunos
paliativosoaestimulantestalescomoelcaf,elalcohol,cigarrillos,etc.,y,cuando
desapareceelefecto,aparecela ronquera.Elcansancioquesientoamplificalas
inquietudes y las preocupaciones que no quera mirar. Tomo consciencia que
necesitountiempodeparoyaceptodarmeeldescansoyeltiemponecesarios
para regenerarme. Al haber descansado, las situaciones y los acontecimientos
recobran su proporcin real, soy mucho ms objetivo y lcido para tomar las
decisionesqueseimponen.
VULVA (ver tambin: LABIOS)
Delmismomodoqueloslabiosdelrostroseconsiderancomolaspuertasde
laboca,loslabiosvaginalesrepresentanlasdelaparatogenital.Unsentimientode
vaco,agotamiento,cansanciopuedeprovocarunainflamacinuotrostrastornos
enlavulva.Mesientovulnerable,impotente,rechazocualquiercontactofsico,
mesientosinalegraadentromo.Elorigendelasenfermedadesdelavulvaes
normalmentedeordenpsquico.Laangustiaylostemoreslleganainflamaruna
vulva frecuentemente despus de que se haya tenido que tomar numerosas
decisiones.Estoycansadadetenerquedecidir,yesunmododemanifestarmi
impotencia,misensacindeestardisminuidadelantedelosacontecimientos.Elijo
sentirmevalorizadayaceptolaresponsabilidaddemiselecciones.
ZUMBIDOS DE ODOS (ver OREJAS: ZUMBIDOS DE ODOS)
ZURDO
Un zurdo,engeneral,as sellamaporqueusa mssu manoysubrazo
izquierdos quesumanoybrazoderechos,enactividadestalescomoelescribir,
tocar msica, hacer deporte, etc. Antao, en nuestra educacin, se daba gran
importanciaalhechodeserdiestro,locualsetraducaporelhechodequeser
diestro era ser correcto y ser zurdo significaba no ser correcto. Incluso la
expresin ser zurdo en Francs puede a veces significar ser torpe.
Actualmente,estamospasandodelaeradelosPiscisalaeradeAcuario,i.e. 87que
pasamos del lado racional a nuestro lado ms intuitivo y creativo. Est
comprobadoqueimpedirqueunnioseazurdocuandoesunatendencianatural,
puedellevarleatenertics,torpeza,trastornosafectivos,dificultadenhablaroen
leer, hacerle desarrollar sentimientos de culpabilidad e inferioridad. Si viv
sentimientosdeestetipoporquemeobligaronaserdiestro,convendraquehagala
87

I.e.:=esdecir.

323

pazhaca mmismo concedindomecomprensinyaceptacin enloque


viv.Yaqueelladoizquierdorepresentaelladoafectivo,intuitivo,lasensibilidad,
oseaelladofemeninodemiser,sisoyzurdo,queseahombreomujer,milado
creativoestmuydesarrollado,tengounafacilidadparticularparaaprendermsica,
canto,oseatodaformadearte.Estoenmesinnato.Elzurdopuedetambintener
unapersonalidadmsintrovertida,reservadamientrasqueeldiestrotienetendencia
asermsextravertidoyairhacalosdems.Slohedeaceptarmipotencial
creativoysacarprovechodemigransensibilidadparaquetodosemanifiestecon
plenitud.Encualquiercaso,meaceptotalcomosoysabiendoquetengofuerzas
particularesquehacendemunapersonanica.

324

ANEXO I
CUERPO(engeneral)(vertambin:laspartescorrespondientes)
Acontinuacinlas partes delcuerpoyelsignificadometafsico general
vinculadoacadaunadeellas.
Loscabellos:
Elcuerocabelludo:
Lacabeza:
Losojos:
Lasorejas(odos)
Lanariz:
Loslabios:
Losdientes:
Elcuello:
Lagarganta:
Loshombros:
Losbrazos:

Loscodos:
Losdedos:
Elpulgar:
Elndice:
Elmayor:
Elanular:
Elauricular:
Elcorazn:
Lasangre:
Lospechos:

Mifuerza.
Mifeymiladodivino
Miindividualidad
Micapacidaddever
Micapacidaddeor
Micapacidaddeolerosentiralaspersonasosituaciones.
Milabiosuperiorestrelacionadoconelladofemenino88
yellabioinferiorconelladomasculino89.
Mis decisiones, vinculadas al lado femenino arriba,
vinculadasalladomasculino,abajo.
Miflexibilidad,micapacidadparavervariosladosdelas
situacionesdelavida.
La expresin de mi lenguaje verbal y no verbal, mi
creatividad.
Micapacidadparallevarunacarga,responsabilidades.
Micapacidadparatomaralaspersonasolassituaciones
delavida.Sonlaprolongacindelcorazn.Sirvenpara
ejecutarlasordenes.Estnvinculadosaloquehagoenmi
vida,porejemplomitrabajo.
Miflexibilidadenloscambiosdedireccionesenmivida.
Lospequeosdetallesdelocotidiano.
vinculado a las inquietudes o a mi intelecto o a mi
audicin.
Vinculado a miedos o a mi personalidad (ego) o a mi
olfato.
Vinculadoalairaomisexualidadoamivisin.
Vinculadoapenaoamiuninoamitacto
Vinculadoapretensinomifamiliaoalgusto.
Miamor.
Laalegraquecirculaenmivida.
Miladomaterno

88

Ladofemenino:ver:FEMENINO(principio)
Ladomasculino:ver:MASCULINO(principio)

89

325

Lospulmones:

Mi necesidad de espacio, autonoma, Vinculados a mi


sentimientodevivir.
Elestmago:
Micapacidadparadigerirnuevasideas.
Laespalda:
Misoporte,miapoyo.
Lasarticulaciones:
Mi flexibilidad, mi capacidad para doblarme a las
diferentessituacionesdemivida.
Lapiel:
Mivnculoentremiinteriorymiexterior(equilibrio).
Loshuesos:
Laestructuradelasleyesyprincipiosdelmundoenel
cualvivo.
Eltero:
Mihogar.
Losintestinos:
(sobretodoelgrueso,elcoln):micapacidadparasoltar,
dejar fluir lo que me es intil y dejar fluir los
acontecimientosdemivida.
Losriones:
Lasededelmiedo.
Elpncreas:
Laalegraqueestenm.
Elhgado:
Lasededelacrtica.
Laspiernas:
Micapacidadparaadelantarenlavida,irhacaelcambio,
hacalasnuevasexperiencias.
Lasrodillas:
Mi flexibilidad, mi amor propio, mi orgullo, mi
testarudez.
Lostobillos:
Miflexibilidadenlasnuevasdireccionesdelfuturo.
Lospies:
Mi direccin (quedarse en el mismo sitio). Mi
comprensin de m mismo y de la vida (pasado,
presente,futuro).
Losdedosdelospies: Losdetallesdemiporvenir.

326

ANEXO II
Lista de las principales dolencias y principales enfermedades con su
significadoprobableresumido.
Absceso
Accidente
Acn
Acfeno
Ahogo,sofoco
Alcoholismo
Alergias
Alzheimer
Amputacin
Angustia
Anorexia
Apendicitis
Artritis
Articulaciones
Autismo
Bulimia
Burnout
Cncer
Cansancio
Celulitis
Colesterol

Frecuentementerelacionadoconunadificultadenexpresaralgoqueme
irritaomepreocupa.Estadificultadsemanifestarentoncesbajoformade
absceso.
Frecuentementerelacionadoconmiedooculpabilidad.
Frecuentementerelacionadoconunacarenciadeautoestima,eldeseode
manteneralagenteapartadades,elmiedoaestarherido.
Frecuentementerelacionadoconlanecesidaddeestaralaescuchadesus
necesidadesinteriores,susvalores.
Frecuentemente relacionados con el hecho de sentirme anormalmente
criticado,cogidoporlagarganta,conunafaltadeespaciovitalydetener
dificultadenvivirloquequierovivir.
Frecuentemente relacionado con el deseo de huir sus responsabilidades
fsicasoafectivaspormiedoaestarheridootravez.
Frecuentementerelacionadasconlairaofrustracinfrenteaunapersonao
unsucesoasociadoalproductoalergeno.Aquinoaquestuvealrgico
cuandosepresentestasituacin?
Enfermedad frecuentemente relacionada con el deseo de huir de las
realidadesdeestemundoyyanoquerertomarresponsabilidades.
Frecuentementerelacionadaaunagranculpabilidad.
Frecuentementevinculadaalsentimientodecreermelimitado,restringido
conunasensacinmuymarcadadeahogarenunasituacin.
Frecuentemente relacionada con una estima de s muy baja y al deseo
inconscientedequererdesaparecer.
Frecuentementerelacionadaalairaporquemesientoenuncallejnsin
salida.
Frecuentementerelacionadaconlacrticahacasolosdems.
Frecuentementerelacionadasconunacarenciadeflexibilidadfrentealas
situacionesdelavida.
Frecuentementerelacionadaalahuidaporquetengodificultadentransigir
conelmundoquemerodea.
Frecuentementerelacionadaconlanecesidaddequerercolmarunvaco
interiorafectivo.
Frecuentementerelacionadoconlahuidadeunaemocinintensavividaen
eltrabajooenocupacionesdiversas.
Frecuentementerelacionadoconungranmiedoounagranculpabilidad,al
puntodeyanopodervivir,inclusoinconscientemente.
Frecuentementerelacionadoconelhechoquedispersomisenergasyque
medejofcilmentecontrolarpormismiedos,misinseguridadesypormis
inquietudes.
Frecuentemente relacionada con el miedo a comprometerme y a mi
tendenciaaguardaremocionesdelpasado.
Frecuentementevinculadoconmialegradevivirquecirculadifcilmente.

327

Cigarrillo
Corazn
Comezones,
irritaciones
Depresin
Desvanecimiento,
desmayo,coma
Diabetes
Diarrea
Dolor
Eczema
Entumecimiento
Envenenamiento
Esclerosisenplacas
Escoliosis
Estreimiento
Gangrena
Gases
Gripe
Hinchazn(edema)
Hipoglicemia
Incontinencia
Infarto
Infecciones
Insomnio
Leucemia
Malestar

Frecuentementerelacionadoconunvacointeriorquequierocolmar.
Frecuentemente, todas las enfermedades vinculadas con el corazn se
relacionanconunafaltadeamordem,demisfamiliaresodemientorno.
Frecuentemente relacionadas con la impaciencia, inseguridad o
contrariedadcontrammismo.
Frecuentementerelacionadaconelhechodequererquitarmepresinenmi
vida.Entonces,hagounadepresin.
Frecuentemente relacionados a un deseo de huir una situacin o una
persona cuando tengo la sensacin de que esto evoluciona demasiado
rpido.
Frecuentementerelacionadacontristezaprofundaqueseproducedespus
deunacontecimientoenelcualsentrencorcontralavida.
Frecuentementerelacionadaconelhechodequererrechazarlassoluciones
olassituacionesqueseofrecenamparaprogresarenlavida.
Frecuentemente, forma de auto castigo frente a un sentimiento de
culpabilidad.Avecessepuederelacionarconunanecesidaddeatencin,
unmiedooira.
Frecuentementerelacionadoconelhechodeyanotenercontactoconun
seramado.
Frecuentementerelacionadoconundeseodehacersemenossensibleauna
personaounasituacin.
Debopreguntarme:Quoquinmeestenvenenandolaexistencia?
Frecuentemente relacionadaconelhechodetenerpensamientos rgidos
hacam,hacalosdemsyhacalassituacionesdelavida.
Frecuentemente relacionada conelhechodequetengolasensacinde
llevartantasresponsabilidadesenmishombrosquequierohuirlas.
Frecuentementevinculadaalhechodequererretenerlaspersonasolos
acontecimientosdemivida.
Frecuentementerelacionadaconelrencoroconodiofrenteaunasituacin
encuantoalaspectodemividaqueestrepresentadoporlaparteafectada.
Frecuentementevinculadoconalgooalguienalocualmeagarroyqueya
noesbenficoparam.
Frecuentementerelacionadaairaporquetengoatravesadoaalguieno
algo.
Frecuentementerelacionadaconelhechoquemesientolimitadootengo
miedodeestarlimitadooparadoenloquedeseohacer.
Frecuentementerelacionadacontristezaprocedentedelaresistenciafrente
alosacontecimientosdelavida.
Frecuentementerelacionadaaldeseodequerercontrolarlotodoenmivida.
Frecuentementevinculadoalamorquedebomsaceptarrecibir.
Frecuentementerelacionadasconlafrustracinfrenteadiferentesaspectos
demivida.
Frecuentemente relacionado conelhechodequedarmeenganchado a
unaformadeculpabilidad.
Frecuentemente relacionada con el hecho de ya no querer luchar para
obtenerloquerepresentaelamorenmivida.
Frecuentemente relacionado con el hecho de querer exteriorizar una
tensininterior.

328

Mononucleosis

Frecuentemente relacionada con un gran miedo de deber afrontar una


situacinquemellevaraacomprometermeenelplanoafectivo.
Nausea
Frecuentementerelacionadaconunaspectodemividaquequierorechazar
porquemedaasco.
Nerviocitico
Frecuentemente relacionado con una gran inseguridad en cuanto a mis
necesidadesdebase:vivienda,alimento,dinero.
Parlisis
Frecuentementerelacionadoconlahuidaporquemeparalizaunmiedo.
Piel
Frecuentemente, las enfermedades de la piel tienen relacin con el
sentimientodenotenerelcontactofsicouotroparaprocurarmeelamor
quenecesito.
Peso(excesode)
Frecuentemente relacionado con el hecho de acumular cosas, ideas,
emociones,quererprotegerse,sentirselimitado,vivirunavidainterior.
Pulmones
Frecuentementelasenfermedadesvinculadasalospulmonesserelacionan
conelhechodepodertomarelespaciovital,elairequenecesitopara
sentirmelibreyparapodervivir.
Quemadura, ardor, Frecuentementerelacionadasconlairaquehierveenmiinteriorohaca
fiebre
unapersonaounsuceso.
Rampa
Frecuentementerelacionadacontensinenlaaccintomadaoportomar.
Rigidez(articulacin) Frecuentemente relacionada con una falta de flexibilidad, testarudez,
resistenciaorigidez,sobretododecaraalaautoridad.
Reuma
Frecuentementerelacionadoconlacrtica,bienhacaunomismo,bien
hacalosdems.
Ronquido
Frecuentemente relacio