Vous êtes sur la page 1sur 403

Arthur AVALON

(Sir John WOODROFFE)

LA PUISSANCE
DU SERPENT
(THE SERPENT POWER)

INTRODUCTION AU TANTRISME

Prface de Jean HERBERT

DITIONS PAUL DERAIN


1959

Arthur AVALON
(Sir John WOODROFFE)
LA PUISSANCE DU SERPENT
(The Serpent Power)
Collection Tantrisme
publie sous la direction de Jean HERBERT
et Swmi SIVANANDA SARAVASTI
Traduit par Charles VACHOT sur la 4e dition anglaise,
Ganesh et Cie Madras 1950
Ouvrage orn de 8 illustrations en couleurs
et de 4 tableaux dont 1 hors-texte
Tous droits de reproduction et d'adaptation rservs pour tous pays.
DITIONS PAUL DERAIN
128, rue Vauban - LYON
1959

TABLE DES MATIRES


PRFACE
AVERTISSEMENT DU TRADUCTEUR
I. INTRODUCTION
II. LA CONSCIENCE NON INCARNE
III. LA CONSCIENCE INCARNE OU JIVATMA
IV. LE MANTRA
V. LES CENTRES OU LOTUS (CHAKRA, PADMA)
VI. LA PRATIQUE (YOGA ; LAYA-KRAMA)
VII. BASES THORIQUES DU YOGA TANTRIQUE
VIII. PLANCHES DES CHAKRA
Les Centres ou Lotus
Mldhra Chakra
Svdhishthna
Manipra
Anhata
Vishuddha
Ajn
Sahasrra

PRFACE

L'image que les Occidentaux se font du tantrisme dcoule


gnralement de certaines manifestations spectaculaires et
dgnres qu'ils ont eu l'occasion d'en voir ou, bien plus
souvent encore, qui leur ont t dcrites aprs avoir pass
par de trs nombreux intermdiaires. D'autre part certains
auteurs occidentaux qui n'en avaient pratiquement aucune
connaissance ont publi sur ce sujet des livres d'une complte fantaisie en faisant croire qu'ils en avaient une exprience directe, et malheureusement de tels ouvrages ont
connu de trs gros succs de librairie.
Aussi sommes-nous fort tents de prendre le tantrisme
pour un ensemble de pratiques fort peu recommandables,
plus orientes vers la sensualit et la sexualit que vers la
spiritualit, qui se poursuivent dans un secret propice la
magie noire et aux orgies les plus abominables.
Or il se trouve que les plus grands matres spirituels de
l'Inde moderne revendiquent hautement leur appartenance
aux coles sur lesquelles nous faisons peser de si graves
soupons. Shr Rmakrishna avait fait personnellement
l'exprience complte des soixante-quatre disciplines tantriques. Shr Aurobindo me disait lui-mme qu'il se considrait plus tantriste que vdntiste, et cela apparat d'ailleurs
tous les lecteurs avertis de ses uvres.
M Ananda Moy, Mahmahopadhyya Pandit, Gopnth

Kavirj ne cachent pas qu'ils le sont aussi. Et lorsqu' Bnars, dans le lieu saint du shivasme, les moines les plus
rigoureusement advatistes, disciples de Shankara, sont
parvenus au point suprme de leur discipline, la conscience de l'Absolu, au nirvikalpa samdhi, ils sollicitent,
pour aller plus loin, la faveur d'adorer la Desse sous son
aspect suprme de Rjarjeshvari. Cela ne surprend d'ailleurs que les Occidentaux, car tous les Hindous savent fort
bien que le matre de tous les advatistes, Shankarchrya,
tait un grand adorateur de la Mre Divine, qui il a consacr ses plus beaux hymnes.
En ralit on peut sans doute compter sur les doigts les
Occidentaux qui ont t vritablement initis dans les enseignements et les cultes extrmement hermtiques que
comporte le tantrisme.
Or, dans une telle discipline, l'instruction n'est donne
par le Gourou au disciple que trs progressivement, au fur
et mesure que ce dernier montre la fois qu'il a assimil
tout ce qui lui a t donn et qu'il est digne d'en recevoir davantage. Les lamas tibtains n'accdent aux plus hauts
grades qu'aprs des tudes qui peuvent se prolonger pendant soixante annes, au cours de chacune desquelles ils
peuvent tre appels non seulement mmoriser un millier
de pages de textes terriblement ardus, mais encore les
mettre en pratique.
Plus que dans d'autres enseignements du mme ordre,
dans les textes qui sont transmis, et dont une faible partie
seulement a t mise par crit et bien moins encore imprime, l'auteur reste volontairement obscur et ambigu, et la
possession matrielle d'un tel document reste sans aucune
utilit pour celui qui un matre ne vient pas l'expliquer. Par
ailleurs, tous ces textes comportent un nombre parfois im-

portant de significations successives, toutes authentiques et


aucune ne contredisant les autres, mais chacune allant
plus loin et plus haut que celles de caractre plus exotrique.
L'auteur du prsent volume est un de ces trs rares Europens qui ont reu d'authentiques initiations, et si les
livres importants qu'il a publis et traduits du sanskrit sont
souvent peu prs inintelligibles, ce n'est pas par sa faute,
mais par suite de la nature mme du texte et par suite aussi de ce que le traducteur n'a pu rvler la comprhension
sotrique qu'il en avait obtenue que dans la faible mesure
o son instructeur lui-mme le lui a permis.
C'est pourquoi les textes qu'a composs lui-mme Arthur
Avalon, s'ils vont infiniment moins loin que les ouvrages
sanskrits communiqus par lui, sont bien plus accessibles
et peuvent nous apporter une connaissance qui, sans tre
approfondie, n'en a pas moins le mrite d'tre vridique.
C'est le cas de la Puissance du Serpent que M. Charles
Vachot a traduite en franais aussi bien qu'il est possible
de le faire.
Il faut pourtant mettre le lecteur solennellement en garde
contre la tentation laquelle il pourra tre soumis d'essayer
dans la pratique ce qu'il aura compris ou cru comprendre de
ces enseignements. Justement parce qu'ils sont absolument
vrais et extrmement puissants, ils sont infiniment dangereux. Celui qui s'y aventure sans tre guid par un matre
authentique ce qui est presque certainement impossible
en Occident se trouvera dans une situation fort analogue
un enfant qu'on laisserait jouer avec toutes les drogues
garnissant une pharmacie, ou se promener avec une torche
dans un magasin d'artificier. Troubles cardiaques incurables, destruction lente de la moelle pinire, dsordres

sexuels et folie attendent ceux qui s'y risquent.


JEAN HERBERT.

AVERTISSEMENT DU TRADUCTEUR

La Puissance du Serpent fut rdig en guise d'introduction


la traduction anglaise1 de deux ouvrages sanskrits, prcdemment publis par Avalon dans la langue originale
seulement2 : le Shatchakranirpana, ou Description des Six
Centres Corporels, constituant le sixime chapitre, en cinquante-cinq versets, d'un crit sur le rituel tantrique intitul Shrtattvachintmani et compos au XVIe sicle par
Prnnanda ; le Pdukpanchaka, ou Quintuple Pidestal
du Guru, en sept versets ; chacun des versets de ces deux
textes tant accompagn de son commentaire par Klcharana.
En ralit, La Puissance du Serpent est une substantielle introduction au Tantrisme en gnral, et qui demeure sans doute la plus autorise ; la seule autorise
peut-tre, au sens plein du terme3. Ce fut le dernier ou1 Parue en 1918 chez Luzac, Londres.
2 Tntrik Texts, vol. II. Le texte sanskrit figure la suite du texte anglais dans les

ditions de The Serpent Power parues en 1922, 1931, 1950 et 1953 chez Ganesh,
Madras.
3 l'exception de l'uvre d'Arthur Avalon (Sir John Woodroffe), les tudes,

traductions et commentaires publis rcemment en Occident relvent de la plus


entire fantaisie... Jusqu'ici il semble bien n'y avoir eu qu'un seul Occidental, Sir
John Woodroffe (Arthur Avalon) qui ait reu une vritable initiation tantrique et
qui ait t autoris par des matres comptents publier des textes et des commentaires. Ses ouvrages, heureusement abondants, autant que consciencieux et

vrage publi sous le pseudonyme d'Arthur Avalon par Sir


John Woodroffe, juriste et juge minents, qui pourtant,
avec la collaboration de sa femme Ellen Avalon, consacra
le meilleur de sa vie l'tude du Tantrisme, la publication de quelques-uns de ses textes capitaux, l'exposition
lucide de ce qui pouvait en tre expos.
Son uvre lui valut l'estime et la gratitude des Hindous
comme des hindouistes comptents ; elle reste pour nous
la clef la plus sre d'une doctrine inconnue ou mconnue,
rserve entre toutes : rserve, est-il dit, l'intention de
notre poque, le Kali-Yuga, le Quatrime et Dernier ge
des traditions unanimes.
Aussi ne donnerons-nous de bibliographie que la liste
des autres ouvrages de cet irremplaable introducteur :
Introduction to Tantra Shstra ;
Shakti and Shkta ;
Garland of Letters ;
The World as Power ;
Mahmy.
On lui doit aussi :
une analyse du Tantrarja Tantra ;
la traduction du Tantratattva (Principles of Tantra) ;
celle du Mahnirvna Tantra (The Great Liberation) ;
celle de divers hymnes la Dev tirs des Tantra, des
Purna, du Mahbhrata et de Shankarchrya
mthodiques, dans l'expos d'un sujet extraordinairement difficile et dlicat,
sont donc les seules sources authentiques auxquelles on puisse actuellement
puiser. Jean Herbert, Spiritualit hindoue (Albin Michel, 1947), pp. 308, 407408.

(Hymns to the Goddess) ;


la publication du Kulachdmani Nigama ;
et celle, avec traduction anglaise et commentaire, des
textes suivants :
Kmakalvilsa ;
Karprdi Stotra (Hym to Kli) ;
Anandalahar (Wave of Bliss) ;
Manimnastava (Greatness of Shiva) ;
Isopanishad.
Tous ces ouvrages sont publis chez Ganesh, Madras.

I. INTRODUCTION

Il sera trait ici d'une forme particulire de Yoga tantrique


nomme Kundalin Yoga, ou, dans certains ouvrages,
Bhta-shuddhi. Ces noms voquent d'une part la Kundalin Shakti, Puissance Suprme prsente dans le corps
humain et dont l'veil permet la ralisation du Yoga,
d'autre part la purification des lments du corps (Bhtashuddhi) qui se produit lors de cette ralisation.
Ce Yoga s'effectue suivant une technique appele Shatchakra-bheda, c'est--dire percement des six Centres ou
Rgions (Chakra) ou Lotus (Padma) du corps, sous l'action
de la Kundalin Shakti, que, pour lui donner une dsignation occidentale, j'ai nomme ici la Puissance du Serpent4.
Kundala signifie lov. La puissance est la Desse (Dev)
Kundalin, celle qui est love ; car Sa forme est celle d'un
serpent lov et endormi dans le plus bas des centres corporels, la base de la colonne vertbrale, tant qu'Elle n'est
pas veille par le Yoga qui porte Son nom. Kundalin est
l'nergie Cosmique Divine dans les corps. Les Saptabhmi, ou sept rgions (Loka)5, sont une interprtation popu4 Un des noms de cette Dev est Bhujang, le Serpent.
5 Les sept mondes : Bhh, Bhuvah, Svah, Mahah, Jana, Tapah, Satya. (Voir

Avalon, Wave of Bliss, Comm. du v. 35.) Les Loka sont ce qui est vu (lokyante),
c'est--dire atteint, et sont par suite les fruits du Karma sous la forme d'une renaissance particulire. (Voir Satynanda, Comm. de l'Isha Up., Mantra II, p. 258).

laire, une prsentation exotrique de l'enseignement profond du Tantrisme touchant les sept centres6.
Ce Yoga est appel tantrique pour plusieurs raisons.
Certes, on le trouve mentionn dans les Yoga Upanishad
relatives aux Centres, ou Chakra, et dans quelques-uns
des Purna. Les traits sur le Hathayoga s'en occupent
galement. Nous trouvons mme des conceptions analogues dans des systmes trangers l'Inde, laquelle il
est possible qu'ils les aient empruntes dans certains cas.
C'est ainsi que dans le Risala-i-haq-numa, du prince Mahomed Dara Shikoh7, sont dcrits les trois centres Mre
du Cerveau ou Cur sphrique (Dil-i-muddawar) ;
Cur de cdre (Dil-i-sanowbari) ; et Cur de lis (Dil-inilofari)8.
On peut trouver d'autres allusions dans les ouvrages
des Soufis de l'Islam. Par exemple certaines confrries
soufiques (comme les Naqshbandi) ont, dit-on9, imit, ou
plutt emprunt, la mthode de la Kundalin pratique par
les Yogi de l'Inde10 comme moyen de ralisation11.
6 C'est--dire les six Chakras et le centre crbral suprieur, ou Sahasrra. Il sera

parl plus loin des Upanishad et des Purna.


7 La Boussole de Vrit. L'auteur tait le fils an de l'empereur Shah-i-Jehan, et il

mourut en 1659 de notre re. On prtend que son enseignement est celui de la
doctrine secrte de l' Aptre de Dieu .
8 Ch. I sur Alam-i-nasut : le plan physique, ou ce que les Hindous appellent l'tat

Jgrat. (Ed. Rai Bahadur Srisha Chandra Vasu).


9 Voir Shaikh Muhammad Iqbal, The Development of Metaphysics in Persia, p. 110.
10 Al-Biruni traduisit en arabe, dit-on, les, uvres de Patanjali, et aussi les

Snkhya Stra, au dbut du XIe sicle.


11 L'auteur dit pourtant : De telles mthodes de contemplation n'ont pas du

tout un caractre islamique, et les Soufi suprieurs ne leur attachent aucune

On me dit que des correspondances se peuvent discerner entre les Shstra de l'Inde et, chez les Mayas d'Amrique, le livre sacr des Zunis appel Popul Vuh12. Mon informateur me dit que leur tube air est la Sushumn ;
leur double tube air , les Nd Id et Pingal. Hurakan , l'clair, est Kundalin, et les centres sont reprsents par des symboles animaux.
On expose, m'a-t-on rapport, des conceptions analogues dans l'enseignement secret d'autres communauts.
Que la doctrine et la pratique soient largement rpandues,
nous pouvions nous y attendre, si elles reposent sur une
ralit. Cette forme de Yoga est, cependant, particulirement associe aux Tantra ou Agama, et d'abord parce que
ces critures lui sont en grande partie consacres.
En fait, les descriptions mthodiques, dtailles, pratiques qui ont t mises par crit, se trouvent principalement dans les ouvrages sur le Hatha-yoga et dans les Tantra, qui sont les manuels, non seulement du culte, mais
de l'occultisme hindou.
D'autre part, le Yoga ralis par action sur le centre infrieur semble caractristique du systme tantrique, dont
les adeptes sont les gardiens du savoir technique par lequel les indications gnrales des livres peuvent tre mises
en pratique. En outre, ce systme est d'un caractre tantrique en raison de son choix d'un centre principal de
conscience.
Dans l'antiquit, on a localis en diverses parties du
importance .
12 On me dit qu'une traduction fut commence, puis abandonne, par l'occultiste

James Pryse dans Lucifer, l'ancien journal thosophique, que je n'ai pas vu.

corps le sige de l' me ou de la vie : par exemple dans


le sang13, le cur, le souffle. Le cerveau n'a pas t, en gnral, considr comme tant ce sige. Le systme vdique
admet que le cur est le centre principal de la Conscience, conception dont il reste un souvenir dans des expressions comme prendre cur et apprendre par
cur .
Sdhaka, qui est l'une des cinq fonctions de Pitta14, et
qui est situ dans le cur, collabore indirectement l'accomplissement des fonctions cognitives en maintenant le
rythme des contractions du cur, et l'on a suppos15 que
peut-tre ce fut cette conception du cur qui prdisposa
les physiologistes de l'Inde le tenir pour le sige de la
connaissance.
Selon les Tantra, cependant, les centres de conscience
principaux se trouvent dans les Chakra du systme crbro-spinal et dans le sommet du cerveau (Sahasrra), bien
que le cur soit aussi reconnu pour un sige du Jvtm,
l'esprit incarn, sous son aspect de principe vital ou Prna16. C'est pourquoi le premier verset du Shatchakranirpana parle du Yoga qui doit tre ralis selon les Tantra
13 Cf. l'expression biblique : Le sang est la vie .
14 Voir Avalon, Tntrik Texts. Introduction au vol. III (Prapanchasra Tantra), p.

12.

15 Kavirja Kunjalla Bhishagaratna, dans son dition de la Sushruta Sarnhit. On

peut cependant donner cette autre explication, qu'au cours de l'histoire humaine
l'importance des divers centres de perception a rellement vari.
16 Selon certaines conceptions hindoues, le cerveau est le centre du mental et

des sens, et le cur celui de la vie. Charaka dit que le cur est la racine d'o
proviennent toutes les autres parties du corps, et qu'il est le centre de certaines
fonctions ou de certains organes. Selon Sushruta, le cur est le sige des sensations.

(Tantrnusrena), c'est--dire, comme le dit Klcharana,


son Commentateur, en suivant l'autorit des Tantra .
On s'est occup de ces choses ces derniers temps, dans
des ouvrages occidentaux de tendance occultiste. En gnral leurs auteurs ont voulu exposer ce qu'ils croyaient tre
la thorie hindoue sur cette question, mais avec des
inexactitudes considrables. Celles-ci ne sont d'ailleurs
nullement l'apanage des tudes de ce genre.
Ainsi, pour ne prendre que deux exemples dans deux
catgories diffrentes, nous trouvons, dans un dictionnaire sanskrit bien connu17, les Chakra dfinis comme
des cercles ou des dpressions (sic) du corps, utiliss pour
des buts de mystique ou de chiromancie , et leur localisation est presque en tous points errone. Le Mldhra est
inexactement dcrit comme situ au-dessus du pubis .
Quant au Svdhishthna, il ne correspond nullement
la rgion ombilicale. Anhata n'est pas la racine du nez,
mais le centre spinal de la rgion du cur ; Vishuddha
n'est pas le creux entre les sinus frontaux , mais le
centre spinal de la rgion de la gorge. Ajn n'est pas la
fontanelle o se runissent les sutures coronale et sagittale, qu'on donne pour le Brahmarandhra18, mais se
trouve l'emplacement assign au troisime il, ou
Jnnachakshu.
D'autres, sans tomber dans des erreurs aussi grossires, ne sont pas exempts d'inexactitudes mineures.
C'est ainsi qu'un auteur dont la connaissance des choses
17 Le Dictionnaire Sanskrit du Professeur Monier William, l'article Chakra .
18 Ce terme s'emploie aussi pour dsigner la Brahmand, cette dernire tant la

voie par o l'on atteint le Brahmarandhra dans le cerveau.

occultes tait, me dit-on, considrable, parle de la Sushumn comme d'une force qui ne peut tre mise en
action tant qu'Id et Pingal ne l'ont pas prcde , qui
passe, accompagne d'un choc violent, par chaque section
de la moelle pinire , et qui, une fois veill le plexus sacr, suit la moelle et frappe le cerveau, avec ce rsultat
que le nophyte se sent comme une me dsincarne,
seule dans l'abme tnbreux de l'espace vide, en proie
une terreur et une pouvante indicibles .
Il crit aussi que le courant de Kundalin s'appelle
Nd ; que la Sushumn s'allonge comme un nerf jusqu'au
Brahmarandhra ; que les Tattva sont au nombre de sept ;
et autres inexactitudes. La Sushumn n'est pas une
force19 , elle ne suit ni ne frappe rien, mais elle est la plus
extrieure des trois Nd, qui canalisent la force libre
par l'veil de la Dev nomme Kundalin, la Puissance
Cosmique dans les corps, force qui n'est pas elle-mme
une Nd, mais passe par la plus intrieure, ou Chitrin
Nd, qui se termine au lotus douze ptales au-dessous
du Sahasrra, d'o l'on s'lve au Brahmarandhra.
Il serait facile de relever d'autres erreurs chez des auteurs qui ont trait ce sujet. Il sera plus profitable d'exposer, aussi correctement que le permettra mon savoir, ce
mode de Yoga. Mais je veux ajouter que certains auteurs
hindous modernes ont contribu, pour leur part, rpandre des ides fausses sur les Chakra en les dcrivant
d'un point de vue purement matrialiste ou physiologique
: ce qui n'est pas seulement une inexactitude, mais une
trahison ; car la physiologie ignore les Chakra tels qu'ils
sont en ralit, c'est--dire comme centres de conscience,
19 Except en ce sens que tout est manifestation de la puissance.

et l'activit de Skshma Prna-vyu, ou force vitale subtile


; bien qu'elle s'occupe du corps grossier qui leur est associ. Ceux qui n'en appellent qu' la physiologie ont des
chances de ne pas recevoir satisfaction.
Nous pouvons signaler ici la description faite par un auteur thosophique bien connu20, de ce qu'il appelle les
centres de Force et le Feu du Serpent , dont il dit avoir
fait l'exprience personnelle. Bien qu'il parle aussi du Yoga
Shstra, il est peut-tre bon de prciser que son expos ne
prtend pas reprsenter l'enseignement des Yogi hindous
(dont cet auteur dnigre quelque peu la comptence en
leur propre Yoga), mais qu'il est donn comme cet explication personnelle et originale (confirme, dans sa pense,
par certains aspects de la doctrine hindoue) de l'exprience personnelle que, dit-il, il a connue. Cette exprience
consiste, semble-t-il, en l'veil conscient du Feu du Serpent21 , avec la vision astrale et mentale qu'il apporte
et qui lui a rvl, croit-il, ce qu'il nous expose22.
Les centres, ou Chakra, du corps humain sont dcrits
comme des tourbillons de matire thrique23 , dans

20 C.W. Leadbeater, The Inner Life, pp. 143-478, 1re srie.


21 Comparons sa thorie avec la thorie hindoue. La Devi ou Desse, nous l'avons

dit, est appele Bhujang ou Serpent, parce qu'au centre le plus bas (Mldhra)
Elle est enroule autour du Linga. Enroule signifie au repos . La Puissance Cosmique dans les corps est ici au repos ; une fois veille elle est ressentie comme une chaleur intense.
22 Certaines Siddhi ou pouvoirs occultes s'acquirent chaque centre mesure

que s'lve le Yogi.

23 Les ptales du lotus sont Prna-shakti manifeste par Prna-vyu, la force

vitale. Chaque lotus est un centre d'une forme diffrente de matire (Bhta)
qui y prdomine.

lesquels se prcipite, venue du monde astral24 , et


angle droit avec le plan du disque tournoyant, la septuple
force du Logos apportant la vie divine dans le corps
physique. Bien que ces sept forces oprent toutes sur tous
les centres, en chacun d'eux une forme particulire de
force prdomine nettement. Cette irruption de forces est
cense dterminer la surface du double thrique des
forces secondaires formant angle droit avec elles.
La force premire, en entrant dans le tourbillon,
rayonne de nouveau en lignes droites, mais angle droit.
Le nombre de ces radiations de la force premire dtermine, parat-il, le nombre de ptales (comme disent les
Hindous) que dploie le Lotus ou tourbillon. La force
secondaire, en se prcipitant autour du tourbillon, produit
l'apparence de ptales de fleur, ou peut-tre plus exactement de soucoupes ou de vases peu profonds en verre
ondul et iris .
Ainsi, en supposant un tourbillon thrique soumis
l'arrive d'une force du Logos, les Lotus dcrits dans les
livres hindous et le nombre de leurs ptales sont galement expliqus par l'auteur, qui substitue au centre
Svdhishthna un lotus six ptales situ au niveau de la
rate25, et corrige le nombre des ptales du lotus de la tte,
qui, dclare-t-il, n'est pas mille, comme le disent les traits
de Yoga tantrique, mais exactement 96026 .
Le centre thrique qui maintient en vie le vhicule
24 C'est l un terme occidental.
25 Non mentionn dans le Shatchakranirpana.
26 On semble accorder si peu d'attention l'exactitude en cette matire, qu'on

nglige une des lettres pour faire 1.000 ptales, c'est--dire 50 x 20. Mille , ici,
n'est qu'un symbole de grandeur.

physique correspondrait un centre astral quatre


dimensions, mais entre elles se trouve une gaine ou un
rseau de tissu serr, compos d'une seule couche comprime d'atomes physiques, qui empche l'ouverture d'une
communication prmature entre les plans. Il existerait
une manire de les ouvrir ou dvelopper correctement,
afin d'introduire des plans suprieurs, par ce canal, plus
qu'il n'en passe ordinairement.
Chacun de ces centres astraux a certaines fonctions :
au nombril s'obtient un simple pouvoir de sentir ; la
rate, le voyage conscient en corps astral ; au cur, le
pouvoir de comprendre les vibrations d'autres entits astrales et de sympathiser avec elles ; la gorge, le pouvoir
d'entendre sur le plan astral ; entre les sourcils, la vue27
astrale ; au sommet de la tte , la perfection de toutes
les facults de la vie astrale. C'est pourquoi l'auteur dit
que ces centres jouent le rle, dans une certaine mesure,
d'organes des sens pour le corps astral.
Dans le premier centre, la base de la moelle pinire
, est le Feu du Serpent , ou Kundalini, qui existe en
sept couches ou sept degrs de force28.
Ce Feu est la manifestation dans la matire thrique, sur le plan physique, de l'une des grandes forces
cosmiques, l'une des puissances du Logos, dont la vitalit
et l'lectricit sont des exemples.

27 Certaines Siddhi s'acquirent, comme nous l'avons dit, chaque centre. Mais

le sommet de la tte est bien au-del de la vie astrale . L s'obtient le Samdhi,


ou union avec la Conscience Suprme.
28 Parashabda, qui est Kundalin sous son aspect de cause de tous les sons, a sept

aspects, de Kundal Bindu.

Autre, parat-il, est Prna, la vitalit29. Les centres


thriques , une fois compltement veills par le Feu
du Serpent , sont censs amener la conscience physique la qualit, quelle qu'elle soit, inhrente au centre
astral qui lui correspond. Une fois vivifis par le Feu du
Serpent , ils deviennent des portes faisant communiquer
les mondes physique et astral .
Quand l'veil astral de ces centres a eu lieu pour la
premire fois, la conscience physique n'en fut pas avertie.
Mais le corps sensible peut maintenant tre amen
partager tous ces avantages en rptant ce processus
d'veil avec les centres thriques . On y parvient en veillant, par la force de la volont, le Feu du Serpent , qui
existe vtu de matire thrique sur le plan physique, et
dort30 dans le centre thrique correspondant, celui qui se
trouve la base de la moelle .
Les centres suprieurs en sont vivifis, ce qui a pour effet d'amener la conscience physique les puissances veilles par le dveloppement des centres astraux qui leur
correspondent. En un mot, on commence vivre sur le
plan astral, ce qui ne serait pas absolument un bnfice,
n'tait que l'accs au monde cleste s'obtient, dit notre
29 Kundal est Shabdabrahman ou le Verbe (Vk) dans les corps, Elle est en Sa

propre forme (Svarpa) Conscience Pure, et Elle est toutes les Puissances (Sarvashaktimay). Kundalin est en fait l'nergie cosmique dans les corps, et comme
telle la cause de tout, et, bien que manifeste en elles, non limite par aucune de
Ses productions.
30 Kundalini est appele le Serpent (Bhujang). Elle dort dans le Mldhra. Elle

dort, parce qu'Elle repose. Alors la conscience de l'homme est veille au monde,
Sa cration, dans laquelle Elle demeure immanente. Lorsqu'Elle s'veille et que le
Yoga est ralis, l'homme dort au monde et jouit d'une exprience transcendante.

auteur, la fin de la vie sur ce plan31.


Ainsi, au deuxime centre, on a conscience dans le
corps physique de toutes sortes d'influences astrales,
avec le vague sentiment qu'il en est d'amicales et d'autres
hostiles, sans qu'on sache le moins du monde pourquoi .
Au troisime centre on devient capable de se rappeler,
en partie seulement , de vagues voyages dans l'astral,
avec parfois le demi-souvenir d'une sensation dlicieuse
de voler travers les airs.
Au quatrime centre l'homme connat d'instinct les joies
et les peines des autres reproduisant parfois eu lui-mme
leurs maux et leurs souffrances physiques.
l'veil du cinquime centre il entend des voix qui lui
suggrent toutes sortes de choses . Parfois il entend de la
musique, ou d'autres bruits moins agrables32 . Un
complet dveloppement procure la clair-audience sur le
plan astral .
L'veil du sixime centre produit des rsultats qui sont
d'abord d'un caractre insignifiant, comme d'entrevoir
des paysages et des nuages colors , mais par la suite atteignent la clairvoyance. Il y aurait ici un pouvoir
d'agrandissement obtenu au moyen d'un tube thrique
flexible qui ressemble au serpent microscopique figur
sur la coiffure des Pharaons . Le Pouvoir d'tendre ou de
limiter la vision de ce serpent microscopique expliquerait la possibilit, dont parlent les livres anciens, de se
31 Le but du Kundal Yoga est au-del de tous les mondes clestes. Aucun Yogi ne

cherche le Ciel , mais l'union avec ce qui est la source de tous les mondes.
32 D'aprs le Shatchakranirpana, le son du Shabdabrahman est peru dans

l'Anhata, ou quatrime centre.

rendre grand ou petit volont33.


Quand le corps pituitaire est mis en tat de fonctionner,
il forme un lien avec le vhicule astral, et quand le Feu
atteint le sixime centre, et le vivifie pleinement, la voix du
Matre (qui dans ce cas signifie le Soi suprieur ses
degrs divers) se fait entendre 34. L'veil du septime centre
permet de quitter le corps en pleine conscience.
Quand le feu est ainsi pass par tous ces centres dans
un certain ordre (qui varie pour les diffrents types humains), la conscience s'lve graduellement jusqu' l'entre dans le monde cleste 35 la fin de la vie sur le plan
astral .
Il y a quelques ressemblances entre cet expos et l'enseignement du Yoga Shstra, dont l'auteur cit semble
avoir, d'une manire gnrale, une certaine connaissance,
et qui a pu lui suggrer quelques traits. D'abord, on nous
parle de sept centres, qui, une exception prs, correspondent aux Chakra. L'auteur dit qu'il existe trois autres
centres infrieurs, mais que la concentration sur eux est
pleine de danger.
Ce qu'ils sont, on ne le prcise pas. Il n'existe pas, que
je sache, de centre infrieur au Mldhra (comme l'implique le nom mme de centre-racine ), et le seul centre
voisin, qui est exclu dans l'expos prcdent, est le centre
Apas Tattva, ou Svdhishthna. Ensuite il est question de
33 Il n'est pas fait mention de ce serpent dans les textes. Les Siddhi (Anim,

etc.) n'en ont aucun besoin. C'est la conscience qui s'identifie avec le petit ou le
grand.
34 Comme le dit le Shatchakranirpana, l'Ajn est ainsi nomm parce qu'en lui

est reu le commandement du Guru d'en haut.


35 Voir note 31.

cette Force, le Feu du Serpent , que les Hindous nomment Kundalin, situe dans le centre le plus bas, le Mldhra. Enfin, l'effet de l'veil de cette force, qui est accompli par la puissance de la volont (Yogabala)36, exalterait la conscience physique, en passant par les plans ascendants, jusqu'au monde cleste .
Pour employer l'expression hindoue, l'objet et le but de
Shat-chakra-bheda est le Yoga. Celui-ci est finalement
l'union avec le Soi Suprme ou Paramtm ; mais il est
vident que le corps dans son tat actuel tant dj, bien
qu'inconsciemment, en Yoga, sans quoi il ne saurait exister, tout pas fait consciemment vers le haut est Yoga, et il
en existe bien des degrs avant que ne soit obtenue la Dlivrance complte ou Kaivalya Mukti.
Ce degr, et, en vrit, bon nombre des degrs prcdents, sont bien au-del du monde cleste dont parle
l'auteur. Les Yog ne s'intressent pas au monde cleste
, mais cherchent le dpasser ; sinon, ils ne sont nullement des Yog. Ce que semble accomplir, dans cette thorie, la force manifeste, c'est l'exaltation des qualits mentales et morales de l'oprateur, telles qu'elles existaient
lorsque se rvla lui cette force.
Mais s'il en est ainsi, une telle exaltation peut tre aussi
peu dsirable que l'tat originel. En dehors de la ncessit
de possder sant et force, la pense, la volont et la moralit qu'on se propose de soumettre son influence doivent tre d'abord purifies et fortifies, avant d'tre intensifies par l'influence vivificatrice de la force veille.

36 l'aide de la purification du corps, et de certains Asana et Mudr, dont il sera

parl plus loin.

En outre37, les Yog disent que la perce du Brahmagranthi ou nud38 entrane parfois une souffrance considrable, des dsordres physiques, et mme la maladie,
comme en peut fort bien entraner la concentration sur un
centre tel que le nombril (Nbhipadma).
Pour user de termes hindous, le Sdhaka doit tre qualifi (Adhikr), et sa qualification dtermine par son Guru, qui peut seul enseigner la mthode effective du Yoga.
Les dangers possibles que signale l'auteur dpassent, cependant, tous ceux qui m'ont t mentionns par les Hindous eux-mmes : ceux-ci, en gnral, semblent tout ignorer d'une sorcellerie phallique laquelle l'auteur fait
allusion, parlant dcoles de Magie Noire (apparemment
occidentale), qui se serviraient de Kundalin pour stimuler
le centre sexuel. Un autre auteur dclare39 :
Le simple amateur qui se mlerait du pseudo-occulte
ne ferait que dgrader son intelligence par les purilits du
psychisme, il deviendrait la proie de la funeste influence
du monde des fantmes, ou ruinerait son me par les pratiques rpugnantes de la sorcellerie phallique, comme le
font, aujourd'hui mme, des milliers d'gars .
En est-il ainsi ? Il est possible qu'une concentration
perverse ou mal dirige sur les centres sexuels et ceux qui
leur sont associs ait l'effet signal. Et il se peut que le
Commentateur Lakshmdhara y fasse allusion quand il
parle des Uttara Kaula qui veillent Kundalin dans le M37 Voir Avalon, Mahnirvna Tantra, CXXIV, 1re dit.
38 Il y a trois nuds qui doivent tre percs : ce sont (les centres o la force

de My est particulirement puissante.


39 The Apocalypse Unsealed p. 62.

ldhra pour satisfaire leurs dsirs de jouissance terrestre, et ne tentent pas de La conduire vers le Centre Suprieur qui est l'objet du Yoga en qute de la flicit transcendante. De ceux-l, un vers sanskrit dit qu' ils sont les
vritables prostitus .
Je n'ai jamais entendu, pourtant, d'Hindous parler de
ces choses, probablement parce qu'elles sont trangres
au Yoga pris dans son sens habituel, et aussi parce qu'en
raison de la discipline pralable requise de ceux qui voudraient entreprendre ce Yoga, de la nature de leurs pratiques, et du but qu'ils ont en vue, une telle possibilit
n'entre pas en considration. L'Hindou qui pratique le Yoga tantrique, ou toute autre sorte de Yoga spirituel, ne le
fait pas d'ordinaire par curiosit de l'occultisme ou par
dsir d'acqurir des expriences astrales ou d'un genre
similaire40. Son attitude, en cela comme en tout le reste,
est essentiellement religieuse, base sur une foi solide en
Brahman (Sthiranishth), et inspire par un dsir d'union
avec Lui, c'est--dire de Dlivrance.
Les qualifications pour le Tantra (Tantrashstradhikra), le deuxime chapitre du Gandharva Tantra les dcrit comme il suit.
L'aspirant doit tre intelligent (Daksha), avoir la matrise de ses sens (Jitendriya), s'abstenir de nuire aucun
tre (Sarvahimsvinirmukta), faire toujours le bien tous
(Sarvaprnihite ratah), tre pur (Shuchi), croire au Veda
40 Ceux qui pratiquent rellement une magie de l'espce mentionne n'oprent

que dans le centre le plus bas ; ils ont recours au Prayoga, qui conduit la Nyika
Siddhi, par laquelle on a commerce avec des esprits fminins et autres entits. La
voie dcrite en cet ouvrage est celle de la Dlivrance, et n'a rien voir avec la
magie noire sexuelle.

(Astika), avoir sa foi et son refuge en Brahman (Brahmishthah, Brahmavdi, Brhm, Brahmaparyana), et tre
non-dualiste (Dvaitahna). Un tel homme est qualifi
pour cette criture, sinon il n'est pas un Sdhaka.
(So'smin shstre, dhikar syt tadanyatra na Sdhaka.)
Avec une telle attitude il est possible, comme l'indique
un auteur hindou (voir plus loin, ch. VII), que la concentration sur les centres infrieurs associs aux passions
puisse, bien loin de stimuler ces dernires, les apaiser. Il
est fort possible, d'autre part, qu'une attitude, des pratiques et un but diffrents produisent un rsultat diffrent. Parler, pourtant, de concentration sur le centre
sexuel est en soi-mme propre garer, car les Chakra ne
sont pas dans le corps grossier, et la concentration s'effectue sur le centre subtil, avec la Conscience qui le gouverne, mme si de tels centres peuvent avoir, en dernire
analyse, une relation avec la fonction physique grossire.
Sans doute y a-t-il galement relation et correspondance entre les Shakti des centres mental et sexuel, et la
force du second, si on la dirige vers le haut, exalte extraordinairement toutes les forces mentales et physiologiques41.
En fait, ceux qui sont centrs savent comment faire
converger toutes leurs forces sur l'objet de leur vouloir, et
exercer, puis utiliser toutes ces forces sans en ngliger aucune. Ceux qui ont l'exprience de cette mthode avouent
cependant, comme je l'ai signal, qu'elle peut s'accompagner de certains inconvnients ou dangers, et par suite on
41 Le Mental, le Souffle et la Fonction sexuelle sont associs. Le but du Yogi est de

porter sa semence vers le haut pour tre Urddhvarets . Les Viparta Mudr sont conus dans ce but.

considre qu'elle est dconseiller qui n'est pas pleinement qualifi.


Il existe, d'autre part, de nombreuses et importantes
diffrences entre l'expos que nous avons rsum plus
haut, et la doctrine sur quoi repose la forme de Yoga dont
traite cet ouvrage. La terminologie et la classification
adoptes par l'expos peuvent tre qualifies de thosophiques42 ; et bien qu'il soit possible, ceux qui sont familiariss la fois avec cette terminologie et avec la terminologie hindoue, d'tablir des points de correspondance
entre les deux systmes, on ne saurait admettre que la
signification, mme dans ces cas privilgis, soit exactement la mme.
Car, bien que la doctrine thosophique soit largement inspire des ides hindoues, le sens qu'elle attribue
aux termes hindous qu'elle emploie n'est pas toujours celui que donnent ces termes les Hindous eux-mmes. Il y
a l parfois une source de confusion et d'erreur, ce que les
auteurs de cette doctrine eussent vit en adoptant dans
tous les cas leur nomenclature et leurs dfinitions
propres43.
42 Je sais bien que la Socit Thosophique n'a pas de doctrine officielle. J'appelle

thosophiques les thories avances par ses principaux reprsentants et


gnralement acceptes par ses membres. Je mets le mot entre guillemets pour
dsigner la doctrine ainsi enseigne et admise par la Socit, doctrine avec laquelle la Thosophie, prise dans son sens gnral, ne s'identifie pas ncessairement tout entire.
43 Ainsi le sankritisant thosophique Srsha Chandra Vasu, dans son Introduction

to Yoga Philosophy, appelle le Linga Sharra le double thrique (p. 35). Selon
l'usage ordinaire du terme hindou le Linga Sharra est le corps subtil (Antahkarana et Indriya) vhicul par les Tanmtra, ou, selon d'autres exposs, par les
cinq Prna. Ailleurs (p. 51), cet auteur l'appelle le corps astral , et ce qu'il dit

Bien que pour exposer nos conceptions le terme de


plans soit acceptable, la division en principes donne
une plus juste image de la vrit. Il n'est pas facile de
mettre en parallle avec une parfaite exactitude les thories hindoue et thosophique sur les principes de
l'homme.
On a dit, cependant44, que le corps physique se subdivise en corps opaque et corps thrique ; qu'ils correspondent aux Kosha Annamaya et Prnamaya, et que le
corps astral correspond au ct kmique ou affectif
du Manomayakosha ou enveloppe mentale. Si l'on se base
sur la correspondance invoque, les centres thriques
ou Chakra apparaissent, d'aprs l'auteur, comme des
centres d'nergie du Prna-vyu ou Force vitale. Les lotus
sont aussi cette force et des centres de la conscience universelle. Kundalin est la forme statique de l'nergie cratrice dans les corps, qui est la source de toutes les nergies, y compris Prna.
D'aprs cette thorie, Kundalin est une force distincte
de Prna, entendu dans le sens de vitalit ou de principe
vital, qui son entre dans le corps se rvle par diverses
manifestations de vie, les Prna secondaires, qu'on dsigne du nom gnral de la force elle-mme (Prna).
Le Shatchakranirpana (v. 10 et 11) dit de Kundalin :
C'est Elle qui maintient tous les tres (c'est--dire Jva,
Jvtm) par l'inspiration et l'expiration.
Elle est donc la Prna Devat, mais, comme Elle est

des Chakra est plusieurs fois en dsaccord avec les textes que je connais.
44 Ancient Wisdom, par le D, A. Besant, p. 176.

Srishti-sthit-laytmik45, toutes les forces sont en Elle.


Elle est, en fait, le Shabdabrahman ou Verbe dans les
corps. La thorie que nous discutons semble s'carter de
celle des Yogi sur la question de la nature des Chakra et
sur celle de leur vivification.
D'aprs l'auteur anglais, les Chakra sont tous des tourbillons de matire thrique , apparemment de la mme
espce et sujets la mme influence extrieure de la septuple force envahissante du Logos , mais diffrents en
ceci, que dans chacun des Chakra l'une ou l'autre des
sept forces est prdominante.
D'autre part, si, comme on l'affirme, le corps astral correspond au Manomayakosha, la vivification des Chakra
apparat alors comme un veil de l'aspect kmique de l'enveloppe mentale. Dans la doctrine hindoue, ces Chakra
sont des centres diffrents de conscience, de vitalit et
d'nergie tttvique.
Chacun des cinq Chakra infrieurs est le centre d'nergie d'un Tattva grossier, c'est--dire de cette forme d'activit tttvique ou Tanmtra qui manifeste le Mahbhta ou
matire sensible. Le sixime est le centre du Tattva mental
subtil, et le Sahasrra n'est nullement dsign comme un
Chakra. D'autre part, comme nous l'avons dit, le centre
splnique n'est pas compris dans les six Chakra dont il est
ici question.
Dans le systme hindou, le nombre total des ptales
correspond au nombre des lettres de l'alphabet sanskrit 46,
et le nombre des ptales de n'importe quel lotus particulier
45 Voir Comm. du Shatchakranirpana, v. 10 et 11.
46 Elles sont tantt 50, tantt 51.

est dtermin par la disposition des nerfs subtils ou


Nd qui l'entourent. Ces ptales, de plus, possdent des
pouvoirs de son subtils, et sont au nombre de cinquante,
comme les lettres de l'alphabet sanskrit.
La Shatchakranirpana dcrit encore certaines choses
qui s'obtiennent par la contemplation de chacun des Chakra. Quelques-unes sont d'un caractre gnral, comme la
longvit, la libration du dsir et du pch, la matrise
des sens, la connaissance, la puissance de la parole et la
renomme.
Certaines de ces qualits, et d'autres encore, sont un
rsultat commun de la concentration sur des Chakra divers. D'autres sont donnes comme associes la contemplation d'un centre seulement. De telles affirmations
semblent faites, non pas ncessairement dans l'intention
de noter exactement le rsultat spcifique, s'il existe, de la
concentration sur un centre particulier, mais pour clbrer la matrise accrue de soi-mme, ou Stutivda ; ainsi
lorsqu'il est dit au verset 21 que la contemplation du Nbhi-padma procure au Yogi le pouvoir de dtruire et de
crer le monde.
On dit aussi que la matrise des centres peut produire
diverses Siddhi ou pouvoirs suivant les lments qui y
prdominent47. Le Pandit Ananda Shstr dclare48 :
Tous les jours nous pouvons rencontrer et coudoyer
dans les rues ou les bazars plusieurs personnes qui ont
47 Voir la Yogatattva Up., o la contemplation du centre terrestre assure la ma-

trise sur la terre, etc. Elle souligne, en mme temps, que ces pouvoirs sont des
obstacles sur la voie de la Libration.
48 Anandalahar, p. 35.

tent en toute sincrit d'atteindre au plan suprme de la


flicit, mais furent victimes des illusions du monde psychique et s'arrtrent l'un ou l'autre des six Chakra.
Elles appartiennent divers degrs de matrise, et l'on
constate qu'elles possdent certains pouvoirs qui ne se
trouvent pas mme dans l'lite intellectuelle de l'humanit
courante. Que cette cole de psychologie pratique ait eu
dans l'Inde, une certaine poque, des rsultats excellents, est prouv de manire vidente par l'exemple vivant
(pour ne point parler des innombrables traits sur cette
question) de ces hommes circulant dans toutes les rgions
du pays .
Le seul veil de la puissance du Serpent n'est pas, du
point de vue spirituel qui est celui du Yoga, d'un grand
prix. Rien de vraiment important, du point de vue du Yog
suprieur, ne s'obtient avant que l'Ajn Chakra ne soit
atteint. Il est dit que le Sdhaka dont l'Atm n'est que mditation sur ce lotus devient le crateur, le prservateur
et le destructeur des trois mondes ; et pourtant, comme
le remarque le commentateur du Shatchakranirpana (v.
34), ce n'est l que le plus haut Prahams-vda ou Stutivda , c'est--dire complment , qui, dans la littrature
sanskrite, est aussi souvent dpourvu de ralit que notre
vie ordinaire.
Bien qu'il y ait l un gain apprciable, ce n'est qu'au
moment o les Tattva de ce centre sont absorbs aussi, et
o une connaissance complte49 du Sahasrra est acquise,
49 Elle ne s'obtient naturellement qu'aprs un long effort, et la suite d'exp-

riences et de rsultats moins complets. Suivant les ides hindoues, le succs


(Siddhi) dans le Yoga peut tre le fruit des expriences de nombreuses vies antrieures. Kundalin doit tre graduellement leve d'un centre un autre, jusqu'
ce qu'elle atteigne le Lotus du cerveau. Le temps ncessaire varie selon les indi-

que le Yog atteint ce qui est la fois son but et la raison


de son travail, la libration des renaissances qui est le rsultat de la matrise et de la concentration du Chitta sur le
Shivasthnam, la Demeure de la Flicit. Il ne faudrait pas
s'imaginer, simplement parce que le Feu du Serpent a t
veill, qu'on est devenu par cela mme un Yog ou qu'on
a atteint le but du Yoga.
Il y a d'autres diffrences que le lecteur dcouvrira par
lui-mme, mais que je laisse de ct, mon objet en comparant les deux doctrines ayant t d'tablir un contraste
gnral entre la doctrine moderne et celle des coles hindoues. Je peux ajouter, pourtant, que ces diffrences ne
concernent pas de simples dtails. Le style de pense diffre d'une faon qu'il est malais de dcrire brivement,
mais que reconnatront vite ceux qui sont un peu familiariss avec les critures et le mode de pense de l'Inde.
Celle-ci a toujours tendance interprter toutes les
oprations, ainsi que leurs rsultats, d'un point de vue
subjectif, bien que pour les buts de la Sdhan l'aspect
objectif ne soit pas ignor. La thorie hindoue est hautement philosophique.
Ainsi, pour ne prendre qu'un exemple, tandis que le
Rev. Leadbeater attribue le pouvoir de se faire grand ou
petit volont (Anim et Mahim Siddhi) un tube
flexible ou serpent microscopique situ au niveau du
front, l'hindou dit que tous les pouvoirs (Siddhi) sont les
attributs (Aishvarya) du Seigneur Ishvara, ou Conscience
Cratrice, et que dans la mesure o le Jva ralise cette
conscience50, il a sa part des pouvoirs inhrents son devidus : des annes en gnral, ou des mois dans des cas exceptionnels.
50 Comme elle se ralise par la grce de la Devi, on L'appelle celle qui donne les

gr de ralisation.
Ce qui, d'une manire gnrale, caractrise les systmes
hindous, et ce qui constitue leur profondeur vritable,
c'est l'importance souveraine qu'ils attachent la Conscience et ses tats. Ce sont ces tats qui crent, soutiennent et dtruisent les mondes. Brahm, Vishnu et Shiva
sont les noms des fonctions de la Conscience Une et Universelle oprant en nous-mmes. Et quels que soient les
moyens employs, c'est la transformation des tats de
conscience infrieurs en tats suprieurs qui est
l'opration et le fruit du Yoga, et la raison de toutes ses
expriences.
Pourtant, sur cette question comme sur plusieurs
autres, nous devons distinguer de la thorie la pratique et
l'exprience. Une exprience semblable peut s'obtenir par
des moyens pratiques divers, et une exprience, relle en
fait, peut tre explique par une thorie inexacte.
Les chapitres ultrieurs permettront au lecteur de poursuivre par lui-mme la comparaison.
En ce qui regarde la pratique, on me dit que Kundalini
ne peut tre veille que dans le Mldhra et par les
moyens indiqus ici, bien que cet veil puisse se produire
accidentellement lorsqu'une personne a rencontr par hasard les positions et les conditions ncessaires, mais pas
autrement.
C'est ainsi qu'on rapporte l'histoire d'un homme dont le
corps fut trouv froid comme un cadavre, bien que le
sommet de la tte ft lgrement tide. (C'est, dans le
Kundal-Yoga, l'tat de Samdhi.) On le massa avec du
huit Siddhi (Ishitvdyshtasiddhid ; voir Trishat, II, 47). Elle donne Aishvarya.

ghee (beurre clarifi), et la tte se rchauffa graduellement.


La chaleur descendit jusqu'au cou, et alors le corps tout
entier retrouva d'un seul coup sa chaleur. L'homme reprit
conscience, et conta comment il tait tomb dans cet tat.
Il dit qu'il avait fait des contorsions, imitant les postures
d'un Yogi, quand brusquement le sommeil l'avait pris.
On supposa que sa respiration avait d s'arrter, et que,
se trouvant dans la position et les conditions requises, il
avait sans le savoir veill Kundalin, qui tait monte
Son centre crbral. Cependant, n'tant pas Yogi, il n'avait
pu la faire redescendre. Cela, d'ailleurs, n'est possible que
si les Nd sont pures.
Je contai au Pandit qui me rapporta cette histoire (il
connaissait le Yoga tantrique, et son frre le pratiquait) le
cas d'un de mes amis europens, ignorant des oprations
du Yoga ici dcrites, bien qu'il et appris quelque chose au
sujet de Kundal dans des traductions d'ouvrages sanskrits, et qui nanmoins croyait avoir veill Kundal par le
moyen de la seule mditation.
En fait, comme il me l'crivit, il tait inutile pour lui,
Europen ; d'entrer dans les dtails du Yoga oriental. Il vit
pourtant les nerfs Id et Pingal, le feu central avec
une aura tremblante de lumire rose, une lumire bleue
ou azure, un feu blanc qui montait jusqu'au cerveau et
s'irradiait en ailes de flamme des deux cts de la tte. Le
feu gagnait de centre en centre avec une telle rapidit qu'il
ne put percevoir qu'une faible part du spectacle, et il
voyait des mouvements de forces dans le corps des autres.
Le rayonnement, l'aura qui entourait Id avait un aspect
lunaire (c'est--dire qu'il tait du plus ple azur), et celui
qui entourait Pingal tait rouge, ou plutt d'un rose ple
et opalescent. Kundal apparaissait dans cette vision

comme un feu intense, blanc et dor, en forme de spirale.


Si l'on considre le Caduce de Mercure 51 comme symbolisant les centres, Sushumn, Id et Pingal, la petite
boule au sommet de la baguette s'identifiait au Sahasrra
ou glande pinale52, et les ailes au flamboiement des auras
de part et d'autre du centre quand le feu l'atteint. Une
nuit, se trouvant exceptionnellement pur de tout dsir
charnel, il sentit le serpent se drouler, puis s'lancer, et il
se trouva dans une fontaine de feu ; je sentis, disait-il,
les flammes se dployer comme des ailes autour de ma
tte, et il y avait un fracas musical comme un choc de
cymbales, tandis que certaines de ces flammes, comme
des manations, semblaient s'tendre et se rejoindre en
ailes replies au-dessus de ma tte. Je me sentais comme
berc. Je fus rellement effray, car cette Puissance semblait capable de me consumer .
Mon ami m'crivit que dans son agitation il oublia de
fixer son esprit sur le Suprme, et manqua ainsi une
aventure divine. Peut-tre est-ce pour cette raison qu'il
dclare ne point regarder l'veil de cette puissance comme
une trs haute exprience spirituelle, ni du niveau
d'autres tats de conscience par lui prouvs. L'exprience
le convainquit, pourtant, qu'il y avait une science et une
magie relles dans les livres hindous qui traitent de physiologie occulte.
51 Dans lequel la baguette est le canal central (Sushumn), auquel s'entrelacent

les sympathiques Id et Pingal, les points d'intersection se trouvant l'emplacement des centres. Les deux ailes au sommet sont les deux lobes ou ptales de
l'Ajn Chakra.
52 Sur ce point je ne suis pas d'accord. Le Sahasrra est au sommet du crne ou

du cerveau. La glande pinale est beaucoup plus bas, dans la rgion de l'Ajn
Chakra.

Voici les observations du Pandit sur cette exprience. Si


la respiration est arrte et le mental dirig vers le bas, on
ressent une chaleur. Il est possible de voir Kundalin
avec l'il mental, et ainsi d'en avoir l'exprience sans
vraiment L'veiller et L'lever, ce qui ne peut s'accomplir
que par les mthodes prescrites par le Yoga. Kundalin
peut donc avoir t vue comme une Lumire dans le
centre fondamental (Mldhra). C'est l'esprit (Buddhi) qui
La percevait, mais comme l'exprimentateur tait ignorant
de la pratique il ne vit rien clairement.
Il existe une preuve simple de l'veil rel de la Shakti.
Lorsqu'elle est veille, on ressent une chaleur intense
l'endroit o l'veil s'est produit ; mais lorsqu'elle abandonne un centre particulier, la partie abandonne devient
aussi froide et apparemment inanime qu'un cadavre. La
monte de la Puissance peut-tre ainsi vrifie de l'extrieur par autrui. Quand la Shakti (Puissance) a atteint le
sommet du cerveau (Sahasrra), le corps tout entier est
froid et cadavrique, sauf le sommet du crne o lon sent
quelque chaleur, cet endroit tant celui o sunissent les
aspects statique et nergtique de la conscience.
Je publie cet ouvrage, non en vue d'tablir la vrit ou
l'opportunit des principes et des mthodes d'une forme
de Yoga, chose que chacun dterminera par lui-mme,
mais comme un premier effort pour donner, plus particulirement ceux qui s'intressent l'occultisme et au
mysticisme, une prsentation plus complte, plus exacte
et plus rationnelle du sujet.
La comprhension du contenu abstrus d'un trait tantrique ne leur sera possible, que si d'abord nous rsumons
brivement quelques-unes des doctrines philosophiques et
religieuses qui sont sa base, et dont l'auteur suppose

chez son lecteur une certaine connaissance.


C'est pourquoi les chapitres de cette Introduction traiteront d'abord des notions de Conscience53 et d'inconscient,
comme Mental, Matire et Vie, et de leur association dans
l'Esprit Incarn ou Jvtm. Puis nous considrerons
l'aspect nergtique de l'Esprit, ou Shakti ; son idation et
sa manifestation dans le dveloppement du Macrocosme et
dans le corps humain ou Microcosme (Kshudrabrahmnda), qui est une rplique ou une rduction de
l'univers. Car, comme le dit le Vishvasra Tantra, ce qui
est ici est partout ; ce qui n'est pas ici n'est nulle part .
(Yad ihsti tad anyatra yannehsti na tat kvachit.)
Aprs un expos sur le Verbe et sur les lettres du
langage, je conclus par la mthode de Retour au principe
qu'est le Yoga. On ne comprendra celui-ci que si l'on a assimil la matire des chapitres qui prcdent.
Il est ncessaire d'expliquer et de comprendre la thorie
de l'volution universelle, mme en vue de la pratique.
Car, comme le dit au verset 39 le Commentateur du Shatchakranirpana, lorsqu'il s'agit de la pratique du Yoga, la
rgle est que les choses se dissolvent en cela dont elles
sortent, et l'opration du Yoga ici dcrit est une telle dissolution (Laya). Ce retour, ce processus de dissolution (Nivritti), effectu par le Yoga, ne sera compris que si l'on a
compris d'abord la marche en avant, le processus crateur
(Pravritti).
Des considrations analogues sont valables pour les
autres questions ici traites.
C'est ainsi qu'une brve analyse de la doctrine Shkta
53 Sur la signification de ce terme ainsi employ, voir Avalon, Shakti and Shkta.

sur la Puissance ne sera pas inutile.


Tout ce qui est manifest est Puissance (Shakti) comme
Mental, Vie et Matire. La Puissance implique un ToutPuissant (Shaktimn). Il n'est pas de Tout-Puissant sans
la Puissance, ou de Puissance sans un Tout-Puissant. Le
Tout-Puissant est Shiva. La Puissance est Shakti, la
Grande Mre de l'Univers. Il n'est pas de Shiva sans Shakti, ni de Shakti sans Shiva. Les deux, tels qu'ils sont en
eux-mmes, ne font qu'un. Chacun est tre, Conscience et
Batitude.
Ces trois termes sont choisis pour dsigner la suprme
Ralit, parce que ltre en soi, distinct des formes particulires de ltre, ne peut tre pens. tre , c'est tre
conscient , et ltre-Conscience en Sa perfection est le
Tout, et ltre sans limite, absolument libre, est Batitude.
Ces trois termes dsignent la suprme Ralit cratrice
telle qu'elle est en elle-mme. Par l'imposition sur ces
termes du Nom (Nma) et de la Forme (Rpa), autrement
dit du Mental et de la Matire, nous avons ltreConscience et la Batitude limits qui sont l'Univers.
Qu'est donc la Puissance lorsqu'il n'y a pas d'Univers ?
Elle est alors Puissance d'tre, de se conserver et de rsister au changement. Dans l'volution, elle est Puissance de
devenir et de changer, et dans sa manifestation formelle,
elle est, comme cause matrielle, le Devenir changeant des
Mondes. Le Devenir n'gale pas Dieu, car il est forme finie
et Dieu est l'infini informel. Mais l'essence des formes est
la Puissance infinie, qui gale le Tout-Puissant infini. C'est
Lui qui exerce la Puissance et cre l'Univers.
Le Repos implique l'Activit, et l'Activit implique le Repos. Derrire toute activit, il y a un fond statique. Shiva

reprsente l'aspect statique de la Ralit, et Shakti son


aspect mouvant. Les deux, tels qu'ils sont en eux-mmes,
ne font qu'un54. Tout est Rel, la fois Immuable et Changeant. My dans cette doctrine n'est pas illusion , mais
elle est, suivant l'expression concise du Shkta Sdhaka
Kamalknta, la Forme du Sans forme (Shnyasya
kra iti My). Le monde est sa forme et ces formes sont
donc relles.
L'homme est ainsi, en son essence, le Tout-Puissant
statique, ou Shiva qui est Conscience pure ; et, en tant
que Mental et Corps, il est la manifestation de la Puissance de Shiva, Shakti, ou la Mre. Il est donc ShivaShakti. Il est, dans son tat ordinaire, une expression de
la Puissance. L'objet de la Sdhan, ou Adoration, et du
Yoga, est d'lever cette Puissance son expression parfaite, qui est parfaite dans le sens d'exprience illimite.
Un moyen d'y parvenir est le Yoga tantrique, par lequel
l'homme change son exprience limite du monde contre
celle qui est le Tout sans limite (Prna), ou la Batitude
Parfaite.

54 Sur la Puissance, voir Chhndogya Up., 6, 2, 1 ; 6, 3, 4 ; 6, 8, 6 ; 7, 26, 1 ; 6, 2, 3 ;

Taittiriya Up. ; Sveta Up., 1-3 ; 6-8 ; Rigveda Samhit, 10, 129, 2 ; 10, 129, 5 ; Taittirya Brhmana, 3, 8 ; 17, 3 ; Yajurveda, 7, 3, 14, 1 ; Mundaka Up., 1, 9 ; Krma
Purna, 1, 12, 28.

II. LA CONSCIENCE NON INCARNE

Les bases du Yoga tantrique sont d'un caractre hautement mtaphysique et scientifique. Sa comprhension
exige une connaissance complte de la philosophie, de la
doctrine religieuse et du rituel hindous en gnral, et en
particulier de l'exposition que prsentent de ces trois sujets les Shkta Tantra et les Shaiva Tantra monistiques
(Advaita)55.
Un gros volume ne suffirait pas dcrire et expliquer
d'une manire un peu dtaille la nature et le sens de ce
Yoga, et les bases sur lesquelles il repose. Je dois donc
supposer chez le lecteur soit cette connaissance gnrale,
soit le dsir de l'acqurir, et me borner un expos des
principes gnraux et des faits essentiels, qui fournira la
clef capable d'ouvrir, pour ceux qui dsirent passer audel, les portes conduisant une connaissance thorique
du sujet, et qui facilitera ainsi la comprhension des difficiles textes tantriques.
Car, pour ce qui concerne la pratique, je ne peux que
reproduire les indications donnes dans les livres, avec les
explications que j'ai reues oralement. Ceux qui dsirent
aller plus loin, et mettre vritablement en pratique ce Yoga, devront d'abord se persuader de sa valeur et de son
efficacit, et ensuite suivre l'enseignement direct d'un Gu55 Sur l'Advaita du Shkta Tantra, voir Avalon, Shakti and Shkta.

ru l'ayant pratiqu lui-mme (Siddha). Seule son exprience dcidera si l'aspirant est capable de russir. On dit
que parmi ceux qui le tentent, un sur mille peut atteindre
le but. Si l'aspirant entre dans la Voie, le Guru peut seul
le prserver des risques qui l'attendent, en dterminant et
dirigeant la pratique selon sa volont et selon les capacits
et les besoins particuliers de son disciple. S'il est possible
en ce domaine d'exposer quelques principes gnraux,
leur application dpend donc des circonstances dans
chaque cas particulier.
La ralit suprme, irrductible, est Esprit dans le
sens de Conscience Pure (Chit, Samvit), dont procdent,
comme sa Puissance (Shakti) et par Elle, le Mental et la
Matire. L'Esprit56 est un. Il n'y a dans l'Esprit ni diffrences ni degrs. L'Esprit qui est dans l'homme est l'Esprit
unique qui est dans toute chose et qui, comme objet du
culte, est le Seigneur (Ishvara) ou Dieu. Le Mental et la
Matire sont multiples, avec des degrs et des qualits
multiples. Atm ou l'Esprit comme tel est le Tout (Prna)
sans sparation (Akhanda).
Le Mental et la Matire sont des parties de ce Tout. Ils
sont le non-tout (Aprna) et ils sont la sparation (Khanda). L'Esprit est infini (Aparichchinna) et informel (Arpa).
Le Mental et la Matire sont finis (Parichchhinna) et formels (Rpa). Atm est immuable et sans activit. Sa Puissance (Shakti) est active et change sous la forme du Mental et de la Matire. La Conscience Pure est Chit ou Samvit.
56 L'Esprit est Atm se manifestant comme le Soi. Ses vhicules sont le Mental ou

Antahkarana oprant avec Manas et les Sens ou Indriya, et la Matire, c'est--dire


les cinq espces de Bhta ou matire sensible.

La Matire comme telle est l'inconscient. Et le Mental


aussi est inconscient d'aprs le Vednta. Car tout ce qui
n'est pas le Soi conscient est objet inconscient. Cela ne
signifie point qu'il soit inconscient en lui-mme (au contraire tout est essentiellement conscience) ; mais il est inconscient parce qu'objet du Soi conscient. Car le Mental
limite la Conscience pour permettre l'homme d'avoir une
exprience finie. Il n'y a pas de Mental sans un fond de
conscience, bien que la Conscience suprme soit sans
Mental (Amanah). L o il n'y a pas de Mental, il n'y a pas
de limite. La Conscience, qui demeure sous l'un de ses
aspects inchange, change sous son autre aspect de Puissance active qui se manifeste comme Mental et Corps.
En thologie cette Conscience Pure est Shiva, et Sa
Puissance (Shakti) qui, telle qu'Elle est dans Sa ralit informelle, ne fait qu'un avec Lui. Elle est la grande Dev, la
Mre de l'Univers, qui, en tant que Force Vitale, rside
dans le corps de l'homme en son centre le plus bas, la
base de la moelle, tout comme Shiva se ralise dans le
plus haut centre crbral, le Sahasrra Padma. L'accomplissement du Yoga est l'Union d'Elle et de Lui dans le
corps du Sdhaka. Cette union est Laya ou dissolution,
l'inverse de Srishti ou involution de l'Esprit dans le Mental
et la Matire.
Certains ont un culte prdominant pour le ct droit, ou
masculin, de la double figure mle et femelle (Ardhanrishvara). D'autres, les Shakta, ont un culte prdominant
pour le ct gauche, et L'appellent Mre, car Elle est la
Grande Mre (Magna Mater), la Mahdev qui conoit,
porte et nourrit l'univers sorti de Son sein (Yoni). Il en est

ainsi parce qu'Elle est l'aspect actif57 de la Conscience,


imaginant (Srishtikalpan)58 le monde venir d'aprs les
impressions (Samskra) tires du plaisir et de la souffrance connus dans les mondes antrieurs. On tient pour
naturel de L'adorer comme Mre.
Le premier Mantra auquel sont initis tous les hommes
est le mot M (Mre). C'est leur premier, et gnralement
aussi leur dernier mot. Le pre n'est qu'un auxiliaire (Sahakri-mtra) de la Mre59. Le monde des cinq lments
tout entier sort aussi de la Conscience Active ou Shakti, et
il est Sa manifestation (Prna-viksha). C'est pourquoi les
hommes adorent la Mre60, plus tendre que tout61, saluant
57 L'aspect de Shiva au repos est par dfinition inerte. C'est pourquoi la Dev est

symboliquement reprsente dans les Tantra comme dominant le corps de Shiva, qui gt sous Elle comme un cadavre (Shava). Comme le dclare le Kubjik
Tantra, ch. I, ce ne sont pas Brahm, Vishnu et Rudra qui crent, prservent et
dtruisent, mais leurs Shakti : Brahmni, Vaishnav, Rudran. (Voir Prnatoshin,
9). L'activit est la nature de Prakriti (Smkhya Pravachana Stra, III, 66). Pour la
mme raison la forme fminine est reprsente dans l'union sexuelle comme
dominant (Viparta) la forme masculine. Quand la Dev se tient debout au-dessus
de Shiva, ce symbolisme indique aussi (particulirement dans le cas de Kl)
l'aspect librateur de la Mre. (Voir Avalon, Principles of Tantra, I, 323).
58 Le monde est appel une imagination (Kalpan), car il est idation cra-

trice sur le souvenir de l'univers pass. Comme le dit le Yoginhridaya Tantra,


l'image du monde est trace par la volont de la Devi (Svechchhvisvamayollekhakhachitam) ; et Bhagavn, voyant cela, fut trs satisfait .
59 Le Pre Suprme donne Son illumination (Praksha). Elle, la Vimarshashakti,

produit, mais pas toute seule. (Vimarshashakti prakshtman paramashivena


smarasya-vishvam srijati na tu keval ; (Yoginhridaya Tantra).
60 En Mtri-bhva, selon le terme sanskrit. Cela est juste aussi philosophique-

ment, car tout ce que l'homme connat (en dehors de l'extase de Samdhi) est la
Mre sous Sa forme cosmique. La Shakti Suprme, qui n'est point diffrente de
Shiva (Parshaktishivbhinn), est incarne en toutes choses (Sarvakramashririn ; Yoginhridaya Tantra).

Sa beaut souriante comme la rose Tripurasundar,


source de l'univers, et Sa grandeur effrayante comme Kl,
qui le reprend en Elle. Nous nous occupons ici du Yoga
qui ralise l'union des aspects de Mre et de Seigneur, en
cet tat de conscience qui est l'Absolu.
Le Veda affirme : Tout cela (c'est--dire le monde de la
multiplicit) est (l'unique) Brahman. (Sarvam khalvidam
Brahma)62. Comment le multiple peut tre l'un 63, les diffrentes coles l'expliquent de diverses manires. L'interprtation donne ici est celle des Shkta Tantra ou Agama.
En premier lieu, quelle est la Ralit unique qui apparat
comme multiple ? Quelle est la nature de Brahman tel
qu'il est en lui-mme (Svarpa) ? La rponse est Sat-Chit-Ananda , c'est--dire tre-Conscience-Batitude. La
conscience ou sensibilit comme telle (Chit ou Samvit) est
identique ltre comme tel. Bien que dans l'exprience
ordinaire les deux soient essentiellement lis ensemble,
pourtant ils diffrent ou semblent diffrer l'un de l'autre.
L'homme, en vertu de sa constitution, croit fermement
une existence objective en dehors et indpendamment de
lui-mme. Et une telle objectivit existe aussi longtemps
que, tant l'Esprit incarn (Jvtm), sa conscience est voi61 Il est dit que rien n'est plus tendre que Prakriti , qui sert de toutes ma-

nires le plaisir de Purusha, donnant la fin Mukti, la Dlivrance, en Se retirant


de Lui quand Il ne Lui sert plus de rien.

62 C'est l, comme le dit le Mahnirvna Tantra (VII, 98), la fin et le but de Tn-

trika Kulchra ; la ralisation de cette vrit constitue, selon le Prapanehasra


Tantra, le cinquime tat ou tat Suprme. (Tntrik Texts, vol. III, ch. XIX).
63 C'est ainsi qu'il est dit de la Devi que Sa forme est une et multiple (Eknek-

ksharkritih). Ekam = ekam ajnnam, ou My. Anekni = les divers Ajnna,


c'est--dire Avidya. Elle est les deux comme Updhi d'Ishvara et de Jva. (Trishat,
II, 23).

le ou contracte64 par My.


Mais dans l'ultime objet de l'exprience, qui est l'Esprit
Suprme (Paramtm), la diffrence a disparu, car l sont
unis en un tout indiffrenci l'exprimentateur, l'exprience et l'objet de l'exprience. Cependant, lorsque nous
parlons de Chit comme Sensibilit-Conscience, nous devons nous rappeler que ce que nous connaissons et observons comme tel n'est qu'une manifestation changeante et
limite de Chit, qui est en lui-mme le principe immuable
et infini, constituant le fond de toute exprience.
Cet tre-Conscience est Batitude absolue (Ananda),
qui se dfinit comme repos dans le Soi (Svarpavishrnti). Il est Batitude parce qu'tant le Tout infini
(Prna), rien ne peut lui manquer.
Cette Conscience bienheureuse est la nature dernire,
irrductible, de Svarpa ou forme propre de la Ralit
unique qui est la fois le Tout en tant que Rel irrductible, et Partie en tant que Rel rductible. Svarpa est la
nature de toute chose telle qu'elle est en elle-mme, et distincte de ce qu'elle peut sembler tre. La Conscience Suprme est le Couple Suprme Shiva-Shakti (ParashivaParashakti), qui jamais ne change, mais demeure ternellement le mme travers tous les changements qui affectent son aspect crateur de Shiva-Shakti. Toute manifestation est lie une apparente inconscience.
Le mental n'est videmment pas conscience pure, mais
conscience limite. Ce qui la limite doit tre quelque chose
d'inconscient en soi, ou, sinon, capable de produire l'ap64 Samkocha. La plnitude, la totalit, est voile afin que la partie, le particu-

lier, puisse tre peru.

parence de l'inconscience65. Rien, dans le monde phnomnal, n'est absolument conscient ni absolument inconscient.
Conscience et inconscience sont toujours entremles.
Certaines choses, pourtant, semblent tre plus conscientes, et certaines plus inconscientes que d'autres. Cela
est d au fait que Chit, qui n'est jamais absent de rien,
pourtant se manifeste en diverses guises et divers degrs. Le degr de cette manifestation est dtermin par la
nature et le dveloppement du mental et du corps dont il
s'est revtu. L'Esprit demeure le mme ; le mental et le
corps varient.
La manifestation de la conscience est plus ou moins limite, mesure qu'on s'lve du minral l'homme.
Dans le rgne minral, Chit se manifeste comme la plus
infrieure des formes de sensibilit, se traduisant par des
rponses-rflexes des excitations, et comme cette conscience physique appele en Occident mmoire atomique.
La sensibilit des plantes est plus dveloppe, bien
qu'elle demeure, comme le dit Chakrapni dans le
Bhnumat, une conscience endormie. Elle se manifeste
davantage en ces micro-organismes qui sont des degrs
intermdiaires entre le monde vgtal et le monde animal,
et qui possdent une vie psychique propre.
Dans le rgne animal la conscience devient plus centrale et plus complexe, atteignant son plein dveloppement
chez l'homme, qui possde toutes les fonctions psychiques
: connaissance, perception, sensibilit et volont.
65 Cette alternative correspond aux vues diffrentes du Myvda et du Shak-

tivda.

Derrire toutes ces formes particulires et changeantes


de sensibilit ou de conscience est le Chit unique, informel, immuable en soi (Svarpa), c'est--dire distinct des
formes particulires de sa manifestation.
Comme travers tous ces degrs de vie Chit demeure le
mme, il ne se dveloppe pas lui-mme en ralit. L'apparence de dveloppement est due au fait qu'Il est tantt
plus et tantt moins voil ou contract par le Mental et la
Matire. C'est en Le voilant ainsi que la puissance de la
Conscience (Shakti) cre le monde.
Qu'est-ce donc qui voile la Conscience et produit ainsi
l'exprience cosmique ?
C'est la Puissance ou Shakti en tant que My. My
Shakti est cela qui, en apparence, change le Tout (Prna)
en non-tout (Aprna), l'infini en fini, l'informel en formes,
et ainsi de suite. C'est donc une puissance qui rduit,
voile et nie. Nie quoi ? La Conscience parfaite. Shakti estelle au fond la mme chose, ou autre chose, que Shiva ou
Chit ? Elle doit tre la mme chose, sans quoi tout ne
pourrait tre l'unique Brahman. Mais si elle est la mme
chose elle doit tre aussi Chit ou Conscience. Elle est donc
Sachchidnandamay66 et Chidrpn67.
Et pourtant il existe, au moins en apparence, une distinction. Shakti (de la racine Shak, avoir la puissance ,
tre capable ) signifie puissance . Comme Elle ne fait
qu'un avec Shiva en tant que Puissant (Shaktimn), Elle,
en tant que Puissance, est la puissance de Shiva, ou la
66 C'est--dire que sa substance est Sat, Chit, Ananda.
67 Ayant la forme ou la nature de Chit. Comme dit le Kubjik Tantra, le Param

Kal est la fois Chit (Chidrp) et Nda (Ndarp).

Conscience. Il n'y a pas de diffrence entre Shiva possesseur de la puissance et la Puissance telle qu'Elle est en
Elle-mme. La puissance de la Conscience est la Conscience sous son aspect actif.
Donc, si Shiva et Shakti sont tous deux Conscience, le
premier est l'aspect statique et immuable de la Conscience, et Shakti l'aspect actif et nergtique de cette
mme Conscience. La puissance particulire par quoi le
monde de la dualit est amen l'tre est My Shakti,
Shakti qui tout la fois voile (Avarana) et projette (Vikshepa). La Conscience se voile elle-mme, et elle projette,
l'ayant tire de l'amas de ses expriences passes
(Samskr), l'ide d'un monde o elle prouve souffrance
et plaisir.
L'univers est donc l'imagination cratrice (Srishtikalpan) du Suprme Penseur du monde (Ishvara). My est
cette puissance par laquelle les choses sont mesures ,
c'est--dire formes et manifestes. Elle est le sens de la
diffrence (Bhedabuddhi), qui fait que l'homme voit le
monde, avec toutes les choses et toutes les personnes qui
s'y trouvent, comme diffrent de lui-mme, alors qu'essentiellement l'homme, le monde et tous les tres sont le
mme Soi unique. Elle tablit une sparation dans ce qui
serait, sinon, une exprience d'unit, et produit le dualisme inhrent toute exprience phnomnale. Shakti en
tant qu'action voile la conscience en se niant Elle-mme
comme Conscience, des degrs divers.
Avant la manifestation de l'univers, ltre-Conscience-Batitude infini tait seul ; il tait Shiva-Shakti, respectivement Chit et Chidrpin68.
68 Aham prakritirp chet chidnanda-paryan (Kulachdmani Nigama, ch. I,

Les suffixes May et Rpn indiquent une distinction


subtile, savoir, qu'Elle est en Elle-mme Chit, et cependant en apparence, par l'effet de la Puissance, quelque
chose qui diffre de lui.
C'est l l'Exprience totale (Prna), dans laquelle,
comme le dit l'Upanishad, le Soi connat le Soi et L'aime
. C'est l cet Amour qui est Batitude ou repos dans le
Soi , car, comme il est dit ailleurs, l'Amour suprme est
Batitude . C'est l Parashiva, qui, dans le systme des
Trente-six Tattva69, est connu sous le nom de Parsamvit.
Ce monisme suppose un double aspect de la Conscience
simple : l'aspect transcendant, immuable (Parsamvit), et
l'aspect crateur et changeant, qui est nomm ShivaShakti Tattva. Dans Parsamvit le Je (Aham) et le Cela
(Idam), c'est--dire le monde des objets, sont indissolublement mls dans l'exprience suprme de l'unit 70.
Dans le Shiva-Shakti Tattva, Shakti, qui est l'aspect ngatif de Shiva, Sa fonction tant la ngation, Se nie comme
objet d'exprience, laissant la conscience de Shiva l'tat
de simple Je , qui ne tourne son regard vers nul autre
v. 16-24 ; Tntrik Texts, vol. IV).
69 Rghava Bhatta dit : Y andirp chaitanydhyasena mahpralaye skshm

sthith (Comm. du Shrad Tilaka, ch. I). Sur l'cole du Cachemire et sa philosophie des Tattva, voir J.C. Chatterji, Kashmir Shaivism. C'est Paramashiva, ou
Shiva Nirguna (sans attribut), ou Nishkala (dpourvu de Shakti manifeste), ou
Parabrahman, oppos Shiva Saguna (avec attribut), ou Sakala (avec des parties
ou avec Shakti), ou Shabda-brahman (Brahman source du son , dont il sera
parl plus loin).
70 Comme dit le Yoginhridaya Tantra : La Par Devi est Prakshavimarsha-

smarasyaripin. C'est l'tat de Nirvikalpajnna, dans lequel il n'existe aucune


distinction du Ceci et du Cela , du Je et du Cela . Dans le Vikalpajnna,
il existe un sujet et un objet.

. C'est un tat de pure illumination subjective (Prakshamtra)71, dans lequel Shakti, qu'on appelle alors Vimarsha72, intervient de nouveau, mais maintenant avec la distinction du Je et du Cela , toujours maintenus lis
comme parties d'un mme soi.
ce point, premire tape de la dualit naissante, se
produit la premire transformation de la conscience, connue sous le nom de Sadshiva ou Sadkhya Tattva, qui
est suivie de la seconde ou Ishvara Tattva, puis de la troisime ou Shuddhavidy Tattva. Dans la premire l'accent
est mis sur le Cela , dans la seconde sur le Je , et
dans la troisime sur les deux galement. Alors My divise la conscience une, de sorte que l'objet est peru
comme diffrent du soi, puis dispers dans les multiples
objets de l'univers.
Dans la partie du Tantra Shstra qui traite du Mantra
et de son origine, ces deux Tattva mans de Shakti sont
connus, du point de vue du son, sous les noms de Nda et
Bindu. Parashiva et Parshakti sont immobiles (Nihspanda) et silencieux (Nihshabda).
Nda est le premier mouvement produit dans la conscience cosmique idante conduisant au Brahman-son
(Shabdabrahman), dont drivent toutes les ides, le langage dans lequel elles s'expriment (Shabda), et les objets
71 Paramashiva a deux aspects : Praksha et Vimarsha, ou Kmeshvara et Ka-

meshvar le Paralinga. Praksha = asphutasphutikara, manifestation de ce qui


n'est pas manifest.
72 Ce mot vient de la racine Mrish (toucher, affecter, mditer). Il dsigne ce qui

est frapp ou mani par la pense, c'est--dire objet de pense rflchie. Pradhna et Prakriti impliquent galement le sens de placer en face ; ce qui est ainsi
plac devient objet. Les trois termes dsignent le principe d'objectivation.

(Artha) qu'elles reprsentent.


Bindu signifie littralement un point , et le point diacritique (Anusvra)73 qui reprsente en sanskrit l'aspiration nasale (). Il se place, dans l'aspiration nasale
Chandrabindu, au-dessus de Nda. Dans le sens technique que lui donne le Mantra, il reprsente l'tat de
Conscience active ou Shakti dans lequel le Je ou aspect
illuminateur de la Conscience s'identifie avec le Cela
total74. Il subjective le Cela , devenant par l mme un
point (Bindu) de conscience avec lui.
Lorsque la Conscience apprhende un objet comme diffrent d'Elle-mme, Elle voit cet objet comme tendu dans
l'espace. Mais lorsque cet objet est compltement subjectiv, il est peru comme un point sans tendue. C'est l'exprience d'univers qu'a le Seigneur en tant que Bindu75.
O va l'Univers au moment de sa dissolution ? Il se rsorbe en cette Shakti qui le projeta. Il se rduit, pour ainsi
dire, un point mathmatique sans aucune tendue76.
C'est le Shivabindu, qui se rsorbe son tour dans le
Shiva-Shakti-Tattva dont il tait sorti. On se reprsente
73 Littralement ce qui accompagne (Anu) un son voyelle (Svra ou Sva-

ra).
74 Car, jusqu' une tape plus avance de l'opration de M y, le Cela est

toujours prouv comme faisant partie du Je . Aussi n'y a-t-il pas de manifestation ni de dualit.
75 Pour la mme raison Shakti est dite alors Ghanbht, c'est--dire littrale-

ment massive ou compacte . C'est cet tat de puissance concentre qui


prcde immdiatement le bourgeonnement (Sphurana) de l'univers.
76 L'image, comme toutes celles de son espce, est ncessairement imparfaite :

car un tel point, bien que sans tendue, est suppos avoir une position. Ici il n'en
a pas, nous sommes en dehors de l'espace.

Shakti enroule autour du Shiva Bindu, tout comme dans


le centre terrestre du corps humain nomm Mldhra
Chakra un serpent est lov autour du Phallus produit de
lui-mme (Svayambhulinga).
Cette Shakti love peut tre conue comme une ligne
mathmatique, elle aussi dnue d'tendue, qui, se trouvant partout en contact avec le point autour duquel elle
s'enroule, se rduit avec lui un seul et mme point. Il y a
l une unit indivisible de l'aspect de dualit, qui est aussi
reprsente dans les Tantra 77 comme un pois chiche
(Chanaka), contenant deux germes si troitement joints
qu'ils semblent n'en former qu'un seul entour d'une enveloppe extrieure78.
Pour revenir la prcdente comparaison, la Shakti enroule autour de Shiva et ne formant avec lui qu'un seul
point, est Kundalin Shakti. Ce mot vient de Kundala qui
signifie repli , anneau . On dit qu'Elle est love, La
comparant un serpent (Bhujang), qui, au repos et endormi, est lov ; et aussi parce que Sa puissance est de
nature spiralode, se manifestant comme telle dans les
mondes, qui sont les sphrodes ou ufs de Brahma
(Brahmnda), dans leurs orbites circulaires, et ailleurs
encore.
Aussi les Tantra parlent du dveloppement de la ligne
droite partir du point qui, lorsqu'il a accompli son parcours comme point, est modifi par la force de l'enveloppe
spiralode de My dans laquelle il opre, de manire
77 Voir Shatchakranirpana, Comm.
78 Les deux germes sont Shiva et Shakti, et l'enveloppe est My. Lorsqu'ils se

sparent il y a cration . Ici encore l'image est inexacte en nous prsentant


deux germes, alois que Shiva et Shakti sont l'Un sous l'aspect de la dualit.

former une figure deux dimensions, qui reprend ensuite


sa premire forme, montant comme une ligne droite au
plan de la troisime dimension et formant ainsi la figure
triangulaire ou pyramidale appele Shringtaka79.
En d'autres termes, cette Kundal Shakti est cela qui, se
mouvant pour se manifester, apparat comme l'univers.
Dire qu'elle est love , c'est dire qu'elle est au repos ,
sous la forme d'une nergie potentielle et statique. Cette
Shakti enroule autour du Suprme Shiva est appele
Mahkundal (la grande puissance love), pour la distinguer de la mme puissance qui existe dans les corps individuels, et qu'on appelle Kundalin80. C'est avec et par
cette dernire puissance que se ralise le Yoga.
Lorsqu'il est accompli, la Shakti individuelle (Kundal)
est unie la grande Shakti cosmique (Mah-Kundal), et
Celle-ci Shiva, avec qui Elle est essentiellement une.
Kundalin est un aspect de l'ternel Brahman (Brahmarp Santani), et Elle est la fois sans attribut et avec
attribut (Nirgun et Sagun). Sous Son aspect Nirgun
Elle est Conscience pure (Chaitanyarpin) et la Batitude
mme (Anandarpin et, dans la cration, Brahmnandaprakshin).
Sous l'aspect Sagun, c'est Elle dont la puissance dploie toutes les cratures (Sarvabhtaprakshin)81. Kundal Shakti dans les corps individuels est puissance au
79 La forme de la noix d'eau Singr, qui pousse en abondance dans les lacs du

Cachemire. Je ferai remarquer ici que les Yantra, bien que tracs plat, peuvent
tre imagins comme des solides. Le dessin plat ne fait que suggrer la figure
trois dimensions que constitue le Yantra.
80 Parce qu'Elle est ainsi ploye, la Devi est appele Kubjik (bossue).
81 Kubjik Tantra, ch. I, Prnatoshin, p. 8.

repos, centre statique autour duquel chaque forme d'existence tourne comme puissance active. Dans l'univers,
toute forme d'activit a toujours un noyau et un fond statiques. La Conscience unique se polarise en aspects statique (Shiva) et nergtique (Shakti) en vue de la cration
. Le Yoga rsout de nouveau cette dualit en unit.
Selon les critures hindoues, et en les traduisant par
les termes qu'emploie Herbert Spencer dans ses Premiers
Principes, l'univers est un dveloppement (Srishti) de l'homogne (Mlaprakriti) l'htrogne (Vikriti), puis un retour l'homogne (Pralaya ou Dissolution). Il y a ainsi des
tats alterns d'volution et de dissolution, la manifestation se produisant aprs une priode de repos.
De mme le Professeur Huxley, dans son ouvrage volution et thique, parle de la manifestation de l'nergie cosmique (My Shakti), qui prsente des phases alternatives
de potentialit et de dveloppement. Il est possible, dit-il,
comme le suggre Kant, que chaque masse cosmique prdestine se dvelopper en un monde nouveau ait t la
fin non moins prdestine d'un monde antrieur vanoui .
C'est ce qu'affirme le Shstra hindou, dont la doctrine
n'admet pas de premire cration absolue : le prsent univers n'tant qu'un monde dans une srie de mondes passs et futurs.
Au moment de la Dissolution (Pralaya) il y a dans la
Conscience, considre comme Mahkundal, la potentialit, le germe, d'ailleurs indistinct dans l'ensemble, de l'univers futur. My, le monde, existe potentiellement comme
Mahkundal, qui Elle-mme est une avec la Conscience
ou Shiva. Cette My contient le Samskra ou Vsan collectif (qui en fait la constitue), c'est--dire les impressions
mentales et les tendances produites par le Karma accom-

pli en des mondes antrieurs.


Elles constituent la masse de l'ignorance potentielle
(Avidya) dont se voile la Conscience. Produites par le dsir
de jouissance dans le monde, elles produisent elles-mmes
ce dsir. Les mondes existent parce que, dans leur totalit,
ils veulent l'existence. Chaque individu existe parce que sa
volont dsire la vie dans le monde. Le germe du monde
est donc la volont collective ou cosmique de vie manifeste, vie des formes et de la jouissance.
la fin de la priode de repos, ou Dissolution, ce germe
mrit en Conscience. La Conscience a donc un double aspect : son aspect informel de libration (Mukti), sous lequel elle est, comme simple Conscience-Batitude ; et son
aspect formel d'univers, sous lequel elle devient le monde
de la jouissance (Bhukti). L'un des principes cardinaux du
Shkta Tantra est d'assurer, par sa Sdhan, la fois la
Libration et la Jouissance82.
Cela est possible par l'identification du moi en sa jouissance avec l'me du monde. Quand le germe du monde
mrit, on dit que Shiva dploie sa Shakti. Comme cette
Shakti est Lui-mme, c'est Lui sous son aspect de ShivaShakti qui Se manifeste (Prasarati) et Se revt de toutes
les formes de la vie cosmique. Dans la Conscience pure,
parfaite, informelle, nat le dsir de se manifester dans le
monde des formes, le dsir d'tre forme et de jouir des
formes.
82 Bhogena moksham pnoti bhogena kulasdhanam Tasmd yatnd bhogayuk-

to bhaved vravarah sudhh. (Kulrnava Samhit, v. 219.) Par l'exprience du


monde (Bhoga Bhukti) il gagne la Dlivrance, ou l'exprience du monde est le
moyen d'atteindre Kula. Aussi le sage et bon Vira doit-il chercher avec soin
s'unir l'exprience du monde .

Cela se produit comme une impulsion limite la surface (en ralit immuable) de la Conscience pure, qui est
Nishkala Shiva, mais sans l'affecter. Il y a donc changement dans l'immuable et immutabilit dans le changement.
Shiva sous Son aspect transcendant ne change pas,
mais Shiva (Sakala), sous Son aspect immanent de Shakti,
change. Lorsque nat la volont cratrice, Shakti vibre
comme Nda83, et prend la forme de Bindu, qui est Ishvara
Tattva, dont sortent tous les mondes. C'est pour leur cration que Kundal se droule. Lorsque mrit Karma, la Dev, selon les termes du Nigama 84, devient dsireuse de
cration, et Se couvre de sa propre My . Puis la Dev,
joyeuse dans la folle volupt de Son union avec le Suprme Akula85, devient Vikrin86 , c'est--dire que les Vikra ou Tattva du Mental et de la Matire, qui constituent
l'univers, apparaissent.
Les Shstra dcrivent en dtail les tapes de la cration,
la fois des points de vue subjectif et objectif, comme
changements dans la conscience limite ou comme mouvement (Spanda), forme, et son (Shabda). Les Shaiva
tout comme les Shkta admettent les Trente-six catgories
83 Littralement le son , l'activit initiale qui est la source premire du Shabda

(son) manifest par la suite et qui est, lui, le Mot auquel correspond l'Artha ou
Objet.
84 Kulachdmani, ch. I, v. 16-24. (Tntrik Texts, vol. IV).
85 Akula est un nom tantrique de Shiva, Shakti tant appele Kula, qui est Mtri,

Mna, Meya. Il est dit dans le Yoginhridaya Tantra (ch. I) Kulam meyamnamtrilakshanam, kaulastats amastih. Ces trois termes dsignent la Connaissante,
la Connaissance, le connu, car c'est l la Conscience en tant que Shakti.
86 Kulachdmani, ch. I, v. 16-24.

ou Tattva, les Kala, les Shakti Unman et les autres Tattva, le Shadadhv, les conceptions du Mantra sur Nda,
Bindu, Kmakal, et ainsi de suite87.
Certains auteurs de l'cole shivate du nord, dont le Mlinvijaya Tantra est un Shstra essentiel, ont dcrit ces
Tattva avec beaucoup de profondeur. Mais nous ne faisons
ici que rsumer des conclusions gnrales.
Ces Trente-six Tattva sont dans les Tantra diviss en
trois groupes, nomms Atma, Vidy et Shiva. Le premier
groupe comprend tous les Tattva depuis la Prithivi ( terre
) la plus basse, jusqu' Prakriti, qui sont connus sous le
nom de catgories impures (Ashuddha Tattva) ; le second
comprend My, les Kanchuka88 et Purusha, qui constituent les catgories pures-impures (Shuddha-ashuddha
Tattva) ; et le troisime comprend les cinq Tattva les plus
levs, appels Tattva purs (Shuddha Tattva), de Shiva
Tattva Shuddhavidy. Comme nous l'avons dit dj,
l'tat suprme et immuable (Parsamvit)89 est l'exprience
de l'unit, dans laquelle le Je et le Cela sont absolument fondus l'un en l'autre.
Sous l'aspect actif, ou aspect de Shakti, prsent par les
catgories pures, l'exprience reconnat un Je et un
Cela , mais le second est considr, non comme une rali87 Sur ces termes, voir Avalon, Garland of Letters.
88 Formes de Shakti qui limitent les perfections naturelles de la Conscience. Ain-

si, de toute-connaissante elle devient connaissante de peu ; de toute-puissante,


faiseuse de peu, etc. Voir Garland of Letters. Le terme Samkocha (contraction)
exprime la mme ide. La Devi est Samkuchadrp par l'effet de Mtri, Mna et
Meya, et de mme par suite Shiva en tant que Jva (tath shivo'pi samkuchadrph). Voir Yoginhridaya Tantra.
89 Il n'est pas compt parmi les Tattva, tant Tattvtt.

t oppose et extrieure au Je , mais comme une partie


d'un Soi unique ayant deux aspects, un Je (Aham) et
un Cela (Idam). L'accent est mis d'abord sur le Je ,
puis sur le Cela , puis sur le Je et le Cela galement, pour prparer la sparation qui va suivre dans la
conscience.
Les catgories pures-impures sont videmment intermdiaires entre les pures et les impures. Le caractre essentiel de l'exprience constitue par les catgories impures est sa dualit, accomplie par My, et ses limites,
rsultat de l'opration des Kanchuka. Ici le Cela n'est
pas peru comme partie du Soi, mais comme s'opposant
lui et comme priv de lui, comme un objet extrieur. Toute
conscience est ainsi devenue exclusive de toute autre.
Des trois tats dcrits, le premier est donc un tat
transcendant o le Je et le Cela sont mls, o ces
lments de l'exprience ne sont pas dvelopps comme
tels. Intermdiaire entre le premier et le troisime, le second est une forme pure d'exprience, dans laquelle le Je
et le Cela sont prouvs la fois comme parties du Soi
unique. Enfin se produit l'tat de manifestation vritable,
o il y a coupure totale entre le Je et le Cela , o un
objet extrieur est prsent la conscience d'un connaissant autre que le sujet.
Ce troisime tat est lui-mme double. Au premier
stade, le Purusha a l'exprience d'un univers homogne,
quoique diffrent de lui sous son aspect de Prakriti ; au
second stade, Prakriti est disperse en ses effets (Vikriti),
qui sont le Mental et la Matire, et les multiples tres
qu'ils forment dans l'univers. Shakti uvrant comme Prakriti dveloppe d'abord le Mental (Buddhi, Ahamkra, Manas) et les sens (Indriya), puis la matire sensible (Bhta)

sous ses cinq formes (ther, air, feu, eau, terre)90, drives
des principes suprasensibles dont les Tanmtra sont des
manifestations sensibles particulires. Lorsque Shakti est
entre dans le dernier et le plus grossier des Tattva ( la
terre ), c'est--dire la matire solide, Son uvre est acheve. Son activit cratrice cesse, et Elle Se repose. Elle Se
repose dans Sa dernire manation, le principe terrestre.
La voici de nouveau love et endormie.
Elle est maintenant Kundal Shakti, dont la demeure
dans le corps humain est le centre terrestre ou Mldhra Chakra. De mme que dans l'tat suprme Elle
tait enroule, Mah-Kundal, autour du Suprme Shiva,
ici Elle S'enroule autour du Svayambhu Linga dans le Mldhra. Ce centre et les quatre centres situs au-dessus
sont les centres des cinq formes de la Matire. Le sixime
est celui du Mental. La Conscience, et ses dveloppements
effectus par l'action de Shakti antrieurement l'apparition de My, sont raliss dans le septime lotus (Sahasrrapadma) et dans les centres intermdiaires entre
celui-ci et le sixime ou centre du Mental (Ajn).
L'volution du Mantra est expose avec beaucoup de
clart dans le Shrad Tilaka, o il est dit que du Sakala
Shiva (Shiva Tattva), qui est Sat-Chit-Ananda, est sortie
Shakti (Shakti Tattva) ; de celle-ci Nda (Sadkhya Tattva)
; et de Nda sortit Bindu (Ishvara Tattva) 91, que, pour le
90 Ces termes ne sont pas pris dans le sens occidental habituel, mais dsignent

les tats thr, gazeux, ign, liquide et solide de la matire. Dans le culte (Pj),
ils sont symboliss par les ingrdients (Upachra) suivants : Pushpa (fleur) pour
l'ther ; Dhpa (encens) pour l'air ; Dpa (lumire) pour le feu ; Naivedya (offrande de nourriture) pour l'eau ; Chandana (santal) pour la terre.
91 Sachchidnanda-vibhavt sakalt parameshvart Asichchhaktis tato ndo

ndd bindu-samudbhavah. (Ch. I.)

distinguer du Bindu suivant, on appelle Suprme Bindu


(Para-Bindu). Nda et Bindu sont, comme tout le reste,
des aspects de la Puissance ou Shakti, tant ces tats
d'Elle-mme qui constituent les conditions propres la
cration (Upayogvasth), et L'y inclinant (Uchchhnvasth). Dans ces Tattva le germe de l'action (Kriy
Shakti) se dveloppe en vue de sa manifestation totale.
Les Tantra, dans la mesure o ils sont des Mantra
Shstra, s'occupent du Shabda ou Son , terme qui sera
expliqu plus loin. Le Mantra est le Shabda manifest.
Nda (qui signifie aussi, littralement, son ), est le premier corps causal intermdiaire produit par le Shabda
manifest. Bindu, dont nous avons parl prcdemment,
est dcrit comme l'tat de la lettre Ma avant la manifestation : c'est le Shiva-Shakti Tattva envelopp par My ou
Parama Kundalin. Il implique la fois le vide (Shnya),
c'est--dire l'tat de Brahman (Brahmapada), dans l'espace vide l'intrieur du cercle du Bindu, comme aussi
les Guna qu'il contient implicitement, puisqu'il est indissolublement uni Shakti, en qui sont contenus les Guna
ou facteurs constitutifs de la source matrielle de toutes
choses92.
On appelle le Parabindu Ghanvasth, ou tat massif
de Shakti. Il est Chidghana ou conscience massive, c'est-dire Chit associ Shakti indiffrencie (Chidrpin), en
qui reposent potentiellement comme une masse (Ghana),
bien qu'indistincts, tous les mondes et tous les tres
crer. Il est Parama Shiva, en qui sont toutes les Devat.
C'est ce Bindu qui est le Seigneur (Ishvara) que certains
92 Voir Shatchakranirpana, v. 1, 37-49 ; Todala Tantra, ch. IV ; et Kmakalm-

lin Tantra, cit au v. 43 du Shatchakranirpana.

Paurnika appellent Mahvishnu et d'autres le Brahmapurusha93. Peu importe le nom qu'on Lui donne. Il est le
Seigneur qu'adorent en secret tous les Deva 94, et qui est
dsign en diverses phases du Chandrabindu, dans Nda,
Bindu, Shakti et Shntadu 0m et d'autres Bja Mantra. Sa
demeure est Satyaloka, qui existe l'intrieur du corps
humain dans l'enveloppe du lotus aux mille ptales (Sahasrra), dans le centre crbral suprieur. Le Shrad95
dit encore que ce Parabindu, dont la substance est la Suprme Shakti, se divise en trois, c'est--dire apparat sous
un triple aspect.
Il y a donc trois Bindu, dont le premier est nomm Bindu96, et les deux autres Nda et Bja. Bindu a la nature de
Shiva et Bja celle de Shakti97. Nda est Shiva-Shakti : il
est leur relation ou interaction mutuelle (Mithah samavyah)98, ou leur union (Yoga), comme l'appelle le Prayo93 Shatchakranirpana, v. 49.
94 Ibid., v. 41.
95 Chap. I.
96 Krya Bindu, ou Bindu produit, pour le distinguer du Bindu causal (Krana)

ou Parabindu.

97 Dans le cas des Mantra, Bja (suivant la Kulachdmani, v. 58) est la premire

lettre d'un Kta ou groupe de lettres, et ce qui suit est Shakti. Ainsi dans le Mantra Krm , K est Bja, R et I sont Shakti. Par le Bja la forme est cre (Bjena
mrtikalpan).
98 Parashaktimayah sksht tridhsau bhidyate punah Bindur ndo bijam iti

tasya bhedh samrith Binduh shivtmako bjam shaktir ndas tayor mithah
Samavyah samkhytah sarvgamavishradaih. (Ch. I.)
Ce Bindu, qui est la fois Shiva et Shakti, se divise de nouveau en trois parties.
Bindu, Nda et Bja sont ses trois parties. Bindu est Shivtmaka (c'est--dire
Shiva), Bja est Shakti et Nda est donn pour la relation mutuelle existant entre
eux par tous ceux qui sont verss dans les Agama . Le premier mot du troisime

gasra99. Le triple Bindu (Tribindu) est suprme (Para),


subtil (Skshma) et grossier (Sthla)100. Nda est donc
l'union de Shiva et de Shakti dans la cration.
C'est par cette sparation de Shiva et de Shakti que nat
l'idation cratrice (Srishtikalpan). Le Bindu causal est,
vers se lit de faon plus satisfaisante Binduh shivtmako, au lieu de Bindur ndtmako, qu'on trouve dans certains manuscrits, comme celui dont j'ai donn
une citation dans l'introduction du Mahanirvna. Le Comm. du Shatchakranir
tipana, v. 40, parle aussi du Bindu comme tant Ndtmaka, mais explique que
cela signifie Shivtmaka. Voir aussi pour confirmation Kriysra.
99 Voir le Comm. de Rghava Bhatta sur le Shrad, ch. I, v. 8 :

Nirgunah sagunash cheti shivo jneyah santanah Nirgunchchaiva samjt bindavas traya eva cha Brahmabindur vishnubind rudrabindur maheshavari.
L'ternel Shiva doit tre connu la fois comme Nirguna (sans attributs) et
comme Saguna (avec attributs). Du sans attributs (Nirguna), Maheshvari, sortirent les trois Bindu qui sont Brahma-bindu, Vishnu-bindu et Rudra-bindu .
Le troisime vers, tel que le cite la Prnatoshin (p. 13), porte Nirgunashchaiva ;
mais ce doit tre une erreur pour Nirgunchchaiva, car les Bindu eux-mmes ne
sont pas Nirguna, ils en sortent.
100 Asmch cha kranabindoh saksht kramena kryabindus tato ndas tato

bjam iti trayam utpannam tad idam paraskshmasthlapadaih kathyate. (LalitSahasranma, Comm.).
De ce Bindu causal (Krana) naquirent encore Krya Bindu (le Bindu effet), et
ensuite Nda et ensuite Bila, tous les trois. On les dit Para (transcendant),
Skshma (subtil) et Sthla (grossier).
Ils reprsentent les aspects Chid, Chidachit, Achit, de la nature. Chidamshah chidachinmishrah achidamshahscha teshm rpni. (Bhskararya : Comm. du
Lalit).
Klena bhidyamnastu sa bindur bhavati tridh, Sthlaskshmaparatvena tasya
traividhyamishyate, Sa bindundabjatva bhedena cha nigadyate. Ete cha kranabindvdayash chatvra dhidaivatam avyakeshvarahiranyagarbhavirtsvarph shntvnjyeshthraudrrp ambikechchhjnnakriyrpsh cha.
(Ibid.) Adhibhtantu kmarpapfirnagirij landharaudynapitharph. Pith
rtrp iti tu nityhdridaye spashtam. (Ibid., citant Rahasygama).

sous son aspect de Shakti, Shakti indiffrencie en possession de toutes les puissances ; sous son aspect de Prakriti, Trigunamay Mlaprakriti ; sous son aspect de Devat, le non-manifest ; sous son aspect de Dev, Shnta.
Envisags sparment, les trois Bindu indiquent les oprations des trois puissances de Volont (Ichchh), de Connaissance (Jnna) et d'Action (Kriy), et les trois Guna
(Rajas, Sattva, Tamas) ; et aussi la manifestation des trois
Dev (Vm, Jyeshth, Raudr) et des trois Devat (Brahma, Vishnu, Rudra), qui en sont issus101.
Le Prayogasra et le Shrad disent que Raudr sortit
de Bindu, Jyeshth de Nda, et Vm de Bja. D'elles sortirent Rudr, Vishnu, Brahm, qui ont la nature de Jnna, de Kriy, d'Ichchh, et la Lune, le Soleil et le Feu 102.
Les trois Bindu sont connus sous les noms du Soleil (Ravi), de la Lune (Chandra) et du Feu (Agni).
101 Ichchh, Rajas, Vm, Brahm, Pashyantshabda, Jnna, Sattva, Jyeshth,

Vishnu, Madhyamshabda, Kriy, Tamas, Raudr, Rudra, Vaikharishabda. Voir


Comm. Shloka 22, Kmakalvilsa, Samketa I ; Yoginihridaya Tantra ; et Saubhgya-sudhodaya, cit dans ce dernier Tantra, Samketa 2. Comme dit le Rudra
Ymala (II, 2), les trois Deva sont des aspects de l'Un. Ek mrtistrayo dev
brahmavishumaheshvarh Marna vigrahasamklipt srijaty avati hanti cha. Mais
voir la note suivante.
102 Cit dans Prnatoshin, p. 8.

Raudr bindos tato ndj jyeshth bjd ajyata Vm tbhyah samutpannh


rudra-brahma-ramdhiph Te jnncchchh-kriytmno vahnndvarkavarpinah.
Ichchh kriy tath jnnam gaur, brhmiti vaishnav Tridh shaktih sthit yatra
tatparam jyotir om iti.
Comme le dit l'auteur de la Prnatoshin (p. 9), les noms ne doivent pas se lire
dans l'ordre des mots (Pratishabdam), sinon Jnna serait associe Vaishnav,
mais suivant les faits (Yathasambhavam), comme dans le texte. D'aprs cet expos, il semblerait que Jnna Sattva et Kriy Tamas, dans la note 101, doivent tre
intervertis.

Le Soleil contient le Feu et la Lune103. On l'appelle


Mishra Bindu, et sous cette forme il n'est pas diffrent de
Paramashiva, et il est Kmakal104. Kmakal est le
Triangle du Dsir Divin form par les trois Bindu, c'est-dire leur collectivit (Samashtirp)105. Kmakal est la
racine (Mla) de tout Mantra. La Lune (Soma, Chandra)
est Shiva Bindu, et blanche (Sita Bindu) ; le Feu (Agni) est
Shaktibindu, et rouge (Shonabindu) ; le Soleil est un mlange des deux. Le Feu, la Lune et le Soleil sont Ichchh
Shakti, Jnna Shakti, Kriy Shakti (Shakti de la Volont,
de la Connaissance et de l'Action).
Sur le plan matriel, le Bindu blanc prend la forme de la
semence (Shukr), et le Bindu rouge celle des menstrues
(Rajasphala, Shonita). Mahbindu est l'tat qui prcde la
manifestation de Prakriti 106.
Les trois Bindu (autrement dit le Kmakal) sont tous
trois Shakti, ben que l'un d'eux puisse prsenter plus particulirement l'aspect de Shiva, un autre l'aspect de Shakti. Mishra Bindu est quelquefois appel Shakti Tattva,
pour indiquer la suprmatie de Shakti, et quelquefois Shiva Tattva, pour indiquer la suprmatie du possesseur de
la puissance (Shaktimn). Il est de forme double (Ymala103 Il est Agnishomamayah. Voir Tk, v. 6-7, du Kmakalvilsa ; et Avalon, Gar-

land of Letters.
104 C'est--dire Kmayukt Kal, Kal dou de volont cratrice (ici sa manifes-

tation). Mahbindu = Paramashiva = Mishrabindu = Ravi = Kmakal. RaviParamashivbhinn mishrabindurp Kmakal.


105 En tant que Ravi ou Srya (le Soleil), Bindu est sous la forme de Parashiva, et

en lui sont les deux autres Bindu ; il est leur Samashtirpa, et on le nomme par
suite Kmakal.
106 Ce qui est O devient RR, c'est--dire Chandra, Ravi et Ra (le feu).

rpa). Il n'y a pas de Shiva sans Shakti, ni de Shakti sans


Shiva107.
Il est aussi impossible de les sparer108 que de sparer
le vent mobile de l'ther fixe dans lequel il souffle. Dans
l'unique Shiva-Shakti est une union (Maithuna)109, dont
l'ardeur est Nda, et dont nat Mahbindu, qui devient luimme triple (Tribindu), et alors est Kmakal 110. Le Shrad-Tilaka dit que, lors de l' clatement ou diffrenciation du Suprme Bindu, il y eut le son (Shabda) nonmanifest111. Ce Shabda non-manifest est, sous l'effet de
l'action (Kriy Shakti), la source du Shabda et de l'Artha
manifests, qui seront dcrits plus loin 112. Le Brahman
107 Tayor yad ymalam rpam sa sanghatta iti smritah Anandashaktih saivokt

yato vishvam visrijyati Na Shivah Shaktirahito na Shaktih Shivavarjit. (Tantrloka-Ahnika, 3.) La forme accouple de ces deux (Shiv-Shakti) est appele
jonction. On l'appelle la bienheureuse Shakti dont nat la cration. Il n'y a pas de
Shiva sans Shakti, ni de Shakti sans Shiva .
108 Ibid., Ahn. 3.
109 Sur le plan physique, ce mot dsigne l'union sexuelle.
110 Dans le Shrchakra, il est dans la rgion du Baindava Chakra, le plus haut,

suivi du Chakra triangulaire, qui est Kmeshvae, Bhagamlin et Vajreshvar. Il


sera de nouveau question du Kmakal par la suite.
111 Bhidyamnt pard bindor avyakttmaravo 'bhavat Shabdabrahmeti tam

prnuli sarvgamavi shradh. (Shrad Tilaka, ch. I.) On remarquera que dans
ces vers le premier Bindu est appel Para, et pour l'expliquer l'auteur de la Prnatoshin ajoute la note suivante :
Pard bindor ityanena shaktyavasthrupo yah prathamo bindus tasmt. (Par
Parabindu on entend le premier Bindu, qui est un tat de Shakti). Voir Garland of
Letters.
112 Voir Rghava Bhtta, Comm. du Shrad, ch. I, v. 12, et Garland of Letters.

Kriyshaktipradhnyh shabda-shabdrthakranam Prakriter bindurupinyh


shabdabrahm, bhavat param. Comme le dit le Kulrnava Tantra (Khanda 5,
Ullsa 1), l'unique Brahman a deux aspects, tant Parambrahman (transcendant)

source du langage (Shabda) et des ides d'une part,


d'autre part des objets (Artha) qu'ils reprsentent, est appel Shabdabrahman, ou, pour user d'un terme occidental, le Logos113.
De ce Bindu diffrentiateur ayant la forme de Prakriti,
sortent les Tattva du Mental et de la Matire sous toutes
leurs formes, comme aussi les Seigneurs des Tattva (Tattvesha), c'est--dire leurs intelligences directrices :
Shambhu114, la Devat qui prside l'Ajn Chakra, centre
des facults mentales ; Sadshiva, Isha, Rudra, Vishnu,
Brahm, les Devat des cinq formes de la Matire ; et enfin Prithivi (la terre ) dans le Mldhra, o la Shakti
cratrice, ayant achev Son uvre, retourne Son repos
sous le nom de Kundalin.
Tout comme l'atome est form d'un centre statique autour duquel gravitent des forces mobiles, de mme l'intrieur du corps humain Kundalin, dans le Chakra de la
Terre , est le centre statique (Kendra) autour duquel, sous
et Shabdabrahman (immanent). Shabdabrahmaparambrahmabhedena brahmanor dvaividhyam uktam. (Voir aussi Shrmad Bhgavata, Skandha 6, ch. 16.) Tena
shabdrtharpavishishtasya shabdabrahmatvan avadhritam. (Prnatoshin,
10.)
113 Il est dit dans la Prnatoshin, p. 22, que Shambhu est l' associ du temps

(Klabandhu), parce que Kla, sous la forme de Nda, aide Lui donner naissance ainsi qu'aux autres Devat.
114 Atha bindvtmanah Shambhoh klabandhoh kaltmanah Ajyata jagat-

sksh sarvavyp Sadshivah Sadshivt bhaved Ishas tato Rudrasainudbhavah


Tato Vishnus tato Brahm teshm evam samudbhavah. (Shrad, ch. I, v. 15-16.)
Ils sont ici mentionns en liaison avec la cration de la forme (Arthasrishti). La
Prnatoshin dit : Atra arthasrishtau punah rudrclinm utpattistu artharpena.
Prvam teshm utpattih shabdarpena, ato na punaruktyam iti kal my tadtmanas tadutpannatvt.

Son aspect actif, Elle uvre en tant que force vitale. Le


corps entier, tant Shakti, est mouvement incessant.
Kundalin Shakti est le support immobile de toutes ses
oprations. Lorsqu'Elle est veille et qu'Elle-mme
S'lve, Elle reprend avec Elle et en Elle ces Shakti mouvantes, puis s'unit Shiva dans le Lotus Sahasrra. Cette
monte (ou volution) est le mouvement inverse de l'involution dcrite plus haut. Les Mondes sont dissous (Laya),
de temps autre, pour tous les tres. Le Yogi parfait dissout l'Univers, pour tous les temps, pour lui-mme. Ainsi
le Yoga est Laya.
Avant de procder une description des Chakra, il est
ncessaire de dcrire plus compltement les lments
constitutifs du corps, c'est--dire la Puissance manifeste
sous la forme des Tattva que nous avons mentionns, de
Prakriti Prithivi. De ces Tattva les Chakra sont les
centres. D'autre part, il est ncessaire d'expliquer la doctrine du Son (Shabda), qui existe dans le corps aux
trois tats intrieurs (Par, Pashyant, Madhyam), et
s'exprime dans le langage articul (Vaikhair). Cela facilitera au lecteur la comprhension du Mantra ou Shabda
manifest, et de la Guirlande des Lettres qui est distribue entre les six centres corporels.

III. LA CONSCIENCE INCARNE OU JIVATMA

La Conscience, une sous un aspect de dualit, est Transcendante et Immanente. La Conscience Transcendentale
est appele le Paramtm. La Conscience incarne dans le
Mental et la Matire est le Jvtm. Dans le premier cas la
Conscience est informelle ; dans le second elle a une
forme. La forme est un produit de la Conscience sous son
aspect de Puissance (Shakti). La Puissance nomme Prakriti Shakti est la source directe du Mental et de la Matire. L'aspect statique correspondant est appel Purusha.
(Ce terme est parfois appliqu au Suprme, comme dans
le nom Brahmapurusha.)115 Il s'agit ici d'un centre de
conscience limite, limite par la Prakriti qui s'y trouve
associe, et par le Mental et la Matire quelle produit. On
entend vulgairement par Purusha, comme par Jva, l'tre
sensible pourvu d'un corps, autrement dit la vie organique116.
115 C'est ainsi qu'il est dit : Purushn na param kinchit s kshth s par gatih.
116 Dehendriydiyuktah chetano jvah. Le Kulrnava Tantra, I, 7-9, dcrit les Jva

comme des parties de Shiva enveloppes de My (qui les constitue ainsi en


entits spares), pareilles des tincelles s'chappant du feu ; c'est l une vieille
ide vdantique. Cependant, comme Jva dans le Myvd Vednta est en ralit
Brahman (Jvo brahmaiva nparah), il n'existe au fond, selon cette doctrine, aucune ralit indpendante appele Jva (Nahi rivo nma kashchit svatantrah
padrthah). Atm prend le nom de Jva lorsqu'il est avec Updhi, c'est--dire avec
attributs, tels que le corps, etc. En langage philosophique, tout Atm avec Updhi

Lhomme est un microcosme (Kshudrahmnda)117. Le


monde est le macrocosme (Brahmnda). Il existe des
mondes innombrables, dont chacun est gouvern par des
Seigneurs particuliers, bien que tous n'aient qu'une seule
grande Mre qu'adorent ces Seigneurs eux-mmes, en
mettant sur leur tte la poussire de Ses pieds. En tout,
est tout ce qui est dans tout le reste. Il n'est donc dans
l'univers rien qui ne soit dans le corps humain. Il est inutile de lever les yeux vers le ciel pour trouver Dieu. Il est
en nous, comme le Matre intrieur (Antarymin) ou le
Soi intrieur (Antartm)118. Tout le reste est Sa puissance, manifeste en Mental et Matire. Tout ce quil
existe de Mental ou de matire dans le monde existe sous
quelque forme ou quelque manire dans le corps. Nous
avons dj cit cette formule du Vishvasra Tantra : Ce
qui est ici est l. Ce qui n'est pas ici n'est nulle part 119 .
Dans le corps est le Couple Suprme, Shiva-Shakti,
prsent en toutes choses. Dans le corps est Prakriti Shakti, avec tous Ses produits. En fait, le corps est un vaste
rservoir de Puissance (Shakti). L'objet des rites tantriques
est de conduire ces diffrentes formes de puissance leur
est Jva.
117 Petit uf (sphrode) de Brahm .
118 D'aprs le Jnnrnava Tantra (XXI, 10), antah implique les ides de

secret , de subtil ; car l'Atm, fin comme un atome, est l'intrieur de toute
chose. C'est l'oiseau Hamsah qui se joue dans le Lac de l'Ignorance. Au moment
de la dissolution, o il est Samhrarp, Atm se rvle. La Mre est l'Antarymin
aussi des Devat, telles que les cinq Shiva, Brahm, etc., car Elle est Parabrahmnandarp, Parapraksharp, Sdrp et Chidrp, et ainsi les dirige. (Trishat, II, 47).
119 Yad ihsti tad anyatra yan nehsti na tat kvachit ; version hindoue de la

maxime hermtique : Ce qui est en haut est en bas .

pleine expression. C'est l'uvre de la Sdhan.


Les Tantra disent qu'il est au pouvoir de l'homme d'accomplir tout ce qu'il dsire s'il concentre sur ce but sa volont. Et selon leur doctrine il en doit tre ainsi, car
l'homme est essentiellement un avec le Seigneur Suprme
(Ishvara) et la Mre Suprme (Ishvar), et plus il manifeste
l'Esprit, plus il est dou des pouvoirs de l'Esprit.
Le centre et la racine de tous ses pouvoirs de Jva, c'est
Kundalin Shakti. Le centre o se ralise la conscience endormie est le sommet du cerveau ou Sahasrra, d'o, chez
le Yog, le Prna schappe au moment de la mort, par une
fissure appele Brahmarandhra. Le Mental et le Corps
sont les effets de Prakriti. Ayant tous deux la mme origine, tous deux, Mental ou Matire, sont choses matrielles , c'est--dire par nature des forces 120, et des instruments limits par lesquels opre l'Esprit, ou Conscience, qui, bien qu'en lui-mme sans limite, apparat ainsi limit.
La lumire d'une lanterne n'est point modifie, mais sa
manifestation l'extrieur est affecte, par la matire
travers laquelle brille cette lumire. Prakriti, cependant,
n'est pas la Matire des savants. Celle-ci n'est que son
produit le plus grossier, et comme telle n'a pas d'existence
durable. Prakriti est la cause matrielle du Mental
comme de la Matire, et de l'ensemble de l'univers qu'ils
composent. Elle est la matrice (Yoni) mystrieuse et f-

120 Herbert Spencer pense galement, en conformit avec la doctrine hindoue,

que l'univers, physique ou psychique, est un jeu de la force, que, dans le cas de la
matire, nous, en tant que moi ou mental, percevons comme objet. Sur le Mental
et la Matire, voir Avalon, The World as Power (Mind ; Matter).

conde qui donne naissance toute chose121. Ce qu'Elle est


en Elle-mme, nul ne peut le concevoir. Elle n'est connue
que par Ses effets122.
Bien que Mlaprakriti soit la cause matrielle du monde
sorti d'elle123, en dernire analyse, telle qu'elle est en ellemme (Svarpa), Prakriti, comme tout le reste, est Conscience, car la Conscience qui est Puissance et la Conscience demeure statique ne font qu'une124.
121 On a fait driver Prakriti de Kri et du suffixe ktin, qui s'ajoute pour exprimer

bhva, l'ide abstraite, et quelquefois le Karma, ou objet de l'action, et qui correspond au suffixe grec sis. Ktin inflchi au nominatif devient tih, tis. C'est pourquoi on a vu dans Prakriti l'quivalent de la phusis (nature) des Grecs. (Banerjee,
Dialogues on Hindu Philosophy, 24). On l'appelle aussi Pradhna.
Pra+dh+anat=Pradhatte sarvam tmani, cela qui contient tout en soi , la
source et le rceptacle de toute matire et de toute forme. Pradhna signifie encore littralement principale (substance), car selon le Smkhya elle est la
vritable cratrice.
122 Voir le magnifique Hymne Prakriti dans le Prapanchasra Tantra (Tntrik

Texts, vol. III). Ce que les yeux peuvent voir peut se dfinir, mais non pas Elle.
Les yeux ne peuvent la voir. Kena Up., 1, 6 : Yat chakshush na pashyati. Elle est
au-del des sens. Aussi la Trishat invoque-t-elle la Devi (II, 44) comme Idrigityavinirdeshy (qui ne peut tre dsigne particulirement comme tant ceci ou
cela). Voir Shrad Tilaka, Vmakeshvara Tantra et Vishvasra Tantra, cits dans
Prnatoshin, p. 24. Elle est ineffable et inconcevable : doue de forme (Vikriti),
pourtant Elle-mme (Mlaprakriti) sans forme. Voir Mahnirvna Tantra, IV, 3335. Aussi Syana (Rig-Veda, X, 129, 2) dit que, tandis que My est Anirvchy
(indfinissable), puisqu'elle n'est ni Sat ni Asat, Chit est dfinissable comme Sat.
123 Kriteh prrambho yasyh. C'est--dire par qui s'effectuent la cration

(Srishti), la conservation (Sthiti) et la dissolution (Laya). (Prakriyate krydikam


anay).

124 Voir le Comm. de Sadnanda sur le 4e Mantra de l'Isha Up. Le Brahman

immuable qui est conscience apparat dans la cration comme My qui est
conscience (Chidrpin) de Brahman (Brahmamay), portant en Elle des tendances karmiques (K armasamskra) incres (Andi) sous la forme des trois
Guna. Elle est donc Gunamay tout en tant Chinmay. Et comme il n'y a pas de

La Conscience, cependant, assume le rle de Prakriti,


c'est--dire de la puissance cratrice, en dployant l'univers. Sa substance est faite des Guna, ou modes de ce
principe naturel, appels Sauva, rajas, Tamas 125. L'action
gnrale de Shakti est de voiler ou de contracter la conscience. Prakriti est en fait un principe finitisant . Selon
toute apparence, elle finit , elle trace une forme dans la
Conscience informelle et infinie126. Ainsi font tous les Guna, mais dans une mesure ingale.
Le premier, Sattvaguna, a pour fonction, relativement
aux autres Guna, de rvler la conscience ; plus grande
est la prsence ou la puissance de Sattvaguna, plus
proche est la condition de Conscience Pure. La fonction de
Tamas Guna est de supprimer ou de voiler la conscience.
Celle de Rajas Guna est d'activer, c'est--dire qu'il agit sur
Tamas pour supprimer Sattva, ou sur Sattva pour supprimer Tamas127. L'objet et leffet de l'volution, comme de
toute Sdhan, sont de dvelopper Sattvaguna. Les Guna
coexistent toujours en tout, mais prdominent de manire
varie. Plus la descente est profonde par les degrs de la
second principe ces Guna sont Chit-Shakti .
125 Les trois Guna sont Prakriti. La Dev, sous la forme de Prakriti, est appele

Triguntmik (compose des trois Guna). Toute la nature sortie d'Elle, la Grande
Cause (Mahkranasvarp), est compose aussi des mmes Guna en divers
tats de relation.
126 Voir Avalon, Shakti and My ; article publi dans l'Indian Philosophical Re-

view) et reproduit dans la 3e dition de Shakti and Shkta.


127 Comme le dit le Professeur P. Mukhyopadhyaya, traitant de cette question

d'un point de vue monistique, ce sont les trois lments de la Tension Vitale la
surface de la Conscience pure : la prsentation (Sattva), le mouvement (Rajas), et
l'obscuration (Tamas), qui sont les trois lments de l'volution cratrice. (The
Patent Wonder, p. 19).

nature, plus domine Tamas Guna, comme dans ce qu'on


appelle la matire brute , suppose entirement inerte.
Plus haute est la monte, plus domine Sattva. L'homme
vritablement sattvique est un homme divin ; son temprament est appel dans les Tantra Divyabhava128. Par
Sattvaguna, parvient Sat, qui est Chit ou Conscience
pure, le Siddhayog, qui s'identifie l'Esprit Pur.
Prakriti existe en deux tats. Dans l'un (si du moins lon
considre les effets)129, Elle repose. Les Guna sont alors en
quilibre stable, et sans action rciproque. Il n'y a pas de
manifestation. C'est le non-manifest (Avyakta), la potentialit de puissance naturelle (natura naturans)130. Pourtant, lorsque par suite de la maturation du Karma, le
temps de la cration arrive, les Guna se mettent en mouvement (Gunakshoba) et il se produit une vibration initiale
(Spandana), que le Mantra Shstra nomme le Son Cosmique (Shabdabrahman). Les Guna agissent les uns sur
les autres et l'univers form de ces trois Guna est cr. Les
produits de Prakriti ainsi dvelopps sont appels Vikra
ou Vikriti131.
128 Ceux chez qui prdomine Rajas, et qui font agir ce Guna pour supprimer

Tamas, sont Vira (hros), et l'homme chez qui prdomine Tamas est un Pashu
(animal).
129 Les trois Guna sont essentiellement changeants. Nparinamya kshana-

mapyavatishthante gunh : les Guna ne restent pas un instant immobiles.


(achaspati Misra : Smkhya-TattvaKaumud, Krika 16). Le mouvement est
double : (a) Sarpaparinma ou Sadrishatarinma dans la dissolution ; (b) Virpaparinma dans l'volution.
130 C'est l, en fait, la dfinition de Prakriti oppose Vikriti : Sattvarajastama-

sm smyvasth prakritih. (SmkhyaKaumudi Krik, 3 ; Smkhva-Pravachana,


I, 61).
131 Vikra ou Vikriti est quelque chose de rellement transform, comme le lait

Vikriti est Prakriti manifeste (Vyakta ; natura naturata). Dans la Prakriti infinie et informelle apparat une tension, un effort, peru comme forme. Quand cette tension
se relche dans la dissolution, la forme disparat dans la
Prakriti informelle, qui en tant que puissance manifeste
rentre dans la Conscience de Brahman. Ces Vikriti sont
les Tattva sortis de Prakriti132, les Avidy Shakti, c'est-dire les diffrentes catgories du Mental, des Sens et de la
Matire.
Les corps sont triples : causal (Kranasharra, ou,
comme disent les Shaiva, Parasharra, subtil (Skshmasharra), et grossier (Sthlasharra). Ces corps, dans lesquels est incarn lAtm, sortent de Prakriti Shakti, et sont
constitus par ses diverses productions. Ils constituent le
tabernacle de l'Esprit Atm), qui, tant le Seigneur est
dans tous les tres, et dirige de l'intrieur tous les tres133
en caill : celui-ci est une Vikriti de celui-l. Vivarta est une transformation apparente mais non relle, comme l'apparence de serpent prise par ce qui tait et
demeure une corde. Le Vedntasra dfinit les deux termes sous cette forme
musicale : Satatt 'vato 'nyathprath vikra ityudritah Atattvato' nyathprath
vivarta ityudritah.
propos du v. 40 du Shatchakra, le Commentateur parle de Vikriti comme d'un
reflet (Pratibimbat) de Prakriti. Elle est Prakriti modifie.
132 Comme nous l'avons dj expliqu, il y a des Tattva qui prcdent les Tattva

Purusha-Prakriti. tymologiquement, Tattva est un driv abstrait du pronom


Tat ( cela , ou la Quiddit), et, comme on l'a fait remarquer, peut se comparer
l'haecceitas de Duns Scot. Le Tattva, dans un sens gnral, est la Vrit ou Brahman. Mais dans le Smkhya il a un sens technique, et s'emploie comme un terme
concret pour dsigner les huit producteurs , les seize productions , et le
vingt-cinquime Tattva ou Purusha.
133 Yah sarveshu bhteshu tishthan ; yah sarvni bhtny antaro yamayati (Bri-

hadranyaka Up., III, 7, 15). Le Jva est ainsi, dans le Myvda, Chaitanyarpa
avec l'Updhi ajnna et ses effets, mental et corps, et Abhimnin, s'attribuant

. Le corps du Seigneur (Ishvara) est pur Sattvaguna


(Shuddhasattvagunapradhna)134. Il est l'ensemble de Sa
Prakriti ou My, Lui, ou Elle, Crateur-Cratrice de
toutes choses. Jva, dit le Kulrnava Tantra135, est li de
liens (Psha) ; Sadshiva est libre de tout lien136.
Le premier est Pashu, et le second Pashupati, ou Seigneur des Pashu.
En d'autres termes, Ishvar 137 n'est pas affecte par Sa
propre My. Elle voit tout, connat tout. Elle est toutepuissante. Ainsi, Ishvara gouverne My ; Jva est gouvern par elle.
De ce point de vue, la Mre et Son enfant le Jva ne sont
donc pas identiques. Car le second est une conscience limite, sujette l'erreur, et gouverne par cette Myshakti de la Mre qui fait que le monde semble diffrent de
ce qu'il est en son essence.
Le corps de Jva est donc la Prakriti ou l'Avidya individuels, en qui Sattva est impur, ml de Rajas et de Tamas.
Mais dans la Mre sont toutes les cratures. Aussi dans la
Trishat138 la Dev est appele sous la forme d'une et de
lui-mme les tats de veille, de rve et de sommeil profond.
134 Bhashya de Shankara, II, 3-45. Le Jva est Chaitanya distingu par Updhi. Ce

dernier terme signifie proprit distinctive, attribut, corps, etc., et ici le corps
(Deha), les sens (Indriya), le mental (Manas, Buddhi), etc. (Ibid.,1, 2-6).
135 Avalon, Tntrik Texts, vol. V.
136 Pshabaddho bhavej jvah pshamuktah sadshivah (Kulrnava Tantra, IX,

48) l'auteur de la Prnatoshird, qui cite ce passage, dit son sujet : Ainsi est
montre l'identit de Shiva et de Jva . (Iti shivajvayor aikyam uktam).
137 Fminin d'Ishvara. Certains adorent Shiva, d'autres la Dev. Les deux ne font

qu'un.
138 Comm. de Shankara sur le v. 23.

mainte lettre (Eknekksharkriti).


Ek, Elle est l'Ajnna qui est pur Sauva et attribut
(Updhi) d'Ishvara ; Anek, Elle est Updhi ou vhicule de
Jva. Alors qu'Ishvara est un, les Jva sont multiples139,
suivant la diversit cause dans la nature de la Prakriti
individuelle par l'apparition en elle de Rajas et de Tamas
en proportions diverses. L'Atma apparat comme Jva dans
les diverses formes des mondes vgtal, animal et humain.
Le premier corps, ou Corps Causal, de n'importe quel
Jva particulier, est donc cette Prakriti (Avidy Shakti) qui
est la cause des corps subtil et grossier de ce Jva, sortis
d'elle. Ce corps dure jusqu' la Dlivrance : alors le
Jvtm cesse d'tre tel et redevient le Paramtm ou Esprit non-incarn (Videha-mukti). Le Jva existe dans ce
corps pendant le sommeil profond (Sushupti).
Le second et le troisime corps sont des diffrenciations
par volution du corps causal, dont procde d'abord le
corps subtil, et de celui-ci sort le corps grossier.
Le Corps Subtil, appel aussi Linga Sharra ou Puryashtaka, est constitu par les premiers dveloppements (Vikriti) du corps causal prakritique, c'est--dire le Mental (Antahkarana), l'organe interne, en mme temps ses organes
externes (Bhyakarana), qui sont les Sens (Indriya) et
leurs objets suprasensibles (Tanmtra).
Le troisime corps ou Corps Grossier est le corps matriel qui est l'objet particulier des sens140, drivs des suprasensibles.
139 Selon une autre opinion vdantique, il n'y a qu'un seul Jva.
140 Un Bhta (matire sensible) est ce qui peut tre peru par l'organe externe,

l'il ou l'oreille par exemple.

Le corps subtil peut tre dcrit en un mot comme le


Corps Mental, celui qui lui succde tant le corps matriel
grossier. Nous considrons le Mental isol, abstrait, dissoci de la Conscience (ce qui en fait n'arrive jamais), comme
une force inconsciente brisant en lments particuliers
l'Exprience Totale qui est Chit.
On lappelle cela qui opre l'intrieur ou l'organe
interne , et, bien qu'il soit unique, on lui donne des noms
divers pour dsigner la diversit de ses fonctions141. Ainsi
le Smkhya parle de Buddhi, dAhamkra, de Manas,
quoi le Vednta ajoute Chitta, ces termes dsignant divers
aspects ou attributs (Dharma) du Mental, manifests dans
les oprations psychiques par lesquelles le Jva connat,
sent et veut.
On peut les considrer du point de vue de l'volution,
c'est--dire dans l'ordre des tapes du dveloppement de
l'exprience limite du Jva, ou du point de vue d'aprs la
cration, une fois obtenue l'exprience des objets concrets
des sens.
Sous le premier aspect, Buddhi ou Mahat Tattva est
l'tat de simple prsentation ; une simple conscience
d'tre, sans la pense du je , et non affecte par des
sensations dobjets particuliers. Cest la conscience impersonnelle du Jva. Ahamkra, dont Buddhi est la base, est
la conscience personnelle qui se conoit comme un je
particulier, le sujet de lexprience.
Le Jva, dans lordre de la cration, a dabord une exprience dun caractre vague et gnral, sans conscience du
moi, comme l'exprience qui suit immdiatement le rveil.
141 Smkhya-Prachavana-Stra (II, 16). Voir Avalon, The World as Power ; Mind.

Il rapporte ensuite cette exprience au moi limit, et il a


conscience d'tre tel ou tel .
Manas est le dsir qui suit cette exprience, et les Sens
(Indriya) et leurs objets sont les moyens d'obtenir cette
jouissance qui est le but de tout vouloir-vivre. Mais, tandis
que dans l'ordre de l'volution Buddhi est le principe premier, dans l'opration relle de l'Antahkarana aprs que la
cration a eu lieu, elle vient la dernire.
Il est donc prfrable de commencer par les objets des
sens et par les sensations qu'ils veillent. Le sujet de l'exprience est affect par la Matire de cinq faons diffrentes, qui provoquent chez lui les sensations de l'oue, du
toucher et du tact142, de la couleur, de la forme143, et de la
vue, du got, de lodorat144. Mais la perception sensible
nexiste qu lgard dobjets particuliers, elle n'est donc
perue que dans ses variations.
Pourtant il existe aussi des lments gnraux des organes particuliers de la perception sensible. Que des ides
gnrales puissent se former partir d'objets sensibles
particuliers, cela, dit-on145 (142), indique leur existence en
142 Voir plus loin ; et aussi Avalon, Matter.
143 Rpa est d'abord la couleur. Au moyen de la couleur est perue la forme, car

une chose parfaitement incolore n'est point perceptible par les sens grossiers.

144 Les autres objets des sens sont ce qui se parle, ce qui se saisit, ce qui s'ap-

proche, ce qui s'excite (ce qui est dans les parties gnitales), et ce qui s'excrte.
Chaque sens est adapt une catgorie particulire d'influences : le toucher la
pression d'un solide, l'oue la pression de l'air, le got au liquide, la vue aux
rayons lumineux . (Bain, Mind and Body, p. 22 ; 1892). Voir SmkhyaPravachana-Stra, II, 26-28, 40 ; Smkhya-Tattva-Kaumud, Krik 27.
145 Voir, pour plus de dtails sur cette question, J.C. Chatterj, Kashmir Shaivaism,

125.

quelques parties de la nature du Jva comme faits d'exprience ; sans quoi les ides gnrales ne pourraient se
former partir des impressions particulires donnes par
les sens comme faits physiques d'exprience.
Cette ide gnrale s'appelle un Tanmtra, c'est--dire
la pure quiddit , ou qualit abstraite, d'un objet. Ainsi,
le Tanmtra d'un son n'en est aucune forme sensible particulire, mais il est la quiddit de ce son, autrement dit
ce son tel qu'il est indpendamment de toutes ses variations particulires.
Aussi a-t-on justement appel les Tanmtra les principes gnraux des impressions particulires des sens 146 ,
c'est--dire les lments gnraux de la perception sensible. Ils viennent ncessairement l'existence quand sont
produits les sens ; car un sens exige quelque chose qui
puisse tre objet de sensation.
Ces Bhta subtils (Skshma), comme on les appelle
aussi, ne sont pas ordinairement perus eux-mmes, car
ils sont suprasensibles (Atndriya). Leur existence n'est
qu'indirectement perue par l'intermdiaire des objets particuliers grossiers dont ils sont les principes gnraux, et
qui procdent d'eux. Ils ne peuvent tre objets de perception directe que pour les Yog147. Ils sont, comme les objets
sensibles grossiers qui en drivent, au nombre de cinq : le
son (Shabdatanmtra), le toucher et le sens thermique
(Sparshatanmtra), la couleur et la forme (Rpatanmtra),
la saveur (Rasatanmtra),(Gandahatanmtra).Chacun d-

146 Ibid. ; voir plus loin.


147 C'est pourquoi il est dit : Tni vastni tanintrdini pratyaksha-vishayni

(c'est--dire, aux Yogi).

rive de celui qui le prcde148.


Les sensations veilles par les objets des sens sont
prouves au moyen des organes externes du Seigneur, les
sens, qui sont les portes par lesquelles le Jva reoit
lexprience du monde. Ils sont au nombre de dix, et appartiennent deux catgories : les cinq organes de la sensation ou de la perception (Jnnendriya), c'est--dire
l'oreille (l'oue), la peau (le toucher), l'il (la vue), la langue
(le got), et le nez (l'odorat) ; et les cinq organes de l'action
(Karmendriya), qui sont les ractions du moi la sensation, c'est--dire la bouche, les mains, les jambes, l'anus
et le sexe, par lesquels s'accomplissent la parole, la prhension, la marche, l'excrtion et la procration, et par
lesquels se satisfont les dsirs du Jva. Ce sont respectivement des impulsions affrentes et effrentes.
L'Indriya, ou sens, n'est pas l'organe physique, mais la
facult du mental qui opre par cet organe comme par sou
instrument. Les organes externes des sens sont les
moyens habituels par lesquels s'effectuent sur le plan
physique les fonctions de l'oue et des autres Indriya. Mais
comme ce sont l de simples instruments et qu'ils tirent
leur puissance du mental, un Yogi peut accomplir par le
seul mental tout ce qui peut se faire au moyen de ces organes physiques, sans les utiliser.
Par rapport leurs manifestations physiques, mais non
leur nature intime, les classes auxquelles appartiennent
les Indriya peuvent se dfinir comme les systmes nerveux
sensoriel et moteur. Comme les Indriya ne sont pas les
148 D'une manire gnrale, les quatre derniers correspondent aux Vaisheshika

Paramnu. Il y a pourtant des diffrences. C'est ainsi que ces derniers sont ternels (Nitya) et ne procdent pas les uns des autres.

organes physiques, tels que loreille, lil, etc., mais des


facults du Diva qui dsire connatre et agir par leur
moyen, le Yog prtend accomplir sans laide de ces derniers tout ce qui dordinaire seffectuent par eux. C'est
ainsi quun sujet hypnotis peut percevoir des objets sans
faire usage des organes physiques spciaux ordinairement
ncessaires149.
La diversit des actions n'implique pas ncessairement
un nombre correspondant d'Indriya. L'acte d' avancer ,
accompli au moyen de la main comme dans le cas d'un
infirme, doit tre regard en ralit comme une action de
l'Indriya des pieds (Padendriya), bien que la main soit le
sige de l'Indriya qui manie150. Par le moyen de ces Indriya
les choses sont perues et l'action qui les concerne effectue. Les Indriya, pourtant, ne sont pas eux-mmes suffisants pour cela.
Tout d'abord, sans la coopration de l'attention (Alochana), il n'y a pas du tout de sensation. tre distrait ,
c'est ne pas savoir ce qui arrive 151. L'attention doit donc
cooprer avec les sens avant que ceux-ci puissent donner
au sujet quoi que ce soit152.
D'autre part, au mme instant le sujet peut recevoir un
nombre incalculable de sensations qui viennent lui et le
pressent de toutes parts. Si l'une d'elles doit tre amene
149 Voir Kashmir Shaivaism, p. 120. C'est ainsi que le Professeur Lombroso rap-

porte le cas d'une femme qui, tant aveugle, lisait avec le bout de l'oreille, gotait
avec les genoux, et sentait avec les orteils.
150 Tantrasra Ahnika, 8.
151 Voir Kashmir Shaivaism, p. 112.
152 C'est ainsi qu'on peut lire dans la Brihadranyaka Up., I, 3-27 : Mon Manas

(mental) tait attir ailleurs. Aussi n'ai-je pas entendu .

dans le champ de la conscience, il faut qu'elle soit choisie


l'exclusion des autres. L'opration de perception est le
choix d'une section particulire prise dans un tout, puis la
fixation de l'attention sur elle pour la faire sienne, soit
comme un objet particulier de la pense, soit comme un
champ particulier d'opration153.
Enfin, comme l'affirme la psychologie occidentale, les
sens ne fournissent pas un tout complet, mais une multiplicit, la multiplicit sensible. Ces points de sensation
doivent tre rassembls en un tout. Ces trois fonctions
d'attention, de choix, et de synthse de la multiplicit sensible discontinue, appartiennent cet aspect du corps
mental appel Manas154. Tout comme Manas est ncessaire aux sens, ces derniers sont ncessaires Manas.
Car il est le sige du dsir, et ne peut exister par luimme. Il est le dsir de percevoir ou d'agir, et n'existe donc
qu'associ avec les Indriya.
Ainsi, Manas est l'Indriya directeur, dont les sens sont
les pouvoirs. Car, sans l'aide et l'attention de Manas, les
autres Indriya sont incapables d'accomplir leurs fonctions
respectives ; et comme ces Indriya sont ceux de la perception et de l'action, Manas, qui collabore avec ces deux catgories, est dit participer du caractre de la connaissance
et de l'action.
Manas, par son association avec l'il ou un autre sens,
devient multiple, se particularisant ou se diffrenciant par
153 Ainsi, dans le Shatchakranirpana, on parle de Manas comme d'un portier

qui fait entrer les uns, et laisse les autres dehors.

154 Voir Kashmir Shaivaism, pp. 94-114. C'est la dfinition du Smkhya et du

Vednta. Selon le Vaisheshika, Manas est ce qui donne la connaissance du plaisir,


de la douleur, et de Jivtm (Je suis un tel).

sa coopration avec cet instrument particulier, qui ne peut


accomplir ses fonctions qu'en conjonction avec Manas.
Sa fonction est Samkalpa-Vikalpa, c'est--dire choix et
rejet de matriaux fournis par le Jnnendriya. Lorsqu'aprs avoir t mis en contact avec les objets des sens
il choisit la sensation qui sera prsente aux autres facults du mental, il y a Samkalpa. Cependant, l'activit de
Manas n'est elle-mme ni rsultat intelligent, ni sentiment
moteur de plaisir ou de douleur. Il n'a aucun pouvoir indpendant de se rvler au sujet. Avant que les choses
puissent tre ainsi rvles et ralises comme objets de
perception, elles doivent tre soumises l'opration
d'Ahamkra et de Buddhi, sans la lumire intelligente
desquels elles seraient des formes obscures, inaperues et
ignores du sujet, et les efforts de Manas des ttonnements aveugles dans l'obscurit.
Et les images construites par Manas ne peuvent affecter
le sujet pour linciter quelque raction que ce soit, tant
que le sujet ne sest pas identifi elles par Ahamkra,
cest--dire en les faisant siennes par la sensation et
lexprience. Manas tant ainsi une exprience dactivit
dans les tnbres, invisible et non rvle par la lumire
de Buddhi, et n'inspirant aucune impulsion au sujet avant
qu'il ne s'identifie elle dans la sensation, est une des
manifestations o la qualit obscure, opaque (Tamas guna) de Shakti Prakriti est la plus vidente155.
Ce Guna prdomine aussi dans les Indriya et dans les
objets subtils de leur opration (Tanmtra). Ahamkra (ce

155 Voir Kashmir Shaivaism, p. 116, o l'auteur cite l'affirmation de Kant, que les

perceptions (Anschauung) sans conceptions sont aveugles.

qui fait le Je) est affirmation de soi156, autrement dit ralisation de soi-mme par le Je personnel ou la conscience
individuelle de l'exprience du monde, dans laquelle le
Jva se conoit comme une personne particulire, en relation avec les objets de son exprience. C'est le pouvoir
d'affirmation de soi par quoi tout ce qui constitue l'homme
est fondu en un seul Moi, et par quoi perception et conception sont rapportes ce sujet pensant particulier et
deviennent partie de son exprience.
Ainsi, quand une sensation est perue par Manas et dtermine par Buddhi, Ahamkra dclare : C'est moi qui
la perois .
C'est le Je de la conscience phnomnale, distingu
du cela , le connu. Buddhi opre avec son aide157. Buddhi, considre en relation avec les autres facults d'exprience, est cet aspect de l'Antahkarana qui dtermine (Adhya vasytmik buddhih)158.
On dit qu'un homme dtermine lorsqu'ayant peru
(Manas), et pens : Cette chose me concerne (Ahamkra), et
s'tant ainsi affirm, il en vient cette dtermination : Ceci
doit tre fait par moi. (Kartavyam etat May)159. Doit tre
fait ne se rapporte pas ici l'action extrieure seulement,
156 Abhimna. Abhimno'hamkrah. (Voir Smkhya-Tattva-Kaumudi, Krika 24,

et Smkhya-Pravachana-Stra, livre II, Stra 16.


157 Tam ahamkram upajvya hi buddhir adhyavasyati. (Smkhya-Tattva-

Kaumud, Ibid.).
158 Smkhya-Pravachana, II, 13. Le Stra dit : Adhyavasyo buddhih ; mais le

Commentateur fait remarquer que Buddhi ne doit pas tre identifie avec ses
fonctions. C'est pourquoi Buddhi est appele Nishchayakrini.

159 Smkhya-Tattve-Kaumud, Krik 23 : Sarvo vyavahartt lochya mattv

aham atrdhikrita ityabhimatya kartavyam etat may iti adhyavasyaii.

mais aussi l'action mentale, telle qu'une dtermination


quelconque par formation de conceptions et de perceptions ( C'est ainsi ), puis de rsolutions ( Cela doit tre
fait ). Buddhi est prsente dans tous les effets autres
qu'elle-mme. Elle est le principal Tattva parce que prsente dans tous les Indriya, contenant tous les Samskra
ou tendances karmiques, et sige de la mmoire selon le
Smkhya160.
Elle est le principe pensant qui forme les concepts ou
les ides gnrales agissant par l'intermdiaire d'Ahamkra, de Manas et des Indriya. Dans les oprations des sens,
Manas est le principal agent ; dans l'opration de Manas,
Ahamkra est le principal agent ; et dans l'opration
d'Ahamkra, Buddhi est le principal agent.
C'est par l'intermdiaire d'eux tous qu'opre Buddhi,
des modifications se produisant en elle, par l'opration des
fonctions des sens161.
C'est Buddhi qui est la base de toute connaissance,
sensation et rsolution, et qui fournit des objets Purusha, la Conscience. Cest pourquoi lon dit que Buddhi,
dont la caractristique est la dtermination, est le conducteur de char ; Manas, dont la caractristique est Samkalpavikalpa, correspond aux rnes ; et les sens sont les chevaux. Jva est Celui qui jouit (Bhokt), c'est--dire Atm
associ au corps, aux sens, Manas et Buddhi162. En
Buddhi Sattvaguna prdomine ; en Ahamkra, Rajas ; en
160 Smkhya-Pravachana, II, 40-44.
161 Smkhya-Pravachana, II, 45, 39.
162 Comm. de Shankara sur la Katha 4., 3e Valli, 4e Mantra : Atmendriyama-

noyuktam bhoktetyhur manshinah. Voir aussi Smkhya-Pravachana, II, 47.

Manas et dans les Indriya et leurs objets, Tamas.


Chitta163, dans son sens spcial, est cette facult (Vritti)
par laquelle le Mental rappelle d'abord la mmoire (Smaranam) ce dont il a t pris auparavant connaissance
(Anubhava ou pratyaksha Jnna. Ce Smaranam nexiste
que dans la mesure o il y a rellement Anubhava. Car le
souvenir n'est ni plus ni moins que l'quivalent de ce qui a
t connu prcdemment164 ; il en est le rappel.
Quant Chint, c'est la facult par laquelle le courant
de la pense sarrte mditer et contempler (Chint)165
lobjet ainsi rappel par Smaranam, et antrieurement
connu et dtermin par Buddhi. Car une telle mditation
(Dhyna) s'effectue par le rappel des perceptions et des
concepts passs, et la fixation sur eux du mental.
Selon le Vednta, Buddhi ne dtermine qu'une seule
fois, aprs quoi le rappel et la mditation de l'objet mental
ainsi dtermin sont la facult d'une catgorie mentale
distincte appele Chitta. Le Smkhya, quant au principe
d'conomie des catgories, regarde Smaranam et Chint
comme des fonctions de Buddhi166. Dans les textes tantriques, pourtant, Chitta est employ couramment comme
un terme gnral pour le mental en son opration, donc

163 Chetati anena iti chittam.


164 C'est pourquoi le Ptanjala Stra dit : Anubtavishaysampramoshah

smirtih. (Il n'est rien t l'objet peru).


165 Anusandhntmik antahkarana-vrittir iti vedntah. (C'est la facult de l'An-

tahkarana qui fait des recherches dans le Vednta).

166 Smkhyashstre cha chintvrittikasya chittasya buddhavevntarbhavah.

(Dans le Smkhya Shstra, Chitta, dont la fonction est Chint, est compris en
Buddhi ; I, 64).

comme un synonyme d'Antahkarana167.


Rsumons les fonctions du corps mental : les objets des
sens (Bhta, issus des Tanmtra) affectent les sens et sont
perus par Manas, rapports au moi par Ahamkra, et
dtermins par Buddhi. Cette dernire son tour est illumine par la Conscience (Chit), qui est le Purusha ; tous
les principes (Tattva) jusqu' Buddhi incluse, tant des
modifications de Prakriti, inconsciente en apparence. Ainsi
tous les Tattva uvrent pour le plaisir du Soi ou Purusha.
Ils ne doivent pas tre regards comme des ralits ayant
par elles-mmes une existence indpendante, mais
comme des attributs de l'Esprit (Atm). Ils n'uvrent pas
leur gr, arbitrairement, mais reprsentent un effort collectif, organis, au service du Purusha qui prouve le Plaisir et l'Exprience.
Le corps subtil est ainsi compos de ce qu'on nomme
les dix-sept , savoir Buddhi (qui contient Ahamkra),
Manas, les dix sens (Indriya), et les cinq Tanmtra. Le
Smkhya ne fait pas mention particulire de Prn, le
Principe Vital, et le regarde comme une modification de
l'Antahkarana, ce qui fait qu'il est implicitement mentionn. Les Myvdin mettent les cinq aspects de Prna la
place des Tanmtra168.
Le Jva vit dans son corps subtil ou mental seulement,
lorsquil est dans l'tat de rve (Svapna). Car le monde extrieur des objets (Mahbhta) n'a point d'accs alors et la
conscience erre dans le monde des ides. Le corps subtil
ou me est imprissable jusqu' la Dlivrance : alors le
167 Chittam antahkarana-samanyam. (Chitta est l'Antahkarana en gnral ;

Smkhya-Pravachana-Bhshya).
168 Smkhya-Pravachana-Stra, III, 9. Voir Avalon, Life (Prna-Shakti).

Jvtm, ou conscience conditionne en apparence, cesse


d'tre tel, et redevient la Conscience Suprme, Paramtm, Nirguna Shiva.
Ainsi le corps subtil survit la dissolution du corps
grossier, matriel, dont il s'chappe (Utkramana) pour se
rincarner169 (selon la terminologie occidentale) jusqu la
Dlivrance (Mukti). Le Lingasharra n'est point universel
(Vibhu), car dans ce cas il serait ternel (Nitya) et ne pourrait agir (Kriy). Mais il se meut et se dplace (Gati).
N'tant point Vibhu, il doit tre limit (Parichchhinna) et
de dimension atomique (Anuparimna). Il dpend indirectement de la nourriture. Car, bien que le corps de nourriture soit le corps matriel, le Mental dpend de la nourriture lorsqu'il est associ au corps grossier. Le Mental dans
le corps subtil porte les Samskra qui sont le fruit des actions passes. Ce corps subtil est la cause du troisime
corps ou corps grossier.
Le cours entier de l'volution est d la prsence du
vouloir-vivre et du vouloir-jouir, rsultat de Vsan, ou
dsir du monde, transport de vie en vie dans les Samskra, ou impressions faites sur le corps subtil par Karma,
qui est guid par Ishvara. Dans son effort pour atteindre le
monde, le Soi n'est pas seulement dou des facults du
corps subtil, mais des objets grossiers de jouissance dont
ces facults se nourrissent. C'est pourquoi vient l'tre,
comme une projection de la Puissance (Shakti) de la
169 C'est la transmigration ou pretyabhva, qui signifie la renaissance encore et

encore , punarutpattih pretya bhvah, comme dit Gautama. Pretya = tant mort
; Bhva = le redevenir (n en ce monde). De nouveau implique une chose
habituelle ; naissance, puis mort, puis naissance, et ainsi de suite, jusqu' l'mancipation finale qui est Moksha, ou, comme l'appelle le Nyya, Apavarga (libration).

Conscience, le corps grossier, matriel, appel Sthla Sharra.


Le mot Sharra vient de la racine Shri, dprir ; car le
corps grossier subit chaque instant une naissance et
une mort de ses lments molculaires jusqu' ce que
Prna, la vitalit, abandonne l'organisme, qui, en tant que
tel, se dissout. L'me (Jvtm), lorsqu'elle abandonne le
corps, n'a plus rien de commun avec lui. Il n'existe rien
qui ressemble une rsurrection de ce mme corps. Il retourne la poussire et le Jva, lorsqu'il se rincarne, le
fait dans un corps nouveau, qui est pourtant, comme le
prcdent, apte accomplir son Karma.
Le Sthla Sharra, avec ses trois Dosha, ses six Kosha,
ses sept Dhtu, ses dix Feux, etc.170, est le corps prissable form de composs des cinq formes de matire grossire sensible (Mahbhta), corps toujours dprissant, et
finalement dissous en ses lments constitutifs aprs la
mort171. C'est lui que le Vednta appelle le corps de nourriture (Annamaya Kosha), parce qu'il se maintient au moyen
de la nourriture, convertie en chyle (Rasa), en sang, en
chair, en graisse, en os, en moelle et en semence du corps
grossier. Le Jva vit dans ce corps lorsqu'il est l'tat de
veille (Jgrat).
Le corps humain physique, grossier, est, daprs la
science occidentale, form de certains composs dont les
principaux sont l'eau, la glatine, la graisse, le phosphate
de chaux, l'albumine et la fibrine, l'eau constituant envi170 Voir Avalon : Introduction au Prapanchasra Tantra (Tntrik Texts, vol. III).
171 Le dprissement et la mort sont deux des six Urmi qui, avec la faim et la soif,

le chagrin et l'ignorance, sont les caractristiques da corps (Dehadharma : Prapanchasra Tantra, II).

ron les deux tiers du poids total. Ces substances sont


composes d'lments simples, mtalliques ou non, dont
les principaux sont l'oxygne (dans la proportion de deux
tiers peu prs), l'hydrogne, le carbone, l'azote, le calcium et le phosphore. Pour aller plus loin encore, bien que
la prtendue indestructibilit des lments de leurs
atomes prsente, disent certains, le caractre d'une vrit pratique , des expriences rcentes et bien connues
tendent rtablir l'ancienne hypothse d'une Substance
Primordiale unique laquelle peuvent se rduire ces diffrentes formes de matire, avec pour rsultat la transmutation possible (et jusqu'alors objet de raillerie) d'un
lment en un autre : chacun n'tant qu'une des diverses
manifestations de la mme unit fondamentale.
De rcentes recherches ont montr que cette substance
originelle ne peut tre de la matire au sens scientifique, c'est--dire possder masse, poids et inertie. La matire a t dmatrialise et rduite, suivant des hypothses courantes, quelque chose de profondment diffrent de la matire que peroivent les sens. Cette substance dernire est donne comme l'ther en tat de mouvement.
La nouvelle hypothse se prsenterait ainsi : l'ultime, le
plus simple facteur physique d'o est sorti l'univers est le
mouvement d'une substance, appele ther , qui n'est
pas la matire scientifique. Les mouvements de cette
substance donnent naissance la notion raliste de matire . La matire est ainsi une l'origine, malgr la diversit de ses formes. Son lment ultime est en dernire
analyse un, et les diffrences entre les diverses sortes de
matire dpendent des mouvements varis de la particule
ultime et de ses combinaisons successives. tant donne

une telle unit fondamentale, il est possible une forme


de la matire de se changer en une autre
La thorie hindoue s'accorde avec ces spculations occidentales : ce que ces dernires appellent matire scientifique ou pondrable n'existe pas pour elle de faon permanente, et elle prcise qu'il y a certains mouvements ou
forces (au nombre de cinq qui produisent la matire solide,
et qui sont rductibles en dernire analyse lther
(Aksha).
Cependant Aksha et l ther des savants ne sont
pas tous gards analogues. Le second est une substance
primitive, qui n'est point matire , mais possde des
mouvements vibratoires et fournit un milieu pour la
transmission de la lumire. Aksha est une des forces
grossires en lesquelles se diffrencie la Puissance Primordiale (Prakriti-Shakti). Considr objectivement, il est
une vibration172 de la substance (et dans la substance) de
Prakriti ; il en est une transformation dans laquelle on voit
oprer les autres forces. Enfin, Aksha n'est pas un lment ultime, mais provient du Tanmtra suprasensible,
avec la qualit (Guna) par laquelle Aksha affecte les sens
; et ce Tanmtra provient lui-mme du principe mental
gnrateur du Je (Ahamkra), conscience personnelle ne
du Jva-conscience supra-personnel (Buddhi), man de
172 Il est Spandanashla (vibratoire), d'aprs le Smkhya ; car les productions

participent du caractre de la Prakriti originelle vibrante, et ces productions ne


sont pas, comme Prakriti elle-mme, universelles (Vibhu). Le Vaisheshika Strakra le regarde comme une tendue (Sarvavyp) immobile et incolore (Nirpa). Il n'est pas un effet et il est Vibhu, il ne peut donc vibrer (Gatikriy). Les
commentateurs disent qu'tant une chose (Dravya), il doit possder la qualit
gnrale (Dharma) de Dravya ou Kriya, c'est--dire l'action. (Voir Avalon, The
World as Power ; Matter).

l'nergie originelle, ou Prakriti-Shakti, origine et base de


toutes les formes d'nergie ou de substance matrielle .
Derrire la matire comme derrire le mental, il y a
l'nergie cratrice (Shakti) du Suprme qui est la cause de
l'univers et la Conscience mme.
La matire affecte le Jva de cinq manires diffrentes,
veillant chez lui les sensations d'odorat, de got, de vue,
de toucher et de temprature, enfin doue.
Comme nous l'avons expliqu dj, les Tanmtra sont
suprasensibles, tant des qualits abstraites, tandis que
les sens peroivent seulement leurs variations dans les
objets particuliers. Ces objets sensibles particuliers drivent des principes gnraux ou Universaux .
Du Shabda Tanmtra et de ses combinaisons avec les
autres Tanmtra naissent les Bhta grossiers (Mahbhta), qui, tant des objets, occupant une tendue physique,
perceptible par les sens, se rapprochent de la dfinition
occidentale de la matire sensible distincte.
Ces cinq Mahbhta sont Aksha (l'ther), Vyu (l'Air,
Tejas (le Feu), Apas (l'Eau) et Prithiv (la terre). Leur dveloppement part du Tanmtra, d'une seule unit de ce
qu'on appelle la masse (Tamas) dans la matire sensible,
charge d'nergie (Rajas) par laccroissement graduel de la
masse o l'nergie est redistribue. Le rsultat est que
chaque Bhta est plus grossier que son prdcesseur,
jusqu' ce qu'on arrive la Terre .
Ces cinq Bhta n'ont rien de commun avec les lments occidentaux ; en vrit ce ne sont nullement des
lments, puisqu'ils sont produits par les Tanmtra. Considrs dynamiquement et objectivement, ils apparaissent
comme cinq formes de mouvement ( partir d'Aksha),

dans lesquelles se diffrencie Prakriti.


Ce sont : un mouvement libre, en tous sens, rayonnant
des lignes de force dans toutes les directions, et symbolis
par les Cheveux de Shiva173 qui produisent l'espace
(Aksha) dans lequel oprent les autres forces ; un mouvement transversal174 et un dplacement dans l'espace
(Vyu) ; un mouvement vers le haut produisant l'expansion (Tejas) ; un mouvement vers le bas produisant la
contraction (Apas) ; et ce mouvement qui produit la cohsion, et dont le caractre obstructif en fait l'oppos de
lther libre dans lequel il existe et dont il sort, ainsi que
les autres Tattva.
Le premier est peru par l'oue en raison de sa qualit
(Guna) de son (Shabda)175 ; le second par le toucher
prouvant rsistance et temprature176 le troisime par la
vue, comme couleur177 ; le quatrime par le got, possdant la saveur ; et le cinquime par l'odorat, ayant une
odeur, produite par la Matire dans la mesure seulement

173 Voir Kashmir Shaivaism, p. 132, o il est dit que les lignes du champ magn-

tique peuvent tre en rapport avec les lignes de Dik (direction) comme lignes de
l'nergie thrique.
174 Vyu, comme le dit le Prapanchasra Tantra, se caractrise par le mouve-

ment (Chalanapara). La racine sanskrite V signifie se mouvoir . Voir Sushruta,


vol. II, p. 2, d. Kaviraj Kunja Lala Bhishagratna.
175 D'aprs les conceptions occidentales, c'est l'air qui est la cause du son.

D'aprs la conception hindoue, l'ther est le support (Ashraya) du son, et l'Air


(Vyu) est un auxiliaire (Sahakr) de sa manifestation.
176 Le toucher ne dsigne pas ici toutes les formes de contact, car la forme et la

solidit ne sont pas encore dveloppes : mais le contact particulier qui renseigne sur la qualit thermique des choses.
177 Le feu est le nom de l'action qui difie et qui dtruit les formes.

o elle participe de l'tat solide178.


La terre dure, stable, massive, est ce qui est senti,
got, vu et touch, et qui existe dans l'espace connu par
l'oue, c'est--dire dans les sons qu'il contient. L' eau
fluide est ce qui est got, vu et touch dans l'espace. Le
feu est ce qui est vu et touch, c'est--dire prouv
comme temprature, dans lespace. L' air est ce qui est
senti de cette manire dans l'espace. Et le son entendu est
ce par quoi est connue l'existence de l' ther .
Ces Bhta, en se combinant, forment l'univers matriel.
Tout objet en lui contenu tant ainsi compos de tous les
Bhta, nous lisons dans les Tantra que la forme, la couleur et le son se trouvent en correspondance, vrit d'une
profonde signification rituelle. Ainsi, chaque son du langage ou de la musique a une forme correspondante, que le
phonoscope a maintenant rendue visible au regard 179. Ainsi les sourds peuvent percevoir les sons par l'il, tout
comme, au moyen de l'optophone, les aveugles peuvent
lire au moyen de l'oreille.
Dans le mme Shstra, diverses couleurs et figures
(Mandala) sont assignes aux Tattva pour les reprsenter.
Aksha est figur par un diagramme circulaire, blanc et
transparent, dans lequel, suivant certaines reprsentations, il y a des points (Chhidra, trous), indiquant les interstices que produit Aksha ; car Aksha, qui est universel, emplit l'intervalle entre les Tattva sortis de lui.
178 Toute matire l'tat solide (Prthiva) qui met une odeur est l'tat ter-

restre : par exemple les mtaux, les fleurs, etc.

179 Si l'on parle ou chante dans une petite trompette attache l'instrument, un

disque tournant semble se diviser en un certain nombre de figures, qui changent


avec les changements du son.

Vyu est figur par un diagramme gris de fume, six


angles180 ; Tejas par un diagramme rouge et triangulaire ;
Apas par un diagramme blanc en forme de croissant ; et
Prithiv var un diagramme jaune rectangulaire, qui, tant
la reprsentation du cube sur une surface plane, traduit
bien l'ide de solidit.
De mme, chaque Devat se rapporte un Yantra ou figure, qui suggre la forme prise par la Prakriti ou corps de
cette conscience particulire.
Le corps grossier est donc form des composs de ces
Mahbhta, issus de lAksha Tattva ou ther. Les Bhta
et les Tanmtra, faisant partie de ces composs, sont partout dans le corps, mais certains Bhta particuliers possdent, dit-on, des centres de force dans des rgions particulires. Ainsi les centres (Chakra) de la Terre et de l'
Eau sont deux centres infrieurs du tronc. Le Feu
rgne au centre de la rgion abdominale ; l' Air et l'
ther dans les deux centres suprieurs du cur et de la
gorge.
Les cinq Tanmtra, les cinq Bhta, et les dix sens qui
les peroivent, sont connus sous le nom des vingt Tattva
grossiers qui, dans le Yoga, sont absorbs dans les centres
du tronc. Les quatre autres Tattva, ceux-l mentaux, subtils (Buddhi, Ahamkra Manas et Prakriti) ont leurs
centres spciaux d'activit dans la tte. D'autre part, les
Btha peuvent tre spcialement rpandus dans d'autres
parties de l'organisme corporel. Ainsi Prithiv se manifeste
comme os et muscles ; Apas comme urine et salive ; Tejas
comme faim et soif ; Vyu dans l'acte de saisir et de marcher. Le Feu est multiple, et son grand mystre est honor
180 Voir les planches en couleurs la fin du volume.

sous bien des noms.


Ainsi Tejas se manifeste la fois comme lumire et chaleur, car, comme le dit Helmholtz, le mme objet peut affecter les sens de diverses manires. Le mme rayon de
soleil, qu'on nomme lumire lorsqu'il tombe sur les yeux,
est nomm chaleur lorsqu'il tombe sur la peau. Agni se
manifeste dans les feux domestique et ombilical ; sous le
nom de Kmgni, dans le centre Mldhra ; dans Vadav, le feu sous-marin, et dans l clair de la Sushumn
dans la colonne vertbrale.
Ainsi la matire existe sous les cinq tats thrique181,
arien182, ardent183, fluide184, et solide185.
Prithiv ne reprsente pas seulement ce qu'on nomme
vulgairement la Terre . Toute substance solide (Prthiva)
et odorante est l'tat de Prithiv. Toute substance l'tat
liquide (Apya) est l'tat d'Apas, comme tout ce qui possde cohsion et rsistance est l'tat de Prithiv. Celle-ci
est donc la vibration qui agglomre et cause la solidit, et
la terre commune n'en est qu'une forme compose grossire. Toute matire l'tat arien (Vyava) est Vyu. Ce
sont l des diffrenciations premires de la matire cos181 Universel (Sarvavyp), quoique relativement tel dans le Smkhya, et inco-

lore (Nirpa).

182 Aux mouvements non rectilignes (Tiryag-gamana-shla).


183 Lumineux (Praksha) et chaud (Tpa).
184 Liquide (Tarala), mouvant (Chalanashla). Il a la qualit de Sneha, par quoi

les choses peuvent tre roules en une masse (Pinda), comme la farine ou la
terre humide. Certaines choses solides deviennent temporairement liquides sous
l'action de la chaleur ; et d'autres deviennent des solides, dont la nature (Jti) est
toujours celle de l'eau (Jalatva).
185 Plein, dense (Ghana), ferme (Bridha), compos (Sanghata), et dur (Kathina).

mique dans un univers de mouvement subtilement fin.


Les Tattva, considrs objectivement, veillent dans les
Indriya l'odeur, le got, la vue, le toucher et l'oue.
Le corps grossier, rptons-le, est ainsi form des composs de ces Mahbhta, issus en dernire analyse de
l'ther, lui-mme volu comme nous l'avons montr.
Les corps grossier et subtil dcrits plus haut sont vivifis et maintenus comme organisme cohrent par Prna,
produit par lnergie active (Kriy Shakti) du Linga Sharra. Prna, le principe vital, est la relation spciale de
l'Atm avec une certaine forme de matire que par cette
relation l'Atm organise et difie comme un moyen d'exprience186.
Cette relation spciale constitue le Prna individuel du
corps individuel. Le Prna cosmique et universel nest
Prna dans ce sens grossier, mais c'est un nom du Brahman en tant qu'auteur du Prna individuel. Le Prna individuel est limit au corps particulier qu'il vivifie, et il est
une manifestation dans toutes les cratures qui respirent
(Prn) de l'activit cratrice et prservatrice du Brahman,
reprsent dans les corps individuels par la Dev Kundalin.
Tous les tres, qu'ils soient Devat, hommes ou animaux, nexistent qu'aussi longtemps que le Prna est dans
le corps. Il mesure tous leur dure de vie187. Ce qu'est la
vie, on en a discut dans l'Inde comme ailleurs 188.
Les matrialistes de l'cole Lokyata considraient la vie
186 Voir Hindu Realism, p. 84 ; et Avalon, Life.
187 Kaushtak Up., 3, 2.
188 Voir Avalon, Life.

comme le rsultat de combinaisons chimiques des lments, tout comme la proprit enivrante des boissons
alcooliques rsulte de la fermentation de riz et de mlasse
non enivrants, ou comme se produisait, croyait-on, la gnration spontane sous l'influence d'une chaleur douce.
Le Smkhya repousse cette explication. Bien que Prna et
ses cinq fonctions soient nomms Vyu, la Vie, pour cette
cole, n'est pas un Vyu au sens d'une simple force biomcanique, ni un simple mouvement mcanique rsultant
de l'impulsion d'un tel Vyu.
Selon cette cole, Prna, la vitalit, est la fonction commune du mental et de tous les sens, aussi bien rcepteurs
(Jnnendriya) que moteurs (Karmendriya), qui ont pour
rsultat le mouvement du corps. Tout comme plusieurs
oiseaux enferms dans une mme cage font bouger cette
cage en bougeant eux-mmes, ainsi le mental et les sens
font mouvoir le corps en se livrant leurs activits respectives. La vie est donc une rsultante des activits diverses
et concordantes d'autres principes ou forces de l'organisme.
Les Vdantistes sont d'accord pour dire que Prna n'est
ni Vyu ni son opration, mais ils nient qu'il soit la simple
rsultante des activits concomitantes de l'organisme, et
ils estiment que c'est un principe distinct et indpendant,
une forme matrielle assume par la Conscience universelle. La vie est donc un principe subtil prsent dans
tout l'organisme et qui n'est point Vyu grossier, mais
nanmoins une espce subtile de force, inconsciente en
apparence, puisque tout ce qui n'est pas l'Atm ou le Purusha est, selon le Myvda Vednta et le Smkhya, in-

conscient, ou, en langage occidental, matriel (Jada)189.


Le corps extrieur grossier est htrogne (Parichchhinna),
c'est--dire form de parties distinctes ou bien dfinies.
Par contre, le moi Prnamaya situ l'intrieur du moi
Annamaya est un tout homogne et un (Sdhrana), qui
imprgne tout le corps physique (Sarvapindavypin). Il
n'est pas divis en rgions distinctes (Asdhrana) comme
le Pinda, ou corps physique microcosmique. la diffrence
de ce dernier, il n'a pas d'organes spcialiss exerant
chacun une fonction spcifique. C'est une unit homogne, prsente en chaque partie du corps, dont elle est
l'me et le soi intimes. Vyu190, qui parcourt le corps, est
la manifestation spontane, lnergie subtile, invisible universelle et divine de la vie ternelle.
On la nomme ainsi parce qu'elle circule dans tout
lunivers. Invisible elle-mme, ses oprations pourtant la
manifestent. Car elle dtermine la naissance, la croissance
et le dclin de tous les organismes anims, et comme telle
reoit l'hommage de tout tre cr. tant le Vyu vital, elle
est instantane dans son action, rayonnant comme force
nerveuse travers l'organisme en courants incessants.
Dans sa condition normale elle maintient un tat d'quilibre entre les diffrents Dosha et Dhtu, ou principes
primordiaux du corps.
189 Voir le Comm. de la Taittirya Up., dite par Mahdeva Shstri, et l'Appen-

dice C, par le Docteur Brojendra Nath Seal, l'ouvrage du Professeur B.K. Sarkar,
The Positive Background of Hindu Sociology, qui donne d'autres rfrences. Par
inconscient le Vednta veut dire qu'une chose est objet de conscience, non
qu'elle soit inconsciente en elle-mme, car essentiellement tout est conscience.
190 Au sens de Prna. La racine V, rappelons-le, signifie se mouvoir . Voir

Sushruta, vol. II, p. 2.

Le Vyu corporel est divis, comme le sont les principes


appels Pitta et Kapha191, en cinq sections principales, selon les diffrences de localisation et de fonction. Vyu, qui
sous son aspect corporel est appel Prna, la force universelle d'activit vitale, en entrant dans chaque individu se
divise en dix fonctions (Vritti) dont cinq principales.
La premire est la respiration, (qui porte le mme nom Prna - que la force considre dans sa totalit), la fonction par laquelle l'air atmosphrique avec sa vitalit partout rpandue, aspir d'abord de l'extrieur dans le systme corporel, est expir192.
Sur le plan physique, Prna se manifeste dans le corps
animal comme souffle par l'inspiration (Sa), ou Shakti, et
l'expiration (Ha), ou Shiva. La respiration est elle-mme un
Mantra, le Mantra non-rcit (Ajap-mantra), car on le dit
involontairement193.
Le courant divin est le mouvement de Ha et de Sa. Ce
mouvement, qui existe sur tous les plans de vie, est, pour
le plan terrestre (Bhrloka), cr et maintenu par le soleil,
191 Voir Avalon, Tntrik Texts, Introduction du vol. III, o ces termes sont expli-

qus. Les Devat de ces Dhtu sont Dkin et les autres Shakti des Chakra. Voir
Avalon, Life.
192 Les Vyu ont d'autres fonctions encore. Nous ne donnons ici qu'un expos

gnral. Voir Sushruta Samhit, cite plus haut. Prna n'est pas le souffle physique, qui appartient au monde grossier, mais la fonction de la force vitale qui se
manifeste dans la respiration.
193 Ainsi le Niruttara Tantra (ch. IV) dit :

Ham-krena vahir yti sah-krena vishet punah


Hamseti paramam mantram jvo japati sarvad.
(Par Hamkra il sort, et par Sahkra il rentre. Un Jva rcite toujours le Suprme
Mantra Hamsah). Voir aussi Dhynabindu Up.

le souffle solaire tant la cause du souffle humain avec ses


mouvements centrifuge et centripte, contrepartie chez
lhomme du mouvement cosmique des Tattva Hamsa ou
Shiva-Shakti, qui sont l'me de l'Univers.
Le Soleil n'est pas seulement le centre et le soutien du
systme solaire194, mais la source de toute nergie disponible et de toute vie physique sur la terre. Avec la lumire
il s'chappe de son orbe un vaste rayonnement invisible,
condition ncessaire de toute vie vgtale et animale. Ce
sont ces rayons invisibles qui, selon la science, entretiennent mystrieusement toute vie organique. Le Soleil, en
tant que grand luminaire, est le corps du Dieu solaire,
grande manifestation du Soleil spirituel intrieur195.
Apna, le souffle dirig vers le bas, et qui s'oppose
Prna, gouverne les fonctions d'excrtion ; Samna attise
le feu corporel et dirige les oprations de digestion et
d'assimilation ; Vyna, ou respiration diffuse, est prsent dans le corps entier, effectuant division et diffusion,
rsistant la dsintgration, et maintenant la cohsion du
corps en toutes ses parties ; et Udna, le Vyu ascendant,
est la respiration dirige vers le haut . Prna est dans le
cur ; Apna dans l'anus ; Samna dans le nombril ;
Udna dans la gorge ; et Vyna est rpandu dans le corps
entier196.
194 Le Soleil soutient, dit-on, le vaste ensemble de la matire totale du systme

solaire, alors qu'il ne supporte que deux pour cent environ de son moment.
195 Les ouvrages sur le Yoga parlent du Chit de la Lune (Chichchandra). C'est

cette lune spirituelle qui est reprsente sur la couverture de ce livre, enlace
par le Serpent Kundalin.
196 Amritanda Up., v. 34-35 (d. Anandshrama, vol. XXIX, p. 43) ; Shndilya Up.,

ch. I. Voir aussi, sur le Prna, Prapanchasra Tantra, ch. II. On dit aussi que Prna

Cela ne veut pas dire que le Vyu est dans le nombril


lui-mme, mais qu'il rside dans la rgion du corps dsigne par ce nom, la rgion abdominale avec son centre, le
Manipra Chakra ; de mme pour les autres localisations.
Les cinq Vyu mineurs sont Nga, Krma, Krikara, Devadatta et Dhananjaya, qui se manifestent dans le hoquet, la
fermeture et l'ouverture des yeux, la digestion 197, le billement, et dans ce Vyu qui ne quitte pas mme le cadavre . Les fonctions de Prna peuvent se dfinir scientifiquement comme suit : Appropriation (Prna), Expulsion
(Apna), Assimilation (Samna), Distribution (Vyna) et
Expression (Udna). Le Prna reprsente l'acte rflexe involontaire de l'organisme, et les Indriya l'un des aspects de
son activit volontaire.
Dans le cas du Prna individualis, principe de vie de
l'organisme animal durant son existence terrestre, il peut
se dfinir, si on le considre comme un principe indpendant, comme une force plus subtile que celle qui se manifeste sous forme de matire terrestre, par lui vivifie. En
d'autres termes, d'aprs cette thorie, l'Atm donne vie
aux organismes terrestres par le moyen du Prna terrestre, qui est lune des manifestations de cette nergie
mane de lAtm universel, ou Shakti, dont elle ne diffre
pas au fond.
Atm en lui-mme ne comporte point d'tats, mais dans
le langage de ce monde nous parlons d'tats. C'est ainsi

est l'extrmit des narines (Nsgravartt), et d'autres souffles encore sont


parfois localiss diffremment. Ces localisations indiquent le sige de fonctions
spciales. Voir Avalon, Life.
197 Kshudhkara ; litt. : crateur d'apptit .

que la Mndukya Upanishad198 parle des quatre aspects


(Pda) du Brahman.
Chaitanya la Conscience incarne, est immanente et
transcendante aux corps individuels et collectifs, grossier,
subtil, causal. Un seul et mme Chit est prsent en toutes
choses et les transcende, mais reoit des noms diffrents
pour marquer ses diffrents aspects dans le Jva. Chit,
tant immuable, est lui-mme sans tats ; car il ne peut
exister d'tats que dans les produits de la changeante
Prakriti-Shakti. Mais partir de l'tat de Jva, il existe
plusieurs tats, qui, bien que forms par le mme Chit,
peuvent recevoir le nom d'tats de conscience199.
Dans le monde manifest, la Conscience apparat sous
trois tats (Avasth)200 : la veille (Jgrat), le rve (Svapna),
et le sommeil profond (Sushupti). ltat de veille le Jva a
conscience des objets extrieurs (Bahihprajna), et la jouissance grossire de ces objets au moyen des sens (Sthlabhuk)201. Le Jva reoit, dans cet tat, le nom de Jgar,
c'est--dire celui qui revt le corps grossier appel Vishva.
La conscience du Jva est ici dans le corps grossier.
Dans le rve le Jva a conscience des objets intrieurs
198 Cette Upanishad donne une analyse des tats de la Conscience sur tous les

plans, et doit tre tudie avec les Krik de Gaudapda sur le mme sujet, et
leur Comm. par Shankarchrya.
199 Dcrits en dtail plus loin.
200 Voir Mndukya Up. (o ces tats sont analyss), ainsi que les Krik de Gau-

dapda et leur Commentaire par Shankarchrya.


201 Mndukya Up., Mantra 3. Prapanchasra Tantra : Svairindriyair yadtm

bhungte bhogn sa jgaro bhavati (ch. XIX ; Tntrik Texts, vol. III). Voir Ishvarapratyabhijna : Sarvkshagocharatvena y tu vhyatay sthit (cit par Bhskararya dans son Comm. du v. 62 de la Lalit).

(Antahprajna), et la jouissance de ce qui est subtil (Praviviktabhuk), c'est--dire des impressions laisses sur le
mental par les objets perus l'tat de veille. Les objets du
rve n'ont de ralit extrieure que pour celui qui rve,
tandis que les objets perus l'tat de veille ont une telle
ralit pour tous ceux qui se trouvent dans cet tat. Le
mental cesse d'enregistrer des impressions nouvelles, et
travaille sur ce qui a t enregistr l'tat de veille. L'tat
de veille tait celui de la perception sensible ; dans celuici, le moi vit dans un monde mental, un monde d'ides, et
la conscience du Jva est dans le corps subtil. Les deux
tats sont des tats de dualit, o l'on a l'exprience de la
multiplicit202.
Le troisime tat, celui de sommeil profond, se dfinit
comme l'tat qui n'est ni veille ni rve, et dans lequel les
diverses expriences des deux tats prcdents se fondent
dans une exprience simple (Ekbhta), comme la diversit
du jour se perd dans la nuit sans que disparaisse cette
diversit. La conscience n'est ni objective ni subjective,
mais simple et indiffrencie, sans autre objet qu'ellemme (Prajnnaghana).
Dans la veille la conscience du Jva est associe au
mental et aux sens ; dans le rve les sens se sont retirs ;
dans le sommeil profond le mental aussi s'est retir. Le
Jva, appel Prjna, est alors plong dans son corps causal, cest--dire dans Prakriti insparablement associe
202 Voir Mndukya Up., Mantra 4. Ishvarapratyabhijn : Manomtrapathe'

dhyakshavishayatvena vibhramt Spastvabsabhvnm srishtih svapnapadam


matam. (Cit dans Lalit, propos du v. 113.)

Prapanchasra Tantra : Samjnrahitair api tair asynubhavo bhavet punah


svapnah.

la Conscience, autrement dit, dans cet tat de la Conscience qui est le germe partir duquel se dveloppent les
corps grossier et subtil. C'est un tat de batitude. Le Jva
n'a conscience de rien 203, mais au rveil se rappelle seulement ceci : Heureux je dormais ; je n'avais conscience de
rien204. Cet tat est donc celui qui n'a pour objet que le
sens du rien205.
Alors que les deux tats prcdents sont respectivement
la jouissance des corps grossier et subtil, celui-ci a la
jouissance de la seule batitude (Anandabhuk), c'est-dire dune batitude simple et sans objet. Le Seigneur jouit
toujours de la batitude, mais dans les deux premiers
tats Il en jouit par l'intermdiaire d'objets. Ici, Il jouit de
la batitude elle-mme, sans sujet ni objet. En ce sens
l'tat de Sushupti se rapproche de la Conscience du
Brahman. Mais il n'est pas cette Conscience dans sa puret, parce qu'il est, comme les deux autres tats, associ
l'ignorance (Avidy) : les deux premiers avec Vikriti, et le
dernier avec Prakriti. Au-del, donc, est le quatrime
tat (Turya). Ici l'exprience pure appele Shuddhavidy
est obtenue par le Samdhiyoga. Jva, l'tat de Sushupti,
est dans le corps causal (Krana), et l'tat Turya, on dit
qu'il est dans le grand corps causal (Mahkrana)206.
203 Cet tat, exempt de tout rve, est plus rare qu'on ne le suppose gnrale-

ment.
204 Voir Ptanjala Yoga-Stra : Sukham aham asvpsam na kinchid avedisham iti

smarant.
205 Abhvapratyaylambanvrittir nidr. Voir aussi Prapanchasra Tantra :

Atmanirudyuktatay nairkulyam bhavet sushuptir api (ch. XIX ; Tntrik Texts,


vol. III).
206 Bhskararya dit dans son Comm. de la Llit : Ata eva sushuptidashpan-

najvopadheh kranasharratvena turiyadash-pannajivopdhhe mahkranas-

Au-del encore, certains parlent d'un cinquime tat,


l'tat au-del du quatrime (Turytta), qui s'obtient en
se maintenant fermement dans le quatrime. On atteint
alors l'Ishvara Tattva. C'est l'tat de conscience Unmesha207, dont le Sadkhya Tattva est le Nimesha 208. En passant au-del, le sans tache atteint la srnit suprme ,
et se fond dans le Suprme Shiva.
Les distinctions prcdentes (Vishva, Taijasa et Prjna)
sont celles du Jva individuel. Mais il y a aussi le Jva collectif ou cosmique, qui est l'ensemble des Jva individuels
de chaque tat particulier209.
Dans le macrocosme, ces Jva collectifs210 sont nomms
Vaishvnara (correspondant au corps Vishva individuel)
Hiranyagarbha et Strtm211, (correspondant au corps
harratvena vyavahrah.
(De mme que le Jva dans l'tat Sushupti est en possession du Kranasharra
(corps causal), le mme Jva dans l'tat Turya est cens tre en possession du
Grand Corps Causal (Mahkranashariratvena vyavahrah).
207 Ouverture des yeux (de la conscience).
208 Fermeture des yeux de la conscience. C'est le dernier stade avant l'obtention

de la parfaite conscience de Shiva.

209 Les exposs varient dans le dtail, numrant un plus ou moins grand

nombre de degrs. Ainsi le Nirvna Tantra, cit dans le Comm. du v. 43 du Shatchakranirpana, dit que le Paramtm est la Devat dans l'tat Turya ; et le Prapanchasra Tantra (eh. XIX) dit que Jgrat est Bja, Svapna Bindu, Sushupti Nda,
Turya Shakti, et le Laya qui est au-del, Shnta.
210 Cette collectivit n'est pas une simple somme d'units, mais une collectivit

dont les units constitutives sont en relation entre elles comme les parties d'un
tout organis. Ainsi, Hiranyagarbha est celui qui a conscience d'tre tous les Jva.
Samashtyabhimni Hiranyagarbhtmakah (Bhskararya, op. cit., v. 61). Il est
l'ensemble de ces Jva.
211 On dit qu'il existe entre eux cette diffrence, que le Paramtm manifest

Taijasa individuel) ; et Ishvara est le nom de la forme collective des Jva dfinis comme Prjna. Du point de vue
cosmique, ceux-ci sont les Seigneurs conscients des
mondes objectif, subjectif et causal, au-del desquels est
la Conscience Suprme.
L'exprience suprme du Yoga et la Dlivrance s'obtiennent par le passage au-del des trois premiers tats de
l'exprience ordinaire.
L'opration du Yoga est un mouvement de retour la
Source, l'inverse du mouvement crateur parti de cette
Source. Voici l'ordre de la manifestation : Buddhi, puis
Ahamkra, dont sortent Manas, Indriya et Tanmtra, ce
dernier produisant les Bhta. Le sige de la Source tant,
dans le corps humain, le cerveau, o se trouve la plus
grande manifestation de la Conscience, le sige du Mental
est entre les sourcils et les siges de la Matire dans les
cinq centres qui s'chelonnent de la gorge la base de la
moelle pinire. Cest l que commence le mouvement de
retour et les diverses espces de Matire se fondent l'une
en l'autre, puis dans le Mental, et le Mental dans la Conscience, comme on le verra au chapitre V. la question de
savoir si l'homme peut, hic et nunc, atteindre au suprme
tat de Batitude, le Yoga rpond oui .

comme l'Antahkarana collectif est Hiranyagarbha, et comme le Prna collectif


Strtm. Manifest par ces deux vhicules sans diffrenciation, il est Antarymin. Voir Bhskararya, loc. cit.

IV. LE MANTRA

Il est question dans cette introduction de Shabda, de Varna, de Mantra. Il est dit que les lettres (Varna) de l'alphabet sont distribues dans tous les centres corporels sur les
ptales des lotus. Dans chacun des lotus il a aussi un
Mantra-germe (Bja du Tattva de ce centre. Kundalin est
la fois Lumire (Jyotirmay) et Mantra (Mantramay)212, et
l'on utilise le Mantra dans l'opration qui a pour but de
lveiller.
Il nest peut-tre aucun sujet dans le Shstra hindou
qui soit moins bien compris que le Mantra. Il forme une
partie si importante du Tantra-Shstra que celui-ci porte
aussi le nom de Mantra-Shstra. Les orientalistes et
autres auteurs dcrivent communment le Mantra comme
une prire , comme des formules d'adoration , des
syllabes mystiques , etc. La science du Mantra peut avoir
ou non des bases solides, mais, mme dans la ngative,
elle n'est point l'absurdit que certains imaginent. Ces
derniers ont pu faire une exception en faveur des Mantra
qui sont des prires, et dont ils comprennent le sens, car
avec la prire ils sont familiers. Mais une telle apprciation
dnote elle-mme un manque de comprhension. Il
n'existe rien dans un Mantra qui soit ncessairement sa212 La premire est la forme subtile, la seconde la forme grossire. Voir, sur le

Mantra : Avalon, Garland of Letters.

cr, ou qui contienne une prire.


Le Mantra est une puissance (Mantrashakti) qui se
prte impartialement tout usage. Un homme peut tre
bless ou tu par le Mantra213 ; par le Mantra certains ralisent, dit-on, une sorte d'union avec la Shakti physique214
; par le Mantra, dans l'initiation appele Vedhadgsh, il se
produit une telle transmission de pouvoir du Guru au disciple que celui-ci s'vanouit sous le choc215 ; par le Mantra, le feu du Homa peut, et dans certaines conditions
idales, doit tre allum216 ; par le Mantra l'homme est
sauv. Le Mantra, en un mot, est une puissance (Shakti) ;
la puissance sous la forme du Son. La racine man signifie penser .
213 Comme dans Mranam et autres sortes de Shatkarma. Voici un exemple que

j'ai lu dun auteur qui n'est nullement suspect d'occultisme ni de thosophie.


Le gnral J.T. Harris aperut un scorpion tout prs du pied d'un Sdhu. Ne
bougez pas, dit-il, il y a un scorpion prs de votre pied . Le Sdhu se pencha, et
lorsqu'il vit le scorpion il dirigea ses doigts vers lui ; alors l'animal, immdiatement et en prsence du gnral, se recroquevilla et mourut. Vous semblez possder dj quelques pouvoirs , dit le gnral ; mais le Sdhu esquiva le sujet
comme sans importance. (China Jim : Incidents in the Life of a Mutiny Veteran, par
le Gnral J.T. Harris, p. 74 ; d. Heinemann.)
214 Un usage extraordinaire fait du Mantra m'est rvl par des pratiquants du

Shairava Mantra. L'homme projette le Mantra sur la femme, qui prouve alors la
sensation d'une union physique. Le Vishnu Purna parle de conception par la
puissance de la volont.
215 Comme le dit le Kulrnava Tantra, et comme il est facile de le comprendre,

un tel Guru se trouve rarement. Le disciple qui reoit cette initiation obtient tous
les pouvoirs de son initiateur. On dit qu'il existe des Guru qui peuvent immdiatement rendre leurs disciples capables datteindre les buts les plus levs.
216 On affirme que le cas s'est produit rcemment dans la maison d'un ami d'un

de mes collaborateurs. On prtend qu'un homme y enflamma le combustible du


Kushandik Homa seulement par le Mantra et le Bja du feu (Ram), sans employer ni flamme ni allumette.

Le pouvoir crateur de la pense est maintenant de plus


en plus admis en Occident. Lecture de pense, transmission de pense, suggestion hypnotique, projections magiques (Mokshana) et boucliers magiques (Grahana)217,
commencent tre connus et pratiqus, pas toujours avec
de bons rsultats. La doctrine est ancienne dans l'Inde,
elle est la base des pratiques qu'on trouve dans les Tantra, et dont certaines sont gnralement gardes secrtes
pour en prvenir l'abus218.
Ce qui, pourtant, est mal compris en Occident, c'est la
forme particulire de science de la pense que constitue le
Mantravidy. Ceux qui sont familiariss avec la prsentation occidentale des sujets de cette sorte comprendront
plus vite219, si je dis que, selon la doctrine hindoue ici dcrite, la pense (comme le mental, dont elle est l'opration)
est une Puissance ou Shakti. Elle est donc aussi relle que
les objets matriels extrieurs. L'une et les autres sont des
projections de la pense cratrice de Celui qui pense le
monde. La racine man , qui veut dire penser , est aus217 Ce terme sanskrit dsigne moins une protection pour laquelle on met un

Kavacha, que l'art d' attraper un Mantra qu'on projette sur vous.
218 Dans la Samhit appele Kulrnava (non dans le Tantra de ce nom), Shiva,

aprs avoir fait allusion certains rites terribles pratiqus avec la chair de chats
noirs, de chauves-souris et d'autres animaux, le linge souill d'une femme Chandla, le linceul d'un cadavre, et ainsi de suite, s'crie : O Prvati, ma tte et mes
membres tremblent, ma bouche est dessche (Hridayam kampate marna,
gtrni marna kampante, mukham shushyate Prvati) ; et il ajoute : On n'en
doit point parler, on n'en doit point parler, on n'en doit point parler, je dis et
redis qu'on n'en doit point parler . (Na vaktavyam na vaktavyam na vaktavyam
punah punah.)
219 C'est parce que les orientalistes et les missionnaires ignorent tout de l'occul-

tisme, et le regardent comme une superstition, que leur faon de prsenter la


doctrine hindoue est si souvent ignorante et absurde.

si la racine du mot sanskrit dsignant l'Homme , qui


seul de toute la cration pense proprement parler. Le
Mantra est le Shabdabrahman manifest.
Mais qu'est-ce que Shabda ou le son ? Shkta Tantra
Shstra suit la doctrine du Mmms sur Shabda, avec les
modifications qui sont ncessaires pour l'adapter sa doctrine de la Shakti. Le son (Shabda), qui est une qualit
(Guna) de l'ther (Aksha), et qui est prouv par l'oue,
est double ; savoir : exprim par des lettres (Varntmakashabda), et non exprim par des lettres, ou Dhvani
(Dhvanytmaka sabda)220.
Le second est caus par le choc de deux objets, et n'a
point de signification. Shabda, au contraire, qui est
Anhata (terme appliqu au Lotus du Cur), est le son de
Brahman qui n'est pas caus par le choc de deux objets.
Le son exprim par des lettres est compos de phrases
(Vkya), de mots (Pada), et de lettres (Varna). Un tel son a
une signification221. Shabda se manifestant comme langage est dit ternel222. Ceci est ni par les Naiyyika, qui le
disent transitoire. Un mot est prononc, et il a disparu.
Mais le Mmms s'lve contre cette opinion, dclarant
que la perception du son exprim doit tre distingue du

220 Ce Dhvani est le corps grossier du Mantra. Voir Avalon, Garland of Letters.
221 Quand le mot Ghata est prononc, alors s'veille dans l'esprit l'ide d'une

jarre. Quand le Mantra d'une Divinit est prononc, s'veille l'ide de la Dit
dont il est le nom.
222 Non en tant que sons audibles (Dhvani), mais comme la ralit qui trouve

une expression pour l'oue dans les sons audibles. Les expressions sensibles sont
transitoires. Derrire elles est le Verbe ternel (Shabdabrahman), dont elles sont
la manifestation.

son exprim lui-mme223. La perception est due Dhvani,


caus par le choc de l'air en contact avec les organes vocaux, c'est--dire la gorge, le palais et la langue. Avant
qu'il n'y ait Dhvani, il doit y avoir le choc dune chose
contre une autre. Ce n'est pas ce simple choc qui est le
Shabda articul : il le manifeste seulement.
Le son articul est produit par les organes vocaux en
contact avec l'air, et cette production rpond au mouvement mental ou ide, qui par la volont cherche ainsi une
expression extrieure sous forme de son audible224. C'est
cette perception qui est transitoire, car le Dhvani qui manifeste les ides dans le langage est tel. Mais le son articul, tel qu'il est en lui-mme, est ternel. Il n'a pas t produit l'instant o il a t peru. Il a t seulement manifest par le Dhvani.
Il existait auparavant, comme il existe aprs une telle
manifestation, tout comme une jarre dans une pice obscure, rvle par un clair, n'est point produite par lui, et
ne cesse point d'exister en cessant d'tre perue quand
disparat l'clair qui la manifesta. L'air en contact avec les
organes de la voix rvle le son sous la forme des lettres de
l'alphabet, et de leurs combinaisons en mots et en
phrases. Les lettres sont produites pour l'oue par l'effort
de la personne dsirant parler, et deviennent audibles
l'oreille des autres par l'opration du son sans lettres, ou
Dhvani. Celui-ci ne faisant que le manifester, le Shabda
avec lettres est quelque chose d'autre que ce qui le mani223 Samantu tatra darshanam (Mais semblable en est la perception).
224 Ce n'est l qu'une des formes dans lesquelles les lettres trouvent une expres-

sion sensible. Ainsi l'criture donne une impression visuelle, et aux aveugles des
points perfors donnent une impression tactile.

feste.
Avant de dcrire la nature de Shabda dans ses diverses
formes de dveloppement, il est ncessaire de comprendre
la psychologie hindoue de la perception. chaque instant
le Jva est sujet d'innombrables influences qui se dversent sur lui de toutes les rgions de l'univers. Seules atteignent sa Conscience celles qui attirent son attention, et
sont ainsi choisies par son Manas. Celui-ci s'occupe de
l'une ou l'autre de ces impressions sensibles, et la transmet la Buddhi.
Lorsqu'un objet (Artha) est prsent au mental et peru,
le mental prend la forme de l'objet peru. C'est ce qu'on
appelle une Vritti (modification) mentale, que le but du
Yoga est de supprimer. Le mental en tant que Vritti est
donc une reprsentation de l'objet extrieur. Mais dans la
mesure o il est une telle reprsentation, il est objet tout
comme l'objet extrieur. Celui-ci, l'objet physique, est appel l'objet grossier (Sthla artha), et l'autre, l'impression
mentale, est appele l'objet subtil (Skshma artha). Mais
en dehors de l'objet il y a le mental qui le peroit. Il s'ensuit que le mental a deux aspects, sous l'un desquels il est
le percevant, et sous l'autre le peru, la formation mentale
(Vritti) qui dans la cration prcde la projection extrieure, et aprs la cration suit comme l'impression produite dans le mental par la perception d'un objet physique
grossier.
L'impression mentale et l'objet physique se correspondent exactement, car l'objet physique n'est, en fait,
qu'une projection de l'imagination cosmique, bien qu'il
possde la mme ralit que le mental ; ni plus ni moins.
Le mental est donc la fois connaissant (Grhaka) et connu
(Grhya),
rvlateur
(Prakshaka)
et
rvl

(Prakshya), indicateur (Vchaka) et indiqu (Vchya).


Quand le mental peroit un objet, il prend la forme de cet
objet. Ainsi le mental qui pense la Divinit qu'il adore
(Ishtadevat) prend la fin, par l'effet d'une dvotion continue, la ressemblance de cette Devat. C'est l un principe fondamental de la Sdhan, ou pratique religieuse,
du Tantrisme.
L'objet peru est nomm Artha terme qui vient de la racine Ri , qui signifie obtenir , connatre , goter .
Artha est cela qui est connu, et qui est par suite objet de
jouissance. Le mental en tant qu'Artha, c'est--dire sous
sa forme d'impression mentale, est un reflet de l'objet extrieur ou Artha grossier. Comme l'objet extrieur est Artha, de mme est la forme mentale intrieure subtile qui
lui correspond.
L'aspect sous lequel le mental est connaissant est appel Shabda ou Nma (nom), et l'aspect sous lequel il est son
propre objet, autrement dit le mental connu, est appel
Artha ou Rpa (forme). L'objet physique extrieur dont ce
dernier est, chez l'individu, une impression, est aussi Artha ou Rpa, et la parole exprime est le Shabda extrieur. Ainsi le sujet et l'objet, du point de vue du Mantra,
sont Shabda et Artha, termes qui correspondent au Nma
et au Rpa du Vednta, c'est--dire aux concepts et aux
concepts objectivs. Comme le dit le Vednta, la cration
tout entire est Nma et Rpa. Le mental est la puissance
(Shakti), dont la fonction est de distinguer et d'identifier
(Bhedasamsargavritti Shakti).
Tout comme le corps est causal, subtil et grossier, de
mme Shabda, dont il existe quatre tats (Bhva), appels
Par, Pashyant, Madhyam et Vaikhair, termes qui seront expliqus plus longuement au chapitre V de cette in-

troduction.
Para est ce qui existe par la diffrenciation du Mahbindu avant la manifestation effective. C'est le Shabda
causal, immobile, en Kundalini, dans le centre corporel
Mldhra. L'aspect sous lequel il commence se mouvoir
d'un mouvement gnral (c'est--dire non particularis)
(Smnya-spanda), est Pashyant, dont le domaine s'tend
du Mldhra au Manipra Chakra, le centre voisin [Voir
note du traducteur en fin de chapitre]. Il est ici associ
Manas. Ces deux tats reprsentent l'aspect immobile et le
premier aspect mobile de Shabda.
Le son Madhyam est associ Buddhi. Il est Hiranyagarbha Shabda (Hiranyagarbharpa) qui s'tend de Pashyant jusqu'au cur.
Le son Madhyam, qui est l'acte intrieur de nommer
par l'aspect cognitif du mouvement mental, comme aussi
son Artha ou objet subtil, appartiennent au corps mental
ou subtil (Skshma ou Linga Sharra). La perception dpend de la distinction et de l'identification.
Dans la perception d'un objet, la partie du mental qui
identifie et distingue, autrement dit la partie connaissante,
est le Shabda subtil ; et la partie qui prend la forme de
l'objet (une forme correspondant la chose extrieure), est
l'Artha subtil. La perception d'un objet suit donc l'opration simultane du mental sous son double aspect de
Shabda et d'Artha, qui sont entre eux dans une relation
indissoluble comme connaissant et connu. Tous deux appartiennent au corps subtil. Dans la cration, Madhyam
Shabda est apparu le premier. Il n'y avait pas alors d'Artha extrieur.
Puis le mental cosmique projeta ce Madhyam Artha in-

trieur dans le monde de l'exprience sensible, et le nomma en langage exprim (Vaikhair Shabda). Ce dernier est
la parole mise, dveloppe dans la gorge et sortie de la
bouche. Il est Virt Shabda. Vaikhar Shabda est donc le
langage, le son grossier exprim par les lettres. L'Artha
qui lui correspond est l'objet physique ou grossier que le
langage dsigne. Il appartient au corps grossier (Sthla
Sharra).
Madhyam Shabda est le mouvement mental ou l'idation sous son aspect de connaissance, et Madhyam Artha
est l'impression mentale de l'objet grossier. Le mouvement
de pense intrieur sous son aspect de Shabdrtha, et
considr la fois sous son aspect de connaissant (Shabda) et comme l'objet connu subtil (Artha), appartient au
corps subtil. Leur cause tous deux est le premier mouvement gnral vers une idation particulire (Pashyant),
partir de la cause immobile, Parashabda, ou le Langage
Suprme. Deux formes de langage intrieur ou cach,
causal et subtil, accompagnant le mouvement mental,
prcdent et prparent le langage parl. Les formes intrieures du mouvement d'idation constituent l'aspect subtil, et le son exprim l'aspect grossier du Mantra, qui est le
Shabdabrahman manifest.
Le Shabda grossier, appel Vaikhar ou langage parl, et
l'Artha grossier, ou objet physique dsign par ce langage,
sont la projection du Shabda et de l'Artha subtils, par l'activit initiale du Shabdabrahman, dans le monde de la
perception grossire sensible. C'est pourquoi, dans le
monde physique grossier, Shabda signifie langage, c'est-dire les phrases, les mots et les lettres, qui sont l'expression des ides et qui sont le Mantra.
Dans le monde subtil ou mental, Madhyam Shabda est

le mental qui nomme sous son aspect de connaissant,


et Artha est le mme mental sous son aspect dobjet mental de sa connaissance. On le dfinit comme extrieur sous
1a forme du mental. Il est donc semblable l'tat de rve
(Svapna) : tandis que Parashabda est l'tat causal sans
rve (Sushupti), et Vaikhar l'tat de veille (Jgrat).
L'Artha mental est un Samskra, une impression laisse sur le corps subtil par une exprience antrieure, qui
se ravive quand le Jva s'veille de nouveau l'exprience
du monde et se rappelle l'exprience provisoirement perdue dans l'tat cosmique sans rve, qui est la dissolution
(Mahpralaya).
Qu'est-ce donc qui veille ce Samskra ? tant effet
(Krya), il doit avoir une cause (Krana). Ce Krana est le
Shabda ou le nom (Nma), subtil ou grossier, correspondant cet Artha particulier. Quand on prononce le mot
Ghata , il voque lesprit l'image d'un objet (une jarre),
tout comme le fait la prsentation de cet objet. Dans l'tat
Hiranyagarbha, Shabda en tant que Samskra uvrait
pour voquer des images mentales.
Ainsi le monde entier est Shabda et Artha, c'est--dire
nom et forme (Nma Rpa). Les deux sont associs insparablement. Il n'y a pas de Shabda sans Artha ni d'Artha
sans Shabda. Le mot grec Logos dsigne aussi la pense et
le mot combins. Il existe donc une double ligne de cration, Shabda et Artha, les ides et le langage en mme
temps que leurs objets. Le langage, cela qui est entendu,
manifestation extrieure de Shabda, reprsente le ct
Shaba de la cration. Le ct Artha de la cration, ce sont
les objets intrieurs et extrieurs perus par la vision
mentale ou physique.

Du point de vue de la cration cosmique le mental apparat le premier, et partir de lui se dveloppe le monde
physique conformment aux Samskra parvenus maturit, qui ont amen l'existence l'univers actuel particulier. Aussi l'Artha mental prcde-t-il l'Artha physique, qui
est un dveloppement du premier dans la matire grossire. Cet tat mental correspond celui des rves (Svapna), o l'homme vit seulement dans le monde mental.
Aprs la cration, qui est l'tat de veille (Jgrat), il y a pour
l'individu un paralllisme dj existant des noms et des
objets.
Le langage parl est une manifestation de la facult intrieure de nommer, ou pense. Ce mouvement de pense
est identique chez les hommes de toutes les races. Lorsqu'un Anglais ou un Indien pense un objet, l'image est la
mme pour tous deux, qu'elle soit voque par l'objet luimme ou par l'nonc de son nom. C'est peut-tre pour
cette raison qu'un liseur de pense dont le centre crbral
est en rapport avec celui d'un autre peut lire la parole
cache, c'est--dire la pense de quelqu'un dont il ne peut
comprendre la langue parle. Ainsi, alors que le mouvement de pense est identique chez tous les hommes, son
expression comme Vaikhar Shabda diffre.
Selon la tradition, il existait jadis un langage universel.
D'aprs le rcit biblique, il en tait ainsi avant la confusion
des langues dans la tour de Babel. Il n'y a l rien d'invraisemblable, tant donn que la diffrence entre les langues
parles est due la diffrence des races qui s'est dveloppe au cours des temps. Si la pense se rvlait par le langage au moyen des mmes instruments, et dans les
mmes conditions, chez tous les hommes, alors il n'y aurait qu'un seul langage. Mais il en est autrement de nos

jours.
Diffrents sont les caractres raciaux et les conditions
physiques, telles que la nature des organes vocaux, le climat, les impressions hrditaires, etc. Par suite, diffrents
aussi les langages. Mais pour chaque homme particulier,
parlant n'importe quel langage particulier, le nom prononc de n'importe quel objet est l'expression grossire de son
mouvement de pense intrieur. Il voque ce mouvement,
et l'exprime. Il voque l'ide, et l'ide est la Conscience en
tant qu'opration mentale. Cette opration peut s'intensifier au point de devenir elle-mme cratrice : c'est le Mantrachaitanya.
Il est clair, d'aprs l'expos qui prcde, que si les
lettres sont, comme il est dit, dans les six Chakra corporels, on ne doit pas supposer qu'il est ainsi affirm, d'une
manire absurde, que les lettres s'y trouvent comme des
formes crites, ou comme les sons articuls que l'oreille
entend. Prises dans ce sens, les lettres, objets grossiers,
ne sont manifestes que dans le langage et l'criture. Jusqu'ici tout est clair. Mais la signification prcise de cette
distinction soulve de grandes difficults. Aucun sujet, en
fait, ne prsente plus de difficults que le Mantravidy,
qu'on le considre dans son ensemble ou par rapport
cette question particulire. D'abord, il faut constamment
prendre garde de ne pas tomber dans un pige possible,
qui serait de prendre des mthodes prescrites en vue
d'une ralisation, pour des faits au sens ordinaire de ce
mot.
Les premires sont conventionnelles, les seconds sont
rels. Les doutes ce sujet sont accrus par certaines variantes dans les exposs. C'est ainsi que dans certains
d'entre eux, Ganesha est la Devat du Mldhra. Dans le

Shatchakranirpana, cette Devat est Brahm. De mme


ce texte donne Dkin dans le Mldhra comme la Devat de l'Ashti Dhtu (la substance osseuse). Lorsqu'on est
assis dans la posture (Asana) prescrite, les os sont rassembls autour de ce Chakra, et de plus, c'est de lui
comme du centre du corps que les os se dirigent vers le
haut ou vers le bas.
Pourtant, on me communique une autre description qui
dans ce centre place Dev Shkin225. Il faut aussi compter
avec les fautes, qu'on ne peut tablir et rectifier que par la
comparaison de plusieurs manuscrits226.
Il est dit, d'autre part, que quatre lettres sont sur les
ptales du Lotus Mldhra : ce sont Va, Sha, Sha et Sa.
Pourquoi dit-on qu'elles se trouvent l ? On m'a fait part
de diverses explications. Certaines lettres tant associes
chaque forme de matire sensible (Bhta) il semble naturel de supposer que les lettres de la Terre (Prthiva varna) se trouvent dans le centre terrestre. Mais l'examen ne
confirme pas cette supposition. On dit encore que les
lettres ont des couleurs, et que les lettres d'une couleur
225 Voici cette description :

L'os (Asthidhtu) : Mldhra chakra ; Dev Shkin.


La graisse (Medadhtu) : Svshishthna chakra ; Dev Kkini.
La chair Mmsadhtu) : Manipra chakra ; Dev Lkin.
Le sang (Ra ktadhtu) : Anhata chakra ; Dev Rkin.
La peau (Tvakdhtu) : Vishuddha chakra ; Dev Dkin.
La moelle (Majjdhtu) : Ajn chakra ; Dev Hkin.
Dans le Sahasrra Padma sont tous les Dhtu, le premier tant Shukra (la semence).
226 Ainsi dans le texte qu'on m'a donn, et que je cite, les quatre lettres du M-

ldhra sont donnes comme tant Va, Sha, Sha et La. La dernire, d'aprs
d'autres exposs, devrait tre Sa.

particulire sont situes dans les lotus de mme couleur.


Le Shatchakranirpana n'apporte aucun appui cette
thorie. On a dit que certaines lettres naissent de certaines Devat ; mais ce sont les lettres qui produisent la
Devat, car elles sont l'Arth a du Mantra en tant que
Shabda. On m'a dit aussi que les lettres sont places
d'aprs le sige de leur mission (Uchchrana).
Mais on peut rpondre que le Mldhra est la source
commune de tous leurs siges d'mission (Uchchranasthna)227. On dit encore que les lettres inscrites sur les
ptales sont les Bij ou Mantra-germes de toutes les activits (Kriy) associes au Tattva de ce centre, chaque lettre
subissant des variations selon les voyelles 228.
C'est dans le Mldhra qu'on doit mditer sur tous les
tres du Prithiv Tattva (Tattva terrestre). L se trouvent
donc, comme nous pouvions nous y attendre, les organes
des pieds (Pdendriya), l'action de marcher (Gamanakriy), l'odorat (Gandha), la qualit de Prithiv, le sens de
l'odorat (Ghrna), Nivritti Kal229, et Brahm (Seigneur du
Tattva).
Mais on nous dit aussi que les lettres Va, Sha, Sha et

227 Cela est vrai, mais il peut nanmoins y avoir des siges spciaux d'mission

pour chaque lettre ou classe de lettres. On peut remarquer que les sons voyelles
sont placs dans le centre de la gorge, et Ha et Ksha au-dessus : ce qui semble
appuyer cette hypothse.
228 On me signale que ce sujet est trait en dtail dans le Kundalinkalpataru, et

particulirement dans l'Adhytmasgara je n'ai vu encore ni l'un ni l'autre de ces


manuscrits.

229 Voir Avalon, Garland of Letters (les Kal des Shakti). Samna Vyu est aussi

localis dans ce centre.

Sa sont l'Atm et les Bja des quatre Veda230, des quatre


Yuga231 des quatre ocans232, qu'on appelle par suite Chaturvarntmaka, c'est--dire situs dans l'tre des quatre
lettres. Il est exact que les quatre Veda sont en Parashabda, et en manent, le sige de Parashabda tant le Mldhra.
Car le Veda, dans son premier sens, est le monde
comme ide dans l'esprit du Brahman crateur, et dont
des parties ont t rvles aux Rishi (voyants) et incarnes dans les quatre Veda. Mais pourquoi Va serait-elle le
germe du Rigveda, Sha le germe du Yajurveda, et ainsi de
suite ?
L'explication rituelle, donne dans le Rudraymala (XIV,
73 ; XV, 2 ; XVI, 1, 2), est que le ptale Va est Brahm
(Rajoguna), et le Bja du Rik ; Sha est Vishnu (Sattvaguna), et Sha, tant Pundarktm, est le Bja du Yajus ; Sha
est Rudra (Tamoguna), et le Bja du Sama ; Sa est le Bija
de l'Atharva, tant le Bja de Shakti233. Toutes quatre sont
en Parashabda dans le Mldhra. Il me semble (en l'tat
actuel de mes tudes sur le Shstra) que les dtails des
descriptions des centres se rpartissent en deux catgories.
Il y a d'abord certains faits rels, objectifs, de valeur
universelle. C'est ainsi, par exemple, qu'il y a certains
centres dans la colonne vertbrale. Le principe de de soli230 Va du Rig, Sha du Yajus, Sha du Sma et Sa de l'Atharva Veda.
231 Les quatre ges : Satya, Treta, Dvpara et Kali.
232 De jus de canne sucre, de vin, de ghee (Ghrita), de lait.
233 Le Rudraymala (XVII) donne la priorit l'Atharva, parce qu'il traite de

l'Achra de Shakti. De l'Atharva sortit Sma, de Sma Yajus, et de ce dernier Rik.

dit (Prithivi Tattva) est dans le plus bas de ces centres,


qui, en tant que centre du corps, contient l'nergie statique ou potentielle appele Kundalin Shakti. Ce centre,
considr comme un lotus, est dit quatre ptales,
cause de la forme et de la distribution des nerfs du Yoga
(Nd)234 en ce point particulier.
La solidit est figure avec justesse par un cube, qui est
le symbole graphique (Yantra) de ce centre. La conscience
de ce centre considre comme Devat est aussi avec justesse porte par un lphant, dont la solidit massive
symbolise le principe terrestre de solidit (Prithiv). Les
forces qui uvrent pour la formation de la matire solide
peuvent tre perues comme jaunes par le Yogi. Il se peut
que des substances particulires (Dhtu) du corps, et des
Vritti (qualits) particulires, soient associes des Chakra particuliers.
Il existe, cependant, une autre catgorie de dtails qui
n'ont peut-tre qu'une ralit symbolique, et qui sont
donns au Sdhaka dans un dessein d'instruction et de
mditation seulement235. Les lettres telles que nous les
connaissons, c'est--dire comme langage extrieur, ne
sont manifestes quaprs tre passes par la gorge. Elles
ne peuvent donc exister comme telles dans les Chakras.
Mais on dit quelles y sont. Elles y sont, non dans leur
forme grossire, mais dans leurs formes subtiles et causales. Ce sont ces formes subtiles quon appelle Mtrik.
Mais sous ces formes les lettres sont Shabda crant ou
234 J'emploie le mot nerf dfaut d'un autre quivalent. Ces Ndi, appels

Yog-Nd, ne sont pas, comme les Nd de la physiologie, des objets grossiers,


mais des canaux subtils par lesquels la force vitale uvre dans les corps.
235 Voir le Demchog Tantra (Tntrik Texts, vol. VII).

reprsentant des mouvements d'idation, ou elles en sont


la cause. La conscience, qui est en elle-mme (Svarpa)
muette (Nih shabda), sous sa forme suprme (Parashabda), assume un mouvement gnral indiffrenci (Smnyaspanda), puis un mouvement diffrenci (Visheshaspanda), s'exprimant par la parole clairement articule
(Spashtatara-spanda). Le mouvement interne a une correspondance externe en celui qui s'exprime par les lvres
avec l'aide de Dhvani. Le Mantra veut simplement dire, en
prsentant ainsi les choses, que la Conscience assume le
mouvement comme Shakti, apparat comme sujet (Shabda) et objet (Artha), d'abord sous la forme subtile du Mental et de son contenu produit par les Samskra, et ensuite
sous la forme grossire du langage en tant qu'expression
des ides et des objets physiques, que le Mental cosmique,
ou crateur, projette dans le monde de l'exprience sensible pour tre la source des impressions qu'y ressent le
sujet individuel de l'exprience.
Il est exact qu'en ce sens les lettres, en tant que parole
secrte ou germe de la parole extrieure, sont dans les
Chakra, mais la localisation de lettres particulires dans
des Chakra particuliers est une question qui, si elle possde une signification relle et non seulement symbolique,
doit recevoir l'explication donne dans notre ouvrage
Shakti and Shkta .
Dans chacun des Chakra se trouve aussi un Bja Mantra, ou Mantra germe , de chacun des Tattva qui y sont
attachs. Ils sont le germe du Tattva, car celui-ci sort
deux et rentre en eux. Le Nom naturel de toute chose est
le son produit par l'action des forces mouvantes qui le
constituent. C'est pourquoi, dit-on, celui qui prononce,
mentalement et vocalement, avec une Force cratrice, le

nom naturel de quelque chose que ce soit, amne ltre


la chose qui porte ce nom.
Ainsi Ram est le Bja du feu dans le Manipra Chakra. Il est dit que ce Mantra Ram est l'expression en
son grossier du son subtil produit par les forces constituant le feu. La mme explication est donne en ce qui
concerne Lam dans le Mldhra, et les autres Bja des
autres Chakra. Le seul fait de prononcer la syllabe Ram
ou tout autre Mantra236 n'est, cependant, rien d'autre
qu'un mouvement des lvres. Mais lorsque le Mantra est
veill (Prabudha)237, c'est--dire lorsqu'il y a conscience
du Mantra (Mantra-chaitanya), alors le Sdhaka peut uvrer l'aide du Mantra. Ainsi, dans le cas cit, le Vaikhar
Shabda, par l'intermdiaire de son vhicule Dhvani, est le
support d'un pouvoir de conscience qui permet au Mantrin de devenir le Matre du Feu 238.
Quoi qu'il en soit, c'est, de toute manire, la pense
cratrice qui anime le son mis oprant aujourd'hui dans
236 Dans l'adoration avec forme (Skra), le mental doit tre concentr sur la

Dit objet de l'adoration (Ishtadevat) ; et dans le Yoga sur la forme de lumire


(Jyotirmayarpa). Il est dit, pourtant, que la simple rptition d'un Mantra alors
mme qu'on en ignore le sens procurera un certain bnfice, celui qui provient de l'adoration. La question du Nom naturel est traite dans Avalon, Garland
of Letters.
237 La pense n'est pas seulement alors dans l'enveloppe externe, mais elle est

vitalise par son centre conscient.

238 Il en est qui obtiennent ces pouvoirs par l'adoration (Upsan) d'Agni Vetla,

un Devayoni ; d'autres par l'adoration d'Agni lui-mme. La premire mthode,


qui exige 12.000 Japa, est donne dans le Shavara-tantra. De mme on dit que
des objets se trouvant loin de l'oprateur peuvent tre dplacs par l'adoration
de Madhumat Devi. un degr plus lev de dveloppement, on peut se passer
de tous les agents extrieurs.

la petite magie humaine, tout comme l'origine il opra


dans le grand dploiement magique du Crateur cosmique. Sa pense fut la somme de toute pense, doue de
puissance cratrice. Tout homme est Shiva, dont il peut
atteindre la puissance selon son degr de capacit prendre conscience de lui-mme comme tel.
Pour diverses raisons l'on invoque les Devat. Mantra et
Devat ne font qu'un. Un Mantra-Devat est Shabda et
Artha, le premier tant le nom, et le second la Devat dont
il est le nom. Par la pratique (Japa) du Mantra, on invoque
la prsence de la Devat. Le Japa, ou rptition du Mantra, est compar laction dun homme secouant un dormeur pour lveiller. Les deux lvres sont Shiva et Shakti.
Leur mouvement est laccouplement des deux. Shabda,
qui en est le fruit, a la nature d'un Germe ou Bindu. La
Devat ainsi produite est, pour ainsi dire, le fils du
Sdhaka. Ce n'est pas la Devat suprme qui apparat (car
elle est non-agissante), mais de toute manire une manation produite par le Sdhaka pour son seul bnfice 239.
S'il s'agit d'adorateurs de Shiva, un Shiva Enfant (Bla
Shiva) apparat, qui est ensuite fortifi par la nourriture
que le Sdhaka donne sa cration. L'occultiste comprendra ce que signifie tout ce symbolisme : la Devat est une
forme de la conscience du Sdhaka, que celui-ci veille et
fortifie, en tirant bnfice. C'est sa conscience qui devient
l'enfant Shiva, puis, une fois fortifie, la puissance divine
en sa plnitude. Tous les Mantra sont dans le corps
comme des formes de conscience (Vijnnarpa). Quand le
Mantra est pleinement pratiqu, il vivifie le Samskra, et
239 Si l'on invoque Srya (le dieu du Soleil), c'est une manation qui vient du

soleil et y retourne.

lArtha apparat au mental.


Les Mantra sont donc une forme du Samskra des Jva,
dont l'Artha se manifeste la conscience capable de le
percevoir. Tout cela signifie essentiellement : concentrer et
vivifier la pense et le pouvoir de la volont. Mais pour cela
une mthode est ncessaire, savoir le langage, et des
pratiques dtermines selon le but poursuivi. Ces pratiques, le Mantravidy (qui explique ce quest le Mantra)
les prescrit aussi.
L'tat causal de Shabda est appel Shabdabrahman,
c'est--dire le Brahman comme cause de Shabda et d'Artha. La puissance non-manifeste (Avyakta) du Shabda,
qui est la cause de Shabda et d'Artha manifests, nat de
la diffrenciation du Bindu Suprme et de Prakriti, le premier prenant la forme de Bindu par la prdominance de
Kriy Shakti240. Avyakta Raya ou Shabda (le son nonmanifest) est le principe du son comme tel (Nda-mtra),
c'est--dire du son indiffrenci, non particularis sous
forme de lettres, mais cause, par activit cratrice, de
Shabda et d'Artha manifests241.
C'est le Brahman considr comme Shabda omniprsent, non-divis, non-manifest, dont la substance est Nda et Bindu, l'impulsion cratrice immdiate en Parashiva
240 Voir Shrad, v. 12.

Kriyshaktipradhnyh shabdashabdrtha-kranam
Prakriter bindurpinyh shabdabrahmbhavat param.
Ce qui signifie, en fait, qu'une activit croissante dans la Conscience sur le point
de crer (Bindu) produit l'tat dans lequel elle est la cause du sujet et de l'objet,
en tant que mental et matire.
241 Tena shabdtharpa-vishishtasva shabda-brahmatvam avadhritam (Prna-

toshin, 13).

et la cause immdiate de Shabda et d'Artha manifests 242.


C'est l'ternel et indivisible Sphota243 qui n'est point particularis en Shabda et Artha, mais qui est la Puissance
par laquelle tous deux existent et se rvlent. Shabdabrahman est ainsi l'aspect nergtique et crateur de la
Conscience Suprme et indiffrencie de la philosophie, et
du Saguna Brahman de la religion.
Il est Chitshakti ayant pour vhicule Prakriti-shakti indiffrencie, c'est--dire l'aspect crateur du Brahman
unique, transcendant et informel (Nirguna), en mme
temps qu'immanent et formel (Saguna)244.
Comme le dit le Hathayogapradpik245 : Tout ce qui
est entendu sous forme de son est Shakti. L'tat rsorb
(Laya) des Tattva (dvelopps par Prakriti) est celui dans
lequel aucune forme n'existe246. Tant qu'il y a la notion de
242 Voir Prnatoshint, p. 10 ; Rghava Bhatta, Comm. du Shrad, ch. I, v. 12.

Shrishtyunmukha-paramashiva-prathamollsamtram akhando vyakto ndabindumaya eva vypako brahmtmakah shabdah.


243 Sphota, driv de Sphut, s'ouvrir ( la manire d'un bourgeon), est ce par

quoi se rvle le sens particulier des mots. Les lettres sparment, et donc aussi
en combinaison, sont dpourvues de signification. Un mot n'est pas la chose,
mais ce par quoi, lorsqu'il est prononc, nat la connaissance de la chose qu'il
dsigne. Ce qui dsigne la chose dsigne est un dvoilement (Sphota) diffrent
de ces lettres. Ce Sphota est le Shabda ternel.
244 Il convient de remarquer que, des cinq Bhta, Aksha et Vyu appartiennent

la catgorie informelle (Amrtta), et les trois autres la catgorie formelle


(Mrtta). Le premier est peru par l'oue. Shabda est vibration pour l'oreille en
tant que nom. Agni, qui vient en tte de la deuxime catgorie, est peru comme
forme (Rpa). Artha est vibration pour l'il (mental ou physique) comme forme.
245 Le terme Bindu peut signifier aussi une goutte, de semence par exemple.
246 Yatkinchin ndarpena Shryate shaktir eva s Yas tattvnto nirkrah sa

eva parameshvarah.

l'ther, le son est entendu. Ce qui est dpourvu de son est


appel Parabrahman ou Paramtm247 .
Ainsi Shabdabrahman se projette, en vue de la cration,
en deux sries de mouvements : d'abord le Shabda (avec
des vibrations mentales de connaissance), qui, passant
par les organes de la parole, devient son articul ; ensuite,
les mouvements Artha, dsigns par Shabda, et qui forment toutes choses constituant le contenu du mental et
du monde objectif. Ces deux sries sont des manations
de la mme Activit Consciente (Shakti) qui est le Verbe
(Vk ou Logos ), et sont par suite essentiellement identiques. Aussi sont-elles lies l'une l'autre de faon permanente.
C'est dans le sens dfini ci-dessus que l'univers est dit
compos de lettres : les cinquante248 lettres de l'alphabet
sanskrit qui sont symbolises par la guirlande de ttes
humaines coupes que la Mre nue249, Kl, sombre
comme un menaant nuage d'orage, porte dresse parmi
des ossements et des cadavres de btes et d'oiseaux dans
le lieu d'incinration, et sur le corps blanc, pareil un cadavre (Shavarpa) de Shiva. Car c'est Elle qui massacre
, c'est--dire reprend en Elle toute parole avec ses objets
l'heure de la dissolution de toutes choses (Mahpra-

247 Tvad kshasamkalpo yvachchhabdah pravartate Nihshabdam tatparam

brahma paramtmeti gyate.


248 Quelquefois cinquante-et-une.
249 On La reprsente ainsi parce qu'Elle est au del de My (Mytt). Elle est

Celle qui gare tous les tres par Sa My, mais Elle-mme n'en est pas affecte.
Ce symbolisme de Kl est expliqu dans le Svarpa-vykhy de l'Hymne Kl
(Karprdi Stotra), publi dans Tntrik Texts, vol. IX.

laya)250. Shabdabrahman est la Conscience (Chaitanya)


dans toutes les cratures. Il prend la forme de Kundal, et
demeure dans le corps de toutes les cratures ayant
souffle (Prn), se manifestant par les lettres sous forme de
prose et de vers251.
Dans le symbolisme sexuel des Shkta Tantra, la semence (Bindu)252 a jailli lors de l'union inverse 253 de Mahkla et de Mahkl, et cette semence, mrie dans la
matrice de Prakriti, est sortie comme Kundal sous la
forme des lettres (Akshara). Kundal, comme Mhmtriksundar, a cinquante-et-un replis, qui sont les Mtrik
ou formes subtiles des lettres grossires ou Varna, forme
Vaikhar du Shabda dans les centres. Kundal, avec un
seul repli, est Bindu ; avec deux, Prakriti-Purusha ; avec
trois, les trois Shakti (Ichchh, Jnna, Kriy) et les trois
Guna (Sattva, Rajas, Tamas) ; avec trois et demi, Elle est
alors rellement cratrice avec Vikriti ; avec quatre Elle est
la Dev Ekajat, et ainsi de suite jusqu' Shrmtrikotpattisundar aux cinquante-et-un replis254.
Dans le corps, le Parashabda non-manifest est en
250 On trouve le mme symbolisme dans la description du Heruka, dans le De-

mehog Tantra bouddhique.


251 Chaitanyam sarvabhtnm shabdabrahmeti me matih Tat prpya kun-

dalrpam prninm dehamadhyagam Varntmanvirbhavati gadyapadydibhedatah. (Shrad Tilaka, ch. I.)


252 Le terme Bindu peut signifier aussi une goutte, de semence par exemple.
253 Viparta maithuna. Shakti est au-dessus de Shiva, et c'est Elle qui agit pour et

dans l'union avec Lui, parce qu'Elle est la Conscience active et Lui la Conscience
inerte.
254 Shaktisamgama Tantra, Ullsa Utpattikhanda 1. Avec les dix replis, Elle est la

Dashamahvidy bien connue.

Kundal Shakti. Ce qui nat de lui tout d'abord est dans le


Chakra infrieur, et s'lve comme Pashyant, Madhyam
et Vaikhar Shabda. Lorsque Shakti voit255 pour la premire fois, Elle est Param Kal256 sous la forme maternelle (Ambikrup), qui est la parole suprme (Par vk) et
la paix suprme (Param shnt). Elle voit le Shabda
manifest de Pashyant Vaikhair.
L'tat Pashyant257 de Shabda est celui dans lequel Ichchh Shakti (la Volont), sous la forme d'un aiguillon258
(Amkushkra), est sur le point de dployer l'univers,
alors sous la forme d'un germe (Bja). C'est le Shakti
Vm259. Madhyam Vk, qui est Jnna (la connaissance),
et a la forme d'une ligne droite (Bijurekh), est Jyeshth
Shakti. C'est ici qu'une premire forme est revtue comme
Mtrik, car il y a ici un mouvement particulier.
L'tat Vaikhar est celui de Kriy Shakti, qui est la Dev
Raudr, dont la forme est triangulaire260, la forme de l'univers. Sous la forme prcdente, Shakti produisait les
lettres subtiles de Mtrik qui sont le Vsan261 ; sous sa
255 C'est le premier mouvement de la cration, appel Ikshana (la vue) dans le

Veda. Voir, c'est concevoir.


256 Paran = suprme ou premier. Kal est la VimarshaShakti d'Atm. Elle est,

comme telle, la cause premire de toutes les lettres.


257 Pashyant = Celle qui voit (Ikshana).

258 Ici la ligne courbe (Vakrarekh) vient la premire, et la ligne droite la se-

conde. Peut-tre faut-il voir ici la ligne s'levant pour former la pyramide triangulaire.
259 Ainsi nomm parce qu'elle vomit l'univers (Vamant vm iti).
260 Shringtaka, c'est--dire une figure pyramidale triangulaire trois dimen-

sions.
261 Autrement dit Samskra ou impression ravive, qui est le germe de la Cons-

dernire forme elle est la Shakti des lettres grossires des


mots et de leurs objets262. Ces lettres sont la Guirlande de
la Mre, sortie d'Elle sous Sa forme de Kundalin Shakti,
et rsorbe en Elle dans le Kundalin-yoga que dcrit cet
ouvrage.
Note du traducteur : Le texte anglais de ce chapitre contient un lapsus que nous ne possdons aucun moyen de
corriger dans la version franaise : du Mldhra au Manipra Chakra, le centre voisin (page 92, ligne 32 Rf. Du
livre papier ).

cience Cosmique cratrice.


262 Yoginhridaya Tantra, Samketa I.

V. LES CENTRES OU LOTUS (CHAKRA, PADMA)

Nous voici dsormais en mesure de passer l'examen des


Chakra, que l'on peut dfinir sommairement comme des
centres subtils d'opration, dans le corps, des Shakti ou
puissances des divers Tattva ou principes qui constituent
les enveloppes corporelles. C'est ainsi que les cinq Chakra
infrieurs, de Mldhra Vishuddha, sont les centres
des Bhta, les cinq formes de la matire sensible. L'Ajn,
et les autres Chakra situs dans la rgion qui s'tendent
entre Ajn et le Sahasrra, sont les centres des Tattva
constituant les enveloppes mentales, tandis que le Sahasrra ou lotus aux mille ptales, situ au sommet du
cerveau, est la demeure bienheureuse de Parama ShivaShakti qui est l'tat de pure Conscience.
Une description des Chakra implique, en premier lieu,
un expos de l'anatomie et de la physiologie occidentales
des systmes nerveux central et sympathique ; ensuite, un
expos de la conception tantrique du systme nerveux et
des Chakra ; et enfin les correspondances, dans la mesure
o on peut les tablir, entre les deux systmes du point de
vue de l'anatomie et de la physiologie, car le reste est gnralement propre l'occultisme tantrique.
La thorie tantrique sur les Chakra et le Sahasrra
soccupe, du point de vue physiologique (Bhogyatana), du
systme spinal central, comprenant le cerveau ou encphale contenu dans le crne, et 1a moelle pinire conte-

nue dans la colonne vertbrale (Merudanda).


Il faut remarquer que, de mme qu'il y a cinq centres
dcrits ci-aprs, la colonne vertbrale se divise elle-mme
en cinq rgions, qui, en partant de la plus basse, sont la
rgion coccygienne, compose de quatre vertbres imparfaites, souvent runies en un seul os appel le coccyx ; la
rgion sacre, forme de cinq vertbres runies pour former un seul os, le sacrum ; la rgion lombaire, ou rgion
des reins, comprenant cinq vertbres ; la rgion dorsale,
comprenant douze vertbres ; et la rgion cervicale, ou rgion du cou, comprenant sept vertbres.
Comme on peut s'en rendre compte en pratiquant des
sections, la moelle prsente des caractres diffrents dans
les diffrentes rgions. En gros, celles-ci correspondent
aux rgions respectivement commandes par le Mldhra, le Svdhishthna, le Manipra, l'Anhata et le Vishuddha. Le systme central est en relation avec la priphrie
par l'intermdiaire des trente et un nerfs spinaux et des
vingt nerfs crniens, qui sont la fois affrents et effrents. Cest--dire sensoriels et moteurs, veillant la sensation ou excitant l'action.
Des nerfs crniens, les six derniers sortent du bulbe rachidien, et les six autres, l'exception des nerfs olfactif et
optique, des rgions du cerveau situes juste en avant du
bulbe. Des auteurs appartenant aux coles du Yoga et du
Tantra emploient de prfrence, pour dsigner les nerfs, le
terme Nd. De mme, a-t-on prtendu, ils ont en vue les
nerfs crniens lorsqu'ils parlent de Shir, n'employant jamais ce dernier terme pour les artres, comme on le fait
dans la littrature mdicale263.
263 Dr. Brojendranath Seal, Appendice Positive Background of Hindu Sociology,

Il faut pourtant remarquer que les Nd du Yoga ne sont


pas les nerfs matriels ordinaires, mais des lignes subtiles
de direction que suivent les forces vitales. Les nerfs spinaux, sortis des intervalles entre les vertbres, entrent en
communication avec les cordes du systme nerveux sympathique, situes de part et d'autre de la colonne vertbrale.
La moelle pinire part, chez l'homme, du bord suprieur de l'atlas, sous le cervelet, pntre dans le bulbe,
entre dans le quatrime ventricule du cerveau, et descend
dans la deuxime vertbre lombaire, o elle se termine en
un point appel le filum terminale. On me dit que les observations faites au microscope par le docteur Cunningham ont rvl l'existence d'une matire grise de
haute sensibilit dans le filum terminale, que l'on croyait
jusqu'alors form de simple moelle fibreuse. Cela est important, tant donne la localisation attribue au Mldhra et la Puissance du Serpent. La moelle se prolonge en ce filum terminale sur une longueur variable, puis
se termine brusquement.
l'intrieur du revtement osseux est la moelle, qui est
un compos de matire crbrale grise et blanche, la grise
tant l'intrieur de l'autre, alors que l'encphale prsente
la disposition inverse. La moelle est divise en deux moitis symtriques, runies par une commissure au centre
de laquelle se trouve un canal trs petit, le canal spinal
central (l est la Brahmand), qui est, dit-on, le vestige du
par le Prof. Benoy Kumar Sarkar, p. 337. On emploie aussi le mot Dhaman
pour dsigner les nerfs. Il faut noter pourtant que le Shatchakranirpana dsigne
par le terme de Shir d'autres nerfs que les nerfs crniens : au V. 1, il nomma Id
et Pingal des Nd ou des Shir.

tube creux qui s'est dvelopp en moelle et en cerveau 264.


Ce canal contient du liquide crbro-spinal. La matire
grise, considre dans le sens longitudinal, forme une colonne qui s'tend sur toute la longueur de la moelle, mais
la largeur n'est pas uniforme.
Il y a des largissements particuliers dans les rgions
lombaire et cervicale, dues principalement une plus
grande quantit de matire grise. Mais tout le long de la
moelle la matire grise est particulirement abondante aux
points de jonction des nerfs spinaux, si bien qu'apparat
une disposition en forme de collier, plus visible chez les
vertbrs infrieurs, et correspondant la chane ganglionnaire ventrale des invertbrs265. La matire blanche
consiste en tendues ou en colonnes de fibres nerveuses.
la limite suprieure de l'atlas, premire vertbre cervicale, la moelle pinire entre dans la medulla oblongata
situe sous le cervelet. Le canal central ouvre dans le quatrime ventricule du cerveau. Le cervelet est un dveloppement de la paroi postrieure de la dernire des trois dilatations primaires du tube crbro-spinal de l'embryon, le
quatrime ventricule constituant le restant de la cavit
primitive.
Au-dessus est le cerveau, qui, avec les parties situes
au-dessous, est la partie suprieure largie et grandement
modifie de l'axe nerveux crbro-spinal. La moelle pinire n'est pas seulement un fil conducteur entre la priphrie et les centres de sensation et de volition ; elle est
aussi un centre ou un groupe de centres indpendant. Il
264 Voir Ferrier, Functions of the Brain.
265 Ibid., 7.

existe diffrents centres dans la moelle pinire, qui, bien


qu'autonome dans une mesure considrable, est unie aux
centres suprieurs par ses zones connectrices et longitudinales266.
Toutes les fonctions que l'on attribue en premier lieu
aux centres spinaux appartiennent aussi, en dernier ressort, aux centres crbraux. De mme, toutes les Lettres
qui sont rparties entre les ptales des lotus existent
dans le Sahasrra. Les centres n'influencent pas seulement les combinaisons musculaires associes aux mouvements volitifs, mais aussi les fonctions d'innervation vasculaire, de scrtion, etc., qui ont leurs centres immdiats
dans la moelle pinire.
On dit, pourtant, que les centres crbraux ne commandent ces fonctions qu'en tant qu'elles sont lies aux
manifestations de la volont, du sentiment et de l'motion
; alors que les centres spinaux, avec le systme sympathique qui leur est subordonn, constitueraient le mcanisme de l'adaptation inconsciente, en conformit avec les
conditions variables des stimulants qui sont essentiels
la dure de l'existence de l'organisme.
La moelle, donc, est la fois un passage faisant communiquer les centres suprieurs avec la priphrie, et un
centre indpendant rglant des fonctions de la plus grande
importance pour le systme. Il faut remarquer que les
fibres nerveuses portant les impulsions motrices qui descendent du cerveau la moelle pinire passent assez
brusquement d'un ct l'autre de leur chemin travers
la moelle, fait qui a t not dans les Tantra, dans la description de Mukta Triven. La moelle est runie par de
266 Ibid., p. 80.

nombreuses zones affrentes et effrentes au cervelet et


aux ganglions crbraux.
Au-dessus du cervelet est le cerveau, dont l'activit est
ordinairement associe la volont et la conception
conscientes, ainsi qu' la production des mouvements volontaires. La notion de Conscience, qui est l'objet introspectif de la psychologie, ne doit pas, cependant, tre confondue avec celle de fonction physiologique. Il n'y a pas
d'organe de conscience, tout simplement parce que la notion de Conscience n'est pas organique, et n'a rien
voir avec la notion physiologique d'nergie, dont elle prsente l'aspect introspectif intrieur 267. La conscience en soi
est l'Atm. Le mental comme le corps, dont le cerveau fait
partie, sont des expressions voiles de la Conscience, qui
dans le cas de la matire est voile au point de prendre
l'apparence de l'inconscience.
Le cerveau vivant est constitu par de la matire sensible grossire (Mahbhta) anime par Prna, le principe
vital. Sa matire a t labore pour constituer un support
convenable l'expression de la Conscience sous forme de
mental (Antahkarana). De mme que la Conscience n'est
pas une proprit du corps, elle n'est pas non plus une
simple fonction du cerveau. Le fait que la conscience mentale est affecte ou supprime par le dsordre du cerveau
prouve la ncessit de ce dernier pour l'expression d'une
telle conscience, et non que la conscience est inhrente,
ou appartient, au cerveau seul.
De chaque ct de la colonne vertbrale est une chane
de ganglions runis par des fibres nerveuses, qui porte le
nom de sympathique (Id et Pingal), s'tendant de la base
267 Voir Auguste Forel, Hygiene of Nerves and Mind, p. 95.

du crne au coccyx. Le sympathique est en communication avec la moelle pinire. Il est remarquable que
dans les rgions thoracique et lombaire il existe un ganglion de chaque chane correspondant avec une grande
rgularit chaque nerf spinal, bien que dans la rgion
cervicale beaucoup semblent manquer ; et que d'importantes masses supplmentaires de tissu nerveux se trouvent dans la rgion du cur, de l'estomac et des poumons,
rgions gouvernes respectivement par l'Anhata, la Manipra et le Vishuddha, les trois Chakra suprieurs parmi
les cinq dcrits plus loin.
Des deux chanes sympathiques, des fibres nerveuses
partent vers les viscres de l'abdomen et du thorax. De ces
derniers, partent aussi des nerfs qui retournent aux nerfs
spinaux, et d'autres qui rejoignent certains des nerfs crniens ; ils sont ainsi distribus entre les vaisseaux sanguins des membres, du tronc et des autres parties du
corps o vont les nerfs spinaux ou crniens. Les nerfs
sympathiques transportent surtout des impulsions qui
commandent au tissu musculaire des viscres et au revtement musculaire des petites artres des divers tissus.
C'est par l'intermdiaire du sympathique que le tonus
des vaisseaux sanguins est maintenu sous l'action du
centre vaso-moteur de la moelle pinire. Le sympathique,
cependant, transmet les impulsions qu'il reoit du systme nerveux central ; elles n'ont pas leur origine dans le
sympathique lui-mme. Les impulsions partent de la
moelle par les racines antrieures des nerfs spinaux, et
aboutissent, par de courtes ramifications, aux chanes
sympathiques. Le travail des systmes sympathiques
commande et influence la circulation, la digestion et la

respiration268.
La structure anatomique du systme nerveux central
est excessivement complique, et ce qui se produit dans
cet enchevtrement de fibres, de cellules et de fibrilles est,
d'autre part, peu prs inconnu encore269. Aussi faut-il
admettre que dans la description de la physiologie du systme nerveux central, nous ne pouvons jusqu' prsent
faire beaucoup plus que tracer les voies par lesquelles les
impulsions peuvent passer, entre une portion du systme
et une autre, et des connections anatomiques dduire,
avec plus ou moins de probabilit, la nature du nud
physiologique que ses parties forment entre elles et avec le
reste du corps270.
D'une manire gnrale, cependant, il existe, dit-on, des
raisons de supposer qu'il y a dans le systme central des
centres nerveux associs particulirement des mcanismes spciaux, sensoriels, scrtoires ou moteurs, et
qu'il existe, dans une portion dfinie de la moelle pinire,
des centres, tels que le prtendu centre gnito-spinal, destins une action physiologique dtermine. C'est l'aspect
subtil de ces centres en tant qu'expressions de la Conscience (Chaitanya) manifeste sous diverses formes de
My Shakti, que nous appelons ici Chakra. Ils sont relis
par l'intermdiaire de nerfs aux organes grossiers de la
gnration, de la miction, de la digestion, de la fonction
cardiaque et de la respiration, relis en dernier ressort aux
Chakra Mldhra, Svdhishthna, Manipra, Anhata et
Vishuddha respectivement, tout comme des rgions des
268 Voir Foster and Shore, Physiology, pp. 206-207.
269 G.N. Stewart, Manuel of Physiology, p. 656, Se d., 1906.
270 Ibid.

centres suprieurs ont t spcialement, sinon exclusivement associes diverses oprations de perception, de volont et de conception.
De ce bref prambule en termes de physiologie et d'anatomie occidentales modernes, je passe la description des
Chakra et des Nd (nerfs), et j'essaierai ensuite de montrer les rapports entre les deux systmes.
Les conduits de la force prnique ou vitale sont les nerfs
appels Nd, que l'on estime exister par milliers dans le
corps. De mme que dans la feuille de l'arbre Ashvattha
(ficus religiosa), il y a des fibres minuscules, de mme le
corps est tout travers de Nd271 . On fait driver Nd272
de la racine Nad, mouvement . Car c'est l que se meut
le Prn, ou Principe vital. Le Bhtashuddi Tantra parle de
72.000 Nd, le Prapanchasra Tantra de 300.000, la Shiva Samhit de 350.000 ; mais, quel qu'en soit le nombre
total, seulement un nombre limit d'entre elles sont importantes.
Certaines sont des Nd grossires, telles que les nerfs
physiques, les veines et les artres connus de la science
mdicale. Mais toutes n'ont pas ce caractre grossier, physique et visible. Elles existent, comme tout le reste, sous
des formes subtiles, et sont connues alors sous le nom de
Yoga Nd. Celles-ci peuvent tre dfinies comme des canaux subtils (Vivara) de l'nergie prnique ou vitale. Les
Nd sont, comme nous l'avons dit, les conduits de Prna.

271 Shndilya Up., ch. I, o les Nd sont indiques et o il est question de leur

purification. Voir aussi Dhynabindu Up. Et sur la Sushumn voir Mandalabrhmana Up., Brhmana 1.
272 Shatchakranirpana, v. 2.

travers elles circulent ses courants solaire et lunaire.


Si nous pouvions les voir, le corps prsenterait l'apparence
de ces cartes o sont tracs les divers courants ocaniques. Elles sont les voies que suit Prnashakti. Elles appartiennent donc la science vitale en tant qu'lments de
vie, et non au Shstra mdical (Vaidyashstra). D'o l'importance de la Sdhan, qui consiste en la purification
physique du corps et de ses Nd. La puret du corps est
ncessaire si l'on veut obtenir la puret du mental dans
toute l'acception du sens hindou. La purification des Nd
est peut-tre le facteur principal dans les stades prliminaires du Yoga que nous tudions ; car, de mme que leur
impuret entrave la monte de Kundal Shakti, leur puret
la facilite. Cette puret est l'uvre de Prnyma 273.
Parmi ces Nd, il en est quatorze principales, et de ces
quatorze les plus importantes sont Id, Pingal et Sushumn. De ces trois, Sushumn est la principale, et
toutes les autres lui sont subordonnes ; car, par la puissance du Yoga (Yogabala), on fait passer Prna par cette
Nd, de Chakra en Chakra, pour lui faire quitter le corps
par le Brahmarandhra. Elle est situe l'intrieur de l'axe
crbro-spinal, le Merudanda ou colonne vertbrale,
l'emplacement attribu son canal intrieur, et s'tend du
plexus situ la base, le centre tttvique appel le Mldhra, jusqu'au lotus douze ptales situ dans le pricarpe du Sahasrra Padma, ou lotus aux mille ptales.
Dans la Sushumn tmasique, d'un rouge ardent, est le
brillant Vajr rjasique ou Vajrin Nd, et l'intrieur de
celui-ci le ple Chitr ou Chitrini sttvique, d'o tombe
goutte goutte le nectar. L'intrieur de ce dernier est ap273 Voir plus loin.

pel la Brahma Nd. Le premier est dit pareil au feu


(Vahnisvarp), le second pareil au soleil (Srya svarp),
et le troisime pareil la lune (Chandrasvarp)274.
Ils constituent le triple aspect du Shabdabrahman.
L'ouverture situe l'extrmit de la Chitrin Nd est appele la porte de Brahman (Brahmadvra), car c'est par
elle qu'entre la Dev Kundal pour monter275. C'est le long
de cette dernire Nd, connue sous le nom de Kula Mrga
et de Voie royale , que l'on conduit la Shakti Kundalin
dans l'opration dcrite plus loin.
l'extrieur de ce nerf sont les deux Nd, la ple Id ou
Shash (la Lune), et le rouge Pingal ou Mihira (le Soleil),
qui sont associes la respiration alterne de la narine
droite la narine gauche, et rciproquement 276. La premire, qui est fminine (Shaktirp) et incarne le nectar
(Amritavigrah), est gauche ; et la seconde, qui est
masculine , ayant la nature de Rudra (Raudrmik), est
droite. Toutes deux indiquent le Temps ou Kla, et Sushumn dvore Kla. Car on entre, par cette voie, hors du
temps. Les trois Nd portent aussi les noms de Gang
274 C'est pourquoi Elle est appele dans le Lalit-Sahasranma (v. 106),

Mldhrmbujrdh. Le Feu, le Soleil et la Lune sont des aspects du Parabindu


ou Kmakal diffrenci (voir plus haut). Voir, dans Garland of Letters, le chapitre sur le Soleil, la Lune et le Feu.
275 Le soleil reprsente gnralement le poison, et la lune le nectar (Shndilya

Up., ch. I). Tous deux furent produits par le barattement de l'ocan, et reprsentent les forces constructives et destructives de la Nature.

276 Les Hindous savent depuis longtemps que la respiration s'effectue par une

narine pendant un certain temps, et ensuite par l'autre. Dans le Prnyma, on


ferme une narine pour modifier la respiration. Mais le Yogi avanc peut volont
modifier la respiration sans fermer une des narines avec ses doigts. l'instant de
la mort, la respiration se fait par les deux narines la fois.

(Id), Yamun (Pingal) et Sarasvat (Sushumn), noms


des trois fleuves sacrs de l'Inde. Le Mldhra est le lieu
o se runissent les trois fleuves , et pour cette raison
porte le nom de Yuktatriven. Partant du lotus Adhra, ils
passent alternativement de droite gauche et de gauche
droite, entourant ainsi les lotus.
Un autre expos les place comme deux arcs de chaque
ct de la moelle pinire. Un mdecin hindou de mes
amis me dit que les deux descriptions ne sont point contradictoires, mais reprsentent des positions diffrentes
suivant qu'Id et Pingal existent l'intrieur ou l'extrieur de la moelle pinire. Quand elles atteignent l'espace
entre les sourcils, connu sous le nom d'Ajn Chakra, Id
et Pingal entrent dans la Sushumn, formant elles trois
un nud appel Muktatriven. Les trois fleuves , qui se
trouvent de nouveau runis en ce point, s'en coulent sparment, et pour cette raison l'Ajn Chakra est appel
Muktatriven. Aprs sparation, la Nd qui partait du testicule droit gagne la narine gauche, et celle qui partait du
testicule gauche la narine droite. On a dit que la distinction faite entre le Soleil rchauffant et la Lune rafrachissante est celle qui existe entre les phases positive et
ngative du mme sujet, les forces positive et ngative
tant prsentes en toute forme d'activit.
Ainsi Pingal, de ce point de vue, est le canal du courant solaire positif, et Id celui du courant lunaire ngatif.
Il y a aussi, comme nous l'avons vu, des Nd intrieures
solaire et lunaire dans la brlante Sushumn o se runissent les deux courants277. Ce ne sont l qu'exemples
277 De mme, il y a trois Nd qui en Latsdhan sont adores dans le Madan-

gra : Chndr, Sauri, Agney, reprsentant le soleil, la lune et le feu.

microcosmiques du systme majeur de matire cosmique,


dont chaque portion est compose des trois Guna (Triguntmaka) et des trois Bindu, qui sont le Soleil, la Lune et
le Feu.
En ce qui regarde les cordons et les fibres nerveuses, les
nerfs crniens et spinaux, et les nerfs sympathiques qui
s'y rattachent, le Docteur Brojendranath Seal dit : Pour
ceux qui ont crit sur le Yoga, toutes les Shir, et celles
des Dhaman qui ne sont pas des vhicules de courant
vital, de liquide mtabolique, de lymphe, de chyle ou de
sang, sont des nerfs crniens, et vont du cur au crne
par la moelle pinire. Ces nerfs crniens comprennent
des couples pour le larynx et la langue, pour la comprhension et l'usage de la parole, pour lever et baisser les
paupires, pour pleurer, pour les sensations des sens particuliers, etc., reproduction confuse et inintelligente de la
classification de Sushruta. Mais l'numration des nerfs
spinaux avec la chane sympathique et les ganglions qui
s'y rattachent constitue un net progrs sur les anciens
anatomistes278 .
Il poursuit alors : La Sushumn est le cordon central
de spinal sympathique (voir Sangtaratnkara), les quatorze appeles respectivement Id et Pingal. Les nerfs
sympathiques ont leur jonction principale avec Sushumn
au plexus solaire (Nbhi colonne vertbrale (Brahmadanda
ou Meru). Les deux chanes de ganglions sympathiques
gauche et droite sont (Nbhi Cakra). Des sept cents cor278 Appendice Positive Background of Hindu Sociology, p. 340, publi par la

suite dans Positive Sciences of the Hindus. L'auteur joint un plan qui tente de donner une ide sommaire de la position relative des principaux nerfs du systme
spinal sympathique.

dons nerveux du systme plus importants sont279 :


1. Sushumn, dans le canal central de la moelle pinire.
2. Id, la chane sympathique gauche, qui s'tend en
forme d'arc, prend naissance sous la narine gauche
et se termine au-dessous du rein gauche.
3. Pingal, la chane correspondante droite.
4. Kuh, le nerf pudique du plexus sacr, gauche
de la moelle pinire.
5. Gndhr, en arrire de la chane sympathique
gauche, suppos natre sous le coin de l'il gauche
pour aboutir la jambe gauche. On supposait videmment que certains nerfs du plexus cervical descendaient par la moelle pinire et rejoignaient le
grand nerf sciatique du plexus sacr.
6. Hastijihv, en avant de la chane sympathique
gauche, naissant au-dessous du coin de l'il gauche
et aboutissant au gros orteil du pied gauche, en vertu
de la mme supposition. On croyait que les faits pathologiques se rfraient une jonction nerveuse
spciale entre les yeux et les orteils.
7. Sarasvat, droite de Sushumn, s'levant jusqu'
la langue (les nerfs hypoglossaux du plexus cervical).
8. Psh, en arrire de la chane sympathique droite,
naissant au-dessous du coin de l'il droit et allant
l'abdomen (chane mixte de nerfs cervicaux et lombaires).
9. Payasvin, entre Psh et Sarasvat, branche auri279 Certains sont mentionns dans le Shatchakranirpana, v. I.

culaire du plexus cervical droite.


10. Sankhin, entre Gndhr et Sarasvat, branche
auriculaire du plexus cervical gauche.
11. Yashasvin, en avant de la chane sympathique
droite, allant du pouce droit la jambe gauche (le
nerf radial du plexus brachial prolong vers certaines
branches du grand sciatique).
12. Vrun, les nerfs du plexus sacr, entre Kuh et
Yashasvin, se ramifiant sur le bas du tronc et les
membres.
13. Vishvodar, les nerfs du plexus lombaire, entre
Kuh et Hastijihv, se ramifiant sur le bas du tronc
et les membres.
14. Alambush, les nerfs du coccyx, allant des vertbres du sacrum aux organes gnito-urinaires280 .
Les Tattva dans le corps pntr de Prna y possdent
certains centres spciaux de prdominance et d'influence,
qui sont les Chakra (centres, cercles ou rgions), ou Padma (lotus), dont le Shatchakranirpana est la description.
l'intrieur du Meru, ou colonne vertbrale, sont les six
centres principaux d'activit tattvique, appels Chakra ou
Padma, qui sont les siges de Shakti, alors que le Sahasrra, centre suprieur, est la demeure de Shiva281.
Ces centres sont le Mldhra, le Svdhishthna, le
Manipra, l'Anhata, le Vishuddha et l'Ajn, qui dans le
corps physique ont leurs correspondances dans les plexus
280 L'auteur cite le Sangitaratnkara, shloka 144-156 ; et aussi le Yogrnava

Tantra. Un mdecin hindou de mes amis critique certaines parties de cet expos,
qu'il dclare trop influences par la physiologie occidentale.
281 Varha Up., ch. V.

nerveux et les organes principaux, partir de ce qui peuttre est le plexus sacrococcygien jusqu' l'espace entre
les sourcils , que certains identifient avec la glande pinale, centre du troisime il ou il spirituel, et d'autres
avec le cervelet.
Les Chakra282 eux-mmes, cependant, comme on l'expliquera plus loin, sont des centres de Conscience (Chaitanya) en tant que force extrmement subtile (Shakti) ;
mais les rgions grossires cres par leurs vibrations,
soumises leur influence, et parfois vaguement et inexactement identifies avec eux, ont t assimiles divers
plexus du tronc et aux centres crbraux infrieurs indiqus plus haut. Dans la portion du corps qui s'tend audessous du Mldhra sont les sept mondes infrieurs,
Ptla et les autres, avec les Shakti qui soutiennent toutes
choses dans l'univers.
Le premier centre, ou Mldhra Chakra, ainsi nomm
parce quil est la racine de Sushumn o repose Kundalini283, est au lieu de runion du Kanda (racine de toutes
les Nd) et de la Nd Sushumn, et se trouve dans la rgion intermdiaire entre les parties gnitales et l'anus. Il
est ainsi pour les hommes le centre du corps 284. Cette localisation, non plus que des localisations analogues concernant les autres lotus, ne signifie pas que le Chakra
proprement dit se trouve dans la rgion mentionne du
corps grossier, mais qu'il est le centre subtil de cette rgion
282 Varha Up., ch. V ; Dhynabindu Up. ; Yogakundal Up., ch. III.
283 Driv de Mla (racine) et Adhra (support).
284 Shndilya Up., ch. I, o sont indiqus aussi les centres pour les oiseaux et

pour d'autres animaux. Dans certains diagrammes (les Ndichakra du Cachemire), Kundal est reprsente au-dessus de l'emplacement donn dans le texte.

grossire, ce centre existant dans la colonne vertbrale qui


forme son axe.
Le lecteur devra garder cette remarque prsente l'esprit dans la description des Chakra, pour ne pas se faire
de ceux-ci une ide fausse. Ce lotus Mldhra, de couleur cramoisie285, est dcrit comme un lotus quatre ptales, dont les Vritti sont les quatre formes de batitude
connues sous le nom de Paramnanda, Sahajnanda, Yognanda et Vrnanda286. Sur ces quatre ptales sont les
lettres d'or Vam, Sham, Sham et Sam287.
Chaque lettre sous sa forme Vaikhar est une manifestation grossire du Shabda intrieur ou subtil. Sur les ptales sont figures les lettres, dont chacune est un Mantra, et comme tel une Devat. Les ptales sont des figures
formes par la position des Nd n'importe quel centre
particulier, et sont en eux-mmes Prnashakti manifeste
par Prnavyu dans le corps vivant. Quand ce Vyu s'en
va, ils cessent d'tre manifests. Chaque lettre est donc un
Shabda ou une Shakti particulire et une Devat entourant (Avarana) la Devat principale et sa Shakti du Chakra
particulier. En tant que Shakti, elles sont des manifestations de Kundal, et dans leur totalit constituent son
corps de Mantra, car Kundal est la fois lumire (Jyotirmay) et Mantra (Mantramay). Ce dernier est l'aspect
grossier (Sthla) dont est fait Japa. La premire est
285 Ce lotus, ainsi que les autres, pend la tte en bas, sauf lorsque Kundal les

traverse, alors ils se redressent.


286 Ces Vritti ou qualits (voir plus loin) dsignant quatre formes de batitude

sont indiques dans le Commentaire du Mahnirvna Tantra par Tarklankra.


287 Dans ce cas, comme dans d'autres, la mditation s'effectue en partant de la

droite (Dakshinvartena).

l'aspect subtil (Skshma) auquel conduit le Yoga. Leur


numration et leur localisation spcifique indiquent la
diffrenciation dans le corps du Shabda total. Ce Lotus est
le centre de la Prithiv jaune, ou Tattva de la Terre , avec
sou Mandala quadrangulaire, Tattva dont le Bja ou Mantra est Lam288.
ce centre est le Prithiv Tattva, dont le Bja est La,
avec Bindu, ou la conscience de Brahma, prsidant ce
centre ou Lam, dont il est dit qu'il est l'expression en son
grossier (Vaikhair) du son subtil produit par la vibration
des forces de ce centre. Donc, le Tejas Tattva subtil et son
Bja Ram sont dans le Manipra Chakra, et le feu grossier
connu sous le nom de Vaishvnara est dans le ventre physique, que gouverne le centre subtil.
Ce Bja reprsente, en termes de Mantra, le Tattva qui
rgne ce centre, et son activit essentielle. Avec le symbolisme employ tout au long de l'ouvrage, le Shatchakranirpana dit que Bja est assis sur l'lphant Airvata, qui
est localis en ce point. Les divers animaux ainsi figurs
dans les Chakra ont pour but d'exprimer les qualits des
Tattva qui y rgnent. Ainsi l'lphant est l'emblme de la
force, de la fermet et de la solidit de ce Tattva de la
Terre .
Ils sont, de plus, les vhicules (Vhana) des Devat qui
y rsident. C'est ainsi que dans le Mldhra Chakra est
le Mantra-germe (Bja) d'Indra, dont le vhicule est l'lphant Airvata. La Devat de ce centre est, selon le mme
ouvrage, le Brahma crateur, dont la Shakti est Svitr289.
288 La Dhynabindu Up. associe les Bja aux cinq Prna. C'est ainsi que Lam est

associ Vyna.
289 Le Crateur est appel Savit parce qu'Il cre.

L aussi est la Shakti connue sous le nom de Dkin 290,


qui, comme aussi les autres Shakti, Lkin et les suivantes, sont les Shakti des Dhtu, ou substances corporelles291, assignes ce centre et aux autres.
L est le triangle fminin ou Yoni, connu sous le nom
de Traipura, et qui est le Shaktiptha, dans lequel est fich
le Shivalinga mle connu sous le nom de Svayambhu,
de la forme et de la couleur d'une feuille nouvelle, reprsentant, comme toutes les Dev et tous les Deva, la MyShakti et Chit-Shakti, aspects du Brahman en tant que
manifest dans les centres particuliers292.
Les Linga sont au nombre de quatre : Svayambhu, Bna, Itara, Para. D'aprs le Yoginhridaya Tantra (ch. I), ils
sont ainsi appels parce qu'ils conduisent Chit. Ils sont
les Ptha, Kmarpa, etc., parce qu'ils refltent Chit
(Chitsphurattdhratvt). Ils sont Vritti de Manas,
Ahamkra, Buddhi, Chitta.
Aux trois premiers sont assignes certaines formes et
couleurs : jaune, rouge, blanche, triangulaire, circulaire ;
et aussi certaines lettres : les seize voyelles, les consonnes
de Ka Ta (douce), et de Tha Sa. Para est sans forme,
sans couleur et sans lettre, tant la collectivit (Samashti)
de toutes les lettres sous forme de batitude. Le Traipura
est la contrepartie dans le Jva du Kmakldu Sahasrra. La Dev Kundalini, lumineuse comme l'clair, brillant
au creux de ce lotus comme une chane de lumires resplendissantes, tonnement du monde et prservatrice de
290 Qui, suivant le Sammohana Tantra, ch. II, est gardienne de la porte.
291 C'est--dire le chyle, le sang, la chair, la graisse, l'os, la moelle et la semence.
292 Voir Shatchakranirpana, v. 4-14.

toute crature qui respire 293, repose endormie, enroule


trois fois et demie294 autour du Linga, couvrant de Sa tte
le Brahmadvra295.
Le Svdhishthna Chakra est le deuxime lotus en
montant, et, d'aprs le commentaire du Shatchakranirpana, il tient son nom de Sva, le Param Lingam 296. C'est
un lotus vermillon, six ptales, plac au centre spinal de
la rgion situe la racine des parties gnitales. Sur ces
ptales sont les lettres pareilles la foudre : Barn, Bham,
Ham, Yam, Rani, Lam. L' Eau (Ap) est le Tattva de ce
Chakra, qui est connu comme la blanche rgion de Varuna. Le Mandala tttvique a la forme d'un croissant de lune
(Ardhendurpalasitam)297. Le Bja de l'eau (Varuna) est
Vam . Celui-ci, le Varuna Bja, sige sur un Makara 298
blanc avec un lacet la main. Hari (Vishnu) et Rkin
Shakti l'aspect furieux, montrant les dents d'un air froce, sont ici299.
Au-dessus, au centre de la rgion du nombril, est le lo293 Ibid., v. 49.
294 En correspondance avec les trois Bindu et demi dont parle le Kubjik Tantra.

Voir plus haut.


295 Entre de la Sushumn.
296 Pour une autre dfinition, voir Dhynabindu Up., o sont nomms tous les

Chakra. Une autre tymologie est propre demeure (de Shakti).


297 Les figures, ou Mandala, qui symbolisent les lments, sont aussi donnes

dans le premier chapitre du Shrad Tilaka et dans le Vishvasra Tantra, cit la


page 25 de la Prnatoshin, avec cette diffrence que, suivant le Vishvasra Tantra, le Mandala de l'eau n'est pas un croissant, mais un octogone (Ashtsra). Les
diffrents Tantra donnent des descriptions diffrentes. Voir Shrad, ch. I.
298 Animal qui ressemble un alligator. Voir planche III.
299 Shatchakranirpana, v. 14-18.

tus Manipra (Nbhipadma), ainsi nomm, suivant le


Gautamya Tantra, parce que, grce la prsence du brlant Tejas, il est clatant comme une gemme (Mani) 300.
C'est un lotus dix ptales sur lesquels sont les lettres
Dam, Dham, Nam, Tam, Tham, Dam, Dham, Nam, Pam,
Pham. C'est la rgion triangulaire du Tejas Tattva.
Ce triangle a trois Svastika. Le rouge Bja du feu, Ram
, sige sur un blier, le porteur d'Agni, Seigneur du Feu.
L sont le vieux Rudra rouge souill de cendres blanches,
et la Shakti Lkin qui, tant la Devat de ce centre digestif, est dite friande de nourriture animale , et dont les
seins sont rougis par le sang et la graisse qui tombent de
sa bouche . Lkin et les autres Shakti particulires aux
centres ici nomms sont les Shakti du Yogi lui-mme, autrement dit, les Shakti des Dhtu assigns chacun de
ses centres corporels, et la concentration sur ce centre
peut impliquer la satisfaction des apptits de cette Devat.
Les Shakti des centres suprieurs ne sont pas mangeuses
de viande. partir de ces trois premiers centres se dveloppe le Virt grossier, le corps veill301.
Immdiatement au-dessus du lotus du nombril (Nbhipadma) est l'Anhata, dans la rgion du cur, qui est
rouge comme une Bandhka, et qui porte ce nom parce
que c'est cet endroit que les Muni, ou sages, entendent
ce son (Anhata shabda) qui est produit sans le choc de
deux objets , ou le son du Shabdabrahman, qui est ici
la Pulsation de la Vie. Car c'est ici que demeure le Purusha (Jvtm). Ce lotus doit tre distingu du Lotus du
300 Voir pour une autre tymologie, drive du culte Samaya, le Commentaire

des Lalit-Sahasranman, v. 88-89.


301 Shatchakranirpana, v. 19-21.

cur huit ptales, qui est reprsent au-dessous de lui,


o dans l'adoration mentale la divinit tutlaire (Ishtadevat) est le sujet de la mditation (Voir planche V).
L se trouve l'Arbre qui exauce tous les dsirs (Kalpataru), et sous cet Arbre l'Autel orn de joyaux (Maniptha).
Comme dit le Vishvasra Tantra cit dans la Prnatoshin :
On dit que Shabdabrahman est Deva Sadshiva. On dit
que ce Shabda est dans l'Anhatachakra. Anhata est le
grand Chakra dans le cur de tous les tres. On dit que
s'y trouve Omkra associ aux trois Guna302 .
Le Mahsvachchhandra Tantra dit303 : Les grands dclarent que Ta forme bienheureuse, Reine, se manifeste
dans Anhata, et qu'elle se rvle au mental des Bnis,
tourn vers l'intrieur, dont les cheveux se dressent et
dont les yeux pleurent de joie . C'est un lotus dix ptales portant en vermillon les lettres Kam, Kham, Gam,
Gham, Ngam, Cham, Chham, Jam, Jham, Nyam, Tam,
Tham. C'est le centre du Vyu Tattva.
D'aprs le verset 22 du Shatchakranirpana, la rgion
de Vyu est hexagonale (c'est--dire forme de deux
triangles, dont l'un est renvers), et sa couleur est celle de
la fume parce qu'elle est environne de masses de vapeur304. Son Bja Yam sige sur une antilope noire,
302 Shabdabrahmeti tam prha skshd devah sadshivah Anhateshu cha-

kreshu sa shabdah parikrttnate Anhatam mahchakram hridaye sarvajantushu


Tatra omkra ityukto gunatraya-samanvitah.
303 Cit par le Commentaire de Bhskararya sur la Lalit, v. 121, sur le titre de

Ndarp donn la Dev ; et v. 218, o elle est dcrite comme Ndarpin, avec
une allusion aussi au Yoginhridaya Tantra.
304 Suivant le Shrad, ch. I (et aussi le Prapanchasra Tantra), les couleurs des

Bhta sont les suivantes : Aksha (l'ther) est transparent (Svachchha) ; Vyu
(l'air) est noir (Krishna) ; Agni (le feu) est rouge (Rakta) ; Ap (l'eau) est blanche

animal renomm pour son agilit, et il est le Vhana de l'


Air (Vyu), avec sa proprit de mouvement. L sont Isha, le Matre qui gouverne les trois premiers Chakra ; la
Shakti Kkin pare de guirlandes d'os humains, et dont
le cur est adouci par le nectar qu'Elle boit ; et la Shakti
en forme de triangle renvers (Trikona), o est le Bna
Linga dor, joyeux d'une pousse de dsir (Kmodgamollasita), et le Hamsa comme Jvtm, pareil la
flamme constante d'une lampe l'abri du vent 305 . L'Atm
est ainsi dcrit parce que, tout comme la flamme est inaffecte par le vent, l'Atm est en lui-mme inaffect par les
mouvements du monde306.
Le dix-septime vers de l'Ananda-Lahar signale que la
Devat Vashin ainsi que sept autres, doivent tre adores
dans les deux derniers Chakra dcrits307.
Ces huit Devat sont :
(1) Vashin ;
(2) Kmeshvar ;
(3) Modin ;
(4) Vimal ;
(5) Arun ;
(6) Jayin ;
(7) Sarveshvar ;
(Sveta) ; et Prithiv (la terre) est jaune (Pita).
305 Shatchakranirpana, v. 22-27.
306 Cet tat stable, immobile, est celui de l'Atm comme tel. Voir Mandalabrh-

mana Up., Brhmana II et III.


307 Ananda-Lahar du Pandit Ananta Shstri, pp. 47-48 ; traduction par A. Ava-

lon, Wave of Bliss.

(8) Kl ou Kaulin.
Ce sont respectivement les Dits prsidant aux huit
groupes de lettres suivants :
(1) a ha, 16 lettres ;
(2) ka na, 5 lettres ;
(3) ca a, 5 lettres ;
(4) ta na, 5 lettres ;
(5) ta na, 5 lettres ;
(6) pa ma, 5 lettres ;
(7) ya va, 4 lettres ;
(8) a krsa ou da, 5 lettres.
Les autres tres cits au vers 17 de l'Ananda-Lahar
sont les douze Yogin, savoir :
(1) Vidyyogin ;
(2) Rechik ;
(3) Mochika ;
(4) Amrit ;
(5) Dipik ;
(6) Jnn ;
(7) Apyyan ;
(8) Vyapini ;
(9) Medh ;
(10) Vyomarp ;
(11) Siddhirp ;
(12) Lakshmyogin.
Ces vingt Dits (huit Vashin et douze Yogin) doivent

tre adores dans les centres Manipra et Anhata. ce


sujet, le Commentateur cite un vers du Tittiryranyaka,
et donne une description de ces Dits, indiquant leur
couleur et leur place respectives, avec d'autres dtails.
Au centre spinal de la rgion situe la base de la gorge
(Kantha-mla) est le Vishuddha Chakra ou Bhratsthna308 seize ptales d'une couleur violette tirant sur le
noir, sur lesquels sont les seize voyelles portant Bindu,
cest--dire Am, Am, Im, Im, Um, Um, Rim, Rm, Lrim,
Lrm, Em, Aim, Om, Aum, et les deux aspirations Am et
Ah.
Suivant le Devbhgavata (VII, 35), ce Chakra est ainsi
nomm parce que le Jva est purifi (Vishuddha) par la
vue du Hamsa. C'est le centre de l'Aksha Tattva, ou Tattva de l'ther, blanc et circulaire, dont le Bja est Ham .
Aksha est vtu de blanc et mont sur un lphant blanc.
Son Mandala a la forme d'un cercle309. L est Sadshiva
dans sa Mrti androgyne ou Arddhanrshvara, dans laquelle la moiti du corps est blanche et l'autre moiti dore. L aussi est la blanche Shakti Shkin, dont la forme
est lumire (Jyotihsvarpa). L encore est la rgion lunaire, la porte de la grande Dlivrance . C'est l que le
Jnn voit les trois formes du temps (Trikladarsh).
Comme toutes choses sont dans l'Atm, le Jnn qui a
ralis l'Atm les a vues310.
308 C'est--dire : sjour de la Devi du langage.
309 On le reprsente parfois par un cercle avec un certain nombre de points

l'intrieur, car, comme le dit le Prapanchasra Tantra, Aksha a d'innombrables


Sushira, ou Chhidra, ou intervalles dans sa substance. C'est en raison de son caractre interstitiel que les choses existent dans l'espace.
310 Shatchakranirpana, v. 28-31.

Au-dessus du Vishuddha, la racine du palais, est un


Chakra mineur appel Lalan, ou, dans certains Tantra,
Kal Chakra311. C'est un lotus rouge douze ptales portant les Vritti ou qualits suivantes : Shraddh (la foi),
Santosha (le contentement), Apardha (le sens de l'erreur),
Dama (la matrise de soi), Mna (la colre) 312, Sneha (l'affection)313, Shuddhat (la puret), Arati (le dtachement),
Sambhrama (l'agitation)314, Urmi (l'apptit)315.
Avant de rsumer la description prcdente, il convient
de remarquer ici que le Commentateur du Shatchakranirpana, Klcharana, donne pour principe du Laya Yoga
que le plus grossier se fond dans le plus subtil (Sthulnm
skshme layah). Les lments les plus grossiers sont situs plus bas dans le corps que les lments les plus subtils. Les lments grossiers qui sont dans le Mldhra et
au-dessous, ou associs ce centre, sont :
(1) le Prithiv Tanmtra ;
(2) le Prithiv Mahbhta ;
(3) les narines avec le sens de l'odorat, qui est le plus
grossier des sens de connaissance (Jnnendriya), et
qui est la qualit (Guna) du Prithiv Tanmtra ;
(4) les pieds, qui sont les plus grossiers des sens ac311 Non mentionn dans le Shatchakranirpana.
312 Ce terme s'applique en gnral aux cas surgissant entre deux personnes qui

sont attaches l'une l'autre, comme mari et femme.


313 Habituellement entendue comme une affection envers ceux qui sont plus

jeunes, ou infrieurs.

314 Par vnration ou respect.


315 Il peut s'agir aussi des six choses portant le nom technique d'Urmmi, c'est--

dire la faim, la soif, le chagrin, l'ignorance (Moha), la dcrpitude et la mort.

tifs (Karmendriya), et qui ont Prithiv (la terre) pour


support .
Les narines sont classes comme les plus grossiers des
Jnnendriya, parce qu'en elles est le sens qui peroit la
qualit (Guna) d'odeur du Tanmtra le plus grossier (Gandha), dont drive le Prithiv Sthla Bhta.
Les Jnnendriya sont donc en relation avec les Tanmtra par l'intermdiaire de leurs Guna (qualits), pour la
perception desquelles ces sens existent. Cependant, dans
le cas des sens actifs (Karmendriya), aucune relation de
cette sorte ne parat exister entre eux et les Tanmtra.
Dans l'ordre des dissolutions (Laya) successives, les
pieds viennent au mme rang que la terre, les mains au
mme rang que l'eau, l'anus au mme rang que le feu, le
pnis au mme rang que l'air, et la bouche au mme rang
que l'ther ; non point, apparemment, qu'il y ait aucune
relation directe entre la terre et les pieds, l'eau et les
mains, le feu et l'anus, et ainsi de suite, mais parce que
ces organes sont dans le mme ordre de subtilit relative
que la terre, l'eau, le feu, etc.
Les mains sont considres comme des agents plus
subtils que les pieds ; l'anus316 comme un agent plus subtil que les mains ; le pnis comme un agent plus subtil
que l'anus ; et la bouche comme un agent plus subtil que
le pnis. C'est aussi l'ordre dans lequel ces agents sont
situs dans le corps, les mains venant en second lieu
parce qu'elles trouvent place entre les pieds et l'anus
quand on donne aux bras leur position verticale naturelle.
316 premire vue il pourrait sembler qu'il n'en est pas ainsi, mais l'importance

de l'anus est bien connue des experts en mdecine, sa sensibilit ayant mme
donn naissance ce qu'on a appel une psychologie de l'anus .

On doit se rappeler ce propos que les Tantra suivent


ici le Smkhya, et donnent le plan de la cration tel qu'il
apparat aussi dans les Purna, suivant lesquels les Jnnendriya, les Karmendriya et les Tanmtra naissent des
diffrents aspects du triple Ahamkra. Il existe une relation entre les sens et les Tanmtra dans le Jva cr, selon
le Vednta, car les sens sont relis aux Tanmtra, mais
l'ordre dans lequel, l, les sens apparaissent est diffrent
de celui que nous donnons d'aprs le Shatchakranirpana.
Car, suivant l'expos vdantique, la terre est en relation
avec le sens de l'odorat et le pnis ; l'eau avec le sens du
got et l'anus ; le feu avec le sens de la vue et les pieds ;
l'air avec le sens du toucher et les mains ; et l'ther avec le
sens de l'oue et la bouche.
On a donn cette autre explication, qui parat cependant artificielle : les pieds sont associs la Terre parce
que cette dernire a seule le pouvoir de supporter, et les
pieds y reposent ; l' Eau est associe aux mains parce
qu'en buvant de l'eau on se sert de la main ; (le mot Pni,
qui dsigne les mains, drive de la racine P, boire : Pyate
anena iti pni) ; le Feu est associ l'anus parce que ce
qu'on mange est consum par le feu dans l'estomac, aprs
quoi le rsidu est expuls par l'anus, ce qui purifie le
corps ; l' Air est associ au pnis parce que dans la procration le Jvtm comme Prna Vyu se projette au dehors par le pnis ; et ainsi la Shruti dit : L'Atma lui-mme
renat dans le fils ; (Atmvai jyate putrah) ; l' ther
est associ la bouche parce que par la bouche est mis
le son, qui est la Guna (qualit) de l'ther (Aksha).
Jusqu' prsent nous nous sommes occups des Tattva
relativement grossiers. Suivant le Shatchakranirpana, les
vingt Tattva les plus grossiers sont associs (4 x 5) comme

dans le tableau suivant :


Centre de dissolution

Tattva grossiers

1. Mldhra

Gandha (l'odorat) Tanmtra ; Prithiv Tattva (la terre) ; le


Jnnendriya de l'odorat 317 ; le Karmendriya des pieds.

2. Svdhishthna

Rasa (le got) Tanmtra ; Ap Tattva (l'eau) ; le Jnnendriya du got ; le Karmendriya des mains.

3. Manipra

Rpa (la vue) Tanmtra ; Tejas Tattva (le feu) ; le Jnnendriya de la vue ; le Karmendriya de l'anus.

4. Anhata

Sparsha (le toucher) Tanmtra ; Vyu Tattva (l'air) ; le


Jnnendriya du toucher ; le Karmendriya du pnis.

5. Vishuddha

Shabda (le son) Tanmtra ; Aksha Tattva (l'ther) ; le


Jnnendriya de l'oue ; le Karmendriya de la bouche.

On remarquera qu' chacun des lments sont associs


un organe de sensation (Jnnendriya) et un organe d'action (Karmendriya). Il est dit au chapitre II du Prapanchasra Tantra L'ther est dans les oreilles, l'air dans la
peau, le feu dans lil, l'eau dans la langue, et la terre
dans les narines . Il est possible que les Karmendriya
soient ainsi ordonns parce que les Tattva des centres
respectifs dans lesquels ils sont placs sont, comme nous
l'avons dit plus haut, des degrs semblables de subtilit
et de grossiret. Comme il sera expliqu plus loin, chaque
catgorie de Tattva se dissout dans la catgorie place
immdiatement au-dessus, en commenant par le centre
le plus bas et le plus grossier, le Mldhra.
317 Le nez est un centre auquel l'excitation sexuelle peut tre veille ou apaise.

Bien que l'organe reproducteur soit plus haut que le Mldhra, la force sexuelle
procde, en fin de compte, de ce dernier.

Jusqu' prsent, donc, nous avons eu affaire aux Tattva


du ct matriel de la cration.
On passe ensuite au dernier centre ou Ajn Chakra,
dans lequel sont les Tattva subtils du Mental et de Prakriti. Ce Chakra est ainsi nomm parce que l est reu
d'en haut le commandement (Ajn) du Guru. C'est un lotus deux ptales blancs, situ entre les sourcils, et sur
lequel sont les lettres blanches Ham et Ksham : ce qui
puise les cinquante lettres. On aura remarqu qu'il y a
cinquante ptales et cinquante lettres dans les six Chakra.
Dans le pricarpe est le grand Mantra Om .
Chaque lotus a deux ou quatre ptales de plus que celui
qui est immdiatement au-dessous de lui, et le nombre
des ptales du Vishuddha Chakra est la somme des diffrences qui prcdent. L sont Paramashiva sous la forme
de Hamsa (Hamsa-rpa), Siddhakl, la blanche Hkin
Shakt enivre de l'ambroisie qu'elle a bue , le triangle
invers ou Yoni (Trikona), et en lui l'Itara Linga, brillant
comme la foudre. Les trois Linga sont donc respectivement
dans le Mldhra, l'Anhata et l'Ajn ; car ces trois
nuds ou Brahmagranthi la force de My Shakti est
grande. Et c'est le point o convergent les trois groupes de
Tattva associs au Feu, au Soleil et la Lune318.
L'expression ouverture des portes se rapporte au
passage de ces Granthi. Dans l'Ajn est le sige des Tattva
subtils, Mahat et Prakriti. Le premier est l'Antahkarana
avec les Guna, c'est--dire Buddhi, Chitta, Ahamkra et
son produit Manas (Sasamkalpavikalpaka). On dit communment et sommairement que Manas est le Tattva de
l'Ajn Chakra. Cependant, tant le centre mental, il com318 Voir plus loin.

prend tous les aspects du mental indiqus plus haut, et la


Prakriti dont ils drivent, comme aussi lAtm sous la
forme du Pranava (Om), son Bija. L l'Atm (Antartm)
brille avec l'clat d'une flamme. La lumire de cette rgion
rend visible tout ce qui est entre le Mla et le Brahmarandhra. Le Yog, par la contemplation de ce lotus, acquiert
de nouveaux pouvoirs (Siddhi), et devient Advaitchravdi (moniste).
propos de ce Padma, le Shatchakranirpana explique
(v. 36) comment le dtachement s'obtient par le Yoni Mudr. C'est l que Yog, l'heure de la mort, place son Prna, et alors entre le suprme Deva primordial, le Purna
(ancien) Purusha, qui tait avant les trois mondes, et qui
est connu par le Vednta . Le mme verset dcrit la mthode (Prnropanaprakra). Du dernier centre et de la
Prakriti causale sort le corps subtil qui est connu, individuellement, sous le nom de Taijasa, et collectivement
(c'est--dire sous l'aspect Ishvara) sous le nom de Hiranyagarbha. Ce dernier terme s'applique la manifestation
du Paramtm dans l'Antahkarana ; dploy en Prna, il
est Strtm ; et lorsqu'il est manifest par ces deux vhicules sans diffrenciation, il est connu sous le nom d'Antarymin. Les Chakra sont les centres corporels du monde
de la manifestation diffrencie, avec ses corps grossier et
subtil naissant de leur corps causal, et ses trois plans de
conscience dans la veille, le rve, et le sommeil profond.
Au-dessus de l'Ajn Chakra sont les Chakra mineurs
appels Manas et Soma, non mentionns319 dans le Shatchakranirpana. Le Manas Chakra est un lotus six ptales, sur lesquels se trouvent (c'est--dire o sigent) les
319 Shatchakranirpana, v. 32-39.

sensations de l'oue, du toucher, de la vue, de l'odorat, du


got, et les sensations du rve et de l'hallucination ayant
leur origine dans un centre.
Au-dessus encore est le Soma Chakra, lotus seize ptales, avec certaines Vritti dont le dtail sera donn plus
loin. Dans cette rgion sont la maison sans support (Nirlambapur), o les Yog voient le radieux Ishvara , les
sept corps causals320, qui sont des aspects intermdiaires
d'Ady Shakti, le lotus blanc douze ptales ct du pricarpe du Sahasrra321, lotus douze ptales dans lequel
est le triangle A-ka-tha, qui entoure l'autel orn de joyaux
(Maniptha) dans l'le des gemmes (Manidvpa) place dans
l'Ocan de Nectar322, avec Bindu au-dessus et Nda audessous, et le triangle de Kmakal et le Guru universel,
Paramashiva. Au-dessus encore, dans le pricarpe, sont
les Srya et Chandra Mandala, le Parabindu entour des
seizime et dix-septime divisions du cercle de la lune.
Dans le Chandra Mandala se trouve un triangle. Audessus de la Lune est Mahvyu, et ensuite le Brahmarandhra avec Mahshamkhin.
Le lotus douze ptales, avec celui qui lui est associ,
constitue le sujet spcial du court ouvrage intitul Pdukpanchaka Stotra, qui est un hymne de Shiva la
louange du Quintuple Pidestal , avec un commentaire
par Shr Klcharana. Les pidestaux sont classs de fa320 Ibid., V. 39.
321 Ibid., v. 32-39.
322 Dans l'adoration mentale, l'autel orn de joyaux de l'Ishtadevat est dans le

lotus huit ptales au-dessous d'Anhata (voir planche V). L'Ile des Gemmes est
un tat suprme de Conscience, et l'Ocan de Nectar est la Conscience infinie
Elle-mme. Sur les corps causals, voir Avalon, Garland of Letters.

ons diverses. D'aprs la premire classification, ce sont :


(1) le lotus blanc douze ptales situ dans le pricarpe du lotus Sahasrra. L se trouve
(2) le Triangle invers, demeure de Shakti, appel Aka-tha .
(3) La rgion de l'autel (Maniptha), de chaque ct de
laquelle sont Nda et Bindu. Le Guru ternel, blanc
comme une montagne d'argent , doit tre plac, dans
la mditation, sur l'Autel orn de joyaux (Maniptha).
(4) Le quatrime Pduk est le Hamsa situ audessous de l'Antartm ;
(5) le Triangle sur le Ptha.
Suivant la seconde classification ils sont ainsi compts :
(1) le lotus douze ptales ;
(2) le triangle appel A-ka-tha ;
(3) Nda-Bindu ;
(4) le Maniptha-Mandala ; et
(5) le Hamsa, qui forme le Kmakal triangulaire.
Ce Triangle, le Tattva Suprme, est form par les trois
Bindu que le texte appelle Chandra Bindu (Bindu de la
Lune), Srya Bindu (Bindu du Soleil), et Vahni Bindu
(Bindu du Feu), connus aussi sous les noms de Praksha,
Vimarsha323 et Mishra Bindu.
C'est le Hamsa qu'on appelle le Kmakal triangulaire,
forme revtue par Purusha-Prakriti. Le premier est le Bindu Hamkra au sommet du triangle, et les deux autres
Bindu, appels Visarga ou Sa, sont Prakriti. Ce Kmakal
323 Sur ce terme, voir Mahmy et Kmakalvilsa dans Avalon, Tntrik Texts.

est le Mla (racine) du Mantr.


Le Shabdabrahman avec son triple aspect et ses nergies est reprsent dans les Tantra par ce Kmakal, qui
est la demeure de Shakti (Aballayam). C'est le Triangle
suprme, qui, comme tous les Yoniptha, est invers.
On peut noter ici que Shakti est reprsente par un
triangle cause de sa triple manifestation comme Volont,
Action et Connaissance (Ichchh, Kriy, Jnna). Ainsi, sur
le plan matriel, s'il y a trois forces, il n'y a d'autre moyen
de les faire agir les unes sur les autres que sous la forme
d'un triangle o, chacune tant spare et distincte des
autres, elles sont pourtant relies l'une l'autre et font
partie d'un tout. Aux angles du Triangle il y a deux Bindu,
et au sommet un seul Bindu. Ce sont les Bindu du Feu
(Vahnibindu), de la Lune (Chandrabindu) et du Soleil
(Sryabindu)324.
Trois Shakti manent de ces Bindu, reprsentes par
les lignes joignant les Bindu et formant ainsi un triangle.
Ces lignes sont celle de la Shakti Vm, celle de la Shakti
Jyeshth et celle de la Shakti Raudr. Ces Shakti sont la
Volont (Ichchh), l'Action (Kriy) et la Connaissance
(Jnna). Avec elles sont Brahm, Vishnu et Rudra, associs aux Guna, Rajas, Sattva et Tamas.
Les lignes du triangle manant des trois Bindu ou
Hamsah sont formes par quarante-huit lettres de l'alphabet :
324 Le Kmakalvilsa dit : Sindu-trayamayas tejastritayah (trois Bindu et

trois feux). Tripurasundar sige dans le Chakra qui est compos de Bindu
(Bindumaye chakre). Sa demeure tant sur les genoux de Kmeshvara, dont le
front est orn du croissant lunaire. Elle a trois yeux, qui sont le Soleil, la Lune et
le Feu .

- Les seize voyelles, en commenant par A, forment


une ligne ;
- les seize consonnes, en commenant par Ka, forment la deuxime ligne ;
- les seize lettres suivantes, en commenant par Tha,
forment la troisime ligne.
C'est pourquoi l'on appelle ce triangle le triangle A-katha. Aux trois angles internes de ce triangle sont les lettres
restantes, Ha, Lla, Ksha. Le Ymala parle ainsi de cette
demeure : Je parle maintenant de Kmakal ; et poursuit Elle est l'Un ternel qui est les trois Bindu, les trois
Shakti et les trois Formes (Trimrti) . Le Brihat-Shrkrama, traitant de Kmakal, dit : partir du Bindu
(c'est--dire du Parabindu), Elle a assum la forme des
lettres (Varn vayvarpin) .
Le Kl Urdhvmnya dit : Le triple Bindu (Tribindu)
est le Tattva suprme, et contient en lui Brahm, Vishnu
et Shiva325 . Le triangle qui est compos des lettres est
man du Bindu. Ces lettres sont connues sous le nom de
Mtrik Varna. Elles forment le corps de Kulakundalin326,
le Shabdabrahman, tant dans leur tat Vaikhar des manifestations diverses du son primordial non manifest
(Avyaktanda).
Elles apparaissent comme le Shabda manifest quand le
Parabindu se divise ; car cette division marque l'apparition
de la Prakriti diffrencie.
325 La Mheshvar Samhit dit : Srya, Chandra et Vahni sont les trois Bindu ;

et Brahm, Vishnu et Shambhu sont les trois lignes .


326 Le Kmakalvilsa dit : Ekapanchshadakshartm (Elle a pris la forme

des 51 lettres). Voir ce texte et sa traduction dans Avalon, Tntrik Texts, vol. IX.

Le commentaire du Pdukpanchaka (v. 3) dit que le


Bindu est Parashakti elle-mme, et que ses variations sont
appeles Bindu, Nda et Bja, ou Soleil, Lune et Feu ; Bindu, le soleil, tant rouge, et Nda, la lune, tant blanc327.
Ils forment le Chinmaya ou Anandamayakosha, enveloppe de conscience et de batitude . Les deux Bindu
formant la base du triangle sont les Visarga (ibid., v. 4).
Il est dit dans l'Agamakalpadruma : Hamkra est Bindu ou Purusha, et Visarga est Sah ou Prakriti. Hamsah
est l'union du principe mle et du principe fminin, et
l'univers est Hamsah . Le Kmakal triangulaire est donc
form par Hamsah (ibid.). Le Hamsa-ptha est compos de
Mantra (ibid., v. 6).
Comme ce sujet est d'une grande importance, donnons
encore d'autres autorits. Dans son commentaire au v.
124 de la Lalit, dans lequel on s'adresse la Dev comme
tant sous la forme de Kmakal (Kmakalrp),
Bhskararrya dit : Il y a trois Bindu et le Hrdhakal328.
De ces Bindu le premier est appel Kma, et le Hakrrdha est appel Kal329 . Il ajoute que la nature de Kmakal est indique dans le Kmakalvilsa, dans les
vers commenant par : La Shakti suprme (Par Shakti)
est l'union manifeste de Shiva et de Shakti sous la forme
de la semence et du germe , et finissant par : Kma signifie le dsir, et de mme Kal. Il est dit que les deux

327 Cela semble en contradiction avec l'expos prcdent de Rghava Bhatta,

suivant lequel Bindu est la Lune et Nda le Soleil.


328 Appel aussi Hakrdha, c'est--dire la moiti de la lettre Ha.
329 Bindu-trayam hrdhakal cha ityatra prathamo binduh kmkhyash Chara-

m kal cha iti pratyhranyyena kmakaletyuchyate.

Bindu sont le Feu et la Lune330 .


Kma, la Volont cratrice, est la fois Shiva et Dev, et
Kal est leur manifestation. C'est pourquoi on le nomme
Kmakal. Cela est expliqu dans le Tripursiddhnta :
O Prvati, Kal est la manifestation de Kmeshvara et de
Kameshvar. C'est pourquoi Elle est connue sous le nom
de Kmakal331 . Ou encore Elle est la manifestation
(Kal) du dsir (Kma)332, c'est--dire d'Ichchh.
Le Klik Purna dit : Dev est appele Kma parce
qu'Elle est venue l'endroit secret sur le pic bleu de la
grande montagne (Kailsa) avec Moi cause du dsir (Kma) : aussi Dev est appele Kma. Comme Elle est aussi
Celle qui donne et satisfait le dsir, dsirante, dsirable et
belle, recrant le corps de Kma (Manmatha) et dtruisant
le corps de Kma, Elle est appele Kma333 .
Aprs que Shiva (avec qui Elle ne fait qu'un) eut dtruit
Kma, lorsqu'il chercha, en versant la passion, dtruire
Son Yoga : Elle (avec qui Il ne fait qu'un) donna par la
suite un nouveau corps Celui qui est sans corps
(Ananga). Ils dtruisent les mondes et les rappellent eux
330 Tasyh svarpam sputhashivashakt-samgamabjamkurarpinpar shak-

tirityrabhya kmah kamanyatay kal cha dahanenduvigrahau bind ityantena


nirntam kmakalvilse tadrpetyarthaha. (Ibid.)
331 Kmayoh kaleti v, taduktam, tripursiddhnte : Tasya kmeshvarkhyasya

kmeshvarysh cha parvvati, Kalkhy sala s cha khyt kmakaleti s.


332 Kmash chsau kalrp cheti v.
333 Kmapadamtra-vchyatyh Klpurne pratipdant.

Kmrtham gat vasmn may srdham mahmirau


Kmkhv prochyate dev nlaktarahogat
Kmad kmin kmy knta kmngadyin
Kmnganshin yasmt kmkhy tena kathyate
Iti shadksharamidam nma. (Ibid.)

par la voie du Yoga cosmique, et de nouveau par leur dsir


et leur volont (Ichchh) les recrent. Il est question de ces
Bindu et de ces Kal dans l'hymne clbre Ocan de Batitude (Anandalahar)334.
Cette Dev est la grande Tripurasundar. Le Guru de
Bhskararya, Nrisimhnandantha, a crit les vers suivants, que commente son disciple : Je clbre Tripur, le
trsor de Kula335, qui est rouge de beaut ; Ses membres
pareils ceux de Kmarja, qui est ador par les trois Devat336 des trois Guna ; qui est le dsir (ou la volont) de
Shiva337 ; qui demeure dans le Bindu et qui manifeste
l'univers .
On lui donne, dit le Commentateur338, le nom de Tripur, parce qu'Elle a trois (Tri) Pura (littralement, cits,
mais signifiant ici Bindu, angles, lignes, syllabes, etc.). Le
Klik Purna dit : Elle a trois angles (dans le Yoni trian334 Mukham bindum kritv kuchayugam adhas tasya tadadho Hakrrdham

dhyyet haramahshi te manmathakalm. (v. 19.) (Qu'il contemple le premier


Bindu comme le visage de la Dev, et les deux autres Bindu comme Ses deux
seins, et au-dessous le demi Ha.) Le demi Ha est le Yoni, la matrice, et l'origine de
tout. Voir Lalit, v. 206.

335 Kulanidhi. Dans son sens littral ordinaire, Kula signifie race ou famille, mais

il a beaucoup d'autres sens : Shakti (Akula est Shiva), la hirarchie spirituelle des
Guru, le Mldhra, la doctrine des Tantristes Kaula, etc.
336 Vishnu, Brahm et Rudra, ayant respectivement les qualits de Sattva, de

Rajas et de Tamas.

337 C'est le sens que donne le commentateur Ekm tm. Ek a + i = e. Sui-

vant le Vishva Dictionary, A possde, entre autres sens, celui d'Isba ou Shiva,
et, suivant l'Anekrthadhvanimanjar Lexicon, I = Manmatha, c'est--dire Km, le
dsir. Ek est donc l'pouse de Shiva, ou Shivakm, le dsir ou la volont de
Shiva.
338 Introduction la Lalit.

gulaire), aussi bien que trois cercles (les trois Bindu), et


son Bhpura339 a trois lignes. Il est dit que son Mantra est
de trois syllabes340, et Elle a trois aspects. L'nergie de
Kundalini est galement triple, afin de pouvoir crer les
trois Dieux (Brahm, Vishnu, Rudra). Aussi, Elle, l'nergie
suprme, tant triple tous gards, on La nomme Tripurasundar341 .
Le Commentateur342 dit que ces trois syllabes sont les
trois Bja des trois subdivisions (du Panchadash) :
Vgbhava, Kmarja et Shakti, qui, selon le Vmakeshvara Tantra, sont Jnnashakti qui donne le salut, Kriy
Shakti et Ichchh Shakti.
On parle aussi de trois Pda sous le nom de Tripur :
blanc, rouge, et mlang 343. Ailleurs, comme dans le
339 La partie du Yantra qui est de forme commune et qui contient en son centre

le dessin particulier. Cependant, il peut galement y avoir ici une allusion aux
trois lignes extrieures du Shrchakra.
340 Voir plus loin. Le Kma Bja est Klm. Klmkra est Shivakma. Im dsigne ici

le Kmakal dans l'tat Turya o s'obtient Moksha : c'est en ce sens qu'il est dit
(Ibid., v. 176) que celui qui entend le Bja sans Ka et La n'atteint pas le lieu des
bonnes actions ; autrement dit, il ne va pas dans la rgion qu'on atteint par les
bonnes actions, mais dans celle qu'on ne peut atteindre que par la seule connaissance. (Voir Ibid., v. 189, qui cite le Vmakeshvara Tantra.)
341 On peut donner d'autres exemples, comme le Tripurtirnava, qui dclare que

la Dev est appele Tripur parce qu'Elle demeure dans les trois Nd (Sushumn, Pingal, Id ; voir plus loin), et dans Buddhi Manas Chitta (voir plus loin).
342 V. 177.
343 D'aprs une note de R. Anantakrishn Shstri, traducteur de la Lalt, p. 213,

les trois pieds sont ainsi expliqus dans un autre ouvrage de Bhskararya :
le Blanc est le pur Samvit (Conscience), exempt de toute Updhi ; le rouge, le
Parhanta (Personnalit Suprme), la premire Vritti (modification) du Samvit ;
et la couleur mlange, la modification (Vritti) du Moi , mentionne plus haut
comme insparable de ce dernier. Ce sont l les trois pieds (Charana-tritaya) :

Varhna Purna, il est dit que la Dev a revtu trois


formes, une blanche, une rouge et une noire : ce qui dsigne l'nergie Suprme doue des qualits sttvique, rjasique et tmasique344. La Shakti unique devient triple
pour produire des effets.
Dans la mditation (Dhyna) sur Kmakal, on pense
aux trois Bindu et Hrdhakal comme au corps de la
Dev Tripurasundar. Le Commentateur du vers cit de
l'Anandalahar dit345 : Dans le cinquime sacrifice
(Yajna), que le Sdhaka se reprsente son Atm comme ne
diffrant en aucune manire du seul et unique Shiva, mais
comme tant lui seul ; et, qu'il se reprsente la Kundalin,
subtile comme un fil, qui est toutes les Shakti, allant du
lotus Adhra jusqu' Paramashiva. Qu'il se reprsente les
trois Bindu comme tant dans Son corps (Tripurasundar),
Bindu qui figurent Ichchh, Kriy, Jnna ; la Lune, le Feu
et le Soleil ; Rajas, Tamas, Sattva ; Brahm, Rudra, Vishnu ; et qu'il mdite ensuite sur le Chitkal qui est Shakti
au-dessous346 .
Le Bindu qui est le visage dsigne Virinchi347 (BrahIndu (blanc). Agni (rouge), Ravi (mlang).
344 C'est ainsi que le Dev Bhgavata Pr. dit aussi : La Shmbhav est blanche ;

Shrvidy, rouge ; et Shym, noir. Le Yantra de Shrvidy est le Shrchakra


mentionn.
345 Shankarchryagranthval, vol. II, d. Shr Prasanna Kumra Shstri. Les

notes de l'diteur sont bases sur le Commentaire d'Achyutnanda Swmi.

346 Atha panchamayge abhedabuddhy tmnam shivarpam ektmnam vib-

hvya dhrt paramashivntam strarpm skshmm kundalinm sarvashaktirpm vibhvya sattvaraj astamogunaschakam brahmavishnushivashaktytmakam srygnichandrarpam bindutrayam tasy ange vibhyya adhash
chitkalm dhyyet. (Comm. du v. 19.)
347 C'est--dire Celui qui cre ; de Vi + rich.

m) associ au Rajas Guna. Les deux Bindu qui sont les


seins , et sur lesquels la mditation doit s'effectuer dans
le cur, dsignent Hari348 (Vishnu) et Hara349 (Rudra) associs au Sattva Guna et au Tamas Guna. Au-dessous
d'eux, mditez dans le Yoni sur le Chitkal subtil, qui dsigne les trois Guna, et qui est ces trois Devat350.
La mditation indique dans le Yogin Tantra est la suivante : Reprsentez-vous trois Bindu au-dessus de Kal,
puis, sortant d'eux, une jeune fille de seize ans, brillante
de la lumire de millions de soleils levants, illuminant
chaque rgion du firmament. Reprsentez-vous Son corps,
du sommet de la tte la gorge, sortant du Bindu suprieur, et Son corps, de la gorge son milieu, avec ses deux
seins et ses trois lignes de beaut (Trival) sur le ventre,
naissant des deux Bindu infrieurs. Ensuite imaginez que
le reste de Son corps, du sexe aux pieds, nat de Kma.
Ainsi forme, Elle est pare de toutes sortes d'ornements
et de vtements, et adore par Brahm, Isha et Vishnu.
Alors, que le Sdhaka se reprsente son propre corps
comme tant ce Kmakal 351 .
Le Shritattvrnava dit : Les hommes glorieux qui adorent dans ce corps en Smarasya352 sont dlivrs des
348 Celui qui te ou dtruit (harati) toute peine et tout pch.
349 Le mme.
350 Mukham bindum kritv rajogunaschakam virinchytmakam bindum muk-

ham kritv, tasydho hridayasthne sattvatamogunaschakam harihartmakam


bindudvayam kuchayugam kritv, tasydhah yonigunatrayaschikm hariharavirinchytmikm skshmm chitkalm hakrrdham kritv vonyantargatatrikonkritim kritv dhyyet. (Comm. du v. 19.)
351 Voir Nityapjapaddhati, par Jaganmohana Tarklamkra, p. 199 et suiv.
352 Union ; union de Shiva et de Shakti.

vagues de poison de la mer infranchissable du monde


(Samsra)353 .
On trouve les mmes indications dans deux ouvrages
tantriques, le Shrkrama354 et la Bhvachdmani355, cits
dans le Commentaire de l'Anandalahar. Le premier dit :
Des trois Bindu, Matresse des Deva, qu'il contemple le
premier comme la bouche et dans le cur les deux Bindu
comme les deux seins. Qu'il mdite ensuite sur le subtil
Kal Hakrrdha dans le Yoni .
Et le deuxime dit : Le visage sous la forme de Bindu,
et au-dessous les seins jumeaux, et au-dessous d'eux la
forme splendide du Hakrrdha . Il est dit que les trois
Devata Brahm, Vishnu et Rudra, avec leurs Shakti, naissent des lettres A, U, M de l'Omkra ou Pranava356. Ma,
353 Voir note 348.
354 Tath cha Shrkrame :

Bindutrayasya deveshi prathamam devi vaktrakam


Bindudvayam stanadvandvam hridi sthne niyojavet.
Hakrerdham kalm skshmm yonimadhye vichintayet.
355 Taduktam Bhvachdmanau :

Mukham binduvadkram
Tadadhah kuchayugmakam
Tadadhashcha hakrrdham
Suparishkritamandalam.

On trouve aussi le troisime vers imprim Tadadhah saparrdham cha. Mais cela
signifie la mme chose. Sapara est Hakra, Ha suivant Sa. Pour les autres Dhyna
et modes de mditation, voir la Nityapjpaddhati de Jaganmohana Tarklamkra, p. 199.
356 Phetkrini Tantra, ch. I :

Tebhya eva samutpann varn ye vishnu-shlinoh Mrtayah shaktisamyukt


uchyante th kramena tu.
Et de mme le Vishvasra Tantra (voir Prnatoshin, 10) : Shivo brahm tath

comme le dit le Prapanchasra Tantra357, est le Soleil ou


l'Atm parmi les lettres, car elle est Bindu. De chacune de
ces trois lettres naissent dix Kal.
Le Shatchakranirpana358 dit que dans le centre Mlchra se trouve le Triangle (Trikona) connu sous le nom
de Traipura, qui est un adjectif correspondant Tripura. Il
doit ce nom la prsence de la Dev Tripur l'intrieur
du Ka dans le triangle. Ce Ka est la lettre principale du
Kma Bja, et Kam359 est le Bja de Kmin, l'aspect de Tripurasundar dans le Mldhra.
L aussi, dit le mme passage, se trouvent les trois
lignes Vm, Jyeshth et Raudr, et, ajoute le Shatchakravivriti, Ichchh, Jnna et Kriy360. Le Traipura Trikona est
donc l'aspect grossier (Sthla) de cette Shakti subtils
(Skshma) qui est sous le Sahasrra, et porte le nom de
Kmakal. C'est cette Kmin que dans l'adoration l'on
offre l'essence du Japa (Tejorpajapa), le Japa extrieur
tant offert la Devata adore afin que le Sdhaka puisse
obtenir le fruit de son adoration361.
Il y a aussi deux autres linga et deux autres Trikona
aux centres Anhata et Ajn, qui sont deux des nuds ou
Granthi, ainsi nomms parce que My est puissante
ces points d'obstruction, o converge chacun des trois
vish-nuronkkre cha pratishthith Akrash cha bhaved brahm ukrah sachehidtmakah Makro rudra ityukta iti tasyrthakalpan.
357 Ch. III.
358 V. 8.
359 Nityapjpaddhati, p. 80.
360 Voir Tntrik Texts, vol. II, p. 117, o est imprime ce Commentaire.
361 Nityapjpaddhati, p. 80.

groupes. Le Traipura Trikona est pourtant, dans le Mldhra, ce qui constitue la correspondance grossire du
Kmakal, racine (Mla) de tous les Mantra au-dessous
du Sahasrra, et, de plus, correspondance, dans le Jva,
du Tribindu d'Ishvara.
Cependant, avant de traiter en dtail du Sahasrra,
nous invitons le lecteur se reporter au tableau (quelques
pages plus loin) qui rsume quelques-uns des dtails donns ci-dessus, jusqu'au Sahasrra inclusivement.
Dans la description des Chakra telle que la donne le
Shatchakranirpana, il n'est pas fait mention des qualits
et choses (Vritti) morales et autres, qui sont associes aux
Lotus dans d'autres ouvrages, tels que l'Adhytmaviveka362, en commenant par le lotus-racine pour finir
par le Soma Chakra.
C'est ainsi que les Vritti Prashraya, Avishvsa, Avajn,
Mrchh, Sarvansha, Krrat363 sont assignes au Svdhisthna ; Lajj, Pishunat, Irsh, Trishn, Sushupti,
Vishda, Kashya, Moha, Ghrin, Bhaya 364, au Manipra ;
Ash, Chint, Chesht, Mamat, Dambha, Vikalat,
Ahamkra, Viveka, Lolat, Kapatat, Vitarka, Anutpa 365
362 Cit dans le Dipik du v. 7 de la Hamsopanishad.
363 La crdulit, le soupon, le ddain, l'illusion (ou la rpugnance), la fausse

connaissance (littralement : la destruction de toute chose, quoi mne la fausse


connaissance), l'absence de piti.
364 La honte, la trahison, la jalousie, le dsir, l'indolence, la tristesse, la mondani-

t, l'ignorance, l'aversion (ou le dgot), la crainte.


365 L'esprance, le souci ou l'anxit, l'effort, le sens du mien (ayant pour

rsultat l'attachement), l'arrogance ou l'hypocrisie, le sentiment de langueur,


l'gosme ou la vanit, le discernement, la cupidit, la duplicit, l'indcision, le
regret.

l'Anhata ; Krip, Mriduta, Dhairya, Vairgya, Dhriti,


Sampat, Hsya, Romncha, Vinaya, Dhyna, Susthirat,
Gmbhrya, Udyama, Akshobha, Audrya, Ekgrat 366, au
Somachakra secret ; et ainsi de suite.
Dans le Mldhra, qui a t dcrit comme la source
d'une abondante sensation de plaisir , sont les quatre
formes de batitude dj mentionnes ; dans le Vishuddha
les sept tons subtils : Nishda, Rishaba, Gndhra,
Shadja, Madhyama, Dhaivata, Panchama ; certains Bja :
Hum, Phat, Vaushat, Vashat, Svadh, Svh, Namah ;
dans le huitime ptale le venin , et dans le seizime le
nectar367 ; dans les ptales et le pricarpe de l'Ajn les
trois Guna, et dans le second les Bja Ham et Ksham ;
dans le Manas Chakra six ptales au-dessus de l'.Ajn
sont Shabdajnna, Sparshajnna, Rpajnna, Aghrnopalabdhi, Rasopabhoga et Svapna, avec leurs contraires, dsignant les perceptions des sens, oue, toucher, vue, odorat, got, et les sensations, d'origine centrale, du rve et
de l'hallucination.
On explique que des Vritti particulires sont attribues
un lotus particulier en raison d'une relation entre telle
Vritti et l'opration des Shakti du Tattva rgissant le
centre auquel elle est attribue. Qu'elles existent tel
Chakra particulier est prouv, dit-on, par leur disparition
lors de la monte de Kundal travers ce Chakra. Ainsi les
366 La piti, la douceur, la patience ou la srnit, l'impartialit, la constance, la

prosprit, la joie (spirituelle), le ravissement ou l'motion, l'humilit ou le sens


de la convenance, l'humeur mditative, la quitude ou le calme, la gravit (du
maintien), l'entreprise ou l'effort, l'absence d'motion (le fait de n'tre pas troubl par l'motion), la magnanimit, la concentration.
367 Tous deux furent extraits lors du barattement de l'ocan, et, ainsi voqus,

reprsentent les forces destructive et constructive de l'univers.

mauvaises Vritti des Chakra infrieurs disparaissent chez


le Yogi qui fait monter Kundal au-dessus d'eux.
Des qualits (Vritti) morales apparaissent dans certains
des Chakra infrieurs : dans le lotus secret douze ptales qui porte le nom de Lalan (et de Kal dans quelques
Tantra), et qui est situ au-dessus du Vishuddha, la racine du palais (Tlumla), comme aussi dans le lotus
seize ptales situ au-dessus du Manas Chakra, et connu
sous le nom de Soma Chakra.
Il faut remarquer que les Vritti des deux Chakra infrieurs (Svdhishthna et Manipra) sont toutes mauvaises
; celles du centre Anhata sont mlanges 368, celles du Lalan Chakra sont bonnes en majorit, et celles du Soma
Chakra en totalit ; ce qui indique un progrs mesure
que nous avanons des centres infrieurs aux centres suprieurs, et il en doit tre ainsi, le Jva s'approchant de
ses principes suprieurs, ou vivant en eux. Dans le lotus
blanc douze ptales situ dans le pricarpe du Sahasrra est la demeure de Shakti, appele le Kmakal, dj
dcrit.
Entre Ajn et Sahasrra, au sige du Krana Sharra de
Jva, sont les Varnvalirup Viloma Shakti, descendant
d'Unman Bindu. De mme que dans la cration d'Ishvara ou cration cosmique, il y a sept Shakti cratrices, de
Sakala Parameshvara Bindu ; et dans la cration microcosmique ou cration du Jva sept Shakti cratrices, de
Kundalin, qui est dans le Mldhra, Bindu, les deux

368 C'est ainsi qu'avec Dambha (l'arrogance), Lolat (la cupidit), Kapatat (la

duplicit), nous trouvons Ash (l'esprance), Chesht (l'effort), Viveka (la discrimination).

appartenant ce qu'on appelle l'ordre Anuloma369 : de


mme dans la rgion comprise entre l'Ajn Chakra et le
Sahasrra, qui est le sige du corps causal (Krana Sharra) du Jva, il y a sept Shakti370, qui, en commenant par
la plus basse, sont Bindu (qui est en Ishvara Tattva), Bodhin, Nda, Mahnda ou Ndnta (en Sadkhya Tattva),
Vypik, Saman (en Shakti Tattva), et Unman (en Shiva
Tattva).
Bien que ces dernires Shakti aient un aspect crateur
cosmique, elles ne correspondent pas ici aux premires et
prsentent un aspect diffrent. Elles ne leur correspondent pas, parce que les Shakti que nous avons cites en
dernier lieu sont des Shakti du Jva. Hamsa, Jva ou Kundal n'est qu'une partie infinitsimale du Parabindu. Celuici est dans le Sahasrra, le lotus aux mille ptales, demeure d'Ishvara, qui est Shiva-Shakti, et sige de Kundal
dans son ensemble, ou Jva.
C'est pourquoi il est dit que toutes les lettres sont ici
vingt fois (50 x 20 = 1.000). Dans le Sahasrra sont Parabindu, la suprme Nirvna Shakti, Nirvna Kal, Amkal371 et le feu de Nibodhik. Dans le Parabindu est le vide
(Shnya) qui est le suprme Nirguna Shiva.
Une autre diffrence se trouve dans l'aspect des Shakti.
Alors que les Shakti cratrices cosmiques regardent au
dehors et en avant (Unmukh), les Shakti sigeant au369 C'est--dire l'ordre habituel, oppos l'ordre inverse (Viloma). Ainsi, lire

l'alphabet de A Z est Anumola ; le lire rebours, de Z A, est Viloma. Dans le


cas en question, Anuloma est donc l'volution (Shrishti) ou mouvement en avant,
et Viloma (Nivritti) la voie du retour.
370 Voir Garland of Letters, ch. Causal Shaktis of the Pranava .
371 Ibid., ch. Kals of the Shaktis .

dessus de l'Ajn regardent, dans le Yoga, en arrire, vers


la dissolution. L'Ishvara du Sahasrra n'est donc pas
l'aspect crateur d'Ishvara. Il s'y trouve dans l'tat de Nirvna, et les Shakti qui lvent Nirvna Shakti sont
montantes , c'est--dire Shakti libratrices du Jva.
Ces sept tats ou aspects de Bindumayaparashakti372
conduisant Unman, dcrits dans le Shatchakranirpana
et dans d'autres ouvrages tantriques, sont appels formes
causales (Kranarpa). Le Commentaire de la Lalit373 en
numre apparemment huit, mais cela semble d une
erreur, Shakti et Vypik tant regardes comme des
Shakti distinctes au lieu de noms diffrents pour la troisime de cette srie de Shakti.

372 Shatchakranirpana, v. 40.


373 Lalit-Sahasranma, v. 121.

Chakra

Position

Nbre de
ptales

Lettres sur
ces ptales

Tattva matre et
ses qualits

Couleur du
Tattva

Mldhra

Centre spinal
de la rgion
au-dessous
des parties
gnitales

va, sha, sha,


sa

Prithiv, cohsion,
excitant le sens
de l'odorat

Jaune

Svdhishthna

Centre spinal
de la rgion
au-dessus
des parties
gnitales

ha, bha, ma,


ya, ra, la

Ap ; contraction,
excitant le sens
du got

Blanc

10

da, dha, na,


ta, tha, da,
dha, na, p,
pha

Tejas ; expansion,
produisant la
chaleur et excitant le sens de la
vue, des couleurs
et des formes

Rouge

12

ka, kha, ga,


gha, nga,
cha, chha, ja,
jha, nya, ta,
tha

Vyu ; mouvement gnral,


excitant le sens
du toucher

Gris de fume

Aksha ; ouverture de l'espace,


excitant le sens
de l'oue

Blanc

Manas (facults
mentales)

Manipra

Centre spinal
de la rgion
du nombril

Anhata

Centre spinal
de la rgion
du cur

Vishuddha

Centre spinal
de la rgion
de la gorge

16

Les voyelles
a, , i, , u, ,
ri, ri, Iri, lr,
e, ai, o, au,
am, ah

Ajn

Centre de la
rgion entre
les sourcils

ha et ksha

Forme du
Mandala

Bja et son
Vhana
(vhicule)

Devat et
son
Vhana

Carr

Lang sur
llphant

Brahm
sur Hamsa

Croissant

Vang sur
Makara

Vishnu
sur Garuda

Triangle

Rang sur
un blier

Rudra sur
un taureau

Hexagone
six
pointes

Yang sur
une antilope

Cercle

Hang sur
un lphant
blanc

Om

Ish

Sadshiva

Shambhu

Shakti
du
Dhtu

Linga et
Yoni

Autres Tattva qui sy


dissolvent

Dkin

Svayambhu
et Traipura
Trikona

Gandha Tattva ;
lodorat (organe de
sensation ; les pieds
(organe daction)

Rasa Tattva ; le got


(organe de sensation) ; la main (organe daction)

Lkin

Rpa Tattva ; la vue


(organe de sensation) ; lanus (organe
daction)

Kkin

Bna et
Trikona

Sparsha Tattva ; le
toucher (organe de
sensation) ; le pnis
(organe daction)

Shabda Tattva ;
loue (organe de
sensation) ; la
bouche (organe
daction)

Itara et
Trikona

Mahat, la Skshma
Prakriti appele
Hiranyagarbha (Voir
Shatchakranirpana,
v. 52.)

Rkin

Shkin

Hkin

Au-dessous de Visarga (qui est la partie suprieure du


Bralimarandhra, l'emplacement de la fontanelle) et de la
terminaison de Samkhin Nd, est le Suprme Lotus
Blanc (ou, selon certains, diapr) mille ptales374 connu
sous le nom de Sahasrra, et sur lequel sont toutes les
lettres de l'alphabet sanskrit, l'exclusion, selon certains,
de Lakra crbrale, et selon d'autres de Ksha. Ces lettres
sont rptes vingt fois pour faire mille, et se lisent du
commencement la fin (Anuloma), en faisant le tour du
Lotus de droite gauche. L sont Mahvyu et le Chandramandala, dans lequel est le Bindu Suprme (0), qui
est servi en secret par tous les Deva . Bindu implique
Guna, mais il signifie aussi le vide de l'espace, et appliqu
la Lumire Suprme, qui est sans forme, symbolise son
immutabilit.
Le Shnya (Vide) subtil est l'Atm de tout tre (Sarvtm)375. L, dans la rgion du Lotus Suprme, est le Guru, le Suprme Shiva Lui-mme. C'est pourquoi les Shaiva
le nomment Shivasthna, le sjour de batitude o se ralise l'Atm. L, aussi, est la Suprme Nirvna Shakti,
Shakti du Parabindu, et Mre des trois mondes. Celui qui
a vraiment et pleinement connu le Sahasr ne renat point
dans le Samsra, car il a, par cette connaissance, rompu
tous les liens qui l'y attachaient. Son sjour terrestre se
limite la consommation du Karma dj commenc et non
puis. Il est le possesseur de toute Siddhi, il est dlivr
vivant (Jivanmukta), et il atteint la dlivrance sans corps
(Moksha), ou Videha Kaivalya, la dissolution de son
corps physique.
374 Shatchakranirpana, v. 40-49.
375 Shatchakranirpana, v. 42-49.

Dans le quatorzime vers de l'Anandalahar et dans son


commentaire, est dcrite la Dit prsente dans le Sahasrra376.
Elle est au-dessus de tous les Tattva. Chacun des six
centres reprsente un Tattva. Chaque Tattva a un nombre
dtermin de rayons. Les six centres, ou Chakra, se divisent en trois groupes. Chacun de ces groupes a un nud
ou une pointe o convergent les Chakra qui constituent ce
groupe. Les noms de ces groupes sont tirs de ceux des
Dits qui les gouvernent. Le tableau suivant l'indique
clairement :

Nom du
Chakra

Nom
du
Tattva

Nbre de
rayons

Nom du

du
Tattva

groupe

Mldhra

Bh

56

Svdhishthna

Agni

62

Anhata

Apas

54

Manipra

Vyu

52

Vishuddha

Aksha

Ajn

Manas

72
64

Agni

Nom du
point de convergence

Khanda

Surya

Vishnugranthi

Chandra

Brahmagranthi

Rudragranthi

Remarques

Dans le Sahasrra les


rayons sont innombrables,ternels et
illimits dans l'espace.
Il y a ici un autre
Chandra dont les
rayons sont innombrables et resplendissants.

360

Lakshmidhara cite la Tittiryranyaka l'appui de


son commentaire, dont nous avons tir les notes ci376 Voir l'Anandalahari du Pandit R. Ananta Shstr, pp. 42 et suiv. Le passage

cit est tir de cet ouvrage. Voir aussi Avalon, Wave of Bliss.

dessus. Les extraits qu'il donne de Bhairava Ymala


sont d'un grand intrt. Parlant de Chandra, Shiva
s'adresse Prvati, son pouse, en ces termes (Chandrajnnavidyprkarana, v. 1 -17) :
Bienvenue, Beaut des trois mondes, bienvenue est
Ta question. Cette connaissance (que je vais rvler) est le
secret des secrets, et je ne l'ai communique qui que ce
ft jusqu' prsent. (Mais je vais maintenant te dire le
grand secret. coute-moi donc avec attention :)
Shrchakra (dans le Sahasrra) est la forme de Parashakti. Au milieu de ce Chakra est un endroit nomm
Baindava, o Elle, qui est au-dessus de tous les Tattva,
repose unie Son Seigneur Sadshiva. Suprme, l'Univers entier est un Shrchakra form des vingt-cinq Tattva :
5 lments + 5 Tanmtra + 10 Indriya + le Mental + My,
Shuddhavidy Mahesha et Sadshiva377. Tout comme il est
en Sahasrra, cosmiquement aussi Baindava est audessus de tous les Tattva. Dev, cause de la cration, de la
conservation et de la destruction de l'univers, y repose
toujours unie Sadshiva, qui tout aussi bien est audessus de tous les Tattva et toujours resplendissant. Innombrables sont les rayons qui s'chappent du corps de la
Desse ; Bienveillante, ils manent par milliers, par
lakhs, que dis-je ! par crores378.
Sans cette lumire il n'y aurait aucune lumire dans
l'univers... 360 de ces rayons illuminent le monde sous la
forme du Feu, du Soleil et de la Lune. Ces 360 rayons se
rpartissent comme il suit : Agni (le Feu), 118 ; le Soleil,
377 Les Tattva, de My Sadshiva, sont les Shiva Tattva dcrits dans Garland of

Letters.
378 1 lakh = 100.000 ; 1 crore = 10.000.000. (Note du Traducteur).

106 ; la Lune, 136. 0 Shankari, ces trois luminaires clairent le macrocosme aussi bien que le microcosme, et sont
la source du calcul du temps : le Soleil pour le jour, la
Lune pour la nuit, Agni (le Feu) occupant une place intermdiaire entre les deux379 .
Ainsi constituent-ils (ou sont-ils appels) Kla (le
temps), et les 360 jours (ou rayons) forment-ils une anne.
Le Veda dit : L'anne elle-mme est une forme du Seigneur. Le Seigneur du temps, le Crateur du monde, fit
d'abord Marchi (les rayons), etc., les Muni, les protecteurs
du monde. Tout est venu l'existence par le commandement de Parameshvar.
Dindima comprend ce passage d'une manire toute
diffrente. Son interprtation est qu'ayant dj dcrit l'Antaryga (dvotion intrieure), l'auteur recommande ici le
culte des Avarana Devata, c'est--dire des Divinits rsidant en chacun des Chakra ou centres, sans la faveur
desquelles il est impossible au Yogi de faire passer la
Kundalini par ces Chakra. Il numre les 360 Divinits et
dcrit la manire d'adorer chacune d'elles.
Il est d'autres commentateurs qui interprtent sotriquement les 360 rayons, et les associent aux 360 jours de
l'anne, et aussi avec le corps humain. Chaque commentateur cite la Taittiryranyaka, premier chapitre, pour appuyer ses vues. Il semble donc que cette Taittiryranyaka
offre une abondante matire sotrique la mditation du
mystique. Le premier chapitre de l'Aranyaka en question
se rcite en adorant le Soleil. Il porte le nom d'Arunam

379 Voir Wave of Bliss, d. A. Avalon.

parce qu'il traite d'Arun (Dev de couleur rouge)380 .


Un docteur et sanskritisant hindou a exprim l'opinion
qu'on trouve dans les Tantra une meilleure anatomie que
dans les ouvrages purement mdicaux de l'Inde381. Mais il
est plus facile d'exposer les physiologies moderne et ancienne que d'en tablir les correspondances. C'est l, en
vrit, chose malaise pour l'instant. En premier lieu, la
documentation relative la seconde ne nous est pas suffisamment accessible et connue, et ceux des savants et
Sdhaka indignes (probablement peu nombreux de nos
jours) qui connaissent la question ne sont pas familiers
avec la physiologie occidentale, avec laquelle il faudrait la
comparer.
De plus, il est possible d'avoir une connaissance pratique du Yoga tantrique sans tre au courant de ses correspondances physiologiques. uvrant dans un domaine
inexplor, je ne peux ici qu'avancer d'aprs le Shatchakranirpana et les renseignements que j'ai recueillis, des explications et des suggestions qui dans certains cas ne doivent prsenter que le caractre d'une hypothse, avec l'espoir que d'autres la poursuivront et la vrifieront.
Il est clair que le Merudanda est la colonne vertbrale,
qui, tant l'axe du corps, est suppose avoir avec lui le
mme rapport que le Mont Meru avec la terre. Il va de Mla (la racine) ou Mldhra jusqu'au cou. Lui et les rgions suprieures qui lui sont associes, bulbe rachidien,
cervelet, etc., contiennent ce qui a t dcrit comme le sys380 Anandalhar du Pandit Ananta Shstri, pp. 42-45.
381 Dr. B.D. Basu, de l'Indian Medical Service, dans son Prize Essay on the Hindu

System of Medicine, publi dans la Guy's Hospital Gazette (1889), et cit dans le
vol. XVI des Sacred Books of the Hindus, par le Prof. Benoy Kumar Sarkar.

tme central des nerfs spinaux (Nd) et des nerfs crniens


(Shiro-nd).
La Sushumn, qui est indubitablement une Nd situe
l'intrieur de la colonne vertbrale, et comme telle est
bien dcrite dans les livres comme la principale de toutes
les Nd, suit sur toute sa longueur le Merudanda, comme
la moelle pinire de la physiologie occidentale, si nous y
comprenons le filum terminale.
Si nous y comprenons le filum, et plaons le Kanda
entre l'anus et le pnis, elle part pratiquement de la mme
rgion (sacro-coccygienne), le Mldhra, et il est dit
qu'elle va jusqu' la rgion du Brahmarandhra382, ou jusqu' un point situ au-dessous du lotus douze ptales383, c'est--dire au-dessous du Sahasrra, mais dans
son voisinage, autrement dit au cervelet, o se termine
galement le nerf Chitrin. La position du Kanda est celle
qu'indique le Shatchakranirpana384.
Il faut pourtant remarquer que, d'aprs le Hathayogapradpik, le Kanda se place plus haut, entre le pnis et le
nombril385. Le lieu de runion de Sushumn et de Kanda
est connu sous le nom de nud (Granthisthna), et les
ptales du lotus Mla l'entourent de quatre cts 386.
C'est dans la Sushumn (de quelque manire que nous
l'identifions pour le moment) que se trouvent les centres
382 Sammohana Tantra, II, 7 ; ou, selon le Tripursrasamuchchaya, cit au v. I

du Shatchakranirpana, de la tte l'Adhra.


383 Shatchakranirpana, v. 1.
384 Ibid.
385 Voir plus loin.
386 Shatchakranirpana, v. 4.

de Prna Shakti, la puissance vitale, centres appels Chakra ou Lotus. La moelle pinire se termine brusquement
dans le filum terminale, et semble s'y fermer.
Or il est dit que la Sushumn est ferme sa base, appele la porte de Brahman (Brahmadvra), jusqu' ce
que, par le Yoga, Kundal s'y fraie passage. Le plus haut
des six centres ou Chakra de la Sushumn est l'Ajn, position qui correspond, vers l'avant, l'espace entre les
sourcils (Bhrmadhya), et vers l'arrire la glande pinale, ou corps pituitaire, et au sommet du cervelet. Tout
prs se trouve le Chakra nomm Lalan, et dans quelques
Tantra Kal Chakra, qui est situ la racine du palais
(Tlumla), c'est--dire immdiatement au-dessus. Sa position, comme aussi la nature de l'Ajn, indiqueraient qu'il
est lgrement au-dessous de ce dernier387. La Sushumn
pntre dans les ventricules du cerveau, comme le fait la
moelle pinire, qui pntre dans le quatrime ventricule.
Au-dessus du Lalan sont l'Ajn Chakra, deux lobes,
et le Manas Chakra, six lobes, dont on a suggr qu'ils
sont reprsents dans le corps physique par le cervelet et
le sensorium. Au-dessus, le Soma Chakra, seize ptales , comprend, a-t-on dit, les centres du milieu du cerveau, au-dessus du sensorium. Enfin Sahasrra, le lotus
aux mille ptales, correspond au sommet du cerveau du
corps physique, avec ses circonvolutions corticales,
comme l'indiquera au lecteur un examen de la planche
VIII qui figure ce centre.
387 Et non, comme je l'ai crit dans l'Introduction de la premire dition du Ma-

hnirvna Tantra, p. LXII, au-dessus. Tout bien considr, je crois que la position
indique dans le Shatchakranirpana est correcte, bien qu'en tout cas les deux
soient trs proches.

De mme que tous les pouvoirs existent au sige de l'action volontaire, de mme il est dit que les cinquante
lettres qui sont rparties dans tous les centres spinaux
de la Sushumn existent l multiplies, soit au nombre de
50 x 20. La lune aux rayons de nectar388 est peut-tre la
partie infrieure du cerveau, dont les circonvolutions ou
lobes, en forme de demi-lunes, portent le nom de Chandrakal, et le mont mystique Kailsa est sans aucun doute
le sommet du cerveau. Le ventricule reli la moelle pinire a aussi la forme d'une demi-lune.
Comme je l'ai dit plus haut, il ne fait aucun doute que
la Sushumn soit situe dans la colonne vertbrale, mais
il a t dit qu'elle reprsente le canal central. Il est probable que sa position est dans l'ensemble celle du canal
central. Mais on peut se demander si cela signifie que le
canal seul est la Sushumn. Car cette Nd, d'aprs le
Shatchakranirpana, en contient deux autres, Vajrin et
Chitrini. Il existe donc trois lments.
On a suppos que la Sushumn, considre non comme
formant avec ses Nd intrieures une unit collective,
mais comme distincte d'elles, est la matire nerveuse
blanche de la moelle pinire, Vajrin tant la matire grise
et Chitrin le canal central, dont la Nd intrieure porte le
nom de Brahmand, et, dans la Shivasamhit, de Brahmarandhra389.
Mais il faut remarquer que, contrairement cette hypothse, le v. 2 du Shatchakranirpana dcrit Chitrin
comme tant aussi fine qu'un fil d'araigne (Lt-tantpa388 Voir Shiva-Samhit, II, 6.
389 Ch. II, v. 18.

mey), et la matire grise ne peut tre ainsi dcrite, tant


chose grossire. Nous devons donc rejeter cette hypothse,
et estimer soit que le canal central est la Sushumn, soit
que cette dernire est dans le canal, et qu' l'intrieur, ou
en faisant partie, sont deux canaux d'nergie encore plus
subtils et imperceptibles, nomms Vajrin et Chitrin. Je
penche pour la seconde interprtation.
Le v. 3 du Shatchakranirpana dit que la vritable nature de la Chitrin Nd est pure intelligence (Shuddhabodha-svabhv), force de la Conscience. Comme le dit le
v. 1, les trois ne font qu'une, mais peuvent tre considres sparment comme distinctes. Elles sont trois en ce
sens que Sushumn, qui est tremblante comme une
femme mue , est un ensemble compos de Soleil , de
Lune et de Feu , et des trois Guna.
II est remarquable cet gard que la Kshurik Upanishad390, qui parle de la Sushumn, prescrit au Sdhaka
d'entrer dans la Nd blanche et trs subtile, et d'y conduire Prnavyu . Ces trois Nd, Sushumn, Vajrin et
Chitrin, et le canal central, ou Brahmand, par lesquels,
dans le Yoga ici dcrit, passe Kundalin, font tous partie,
en tout cas, de la moelle pinire. Et, comme le disent la
Shivasamhit et tous les autres ouvrages sur le Yoga, le
reste du corps dpend de la Sushumn, celle-ci tant le
principal reprsentant spinal du systme nerveux central.
Il semble aussi exister quelque raison de penser que les
Nd Id et Pingal, la lune et le soleil , sont les cordons sympathiques gauche et droit situs de part et
390 Ed. Anandshrama Series, XXIX, p. 145. Prna ne dsigne pas ici le souffle

grossier, mais ce qui dans les centres respiratoires apparat comme tel, et apparat sous d'autres formes dans d'autres fonctions et parties du corps.

d'autre de la brlante Sushumn. Il faut noter que,


conformment une ide commune que reprend le Shatchakranirpana, ces Nd, qui sont dcrites comme tant
respectivement ple et vermeille (v. 1), ne suivent pas simplement le parcours de la moelle, mais le traversent alternativement d'un ct l'autre (v. 1), formant ainsi avec la
Sushumn et les deux ptales de l'Ajn Chakra la figure
du Caduce de Mercure, qui selon certains en est une reprsentation.
Ailleurs (v. 1), cependant, il est dit qu'elles sont en
forme d'arcs. Autrement dit, l'une est runie la Sushumn et relie au ct gauche du scrotum. Elle monte
vers un point situ prs de l'paule gauche, en se recourbant la hauteur du cur, traverse vers l'paule droite, et
gagne ensuite la narine droite. De la mme manire,
l'autre Nd relie au ct droit du scrotum gagne la narine gauche.
On a exprim devant moi l'hypothse qu'Id et Pingal
seraient des vaisseaux sanguins reprsentant la veine
cave infrieure et l'aorte. Mais les textes et le processus
mme du Yoga n'indiquent pas des artres, mais des
nerfs. Id et Pingal, en atteignant l'espace entre les sourcils, forment, entrecroises avec la Sushumn, un triple
nud appel Triven, et continuent leur parcours vers les
narines. On a dit que c'est l le point de la moelle o les
cordons sympathiques se runissent, ou leur point de dpart.
Il reste considrer la position des Chakra. Bien que le
Shatchakranirpana parle de six, il en existe d'autres selon certains auteurs. C'est ce que dclare Vishvantha
dans sa Shatchakra-Vivriti. Nous avons ainsi mentionn
les Chakra Lalan, Manas et Soma. Les six donns par le

Shatchakranirpana sont les principaux. En vrit, il


existe une trs longue liste de Chakra ou d'Adhra,
comme les appellent certains.
Dans un ouvrage sanskrit moderne intitul Advaitamrtanda, l'auteur391 en donne vingt, qu'il numre
comme suit :
1. Adhra ;
2. Kuladpa ;
3. Vajra ou Yajna ;
4. Svdhishthna ;
5. Raudra ;
6. Karla ;
7. Gahvara ;
8. Vidyprada ;
9. Trimukha ;
10. Tripada ;
11. Kladandaka ;
12. Ukra ;
13. Kladvra ;
14. Karamgaka ;
15. Dpaka ;
16. Anandalalit ;
17. Manipraka ;
18. Nkula ;
391 Brahmnanda Swmi, n Palghat, dans la Prsidence de Madras, dfunt

Guru de S.A. le dfunt Maharaja de Cachemire. L'ouvrage est imprim Jummoo.

19. Klabhedana ;
20. Mahotsha.
Ensuite, sans raison apparente, beaucoup d'autres sont
donns sans numro, circonstance qui, jointe l'impression dfectueuse, rend difficile de dire dans certains cas si
le sanskrit doit se lire en un seul mot ou en deux392.
Ce sont, semble-t-il, Parama, Pdukam, Padam (ou
Pdakampadam), Kalpajla, Poshaka, Lolama, Ndvarta,
Triputa, Kamnklaka, Putabhedana, Mahgranthivirk,
Bandhajvalana (imprim Bandhejvalana), Anhata, Yantraputa (imprim Yatra), Vyomachakra, Bodhana, Dhruva,
Kalkandalaka, Kraunchbherundavibhava, Dmara, Kulakolthala, Hlavarta, Mahadbhaya, Ghorbhairava, Vishuddhi, Kantham, Uttamam (peut-tre Vishuddhikantham
ou Kanthamuttamam), Prnakam, Ajn, Kkaputtam,
Shringtam, Kmarpa, Prnagiri, Mahvyoma, Shaktirpa.
Mais, comme le dit l'auteur, dans les Veda (c'est--dire
dans la Yogachdaman, la Yogashikha et autres Upanishad) il est question de six Chakra seulement, ceux imprims en italiques dans la liste ci-dessus, et dcrits dans le
Shatchakranirpana et le Pnuk-Panchak ; c'est pourquoi il est dit : Comment peut-il exister de Siddhi pour
un homme qui ne connat point les six Adhv, les seize
392 Je ne suis pas sr que lauteur lui-mme l'ait su dans tous les cas. Il se peut

qu'il ait lui-mme reproduit des listes sans autre connaissance de la question. La
liste, selon moi, rvle certains gards un manque de sens critique ; par
exemple, en dehors des remarques entre parenthses dans le texte, Kmarpa et
Prnagiri sont des Ptha, les autres, Jlandhara et Auddyna, n'tant pas mentionns. La dernire citation qu'il fait tablit une distinction entre les Chakra et
les Adhra.

Adhra, les trois Linga et les cinq (lments) dont le premier est l'ther ?)393.
J'ai dj indiqu que les positions des Chakra correspondent en gnral des centres spinaux des divisions
anatomiques des vertbres constituant cinq rgions, et j'ai
dit que les Padma ou Chakra correspondaient divers
plexus qui existent dans le corps autour de ces rgions.
Diverses hypothses ont t mises ce sujet.
L'auteur de l'ouvrage cit 394 identifie les Chakra (en
commenant par le Mldhra) avec les plexus sacr,
prostatique, pigastrique, cardiaque, laryng (ou pharyng) et caverneux, et le Sahasrra avec la moelle. On peut
noter au passage que la dernire hypothse en tout cas ne
peut tre correcte. Elle est apparemment base sur le v.
120 du chapitre V de la Shiva Samhit395. Mais cet ouvrage
mon avis ne la justifie pas.
Ailleurs, l'auteur cit identifie avec raison le mont Kailsa avec le Sahasrra, qui est sans aucun doute le som393 Les six Adhv sont Varna, Pada, Kal, Tattva, Bhuvana et Mantra. Les seize

Adhra sont, d'aprs le commentaire du v. 33 du Shatchakranirpana : Mldhra, Svdhishthna, Manipra, Anhata, Vishuddha, Ajn-chakra, Bindu, Kalpada,
Nibhodhika, Arddhendu, Nda, Ndnta, Unman, Vishnu-vaktra, Dhruvamandala
et Shiva. Les lments sont aussi dcrits dans ce texte. Les trois Linga sont
Svayambhu, Vn et Itara, dont traite galement le mme texte.
394 The Positive Background of Hindu Sociology, par le Professeur Benoy Kumar

Sarkar.

395 P. 54 de la traduction de Srsha Chandra Vasu, laquelle je me rfre la

suite de l'auteur. Cette version, pourtant, ne rend pas fidlement le texte, et


prend des liberts avec lui. C'est ainsi qu'une partie importante en a t omise
sans un mot d'avertissement, et qu' la p. 14 il est dit que Kundalin est sous
forme d'lectricit . Rien dans le texte n'autorise cette expression, et Kundalin
n'est pas, d'aprs le Shstra, que de l'lectricit.

met du cerveau. La position anatomique de la moelle est


plus basse que celle assigne l'Ajn Chakra.
L'ouvrage du Professeur Sarkar contient d'intressants
appendices dus au Docteur Brojendranath Seal, en particulier sur les ides hindoues relatives la vie vgtale et
animale, la physiologie et la biologie, avec des descriptions du systme nerveux selon Charaka et les Tantra 396.
Aprs avoir indiqu que l'axe crbro-spinal, avec le systme sympathique qui lui est associ, contient un certain
nombre de centres et de plexus ganglionnaires (Chakra,
Padma), partir desquels des nerfs (Nd, Shir et Dhaman) s'irradient travers la tte, le tronc et les membres,
le Docteur crit, au sujet des centres et plexus ganglionnaires existant dans le systme spinal sympathique :
En commenant par l'extrmit infrieure, les centres
et plexus des systmes associs, spinal et sympathique,
peuvent tre dcrits comme suit :
1. L'Adhra Chakra, le plexus sacro-coccygien
quatre branches, neuf anguli (environ seize centimtres)
au-dessous du plexus solaire (Kanda, Brahmagranthi) ;
source abondante de sensations agrables ; fortes sensations organiques de repos. Trois centimtres et demi audessus, et une distance gale au-dessous du membre
viril (Mehana), est un centre mineur appel l'Agni-sikh.
2. Le Svdhishthna Chakra, le plexus sacr, six
396 L'ouvrage du Professeur Sarkar et les appendices du Docteur Seal ont beau-

coup de valeur et d'intrt, et rassemblent un nombre considrable de faits importants concernant la gographie, l'ethnologie, la minralogie, la zoologie, la
botanique de l'Inde, ainsi que la physiologie, la mcanique et l'acoustique hindoues. Ces appendices ont t par la suite rdits part sous le titre : Positive
Sciences of the Hindus.

branches (Dalni, ou ptales), ayant part l'excitation des


sentiments sexuels, avec accompagnement de lassitude,
de stupeur, de cruaut, de soupon, de mpris 397.
3. Le Nbhikanda (correspondant au plexus solaire,
Bhnubhavanam), qui forme la grande jonction des
chanes sympathiques droite et gauche (Pingal et Id)
avec l'axe crbro-spinal. Reli lui est le Manipraka, le
plexus lombaire, avec les nerfs sympathiques connexes,
dont les dix branches398 sont associes la production du
sommeil et de la soif, et l'expression de passions telles
que la jalousie, la honte, la peur, la stupfaction.
4. L'Anhata Chakra, peut-tre le plexus cardiaque de
la chane sympathique, douze branches, reli au cur,
sige des sentiments gostes, esprance, anxit, doute,
remords, vanit, gosme, etc.
5. Le Bhratsthna399, jonction de la moelle pinire
avec la medulla oblongata, qui, au moyen de nerfs comme
le pneumogastrique, etc., commande au larynx et aux
autres organes de l'articulation.
6. Le Lalan Chakra, en face de la luette, ayant douze
ptales (ou lobes), rgion que l'on suppose associe la
production des sentiments et des affections go-altruistes,
comme l'amour-propre, l'orgueil, l'affection, le chagrin, le
regret, le respect, la vnration, le contentement, etc.
7. La rgion sensorio-motrice, comprenant deux Chakra
397 Ces Vritti (tel est leur nom) sont numres avec d'autres dans l'introduction

de la premire dition du Mahnirvna Tantra en traduction.


398 C'est--dire ptales.

399 C'est un nom du Vishuddha Chakra en tant que demeure de la Desse du

Langage (Bhrat).

: a) Chakra (litt., le cercle de commande des mouvements)


avec ses deux lobes (le cervelet) ; b) le Manas Chakra, le
sensorium, avec ses six lobes (cinq sensoria spciaux pour
les sensations d'origine priphrique, et un sensorium
commun pour les sensations d'origine centrale, comme
dans les rves et les hallucinations). Les Ajnvah Nd,
nerfs effrents ou moteurs, communiquent les impulsions
motrices la priphrie partir de l'Ajn Chakra, centre
de commande des mouvements ; et les nerfs affrents ou
sensoriels des sens particuliers, par paires, la Gandhavah Nd (sensorium olfactif), la Rpavah Nd (optique),
la Shabdavah Nd (auditive), la Rasavah Nd (gustative), et la Sparshavah Nd (tactile), arrivent de la priphrie (des organes priphriques des sens particuliers)
au Manaschakra, rgion sensorielle situe la base du
cerveau. Le Manaschakra reoit aussi la Manovah Nd,
nom gnrique des canaux le long desquels des sensations
d'origine centrale (comme dans le rve ou l'hallucination)
arrivent au sixime lobe du Manas Chakra.
8. Le Soma Chakra, ganglion seize lobes, comprenant
les centres du milieu du cerveau, au-dessus du sensorium
; sige des sentiments altruistes et du contrle de la volont : la compassion, la douceur, la patience, le renoncement, le caractre mditatif, la gravit, le srieux, la rsolution, la dtermination, la magnanimit, etc.
9. Le Sahasrra Chakra, aux mille lobes, le sommet du
cerveau avec ses lobes et ses circonvolutions, sige suprieur et spcial du Jva, l'me400 .
400 L'auteur cit se rfre au Jnna Samkalin Tantra, au Samhitratnkara, et

pour les fonctions de l'Ajnvah Nd et de la Manovah Nd l'Upaskra de


Shankara Mishra.

Puis, traitant de l'axe crbro-spinal et du cur, et de


leurs relations respectives avec la vie consciente, l'auteur
crit :
Vijnnabhikshu, dans le passage qui vient d'tre cit,
identifie la Manovah Nd (vhicule de la conscience) avec
l'axe crbro-spinal et ses ramifications, et compare la figure qu'ils forment une courge renverse avec une tige
pendante mille rameaux. La Sushumn, passage central
de la moelle pinire, est la tige de cette courge (ou l'un
des rameaux). Les auteurs qui traitent du Yoga (y compris
ceux des divers systmes tantriques) font de ce terme un
emploi quelque peu diffrent. Pour eux, la Manovah Nd
est le canal de communication du Jva (l'me) avec le Manas Chakra (le sensorium) la base du cerveau. Les courants sensoriels sont amens aux ganglions sensoriels par
les nerfs affrents des sens particuliers.
Mais cela ne suffit pas les amener au niveau de la
conscience discriminative. Il faut maintenant qu'une
communication s'tablisse entre le Jva (dans le Sahasrra
Chakra, sommet du cerveau) et les courants sensoriels
reus au sensorium, et cela s'effectue au moyen de la Manovah Nd. Quand les sensations sont d'origine centrale,
comme dans les rves et les hallucinations, une Nd spciale (Svapnavah Nd), qui semble n'tre qu'un rameau
de la Manovah Nd, sert de conduit de communication
du Jva (l'me) au sensorium.
De la mme manire, l'Ajnvah Nd porte les messages de l'me du Sahasrra (sommet du cerveau) l'Ajn
Chakra (rgion motrice la base du cerveau), messages
qui de l sont transmis plus bas, le long des nerfs effrents, aux diverses portions de la priphrie. Je peux
ajouter que les nerfs sensoriels spciaux, avec la Manova-

h Nd, portent parfois le nom gnral (le Jnnavah Nd (litt., canal de la connaissance perceptive). Il n'y a jusqu'ici aucune difficult.
La Manovah et l'Ajnvah Nd mettent en communication la rgion sensorio-motrice de la base du cerveau
(Manas Chakra et Ajn Chakra) avec le sige suprieur (et
spcial) de l'me (Jva) au sommet du cerveau (Sahasrra),
l'une servant de canal pour porter vers le haut les messages sensoriels et l'autre pour porter vers le bas les messages moteurs. Mais les efforts de la volont (Ajn, Prayatna) sont des perceptions conscientes, et la Manovah Nd
doit donc collaborer avec l'Ajnvah pour produire la
conscience de l'effort. En vrit, l'attention, fonction caractristique de Manas, par laquelle il lve les perceptions
des sens au niveau de la conscience discriminative, implique effort (Prayatna) de la part de l'me (Atm, Jva),
effort dont nous sommes conscients par l'intermdiaire de
la Manovah Nd. Mais comment expliquer la perception
d'effort dans les nerfs moteurs ?
Shankara Mishra, auteur de l'Upaskra sur les Stra de
Kanda, soutient que les Nd (mme les nerfs volitifs ou
moteurs) sont elles-mmes sensibles, et que leurs sensations sont conduites au sensorium par le moyen des nerfs
du sens (interne) du toucher (qui leur sont entremles en
trs menues fibrilles). Ainsi la conscience de l'effort, dans
n'importe quel nerf moteur, que ce soit Ajnvah (moteur
volitif) ou Prnavah (moteur automatique), dpend des
nerfs tactiles (ou nerfs de sensation organique) qui sont
mls lui.
Par exemple, l'assimilation de la nourriture et de la
boisson par l'activit automatique des Prna implique un
effort (Prayatna) (automatique) accompagn d'une vague

conscience organique, qui est due au fait que de menues


fibres du sens interne du toucher sont entremles la
machinerie des nerfs automatiques (les Prnavah Nd).
Ces localisations sont dans une certaine mesure hypothtiques. Par exemple, que le centre de la gorge corresponde la carotide, au larynx ou au pharynx, ou tous
trois ; que le centre du nombril corresponde au plexus
pigastrique, solaire ou lombaire, lAjn au plexus caverneux, la glande pinale, la pituite, au cervelet, et ainsi
de suite, c'est l forcment une question d'opinion personnelle. Rien ne s'oppose, dans l'tat de nos connaissances, ce que chaque centre puisse avoir plus d'une
correspondance de cette espce.
Tout ce qu'on peut dire avec quelque certitude, c'est que
les quatre centres situs au-dessus du Mldhra, qui est
le sige de l'nergie directrice, sont en relation avec les
fonctions gnito-excrtrices, digestives, cardiaques et respiratoires, tandis que les deux centres suprieurs (Ajn et
Sahasrra) dnotent diverses formes d'activit crbrale,
qui trouvent leur achvement dans le Repos de la Conscience pure. L'incertitude qui rgne au sujet de certaines
de ces questions est indique dans le texte mme d'un ouvrage comme le Shatchakranirpana, qui montre que sur
plusieurs des sujets ici discuts on a exprim des opinions
diffrentes, interprtations individuelles des exposs qu'on
peut lire dans les Tantra et dans les autres Shstra.
Il y a cependant, si je les lis correctement, des affirmations dans les exposs ci-dessus qui, pour assez communment acceptes qu'elles soient, n'ont point mon accord.
Il est dit, par exemple, que l'Adhra Chakra est le plexus
sacrococcygien, que le Svdhishthna est le plexus sacr,
et ainsi de suite. Or, le Shatchakranirpana, pour ne citer

que cet ouvrage, indique clairement que les Chakra sont


dans la Sushumn. Le v. 1 parle des Lotus qui sont
l'intrieur du Meru (la colonne vertbrale) ; et comme la
Sushumn les porte (les lotus), il faut ncessairement
qu'Elle soit l'intrieur du Meru .
Cela est dit en rponse ceux qui, se basant sur un
passage du Tantrachdmani, supposent tort que Sushumn est l'intrieur du Meru. Le Commentateur rfute
de mme l'erreur de ceux qui, se basant sur le Nigamatattvasra, supposent que non seulement Sushumn, mais
Id et Pingal, sont l'intrieur du Meru.
Le v. 2 dit qu' l'intrieur de Vajr (qui est elle-mme
l'intrieur de Sushumn) est Chitrin, sur laquelle les lotus sont enfils comme des gemmes, et qui, pareille un
fil d'araigne, perce tous les lotus qui sont l'intrieur de
la colonne vertbrale. Dans le mme passage, l'auteur
combat l'opinion, base sur le Kalpa Stra, que les lotus
sont l'intrieur de Chitrin. Ces lotus sont dans la Sushumn ; et Chitrin se trouvant l'intrieur de celle-ci, elle
les perce mais ne les contient pas.
L'affirmation du v. 51, que les lotus sont dans ou sur la
Brahmand, cre quelque incertitude. Mais il veut dire
par l qu'ils se rattachent cette Nd, car ils sont dans
Sushumn, dont la Brahmand est le canal central.
Le commentateur Vishvantha, citant le My Tantra,
dit que les six lotus sont attachs la Chitrin-Nd (Chitrin-grathitam). Une conclusion se dgage clairement de
tout cela, savoir que les Lotus sont dans la colonne vertbrale et dans Sushumn, et non dans les plexus nerveux
qui l'entourent. C'est l, dans la colonne vertbrale, qu'ils
existent comme des centres vitaux, extrmement subtils,

de Prnashakti et comme des centres de conscience.


Je peux citer cet gard l'extrait d'un article sur les Erreurs physiques de l'Hindouisme401, que j'emprunte l'ouvrage du Professeur Sarkar : Cela, en vrit, exciterait la
surprise de nos lecteurs d'apprendre que les Hindous, qui
ne voudraient pas mme toucher un cadavre, plus forte
raison le dissquer, possdent des connaissances anatomiques... Ce sont les Tantra qui nous fournissent
quelques renseignements extraordinaires concernant le
corps humain... Mais de tous les Shstra hindous existants, les Tantra sont les plus obscurs... La thorie tantrique, sur laquelle est fond le Yoga bien connu qui porte
le nom de Shatchakrabheda , suppose l'existence de six
organes internes principaux, appels Chakra ou Padma,
ayant tous une ressemblance particulire avec cette fleur
clbre, le lotus. Ils sont placs les uns au-dessus des
autres, et relis par trois chanes imaginaires, emblmes
du Gange, de la Yamun et de la Saraswat...
Telle est l'obstination des Hindous s'attacher ces
ides errones, que mme quand nous leur montrons par
la dissection matrielle l'inexistence des imaginaires Chakra dans le corps humain, ils prfreront recourir des
prtextes qui rvoltent le sens commun, plutt que d'admettre le tmoignage de leurs propres sens. Ils disent,
avec une impudence sans gale, que ces Padma existent
tant qu'un homme est vivant, mais qu'ils disparaissent
l'instant de sa mort . Cela, pourtant, n'est pas tout fait
exact, car il ne peut exister dans un corps de centres
conscients et vitaux, quand meurt l'organisme dont ils assuraient la cohsion. Une conclusion contraire pourrait,
401 Publi dans la Calcutta Review, vol. XI, pp. 436-440.

en vrit, tre qualifie d' impudente stupidit402.


L'auteur de l'ouvrage dont cette citation est tire dit
que, bien que ces Chakra ne puissent tre identifis de
manire satisfaisante, les tantristes doivent cependant
avoir acquis la connaissance qu'ils en ont par la dissection. Il doit faire allusion aux rgions physiologiques qui
sur le plan grossier correspondent aux Chakra proprement dits, et sont gouvernes par eux ; ces Chakra,
centres subtils, vitaux et conscients de la moelle pinire,
sont invisibles tous sauf au Yogi403, existant lorsque le
corps est en vie et disparaissant lorsque la vitalit (Prna)
abandonne le corps comme une portion du Lingasharra.
C'est donc une erreur, mon avis, d'identifier les Chakra avec les plexus physiologiques qui ont t mentionns.
Ces derniers appartiennent au corps grossier, tandis que
les Chakra sont des centres vitaux extrmement subtils,
ayant diverses fonctions tttviques. En un sens, nous
pouvons associer ces centres subtils les parties organiques grossires, visibles nos yeux, telles que les plexus
et les ganglions. Mais associer et identifier sont choses
diffrentes. La pense indienne et la langue sanskrite, qui
en est l'expression, ont un caractre particulier de pntration et de comprhension qui permet d'expliquer bien
des ides pour lesquelles, sauf par paraphrase, il n'existe
pas d'quivalent en langage occidental.
402 Cela rappelle l'histoire du docteur matrialiste qui disait avoir examin des

centaines de cadavres, mais n'avoir jamais encore trouv trace d'une me.
403 Il est dit : Tni vastni tanmtrdni pratyakshavishayni (Des choses telles

que les Tanmtra ne sont objet de perception immdiate que pour les Yogi). Un
Yogi voit les Chakra avec son il mental (Ajn). Pour les autres, ils ne peuvent tre qu'infrs (Anumna).

C'est par la Puissance, ou Shakti, de l'Atm, ou Conscience, que le corps existe. C'est le Prna collectif qui en
assure la cohsion en tant qu'unit humaine individuelle,
tout comme il soutient les diffrents Principes et lments
(Tattva) dont il est compos. Ces Tattva, quoique prsents
dans le corps entier, ont pourtant divers centres fonctionnels spciaux. Ces centres, comme on pouvait le supposer,
sont disposs le long de l'axe vertbral, et sont les
Skshma Rpa, formes subtiles de ce qui existe sous
forme grossire (Sthla Rpa) dans le corps physique qui
s'est organis autour. Ils sont des manifestations de Prnashakti, la Force Vitale.
En d'autres termes, d'un point de vue objectif, les
centres subtils, ou Chakra, animent et gouvernent les rgions physiologiques grossires dtermines par les diffrentes rgions de la colonne vertbrale, et par les ganglions, plexus, nerfs, artres et organes respectivement
situs dans ces rgions. C'est donc seulement, la rigueur, en ce sens qu'ils sont les correspondances extrieures grossires des centres spinaux, que nous pouvons
associer les plexus et autres lments physiologiques aux
Chakra dont il est question dans les livres sur le Yoga.
C'est en ce sens seulement que toute la rgion qui
s'tend du centre subtil la priphrie, avec ses lments
corporels correspondants, peut tre regarde comme le
Chakra. Le grossier et le subtil tant ainsi associs, toute
opration mentale exerce sur l'un affectera l'autre. Certaines forces sont concentres dans ces Chakra ; c'est
pour cette raison, et en raison de leur fonction, qu'ils sont
considrs comme des centres spars et indpendants.
Il existe ainsi six centres subtils dans la moelle, ayant
des manifestations grossires l'intrieur mme de la

moelle, et des enveloppes plus grossires encore dans la


rgion parcourue par les sympathiques Id et Pingal, et
les autres Nd. C'est partir de cet ensemble et des lments composs grossiers du corps physique que s'organisent les organes de la vie, dont le cur vital est le Chakra subtil qui les vivifie et les gouverne. Les aspects subtils des six centres selon la doctrine tantrique ne doivent
pas tre ngligs au profit de l'aspect grossier ou physiologique du corps.
Comme on l'a expliqu plus haut, d'aprs le Commentaire du trente-cinquime vers de l'Anandalahar, il y a six
Deva : Shambhu, Sadshiva, Ishvara, Vishnu, Rudra,
Brahm, dont les demeures sont les six Loka ou rgions :
Maharloka, Tapoloka, Janaloka, Svarloka, Bhuvarloka et
Bhrloka (la Terre). Ce sont ces Divinits qui sont les
formes de Conscience gouvernant les Shatchakra. Autrement dit, la Conscience (Chit), principe ultime d'exprience, est la base et dans l'ensemble de tout tre.
Chaque cellule du corps a une conscience propre. Les diverses parties organiques du corps difi par les cellules
n'ont pas seulement une conscience cellulaire particulire,
mais la conscience de la partie organique particulire qui
est autre que la simple collectivit de la conscience de ses
units constitutives. C'est ainsi qu'il peut exister une
conscience abdominale. Et la conscience d'une rgion corporelle de cette espce est sa Devat, c'est--dire l'aspect
de Chit qui est associ cette rgion et qui l'organise.
Enfin, l'organisme, comme tout, a sa conscience, qui est
le Jva individuel. Ensuite, il y a la forme subtile, ou corps
subtil, de ces Devat, sous forme de Mental, ou matire
supra-sensible (Tanmtra), et la matire sensible :
ther, air, feu, eau, terre, ayant leurs centres dans l'Ajn,

le Vishuddha, l'Anhata, le Manipra, le Svdhishthna et


le Mldhra. De ces six Tattva est compos, non seulement le corps humain grossier, mais le vaste macrocosme.
Les six Chakra sont donc les centres subtils et divins
des enveloppes physiques et psychiques correspondantes.
Le septime ou suprme centre de Conscience est Paramashiva, dont la demeure est Satyaloka, aspect cosmique
du Sahasrra de notre corps humain.
Le Suprme descend donc dans ses manifestations du
subtil au grossier sous la forme des six Deva et des six
Shakti dans leurs six demeures le long de l'axe du monde,
et sous la forme des six centres de l'axe du corps ou colonne vertbrale. La fonction spciale de chacun des Tattva est situe dans son centre individuel du microcosme.
Mais, malgr toutes ces transformations subtiles et
grossires effectues dans Kula-Kundalin, et par Elle, Elle
demeure constamment, dans Son aspect de Brahman ou
de Svarpa, l'Unique, Sat, Chit et Ananda, et Elle est ralise par le Yogi lorsqu'attirant la Dev hors de Sa demeure
cosmique dans le centre terrestre (Mldhra), il l'unit
Paramashiva dans le Sahasrra, en cette union bienheureuse qui est l'Amour Suprme (Ananda).
Il resterait considrer encore d'autres affirmations relatives ces Chakra ; celles, par exemple, concernant
l'existence des ptales , dont on a dit que le nombre tait
dtermin dans chaque cas par les caractristiques de la
rgion grossire que gouverne le Chakra particulirement
envisag. Il est dit que les centres sont composs de ptales dsigns par certaines lettres.

Le Professeur Sarkar404 exprime l'opinion que ces ptales reprsentent soit les nerfs qui vont former un ganglion ou un plexus, soit les nerfs distribus partir de ce
ganglion ou de ce plexus. On m'a dit que la disposition des
Nd au Chakra particulier en question dtermine le
nombre de ses ptales405.
Dans les cinq Chakra infrieurs leurs caractristiques
sont exposes par le nombre et la position des Nd ou par
les lobes et les zones sensorielles et motrices des parties
suprieures du systme crbro-spinal. Comme je l'ai dj
expliqu, le Chakra ne doit pas tre identifi avec les ganglions et les plexus physiques, bien qu'il leur soit associ
et soit reprsent par eux sur le plan grossier. Les lotus
avec leurs ptales sont l'intrieur de la Sushumn, o
on se les reprsente fleurissant au passage de Kundal.
Les lettres sont sur les ptales.
Les lettres des six Chakra sont au nombre de cinquante
: les lettres de l'alphabet sanskrit moins Ksha, suivant le
Kamklamlin Tantra406, ou le deuxime L ou La crbral407. Toutes ces lettres, multiplies par 20, existent en
puissance dans le Sahasrra, o elles sont donc au
nombre de 1.000, d'o le nom de ce Lotus.
Il y a, d'autre part, 72.000 Nd qui partent du Kanda.
De plus, le fait que ces lettres des Chakra ne sont pas
404 The Positive Background of Hindu Sociology, p. 292.
405 Voir Avalon, Mahnirvna Tantra (1re d.), p. LVII. En y parlant du lotus

comme d'un plexus de Nd, j'ai en vue l'enveloppe grossire du centre subtil,
enveloppe grossire dont il est dit qu'elle contient la cause dterminante (bien
qu'tant l'effet dans un autre sens) des caractres du centre subtil.
406 Cit au v. 40 du Shatchakranirpana.
407 Ibid.

choses grossires est bien montr par les v. 28 et 29 du


Shatchakranirpana, qui disent que les voyelles du Vishuddha sont visibles l'esprit clair (Dptabuddhi) seulement, c'est--dire la Buddhi dbarrasse de l'impuret
qui rsulte des occupations terrestres, par l'effet d'une
pratique constante du Yoga.
Le v. 19, et d'autres encore, parle des lettres en question comme colores. Chaque objet de perception, qu'il soit
grossier ou subtil, a un aspect correspondant chacun
des sens. C'est pour cette raison que le Tantra tablit une
relation entre le son, la forme et la couleur. Le son produit
la forme, et la forme est associe la couleur. Kundal est
une forme de la Shakti Suprme qui conserve toutes les
cratures doues de souffle. Elle est la source partir de
laquelle se manifeste tout son ou nergie, que ce soit sous
forme d'ides ou de langage.
Ce son ou Mtrik, lorsqu'il est mis en langage humain, prend la forme de lettres, et de prose ou de vers
forms par leurs combinaisons. Et le son (Shabda) a son
sens, savoir les objets dsigns par les ides qui sont
exprimes par des sons ou des mots. Sous l'impulsion
d'Ichchh Shakti agissant par l'intermdiaire du Prnavyu (force vitale) de l'Atm, est produite dans le Mldhra la puissance sonore appele Par, qui dans son
mouvement ascendant par les autres Chakra prend
d'autres caractres et d'autres noms (Pashyant et
Madhyam), et lorsqu'elle est mise par la bouche apparat, sous le nom de Vaikhair, sous la forme des lettres
parles qui sont l'aspect grossier du son existant dans les
Chakra eux-mmes408.
408 Ibid., v. 10 et 11.

Les lettres, une fois prononces, sont alors l'aspect manifest en langage grossier de l'nergie subtile du Shabdabrahman en tant que Kundal. La mme nergie qui produit ces lettres manifestes comme Mantra produit l'univers grossier. Dans les Chakra est le Shabda subtil dans
ses tats de Par, Pashyant ou Madhyam Shakti, qui,
port l'organe vocal, prend la forme de son audible
(Dhvani), qui peut tre n'importe quelle lettre particulire.
Il est dit que des formes particulires de l'nergie de
Kundal rsident dans des Chakra particuliers, toutes ces
nergies existant sous une forme magnifie dans le Sahasrra. Chaque lettre manifeste est un Mantra, et un
Mantra est le corps d'une Devat. Il y a donc autant de
Devat dans un Chakra qu'il y a de ptales, qui sont les
Devat ou Shakti entourant (Avarana) la Devat du Chakra, et l'lment subtil dont Elle est la Conscience directrice. Ainsi Brahm est la Conscience directrice du lotus
Mldhra, dsigne par le Bindu du Bja La (Lam), qui
est le corps de la Devat de la terre ; et autour d'eux, associs eux, sont les formes subtiles des Mantra, qui
constituent les ptales et les corps d'nergies associes.
Le corps humain tout entier est en fait un Mantra, et se
compose de Mantra. Ces puissances sonores animent, rglent et dirigent les manifestations grossires correspondantes dans les rgions qui les entourent.
Mais pourquoi des lettres particulires sont assignes
des Chakra particuliers, c'est la question qui se pose
maintenant. Pourquoi, par exemple, Ha est-elle dans
l'Ajn et La dans le Mldhra ? C'est un fait que dans
certains passages des Tantra certaines lettres sont assignes des lments particuliers.

Ainsi, il y a certaines lettres qui sont appeles Vyava


Varna, ou lettres appartenant au Vyu Tattva ; mais un
examen fond sur ce fait ne peut rendre compte de la position des lettres, des lettres qui sont assignes un certain
lment pouvant se trouver dans un Chakra dont le Tattva
prdominant est un autre lment.
On a dit que dans la prononciation de lettres particulires, les centres o elles sont situes entrent en jeu, et
que c'est l l'explication de la position de ces lettres particulires en leur centre particulier. Une explication probable est celle que j'ai donne dans Shakti and Shkta409.
En dehors de celle-ci, on peut seulement dire que tel est
Svabhva, la nature de la chose, qui dans ce cas est aussi
peu susceptible de recevoir une explication dfinitive que
dans le corps la disposition des organes grossiers euxmmes ; ou qu'il peut s'agir d'un arrangement artificiel
dans un but de mditation, auquel cas il n'est pas besoin
d'autre explication.
Les quatre Bhva, ou tats du son, dans le corps humain, sont ainsi nomms parce qu'ils sont des tats dans
lesquels le son, ou le mouvement, est produit ou devient,
se dveloppant partir de Par Shakti dans le corps d'Ishvara, jusqu' la Vaikhar Shakti grossire dans le corps de
Jva.
Comme il a t dit dj, sous l'aspect corporel (Adhytm) le Krana Bindu rside dans le centre Mldhra,
o il est connu sous le nom de Shakti Pinda410 ou de Kun409 3e d. Voir le chapitre sur Kundalyoga.
410 On l'appelle ainsi parce que toutes les Shakti sont rassembles ou roules

en une seule masse . C'est l le Kendra (centre) de toutes les Shakti. Le Svachchhanda dit, comme aussi le Shrad :

dalin411. Kundal est le nom de Shabdabrahman dans les


corps humains.
L'Achrya dit, parlant de Kundalin : Il est une Shakti
nomme Kundalin qui est toujours occupe l'uvre de
cration de l'univers. Celui qui L'a connue ne rentre plus
jamais, enfant, dans le sein maternel, ni ne subit la vieillesse .
Autrement dit, il n'entre plus dans la Samsra du
monde de la transmigration412. Ce Krana Bindu existe
dans un tat non diffrenci413.
Le corps de Kundal est compos de cinquante lettres
ou puissances sonores. De mme qu'il y a une apparente
volution414 dans le corps cosmique d'Ishvara, reprsente
Pindam Kundalin-shaktih
Padam hamsah prakrtitah
Rpam bindur iti khyatam
Rpttas tu chinmayah.
(Kundalin Shakti est Pinda ; Hamsah est Pada ; Bindu est Rpa, mais Chinmaya
(Chit) est sans forme.) La premire, en tant que potentialit de toute puissance
manifeste, est dans le Mldhra Chakra ; le second, en tant que Jvtm, est
dans Anhata, o bat le cur, la pulsation vitale. Bindu, le corps formel causal, en
tant que Shakti Suprme, est dans Ajn, et la Conscience informelle passant par
Bindu Tattva manifest comme Hamsa, puis reposant de nouveau comme Kundalin, est dans le Brahmarandhra (voir Tk du premier Samketa du Yoginhridaya
Tantra).
411 Adhytmantu kranabinduh shaktipindakundalydishabdavchyo mldh-

rasthan (Bhskararya, Comm. de la Lalit, v. 132).

412 Shaktih kundalinti vishvajananavyprabaddhodyamm Jntv ittham na

punar vishanti jananigarbhe ' rbhakatvam narh ityadirtychryair vyavahritah. (Ibid.)


413 So'yam avibhgvasthah kranabinduh. (Ibid.)
414 Vikra ou Vikriti est quelque chose qui est rellement chang, comme le lait

se change en caill. Le second est une Vikriti du premier. Vivarta est un change-

par les sept tats qui vont de Sakala Parameshvara Bindu, il y a dans le corps humain un dveloppement similaire en Kundal, qui s'y trouve prsente comme lIshvar.
Les tats suivants y sont dvelopps, en correspondance avec le dveloppement cosmique : Shakti, Dhvani,
Nda, Nirodhik, Ardhendu, Bindu. Ce sont tous des tats
de Kundal Elle-mme dans le Mldhra, et ils sont connus sous le nom de son Par.
Chacune des lettres composant le corps de Kundal
existe sous les quatre tats de Par Shakti, et, dans les
tats ultrieurs du son, de Pashyant, Madhyam et Vaikhair, dont il sera question plus loin.
Le premier est un tat de son indiffrenci, qui existe
dans le corps d'Ishvara ; le deuxime et le troisime, existant dans le corps de Jva, sont des tapes vers cette manifestation complte du son diffrenci dans le langage
humain qui porte le nom de Vaikhar Bhva. Sous l'aspect
cosmique ces quatre tats sont Avyakta, Ishvara, Hiranyagarbha et Virt.
L'Artharishti (cration objective) de Kundalin constitue
les Kal, qui sortent des lettres, tels que la Rudra Mrti, la
Vishnu Mrti et leurs Shakti, Kma, Ganesha et leurs
Shakti, et ainsi de suite. Dans le Sakala Parameshvara, ou
Shabdabrahman dans les corps, c'est--dire Kundalin
Shakti, celle-ci est appele Chit Shakti ou simplement
Shakti, lorsqu'entre Sattva , tat connu sous le nom de
ment apparent mais non rel, comme l'apparence de serpent prise par ce qui
tait et demeure une corde. Le Vedntasra dfinit les deux termes sous cette
forme musicale :
Satattvato' nyathprath vikra ityudritah
Atattvato' nyath prath vivarta ityudhritah.

Paramkshvasth.
Lorsque Celle en qui Sattva est entr est ensuite perce par Rajas, Elle prend le nom de Dhvani, qui est
l'Aksharvasth. Lorsqu'Elle est de nouveau perce par
Tamas, elle prend le nom de Nda. C'est l'Avyaktvasth,
l'Avyakta Nda qui est le Parabindu. Puis, Celle en qui
abonde Tamas prend, comme le dit Rghava Bhatta, le
nom de Nirodhik ; Celle en qui abonde Sattva prend le
nom d'Ardhendu ; et la combinaison des deux (Ichchh et
Jnna), dans laquelle Rajas opre comme Kriy Shakti,
prend le nom de Bindu. Aussi a-t-on dit : Attir par la
force d'Ichchh Shakti (la volont), illumin par Jnna
Shakti (la connaissance), Shakti le Seigneur apparaissant
comme mle cre (Kriy Shakti, l'action) .
Quand le Krana Bindu germe afin de crer les trois
(Bindu, Nda et Bja), alors nat ce Verbe ou Son non manifest de Brahman appel le Shabdabrahman (Brahman
Son)415. Il est dit : De la diffrenciation du Krana Bindu
nat le Son non manifest, appel Shabdabrahman par
ceux qui sont verss dans la Shruti416 . C'est ce Shabdabrahman qui est la cause immdiate de l'univers, qui est
son et mouvement manifests en ide et langage.
415 Ayam eva cha yad kryabindvditrayajananonmukho bhidyate taddas-

hvm avyaktah shabdabrahmbhidheyo rayas tatrotpadyate. (Ibid.) Quand


celui-ci (le Krana-bindu) se dispose produire les trois Bindu dont le premier
est Kryabindu et qu'il clate ou se divise (Bhidyate), alors ce stade nat le son
(Raya) indistinct (Avyakta) qu'on appelle Shabdabrahman.
416 Tadapyuktam :

Bindos tasmd bhidyamnd avyakttm ravo'bhavat. Sa ravah shrutisampannaih shabdabrahmeti gyate. (Ibid.) Aussi a-t-il t dit : Du Bindu qui clate nat le
son indistinct qui est appel Shabdabrahman par ceux qui sont verss dans la
Shruti.

Ce son, qui ne fait qu'un avec le Krana Bindu, et qui


est donc omniprsent, apparat pourtant d'abord dans le
corps humain dans le Mldhra. Il est dit que dans le
Mldhra du corps l' air (Prnavyu) apparat d'abord.
Cet air , sur lequel s'exerce l'effort d'une personne dsirant parler, manifeste le Shabdabrahman omniprsent417
.
Le Shabdabrahman qui est sous la forme du Krana
Bindu lorsqu'il demeure immobile (Nishpanda) sa place
(c'est--dire en Kundal, qui est Elle-mme dans le Mldhra) est appel Par Shakti, le langage. Le mme
Shabdabrahman manifest par le mme air allant jusqu'au nombril, uni au Manas, possdant la nature du Krya Bindu manifest avec un mouvement gnral (Smnyaspanda), porte le nom de langage Pashyant 418. Pashyant, qui est dfini comme Jnntmaka et Bindvtmaka
(ayant la nature de Chit et de Bindu), s'tend du Mldhra au nombril, ou, d'aprs certains exposs, au Svdhishthna.
Ensuite, le Shabdabrahman manifest par le mme air
allant jusqu'au cur, uni la Buddhi, possdant la nature du Nda manifest et dou de mouvement particulier

417 So'yam ravah kranabindutdtmypannatvt sarvagato' pi vyanjakayatna-

samskritapavanavasht prninm mldhra eva abhivyajyate. Taduktam :


Dehe'pi mldhre'smin samudeti samranah. Vivakshorichchhayotthena
prayatnena susamskritah. Sa vyanjayati tatraiva shabdabrahmpi sarvagam.
(Ibid.)
418 Tad idam kranabindvtmakam abhivyaktam shabdabrahmasvapratishtha-

tay nishpandam tadeva cha par vg ituychyate. Atha tadeva nbhiparyantamgachchhat tena pavanenbhivyaktam vimarsharpena manas yuktam smnyaspandapraksharpakryabindumayam sat pashyant vg uchyate. (Ibid.)

(Visheshaspanda), porte le nom de langage Madhyam 419.


C'est le son Hiranyagarbha, qui s'tend depuis la rgion de
Pashyant jusqu'au cur. Ensuite420 le mme. Shabdabrahman manifest par le mme air allant jusqu' la
bouche, dvelopp dans la gorge et les rgions voisines,
articul et pouvant tre entendu par les oreilles d'autrui,
possdant la nature du Bija manifest avec un mouvement articul tout fait distinct (Spashtatara), porte le
nom de langage Vaikhair421. C'est l'tat Virt du son, ainsi
nomm parce qu'il sort .
L'Achrya donne sur ce sujet les explications suivantes
: Le son qui nat d'abord dans le Mldhra est appel
Par ; puis Pashyant ; puis, lorsqu'il va jusqu'au cur et
qu'il est uni la Buddhi, il est appel Madhyam . Ce
nom est d au fait qu'Elle demeure au milieu . Elle ne
ressemble pas Pashyant, Elle ne sort pas comme Vaikhair, avec une articulation pleinement dveloppe. Mais
Elle est au milieu des deux.
La pleine manifestation est la Vaikhar de l'homme qui
veut crier. Dans ce cas le son articul est produit par
419 Atha tad eva shabdabrahma tenaiva vyun hridayaparyantamabhivyajya-

mnam nishchaytmikay buddhy yuktam visheshaspandapraksharpandamayam sat madhyamvgityuchyate. (Ibid.)


420 Atha tad eva vadanaparyantham tenaiva vyun kanthdisthneshvabhivya-

jyamnam akrdivarnarpam parashrotrgrahanayogyam spashtataraprakshar pabjtmakam sat vaikhar vg uchyate. (Ibid.)


421 C'est--dire Shabda sous sa forme physique. Bhskararya, dans le commen-

taire du mme vers (132) de la Lalit, donne les tymologies suivantes : Vi =


beaucoup ; khara = dur. D'aprs le Saubhgya Sudhodaya, Vai = certainement ;
kha = cavit (de l'oreille) ; ra = aller ou entrer. Mais d'aprs les Yoga Shstra, la
Dev sous la forme de Vaikhar (Vaikharrp) est ainsi nomme parce qu'elle a
t produite par le Prna nomm Vikhara.

l'air422. Le Nity Tantra dit aussi : La forme Par nat


dans le Mldhra produite par l' air ; le mme air
s'levant, manifest dans le Svdhishthna, atteint l'tat
Pashyant423. Le mme s'levant lentement et manifest
dans l'Anhata, uni l'intellect (Buddhi), est Madhyam.
S'levant encore, et apparaissant dans le Vishuddha, il
sort de la gorge comme Vaikhair424 .
Comme le dit la Yogakundal Upanishad425 : Cette Vk
(puissance de langage) qui germe en Par donne des
feuilles en Pashyant, des bourgeons en Madhyam, et
fleurit en Vaikhair. En renversant cet ordre le son est absorb. Quiconque ralise le grand Seigneur du Langage
422 Taduktamchryaih :

Mldhrt prathamam udito yash cha bhvah parkhyah, Pashcht pashyanty


atha hridayago buddhiyug madhyamkhya Vaktre vaikhary atha rurudishor asya
jantoh sushumn, Baddhas tasmt bhavati pavanaprerit varnasamjn. (Bhskararya, op. cit.,)
C'est pourquoi le grand matre a dit (Shankara, Prapanchasra, II, 44) : Lorsque
l'enfant veut crier, le premier tat du son attach la Sushumn lorsqu'il nat
dans le Mldhra est appel Par ; lev par l'air il devient ensuite Pashyant, et
dans le cur uni Buddhi il prend le nom de Madhyam, et dans la bouche il
devient Vaikhar et de celle-ci naissent les lettres de l'alphabet .
423 Bhskararya donne Son autre nom, Uttrn (leve), et cite le Saubhgya

Sudhodaya, qui dit : Comme Elle voit tout en Elle-mme, et comme Elle s'lve
(Uttrn) au-dessus de la voie de l'action, cette Mre est appele Pashyant et
Uttrn .
424 Nitytantre'pi : Mldhre samutpannah parkhyo ndasambhavah. Sa

evordhyam tay ntah svdhishthne vijrimbhitah, Pashyantykhym avpnoti


tathaivordhvam shanaih shanaih, Anhate buddhi-tattyasameto madhyambhidhah, Tath tayordhvam nunnah san vishuddhau kanthadeshatah Vaikharykhya itydi. (Bhskararya, op. cit.)
Voir aussi Prapanchasra Tantra, ch. II (Avalon, Tntrik Texts, vol. III).
425 Ch. III.

(Vk), le Soi radieux et indiffrenci, n'est affect par aucune parole, quelle qu'elle soit .
Ainsi, bien qu'il existe quatre sortes de langage, les
hommes l'esprit grossier (Manushyh sthladrishah)426
qui ne comprennent pas les trois premires (Par, etc.),
croient que le langage est seulement Vaikhair427, tout
comme ils prennent le corps grossier pour le Soi, dans
l'ignorance de ses principes subtils.
La Shruti dit : Aussi les hommes croient que cela seul
est le langage qui est imparfait , imparfait dans la mesure
o il ne possde pas les trois premires formes428.
La Shruti dit encore429 : Il est quatre degrs du langage
; les Brahmanes qui sont sages les connaissent : trois sont
cachs et immobiles ; les hommes parlent le quatrime .
La Sta Samhit dit de son ct : Apada (le Brahman
immobile) devient Pada (les quatre formes du langage), et
Pada peut devenir Apada. Celui qui connat la distinction
entre Pada430 et Apada, celui-l voit rellement (autrement
dit devient lui-mme) Brahman431 .
426 C'est--dire les hommes qui ne voient et n'admettent que l'aspect grossier

des choses.
427 Ittham chaturvidhsu mtriksu parditrayam ajnanto manushyh sth-

ladrisho vaikharm eva vcham manvate. (Bhskararya, Ibid.)


428 Tath cha shrutih : Tasmd yadvcho'nptam tanmanushy upajvanti iti,

anptam aprnam tisribhir virahitam ityartha iti vedabhshye.

429 Shrutyantare'pi : Chatvri vkparimit padni tni vidur brhman ye ma-

nshinah. Guh trni nihit nemgayanti, turyam vcho manushy vadanti. (Ibid.)
430 Le Pada, ou mot, est ce qui a une terminaison. Pnini dit (Stara I, IV, 14) : Ce

qui se termine en Sup (terminaisons nominales) et en Tin (terminaisons verbales) est appel Pada . D'autre part, le Sup (terminaison) a quatre subdivisions.
431 Bhskararya (Ibid.)

Ainsi, les conclusions de la Shruti et de la Smriti sont


que le Cela (Tat) dans le corps humain a quatre subdivisions (Par, etc.). Mais mme sous la forme Par le mot
Tat ne dsigne que l'Avyakta avec trois Guna, cause de
Par, et non le Brahman inconditionn qui est au-dessus
d'Avyakta.
Le mot Tat en son sens transcendant signifie le
Shabdabrahman, ou Ishvara l'uvre de cration, de
conservation et de destruction de l'Univers. Le mme
mot dsigne encore indirectement (Lakshanay) le Brahman inconditionn ou suprme qui est sans attributs. La
relation qui existe entre les deux Brahman est celle d'identit (Tdtmya).
La Dev ou Shakti est donc l'unique consciencebatitude (Chidekarasarpin), c'est--dire qu'elle est toujours insparable de Chit. La relation des deux Brahman
est possible, parce que les deux sont le mme et ne font
qu'un. Bien qu'ils apparaissent diffrents (par les attributs), cependant ils ne font qu'un.
Le commentateur demande ensuite : comment le mot
Tat sous la forme Vaikhar dsigne-t-il le Braham ? Et sa
rponse est qu'il ne le dsigne qu'indirectement. Car le son
sous la forme physique du langage (Vaikhair) ne donne
expression ou ne s'identifie qu' la forme physique de
Brahman (le Virt), et non au pur et Suprme Brahman.
Ce qui suit est un rsum des correspondances signales dans ce chapitre et dans le prcdent. Il y a tout
d'abord le Nirguna Brahman, qui sous son aspect crateur
est Saguna Shabdabraham, et prend la forme de Parabindu, puis du triple Bindu (Tribindu) ; ce sont les quatre qui
sont reprsents, dans le sens indiqu plus haut, par les

quatre formes de langage, de son et d'tat (Bhva).


Le Bindu causal (Krana) ou Suprme (Parabindu) est
non-manifest (Avyakta), Shiva-Shakti indiffrenci, dont
les puissances ne se dploient pas encore, mais sont sur
le point de se dployer partir de l'tat, alors indiffrenci,
de Mlaprakriti. C'est l'tat de Langage Suprme (Par
Vk), le Verbe Suprme ou Logos, dont le sige dans le
corps individuel est le Mldhra Chakra.
Tout est clair jusqu'ici. Il y a, cependant, quelque difficult coordonner les dfinitions des trois puissances qui
se manifestent lors de la diffrenciation du Grand Bindu
(Mahbindu). Cela est d en partie au fait que les vers o
apparaissent ces dfinitions ne doivent pas se lire toujours
dans l'ordre des mots (Shabdakrama), mais suivant l'ordre
rel des faits, quels qu'ils puissent tre (Yathsambhavam)432.
D'autre part, il existe apparemment des divergences
entre les commentaires. En dehors des noms et des dtails
techniques, le fond du sujet est simple et s'accorde avec
les autres systmes. Il y a d'abord le Point (Bindu) nonmanifest, symbole propos duquel Saint Clment
d'Alexandrie dit433 que si l'on abstrait d'un corps ses proprits, profondeur, largeur et longueur, ce qui reste est
432 Comme l'indique l'auteur de la Prnatoshin, p. 2, en citant les vers de la Go-

raksha Samhit : Ichchh kriy tath jnnam gaur brhm tu vaishnav Tridh
shaktih sthit yatra tatparam jyotir Om iti. D'aprs cette description des Deva de
diffrents Adhra de Prnashakti upsan, l'ordre (en suivant celui des mots) est
celui-ci : Ichchh = Gauri ; Kriy = Brhm ; Jnna=Vaishnavi.

433 Stromates, livre V, ch. II. On lit aussi dans Les Mystres de la Croix, ouvrage

mystique du XVIIIe sicle : Ante omnia punstum exstitit ; non mathematicum sed
diffusivum.

un point ayant une position, et que si l'on te la position434, on obtient l'tat d'unit primordiale. Il y a un Esprit unique, qui apparat triple, Trinit de Puissance Manifeste (Shakti). En se manifestant ainsi, l'unique (ShivaShakti) devient double, Shiva et Shakti, et la relation (Nda) entre les deux (Tayor mithah samavyah) forme cette
Trinit commune tant de religions.
L'Unique agit d'abord comme Grande Volont (Ichchh),
puis comme Connaissance ou Sagesse (Jnna) selon laquelle uvre la Volont, puis comme Action (Kriy). Tel est
l'ordre des Shakti en Ishvara.
Donc, suivant le rcit des Purna, au commencement
de la cration Brahm s'veille. Alors les Samskra naissent dans son esprit. Apparaissent le Dsir de crer (Ichchh Shakti) ; puis la Connaissance (Jnna Shakti) de ce
qu'Il va crer ; et enfin l'Acte (Kriy) de cration. Dans le
cas de Jva l'ordre est le suivant : Jnna, Ichchh, Kriya.
Car tout d'abord Il considre ou connat quelque chose.
Inform par cette connaissance, Il veut, puis agit.
Les trois puissances, bien qu'on les compte et qu'on en
parle comme apparaissant sparment, sont des aspects
insparables et indivisibles de l'Unique. O est l'une
l'autre est aussi, bien que la pense des hommes envisage
chacune part et comme venant l'tre, c'est--dire se
manifestant dans la dure, sparment.
D'aprs une nomenclature le Bindu Suprme devient
triple comme Bindu (Krya), Bja, Nda. Bien que Shiva ne
soit jamais spar de Shakti, ni Shakti de Shiva, une manifestation peut signifier l'un ou l'autre d'une manire
434 Voir Garland of Letters.

prdominante. Ainsi, il est dit que Bindu a la nature de


Shiva (Shivtmaka) et Bja celle de Shakti (Shaktytmaka),
et que Nda est une combinaison des deux (Tayor mithah
samavyah).
On les appelle aussi Mahbindu (Parabindu), Sitabindu
(Bindu Blanc), Shonabindu (Bindu Rouge), et Mishrabindu
(Bindu Mlang). Ils sont respectivement suprme (Para),
subtil (Skshma), grossier (Sthla).
Il existe une autre nomenclature : le Soleil, le Feu et la
Lune. Il ne fait aucun doute que Bja est la Lune, que de
Bja sort la Shakti Vm, de qui vient Brahm, ayant la
nature de la Lune et de la Puissance de Volont (Ichchh
Shakti)435. Ichchh Shakti, du point de vue des Guna de
Prakriti, est Rajas Guna, qui pousse Sattva se dployer.
C'est Pashyant Shabda, dont le sige est dans le Svdhishthna Chakra. De Nda sortent de la mme manire
Jyeshth Shakti et Vishnu, et de Bindu Raudr et Rudra,
qui sont Madhyam et Vaikhar Shabda, dont les siges
sont respectivement les Chakra Anhata et Vishuddha.
D'aprs une description436, Bindu est le Feu et Kriy
Shakti (l'action), et Nda est le Soleil et Jnna Shakti,
qui du point de vue des Guna sont respectivement Tamas
et Sattva437. Pourtant Rghavabhatta, dans son Commen-

435 Raudr bindos tato ndj jyeshth bjd sjyata Vm tbhyah samutpann

rudrabrahmaramdhiph
Samjnnechchhkriytmno
svarpinah. (Shrad Tilaka, ch. I.)

vahnndvarka-

436 Yoginhridaya Tantra ; Commentaire, dj cit, relatif au Saubhgyasudho-

daya et au Tattvasandoha. Voir aussi Tantrloka, ch. VI.


437 Voici un tableau des correspondances d'aprs les textes cits :

Bja

Shakti, Lune, Ym, Brahma, Bhrat, Ichchh,

taire du Shrad, dit que le Soleil est Kriy parce que,


comme ce luminaire, il rend toute, choses visibles, et que
Jnna est le Feu parce que la connaissance consume
toute la cration. Quand, par Jnna, Jva sait qu'il est
Brahman, il cesse d'agir pour accumuler du Karma, et atteint la Dlivrance (Moksha). Il se peut qu'il s'agisse du
Jva, alors qu'il s'agit au dbut de la cration d'Ishvara.
Dans le Yoginhridaya Tantra, on lit que Vm et Ichchh Shakti sont dans le corps de Pashyant ; Jnna et
Jyeshth sont appels Madhyam ; Kriy Shati est Raudr
; et Vaikhar est sous la forme de l'univers438.
L'volution des Bhva est dcrite comme il suit dans le
Shrad Tilaka439 : le Shabdabrahman omniprsent, ou
Kundal, mane Shakti, puis suivent Dhvani, Nda, Nirodhik, Ardhendu, Bindu. Shakti est Chit avec Sattva
(Paramkshvasth) ; Dhvani est Chit avec Sattva et Rajas (Aksharvasth) ; Nda est Chit avec Sattva, Rajas,
Tamas (Avyaktvasth) ; Nirodhik de mme avec abondance de Tamas (Tamahprchuryt) ; Ardhendu de mme
avec abondance de Sattva ; et Bindu la combinaison des
Shonabindu
Nda
Mishrabindu
Bindu
Sitabindu

Rajas, Pashyant, Svdhishthna.

Shiva-Shakti, Soleil, Jyeshth, Vishnu, Vishvambhara, Jnna, Sattva, Mdhyam, Anhata.

Shiva, Feu, Raudr, Rudra, Rudran, Kriy, Tamas, Vaikhar, Vishuddha.

438 Ichchhshaktis tath Vm pashyant vapush sthit Jnnashaktis tath

Jyeshth madhyam y-g udrit Kriyshaktis tu Raudryam vaikhar vishvavigraha. (Cit sous le v. 22, Comm. du Kmakalewils.)
439 Ch. I.

deux.
Ce Bindu reoit diffrents noms (Par, etc.), suivant sa
position dans les diffrents centres, Mldhra et autres.
C'est ainsi que Kundal, qui est Ichchh, Jnna, Kriy, qui
est la fois sous forme de conscience (Tejorp) et compose des Guna (Guntmik), cre la Guirlande des Lettres
(Varnaml).
On a parl des quatre Bhva comme venant aprs Nda,
lui-mme une des neuf manifestations suivantes de la Dev.
Le Pandit Ananta Shstr, propos du Commentaire de
Lakshmdhara sur le v. 34 de l'Anandalahar, crit440 :
Bhagavat est le mot employ dans le texte pour dsigner Dev. Celui qui possde Bhaga est appel une Bhagavat (au fminin). Bhaga signifie la connaissance : 1) de la
cration ; 2) de la destruction de l'univers ; 3) de l'origine
des tres ; 4) de la fin des tres ; 5) de la connaissance relle ou de la vrit divine ; 6) d'Avidy, l'ignorance. Celui
qui connat ces six choses est qualifi pour le titre de Bhagavn. D'autre part, Bha = 9. Bhagavat se rapporte au
Yantra (diagramme) neuf angles qui est employ dans le
Chandrakalvidy .
D'aprs les Agama, Dev a neuf manifestations qui
sont :
1. Groupe Kla, durant d'un clin d'il au temps du Pralaya. Le soleil et la lune sont compris dans ce groupe. LE
TEMPS.
2. Groupe Kula, comprenant les choses qui ont forme et
440 Ananta Shstr, op. cit., p. 72.

couleur. LA FORME.
3. Groupe Nma, comprenant les choses qui ont un
nom. LE NOM.
4. Groupe Jnna, l'Intelligence. Il se subdivise en deux
branches : Savikalpa (mlang et sujet au changement), et
Nirvikalpa (pur et immuable). CHIT.
5. Groupe Chitta, comprenant : 1) Ahamkra (l'gosme)
; 2) Chitta ; 3) Buddhi ; 4) Manas ; 5) Unmanas. LE MENTAL.
6. Groupe Nda, comprenant : 1) Rga (le dsir)441 ; 2)
Ichchh (le dsir442 renforc, dvelopp ; 3) Kriti (l'action,
la forme active du dsir) ; 4) Prayatna (effort pour accomplir l'objet du dsir). Ils correspondent, dans l'ordre, : 1)
Par (premier stade du son, man de Mldhra) ; 2)
Pashyant (second stade) ; 3) Madhyam (troisime stade) ;
4) Vaikhar (quatrime stade du son, lorsqu'il est mis par
la bouche). LE SON.
7. Groupe Bindu, comprenant les six Chakra du Mldhra l'Ajn. L'ESSENCE PSYCHIQUE, LE GERME SPIRITUEL (Voir note 439).
8. Groupe Kal, comprenant les cinquante lettres du
Mldhra l'Ajn. LES TONS 443.
9. Groupe Jva, comprenant les mes soumises la matire.
441 Rga doit se traduire par intrt , comme dans Rgakanchuka. Ichchh est

la volont de l'action (Kriy), en conformit avec lui. Le dsir est chose grossire,
qui fait son apparition avec le monde matriel.
442 Je cite le passage tel qu'il est crit, mais ces termes ne me paraissent pas

clairs.
443 Je ne sais ce que le Pandit entend par ce terme.

Les Dits ou Tattva qui gouvernent les quatre parties


constituant Nda sont Mh, Shuddhavidy, Mahesha et
Sadshiva. Le Commentateur traite fond ce sujet, citant
des extraits d'ouvrages occultes. Voici une traduction de
quelques lignes du Nmakalvidy444, ouvrage sur la phontique, qui intressera le lecteur :
Par est Ek (sans dualit) ; son contraire est le suivant
(Pashyant) ; Madhyam se subdivise en deux, forme grossire et forme subtile ; la forme grossire comprend les
neuf groupes de lettres ; et la forme subtile est le son qui
diffrencie les neuf lettres... L'une est la cause, et l'autre
l'effet ; et il n'existe ainsi aucune diffrence matrielle
entre le son et ses formes grossires.
Commentaire. Ek : lorsque les trois Guna, Sattva,
Rajas et Tamas, sont en tat d'quilibre (Smya), cet tat
est appel Par. Pashyant est l'tat o les trois Guna deviennent ingaux (et par voie de consquence produisent
le son). Le stade suivant porte le nom de Madhyam ; sa
forme subtile est appele Skshmamadhyam, et sa forme
grossire Sthlamadhyam, qui produit neuf formes distinctes de son reprsentes par neuf groupes de lettres : a
(et toutes les autres voyelles) ; ka (Kavarga, au nombre de
cinq) ; ca (Chavarga, 5) ; ta (Tavarga) ; ta (Tavarga, 5) ; pa
(Pavarga, 5) ; ya (Ya, Ra, La et Va) ; a (Sha, Sha, Sa et Ha)
; ksa (Ksha). Ces lettres n'existent pas en ralit, mais re444 Cet ouvrage est difficilement accessible aux Pandit ou aux tudiants ; nous

ne trouvons ce nom dans aucun des catalogues rdigs par des rudits europens ou indiens. La politique du secret nous a privs de tous les livres de cette
espce. Mme de nos jours, si nous trouvons dans la maison d'un vieux Pandit un
manuscrit traitant de questions occultes, nous ne serons pas mme autoriss
voir le livre ; et c'est un fait que ces ouvrages sont devenus depuis longtemps la
nourriture des vers et des fourmis blanches. (Ananta Shstr.)

prsentent seulement les ides des hommes. Toutes les


formes et toutes les lettres tirent donc leur origine de Par,
et Par n'est rien d'autre que Chaitanya (la Conscience).
Les neuf groupes de Vyha (manifestations de Dev)
numrs plus haut sont, d'autre part, classs dans les
trois catgories suivantes : 1) Bhokt (celui qui jouit) comprend le groupe 9, Jivavyha ; 2) Bhogya (les objets de
jouissance), comprend les groupes 1, 2, 3, 5, 6, 7 et 8 ; 3)
Bhoga (la jouissance) comprend le groupe 4, Jnnavyha.
C'est l la substance de la philosophie des Kaula telle
que l'expose Shri Shankarchrya dans ce shloka (no 34)
de l'Anandalahar. En le commentant, Lakshmdhara cite
plusieurs vers des Kaula Agama, dont le suivant :
Le bienheureux Seigneur a neuf formes. Ce Dieu est
appel Bhairava. C'est lui qui accorde la jouissance (la
batitude) et qui dlivre les mes (de la servitude). Son
pouse est Anandabhairav, la conscience (Chaitanya)
ternellement bienheureuse. Lorsque tous deux sont unis
harmonieusement, l'univers prend naissance.
Le Commentateur remarque ici que la puissance de Dev prdomine dans la cration, et celle de Shiva dans la
dissolution .

VI. LA PRATIQUE (YOGA ; LAYA-KRAMA)

On entend parfois le mot Yoga comme dsignant le rsultat et non les exercices qui y conduisent. En ce sens, et
du point de vue du dualisme naturel, on a dfini le Yoga
comme l'union de l'esprit individuel avec Dieu.
Mais si, en ralit, Jva et Paramtm ne font qu'un, il
ne peut y avoir union, ce terme ne pouvant strictement
s'appliquer qu'au rapprochement de deux tres distincts.
Samdhi (l'extase) consiste raliser que le Jvtm est
Paramtm ; et le Yoga dsigne, non cette ralisation,
mais les moyens qui permettent de l'atteindre. Le terme
Yoga dsigne donc ces exercices physiques et psychiques
utiliss pour dcouvrir l'essence intime de l'homme, qui
est le Suprme.
Le Yoga n'est donc pas un rsultat, mais la technique, la
mthode, la pratique, qui permet d'atteindre ce rsultat.
Celui-ci est possible, selon l'Advaita Vednta, parce que le
pur Chit, tre essentiel de chaque Jva, n'est pas lui-mme
captif, mais apparat comme tel. Si Atm en tant que tel
n'tait pas rellement libre, la Dlivrance (Moksha) ne serait pas possible. La Dlivrance est donc virtuellement en
la possession de chaque Jva. Son identit avec Paramtm existe ds prsent, mais elle n'est pas ralise
cause du voile de My, qui fait apparatre Jvtm et Paramtm comme spars. L'ignorance de l'identit du
Jvtm et du Paramtm tant cause par Avidy, la ra-

lisation de cette identit est obtenue par Vidy ou Jnna.


Celui-ci peut seul produire immdiatement la Dlivrance (Sadyomukti). Jnna s'emploie dans un double
sens : Svarpa Jnna et Kriy Jnna. Le premier est Pure
Conscience, but et fin du Yoga ; le second comprend ces
exercices intellectuels qui sont les moyens d'acqurir la
premire. Jnna considr comme moyen ou action mentale (Mnas Kriy) est un exercice intellectuel consistant
distinguer ce qui est de ce qui n'est pas Brahman ; la
saine comprhension de ce que signifie Brahman , et la
fixation du mental sur ce que l'on entend par ce terme,
jusqu' ce que le Brahman occupe pleinement et de faon
permanente le mental, l'exclusion de toute autre chose.
Le mental est alors rsorb en Brahman, pure Conscience,
qui seul demeure ; c'est la ralisation ou l'obtention de
l'tat de pure conscience, qui est Jnna dans son sens
Svarpa.
Le Yoga librateur, sans Jnna parfait, effectue ce que
l'on nomme Kramamukti : c'est--dire que le Yogi atteint
Syujya, union avec Brahman en Satya-loka, qui trouve
ensuite son achvement, la Mukti complte, par l'intermdiaire de la Devat laquelle il s'est ainsi uni.
Ce que le Jnnayog ou Jvanmukta complet (Siddha)
accomplit lui-mme en cette vie, s'obtient en consquence
de Brahmasyujya. Mais l'homme n'est pas qu'intellect. Il
est dou de sentiment et de dvotion. Il n'est pas que cela,
mais il possde un corps. D'autres mthodes (Yoga) sont
donc associes Jnna et lui servent d'auxiliaires ; telles
les mthodes rattaches l'adoration (Upsan), et les
techniques grossires (Sthla Kriy) et subtiles (Skshma
Kriya) du Hathayoga.

Le mental et le corps sont les instruments par quoi s'obtient l'exprience cosmique ordinaire et sparative. Toutefois, aussi longtemps qu'ils sont utiliss de cette manire,
ils sont des obstacles l'obtention de l'tat de pure Conscience (Chit). Cette obtention exige que tous les voiles
(Avarana) de Chit soient enlevs.
Le Yoga est donc la mthode par laquelle l'intellection
mentale et le sentiment (Chittavritti), ainsi que Prna, sont
d'abord matriss, puis fixs445.
Lorsque sont apaiss Chitta, Vritti et Prna, alors Chit
ou Paramtm se rvle. Il survient sans qu'il soit besoin
d'autre effort ds labsorption de la matire et du mental
dans la Puissance primordiale (Shakti) dont ils sont issus,
dont ils sont des formes manifestes, et qui Elle-mme, en
tant que Shiv, ne fait qu'un avec Celui qui est Shiva ou
Conscience.
Ainsi le Yoga se propose un tat positif de pure conscience, qu'il atteindra en supprimant l'action du principe
d'inconscience qui fait obstacle son apparition. Cette
suppression est bien voque par les noms d'une Shakti
que le Shatchakranirpana dcrit soit comme Nibodhik,
soit comme Nirodhik. Le premier de ces noms signifie la
Donneuse de Connaissance, et le second Cela qui empche le mental d'tre affect par le monde des objets par
l'intermdiaire des sens.
C'est en empchant de telles impressions qu'on fait
natre l'tat de pure conscience. La naissance de cet tat
est le Samdhi, tat extatique dans lequel est ralise l'
445 Le Tattva (Ralit) se rvle quand toute pense a disparu (Kulrnava Tan-

tra, IX, 10).

galit , ou identit, de Jvtm et de Paramtm. Cette


exprience est obtenue aprs l'absorption (Laya) de Prna
et de Manas et la cessation de toute idation (Samkalpa).
Un tat non-modifi (Samarasatvam) est ainsi produit, qui
est l'tat naturel (Sahajvasth) de l'Atm.
Tant qu'il n'est pas produit, existe cette fluctuation,
cette modification (Vritti) qui est la marque de la conscience conditionne, avec son dchirement du soi en Je
et Toi . L'tat de Samdhi est pareil celui d'un grain
de sel, qui mlang l'eau ne fait plus qu'un avec elle 446 .
Il est, dit le Kulrnava Tantra, cette forme de contemplation (Dhyna) dans laquelle il n'est point d' ici ni de
pas ici , dans laquelle il y a comme la lumire et la paix
d'un vaste ocan, et qui est le Vide Lui-mme447 .
Le Matre vnrable et omniscient a dit : Celui qui est
parvenu la connaissance complte de l'Atm est en repos
comme les eaux calmes de l'ocan (v. 31). Le My Tantra dfinit le Yoga comme l'unit de Jva et de Paramtm
(v. 51) ; ce par quoi l'on arrive ne faire qu'un avec le Suprme (Paramtm) ; et Samdhi, l'extase, est cette unit
de Jva et d'Atm (ibid.)448.
D'autres le dfinissent comme la connaissance de
l'identit de Shiva et d'Atm. Les Agamavd proclament
que la connaissance de Shakti (Shaktytmakam jnnam)
est le Yoga. D'autres sages disent que la connaissance du
446 Hathayogapradpik, IV, 5-7. On trouve la mme image dans le Demchog

Tantra bouddhique. Voir Tntrik Texts, vol. VII.


447 IX, 9.

448 Comme l'eau verse dans l'eau, les deux ne se distinguent plus. (Kulrnava

Tantra, IX, 15.)

Purusha ternel (Purna Purusha) est le Yoga, et


d'autres encore, les Prakritivd, dclarent que la connaissance de l'union de Shiva et de Shakti est le Yoga (ibid.).
Toutes ces dfinitions se rapportent une seule et
mme chose : la ralisation par l'esprit humain du fait
qu'il est essentiellement l'Esprit Suprme, le Brahman,
qui, en tant que Matre des mondes, est appel Dieu.
Comme le dit le Hathayogapradpik449 : Rjayoga, Samdhi, Unman, Manonman450, Amaratvam (l'Immortalit), Shnyshnya (le vide et pourtant le non-vide)451, Paramapada (l'tat Suprme)452, Amanaska (tat sans Manas
; suspension du fonctionnement du mental)453, Advaita
(non-dualit), Nirlamba (tat sans support) ; le Manas
dtach du monde extrieur)454, Niranjana (tat sans
tache)455, Jvanmukti (libration dans le corps), Sahajvasth (tat naturel de l'Atm), et Turya (Quatrime tat),
signifient tous une seule et mme chose, qui est la cessation de l'activit mentale (Chitta) aussi bien que de l'action
(Karma), que suivent la libration des alternatives de joie
et de douleur, et un tat sans changement (Nirvikra). la
449 Ch. IV, v. 3-4.
450 Absence de mental. Voir Ndabindu Up.
451 Voir Hathayogapradpik, IV, v. 37. Le Yog, comme la Conscience avec la-

quelle il ne fait qu'un, est au del des deux.


452 La racine Pad signifie aller vers ; Padam est donc ce quoi l'on a accs .

(Comm. du v. I, ch. IV, du Hathayogapradpik.)


453 Voir Mandalabrhmana Up., II, III.
454 C'est la Nirlambapur laquelle fait allusion le Shatchakranirpana.
455 Anjana = Myopdhi (l'Updhi, ou limitation apparente, produite par My,

l'apparence) ; Niranjana signifie donc exempt de cela (Tadrahitam, ou Shuddham : pur), c'est--dire le Brahman. (Comm. du Hathayogapradpik, IV, v. 1.)

dissolution du corps, cet tat est suivi de la Dlivrance


sans corps (Videhakaivalya) ou suprme (Paramamukti),
qui est l'tat permanent (Svarpvasthnam).
Si la fin et le but du Yoga sont les mmes, les mthodes
pour les atteindre varient.
On dit communment qu'il y a quatre formes de Yoga,
nommes Mantrayoga, Hathayoga, Layayoga et Rjayoga456. Ils sont tous quatre des modes divers de Sdhan
(pratique), par lesquels les sentiments et les activits intellectuelles du mental (Chittavritti) sont matriss, et le
Brahman ralis de diverses manires (Brahmaskshtakra).
Chacune de ces formes a les mmes huit auxiliaires, qui
sont appels les huit membres (Ashtmga). Chacune
d'elles a le mme but l'exprience qui est la ralisation de
Brahman ; elles diffrent cependant quant aux moyens
employs, et, dit-on, par le degr des rsultats. On a dfini
le Samdhi de la premire comme Mahbhva, celui de la
seconde comme Mahbodha, celui de la troisime comme
Mahlaya, et par le Rjayoga et le Jnnayoga s'obtient,
dit-on, la dlivrance appele Kaivalyamukti.
Il faut noter, cependant, que dans l'opinion de ceux qui
pratiquent le Kundal Yoga, celui-ci est le plus haut des
Yoga, dans lequel un Samdhi parfait s'obtient par l'union
avec Shiva du mental et du corps la fois, comme il est
456 Varha Up., ch. V, II ; Yogatattva Up. On trouvera une utile analyse du Yoga

dans Shangkara and Rmnuja, par Rajendra Ghose. Il est aussi fait mention
d'une triple division correspondant aux trois Knda vdiques : Karma Yoga
(Karma Knda), Bhakti Yoga (Upsan Knda), Jnna ou Rja Yoga (Jnna Knda). Le Karma Yoga est la bonne action sans dsir de son fruit. Le Bhakti Yoga est
la dvotion Dieu.

expos plus loin. Dans le Rja Yoga et le Jnna Yoga les


dmarches de l'intellect prdominent, quand elles ne sont
pas l'unique moyen employ. Dans le Mantra Yoga, prdominent l'adoration et la dvotion. Dans le Hathayoga
plus d'importance est attache aux mthodes physiques,
telles que la respiration.
Pourtant, chacun de ces Yoga emploie quelques-unes
des mthodes des autres. Ainsi, dans le Hatha-Layayoga
se trouve Kriyjnna. Mais tandis que le Jnna Yogi atteint Svarpa Jnna par l'effort de son mental sans veiller Kundalin, le Hathayog obtient ce Jnna par Kundalin
Elle-mme. Car Son union avec Shiva dans le Sahasrra
apporte, et elle est en fait, Svarpa Jnna.
Il conviendra donc de traiter des auxiliaires gnraux
(Ashtmga) qui sont communs toutes les formes de Yoga, et de poursuivre par un expos du Mantra Yoga et des
Hathayoga infrieurs, comme une introduction cette
forme de Layayoga qui est l'objet de notre tude, et qui
contient des lments prsents la fois dans le Mantra
Yoga et dans ces formes de Hathayoga.
Les conditions pralables de tout Yoga sont les huit
membres ou parties : Yama, Niyama, etc. La moralit, les
dispositions et les pratiques religieuses, et la discipline
(Sdhan), sont des conditions essentielles de tout Yoga
ayant pour fin l'acquisition de l'Exprience Suprme 457. La
moralit (Dharma) est l'expression de la vritable nature
de l'tre. Le mot Dharma, qui comprend la fois la morale
457 Il y a des formes de Yoga, comme celle dont certains lments donnent des

pouvoirs (Siddhi), qui doivent tre envisages diffremment. Elles se rattachent la magie, et non la religion. Ainsi l'union de Prna avec le Tejas Tattva
dans le nombril assure, dit-on, l'immunit contre le feu.

et la religion, mais possde aussi des significations plus


tendues, vient de la racine Dhri, soutenir , et c'est donc
la fois le soutien et l'action de soutenir.
L'Univers est soutenu (Dhryate) par Dharma, et le Seigneur qui est son Soutien Suprme est incarn dans la loi
ternelle et il est la Batitude qu'assure l'accomplissement
de celle-ci. Dharma est donc la loi qui gouverne l'volution
universelle, ou voie de la sortie (Pravritti), et l'involution,
ou voie du retour (Nivritti) 458. Et seuls peuvent atteindre la
dlivrance laquelle conduit la seconde voie, ceux qui par
leur fidlit Dharma collaborent l'accomplissement du
dessein universel. C'est la raison de cette belle parole :
Faire le bien aux autres est le Devoir suprme (Paropakro hi paramo dharmah).
Selon ce plan, le Jva passe de Shabdavidy, avec son
Tapas impliquant l'gosme et le fruit atteint par la Voie
des Dieux , son Karma (rites), qui est Sakma (avec dsir
du fruit) ou Nishkma (dsintress), Brahmavidy
(connaissance du Brahman), la Thosophie telle que l'enseignent les Upanishad. Ce passage s'effectue par
Nishkma Karma. Par Sakma Karma on atteint la Voie
des Pres (Pitri), Dharma, Artha (la richesse), Kma (le
dsir et sa satisfaction). Mais Nishkma Karma produit
cette puret du mental (Chitta-shuddhi) qui rend l'homme
capable de Brahmavidy, la Thosophie, laquelle procure
458 Cette grandiose conception du Dharma englobe donc sous ce nom toutes ces

lois (dont la religion ne reprsente qu'une) qui maintiennent la cohsion de


l'univers. C'est la loi inhrente tout tre manifest. Ainsi c'est la Loi de la
Forme, dont l'essence est au-del de Dharma et d'Adharma. Comme la douleur
suit l'acte mauvais, le Vaisheshika Darshana dcrit Dharma comme ce par quoi
l'on obtient le bonheur en ce monde et dans l'autre, et met un terme aux naissances et aux souffrances (Mokshadharma) .

la Dlivrance (Moksha), qu'elle est d'ailleurs, en son sens


le plus complet.
Il est vident qu'avant de pouvoir atteindre l'tat de
pure batitude de lAtm, le Jva doit vivre d'abord cette
vie ordonne qui est son expression correcte sur ce plan.
En langage thologique, seuls ceux qui suivent Dharma
peuvent aller son Seigneur. Le dsordre d'une vie immorale n'est pas une fondation sur laquelle on puisse baser
un tel Yoga. Je n'emploie pas le terme d' immoralit
dans le sens limit l'absurde que lui donne le langage
occidental ordinaire, mais comme la violation de toutes les
formes de loi morale. Toute violation de cette sorte est
fonde sur l'gosme. Comme le but du Yoga est de surmonter le moi limit, mme dans sa manifestation la plus
ordonne, ses doctrines prsupposent clairement l'absence
d'un tat gouvern par l'gosme, qui est le plus gros obstacle sa russite. Le but du Yoga est d'atteindre au complet dtachement du monde fini, et de raliser son essence.
Dans une vie gouverne par Dharma, demeurent cet attachement naturel aux objets du monde et ce sens de la
sparation mme dans les actes mritoires, qui existent
ncessairement jusqu' ce que l'absorption de Manas
permette d'atteindre l'tat non mental (Unman). Pourtant,
l o se trouve l'injustice (Adharma), l'attachement (Rga)
existe sous sa forme la plus pernicieuse et la plus nfaste,
et le sens de la sparation (Dvaitabhva) que le Yoga
cherche surmonter atteint dans le pch son plus haut
point. Le corps est intoxiqu par les poisons que secrtent
les passions, et la vitalit ou Prna s'en trouve amoindrie
et lse.

Sous l'influence de la colre459, de la convoitise, de la


malice et des autres passions, le mental est d'abord troubl, puis, en vertu du principe qu'un homme devient ce
qu'il pense, se concentre et se faonne de manire permanente sur Adharma (l'injustice), dont il devient l'expression
mme. Dans ce cas le Jva n'est pas seulement enchan
au monde par la My qui s'exerce la fois sur lui et sur
le vertueux Sakma Sdhaka, mais il endure l'Enfer (Naraka), et descend sur l'chelle de ltre.
Dharma sous son aspect religieux est ncessaire aussi.
Le dsir d'atteindre le but le plus lev du Yoga ne peut
natre que d'une inclination religieuse, et une telle inclination, jointe la pratique (Sdhan), favorise l'acquisition
des qualits que rclame le Yoga. En vrit, par une constante dvotion la Mre, on peut raliser Samdhi.
C'est pourquoi le Commentateur dit, au v. 50 du Shatchakranirpana :
Celui-l seul dont la nature a t purifie par la pratique de Yama et Niyama et les pratiques du mme ordre
(il s'agit de la Sdhan dcrite plus loin), apprendra de la
bouche de son Guru les moyens par lesquels on dcouvre
la voie de la grande Dlivrance .
Il ajoute, cependant, que les pratiques en question ne
sont ncessaires que pour ceux dont le mental est troubl
par la colre, la convoitise, et autres tendances mauvaises.
Mais si, en vertu de mrites acquis dans de prcdentes
existences, un homme est favoris d'une nature libre de
ces vices et des autres, alors il est qualifi pour le Yoga
sans qu'il soit mil besoin de cette prparation pralable.
459 Dans la pense hindoue, la colre est le pire pch.

Toutes les formes de Yoga, Mantra, Hatha, ou Rja Yoga, ont les mmes huit membres (Ashtmga) ou aides
prparatoires : Yama, Niyama, Asana, Prnyma, Pratyhra, Dhran, Dhyna et Samdhi460.
Yama comprend dix espces : abstention de faire du
mal toute crature vivante (Ahims) ; sincrit (Satyam) ;
abstention de prendre ou de convoiter ce qui appartient
autrui (Asteyam) ; continence sexuelle en esprit, en paroles, comme au physique (Brahmacharya)461 ; l'indulgence, la patience supporter toutes choses agrables ou
dsagrables (Ksham) ; la fermet d'me dans le bonheur
ou le malheur (Dhriti) ; la piti, la bont (Day) ; la simplicit (Arjavam) ; la modration462 et la rglementation463 de
460 Varha Up., ch. V. Les prliminaires ne sont ncessaires qu' ceux qui n'ont

pas ralis. Pour les autres, Niyama, Asana, et autres prliminaires, sont inutiles.
(Kulrnava Tantra, XI, 28-29.)
461 Comme le dit le Hathayogapradpik : Celui qui connat le Yoga doit garder

sa semence. Car la dpense de celle-ci tend la mort, mais la vie est celui qui la
garde .
Evam samrakshayet bindum mrityum jayati yogavit
Maranam binduptena jvanam bindudhrant.

Voir aussi la Yogatattva Up., qui dit que le Hathayoga assure au Yogi une si
grande beaut que toutes les femmes le dsirent, mais qu'il faut leur rsister.
Voir aussi le v. 90, qui montre la relation existant entre semence, mental et vie.
Aux premiers stades de la Hathayoga Sdhan la chaleur s'lve, le pnis se rtrcit, et la puissance sexuelle est en grande partie perdue. ce stade, le cot avec
mission de semence a toutes chances d'tre fatal. Mais un Siddha retrouve sa
puissance sexuelle et peut l'exercer. Car si, comme on le dit, il est l'preuve du
feu et des autres lments, que peut une femme contre lui ? Il est pourtant prsumer que la citation rapporte plus haut demeure valable, car dans tous les cas
la continence doit favoriser la force et la longvit. Mais il se peut que la perfection physique obtenue annihile les effets funestes qu'on observe chez les
hommes ordinaires.
462 Le Yogiyjnavalkya (ch. I) dit : 32 bouches pour un matre de maison, 16

la nourriture (Mthra) convenable au dveloppement du


Sattvaguna ; et la puret du corps et du mental
(Shaucham). La premire forme de puret est le nettoyage
externe du corps, dont s'occupe particulirement le Hathayoga ; et la seconde est obtenue par la connaissance
du Soi (Adhytmavidy)464.
Il existe aussi dix espces de Niyama : austrits,
jenes par exemple, en tant qu'actions purificatrices (Tapah) ; satisfaction de ce qu'on a sans l'avoir demand
(Santosha) ; croyance au Veda (Astikyam) ; charit
(Dnam), c'est--dire dons la mesure de ce qui a t lgitimement acquis ; adoration du Seigneur ou de la Mre
(Ishvarapjanam) selon Se, diverses formes ; tude des
fins du Shstra, par exemple par l'tude du Vednta (Siddhntavkyashravanam) ; modestie et sentiment de honte
faire de mauvaises actions (Hr) ; mental correctement
dirig vers la connaissance rvle et la pratique ordonne
par le Shstra (Mati) ; rcitation du Mantra (Japa)465 ; et
sacrifice du Homa (Hutam)466, c'est--dire observances religieuses en gnral (Vrata).
Le Ptanjala Stra ne mentionne que cinq Yama : les
quatre premiers des prcdents, et la libration de la conpour un reclus dans la fort, et 8 pour un Muni .
463 Sur les nourritures dfavorables au Yoga, voir Yogatattva Upanishad et Yo-

gakundal Upanishad.

464 Shndilya Upanishad, ch. I ; voir aussi Mandalabrhmana Upanishad.


465 Il peut tre parl (soit fort, soit bas), ou mental (Shndilya Upanishad).
466 Voir Hathayogapradpik (ch. I, v. 16-17) et Avalon, Tantrik Texts, vol. II, p.

133. La Shndilya Up. donne Vrata comme le dernier, et le dcrit comme l'observance des actions ordonnes et l'abstention des actions dfendues. Voir aussi
Varha Up., ch. V.

voitise (Parigraha). Ahims est la racine des suivants.


Shaucham, la propret, est compris parmi les Niyama.
Cinq de ces derniers sont cits : la propret (Shaucham),
le contentement (Santosha), l'action purificatrice (Tapah),
l'tude des critures menant la dlivrance (Svdhyya),
et la dvotion au Seigneur (Ishvarapranidhna)467.
Des vrits aussi videntes auraient peine besoin
d'tre mentionnes, si certains ne voyaient encore en tout
Yoga que Chamanisme , exploits respiratoires, postures acrobatiques , et autres choses de ce genre. Au contraire, aucun pays plus que l'Inde, depuis le Moyen Age et
jusqu' notre poque, n'a insist sur la ncessit d'associer moralit et religion toutes les formes d'activit humaine468.
La pratique de Yama et de Niyama conduit la renonciation et au dtachement des choses de ce monde et de
l'autre469, par la connaissance du permanent et de l'impermanent, et cause d'un intense dsir et d'une recherche incessante de la dlivrance, caractristiques du
467 Patanjali, Yoga Stra, ch. II, 30, 32.
468 Ainsi, comme c'tait le cas dans nos corporations mdivales, la religion

inspire l'art hindou ; et la pense hindoue est associe la religion comme l'tait
la philosophie scolastique en Occident. Dans les temps modernes, en Occident, le
rapport de la religion avec ces choses n'a pas en gnral t considr comme
digne d'attention, l'habilet dans le premier cas et l'intelligence dans le second
tant d'ordinaire juges suffisantes.
469 Par exemple le Sudh (nectar) qui s'obtient dans les cieux. (Hathayoga-

pradpik, Commentaire du v. 9, ch. I). On peut sans aucun doute pratiquer le


renoncement en sacrifiant ce que l'on dsire, mais renoncement ou abandon
(Tyga) veut dire ici absence du dsir de la jouissance (Tygah =
chogechehhbhvah (Ibid.). Ceux qui recherchent les joies d'un ciel quel qu'il soit
ne peuvent jamais atteindre le but du Yoga monistique.

Mumukshu, de celui qui aspire la Dlivrance.


Yama et Niyama sont les deux premiers des huit instruments du Yoga (Ashtmgayoga). Ces instruments, ou
membres, peuvent se classer en cinq mthodes extrieures
(Bahiranga)470, qui s'occupent principalement de la matrise du corps, et trois mthodes intrieures (Antaranga)471, ou tats affectant le dveloppement du mental.
Il est port attention au corps physique, qui est le vhicule de l'existence et de l'activit du Jva. La puret du
mental n'est pas possible sans la puret du corps dans
lequel il fonctionne et par lequel il est affect. La puret du
mental est prise ici au sens hindou.
En langage occidental, une telle puret implique seulement l'absence d'imaginations sexuelles illgitimes. Une
telle conception, quoique louable, particulirement dans
une civilisation qui semble presque calcule pour attiser
tous les dsirs, n'en est pas moins d'une insuffisance vidente pour le but atteindre. La correction de la pense et
de la conduite sous toutes ses formes n'est que l'alphabet
d'une cole qui ne voit en elle que le premier pas vers la
conqute de difficults plus grandes qui doivent suivre. La
puret dsigne ici cet tat du mental, ou une approche de
cet tat, qui est le rsultat d'un fonctionnement harmonieux, d'une pense claire, du dtachement et de la concentration. Par ces moyens le Manas est libr de toutes
les modifications mentales (Vritti) qui enveloppent l'Atm
dtach de Lui-mme. Il est dirig vers l'intrieur, sur la
Buddhi qui se dissout (Laya) en Prakriti, et sur l'Atma470 Yama, Niyama, Asana, Prnyma, Pratyhra.
471 Dhyna, Dhran, Samdhi qui est incomplet (Savikalpa ou Samprajnta) ou

complet (Nirnikalpa ou Asamprajnta).

tattva ou Brahman.
C'est pourquoi l'on s'est proccup aussi bien d'Asana
(la posture) que de Prnyma ou dveloppement du
souffle ; tous deux feront plus loin l'objet d'un bref examen propos du Hathayoga, dont ils constituent des mthodes particulires.
Pratyhra est la matrise des sens par le mental et leur
soumission au mental, qui trouve ainsi la paix 472 (469). Le
mental se retire des objets des sens. Le mental est agit
par nature, car il se trouve chaque instant affect par la
vue, les sons et autres sensations d'objets externes que
peroit le Manas par l'intermdiaire des sens (Indriya). Il
doit donc tre dtach des objets des sens, dtourn de
toute direction qu'il peut lui arriver de prendre, libr de
toute distraction, et maintenu sous le contrle du moi suprieur. La stabilit (Dhairya) est donc le but et le rsultat
de Pratyhra473.
Les trois mthodes connues sous le nom de membres
internes (Antaranga), c'est--dire Dhran, Dhyna et
Savikalpa Samdhi, compltent la discipline psychique et
mentale. Ce sont la concentration du mental sur un objet ;
l'unit du mental et de son objet ralise par la contemplation ; enfin, comme rsultat, la conscience de l'objet
seulement. Dhran consiste se fixer, c'est--dire fixer
472 Voir Gheranda Samhit, Upadesha IV ; Shndilya Up., ch. I ; Amritanda Up. ;

Mandalabrhmana Up., Brhmana. Le Shrad Tlaka dfinit Pratyhra comme


l'imposition d'un obstacle aux sens qui vagabondent sur leurs objets (Indriyvm vicharatm vishayshu bald haranam tebhyah pratyhrah vidhigate). La Shndilya Up. parle des cinq espces de Pratyhra, dont la dernire est
Dhran sur dix-huit points importants du corps.
473 Shndilya Up., ch. I ; Amritanda Up., Mandalabrhmana Up., Brhmana I.

le Chitta, ou principe de la pense, sur un objet particulier


de mditation ou de concentration.
Le mental, ayant t retir des objets des sens par Pratyhra, est fix sur un objet unique, tel que les Devat
des Bhta. La contemplation uniforme du sujet que le
Chitta tient ferme en Dhran est Dhyna (mditation).
Dhyna a t dfini comme l'tat du mental (Antahkarana)
de ceux dont le Chaitanya est fix sur la pense d'un objet
unique et occup par elle seule, ayant d'abord rejet la
pense de tous les autres objets474.
On acquiert par Dhyna la qualit de la ralisation
mentale (Pratyaksha). Il en existe deux espces : Saguna,
ou mditation d'une forme (Mrti) ; et Nirguna, dans laquelle le soi est son propre objet475.
Samdhi, ou l'extase, a t dfini comme l'identification
de Manas et d'Atm comme du sel dans l'eau476, l'tat
dans lequel tout est connu comme ne faisant qu'un
(gal)477, et comme le nectar de l'galit (de l'unit) 478. Le
Samdhi complet est ainsi l'tat de Parsamvit ou Pure
Conscience. Il y a deux degrs de Samdhi : dans le premier (Savikalpa), un degr moindre, et dans le second
474 Vij tiyapratyayatiraskraprvaka-sajtiyavrittikbhihnirantara (vypti) -

vishaykritachaitanyam yasya, tat tdrishara chittam antahkaranam yeshm


(Comm. du v. 35 de la Trishat, sur le titre d'Ekagrachittanirdhyt donn la
Devi). Ceux dont le Chitta ou Antahkarana (sens interne) a t dbarrass de
toutes les impressions dont la nature est d'tre mutuellement en conflit, et ralise ou prouve constamment Chaitanya .
475 Shndilya Up., ch. I ; Mandalabrhmana Up., Io Brhmana.
476 Varha Up., ch. II.
477 Amritanda Up.
478 Yogakundal Up., ch. III.

(Nirvikalpa) un degr parfait, le mental, d'une manire


continue et l'exclusion de tout autre objet, assume la
nature du sujet de sa contemplation et devient un avec
lui.
On distingue dans l'Advaita Vednta trois tats (Bhmik) de Samprajnta (Savikalpa) Samdhi : Ritambhar,
Prajnlok, Prashntavhit479. Dans le premier le contenu de la Vritti mentale est Sachchidnanda. Il y a encore
un connaissant spar. Dans le second toute espce
d'Avarana (cran) est rejete, et il y a Skshtkra Brahmajnna passant au troisime tat de la Paix, dans lequel
le mental est vide de toute Vritti et le soi existe comme le
Brahman seulement 480, lequel tant connu tout est connu. On entre alors en Nirvikalpa Samdhi par le Rjayoga.
Dhran, Dhyna, Savikalpa, Samdhi, dont l'ensemble
est appel Samyama, ne sont que des tapes dans l'effort
mental de concentration, bien que, comme nous le verrons
plus loin, du point de vue du Hathayoga, elles constituent
des progressions dans le Prnyma, chaque stade tant
une plus longue priode de rtention de Prna481.
Ainsi par Yama, Niyama, Asana, le corps est matris ;
par eux et Prnyma le Prna est matris ; par eux et
Pratyhra les sens (Indriya) sont soumis.
Alors, par l'opration de Dhran, Dhyna et le Samd479 Comm. du v. 35 de la Trishat.
480 Ibid. Manasso vrittishnyasya brahmkratay sthitih. Le mental a toujours

des Vritti (modifications), c'est--dire des Guna. Si le mental du Jva en est libr, il est Brahman.
481 Voir Yogatattva Up.

hi du premier degr (Savikalpa ou Samprajnta), les modifications (Vritti) du Manas cessent et Buddhi seule fonctionne.
En poussant plus loin, longuement, la pratique de la srnit et de l'indiffrence la joie comme la douleur (Vairgya), Buddhi elle-mme devient Laya, et le Yogi atteint le
vritable tat sans modifications de l'Atma, dans lequel le
Jva qui est alors pure Buddhi est fondu en Prakriti et le
Brahman, comme le sel dans les eaux de l'ocan et comme
le camphre dans la flamme.
Passons maintenant aux mthodes482 particulires aux
diffrents Yoga.
Le Mantrayoga comprend toutes les formes de Sdhan
dans lesquelles le mental est matris au moyen de son
propre objet, c'est--dire au moyen des multiples objets du
monde du nom et de la forme (Nmarpa). L'univers entier
est compos de noms et de formes (Nmarpatmaka) qui
sont les objets (Vishaya) du mental. Le mental lui-mme
se modifie pour prendre la forme de ce qu'il peroit. On
appelle ces modifications ses Vritti, et le mental n'est pas
un seul instant vide d'ides et de sentiments. C'est le sentiment ou l'intention (Bhva) avec lequel on accomplit un
acte, qui dtermine sa valeur morale.
C'est de ce Bhva que dpend le caractre comme aussi
la conception entire qu'on se fait de la vie. C'est pourquoi
l'on s'efforce de purifier le Bhva. De mme qu'un homme
tomb sur le sol se relve au moyen de ce mme sol, de
mme pour briser les liens du monde la premire m482 Voir deux publications par Shr Bhratadharmamahmandala : Mantrayoga

et Hathayoga, dans les Dharma Prachra Series (Bnars). La seconde, en peu de


pages, explique tout l'essentiel de chacun des quatre systmes.

thode, et la plus facile, est d'utiliser ces liens comme le


moyen de leur propre destruction483. Le mental est troubl
par Nmarpa, mais ce Nmarpa peut tre utilis comme
le premier moyen de lui chapper.
Ainsi, dans le Mantrayoga, une forme particulire de
Nmarpa, productrice de Bhva pur, est donn comme
objet de contemplation. Elle porte le nom de Sthla ou Saguna Dhyna des cinq Devat, et elle est adapte aux diffrentes natures. En dehors des huit membres
(Ashtmga) habituels, communs toutes les formes de
Yoga, certains modes de pratique et de culte sont prescrits.
En ce qui concerne l'adoration, on utilise des moyens
matriels comme premiers degrs pour atteindre l'Un sans
forme par Jnnayoga : par exemple des images (Mrti) 484,
des emblmes (Linga, Shlagrama), des dessins (Chitra),
des marques murales (Bhittirekh), des Mandala et des
Yantra (symboles graphiques485, des Mudr486, des
Nysa487.
En outre le Mantra prescrit est dit (Japa), soit haute
voix, soit tout bas seulement. La source de tout Bija483 C'est l un principe essentiellement tantrique. Voir Kulrnava, ch. II.
484 Le Deva de celui qui n'est pas veill (Aprabuddha) est dans les Images ;

celui du Vipra dans le Feu ; celui du sage dans le Cur. Le Deva de ceux qui connaissent l'Atm est partout. (Kulrnava Tantra, IX, 44.) 0 Toi dont les yeux
sont si beaux ! Ma demeure n'est point dans le Kailsa, le Meru ni le Mandara. Je
suis l o sont ceux qui connaissent la doctrine Kula. (Ibid., v. 94).
485 Voir Mahnirvna Tantra, Introduction.
486 Ibid. Ces Mudr rituels ne doivent pas tre confondus avec les Yoga Mudr

dcrits plus loin.


487 Ibid.

Mantra (Mantra-germe), le Pranava (Om), ou Brahman, est


l'quivalent articul de ce Son primordial qui rsulta de
la premire vibration des Guna de Mlaprakriti, et les
autres Bija-Mantra sont de mme les quivalents des diverses formes de Saguna, Deva et Dev, qui apparurent
ensuite lorsque Prakriti entra dans l'tat Vaishamyvasth.
Dans le Mantrayoga l'tat de Samdhi porte le nom de
Mahbhva. C'est la forme la plus simple de pratique du
Yoga, qui convient ceux que leurs pouvoirs et leurs capacits ne qualifient pas pour l'une des autres mthodes.
Le Hathayoga comprend les Sdhan (mthodes prescrites d'exercice et de pratique), qui se rapportent principalement au corps grossier, ou corps physique (Sthla
Sharra). Comme celui-ci est reli au corps supraphysique ou corps subtil (Skshma Sharra), dont il est
l'enveloppe extrieure, la matrise du corps grossier
s'tend au corps subtil avec son intellect, ses sentiments
et ses passions.
En fait, c'est la destination prcise du Sthla Sharra,
de permettre au Skshma Sharra d'accomplir le Karma
qu'il s'est attir. Le premier tant construit en conformit
avec la nature du second, et les deux tant unis et interdpendants, il s'ensuit que toute opration accomplie dans
et sur le corps grossier affecte le corps subtil ; les mthodes physiques de ce Yoga ont t prescrites pour des
tempraments particuliers, afin que, le corps physique
tant d'abord matris, le corps subtil avec ses fonctions
mentales puisse tre matris aussi488.
488 Voir le bref rsum de la Hathayoga Samhit donn dans les Dharma Prach-

ra Series. (Shr Bhratadharmamahmandala, Bnars.)

Ces pratiques purement physiques ne sont que les auxiliaires d'autres pratiques. Comme dit le Kulrnava Tantra489 : Ni le sige de lotus ni la fixation du regard sur le
bout du nez ne constituent le Yoga. C'est l'identit de
Jvtm et de Paramtma, qui constitue le Yoga .
Les caractres spciaux du Hathayoga peuvent d'abord
tre mis en contraste avec le Mantra Yoga. Ce dernier s'occupe de choses trangres au corps physique, et accorde
une attention spciale des observances et des rites extrieurs. Il enjoint d'accorder le respect qui leur est d aux
lois rglant les castes et les priodes de la vie (Varnshrama Dharma), et aux devoirs respectifs des hommes et des
femmes (Kula Dharma).
Ainsi le Mantra qui est donn l'initi mle ne peut tre
donn une femme. De mme le Mantra donn un
Brahmane ne conviendrait pas un Shdra.
Les objets de contemplation sont les Deva et les Dev
dans leurs diverses manifestations et sous leurs symboles
concrets, et le Samdhi appel Mahbhva s'obtient par la
contemplation et par le moyen de Nmarpa.
Dans le Hathayoga, d'autre part, la question de savoir si
un novice est qualifi ou non est tranche par des considrations physiologiques, et des rgles sont prescrites
dans le but de procurer et d'affermir la sant et de librer
le corps de la maladie. Dans le Hathayoga, la contemplation porte sur la Lumire , et le Samdhi appel Mahbodha s'obtient par la matrise de la respiration et des
autres Vyu vitaux (Prnyma), par laquelle on acquiert
aussi la matrise du mental.
489 IX, 30.

Comme nous l'avons dj observ, Asana et Prnyma,


qui font partie du Hathayoga, font galement partie du
Mantrayoga. Ceux qui pratiquent le second tireront profit
de certains autres exercices du Hathayoga, tout comme les
adeptes du Hathayoga trouveront une aide dans les exercices du Mantrayoga.
Le mot Hatha est compos des syllabes Ha et Tha, qui
signifient le Soleil et la Lune , autrement dit les Vyu
Prna et Apna. Au v. 8 du Shatchakranirpana, il est dit
que le Prna (qui demeure dans le cur) attire Apna (qui
demeure dans le Mldhra), et qu'Apna attire le Prna,
comme un faucon attach par un lien est ramen en arrire lorsqu'il tente de s'envoler. Tous deux, par leur dsaccord, s'empchent mutuellement de quitter le corps,
mais lorsqu'ils sont accords ils le quittent. Leur union ou
Yoga dans la Sushumn, comme aussi la mthode qui
mne ce but, porte le nom de Prnyma.
Le Hathayoga, ou Hathavidy, est donc la science du
Principe de vie490, le mot tant pris au sens des diverses
formes de Vyu vital dans lesquelles se divise Prna. Prna dans le corps de l'individu est une partie du Souffle
Universel, du Grand Souffle . C'est pourquoi l'on s'efforce d'abord d'harmoniser le souffle individuel, connu
sous le nom de Pinda ou Vyashti Prna, avec le souffle
cosmique ou collectif, Brahmnda ou Samashti Prna. On
obtient ainsi la force et la sant. En rglant le souffle harmonis, on rgle et on calme le mental plus facilement, et
l'on parvient plus facilement la concentration.
En correspondance avec la triple division Adhytma,
Adhibhuta, Adhidaiva, le Mental (Manas), Prna (la vitali490 Voir Avalon, Power as Life (Prna-Shakti).

t) et Vrya (la semence) sont un. Aussi la soumission de


Manas entrane la soumission de Prna ou Vyu et de
Vrya. De mme, en matrisant Prna, on obtient automatiquement la matrise de Manas et de Vrya. De mme encore, si le Vrya est matris, et si la substance qui sous
l'influence du dsir sexuel se dveloppe en semence grossire491 est force de s'couler vers le haut (Urdhvaretas),
on obtient la matrise la fois de Manas et de Prna. Avec
Prnyma la semence (Shukra) se tarit. La puissance
sminale s'lve et revient sous la forme du nectar (Amrita) de Shiva-Shakti.
Prnyma est reconnu comme un des membres de
toutes les formes de Yoga. Mais alors qu'il est utilis
comme un auxiliaire dans le Mantra Yoga, le Laya Yoga et
le Raja Yoga, le Hathayogi comme tel considre cette matrise et ce Yoga du souffle comme le principal moyen de
produire ce rsultat (Moksha), qui est le but commun de
toutes les coles de Yoga. Le Hathayoga, se basant sur le
fait que la Vritti ou modification du mental suit ncessairement Prna492, et jugeant cette base suffisante, a affirm
que par l'union de Ha et de Tha dans la Sushumn, et en
conduisant par cette voie les Prna runis jusqu'au
491 Suivant les conceptions hindoues la semence (Shukra) existe sous une forme

subtile dans le corps entier. Sous l'influence de la volont sexuelle elle se retire et
s'labore sous forme grossire dans les organes sexuels. tre Urdhvaretas n'est
pas seulement empcher l'mission de semence grossire dj forme, mais
empcher sa formation sous forme de semence grossire, et son absorption dans
l'ensemble de l'organisme. Le corps d'un homme qui est vritablement
Urdhvaretas a le parfum du lotus. Un homme chaste dans lequel s'est forme de
la semence grossire peut, en revanche, sentir le bouc.
492 Chitta a deux causes : Vsan et Prna. Si l'une est matrise, alors toutes les

deux sont matrises. (Yoga Kundal Up., ch. I.)

Brahmanrandra, on atteignait Samadhi.


Bien que chacun connaisse l'action rciproque de la
matire et du mental, et bien que les tats physiologiques
influencent les tats psychiques ou mentaux comme ces
derniers influencent les premiers, la mthode du Hathayoga est avant tout une mthode physique, les actes physiques grossiers des tapes prparatoires de ce Yoga tant
nanmoins suivis de Kriyjnna et de techniques vitales
subtiles ayant Prna pour thme.
Sous la rubrique des exercices physiques grossiers,
viennent des stipulations relatives au lieu de rsidence, au
mode de vie en ce qui concerne la nourriture, la boisson,
les fonctions sexuelles, l'exercice, etc.
Les pratiques et exercices lis au Hathayoga se divisent
en sept parties ou priodes : la purification (Shodhana)
par les six procds (Shatkarma) ; l'obtention de la force
ou fermet (Dridhat) par des postures du corps (Asana) ;
de la force d'me (Sthirat) par des positions du corps
(Mudra) ; de la paix du mental (Dhairya) par la contrainte
des sens (Pratyhra) ; de la lgret (Lghav) par Prnyma ; de la ralisation (Pratyaksha) par la mditation
(Dhyna) ; et du dtachement (Nirliptatva) en Samdhi.
Ceux qui souffrent de l'ingalit des trois humeurs 493
doivent pratiquer les six actes (Shatkarma) qui purifient
le corps et facilitent Prnyma. Pour d'autres qui sont
exempts de ces dfauts ils ne sont pas ncessaires, et selon certains matres la seule pratique de Prnyma peut
suffire. Ce sont l les premiers pas dans le Hathayoga.
493 Vta, Kapha et Pitta. On en trouvera la description dans A. Avalon : Introduc-

tion au Prapanchasra Tantra (vol. III de Tantrik Texts), et Power as Life.

Par cette purification (Shodhana) du corps et des Nd,


on acquiert la sant, on rend le feu intrieur plus actif, et
la rtention du souffle (Kumbhaka) devient plus facile. On
a aussi recours, s'il est ncessaire, Oshadhiyoga, dans
lequel sont administres des prparations d'herbes pour
raffermir une sant dficiente.
La purification (Shodhana) s'effectue par les six procds connus sous le nom de Shatkarma. Le premier est
Dhauti (lavage), qui est quadruple : lavage interne (Antardhauti) ; lavage des dents, etc. (Dantadhauti) ; du cur
, c'est--dire de la gorge et de la poitrine (Hriddhauti) ; et
de l'anus (Mladhauti). Antardhauti est lui-mme quadruple : Vtasra, par lequel on attire l'air dans le ventre
et ensuite le rejette ; Vrisra, par lequel on remplit d'eau
le corps, puis vacue cette eau par l'anus494 ; Vahnisra,
par lequel on fait toucher au Nbhigranthi la colonne vertbrale (Meru) ; et Vahishkrita, dans lequel le ventre est
par Kkinmudr495 rempli d'air, qui est retenu durant la
moiti d'un Yma496, puis envoy vers le bas.
Dantadhauti est quadruple ; il consiste dans le nettoyage de la racine des dents et de la langue, des oreilles,
494 Les intestins sont vids d'air, et ainsi par l'action des muscles anaux l'eau est

pompe. Elle pntre naturellement pour emplir le vide cr par l'vacuation de


l'air dans les intestins. Un autre acte auquel j'ai assist consiste attirer de l'air
et du liquide dans l'urtre, puis les en chasser. part sa valeur mdicale suppose, en tant que lavement de la vessie, c'est l un Mudr utilis sexuellement et
par lequel le Hathayog aspire en lui-mme les forces de la femme sans mettre
rien de sa force ni de sa substance propres, pratique qui (en dehors de tout autre
motif) est condamnable comme nocive pour la femme qui se fltrit la suite
de ce traitement.
495 Gheranda Samhit, 3o Up. (v. 86) ; voir aussi Hathayogapradpik, II, 21-38.
496 Un Yma a une dure de trois heures.

et du creux du crne (Kaplarandhra). Par Hriddhauti


l'on fait disparatre le phlegme et la bile. On emploie une
baguette (Dandadhauti) ou un morceau d'toffe
(Vsodhauti) que l'on pousse dans la gorge, ou encore on
vomit (Vamanadhauti). Mladhauti a pour but de nettoyer
l'issue de l'Apnavyu, soit avec le majeur et de l'eau, soit
avec une tige de curcuma.
Vasti, le second des Shatkarma, est double : de l'espce
sche (Shushka) ou de l'espce humide (Jala). Dans la seconde forme, le Yogi est assis dans la posture Utkatsana497 dans l'eau jusqu'au nombril, et l'anus est contract
et largi par Ashvin Mudr ; on peut aussi recourir la
Pashchimottnsana498, et l'on fait remuer doucement
l'abdomen au-dessous du nombril.
Dans la Neti, on nettoie les narines avec un morceau de
ficelle.
Laulik consiste faire tourner le ventre d'un ct
l'autre.
Dans le Trtaka le Yogi, sans ciller, fixe quelque menu
objet jusqu' ce que les larmes jaillissent de ses yeux. On
obtient ainsi la vision cleste (Divya Drishti) dont il est
si souvent parl dans les Upsan tantriques.
Kaplabhti est une mthode pour liminer le phlegme,
et comprend trois formes : Vtakrama, par inhalation et
exhalation ; Vytkrama, en aspirant de l'eau par les na497 Gheranda Samhit, 2o Upadesha, v. 23. Cette posture consiste s'accroupir en

reposant sur les orteils, les talons ne touchant pas le sol, et les fesses reposant
sur les talons. Un Hathayog peut, dit-on, se donner un lavement naturel en
s'asseyant dans l'eau et l'aspirant par l'anus. Les muscles du sphincter s'ouvrent
et se ferment, et la succion s'tablit.
498 Ibid., v. 20.

rines et en la rejetant par la bouche ; et Shtkrama, le procd inverse.


Telles sont les diverses mthodes pour nettoyer le corps
et le purifier en vue de la pratique du Yoga.
Asana, la posture, vient ensuite, et lorsqu'on se dispense des Shatkarma, c'est le premier stade du Hathayoga.
Dridhat, la force ou la fermet, dont l'acquisition est la
seconde des pratiques mentionnes ci-dessus, s'obtient
par Asana.
Les Asana sont des postures du corps. On entend gnralement par ce terme des manires d'asseoir le corps.
Mais la posture n'est pas ncessairement assise ; quelques
Asana en effet s'effectuent sur le ventre, sur le dos, sur les
mains, etc.
Il est dit499 que les Asana sont aussi nombreux que les
tres vivants, et qu'il en existe 8.400.000 ; 1.600 sont dclars excellents, et parmi ces derniers trente-deux sont
bnfiques pour les hommes, et dcrits en dtail.
Deux des plus communs sont Muktapadmsana500, la
position ordinaire de l'adoration, et Baddhapadmsana501.
499 Gheranda Samhit, 2o Upadesha. La Shiva Samhit (ch. III, v. 84-91) men-

tionne quatre-vingt-quatre postures, dont quatre sont recommandes : Siddhsana, Ugrsana, Svastiksana et Padmsana. Un autre expos que l'on me
donna en ajoutait quatre : Baddhapadmsana, Trikonsana, Mayrsana,
Bhujangsana.
500 Le pied droit est plac sur la cuisse gauche, le pied gauche sur la cuisse

droite, et les mains sont croises et places de la mme manire sur les cuisses ;
le menton est plac sur la poitrine, et le regard fix sur le bout du nez. (Voir aussi
Shiva Samhit, ch. I, v. 52.)

501 La mme posture, avec cette diffrence que les mains sont passes derrire

Le Kundalyoga s'effectue habituellement dans un Asana et un Mudr dans lesquels les pieds sont presss sur la
rgion du centre gnital et ferment l'ouverture anale, les
mains fermant les autres ouvertures : les narines, les
yeux, les oreilles, la bouche (Yonimudr). Le talon droit est
press contre l'anus et le gauche contre la rgion du
centre gnital, et afin de fermer l'ouverture du pnis, il est
contract et ramen sous la vote du pubis, si bien qu'on
ne le voit plus502. La langue est retourne en arrire en
Khechari Mudr pour fermer aussi la gorge, lorsque ces
deux Mudr sont combins.
Il existe un certain nombre d'autres Asana qui sont particuliers aux Tantra, comme Mundsana, Chitsana et
Shavsana, dans lesquels des crnes, le bcher funraire,
un cadavre503, forment respectivement le sige du Sdhale dos, que la main droite tient l'orteil droit et la main gauche l'orteil gauche. Une
pression accrue s'exerce ainsi sur le Mldhra, et les nerfs sont tendus par cette
tenue serre du corps.
502 Certains Yogi peuvent faire disparatre la fois le pnis et les testicules sous

la vote du pubis, si bien que le corps a l'apparence d'un corps de femme.

503 Quand le Shavsana est couronn de succs la Devi, dit-on, apparat au Sd-

haka. Dans la Shavasdhan le Sdhaka s'assied (en faisant face au nord), califourchon sur le dos d'un cadavre sur lequel il trace un Yantra, puis fait le Japa du
Mantra avec Shodhnysa et Pja sur sa tte. Un cadavre est choisi comme tant
une pure forme de matire organise, puisque la Devat qu'on invoque pour
qu'elle entre en lui est le Mahvidy qui a pour Svarpa Nirgunabrahman, et par
cette invocation devient Saguna. Le cadavre est exempt de pch ou de dsir. Le
seul Vyu qui soit en lui est le Dhananj aya, qui ne quitte pas mme un cadavre
. La Devat se matrialise au moyen du cadavre. Il y a possession de ce dernier
(Avesha), c'est--dire entre de la Devat dans le corps mort. la fin d'un rite
efficace, on dit que la tte du cadavre se retourne et, faisant face au Sdhaka, lui
parle et lui fait prciser sa requte, qui peut concerner un progrs spirituel ou
matriel selon son dsir. Cela fait partie de la Nla Sdhan effectue par le
Hros (Vira), car elle est, comme le Shavsana, accompagne de mainte terreur.

ka. Bien qu'ils aient d'autres objets rituels et magiques, ils


font aussi partie de la discipline pour surmonter la peur et
atteindre l'indiffrence, qualit du Yogi. Ainsi les Tantra
prescrivent pour dcor de tels rites le sommet solitaire
d'une montagne, la maison vide et solitaire, le bord de la
rivire, et le lieu d'incinration. Le lieu d'incinration intrieur se trouve l o le corps kmique, le corps de dsir,
se consume avec ses passions dans le feu de la connaissance504.
Patanjali, au sujet de l'Asana, se contente d'indiquer
quelles sont les bonnes conditions, laissant chacun le
soin de rgler les dtails par lui-mme selon ses propres
besoins.
Asana aide clarifier et corriger la pense. La convenance d'un Asana s'prouve par son degr de stabilit et
d'agrment, chose que chacun rglera par soi-mme. La
posture devient parfaite lorsque cesse l'effort pour y parvenir, si bien qu'il n'y a plus de mouvement du corps505. Le
Rajas Guna, dont l'action produit l'inconstance du mental,
est matris. Un Asana convenable et stable produit l'quilibre mental.
Le Hathayoga, cependant, prescrit un trs grand
nombre d'Asana, chacun desquels est attribu un effet
particulier. Ils sont plus une gymnastique qu'un Asana
dans son sens de posture assise. Certaines formes de cette
gymnastique se pratiquent assis, mais ce n'est pas le cas
pour d'autres, qui se pratiquent debout, courb, tendu,
ou en se tenant sur la tte. Ce dernier est Vrikshsana.
504 Comme dit la Yogakundal Upanishad (ch. III), brler extrieurement n'est

pas brler du tout.


505 Yogastra de Patanjali, 46-47 (Sthirasukham sanam).

C'est ainsi encore qu'en Chakrsana le Yogi se tient debout, se penche et se touche les pieds avec la main, exercice familier, comme aussi Vmadakshinapadsana, sorte
de pas de l'oie, dans lequel, cependant, les jambes sont
releves angle droit avec le corps.
Ces exercices assurent un bon tat physique et librent
de la maladie506. Ils amnent aussi diffrentes parties du
corps dans une position permettant d'tablir entre elles un
contact direct de Prna-vyu. Il est dit aussi qu'ils facilitent Prnyma et aident atteindre son but, y compris
l'veil de Kundalin. L'auteur de l'ouvrage cit en dernier
lieu dit507 que, si parmi les Niyama le plus important est
Ahims, et parmi les Yama Mithra, ou rgime modr (le
choix est significatif), de mme Siddhsana (dans lequel le
Mldhra est press fermement par le talon et le Svdhishthna par l'autre pied) est le plus important parmi les
Asana. Sa matrise aide atteindre l'Unman Avasth, et
les trois Bandha, dont il sera parl plus loin, s'accomplissent sans difficult.
Sthirat, le courage, s'acquiert par la pratique des Mudr508. Les Mudr dont s'occupent les ouvrages de Hathayoga sont des positions du corps509. Ils sont une gymnastique, qui donne la sant, et qui dtruit la maladie et la

506 Voir le ch. II de la Gheranda Samhit, et Hathayogapradpik, I, v. 19-35 ; voir

la Shndilya Up., ch. I.


507 Ch. I, v. 39.
508 Suivant le Commentaire sur le Hathayogapradpik, (ch. IV, v. 37), Mudr est

ainsi nomm parce qu'il supprime peine et chagrin (Mudrayati klesham iti mudr). Cf. ch. III de la Gheranda Samhit.
509 Gheranda Samhit, 3o Upadesha.

mort, comme le Jlandhara510 et autres Mudr.


Ils prservent aussi de tout danger apport par le feu,
l'eau ou l'air. L'action corporelle et la sant qui en rsulte
ragissent sur le mental, et par l'union d'un mental et
d'un corps parfaits, s'obtient Siddhi. Le Mudr est aussi
dcrit comme la clef qui ouvre la porte de Kundalin Shakti. Cela ne veut pas dire, mon avis, qu'il faut ncessairement employer toutes les clefs dans chaque cas, mais
seulement celles qui sont ncessaires pour parvenir au
but dans tel cas particulier ; ce qui est ncessaire dans un
cas peut ne pas l'tre dans un autre.
La Gheranda Samhit dcrit un certain nombre de Mudr, dont (avec les huit Asana mentionns ci-dessus) dix
sont dclars importants dans le Kundal Yoga, Khechar
tant le premier comme Siddhsana est le premier des
Asana.
Dans le Yonimudr, le Yogi en Siddhsana se ferme
avec les doigts les, oreilles, les yeux, les narines et la
bouche, afin d'interdire l'entre toutes les impressions
extrieures. Comme il a dj t dit, il presse de son talon
le Svan ou centre du prine, fermant ainsi l'ouverture
anale et ramenant le pnis dans l'arche du pubis. Il aspire
Prnvyu par Kkinmudr511, et l'unit Apnavyu. Mditant dans leur ordre sur les six Chakra, il veille la Kulakundalin endormie par le Mantra Hum Hamsah 512 .
510 Ibid., v. 12.
511 Les lvres prennent la forme d'un bec de corbeau, et l'on aspire l'air douce-

ment (Gheranda Samhit, III, 86-87).

512 Hm est appel Krcha Bja. Hum est Kavacha Bija Que je sois protg !

Hm reprsente Kma (le dsir) et Krodha (la colre). Kma dsigne ici la volont cratrice (Srishti), et Krodha son contraire, la dissolution (Laya). Les Devat

Par Ham , le Soleil, une chaleur est produite, et l'on


fait jouer cette chaleur sur Kundal Shakti. Par Sah , le
Kma ou vouloir (Ichchh) est rendu actif. L'air vital
(Vyu) dans le Mldhra est sous la forme la fois de la
Lune et du Soleil (Somasryarp). Par Hamsah Elle est
veille, Ham L'animant de sa chaleur, et Sah La soulevant. Il L'lve jusqu'au Sahasrra ; alors, se reprsentant
plein de Shakti, et en union bienheureuse (Sangama) avec
Shiva, le Yogi mdite sur lui-mme comme tant, par suite
de cette union, la Batitude Elle-mme et le Brahman 513.
Ashvinmudr consiste en la contraction et l'expansion
rpte de l'anus en vue de Shodhana, ou en sa contraction pour retenir l'Apnavyu en Shatchakrabheda. Shaktichlana emploie ce dernier Mudr, que l'on rpte jusqu' ce que Vyu se manifeste dans la Sushumn. Shaktichlana est un mouvement du muscle abdominal de
gauche droite et de droite gauche ; le but tant d'veiller Kundalin par ce mouvement en spirale. Cette pratique
s'accompagne d'aspiration et de l'union de Prna et
d'Apna en tat de Siddhsana514.
Le Yoni Mudr s'accompagne de Shaktichlana Mu-

soi-disant irrits ne sont pas irrits au sens ordinaire, mais se trouvent alors
sous leur aspect de Seigneurs de la Dissolution, aspect qui semble irrit ou terrible du point de vue du monde. Il est dit du Trmantra que le Hm est en lui le
bruit du vent soufflant avec force sur le lac Chola, l'ouest du Meru, au moment
o Elle Se manifesta. Hamsah contient Prakriti (Sah) et Purusha (Ham), le
Jvtm. On utilise ce Mantra pour lever Kundalin, et So'ham (Je suis Lui) pour
La faire redescendre. Ham signifie aussi le Soleil (Srya), et Sah la Lune (Indu),
c'est--dire Kma, ou Ichchh.
513 Gheranda Samhit, 30 Upadesha.
514 Ibid., v. 37, 49, 82.

dr515, qui doit tre bien pratiqu d'abord avant d'effectuer


le Yoni Mudr. Le muscle rectal est contract par Ashvin
Mudr jusqu' ce que le Vyu entre dans la Sushumn,
fait qu'indique un bruit particulier que l'on entend l516. Et
avec le Kumbhaka le Serpent s'lve jusqu'au Sahasrra,
veill par le Mantra Hm Hamsah . Le Yogi doit alors
se reprsenter plein de Shakti et dans un tat d'union
bienheureuse avec Shiva. Alors il contemple : Je suis la
Batitude Elle-mme , Je suis le Brahman517 .
Mahmudr518 et Mahvedha s'effectuent conjointement
Mahbandha, dj dcrit. D'abord le Yogi presse le Yoni
(Mldhra) de son talon gauche, et, tendant la jambe
droite, saisit ses deux pieds dans ses deux mains. Il effectue alors Jlandhara Bandha. Lorsque Kundalini est veille, le Prna entre dans la Sushumn, et Id et Pingal,
maintenant que Prna les a quitts, deviennent sans vie.
L'expiration doit se faire avec lenteur, et le Mudr se pratiquer un nombre gal de fois du ct gauche et du ct
droit du corps. Ce Mudr, comme d'autres Hathayoga
Mudr, carte dit-on, la mort et la maladie.
En Mahvedha519, le Yog prend la posture du Mahbandha, et, concentrant son mental, arrte par des mthodes dj dcrites le mouvement ascendant et descendant de Prna. Puis, plaant les paumes de ses mains sur
515 Ibid., III, v. 49-61.
516 Hathayogapradpik, Commentaire du ch. II, v. 72.
517 Le Mantra Hamsah est le souffle retenu en Kumbhaka.
518 Gheranda Samhit, III, v. 37-42. Le Yoni Mudr, qui dtache le Manas du

monde objectif , est dcrit dans le Commentaire du v. 36 du Shatchakranirpana.


519 Ibid., v. 25 et suivants.

le sol, il frappe le sol de ses fesses (Sphich), et la Lune ,


le Soleil et le Feu , autrement dit Id, Pingal et Sushumn, sont unis l'entre du Prna dans cette dernire
Nd. Le corps prend alors un aspect cadavrique, qui disparat avec la lente expiration qui suit. Selon une autre
manire d'veiller Kundalin, le Yogi assis en Vajrsana
tient fermement ses pieds un peu au-dessus des chevilles,
et en frappe lentement le Kanda (voir ci-dessous). On effectue Bhastra Kumbhaka et l'on contracte l'abdomen 520.
Le Khechar Mudr521 consiste allonger la langue jusqu' ce qu'elle atteigne l'espace entre les sourcils. On la
retourne alors dans la gorge, pour empcher la sortie du
souffle pralablement aspir. Le mental est fix dans
l'Ajn522 jusqu' ce que, par Siddhi, cette voie de la Kundal montante (Urdhvakundalin) conquire tout l'univers, qui est ralis dans le corps du Yog comme ne diffrant point d'Atm523.
On dit que parfois le frein est coup, mais que d'autres
peuvent effectuer ce Mudr sans dommage physique empchant de sortir et rentrer la langue sans l'aide de la
main. Dans le Shmbhav Mudr, on garde le mental libre
520 Ibid., ch. III, v. 114 et suivants.
521 Ainsi nomm, suivant la Dhyna bindu Up., parce que Chitta se meut en Kha

(Aksha), et que la langue par ce Mudr entre en Kha.

522 Gheranda Samhit, ch. III, v. 25-27. Il en rsulte la suspension du souffle et

l'insensibilit, si bien que le Yog peut tre enterr sans air, nourriture ni boisson, comme dans le cas du Yogi dont il est parl dans les rapports du Dr. Mac
Gregor et du lieutenant A.H. Boileau, cits dans le Treatise on the Yoga Philosophy de N.C. Paul, p. 46. Dans le ch. IV, v. 80, du Hathayogapradpik, il est dit
que la concentration entre les sourcils est le moyen le plus facile et le plus rapide
d'atteindre l'Unman Avasth. Cf. Shndilya Up., ch. I ; Dhynabindu Up.
523 Yogakundal Up., ch. II.

de Vritti, ou oprant en Siddhsana.


Le terme Mudr comprend aussi ce qu'on appelle les
Bandha (ligatures), mthodes physiques de matrise de
Prna. Trois des plus importantes sont Uddyna, Mla et
Jlandhara524.
Dans la premire, on vide les poumons par une forte
expiration, on les tire contre la partie suprieure du thorax, entranant le diaphragme avec eux, et l'on fait s'lever
le Prna, qui pntre dans la Sushumn. Par le Mlabandha, le Prna et l'Apna s'unissent525 et entrent dans la
Sushumn. Alors on entend les sons intrieurs, autrement dit on sent une vibration, et Prna et Apna, s'unissant avec Nda de l'Anhata Chakra, le Chakra du cur,
vont au cur et sont ensuite unis Bindu dans lAjn.
Dans le Mlabandha, la rgion du prine (Yon) est
presse avec le pied, le muscle rectal est contract (par
Ashvin Mudr), et l'Apna attir vers le haut 526. Le cours
naturel de l'Apna est dirig vers le bas, mais par contraction au Mldhra, on le fait monter par la Sushumn, et
il rencontre Prna. Quand ce dernier Vyu atteint la r-

524 Ibid., ch. III, v. 55-76. Il y a aussi le Mahbandha. Il est dit au ch. II, v. 45, que

Jlandhara doit s'effectuer la fin de Praka ; et Uddyna Bandha la fin de


Kumbhaka et au dbut de Rechaka. Voir aussi Yogakundal Up., ch. I et ch. III, v.
57 : Yogatattva Up., Dhynabindu Up. La Varha Up., ch. V, dit que, Prna volant
toujours vers le haut (Uddyna), ce Bandha, par lequel on arrte son vol, est
appel Uddynabandha. La Yogakundal Up., ch. I, dit qu'il est appel Uddyna
parce que dans ce Bandha Prnah uddyate (monte dans la Sushumn).
525 La Shndilya Up., ch. I, dfinit Prnyma comme l'union de Prna et d'Ap-

na. Nda et Bindu sont ainsi unis.


526 Voir Agamakalpadruma et Dhynabindu Up. La Yogakundal Up., ch. I, dit

qu'on renverse vers le haut la tendance descendante d'Apna en se baissant.

gion du feu au-dessous du nombril527, le feu devient fort et


brillant, tant attis par Apna. La chaleur devient alors
trs puissante dans le corps, et Kundalin, en la sentant,
S'veille de Son sommeil tout comme un serpent frapp
avec un bton siffle et se raidit . Puis l'Apna entre dans
la Sushumn.
Jlandhara Bandha s'effectue par une profonde inhalation, et ensuite une contraction de la rgion thoracique (o
est situ le Vishuddha Chakra), le menton tant maintenu
fermement press contre la naissance du cou une distance d'environ quatre doigts (Anguli) du cur. Il est dit
qu'on lie de cette manire les seize Adhra528 ou centres
vitaux, et le nectar (Bysha) qui s'coule de la cavit audessus du palais529 ; le mme Bandha a aussi pour but de
faire que le souffle devienne Laya dans la Sushumn.
Si l'on contracte simultanment les rgions du thorax et
du prine, et qu'on force Prna descendre et Apna
s'lever, le Vyu entre dans la Sushumn530. Cette union
des trois Nd, Id, Pingal et Sushumn, peut encore tre
effectue par le Mahbandha531, qui aide aussi la fixation

527 Vahner mandalam trikonam nbher adhobhge (Hathayogapradipika.)


528 Voir Comm. du v. 33 du Shatchakranirpana.
529 La Lune est situe dans la rgion palatale prs de l'Ajn. L, sous l'Ajn, se

trouve le Somachakra, et du Somachakra vient un fleuve de nectar qui, selon


certains, a son origine plus haut. Il descend vers le Soleil prs du nombril, qui
l'engloutit. Au moyen de Vipartakarana on intervertit les positions, et le feu
intrieur (Jathargni) augmente. Dans la position Viparta, le Yog se tient sur la
tte.
530 Hathayogapradpik, II, v. 46-47 ; Yogatattva Up., Dhynabindu Up. La Yoga-

kundal Up., ch. I, dit que la contraction de la partie infrieure du corps fait obstacle la monte du Vyu.

du mental dans l'Ajn.


On exerce une pression avec le talon gauche sur la rgion du prine, entre l'anus et le pnis, le pied droit tant
plac sur la cuisse gauche. On inhale le souffle et l'on
place fermement le menton la naissance du cou, au
sommet du sternum, comme dans le Jlandhara, ou, alternativement, on presse fermement la langue contre la
base des dents de devant ; et tandis que le mental est centr sur la Sushumn, le Vyu est contract. Aprs avoir
retenu le souffle aussi longtemps que possible, on doit
l'exhaler lentement. L'exercice de respiration doit s'effectuer d'abord du ct gauche, ensuite du ct droit. L'effet
de ce Bandha est d'arrter la monte du souffle par toutes
les Nd except la Sushumn.
Comme le dit la Dhynabindu Upanishad, le Jva oscille
entre le haut et le bas sous l'influence de Prna et d'Apna, et n'est jamais en repos, tout comme une balle envoye terre avec la paume de la main s'lve de nouveau,
ou comme un oiseau, li son perchoir par une attache,
s'il s'envole est rappel en arrire. Ces mouvements,
comme toutes les autres dualits, sont calms par le Yoga,
qui unit les Prna.
Une fois le corps physique purifi et matris, vient
Prathyhra pour assurer le calme (Dhairya), comme nous
l'avons dj montr. ce moment le Yogi sort du plan
physique, et cherche atteindre l'quilibre et la matrise
du corps subtil. C'est un stade avanc, dans lequel on acquiert la matrise la fois du mental et du corps.

531 Dhynabindu Up., III, v. 19 ; effectu conjointement avec Mahmudr et Ma-

hvedha, dcrits plus loin ; Ibid., v. 25, et Yogatattva Up.

Du cinquime ou Prnyma nat la lgret (Lghava),


c'est--dire la lvitation ou allgement du corps.
L'air respir par la bouche et les narines est l'air matriel (Sthla Vyu). La respiration est une manifestation
d'une force vitale appele Prna Vyu. La matrise de
Sthla Vyu donne la matrise de Prna Vyu (Skshma
Vyu, l'air subtil) ; la technique s'y rapportant est appele
Prnyma.
On traduit frquemment Prnyma par matrise du
souffle . Considrant les mthodes employes, le terme
n'est pas entirement impropre s'il est entendu que
souffle signifie non seulement le Sthla Vyu, mais le
Skshma Vyu. Mais le mot ne vient pas de Prna (le
souffle) et de Yama (la matrise) : il vient de Prna et
d'Ayma, ce dernier terme, selon l'Amarakosha, signifiant
longueur, monte, extension, expansion532 ; en d'autres
termes, c'est le moyen de prolonger, de fortifier, de dvelopper la manifestation ordinaire et comparativement
faible de Prna.
L'opration a lieu d'abord dans le Prna alors qu'il circule par Id et Pingal, et se poursuit par son transfert
dans la Sushumn : on dit qu'alors il s'panouit (Sphurati)533 ou se dploie dans sa plnitude.
Une fois le corps purifi par une constante pratique,
Prna se fraie passage aisment par la Sushumn centrale534. Cessant d'tre le petit sentier de l'exprience quo-

532 Dairghyam yma rohah parinho vishlat (Dictionnaire d'Amarakosha).


533 Commentaire du Hathayogapradipik, III, v. 27.
534 Shemdilya Up., ch. I.

tidienne, il devient la Voie Royale535 qu'est la Sushumn. Ainsi pratique-t-on Sryabheda Kumbhaka jusqu' ce
qu'on sente Prna imprgner tout le corps de la tte aux
orteils ; Ujjy jusqu' ce que le souffle remplisse le corps
de la gorge au cur ; et en Bhastr le souffle est inhal et
exhal rapidement, maintes reprises, comme le forgeron
actionne son soufflet. Il y a matrise du souffle en ce sens
seulement, qu'il est l'objet de certaines pratiques initiales.
Ces pratiques, cependant, ne matrisent pas par restriction, mais par expansion. Le terme le plus appropri pour
rendre Prnyma est donc matrise et dveloppement
du souffle , conduisant l'union de Prna et d'Apna.
Prnyma est pratiqu d'abord en vue de matriser et de
dvelopper le Prna. Ce dernier est ensuite transport
dans Sushumn par l'veil de Kundalin, qui en fermait
l'entre (Brahmadvra). Abandonns par Prna, Id et
Pingal meurent536 , et le Prna dans la Sushumn, au
moyen de la Shakti Kundalin, perce les six Chakra qui
obstruent le passage dans la Brahmand, et finalement
devient Laya dans le Grand Souffle qui est le but dernier
de cette pratique.
Prnyma537 doit tre pratiqu selon les instructions
dictes par le Guru, le Sdhaka suivant un rgime nour535 Prnasya shnyapadavtath rjapathyate (Ibid., v. 2-3).
536 C'est--dire qu'ils se relchent et perdent leur vitalit, comme le fait toute

partie du corps dont se retire la Prna Shakti.

537 La Shndilya Up., ch. I, dit : De mme que les lions, les lphants et les tigres

s'apprivoisent graduellement, de mme le souffle sous une direction convenable


se matrise ; sinon il tue l'exprimentateur . Il ne faut donc pas pratiquer sans
direction. Beaucoup se sont fait du mal, et certains sont morts, la suite d'erreurs dans leurs exercices, qui doivent tre adapts aux besoins de chacun. D'o
la ncessit d'un Guru expriment.

rissant, mais modr, et gardant la matrise de ses sens.


Comme nous l'avons dit dj, le mental et le souffle ragissent l'un sur l'autre, et quand le second est rgl le
mental l'est aussi ; c'est pourquoi l'on cherche une respiration rythme.
Il est dit que Prnnyma ne russit qu'une fois les Nd purifies, sinon le Prna n'entre pas dans la Sushumn538. Le Yogi prenant la posture Padmsana, inhale
(Praka) et exhale (Rechaka) alternativement par la narine
gauche (Id) et par la narine droite (Pingal), retenant le
souffle dans l'intervalle (Kumbhaka) pendant des priodes
graduellement croissantes.
Les Devat de ces lments du Prnyma sont Brahm, Rudra et Vishnu539. Le Prna entre dans Sushumn,
et s'il est retenu assez longtemps, il va, aprs avoir perc
les Chakra, au Brahmarandhra. Les manuels de Yoga parlent de diverses formes de Prnyma selon que l'on
commence par Rechaka ou Praka, ou que le souffle est
brusquement arrt sans Praka ni Rechaka.
Il existe aussi diverses formes de Kumbhaka : par
exemple Sahita Kumbhaka, qui ressemble aux deux premiers mentionns plus haut, et qui doit tre pratiqu jusqu' ce que le Prna entre dans la Sushumn ; et Kevala,
dans lequel le souffle est retenu sans Praka ni Rechaka540.
538 Hathayogapradpik, ch. II, v. 1-6.
539 Dhynabindu Up., et aussi Amritanda Up., Varha Up., ch. V, Mandalabrh-

mana Up.

540 La Shndilya Up., ch. I, dit que par Kevala nat la connaissance de Kundal, et

que l'homme devient Urdhvaretas, c'est--dire que sa force sminale monte vers
le haut au lieu de se dvelopper en semence grossire prcipite vers le bas par

Il en est d'autres encore qui amendent l'excs de Vta,


Pitta et Kapha541 et les maladies qui en drivent ; Bhastr
est un Kumbhaka important, car il opre dans le cas des
trois Dosha542, et il aide le Prna forcer les trois Granthi,
qui sont fermement tablis dans la Sushumn543.
On observera que toutes les mthodes dcrites ou dcrire se rapportent pratiquement un mme objet, l'entre
du Prna dans la Sushumn, pour qu'il devienne ensuite
Laya dans le Sahasrra aprs que la Prna Devat Kundalin a perc les Chakra placs sur sa voie ; car lorsque
Prna s'coule par la Sushumn le mental est calm.
Lorsque Chit est absorb dans la Sushumn, Prna est
immobile544.
Cet objet concerne aussi les mthodes Pratyhra, Dhran, Dhyna et Samdhi ; car si, du point de vue du Rjayoga, elles constituent divers procds et tats mentaux,
du point de vue du Hathayoga, qui s'occupe de la respiration , elles sont des tapes du Prnyma. C'est pourquoi certains ouvrages les dcrivent de manire diffrente
pour les mettre en harmonie avec la thorie et la pratique
du Hatha Yoga, et les expliquent comme des degrs de
Kumbhaka variant par leur dure 545. Ainsi, si le Prna est
retenu pendant un temps donn, ce Kumbhaka reoit le
Apna. Bindu (la force sminale) doit tre conquis, sinon le Yoga ne peut russir.
Sur les Cheda associs Sahita, voir Yogakundal Up., ch. I.
541 Voir Avalon : Introduction au Prapachasra Tantra (Tantrik Texts, vol. III, p.

11 et suiv.).
542 Ibid.
543 Hathayogapradpik, II, 44-75.
544 Yogakundal Up., ch. I.
545 Voir Yoga Stra, d. Manilal Nabhubhai Dvivedi, Ap. VI.

nom de Pratyhra ; si le souffle est retenu plus longtemps, Dhran et ainsi de suite jusqu' l'arrive en Samdhi, qui quivaut la plus longue priode de rtention
du souffle546.
Tous les tres disent l'Ajap Gyatr547, qui est l'expulsion du souffle par Ham-kra, et son inspiration par Sahkra, 21.600 fois par jour. Ordinairement le souffle s'tend
jusqu' une distance gale la largeur de douze doigts,
mais dans le chant, l'alimentation, la marche, le sommeil,
le cot, les distances sont respectivement de seize, vingt,
vingt-quatre, trente et trente-six largeurs.
Au cours d'un exercice violent ces distances sont dpasses, la plus grande distance tant de quatre-vingtseize largeurs. En maintenant le souffle sa distance
normale on prolonge la vie. En le portant au del, on la
raccourcit. Praka est inspiration, et Rechaka expiration.
Kumbhaka est la rtention du souffle entre ces deux mouvements.
Il existe, suivant la Gheranda Samhit, huit sortes de
Kumbhaka : Sahita, Sryabheda, Ujjyi, Shtal, Bhastrik, Bhmmar, Mrchchh et Keval. Prnyma varie de
la mme manire. Prnyma veille Shakti, dlivre de la
maladie, produit le dtachement du monde et la batitude.
Il a des valeurs diverses : suprieure (Uttama), moyenne
(Madhyama) et infrieure (Adhama). Cette valeur se mesure la longueur du Praka, du Kumbhaka et du Rechaka.
546 Voir Commentaire du Hathayogapradpik, ch. II, v. 12.
547 C'est le Mantra Hamsah manifest par Prna. Voir Dhynabindu Up. Hamsah

est Jvtm, et Paramahamsa est Paramtm. Voir Hamsa up.

En Adhama Prnyma elle est respectivement de 4, 16


et 8, ce qui donne un total de 28. En Madhyama elle est le
double, soit 8, 32, 16, total 56.
En Uttama elle est encore le double, soit 16, 64, 32, total 112. Le nombre donn est celui des rcitations du Pranava Mantra. Le Sdhaka passe dans sa Sdhan par
trois stades diffrents qui portent les mmes noms. Adhama produit la transpiration, Madhyama le tremblement,
et Uttama effectu cent fois a, dit-on, pour rsultat la lvitation.
Il est ncessaire que les Nd soient purifies, car l'air
n'entre pas dans celles qui sont impures. Des mois ou des
annes peuvent tre consacrs la purification prliminaire des Nd. La purification des Nd. (Ndshuddhi)
peut tre Samanu ou Nirmanu, c'est--dire avec ou sans
l'usage du Bja Mantra.
Dans la premire forme, le Yogi en Padmsana accomplit Gurunysa suivant les directives du Guru. Mditant
en Yam , il inhale par Id avec Japa du Bija seize fois,
effectue Kumbhaka avec Japa du Bja soixante-quatre
fois, et ensuite expire par la Nd solaire avec Japa du Bja
trente-deux fois. Il fait s'lever le feu de Manipra et l'unit
Prithiv.
Puis vient l'aspiration par la Nd solaire avec le Vahni
Bja seize fois, Kumbhaka avec soixante-quatre Japa du
Bja, suivis de l'expiration par la Nd lunaire et Japa du
Bja trente-deux fois. Il mdite alors sur l'clat lunaire,
fixant l'extrmit de son nez, et aspire par Id avec Japa
du Bja Tham seize fois. Il effectue Kumbhaka avec le
Bja Vam soixante-quatre fois. Il se reprsente alors
comme inond de nectar, et considre que les Nd ont t

laves. Il expire par Pingal avec trente-deux Japa du Bja


Lam, et se considre par l comme fortifi. Il s'assied alors
sur une natte d'herbe Kusha, une peau de daim, etc., et,
tourn vers l'est ou le nord, effectue Prnyma.
Pour le pratiquer il faut, outre Ndshuddhi, le choix
d'un lieu, d'un moment et d'une nourriture favorables.
Ainsi, le lieu ne doit pas tre assez loign pour causer de
l'inquitude, ni dangereux, comme dans une fort, ni dans
une cit ou dans une localit populeuse, ce qui cause de la
distraction. La nourriture doit tre pure et de caractre
vgtarien. Elle ne doit tre ni trop chaude ni trop froide,
ni cre, ni aigre, ni sale, ni amre. Le jene, la consommation d'un seul repas par jour, sont dfendus.
Au contraire, le Yogi ne doit pas rester sans nourriture
pendant plus d'un Yma (trois heures). La nourriture prise
doit tre lgre et fortifiante. Les longues marches et
autres exercices violents sont viter, comme aussi (certainement dans le cas des dbutants) les rapports sexuels.
L'estomac ne doit tre qu' demi rempli. Le Yoga doit tre
commenc, dit-on, au printemps ou en automne.
Comme nous l'avons vu, les formes de Prnyma sont
variables. C'est ainsi que Sahita, qui peut tre avec Bja
(Sagarbha) ou sans Bja (Nirgarbha), se prsente, sous la
premire forme, ainsi qu'il suit : le Sdhaka mdite sur
Vidhi (Brahm), qui est plein de Rajoguna, de couleur
rouge, et l'image d'A-kra ; il inhale par Ida, en six mesures (Mtr) ; avant Kumbhaka il effectue l'Uddynabandha Mudr ; mditant sur Hari (Vishnu) comme Sattvamaya et le Bja noir U-kra, il effectue Kumbhaka avec
soixante-quatre Japa du Bja ; ensuite, mditant sur Shiva
comme Tamomaya et sur son Bja blanc Ma-kra, il expire
par Pingal avec trente-deux Japa du Bja ; puis, inhalant

par Pingal, il effectue Kumbhaka, et expire par Id avec


le mme Bja ; on rpte ces exercices dans l'ordre normal
et dans l'ordre inverse.
Il existe, selon la Gheranda Samhit, trois sortes de
Dhyna (mditation) : Sthla, ou grossire ; Jyotih ;
Skshma, ou subtile548.
Dans la premire la Devat est amene devant le mental. Voici, titre d'exemple, une forme de Dhyna : Que le
Sdhaka pense au grand ocan de nectar flans son cur.
Au milieu de cet ocan est l'le des Gemmes, dont les rivages sont faits d'une poudre de pierres prcieuses. L'le
est couverte d'une fort de Kadamba aux fleurs jaunes.
Cette fort est entoure de Mlati, de Champaka, de Prijta et d'autres arbres odorants. Au milieu de la fort de
Kadamba s'lve le bel arbre Kalpa charg de fraches
fleurs et de fruits. Parmi ses feuilles bourdonnent les
abeilles noires et les oiseaux Koel se poursuivent. Ses
quatre branches sont les quatre Veda. Sous l'arbre est un
grand Mandapa de pierres prcieuses, et l'intrieur une
couche magnifique, sur laquelle il se reprsentera son Ishtadevat. Le Guru lui donnera des directives au sujet de la
forme, du vtement, du Vhana et du titre de la Devat.
Jyotirdhyna infuse le feu et la vie (Tejas) dans la forme
ainsi imagine. Dans le Mldhra repose Kundalin en
forme de serpent. L demeure le Jvtm, pareil la
548 Gheranda Samhit, 6. Upadesha. Bhskararya, dans la Lalit (v. 53), dit qu'il

existe trois formes de la Devi qui participent galement des deux aspects
Praksha et Vimarsha : la forme physique (Sthla), la forme subtile (Skshma) et
la forme suprme (Para). La forme physique a des mains, des pieds, etc., la forme
subtile consiste en Mantra, et la forme suprme est le Vsan, ou, au sens technique du Mantra Shastra, forme propre. Le Kulrnava Tantra divise Dhyna en
Sthla et Skshma (IX, 3), au del desquelles, dit-il, est Samdhi.

flamme effile d'une bougie. Le Sdhaka mdite alors sur


le Tejomaya Brahman (Brahman Lumire), ou, alternativement, entre les sourcils sur la flamme Pranavtmaka (la
lumire qui est Om) mettant son clat.
Skshmadhyna est la mditation sur Kundalin avec
Shmbhav Mudr aprs qu'Elle a t veille. Par ce Yoga
l'Atm est rvl (Atmskshtkra).
Enfin, par Samdhi l'on atteint la qualit de Nirliptatva,
ou dtachement, et ensuite Mukti (la Dlivrance).
Il existe, d'aprs la Gheranda Samhit, six espces de ce
Samdhi Yoga549 :
1. Dhynayogasamdhi, obtenu par Shmbhav Mudr550, dans lequel, aprs mditation sur le BinduBrahman et ralisation de l'Atm (Atmapratyaksha),
celui-ci est rsorb dans le Mahksha ou Grand
ther.
2. Ndayoga, obtenu par Khechar Mudr551, dans lequel on tire la langue jusqu' ce qu'elle atteigne l'espace entre les sourcils, pour l'introduire ensuite dans
la bouche dans une position renverse. Cela peut s'effectuer en coupant ou sans couper le frein.
3. Rasnandayoga, obtenu par Kumbhaka552, dans
lequel le Sdhaka, dans un endroit silencieux, ferme
ses deux oreilles et effectue Praka et Kumbhaka
jusqu' ce qu'il entende Nda en bruits variant de549 7 Upadesha.
550 Ibid., 3 Upadesha, v. 65 et suiv.
551 Ibid., v. 25 et suiv.
552 Ibid., 5 Upadesha, v. 77 et suiv.

puis le chant du grillon jusqu'au bruit d'une grosse


timbale. Une pratique quotidienne fait entendre le
son Anhata, et voir la Lumire (Jyotih) contenant le
Manas, qui se dissout la fin dans le suprme Vishnu.
4. Layasiddhiyoga, accompli par le clbre Yonimudr
dj dcrit553. Le Sdhaka, se reprsentant comme
Shakti et le Paramtm comme Purusha, se sent en
union avec Shiva, jouit avec lui de la batitude qui
est Shringrarasa554, et devient la Batitude ellemme, ou le Brahman.
5. Bhakti Yoga, dans lequel on mdite sur l'Ishtadevat avec dvotion (Bhakti), jusqu' ce que, les larmes
ruisselant par excs de batitude, on atteigne l'tat
extatique.
6. Rjayoga, accompli l'aide de Manomrchchh
Kumbhaka555. Ici le Manas, dtach de tous les objets
terrestres, est fix entre les sourcils dans l'Ajnchakra, et l'on effectue Kumbhaka. Par l'union du
Manas avec l'Atm, dans lequel le Jnn voit toutes
choses, on atteint Rjayogasamdhi.
553 Dans la Lalit (v. 193), la Devi est invoque sous le nom de Layakari, celle

qui cause Laya, l'absorption .


554 Shringra est le sentiment amoureux ou la passion sexuelle, et l'union

sexuelle. Ici, Shrigrarasa est la racine cosmique de ces ralits. C'est le premier
des huit ou neuf Rasa (sentiments) : Shringra, Vra (l'hrosme), Karuna (la
compassion), Adbhuta (l'tonnement), Hsya (la bonne humeur), Bhaynaka (la
crainte), Bbhatsa (le dgot), Raudra (le courroux), auxquels Mammathabhatta,
l'auteur du Kvyapraksha, ajoute Shnti (la paix). Ce dont jouit le Yog, c'est la
batitude suprasensible qui se manifeste sur le plan terrestre comme Shringra
matriel.
555 Gheranda Samhit, 5 Upadesha, v. 82.

Le Hathayogapradpik dit que, la perfection une fois


atteinte dans le Hatha, le corps devient maigre et sain, les
yeux brillants, la semence concentre, les Nd purifies,
le feu intrieur accru, et les sons Nda mentionns plus
haut deviennent audibles556.
Ces sons manent de l'Anhata Chakra dans la rgion
du cur, car c'est l que le Shabdabrahman manifest par
Vyu et associ Buddhi, et de la nature de Nda manifest et dou d'un mouvement spcial (Vishesha Spanda),
existe en tant que langage Madhyam.
Bien que le son (Shabda) ne soit pas distinct et audible
pour les sens grossiers avant de sortir sous forme de langage Vaikhair, on dit que le Yog entend ce Nda subtil
quand, par les divers Bandha et Mudr que nous avons
dcrits, Prna et Apna se sont unis dans la Sushumn.
Ce Prna et ce Nda combins s'lvent et s'unissent
Bindu.
Il existe une mthode particulire qui permet, dit-on, de
parvenir Laya en entendant les diffrents sons corporels557. Le Yogi en Muktsana et avec Shambhav Mudr se
concentre sur les sons entendus dans l'oreille droite ;
puis, aprs avoir ferm les ouvertures des sens par Shanmukhi Mudr et effectu Prnyma, il entend un son
dans la Sushumn.
Il y a quatre tapes dans ce Yoga. Quand le Brahmagranthi a t perc, on entend dans le vide thr
(Shnya) du cur un doux cliquetis d'ornements ; au se556 Ch. II, V. 78.
557 Comme le dit la Ndabindu Up., le son matrise le mental qui vagabonde dans

le jardin (l'agrment des sens.

cond stade le Prna uni Nda perce le Vishnugranthi.


Dans ce dernier, le vide ultrieur (Atishnya) de la rgion
thoracique, on entend des sons pareils ceux d'une timbale. Au troisime stade on entend un bruit de tambour
(Mardala) dans l'Ajn ou Mahshnya, le sige de tous les
pouvoirs (Siddhi).
Puis le Prna, ayant forc le Rudragranthi ou Ajn,
gagne la demeure d'Ishvara. Lorsqu'on parvient au quatrime stade, et que Prna gagne Brahmarandhra, le quatrime tat, Nishpatti, survient.
Aux premiers stades les sons ont de la force, et graduellement ils se font trs subtils. Le mental est tenu l'cart
de tous les objets extrieurs, et centr d'abord sur les sons
sonores, puis sur les sons subtils. Le mental s'unit ainsi
Nda, sur lequel il est fix.
Nda ressemble donc un pige pour attraper un daim
; il ressemble un chasseur qui tue le mental. Il l'attrape
d'abord pour le tuer ensuite. Le mental absorb en Nda
est libr des Vritti558. L'Antahkarana, comme un daim, est
attir par le son des clochettes, et, demeurant immuable,
le Yogi, comme un habile archer, le tue en dirigeant son
souffle par la Sushumn vers le Brahmarandhra, son
souffle qui ne fait plus qu'un avec ce qu'il vise. Chit existe
l'intrieur de ces sons, qui sont ses Shakti, et l'on dit
que par l'union avec Nda le Chaitanya (conscience) qui
resplendit par lui-mme est atteint. Tant qu'un son est
entendu, l'Atm est avec Shakti. L'tat Laya est sans aucun son559.
558 Comme le dit l'Amritanda Up. (v. 24), l'Akshara (l'imprissable) est ce qui

est Aghosha (sans son), ce qui n'est ni voyelle ni consonne et n'est pas prononc.
559 Hathayogapradpik, ch. IV, v. 65-102.

Il existe encore d'autres mthodes560 pour parvenir


Laya, comme le Mantrayoga, ou rcitation de Mantra suivant une mthode particulire.
Le Layayoga est la troisime et la plus haute forme de
Hathayoga. Sachchidnanda, ou Shiva, et Sachchidnanda, ou Shakti, sont tous deux prsents dans le corps, et le
Layayoga consiste matriser Chittavritti en fondant la
Prakriti Shakti dans la Purusha Shakti, suivant les lois
qui gouvernent les corps Pinda (individuel ; Vyashti) et
Brahmnda (cosmique ; Samashti), et en atteignant ainsi
la Dlivrance (Moksha).
Comme les systmes prcdents, le Layayoga possde
des caractres qui lui sont propres561. D'une manire gnrale, le Hathayoga ordinaire s'occupe spcialement,
quoique non exclusivement, du corps physique, de sa
puissance et de ses fonctions ; et il touche le corps subtil
par l'intermdiaire du corps grossier.
Le Mantrayoga s'occupe spcialement, quoique non exclusivement, des forces et des pouvoirs s'exerant hors du
corps, tout en l'affectant. Le Layayoga s'occupe des Ptha
(siges ou centres) suprasensibles, et des forces et fonctions suprasensibles du monde intrieur du corps. Ces
Ptha, siges des Devat, sont les Chakra dj dcrits, depuis le Sahasrra, demeure du Sachchidnanda maya Paramtm sans attache (Nirlipta), jusqu'au Mldhra,
sige de Prakriti-Shakti, appele Kulakundalin dans les
Yoga Shstra.
560 L'Amritanda Up., ch. IV, v. 66, dit que Shiva a donn un quart de crore

(2.500.000) de moyens de parvenir Laya, mais que Nda est le meilleur de tous.
561 Voir Dharma Prachra Series, 9.

L'objet de ce Yoga est donc de prendre cette Shakti pour


la fondre en Purusha, une fois atteint Samdhi. Dans le
Hathayoga la contemplation de la Lumire est particulirement prescrite, bien que, comme nous l'avons not
dj, son Dhyna soit triple.
Dans le Mantrayoga, on contemple les formes matrielles dont l'Esprit Se revt. Aprs que Prakriti-Shakti
sous la forme de Kulakundalin a t, suivant la mthode
du Layayoga, veille par une pratique constante, son reflet se manifeste comme une Lumire entre les sourcils, et
cette Lumire, quand elle est fixe par la pratique et la
contemplation, devient l'objet de Bindudhyna.
Kundal est veille par divers procds Hatha et autres,
dcrits plus loin. Certaines des mthodes suivies sont
communes tous les systmes : ainsi Yama, Niyama,
Asana, bien qu'on en utilise un nombre limit, ainsi que
des Mudr du Hathayoga. Ces procds font partie des
procds physiques (Sthla Kriy), et sont suivis de Prnyma562, Pratyhra, Dhran, Dhyna (sur le Bindu),
qui sont des exercices supraphysiques (Skshm Kriy). Il
s'y ajoute certains traits particuliers au Yoga tantrique. Il
y a, en plus de ceux dj nots, Svarodaya, la science des
Nd ; Panchatattva Chakra, Skshmaprna, et autres
forces internes de la nature ; et le Layakriy, conduisant
par Nda et Bindu au Samdhi, qui est appel Mahlaya.
Laudition des sons est incluse dans Pratyhra, et
dans Dhran l'veil de Kundal. Comme le Japa, ou rcitation du Mantra, est l'lment principal du Mantrayoga,
et Prnyma celui du Hathayoga ordinaire, Dhran,
562 Des diverses formes de Prnyma donnes dans le Hathayoga, deux seule-

ment, dit-on, sont employes dans le Layayoga.

avec ce dernier pour prliminaire, est la partie la plus importante du Layayoga.


Il faut remarquer, toutefois, que Prnyma n'est
qu'une mthode prliminaire pour s'assurer la matrise du
souffle. C'est la porte basse par laquelle celui qui est dj
un matre n'a pas besoin d'entrer. Certains des procds
dcrits ne concernent que la pratique (Sdhan). Un
matre (Siddha) peut, dit-on, faire monter et descendre
Kundal Shakti en une heure.
Il est dit que, de mme qu'Ananta, le Seigneur des Serpents, soutient l'univers entier, Kundalin, par qui le
corps est soutenu563 , soutient toute pratique de Yoga564,
et que, comme on ouvre une porte avec une clef, le Yogi
doit ouvrir la porte de la dlivrance (Moksha), l'aide de
Kundalin (la love)565, qui est connue sous des noms divers : la Shakti, Ishvar (la Souveraine Dame), Kutilng (la
tortueuse), Bhujang (le serpent), Arundhat (aide irrpressible de bonne action)566.
Cette Shakti est la Shakti Suprme (Parashakti) dans le
corps humain, contenant toutes les puissances et assumant toutes les formes. Ainsi la force sexuelle est une de
ces puissances et elle est utilise. Cependant, au lieu de
563 Varha Up., ch. V.
564 Hathayogapradpik, ch. III, v. I : Sarveshm yogatantrnm tathdhr hi

Kundal.

565 Ibid., ch. III, v. 105 : Udghtayet kaptan tu yath kunchikay hatht. Kunda-

liny tath yogi mokshadvram vibhedayet. On trouve le mme vers dans la Gheranda Samhit, ch. III, v. 5.
566 La Yogakundal Up., ch. I, appelle Sarasvat Arundhat, disant que c'est en

L'veillant qu'on veille Kundalini. Lorsque Kundal veut monter, rien ne peut
L'arrter. C'est pourquoi on L'appelle Arundhat, qui est aussi le nom d'une Nd.

descendre l'tat de liquide sminal grossier, elle est conserve sous forme d'nergie subtile, et s'lve Shiva en
mme temps que Prna. Elle devient ainsi source de vie
spirituelle au lieu d'tre une des causes de mort physique.
Avec l'extinction du dsir sexuel, le mental est dlivr de
sa plus puissante entrave567.
Elle, la Puissance du Serpent , dort enroule dans le
Mldhra, fermant de Sa bouche l'entre de la Sushumn appele porte de Brahman (Brahmadvra). Elle dort
au-dessus de ce qu'on appelle le Kanda ou Kandayoni,
dont la longueur et la largeur sont de quatre doigts, et qui
est recouvert d'un doux tissu blanc , c'est--dire d'une
membrane pareille un oeuf d'oiseau. On le situe gnralement deux doigts (Anguli) au-dessus de l'anus (Guda)
et deux doigts au-dessous du pnis (Medhra)568.
De ce Kanda partent les 72.000 Nd qui s'y unissent et
s'y sparent la fois. Kulakundalin est le Shabdabrahman, et tous les Mantra sont Sa manifestation (Svarpavibhti). C'est pourquoi l'un des noms de cette Mantradevat, qui a les lettres pour substance, est Mtrik,
c'est--dire la Gnitrice de tous les univers. Elle est Mtrik, parce qu'Elle est la Mre de tout et l'enfant de personne. Elle est la Conscience cosmique (Jagachchaitanya),
la conscience Virt de l'ensemble du monde569.
567 Yogakundal Up., ch. I.
568 C'est ce qu'indique Yjnavalkya, cit dans le commentaire du v. 113, ch. III,

du Hathayogapradpik, qui fait aussi allusion au Gorakshashataka. Le vers luimme semble fixer sa position entre le pnis et le nombril (Nbhi), douze
doigts (Vitasti) au-dessus du Mlasthna. Kanda dsigne aussi le sige de Prna,
le cur. (Voir Shatchakranirpana, v. 8.)
569 Voir Principles of Tantra, vol. II, ch. 11, 12 et suiv. C'est parce qu'Elle est Man-

De mme que dans l'espace le son est produit par des


mouvements de l'air, de mme dans l'ther l'intrieur du
corps du Jva des courants circulent, dus aux mouvements de l'air vital (Prnavyu), son entre et sa sortie
de l'inhalation et de l'exhalation.
Le v. 12 du Shatchkranirpana dcrit Kundalin comme
la suprme et vnre Parameshvar (Souveraine Dame), le
Kal570 tout-puissant sous la forme de Ndashakti. Elle, la
subtile des subtils, contient en Elle le mystre de la cration571, et le flot d'Ambroisie qui ruisselle du Brahman
sans attribut. Son clat illumine l'univers, et veille la
conscience ternelle572, c'est--dire que tout ensemble Elle
lie, tant Cratrice (Avidy Shakti), et comme Vidy Shakti
est le moyen d'atteindre la Dlivrance.
C'est pourquoi il est dit dans le Hathayogapradpik
qu'Elle donne aux Yogi la dlivrance et l'esclavage aux
ignorants. Car celui qui La connat, connat le Yoga ; et
ceux qui ignorent le Yoga demeurent esclaves de cette vie
terrestre. Comme le disent les v. 10 et 11 du Shatchakranirpana : Elle, la Charmeuse du monde, est brillante
comme l'clair ; Son doux murmure est pareil au bourdonnement confus d'essaims d'abeilles amoureuses 573.
tradevat qu'Elle est veille par le Mantra.
570 Sur les Kal, voir Avalon, The Garland of Letters.
571 Elle est la cration mme (Srishtirp), en Elle sont la cration, la prserva-

tion et la dissolution (Srishtisthitilaytmik).


572 Car Elle est aussi au del de l'univers (Vishvtt), et Elle est la Conscience

elle-mme (Jnnarp). Comme telle, on se La reprsente S'levant, tandis que


descendante Elle cre et enchane.
573 Vishvantha, le commentateur, dit qu'Elle produit ce son lorsqu'Elle est

veille. Selon le commentateur Shankara, cela indique l'tat Vaikhar de Kunda-

Elle est la source de tout Langage. C'est Elle qui maintient


en vie tous les tres du monde par l'inspiration et l'expiration574, et brille au creux du lotus Mla comme une
chane de resplendissantes lumires .
Les Mantra sont dans tous les cas des manifestations
(Vibhti) de Kulakundalin Elle-mme, car Elle est toutes
les lettres et Dhvani575 et le Paramtm Lui-mme. C'est
pourquoi l'on utilise les Mantra pour veiller Kundalin. La
substance des Mantra est le Shabda ou Conscience ternelle, bien que leur apparence et leur expression soient
des mots. Les mots en eux-mmes semblent sans vie
(Jada), mais la puissance du Mantra qu'ils enveloppent est
Siddha, la vrit, et peut enseigner cette dernire, tant
une manifestation de Chaitanya, qui est Satya Lui-mme.
Ainsi le Veda, qui est le Brahman sans forme (Amrti)
sous la forme du Veda (Vedamrti), est le Principe d'exprience (Chit)576 lui-mme, par soi-mme illumin, et se rvle en mots (Siddhashabda) qui n'ont pas d'auteur humain (Apaurusheya)577, rvlant incessamment la connaislin.
574 Ainsi, on dclare que Prna et Apna maintiennent l'tre anim. (Shatcha-

kranirpana, v. 8.)
575 Voir Principles of Tantra, vol. II, ch. XI et XII.
576 Le Veda ne fait qu'un avec Chaitanya. Comme le dit Shankara (comm. de la

Trishat, v. 19), traitant du Panchadash Mantra : Sarve ved yatra ekam bhavanti, etc. Shruty vedasya tmbhedena svaprakshatay.
577 Et parce qu'il n'a pas d'auteur humain et qu'il est entendu seulement, le

Veda est appel Shruti ( ce qui est entendu ) : Shruyate eva na tu kena chit
kriyate (Vchaspati Misra dans la Snkhya Tattva Kaumudi) ; cf. le Yamala cit
dans la Prnatoshin, 19 : Le Veda est Brahman ; il est sorti de Lui comme Son
souffle .

sance578 de la nature de Brahman, de ltre pur, et de


Dharma579, principes et lois, physiques, psychiques et spirituelles, qui soutiennent l'univers (Dhryate).
Et ainsi la Mre Divine est dite connaissance de Brahman (Brahmavidy) sous la forme de cette exprience immdiate580 qui est le rsultat de la ralisation des grandes
paroles vdantiques (Mahvkya)581. Comme, malgr l'existence d'une conscience sensible en toutes choses, elle ne
se manifeste pas sans des procds particuliers, ainsi,
bien que la substance des Mantra soit conscience sensible, cette conscience sensible n'est pas perceptible sans
l'union de la Shakti du Sdhaka avec Mantrashakti, union
obtenue par Sdhan.
C'est pourquoi il est dit dans le Shrad Tilaka : Bien
que Kulakundalin, dont les Mantra sont la substance,
brille vive comme l'clair dans le Mldhra de chaque
Jva, pourtant c'est seulement dans le lotus du cur des
Yog qu'Elle Se rvle et danse dans Sa joie. (Dans les
autres cas, bien que prsente sous forme subtile), Elle ne
Se rvle point.
Elle a pour substance tous les Veda, tous les Mantra et
tous les Tattva. Elle est la Mre des trois formes d'nergie,
le Soleil , la Lune et le Feu , et Shabdabrahman
578 Le terme Veda drive de la racine Vid, connatre.
579 Selon le Vedanta, le Veda est cette parole sans auteur humain qui parle de

Brahman et de Dharma : Dharmabrahmapratipdakam apaurisheyam vkyam.


580 Skshtkra, l'exprience du Nirvna (Aparoksha-jnna), oppose la con-

naissance indirecte (Paroksha) ou purement intellectuelle.

581 Vednta-mahvkyajanya-skshtkrarpa-brahmavidy (Comm. de Shan-

kara sur la Trishat, v. 8). Vednta veut dire ici Upanishad, et ne dsigne aucune
philosophie particulire de ce nom.

Lui-mme . Kundalin est donc la plus grande manifestation de la puissance cratrice dans le corps humain. Kundal est le Shabdabrahman, autrement dit Atm sous
forme de Shakti manifeste, dans les corps, et en toute
puissance, toute personne et toute chose. Les Six Centres
avec tous leurs dveloppements sont Sa manifestation.
Shiva demeure dans le Sahasrra. Ce dernier est le
Shrchakra, le Chakra suprieur, et les six centres sont les
Chakra infrieurs. Pourtant Shakti et Shiva ne font qu'un.
C'est pourquoi le corps de Kundalin Shakti comprend
huit parties (Anga) : les six centres de force psychique et
physique, Shakti, et Sadshiva Son Seigneur582.
Au Sahasrra Kundal se fond dans l'Atm-Shakti suprme. Kundalin est la grande Prnadevat, Seigneur de
la vie, qui est Ndtm, et pour que monte Prna par la
voie du milieu , la Sushumn, vers le Brahmarandhra, il
doit ncessairement percer les lotus ou Chakra qui en
barrent le chemin. Kundalin tant Prnashakti, si Elle Se
meut Prna se meut.
On utilise Asana, Kumbhaka, Bandha et Mudr pour
veiller Kundalin, pour que le Prna, retir d'Id et Pingal, puisse, par la puissance de sa Shakti, tant entr
dans la Sushumn ou le vide (Shnya), s'lever vers le
Brahmarandhra583. Il est dit qu'alors le Yog est libr du
Karma actif, et atteint l'tat naturel584.

582 Voir le Comm. de Lakshmdhara sur le v. 9 de l'Anandalahar. Dindima, au

sujet du v. 35 du mme ouvrage, dit que les huit formes sont les six (du mental
la Terre ), le Soleil et la Lune.
583 Hathayogapradpik, ch. IV, v. 10.
584 Ibid., v. 11 ; sur ce qui suit, voir aussi le ch. IV.

Il s'agit donc de dvitaliser le reste du corps en faisant


passer le Prna d'Id et Pingal dans Sushumn, qui pour
cette raison est considre comme la plus importante de
toutes les Nd et la joie du Yogi , puis de le faire monter
travers les lotus qui s'panouissent son approche.
Le corps, de part et d'autre de la colonne vertbrale, est
dvitalis, et tout le courant de Prna s'engouffre dans
cette colonne.
On dit que l'tat Manonman apparat la dissolution
(Laya) de Prna, car celle-ci est suivie du Laya de manas.
En s'exerant chaque jour retenir Prna dans Sushumn, on affaiblit l'effort naturel du Prna pour suivre ses
canaux ordinaires et l'on pacifie le mental. Car s'il y a
mouvement (Parispanda) du Prna, il y a mouvement du
mental ; autrement dit, il se nourrit des objets (Yishaya)
du monde objectif.
Mais quand Prna est dans Sushumn il n'y a ni jour
ni nuit , car Sushumn dvore le temps 585 . Lorsqu'il y
a mouvement de Prna (Prnaspanda), il n'y a aucun arrt
de Vritti, le fonctionnement du mental. Et, comme le dit le
Yogavshishtha, tant que le Prna ne cesse point d'exister
il n'y a ni Tattvajnna ni destruction de Vsan, la cause
subtile de la volont de vie qui est la cause des renaissances. Car Tattvajnna, la connaissance suprme, est la
destruction de Chitta et de Vsan586.
La rtention du souffle fixe aussi la semence. Car la
semence circule aussi longtemps que le Prna. Et quand
la semence n'est pas arrte le mental n'est pas arrt 587.
585 Ibid., v. 16-17 et leur Comm.
586 Ibid., v. 19-21 et Comm. (Tattvajnnam mano-nsho vsankshaya eva cha.)
587 Voir plus haut, et Varha Up., ch. V.

Le mental ainsi exerc se dtache du monde. Ces divers


rsultats s'obtiennent, dit-on, par l'veil de Kundalin, et
par les pratiques ultrieures dont Elle est la clef . De
mme qu'on ouvre une porte avec une clef, de mme le
Yogi ouvre la porte de la Dlivrance avec Kundalin588 .
Car c'est Elle qui dort dans le Mldhra, fermant avec Sa
bouche le canal (Sushumn) par lequel on peut monter au
Brahmarandhra. Il faut ouvrir ce canal, et alors le Prna y
entre naturellement. Elle, la jeune veuve , doit tre dpouille de force . Une pratique quotidienne est prescrite,
en vue d'acqurir le pouvoir de manier cette Shakti589.
Il faut gnralement des annes de cette pratique pour
conduire la Shakti au Sahasrra, bien que dans des cas
exceptionnels cela puisse s'accomplir en peu de temps 590.
On ne peut d'abord La conduire que jusqu' un certain
point, puis progressivement plus haut. Celui qui L'a conduite un centre particulier peut atteindre plus facilement le mme centre la tentative suivante. Mais monter
plus haut exige un nouvel effort. chaque centre on
prouve une espce particulire de batitude (Ananda), et
l'on obtient, dit-on, des pouvoirs particuliers, comme la
matrise des formes lmentaires de la matire sensible
(Bhta), pour avoir enfin, au centre Ajn, l'exprience de
l'univers entier.
Aux premiers stades, en outre, l Shakti a une tendance
naturelle revenir en arrire. Par une pratique continue
on acquiert l'aisance et mie matrise plus grande. Si les
588 Hathayogapradpik, ch. III, v. 106. Voir aussi Bhtashuddhi Tantra, cit dans

le Comm. du v. 50 du Shatchakranirpana.
589 Ibid., ch. III, v. 112 et suiv.
590 Selon le rapport du Yog d'un Girnar parlant de son propre cas.

Nd sont purifies il est facile de La faire descendre mme


du Sahasrra. Le Yog accompli peut rester aussi longtemps qu'il le veut dans le Sahasrra, o l'on prouve la
mme batitude que dans la Dlivrance (et qui dans ce
dernier cas peut revenir), ou bien il peut se transporter
dans un autre corps, pratique connue la fois des Tantra
hindou et tibtain : dans ce dernier, elle porte le nom de
phowa.
Le principe de toutes les mthodes ayant pour but d'atteindre Samdhi est de faire sortir le Prna d'Id et Pingal. Une fois cela accompli, ces Nd deviennent mortes
, la vitalit s'en est retire. Le Prna entre alors dans la
Sushumn et, aprs avoir perc, l'aide de Kundalin, les
six Chakra de la Sushumn, devient Laya, absorb dans le
Sahasrra.
Les moyens de parvenir ce but, lorsqu'on opre partir du Mldhra, semblent varier dans le dtail, mais
contiennent un principe commun : il s'agit de forcer Prna
descendre et Apna monter591, au rebours de leur direction naturelle, par le Jlandhara et le Mla Bandha, ou
autrement, pour accrotre par leur union le feu intrieur.
Tout semble se passer comme dans un tube creux dans
lequel un piston fonctionne aux deux extrmits, sans que
puisse s'chapper l'air central, qui est ainsi chauff. Alors
la Puissance du Serpent, Kundalin, veille par la chaleur
ainsi produite, sort de Son tat potentiel, appel sommeil
, o elle repose love ; alors Elle siffle et Se redresse, et
entre dans le Brahmadvra, dans la Sushumn, puis par
des efforts rpts perce les Chakra de la Sushumn.
591 Voir Varha Up., ch. III.

C'est une monte graduelle qui s'accompagne de difficults spciales aux trois nuds (Granthi) o Myshakti
est puissante, particulirement au nud abdominal, dont
on admet que la perce peut impliquer une douleur considrable, des dsordres physiques et mme la maladie.
Comme nous l'avons expliqu dj, ces nuds sont les
points o convergent les Chakra de chacun des trois
groupes. Quelques-unes des pratiques mentionnes cidessus sont dcrites dans le Shatchakranirpana, qu'on
peut sur ce point rsumer comme il suit.
Le verset prliminaire (et dans mes rfrences aux versets je comprends le commentaire) dit que ceux-l seulement qui ont la connaissance des Six Lotus peuvent agir
sur eux ; et le premier verset dit que le Yoga, au moyen de
la mthode ici dcrite, ne peut tre accompli sans la connaissance des Chakra et des Nd.
Le premier verset dit que le Brahman veut tre ralis.
La question qui se pose alors est celle-ci : Comment accomplir cela ? Le Commentateur du verset prliminaire dit
que le trs misricordieux Prnnanda Swmi, dsireux
de secourir le monde enfonc dans le bourbier de la misre, a entrepris la tche, d'abord de l'instruire de l'union
de la Shakti Kundalin avec les centres vitaux, ou Chakra,
et ensuite de rvler cette connaissance de Brahman
(Tattvajnna) qui conduit la Dlivrance.
La premire de ces sciences, celle concernant les Chakra, est la premire pousse de la plante du Yoga.
Brahman, comme le dit le Commentateur, est la Conscience Suprme qui nat de l'acquisition de la connaissance. Le premier moyen de cette connaissance est de savoir et de pratiquer la Sdhaka du Yoga tantrique qui s'occupe des Chakra, des Nd et de Kundalini ; le suivant est

la ralisation de cette Sdhaka par l'veil de Kundalini ; et


le rsultat final est l'exprience de Brahman, effet de l'action de Kundalini, qui est la Shakti ou puissance de la Volont (Ichchh), de l'Action (Kriy) et de la Connaissance
(Jnna), et qui existe la fois sous les formes subtile et
grossire.
Le mental est une des formes de Kundal tout comme
celle qui est appele matire . Toutes deux sont galement des produits de Prakritishakti, qui est une forme
plus grossire de la Ndamay Shakti. Kundal prend la
forme des huit Prakriti592. La Puissance qui est veille est
en elle-mme (Svarpa) Conscience, et une fois veille et
conduite au centre crbral suprieur donne la connaissance vritable (Svarpa Jnna), qui est la Conscience
Suprme.
L'veil de cette force s'effectue la fois par la volont et
par la puissance du mental (Yogabala), accompagnes
d'une action physique approprie. Le Sdhaka593 s'assied
dans l'Asana prescrit et pacifie son mental par le Khechar
Mudr, dans lequel la concentration s'effectue entre les
sourcils. L'air est inhal (Praka), puis retenu (Kumbhaka). La partie suprieure du corps est alors contracte par
Jlandharabandha594 si bien que le souffle ascendant
(Prna) est arrt. Cette contraction empche de s'chapper l'air inhal. L'air ainsi arrt tend vers le bas. Quand
le Yogi sent que l'air qui est en lui, de la gorge au ventre,
tend vers le bas par les canaux des Nd, Vyu qui allait
592 Shndilya Up., ch. I ; Yogakundal Up., ch. I.
593 Le prsent expos suit le texte en l'amplifiant. Voir Comm. du v. 50 du Shat-

chakranirpana.
594 Voir plus haut, et Dhynabindu Up.

s'chapper comme Apna en est encore empch par le


Mlabandha et l'Ashvin Mudr, dans lequel on contracte
le muscle anal.
L'air (Vyu) ainsi accumul devient un instrument au
moyen duquel, sous la direction du mental et de la volont, les potentialits de la force vitale contenue dans le Mldhra peuvent tre ralises de force. La technique de
concentration mentale sur ce centre est dcrite comme il
suit. Avec Japa mental du Mantra prescrit et l'acquisition
par ce moyen de Mantrashakti, Jvtm (la Conscience
individuelle), qu'on se reprsente sous la forme de la
flamme effile d'une lampe, est amen de la rgion du
cur dans le Mldhra.
Le Jvtm dont il est ici question est l'Atm du corps
subtil, c'est--dire l'Antahkarana, ou le mental en tant que
Buddhi (en comprenant dans celle-ci Ahamkra) ; Manas,
les facults sensibles (Indriya) ou le mental oprant pour
recevoir des impressions par l'intermdiaire des organes
des sens ; et Prna595 : lments constitutifs de la seconde,
de la troisime et de la quatrime enveloppes corporelles.
Aprs cette concentration et cette pression du Vyu retenu sur ce centre, on fait monter de nouveau le Vyu
avec le Bja Yam . On fait effectuer une rvolution de
gauche droite l' air de Kma ou Kandarpa (Kmavyu)596. C'est l une forme d'Ichchh Shakti. Celle-ci,
la pression du Prna et de l'Apna retenus en Kumbhaka,
la chaleur naturelle qui en rsulte, et le Vahni Bja (Man595 Suivant la dfinition du Vednta ; ou, suivant le Snkhya, les cinq Tanmtra.

Le Chitta (le mental) entre donc dans la Sushumn avec Prna. (Yogatattva Up. et
Dhynabindu Up.).
596 Une forme d'Apna Vyu.

tra du Feu) Ram , attisent le feu de Kma (Kmgni). Le


feu encercle et rveille le serpent endormi Kundalin, qui
est alors, suivant l'expression du Shstra, prise du dsir
passionn de Son poux, le Parahamsah ou Paramashiva. Shakti, ainsi rendue active, est attire vers Shiva,
comme cela se passe dans le cas des charges d'lectricit
positive et ngative ordinaires, qui ne sont que des manifestations diffrentes de la polarit universelle caractristique du inonde manifest.
La Yogakundalin Upanishad597 indique les mthodes
qui suivent, et d'autres que nous mentionnons. Quand
Prna passe par Id, prenez la pause Padmsana et allongez de quatre l'Aksha de douze points ; autrement dit,
comme dans l'exhalation Prna sort en seize mesures, et
dans l'inhalation entre en douze, inhalez pendant seize
mesures et gagnez ainsi de la puissance. Puis, vous tenant
les cts de chaque main, dressez Kundalin de toute votre
force de droite gauche, sans crainte, pendant quarantehuit minutes. Relevez un peu le corps pour laisser Kundal
entrer dans la Sushumn.
Le Yog effectue un mouvement de redressement dans
lequel il relve et laisse retomber les paules. Prna entre
de lui-mme avec Elle. Pressant vers le haut et se rpandant par en bas, et inversement, Prna s'lve.
Il est dit dans le Commentaire du v. 32 de l'Anandalahar598 : Le soleil et la lune, de mme qu'ils se meuvent
toujours en Devayna et Pitriyna (orbes septentrional et
mridional) dans le macrocosme, voyagent (incessamment
597 Ch. I.
598 Anandalahar, d. par le Pandit R. Ananta Shstri, pp. 69 et 70.

dans le microcosme) par Id et Pingal jour et nuit. La


lune, voyageant toujours par la gauche (Id), arrose de son
nectar tout le systme. Le soleil, voyageant par la Nd
droite (Pingal), dessche le systme (humidifi par ce nectar).
Quand le soleil et la lune se rencontrent au Mldhra,
ce jour porte le nom d'Amvasy (jour de la nouvelle
lune)... La Kundal aussi dort en Adhrakunda... Lorsqu'un Yog dont le mental est matris est capable de
maintenir la lune sa place propre, comme aussi le soleil,
alors la lune et le soleil deviennent fixs, et par suite la
lune ne peut verser son nectar ni le soleil le desscher.
Ensuite, quand la place du nectar est dessche par le feu
l'aide de Vyu, alors la Kundal s'veille par manque de
nourriture et siffle comme un serpent. Puis, forant les
trois nuds, Elle court au Sahasrra et mord le Chandra
(lune)599 qui est au milieu de ce dernier. Alors le nectar
commence couler, et baigne l'(autre) Chandra Mandala
dans l'Ajnchakra. De celui-ci le corps entier reoit un flot
de nectar. Puis les quinze ternels Kal (parties) de Chandra dans l'Ajn vont Vishuddhi et s'y meuvent.
Le Chandra Mandala du Sahasrra porte aussi le nom
de Baindava. Un Kal y demeure toujours. Ce Kal n'est
autre chose que Chit Lui-mme, qu'on appelle aussi Atman. Nous L'appelons Tripurasundar. Par quoi l'on veut
dire que, pour veiller la Kundal, il faut oprer dans la
quinzaine lunaire seulement, et non dans la solaire .
Kundalin est conduite vers le haut comme un cavalier
guide par les rnes une jument entrane , par l'ouverture
jusqu'alors ferme par Ses propres replis, mais dsormais
599 Voir le diagramme de la couverture.

libre, l'entre de la Chitrin Nd. Elle perce alors, dans


cette Nd, chacun des lotus, qui dressent la tte lorsqu'Elle les traverse.
Lorsque Kundalini, unie au Jvtm subtil, traverse
chacun de ces lotus, Elle absorbe en Elle les Tattva qui
rgissent chacun de ces centres, et tout ce que plus haut
nous avons montr en eux. Durant cette monte, chacun
des Tattva grossiers entre dans l'tat Laya, et il est remplac par l'nergie de Kundalin, qui aprs le passage du
Vishuddha Chakra les remplace tous.
Les sens qui oprent en association avec ces Tattva
grossiers se fondent en Elle, qui absorbe ensuite en Elle
les Tattva subtils de l'Ajn. Kundalin Elle-mme prend un
aspect diffrent mesure qu'Elle gravit les trois plans, et
S'unit chacun des Linga sous la forme d'Elle-mme qui
est approprie cette union. Car, tandis que dans le Mldhra Elle est la Shakti de tout en son tat manifest
grossier ou physique (Virt), l'tape d'Ajn, Elle est la
Shakti du corps mental et psychique, ou subtil (Hiranyagarbha), et dans la rgion du Sahasrra Elle est la Shakti
du plan spirituel (Ishvara), qui, bien que lui-mme indiffrenci sous son aspect Shiva, contient sous son aspect Puissance tous les plans infrieurs l'tat potentiel et
cach.
Le My Tantra600 dit que les quatre Shakti productrices
de son, savoir Par, Pashyant, Madhyam et Vaikhair,
sont Kundal Elle-mme (Kundalinyabhedarp). Ainsi,
quand Kundal s'lance pour monter au Sahasrra, sous
Sa forme de Vaikhair, Elle enchante Svayambhu Linga ;
puis Elle enchante de mme Bna Linga dans le cur
600 Voir Shatchakranirpana, v. 51.

sous Sa forme de Madhyam et Itara Linga dans les sourcils sous Sa forme de Pashyant. Puis, lorsqu'Elle arrive
l'tape de Parabindu, Elle atteint l'tat de Par (Parbhva).
Le mouvement ascendant va du grossier au subtil, et
l'ordre de dissolution des Tattva est le suivant : Prithiv
avec ses Indriya (l'odorat et les pieds), ces derniers ayant
pour support Prithiv (la terre en tant que sol), se dissout
en Gandha Tattva, le Tanmtra de l'odorat, qui est dans le
Mldhra ; Gandha Tattva est alors conduit au Svdhishthna, et lui, Ap, et les Indriya qui lui sont associs (le
got et les mains), se dissolvent en Rasa Tanmtra (le
Tanmtra du got) ; celui-ci est conduit au Manipra et l
Rasa Tattva, Tejas, et les Indriya qui lui sont associs (la
vue et l'anus) se dissolvent en Rpa Tanmtra, le Tanmtra de la vue ; puis celui-ci est conduit 1'Anhata, et lui,
Vyu, et les Indriya qui lui sont associs (le toucher et le
pnis) se dissolvent en Sparsha Tanmtra, le Tanmtra du
toucher ; celui-ci est conduit au Vishuddha, o lui,
Aksha, et les Indriya qui lui sont associs (l'oue et la
bouche) se dissolvent dans le Shabda Tanmtra, le Tanmtra du son ; celui-ci est alors conduit l'Ajn, et, l et
plus haut, lui et Manas se dissolvent en Mahat, Mahat en
Skshma Prakriti, et cette dernire s'unit Parabindu
dans le Sahasrra.
Dans le cas de cette dernire absorption, il y a divers
stades qui sont mentionns dans le Shatchakranirpana601, par exemple absorption de Nda en Ndnta, de
Ndnta en Vypik, de Vypik en Saman, de Saman en
Unman, et de cette dernire en Vishnuvaktra ou Pumbin601 Ibid., v. 52.

du, qui est aussi Paramashiva602. Quand toutes les lettres


ont t dissoutes de cette manire, les six Chakra sont
dissous, les ptales des lotus portant les lettres.
Au cours de ce mouvement ascendant, Brahm, Svitr,
Dkin, les Deva, Mtrik et Vritti du Mldhra, s'absorbent en Kundalin, comme aussi le Mahmandala ou Prithiv, et le Prithiv Bja Lam dans lequel il passe. Car
ces Bija, ou puissances de son, expriment l'aspect de
Mantra subtil de ce qui se dissout en eux. Ainsi la terre
sort de sa semence (Bja) et se dissout en elle, ce germe
tant l'aspect particulier de la conscience cratrice, qui lui
donna son mouvement. Le Mantra prononc (Vaikhair
Shabda), ou Lam , est son expression en son grossier.
Quand la Dev quitte le Mldhra, ce lotus, qui en raison de l'veil de Kundalin et de la vivifiante intensit du
courant prnique s'tait ouvert et avait tourn sa fleur
vers le liant, se referme et penche la tte.
Quand Kundalin atteint le Svdhishthna, ce lotus
s'ouvre et redresse la tte. Son entre, Vishnu, Lakshm,
Sarasvat, Rkin, les Mtrik et les Vritti, Vaikunthadhma, Goloka, avec le Deva et la Dev qui y rsident, sont
dissous dans le corps de Kundalin.
La Prithiv, le Bja de la terre Lam , sont dissous dans
le Tattva de l'eau, et l'eau convertie en son Bja Vam
reste le corps de Kundalin. Quand la Dev atteint le Chakra Manipra ou Brahmagranthi, tout ce qui est dans ce
Chakra se fond en Elle. Le Bja de Varuna, Vam , se dissout en feu, qui demeure dans Son corps comme le Bja
Rani .
602 Sur toutes ces Shakti du Pranava, voir Avalon, Garland of Letters.

La Shakti atteint ensuite le Chakra Anhata, qui est


connu comme le nud de Vishnu (Vishnugranthi), dont
tout le contenu se fond de mme en Elle. Le Bja du Feu,
Ram , se sublime en air, et l'air converti en son Bja Yam
s'absorbe en Kundalin. Elle monte ensuite la demeure
de Bhrat ou de Sarasvat, le Chakra Vishuddha.
Son entre, Ardhanrshvara Shiva, Shkin, les seize
voyelles, le Mantra, etc., se dissolvent en Elle. Le Bja de
l'Air Yam se dissout en ther, qui, se transformant luimme en le Bja Ham , se fond dans le corps de Kundalin.
Perant le Chakra cach Lalan, la Dev gagne l'Ajn
connu sous le nom de nud de Rudra (Rudragranthi), o
Paramashiva, Siddhakl, les Deva, et tout ce qu'il contient encore, se dissolvent en Elle.
Enfin le Bja de Vyoma (l'ther) ou Ham s'absorbe
dans les Tattva subtils de l'Ajn, et ensuite dans la Dev.
Aprs avoir travers le Rudragranthi, Kundalin s'unit
Paramashiva. Lorsqu'Elle s'lve au-dessus du lotus
deux ptales, le Nrlambapur, Pranava, Nda, et le reste,
se fondent en la Dev. Elle a ainsi au cours de Sa monte
absorb en Elle les vingt-trois Tattva, en commenant par
les lments grossiers, et ensuite, demeurant Elle-mme
Shakti comme Conscience, cause de toutes les Shakti,
s'unit Paramashiva dont la nature ne fait qu'une avec la
Sienne.
Par cette mthode de concentration mentale, aide par
les moyens physiques et autres que nous avons dcrits, le
grossier s'absorbe dans le subtil, chacun se dissolvant
dans sa cause immdiate et toute chose dans le Chidtm
ou l'Atm qui est Chit. En langage emprunt au monde de

la passion humaine, qui n'est lui-mme qu'un reflet grossier sur le plan physique d'activits et de batitude suprasensuelles correspondantes, quoique plus subtiles, on dit
que la Shakti Kundalin, prise du dsir de Son Seigneur,
se hte vers Lui, et, baisant la bouche de lotus de Shiva,
jouit de Lui.
Le terme Smarasya dsigne la sensation de plaisir qui
nat de l'union (Smarasya) de l'homme et de la femme.
C'est l la forme la plus intense de volupt physique, reprsentant sur le plan du monde la Batitude Suprme
qui nat de l'union de Shiva et de Shakti sur le plan spirituel .
Aussi Daksha, le Dharmashstrakra, dit : Le Brahman ne peut tre connu que par Lui-mme, et Le connatre est pareil au bonheur de connatre une vierge603 .
De mme, le Sdhaka, dans le Layasiddhiyoga, se reprsentant comme Shakti et le Paramtm comme Purusha,
se sent en tat d'union (Sangama) avec Shiva, et gote
avec lui la batitude qui est Shringrarasa, le premier des
neuf Rasa, c'est--dire le sentiment et le bonheur de
l'amour.
Cet Adirasa (Shringra) veill par Sattvaguna604 est insparable de la personne (Akhanda) et l'illumine
603 Svasamvedyam etad brahma kumr-str-sukham yath ; cit dans le Comm.

aux v. 15 du ler chap. du Hathayogapradpik.


604 Ainsi les huit Bhva qui commencent par Sveda, Stambha, et comprennent le

fameux Romncha, frisson qui fait se dresser les cheveux (Pulaka), la voix qui
s'trangle (Svarabhanga), la pleur (Vaivarnaya), etc., sont tous sattviques. L'objection d'un ami hindou, que ces Bhava ne pouvaient tre sattviques vu que Sattva tait spirituel , est un bon exemple de la rupture avec la pense hindoue
effectue par l'ducation anglaise, et du danger de rendre les termes sanskrits en
langue occidentale.

(Svapraksha), il est batitude (Ananda) dont la substance


est Chit (Chinmaya)605. Il est intense et exclusif au point
de rendre l'amoureux inconscient de tout autre objet de
connaissance (Vedyntarasparsha-shnyah), et il est le
propre frre606 de la Batitude du Brahman (Brahmasvdasahodara)607.
Mais de mme que la Batitude du Brahman n'est connue que du Yogi, de mme, comme le remarque l'Alamkra
Shstra que nous venons de citer, mme le vritable bonheur amoureux du monde mortel n'est connu que d'un
petit nombre (Jneyah kaischchit pramtribhih), tels que
les potes et quelques autres privilgis. L'amour sexuel
aussi bien que les autres formes d'amour sont des reflets
ou des fragments de la Batitude du Brahman.
Cette union de la Shakti Kundalin avec Shiva dans le
corps du Sdhaka est cette copulation (Maithuna) du
Sttvika Panchatattva dont le Yogin Tantra dit qu'elle est
la meilleure de toutes les unions pour ceux qui ont dj
matris leurs passions , et sont ainsi Yati608.
Voici ce que dit ce sujet le Brihat Shrikrama : Avec
l'il de la connaissance ils voient le Kal sans tache uni
Chidnanda sur Nda. Il est le Mahdeva, blanc comme
un pur cristal. Il est la Cause resplendissante (Vimbarpanidna), et Elle est la femme adorable aux beaux
605 Ce n'est pas une chose tmasique comme le rve, ou la folie.
606 Sahodara : frres ns de la mme mre. Le plaisir sexuel est le reflet (si faible

soit-il relativement) de la Batitude du Brahman sans forme, dont il est une


forme.
607 Shitya Darpana, ch. III.
608 Ch. VI : Sahasrropari bindau kundaly melanam shive. Maithunam paramam

dravyam yatnm parikrtitam.

membres qui sont inertes par l'effet de Sa grande passion


. Dans leur union coule le nectar (Amrita), qui en un
fleuve d'ambroisie ruisselle du Brahmarandhra au Mldhra, inondant le Kshudrabrahmnda ou microcosme,
et satisfaisant les Devat de ses Chakra. C'est alors que le
Sdhaka, oublieux de tout en ce monde, est plong dans
la batitude ineffable. Renouvellement, force accrue, joie,
suivent chaque visite la Fontaine de Vie.
Il est dit dans le Chintmanistava, attribu Shri
Shankarchrya : Cette pouse (Kundalin), entrant dans
la voie royale (Sushumn), se reposant par intervalles
dans les lieux sacrs (les Chakra), treint l'poux Suprme (Parashiva) et fait couler le nectar (du Sahasrra).
Les instructions du Guru ne doivent pas s'arrter
l'Ajn Chakra, mais aucune indication spciale n'est donne : car, une fois perc ce Chakra, le Sdhaka peut, et il
doit, en vrit, atteindre le Brahmasthna, ou demeure de
Brahman, sans aide et par son propre effort. Au-dessus de
l'Ajn cesse la relation de Guru Shishya (de Matre
disciple).
Kundalin ayant perc les quatorze nuds (Granthi),
c'est--dire les trois Linga, les six Chakra, et les cinq Shiva qu'ils contiennent, et alors ivre Elle-mme du nectar
qui coule de Parashiva, redescend vers Sa demeure (le Mldhra), le sentier par o Elle tait venue609. Lors de Son
retour Elle rpand hors d'Elle-mme dans les Chakra tout
ce qu'Elle avait prcdemment absorb d'eux.
En d'autres termes, alors que Sa monte tait Layakrama, faisant passer l'tat de dissolution (Laya) toutes
609 Sur la pratique du Samaya, voir plus loin.

choses contenues dans les Chakra, Son retour est


Srishtikrama, Elle les recre ou les manifeste.
C'est ainsi qu'Elle regagne le Mldhra, et tout le contenu des Chakra tel que nous l'avons dj dcrit apparat
dans la position qu'il occupait avant Son veil. En fait, le
Jvtm descendant se cre lui-mme l'ide de ce monde
de l'individuel, du multiple et du spar, qui l'avait quitt
lors de sa monte vers la Cause et de sa fusion en elle.
Comme Conscience, Elle absorbe ce qu'Elle avait projet
comme Puissance consciente.
Bref, le retour de Kundalin replace le Jvtm dans le
monde phnomnal du plan le plus bas de l'tre, aprs
son ascension un tat d'extase, ou Samdhi. Le Yog
connat donc, par exprience, la nature et l'tat de l'Esprit,
et la voie qu'il suit pour gagner et quitter le monde de
My, le monde corporel.
Il y a dans le Yoga un processus graduel d'involution du
monde grossier et de ses lments dans sa Cause. Chaque
lment grossier (Mahbhta), avec l'lment subtil (Tanmtra) dont il procde et l'organe sensoriel qui lui correspond (Indriya), se dissout dans l'lment immdiatement
suprieur jusqu' ce que le dernier lment, l'ther, avec le
son Tanmtra et Manas, se soient dissous dans l'Ego
(Ahamkra), dont ils sont des Vikriti. Ahamkra se fond en
Mahat, la premire manifestation d'idation cratrice, et
Mahat en Bindu, qui est ltre Suprme, la Conscience, et
la Batitude en tant que Brahman crateur.
Kundal, une fois veille, est ressentie comme une chaleur intense. Lorsque Kundalin s'lve, les membres infrieurs deviennent inertes et froids comme ceux d'un cadavre ; de mme chaque partie du corps lorsqu'Elle l'a tra-

verse et la quitte. Cela est d au fait que, Puissance qui


soutient le corps comme un tout organique, Elle quitte
Son centre.
Au contraire, la partie suprieure de la tte devient
brillante , par quoi il ne faut pas entendre un clat
(Prabh) extrieur, mais vivacit, chaleur et animation.
Quand le Yoga est accompli, le Yog est assis, rigide, dans
la posture choisie, et la seule trace de chaleur qu'on
puisse trouver en tout son corps est au sommet de la tte,
l o la Shakti est unie Shiva.
Ainsi, les sceptiques peuvent aisment vrifier certains
faits s'ils ont la chance de trouver un Yog accompli qui
veuille bien se laisser voir l'uvre. Ils observeront peuttre son tat d'extase et la froideur de son corps, absente
dans le cas du Yog appel Dhyna Yog, qui opre par la
mditation seulement, et n'veille pas Kundalini. Cette
froideur est un signe extrieur et facilement perceptible.
On en peut voir la progression, qui dnote videmment
le dpart de quelque chose qui donnait auparavant la chaleur. Le corps semble sans vie, ce qui indique que la puissance qui le soutenait l'a quitt (pas entirement toutefois). La redescente de la Shakti ainsi dplace est indique, d'autre part, par la rapparition de la chaleur, de la
vitalit et de la conscience normale. Le processus de retour est celui d'une volution partir de l'tat le plus lev
qui se puisse atteindre, jusqu'au point de dpart.
Parlons un peu maintenant de la Sdhan accompagnant le retour de Kundalin Son lieu de repos dans la
pratique rituelle appele Bhtashuddhi, o la monte et la
descente sont imagines seulement.
Le Sdhaka, se reprsentant le Vyu Bja Yam plac

dans sa narine gauche, inhale par Id, faisant seize fois le


Japa du Bja. Puis, fermant les deux narines, il effectue ce
Japa soixante-quatre fois. Il se reprsente alors l'homme
noir du pch (Ppapurusha)610 dans la cavit gauche611
de l'abdomen comme dessch (par l'air), et en se reprsentant cela il exhale par la narine droite Pingal, tout en
effectuant le Japa du Bja trente-deux fois.
Ensuite le Sdhaka, mditant sur le Bja rouge Ram
du Manipra, inhale en effectuant seize Japa du Bja, puis
il ferme ses narines en effectuant seize Japa. En effectuant
le Japa il se reprsente le corps de l'homme de pch
brl et rduit en cendre (par le feu).
Ensuite il inhale par la narine droite avec trente-deux
Japa, puis mdite sur le Chandrabja blanc Tham . Alors
il inhale par Id, en effectuant le Japa du Bja seize fois,
ferme ses deux narines avec soixante-quatre Japa, et exhale par Pingal avec trente-deux Japa.
Pendant l'inhalation, la rtention du souffle et l'exhalation, il doit considrer qu'un nouveau corps cleste est
form par le nectar (compos de tous les Mtrik-varna,
ou puissances du son, matrialises sous leur forme
Vaikhar comme sons nots par des lettres), qui s'goutte
de la Lune . De manire analogue, avec le Bja de l'eau
Vain , la formation du corps se poursuit, et avec le Bja
Lam du Prithiv Tattva cohsif, ce corps se complte et se
fortifie. Enfin, avec le Mantra So'ham ( Je suis Lui ), le
Sdhaka conduit le Jvtm sa rsidence dans le
610 Voir Mahnirvna Tantra Ullsa, ch. V, v. 98-99, o le processus de la Bh-

tashuddhi est brivement dcrit. Voir aussi Dev-Bhgavata, cite plus loin.
611 Le mauvais ct, le ct le plus faible.

cur612.
Au dbut, Kundal ne demeure pas longtemps dans le
Sahasrra. La longueur du sjour dpend de la force avec
laquelle pratique le Yogi. Il existe alors, de la part de Kundal, une tendance naturelle (Samskra) redescendre. Le
Yog fera tous les efforts possibles pour la retenir en haut,
car plus longtemps il y parviendra, plus sera proche le
moment o Elle pourra y tre retenue de faon permanente613.
Il faut remarquer, en effet, que la dlivrance ne s'obtient
pas en conduisant simplement Kundal au Sahasrra, et
moins encore, videmment, en ne faisant que l'veiller
dans le Mldhra ou en la fixant dans l'un quelconque
des centres infrieurs. La dlivrance n'est obtenue qu'au
moment o Kundal fait du Sahasrra Son sjour permanent, si bien qu'Elle ne redescend que par la volont du
Sdhaka. Aprs avoir sjourn quelque temps dans le Sahasrra, certains Yog, dit-on, ramnent la Kundalin
Hridaya (le cur), et L'adorent en ce centre.
Ainsi font ceux qui sont incapables de sjourner longtemps dans Sahasrra. S'ils conduisent la Kundalin plus
bas que Hridaya, autrement dit s'ils L'adorent dans les
trois Chakra situs au-dessous d'Anhata, il est dit qu'ils
n'appartiennent plus au groupe Samaya614.
Ainsi, une fois obtenue par la Sdhan prliminaire la
612 Certaines formes de mditation sont indiques au v. 51 du Shatchakranir-

pana.

613 Un grand Pouvoir (Siddhi) appartient l'homme qui peut maintenir Kundal

Shakti dans le Sahasrra trois jours et trois nuits.


614 Lakshmdhara, cit par Ananta Shstr, op. cit., p. 71.

puret des fonctions physiques et mentales, le Sdhaka


apprend ouvrir l'entre de la Sushumn, qui est d'ordinaire ferme sa base. C'est l le sens de cette affirmation, que le Serpent ferme de ses replis la porte de Brahma.
la base de la Nd Sushumn et dans le lotus Adhra,
la Shakti Kundalin repose endormie et enroule autour
du Linga, l'aspect Shiva ou Purusha dans ce centre du
Shabdabrahman, dont Elle est l'aspect Prakriti. Kundal,
sous la forme de Ses manations cratrices, mental et matire, est l'ensemble du corps mouvant, mais Elle existe
Elle-mme dans le Mldhra ou centre de terre comme
aspect grossier de Shakti sous sa forme endormie. C'est le
sjour normal de la Shakti qui est le Shabdabrahman.
Pour S'tre manifeste si compltement, Elle repose ou
sommeille en ce qui est Sa plus grossire et Son ultime
manifestation. La force vitale rsiduelle en ce centre
existe l'tat latent et potentiel. Si l'on recherche son aide
en vue du Yoga, la premire opration doit tre celle qui
veille le Serpent de son sommeil. En d'autres termes,
cette force est leve de son tat latent et potentiel un
tat d'activit, et l, unie de nouveau Elle-mme sous
son autre aspect de Lumire Statique brillant dans le
centre crbral615.
Kundal Shakti est Chit, Conscience, sous son aspect
crateur de Puissance. Comme Shakti, c'est par Son activit que le monde existe avec tous les tres qu'il contient.
Prakriti Shakti est dans le Mldhra dans un tat de
sommeil (Prasupt) c'est--dire d'activit latente tourne
615 C'est pourquoi le Sahasrra porte aussi le nom de Bhloka (de la racine Bha,

briller ).

vers l'extrieur (Bahirmukh). C'est parce qu'Elle est dans


cet tat d'activit latente que par Elle toutes les fonctions
vitales du monde matriel extrieur sont accomplies par
l'homme. Et c'est pour cette raison que l'homme est accapar par le monde, et leurr par My, prend son corps et
son petit moi pour le Soi rel ; ainsi tourne la roue de la
vie en son cycle sans fin de naissances et de morts.
Quand le Jva se reprsente le monde comme diffrent
de lui-mme et du Brahman, c'est sous l'influence de
Kundalin qui demeure en lui. Son sommeil dans le Mldhra signifie donc servitude pour l'ignorant616. Aussi
longtemps qu'Elle demeure dans le lotus Mldhra, c'est-dire dans celui de Ses tats qui accompagne l'apparence
cosmique, cette apparence doit durer. En un mot, quand
Elle est endormie, l'homme est l'tat de veille (Jgrat).
C'est pourquoi il est dit 617 que la Shakti de l'initi est
veille, celle du Pashu endormie. Elle est donc veille de
Son sommeil, et une fois veille retourne Son Seigneur,
qui n'est autre qu'Elle-mme sous un autre aspect ; Son
retour est en fait la disparition de cette activit par laquelle Elle produit le monde des apparences, qui disparat
avec elle. Car en gravissant Sa Voie Elle absorbe en Elle
tous les Tattva mans d'Elle.
La conscience individuelle du Yogi, le Jvtm, tant
unie la conscience cosmique en Elle, ou Kundal, devient
alors la conscience universelle, ou Paramtm, dont elle
n'apparaissait diffrente qu'en raison de l'activit, cratrice du monde, de Kundal, activit qui est ainsi suppri616 Shndilya Up., ch. I.
617 Kulrnava Tantra, ch. V, et Mandalabrhmana Up. C'est la destruction de

Tamas.

me. L'instauration par Elle du pur tat dtre-Conscience


est Samdhi.
En rsum, Kundal reprsente dans le corps individuel
la grande Puissance Cosmique (Shakti) qui cre et soutient
l'univers. Quand cette Shakti individuelle, manifeste
comme la conscience individuelle (Jva), se fond dans la
conscience du Shiva Suprme, le monde se dissout pour
ce Jva, et il obtient la Dlivrance (Mukti).
Cependant, sous l'influence de la Shakti Cosmique,
l'univers continue pour ceux qui ne sont pas dlivrs jusqu' la Grande Dissolution (Mahpralaya), la fin de laquelle l'univers se dploie de nouveau en ces Jva dont le
Karma ne s'est pas puis, et qui par consquent n'ont
pas t dlivrs. L'veil, la monte de Kundal, ou Kundal
Yoga, est donc une forme de cette fusion de la conscience
individuelle dans la conscience universelle, ou de leur
union, fin de tout systme de Yoga hindou.
Le Pandit R. Ananta Shstr dit618 : La mthode Samaya pour adorer Shakti, appele Samaychra 619, est
traite dans cinq ouvrages dont les auteurs rputs sont
les grands sages Sanaka, Sananda, Sanatkumra,
Vashishtha et Shuka. Voici un rsum des enseignements
contenus dans ces Samaya Agama, dont chacun porte le
nom de son auteur.
La Shakti ou nergie, dont le dveloppement constitue
le sujet de ces traits, est appele la Kundalin. Le lieu o
618 Anandalahari, p. 8.
619 Ce terme semble avoir des significations varies. Il parat tre employ ici

dans un sens oppos celui de Kulchra, tout au moins sous certaines de ses
formes, et il est encore employ dans les Kaula Shstra pour dsigner leur vnration pour le Panchatattva.

elle rside est appel le Mldhra (sjour originel). Si l'on


russit dvelopper cette Shakti et agir sur elle, on parvient la libration de l'me. Ordinairement Kundalin
repose paisiblement dans le Mldhra. Le premier but
que se proposent les Yog est d'veiller ce serpent endormi,
et cela s'effectue par deux moyens :
(1) Par Tapas. Tapas dsigne ici la pratique du Prnyma, qui consiste rgler le souffle et le retenir pendant des priodes de temps dtermines. C'est aussi la
mthode recommande par les Yoga Shstra.
(2) Par les Mantra. Le disciple est initi l'incantation
de certains Mantra qu'il doit rpter un nombre dtermin
de fois des heures particulires de la journe, ayant toujours sous le regard de son esprit la figure de la Mrti ou
divinit dsigne par le Mantra qu'il rcite. On dit que le
plus important de ces Mantra est la Panchadash.
Une fois veille par ces moyens, la Kundalin s'lve
du Mldhra (premier centre), o elle dormait, vers le
centre immdiatement au-dessus, appel le Svdhishthna (lieu propre ; deuxime centre). De l, grand effort, on
mne cette Shakti aux centres suivants dans un ordre ascendant rgulier, Manpra (plein de rayons : troisime
centre) ; Anhata (le son, n'manant point d'un choc physique, quatrime centre), la Shakti s'y transforme en son ;
Vishuddhi (lieu de puret, cinquime centre), elle y devient
un pur lment sttvique ; et Ajn (-jn, un peu de connaissance, sixime centre). ce stade on peut dire que le
Yog a russi s'assurer la matrise de la Shakti, qui
maintenant lui apparat, ne serait-ce qu'un instant, sous
la forme d'un vif clair.
Le passage de la Kundalin par les centres d'nergie

numrs ci-dessus, du Mldhra Ajn, constitue la


premire partie de la monte. Le disciple qui s'adonne
cette pratique doit se soumettre des exercices d'Upsan
(contemplation et adoration de la divinit prescrite) et de
Mantra Japa (incantations)620, auxquels il sera initi par
son Guru (matre et guide). Les six centres d'nergie numrs ci-dessus, du Mldhra l'Ajn, forment, si on les
joint par des lignes droites imaginaires, un double
triangle, un hexagone, l'toile six branches, qui porte en
sanskrit le nom de Shrchakra. Le centre Anhata (le
cur) est le point critique au cours de cette monte, et
c'est pourquoi on peut lire dans les Agama tant de choses
concernant ce centre.
Ces centres du corps humain (Pindnda) ont leur correspondance sur les plans cosmiques, et chacun d'eux a
sa qualit propre, ou Guna, et une Divinit qui le gouverne. Quand le disciple monte centre par centre, il passe
par les Loka, ou plans cosmiques, correspondants. Le tableau suivant donne les correspondances, les Guna et les
Divinits :

620 Dans cette citation du Pandit, comme dans plusieurs autres, les quivalents

occidentaux des termes sanskrits sont inadquats, comme il fallait s'y attendre
de la part d'un homme dont la propre langue n'est pas occidentale.

Centre psychique
dans le corps
humain

Loka, ou plan
cosmique

Guna, ou
qualit

Divinit

Mldhra au
stade de l'veil de
Shakti

Bhuvarloka

Tamas

Agni (le Feu)

Svdhisthna

Svarloka

Manipra

Maharloka

Rajas

Le Soleil

Anhata

Janaloka

Vishuddha

Tapoloka

Sattva

La Lune

Ajn

Satyaloka

Si un homme mourait aprs avoir atteint l'un de ces


stades, il renatrait avec tous les avantages des stades
matriss ; par exemple, il meurt aprs avoir men la
Shakti jusqu' l'Anhata : dans sa vie suivante il commence o il en est rest, et mne la Shakti plus haut en
partant de l'Anhata.
Cette aspiration unir son me l'ternel a t considre par certains comme une tentative d'origine tamasique pour se librer de tout contenu Tamas et Rajas.
C'est pourquoi l'on dit que le Yogi, au premier et au second stades, a plus de Tamas qu'aux stades suivants, et
par suite est au stade tamasique, gouvern par Agni. Aux

deux stades suivants, on dit qu'il est au stade rajasique,


gouvern par le Soleil. Dans les deux suivants, il est au
stade sattvique, gouvern par la Lune, Divinit laquelle
est assign un plan plus lev qu'au Soleil et qu' Agni.
Mais il importe de remarquer que le Yogi n'atteint au pur
Sattva qu'en arrivant au Sahasrra, et que le Tamas, le
Tajas et le Sattva mentionns dans le tableau ci-dessus ne
sont que relatifs, et sans commune mesure avec leur acception courante.
Kundalin est la forme la plus grossire du Chit, le
vingt-quatrime Tattva, qui habite dans le Mldhra ;
nous aurons en parler de faon plus dtaille en traitant
de la seconde partie de la monte du Yog. Cette Kundalin, son veil, est au stade Kumr (de fille). En arrivant
l'Anhata, elle atteint le stade Yoshit (de femme). C'est
pourquoi l'on indique que c'est l'tape la plus difficile et la
plus importante de la monte. Le stade suivant est celui
du Sahasrra, dont nous parlerons plus loin, et la Shakti
est appele ce stade Pativrat (consacre un poux).
(Voir Taittiryrnyaka, 1, 27, 12.)
La seconde partie de la monte de Kundalin ne comprend qu'une seule tape ; la Shakti doit tre conduite de
l'Ajn, o nous l'avons laisse, dans le Sahasrra. Le Sahasrra (littralement, lotus aux mille ptales) forme par
lui-mme un Shrchakra. La description de ce centre en
sanskrit est trop difficile pour tre rendue de manire satisfaisante en langage occidental. Dans le Sahasrra se
trouve un certain lieu brillant connu sous le nom de
Chandra Loka (monde de nectar). En ce lieu vivent unis le
Sat (Sadshiva) et le Chit, le vingt-cinquime et le vingtquatrime Tattva. Le Chit, ou Shuddha Vidy, est aussi
appel Sadkhy, le seizime Kal de la lune. Ces deux

Tattva sont toujours unis, et cette union est elle-mme


considre comme tant le vingt-sixime Tattva. C'est cette
union de Sat et de Chit qui est le but du Yogi. La Kundalin qui a t amene jusqu'au Sahasrra doit tre fondue
en cette union ; c'est l le terme du voyage du Yogi ; il
jouit prsent de la batitude mme (Paramnanda).
Mais la Kundalin ne sjourne pas longtemps dans le
Sahasrra. Elle a toujours tendance redescendre, et redescend en fait sa demeure originelle. Le Yogi doit recommencer encore et encore, jusqu' ce que la Shakti sjourne de faon permanente avec son Pati (poux), c'est-dire Sadshiva, ou jusqu' ce que l'union de Sadshiva et
de Chit soit complte, et devienne Pativrat, comme nous
l'avons dit dj. Le Yogi est alors un Jvan-mukta, ou pur
Sattva. Il n'a point conscience de cette limitation matrielle de l'me. Il n'est que joie, il est l'ternel lui-mme.
(Voir Shatchakranirpana, v. 9 et 10.) Voil pour Samaychra.
Passons aux autres mthodes d'adoration Shkta ; les
Kaula adorent la Kundalin sans l'veiller de son sommeil621 dans le Mldhra, qui est appel Kula ; de l le
nom de Kaula (Ku = terre, Prithivi ; donc Mldhra). Ils
ne s'lvent pas au-del du Mldhra ; ils pratiquent le
Vmchra ou magie noire622, ils atteignent leurs buts
621 Une affirmation du mme auteur la page 85 est en apparente contradiction

avec ceci. Il disait alors, citant Lakshmdhara : Les Kaula qui adorent Kundalin
dans le Mldhra n'ont d'autre but que de l'veiller de son sommeil. Cela fait, ils
pensent avoir atteint leur but, et en restent l. Suivant leur propre expression, les
Kaula ont le Nirvna toujours porte de la main .
622 Vmchra n'est pas la magie noire , dont l'quivalent sanskrit le plus

proche est Abhichra. Il a pu y avoir, comme le dit la Mahkla Samhit (Ullsa


II), des Kaula qui, la manire des Vaidika, recherchaient la jouissance dans ce

temporels et ils jouissent ; ils ne sont pas librs de la


naissance et de la mort, ils ne dpassent point cette terre.
Bien plus, les Kaula sont aujourd'hui dgrads au point
d'avoir compltement abandonn l'adoration de la Kundalin dans le Mldhra, et s'adonnent des pratiques
tout--fait inhumaines, qui sont loin d'tre divines pour
autant623.
Les Mishra sont bien au-dessus des Kaula. Ils accomplissent tous les Karma, adorent la Dev ou Shakti dans
les lments, tels que le soleil, l'air, etc., et pratiquent
Upsan avec des Yantra d'or ou d'autres mtaux. Ils adorent la Kundalin, l'veillent, et s'efforcent de l'lever. Certains adorateurs Mishra s'lvent jusqu' l'Anhata.
Les Commentateurs nous apprennent que l'ensemble
de ce sujet (l'adoration de la Shakti) est trait en dtail
dans la Taittirya Aranyaka (ch. I). Certains mme font des
citations de cette Aranyaka l'appui de leurs explications.
Le sujet est vaste et fort difficile. Il n'est pas possible de
s'engager dans sa complexit si l'on n'est pas un grand
Guru, d'une vaste science et d'une considrable exp-

monde et dans l'autre, et non la Dlivrance (Aihikrtham kmayanti amrite ratim


na kurvanti). Mais dclarer crment que les Kaula dans leur ensemble n'veillent
point Kundalin et ne la conduisent point au Sahasrra est une erreur. Prnnanda Swm, l'auteur du Shatchakranirpana, tait lui-mme un Kaula, et tout l'objet de l'ouvrage est l'obtention de la Dlivrance (Moksha).
623 Le Pandit semble adopter ici l'opinion de Lakslunidhara, adepte de l'cole

appele Samaya, et adversaire des Kaula. Si (comme c'est probablement le cas) le


mot inhumain doit tre attribu au Pandit, il est inexact. Mais il a exist diffrentes communauts aux vues et aux pratiques fort diverses : comparez, par
exemple, un Brahma Kaula et un Kplika. Sur les rites auxquels fait allusion le
Pandit, voir Shakti and Shakta (Secret Name).

rience personnelle624 ; d'importants ouvrages ont t crits


sur des points particuliers seulement de la monte du Yogi
par les centres psychiques625.
Il est interdit aux adeptes du groupe Samaya d'adorer
la Dev dans le macrocosme. Ils doivent l'adorer dans l'un
des Chakra du corps humain, en choisissant le centre que
leur pratique et leur qualification leur permettent d'atteindre. Ils doivent contempler la Dev et Son Seigneur
Shiva comme (1) ayant le mme sjour (Adhishthnasmya), (2) ayant la mme attitude (Avasthnasmya),
(3) accomplissant les mmes fonctions (Anushthnasmya), (4) ayant la mme forme (Rpa), et (5) ayant le
mme nom (Nma). Ainsi, en adorant la Dev dans
lAdhrachakra, Shiva et Shakti (1) ont Mldhra pour
sjour, (2) tous deux ont l'attitude de danseurs, (3) tous
deux ensemble accomplissent la fonction de crer l'univers, (4) tous deux sont de couleur rouge, (5) Shiva porte
le nom de Bhairava et Shakti celui de Bhairav.
De mme pour les autres Chakra mentionns dans les
Shloka prcdents. C'est ainsi que doivent pratiquer les
dbutants. Les Yogi avancs adorent la Dev dans le Sahasrra, et non dans les centres infrieurs. Comment adorer dans le Sahasrra ?
L'adorateur doit fixer son attention sur Baindava, qui
est le lieu o rside le vingt-sixime Tattva (l'union de Shiva et de Shakti) qui existe ternellement. Ce lieu est situ
au-dessus des vingt-cinq autres Tattva, dans le Chandramandala (la sphre de la lune), lui-mme situ dans le Sa624 Je suis ici tout fait d'accord avec mon distingu ami le Pandit.
625 Voir son dition de l'Anandalahari, pp. 8-13.

hasrra. Il doit contempler cette union et s'identifier avec


elle. (Cela montre que ceux qui pratiquent Bhya Pja, ou
adorent dans le monde extrieur, n'appartiennent pas
l'cole Samaya.) En ce qui concerne cette identification du
moi avec l'union de Shiva et de Shakti au Baindava, il
existe deux manires de la raliser ; l'une est connue sous
le nom de quadruple voie, et l'autre sous celui de sextuple
voie. Elles doivent tre apprises du Guru.
Un novice de l'cole Samaya doit passer par les tapes
suivantes :
(1) Il doit avoir le plus grand respect pour son Guru et
la plus grande confiance en lui. (2) Il doit recevoir de son
Guru le Panchadash Mantra, et chanter (rpter) celui-ci
suivant les instructions reues, connaissant celui qui l'a
vu (Rishi), son mtre (Chhandas), et la Divinit qu'il dsigne (Devat)626. (3) Le huitime jour de la brillante quinzaine du mois Ashvayuja, Mahnavam, il doit minuit se
prosterner aux pieds de son Guru, et ce dernier voudra
bien alors l'initier quelque Mantra et la nature relle
des six Chakra et de la sextuple voie de l'identification.
Une fois ainsi qualifi, le Seigneur Mahdeva627 lui
donne la connaissance, ou capacit de voir son me profonde... Alors la Kundalin s'veille, et, montant soudain
au Manipra, devient visible l'adorateur. De ce centre il
doit La conduire lentement aux Chakra suprieurs, l'un
626 Le Rishi du Mantra est celui qui en eut le premier la rvlation ; le mtre est

celui dans lequel fut mis pour la premire fois par Shiva ; et la Devat est l'Artha
du Mantra comme Shabda. L'Artha est quintuple, tant Devat, Adhidevat, Pratyadhidevat, Varndhidevat, Mantradhidevat.
627 Shiva l'initie la connaissance de Brahman. Shiva est donc considr comme

le Matre des Guru Spirituels (Adintha).

aprs l'autre, et il y accomplit l'adoration prescrite, et Elle


lui apparatra de plus en plus clairement. Une fois travers l'Ajnchakra, la Kundalin s'lance vivement, comme un
clair, au Sahasrra, entre dans Pile des Gemmes entoure des arbres Kalpa dans l'Ocan de Nectar, s'y unit
Sadshiva, et jouit avec Lui.
Le Yogi doit maintenant attendre derrire le voile628
que Kundalin regagne Sa place, et Son retour continuer
ses exercices jusqu' ce qu'Elle soit unie jamais Sadshiva, et jamais ne redescende.
La technique dcrite ci-dessus, et d'autres d'une nature semblable, sont toujours gardes secrtes ; pourtant
le Commentateur dit que, par compassion envers ses disciples, il a donn ici un aperu de la mthode.
Mme en attendant simplement que la Kundalin redescende du Sahasrra, le disciple prouve Brahmnanda
(la batitude du Brahman). Celui qui a conduit une fois
Kundalin au Sahasrra en vient ne plus rien dsirer que
Moksha (la Dlivrance), si tel tait son but. Mme si
quelques adeptes du Samaya ont des buts terrestres, ils
doivent pourtant adorer dans le microcosme seulement.
Le Subhagodaya, et d'autres ouvrages clbres sur
Shrvidy, disent que le Yogi doit concentrer son mental
sur la Dev qui rside en Sryamandala (le disque du soleil), et autres choses de ce genre. Cela n'est pas en dsaccord avec l'enseignement contenu dans ce livre, car le
Sryamandala dont il s'agit se rapporte au Pindnda (microcosme), et non au Brahmnda (macrocosme). De
628 Ceci m'chappe, comme certains autres dtails de cette description. Qui at-

tend derrire le voile ? Le Jva, dans le cas en question, est l'intrieur, s'il existe
un voile ; et quel voile ?

mme, tous les vers recommandant une adoration extrieure doivent tre appliqus aux objets correspondants
du Pindnda629 .
La dernire, la plus haute et la plus difficile forme de
Yoga est le Raja Yoga. Au moyen du Mantra Yoga, du Hatha Yoga et du Laya Yoga, le Yog, par une graduelle ralisation de la puret, se qualifie pour Savikalpa Samdhi,
C'est par le Rja Yoga seulement qu'il peut atteindre
Nirvikalpa Samdhi.
Le premier de ces Samdhi, ou extases, est celui qui,
moins qu'il ne trouve dans le second son accomplissement, permet le retour au monde et son exprience. Il
n'en est pas ainsi dans le Samdhi du Rja Yoga, dans
lequel n'existe pas le moindre germe d'attachement au
monde et qui par suite ne laisse pas revenir lui, mais
assure l'ternelle unit avec Brahman.
Les trois premires sortes de Yoga prparent la voie la
quatrime630. Dans le Samdhi du Mantra Yoga on atteint
l'tat de Mahbhva, caractris par l'immobilit et le silence. Dans le Samdhi du Hatha Yoga la respiration
cesse, et l'observation extrieure le Yog ne prsente aucun signe d'animation et ressemble un cadavre.
Dans le Samdhi du Laya Yoga le Yog n'a pas de conscience externe et il est aussi plong dans l'ocan de la
Batitude. Le Samdhi du Rja Yoga est Dlivrance com-

629 Commentaire sur Anandalahar, d. par le Pandit R. Ananta Shstri, p. 85 et

suiv. Il ajoute : Pour un expos dtaill de ces principes, voir Shuka Samhit,
l'une des cinq Samhit du groupe Samaya .
630 Rja Yoga, par Swm Daynanda, publi par Shr Bhrata Dharma Mah-

mandala, Bnars.

plte (Chit-svarpa-bhva) et dfinitive (Nirvikalpa)631.


Il est dit qu'il existe quatre tats de dtachement (Vairgya) du monde632, correspondant aux quatre Yoga, la
forme la plus modeste du Vairgya tant la marque du
premier, le Mantra Yoga, et le plus haut degr du dtachement tant la marque du Yoga le plus lev, le Rja
Yoga.
Une autre marque distinctive est la prminence donne
l'aspect mental. Tout Yoga comporte des pratiques mentales, mais cela est plus particulirement vrai du Rja Yoga, qui a t dcrit 633 comme le pouvoir de distinguer le
rel de l'irrel, c'est--dire l'infini et le durable, du fini et
du transitoire, au moyen du raisonnement, aid des Upanishad et des systmes philosophiques orthodoxes.
Le lecteur occidental ne doit pas pourtant l'assimiler
une simple philosophie. Il est l'exercice de la Raison, pratiqu par des hommes moralement purs et de grande intelligence, dans les conditions et suivant la discipline dcrites plus haut, avec Vairgya, le Renoncement.
Chez l'homme de Savoir (Jnn), Buddhi (la Raison)
rgne pleinement. Le Rja Yoga comprend seize divisions.
Il y a sept varits de Vichra (raisonnement) sur sept
plans de connaissance (Bhmik) appels Jnnad, Sannysad, Yogad, Llonmukti, Satpad, Anandapad et
631 Ibid., 19, 20.
632 Mridu (intermittent, vague et faible), Madhyama (moyen), Adhimtra (haut

degr, o la jouissance terrestre devient une vritable source de souffrance),


Para (le plus haut, o le mental est compltement dtourn des objets du monde
et ne peut en aucune circonstance leur tre ramen).
633 Ibid., 5.

Partpar634.
Par leur exercice, le Raj-Yog pratique graduellement,
effectivement, les deux espces de Dhran635, c'est--dire
Prakrityshraya et Brahmshraya, qui dpendent respectivement de la Nature ou de Brahman.
Il y a trois sortes de Dhyna, par lesquelles est produit
le pouvoir de raliser le soi (Atmapratyaksha). Il y a quatre
formes de Samdhi. Il y a trois aspects de Brahman : son
aspect grossier, en tant qu'il est immanent l'univers, et
qui porte le nom de Virt Purusha ; son aspect subtil de
crateur, prservateur et destructeur de toutes choses, en
tant que Seigneur (Ishvara) ; et au del est l'aspect suprme, Sachchidnanda.
Le Rja Yoga indique divers modes de Dhyna pour les
trois aspects636. Des quatre Samdhi obtenus par ces
exercices, les deux premiers, ou Savichra, conservent
une subtile relation avec l'exercice conscient du pouvoir de
Vichra (le raisonnement, le discernement), mais les deux
derniers en sont exempts, ils sont Nirvichra. En atteignant ce quatrime tat le Rja-yogi obtient la Dlivrance
tout en vivant dans le corps (Jvanmukta), et il chappe au
Karmshaya637. On considre gnralement que par le seul
Rja Yoga peut s'obtenir ce Nirvikalpa Samdhi.

634 De mme il y a sept Bhmik ou plans du Karma : Vividish ou Shubhech-

chh, Vichran, Tanumnas, Sattpatti, Asamsakti, Padrthbhvin, Turyag ;


et aussi sept plans d'adoration (Upsan Bhmik) : Nmapara, Rpapara, Vibhtipara, Shaktipara, Gunapara, Bhvapara, Svarpapara.
635 Voir plus haut, p. 190.
636 Rja-Yoga, par Daynanda Swmi, 19.
637 La masse des Karma Samskra dans leur tat de germe (Bja).

VII. BASES THORIQUES DU YOGA TANTRIQUE

Nombreuses sont les affirmations de la valeur du Kundalin Yoga. La revue qui en est faite ci-aprs ne prtend pas
tre exhaustive, car la littrature relative Kundalin et au
Laya Yoga est trs vaste, mais se propose seulement de
rappeler brivement quelques-unes des Upanishad et
quelques-uns des Purna qui sont venus ma connaissance, et dont j'ai pris note, au cours de ce travail 638.
Pourtant, elle tablira clairement que cette doctrine relative aux Chakra, ou des parties de cette doctrine, se
trouvent dans d'autres Shstra que les Tantra, bien que
dans certains cas les allusions soient si rapides qu'il n'est
pas toujours possible de dire si la chose est envisage
dans le mme sens que dans le Yoga tantrique, ou comme
formes d'adoration (Upsan).
Il faut noter ce propos que Bhtashuddhi est un rite
considr comme un prliminaire ncessaire l'adoration
d'un Deva639. Il est vident que si la Bhtashuddhi dsigne
la pratique du Yoga, alors, l'exception du Yogi expert en
ce Yoga, nul ne serait qualifi pour l'adoration. Car seul le
Yogi accompli (Siddha) peut rellement conduire Kundalin
638 Il en existe beaucoup d'autres. Certaines rfrences m'ont t aimablement

communiques par Mahmahopdhyya Adityarma Bhattchrya.


639 Voir Taranga I de la Mantramahodadhi : Devrchyogyatprptyai bhtas-

huddhim samcharet.

jusqu'au Sahasrra.
Dans la Bhtashuddhi ordinaire et quotidienne, il s'agit
donc d'un exercice purement mental ou imaginaire, qui
fait partie de l'adoration ou Upsan, et non du Yoga. En
outre, et c'est une forme de culte, le Sdhaka peut adorer,
et adore en fait, son Ishtadevat en diverses parties de son
corps. Cela encore fait partie d'Upsan. Pourtant,
quelques-uns des Shstra mentionns plus loin font clairement allusion aux exercices du Yoga, et d'autres semblent bien le faire.
Dans ce qu'on nomme les Upanishad primitives640, il est
fait mention de certaines choses qui sont dcrites de faon
plus explicite dans celles que les orientalistes occidentaux
disent plus rcentes. Ainsi, nous trouvons des allusions
aux quatre tats de conscience, aux quatre enveloppes,
la cavit du cur comme centre de l' me .
Comme nous l'avons dit dj, les coles hindoues considraient le cur comme le sige de la conscience veille.
Le cur se dilate pendant la veille, et se contracte pendant le sommeil. En lui, dans l'tat de rve (Svapna), les
sens externes se rsorbent, bien que la facult de reprsentation soit veille ; jusqu' ce que, dans le sommeil
profond (Sushupti), elle aussi se rsorbe.
On trouve aussi des allusions aux 72.000 Nd ; l'entre
et la sortie du Prna par le Brahmarandhra (au-dessus du
foramen de Monro et de la commissure mdiane) ; et la
respiration vers le haut par l'une de ces Nd. Ces points
640 Pour certaines citations des plus anciennes Upanishad, voir un article du

Professeur Rhys Davids dans J.R.A.S., p. 71 (janvier 1899), Theory of Soul in Upanishads. Voir aussi Avalon, Principles of Tantra, vol. I, o il est fait mention, entre
autres, de la Prashna Up., III, 6, 7.

impliquent probablement, dans une certaine mesure,


l'admission d'autres lments doctrinaux non expressment mentionns.
C'est ainsi que l'allusion au Brahmarandhra et au nerf
unique implique l'axe crbro-spinal avec sa Sushumn,
par laquelle seulement le Prna passe dans le Brahmarandhra ; c'est apparemment pour cette raison que la
Sushumn elle-mme est dsigne dans la Shivasamhit
comme le Brahmarandhra. La Libration est finalement
accomplie par la connaissance , qui, suivant l'antique
Aitareya Aranyaka641, est Brahman .
La Hamsa Upanishad642 s'ouvre par cette affirmation,
que la connaissance qu'elle renferme ne doit tre communique qu'au Brahmachri possdant la paix du mental
(Shnta), la matrise de soi (Dnta) et la dvotion au Guru
(Gurubhakta). Nryana, le Commentateur, qui cite parmi
d'autres ouvrages l'abrg tantrique Shrad Tilaka, se
dcrit comme un homme dont le seul appui est Shruti
(Nryanena Shrutimitropajvin)643. Cette Upanishad
(par. 4) mentionne par leurs noms les six Chakra, comme
aussi la mthode de l'veil de Vyu dans le Mldhra,
c'est--dire le Kundalin Yoga.
Le Hamsa (autrement dit Jva) est localis dans le lotus
huit ptales au-dessous d'Anhata644 (par. 7), o est
adore l'Ishtadevat. Il y a huit ptales, auxquels sont as641 Anecdota Oxon iensia, p. 236 (d. Arthur Berriedale Keith).
642 Upa nishadm Samuchchayah (Anandshrama Series, vol. XX IX, p. 593).
643 Le Tantra, comme tous les autres Shstra de l'Inde, prtend se baser sur le

Veda.
644 On confond souvent ce lotus avec l'Anhata. Celui-ci est un Chakra situ dans

la colonne vertbrale ; le lotus huit ptales est dans la rgion du cur (Hrid).

socies certaines Vritti. Au ptale de l'est est associe


l'inclination la vertu (Punye matih) ; celui du sud-est,
le sommeil (Nidr) et la paresse (Alasya) ; celui du sud,
la mchancet ou la cruaut (Krra mati) ; celui du sudouest, l'inclination au pch (Ppe manish) ; celui de
l'ouest, diverses qualits infrieures ou mauvaises (Krd) ;
celui du nord-ouest, l'intention dans le mouvement ou
l'action (Gamandau buddhih) ; celui du nord, l'attachement et la satisfaction sensuelle (Rati et Prti) ; et au ptale du nord-est, la prise de la main sur les choses
(Dravyagrahana)645.
Au centre de ce lotus est l'impassibilit (Vairgya). Dans
les filets est l'tat de veille (Jgrad-ayasth) ; dans le pricarpe l'tat de rve (Svapna) ; dans la tige l'tat de sommeil profond (Sushupti). Au-dessus du lotus est le lieu
sans support (Nirlamba pradesha), qui est l'tat Trya.
Le Commentateur Nryana dit que les Vritti des ptales
sont donnes dans l'Adhytmaviveka, qui les assigne aux
diffrents lotus.
Dans le passage cit de la Hamsopanishad, elles apparaissent, ou tout au moins certaines d'entre elles, comme
runies dans le centre de mditation sur l'Ishtadevat. Au
paragraphe 9, dix espces de son (Nda) sont mentionnes, qui ont des effets physiques dtermins, comme la
transpiration, le tremblement, et ainsi de suite, et il est dit
qu'on atteint le Brahmapada par la pratique de la dixime
espce de Nda.
645 Littralement : action de prendre les choses . La traduction du nom de

cette Vritti, comme de plusieurs autres, est approche. Il n'est pas toujours facile
de comprendre la signification exacte ou de trouver un quivalent en langage
occidental.

La Brahma Upanishad646 mentionne au verset 2 le nombril (Nbhi), le cur (Hridaya), la gorge (Kantha) et la tte
(Mrdh), comme des lieux (Sthna) o brillent les
quatre quarts du Brahman . Nryana dit que la Brahmopanishad, en mentionnant ces derniers, indique que ces
emplacements sont les centres partir desquels, selon la
mthode prescrite, le Brahman peut tre atteint647. Mention est faite des lotus de ces quatre emplacements, et le
mental est dsign comme la dixime porte , les neuf
autres ouvertures tant les yeux, les oreilles, les narines,
et ainsi de suite.
La Dhynabindu Upanishad648 fait allusion au fait que le
Yogi entend les sons Anhata (v. 3). L'Upanishad dclare
qu'avec Praka la mditation doit se faire dans le nombril
sur le Grand et Puissant (Mahvra) qui a quatre bras et la
couleur de la fleur du chanvre (c'est--dire Vishnu) ; avec
Kumbhaka, il faut mditer dans le cur sur le Brahm
rouge assis sur un lotus ; et avec Rechaka penser celui
qui a trois yeux (Rudra) dans le front. Le plus bas de ces
lotus a huit ptales ; le second a la tte incline ; et le troisime, qui est compos de toutes les Devata (Sarvadevamaya), ressemble une fleur de plantain (v. 9-12). Dans le
verset 13, la mditation est dirige sur cent lotus ayant
chacun cent ptales, et ensuite sur le Soleil, la Lune et le
Feu. C'est Atm qui veille le lotus, et, en retirant le Bja,
atteint la Lune, le Feu et le Soleil.

646 Anandshrama Series, vol. XXIX, p. 325.


647 On remarquera qu'il n'est pas fait ici mention des deux centres tmasiques

infrieurs.
648 Ibid., p. 262.

L'Amritanda Upanishad649 parle des cinq lments, et,


au-dessus d'eux, d'Ardhamtra, c'est--dire Ajn (v. 3031). Les lments dont il est question ici sont deux des
Chakra, car le verset 26 parle de l'entre du cur comme
de l'entre arienne (le Vyu Tattva tant ici). Au-dessus,
dit l'Upanishad, est la porte de la Libration (Mokshadvra). Elle dclare, au verset 25, que Prna et Manas suivent
la route que voit le Yogi, ce qui se rapporte, selon le Commentateur, la manire dont Prna entre dans le Mldhra, et en sort. Il donne aussi quelques pratiques du
Hatha Yoga.
La Kshurik Upanishad650 parle des 72.000 Nd, et
mentionne Id, Pingal et Sushumn (v. 14-15). Toutes,
l'exception de Sushumn, peuvent tre servies par le
Dhyna Yoga . Le verset 8 enjoint au Sdhaka de pntrer dans la Nda (lire Nd) blanche trs subtile, et d'y
conduire Prna Vyu ; et il y est parl de Praka, de Rechaka, de Kumbhala et de Hatha. Nryana remarque,
propos du verset 8, que Kundal doit tre chauffe par le
feu interne et place ensuite l'intrieur de la Brahmand, ce qui rclame l'emploi du Jlandhara Bandha.
La Nrisimhaprvatpanya Upanishad651 (ch. V, v. 2)
parle du Sudarshana (qui est apparemment ici le Mldhra), se transformant en lotus six, huit, douze, seize
et trente-deux ptales respectivement. Ce qui correspond
au nombre de ptales donn par le Shatchakranirpana,
sauf pour le second lotus. Car, si l'on admet qu'il s'agit du
Svdhishthna, le second lotus devrait avoir dix ptales.
649 Op. cit., 43. L'Amritabindu Up., p. 71, s'occupe du Yoga en gnral.
650 Ibid., vol. XXIX, p. 145.
651 Anandshrama Edition, vol. XXX, p. 61.

Il semble que cette divergence soit due au fait que c'est


l le nombre des lettres du Mantra assign ce lotus. Car
dans le lotus six ptales est le Mantra six lettres de
Sudarshana ; dans le lotus huit ptales, le Mantra huit
lettres de Nryana ; et dans le lotus douze ptales, le
Mantra douze lettres de Vsudeva. Comme c'est ordinairement le cas, dans le lotus seize ptales sont les seize
Kal (ici les voyelles) mises avec Bindu ou Anusvra. Le
lotus trente-deux ptales (Ajn) est en ralit deux ptales, parce qu'il y a ici les deux Mantra (de seize lettres
chacun) de Nrisimha et de Sa Shakti.
Le sixime chapitre de la Maitr Upanishad652 parle des
Nd ; et en particulier de Sushumn, de la perce des
Mandala Soleil, Lune et Feu (chacun de ceux-ci tant
l'intrieur de l'autre, Sattva dans le Feu, et dans Sattva
Achyuta) ; et d'Aman, qui est un autre nom d'Unman.
La Yogatattva Upanishad653 et la Yogashikh Upanishad654 mentionnent toutes deux le Hathayoga, et la seconde parle de la fermeture de la porte intrieure , de
l'ouverture de la porte de Sushumn (par l'entre de Kundalin dans le Brahmadvra), et de la perce du Soleil.
La Rmatpanya Upanishad655 signale diverses techniques du Yoga et du Tantra, telles qu'Asana, Dvrapj,
Pthapj, et elle mentionne expressment Bhtashuddhi,
qui est, comme nous l'avons expliqu plus haut, la purifi652 Ibid., vol. XXIX, p. 345. Voir aussi pp. 441, 450, 451, 458 et 460.
653 Ibid., vol. XXIX, p. 477.
654 Ibid., p. 483. Sur le passage de Kundalin travers le Brahmadvra, voir p.

485.
655 Ibid., vol. XXIX, p. 520.

cation des lments dans les Chakra, soit imaginativement, soit rellement, avec l'aide de Kundalin.
J'ai dj cit dans les notes de nombreux passages, relatifs notre Yoga, de la Shndilya Upanishad de l'Atharvaveda, des Varha et Yogakundal Upanishad du Krishna
Yajurveda, de la Mandalabrhmana Upanishad du Shukla
Yajurveda, et de la Ndabindu Upanishad du Rigveda656.
Le grand Devbhgavata Purna (VII, 35-XI, 8) fait un
expos complet des six Chakra ou Lotus ; de l'veil de
Kundalin (qu'il appelle la Paradevat) dans le Mldhra
de la manire dcrite dans le Shatchakranirpana, et de
son union avec Jva par le Hamgsa Mantra ; de Bhtashuddhi ; de la dissolution des Tattva grossiers dans les
Tattva subtils, au terme de laquelle Mahat est en Prakriti,
My en Atm. Mention est faite, dans ce Purna, du
Dhar Mandala, qui est dcrit, comme les autres Mandala,
de manire conforme au Shatchkranirpana. On donne les
Bja de Prithiv et les autres Tattva. On fait aussi allusion
la destruction de l' homme de pch (Ppapurusha),
en termes semblables ceux du Mahnirvna et des
autres Tantra. On trouvera dans le mme chapitre un remarquable Dhyna de Prnashakti, qui en rappelle fort un
autre donn par le Prapanchasra Tantra (chap. XXXV)657.
Le Linga Purna (1re partie, ch. LXXV) mentionne les
Chakra avec leurs diffrents ptales, dont les noms sont
donns par le Commentateur. Shiva, dit-il, est Nirguna,
mais pour le bien des hommes Il rside dans le corps avec
656 Ces Yoga Upanishad ont t traduites rcemment par K. Nryanasvmi

Aiyar et font partie de son ouvrage : Thirty Minor Upanishad (Theosophical Society of Madras, 1914).
657 Voir Avalon, Tntrik Texts, vol. III, ch. XXXV.

Um, et les Yog mditent sur Lui dans les diffrents lotus.
Le chapitre XXIII de lAgni Purna, qui est rempli de rituel, de magie et de Mantra tantriques, parle aussi du rite
de Bhtashuddhi, dans lequel, aprs mditation accompagne des Bja Mantra respectifs sur le nombril, le cur
et l'Ajn, le corps du Sdhaka est rafrachi par un flot de
nectar.
Enfin, un adversaire de notre Yoga, que je cite plus loin,
invoque l'autorit du grand Shankara, bien qu'en fait, si la
tradition est correcte, elle soit contre ce critique. Shankara, dont les Math contiennent le grand Yantra tantrique
appel le Shrchakra, dit dans son commentaire des versets 9 et 10 du chapitre VIII de la Bhagavad-Gt :
On obtient d'abord la matrise du lotus du cur
(Anhata). Puis, par la conqute de Bhmi (Mldhra,
etc.) et par la Nd ascendante (Sushumn), aprs avoir
plac Prna entre les deux sourcils658, le Yog atteint le Purusha radieux et illuminateur .
On lit sur ce sujet dans la Tk d'Anandagir : Par la
Nd Sushumna entre Id et Pingal. On atteint la gorge
par la mme voie, l'espace entre les sourcils. La conqute
de la terre (Bhmi) dsigne la manire de matriser les
cinq Bhta . Shrdara Svmi dclare : Par la puissance
du Yoga (Yoga-bala), il faut conduire Prna le long de la
Sushumna .
Et Madhusdana Sarasvat : La Nd ascendante est
Sushumna, et la conqute de Bhmi et du reste s'effectue
en suivant le sentier qu'indique le Guru ; et l'espace entre
les sourcils dsigne l'Ajn Chakra. En y plaant Prna, il
658 Voir Shatchakranirpana, v. 38.

sort par le Brahmarandhra, et le Jva ne fait plus qu'un


avec le Purusha .
L'hymne clbre appel Ananda-Lahar ( Vague de Batitude ), et attribu Shankara, traite de ce Yoga (Shatchakrabheda) et dans le treizime chapitre du Shankaravijaya de Vidyranya il est fait mention des six lotus, et
aussi du fruit qu'on obtiendra du culte de la Devat qui
demeure en chacun des Chakra 659.
Le Pandit R. Ananta Shstri dit660 : Maint
grand
homme a conduit avec succs la Kundalini jusqu'au Sahasrra, et effectu son union avec Sat et Chit. Le premier
d'eux tous est le grand et clbre Shankarachrya,
humble disciple de l'un des lves de Gaudapdchrya,
auteur du clbre Subhagodaya (52 sloka). Ayant bien assimil les principes contenus dans cet ouvrage, Shri
Shankarachrya reut des instructions particulires, bases sur l'exprience personnelle de son Guru. En ajoutant ces avantages sa propre exprience, il composa son
fameux ouvrage sur le Mantra-shstra, qui comprend cent
sloka ; les quarante et un premiers formant l'AnandaLahar, et le reste la Saundarya-Lahar ; cette dernire invoque la Dev comme un tre qui n'est que beaut des
pieds la tte.
On peut dire que l'Ananda-Lahar contient la quintessence du Samaychra. L'ouvrage est d'autant plus prcieux que l'auteur y enseigne d'aprs son exprience personnelle. D'abondants commentaires furent crits sur
659 Voir aussi le Shankaravijaya d'Anandagir et celui de Mdhava (ch. XI ; voir

aussi, Ibid., le passage qui mentionne Shrchakra).


660 Anandalahart, 14. Cet hymne a t traduit par Avalon sous le titre Wave of

Bliss.

presque chaque syllabe du texte. La thorie suivante fera


bien comprendre la valeur attache cet ouvrage : certains pensent que Shiva est le vritable auteur de l'Ananda-Lahar, et non point Shankarachrya, qui n'tait qu'un
Mantradrasht ou un Rishi, c'est--dire un homme qui,
ayant men le Yoga jusqu' son terme, le livra au monde.
Il ne subsiste pas moins de trente-six commentaires sur
cet ouvrage. Parmi eux, nous en trouvons un dont l'auteur
est notre grand Appaya Dkshita. Les commentaires ne
sont pas entirement diffrents, mais chacun a ses vues et
ses thories particulires.
Quant au texte de l'Ananda-Lahar, il contient quarante et un sloka. D'aprs certains Commentateurs, les
sloka sont au nombre de trente-cinq ; quelques-uns n'en
reconnaissent que trente, et selon Sudhvidyotin et
quelques autres les sloka suivants constituent le texte de
l'Ananda-Lahar : 1-2, 8-9, 10-11, 14-21, 26-27, 31-41.
mon avis, cette dernire valuation semble correcte, les
autres sloka traitant seulement des Prayoga (applications
des Mantra) pour des buts terrestres 661. Quelques-uns
seulement de ces Prayoga sont reconnus par tous les
Commentateurs, alors que les autres sont omis comme
tant entirement karmiques.
Comme on l'a dj remarqu, 1'Ananda-Lahar n'est
qu'un dveloppement de l'ouvrage appel Subhagodaya, et
d Gaudapda, le Guru du Guru de l'auteur. Ce dernier
ouvrage ne donne que les points principaux, sans y mler
jamais aucun de ces claircissements caractristiques,
que j'ai signals plus haut.
661 Ainsi les vers 13, 18 et 19 traitent, dit-on, du Madanaprayoga, application

pour le troisime Purushrtha ou Kma (le dsir).

De tous les commentaires sur l'Ananda-Lahar, celui


de Lakshmdhara semble le plus rcent ; il n'en est pas
moins le plus populaire, et juste titre. D'autres commentaires soutiennent tel ou tel aspect des diverses coles philosophiques ; mais Lakshmdhara collationne quelquesunes des vues d'autrui, et les note ct des siennes. Son
commentaire est par suite le plus complet. Il ne se range
aucun parti662 ; ses vues sont larges et librales. Toutes les
coles de philosophes sont reprsentes dans ses commentaires. Lakshmdhara a aussi comment beaucoup
d'autres ouvrages sur le Mantrashstra, et par suite jouit
d'une trs haute rputation. Ses commentaires sont aussi
prcieux, pour l'Ananda-Lahar comme pour la Saundarya-Lahar, que ceux de Syana pour les Veda.
Lakshmdhara semble avoir habit le sud de l'Inde ;
les pratiques et les coutumes qu'il dcrit conduisent
toutes cette conclusion ; les exemples qu'il donne ont
invariablement la saveur du sud, et encore aujourd'hui
ses vues ont plus de partisans dans le sud que dans le
nord. Il a aussi crit un commentaire minutieux sur le
Subhagodaya de Gaudapda. Les allusions ce dernier
dans le commentaire de l'autre ouvrage, et les excuses du
Commentateur, et l, pour la rptition de ce qu'il a
crit dans l'tude prcdente, conduisent la conclusion
que le commentaire sur le livre original fut l'uvre de la
vie de l'auteur.
Les commentaires d'Achyutnanda sont en caractres
bengalis, et font autorit aujourd'hui encore au Bengale 663.
Divers commentaires sont admis en divers lieux, mais il
662 Il semble tre l'adversaire de l'cole Uttara, ou cole Kaula du nord.
663 J'ai suivi galement ce commentaire dans Wave of Bliss.

en est peu qui aient gagn une acceptation universelle.


Il n'existe que trois ou quatre ouvrages traitant du
Prayoga (application) ; j'ai eu accs tous. Mais ici je n'ai
suivi que l'un d'entre eux, comme le plus marquant et le
plus important. Il vient d'une vieille famille de Conjeeveram. Il contient cent sloka. Les Yantra (figures) pour les
Mantra contenus dans les sloka, les diffrentes attitudes
de l'adorateur, et autres prescriptions de ce genre, y sont
clairement dcrits jusque dans les plus minutieux dtails.
Il semble y avoir quelque rapport mystique entre
chaque sloka et son Bjakshara664. Mais il n'est pas intelligible, et aucun des Prayoga Kart665 ne l'a expliqu.
Voici une liste de commentaires crits sur l'Ananda-Lahar ; certains concernent aussi la Saundarya-Lahar.
1. Manoram, commentaire.
2. Commentaire par Appaya Dkshita (Bibliothque du
Palais de Tanjore).
3. Vishnupaksh. Peut-tre est-ce le mme ouvrage que
le no 14 indiqu ci-dessous.
4. De Kavirjasharman, environ 3.000 grantha (Bibliothque du Collge du Deccan).
5. Manjubhshan, par Krishnchrya, fils de Vallabhchrya ; environ 1.700 sloka. Il dit dans son introduction
que Shr Shankarchrya louait la Brahmashakti nomme
Kundalin quand il mditait sur les rives du Gange. Il indique l'objet de cet ouvrage dans son premier sloka : Je
loue constamment la Kundalin, qui cre continuellement
664 Bja-mantra, ou Mantra racine.
665 Les auteurs qui traitent des applications pratiques.

des mondes innombrables, bien qu'Elle soit pareille un


filet de lotus, et qui rside la racine de l'arbre (Mldhra)
pour tre veille et conduite (au Sahasrra). L'uvre est
trs connue au Bengale.
6. Un autre commentaire, appel Saubhgyavardhana,
par Kaivalaysharma. La Bibliothque d'Adyar en possde
un exemplaire. Il est connu dans l'Inde entire, aussi pouvons-nous nous procurer en divers endroits autant de
manuscrits que nous voulons. Il contient environ 2.000
grantha.
7. Par Koshavabhatta.
8. Tattvadpik, par Gangahari, petit commentaire bas
sur le Tantrashstra.
9. Par Gangdhara.
10. Par Gopramanatarkapravachana ; environ 1.400
grantha. Semble tre d'origine rcente.
11. Gaurkntasrvabhaumabhattchrya ; environ
1.300 grantha. D'origine rcente.
12. Par Jagadsha.
13. Par Jaganntha Panchnana.
14. Par Narasimha ; 1.500 grantha. La principale particularit de ce commentaire est qu'il explique le texte de
deux manires diffrentes, chaque sloka pouvant s'appliquer en mme temps la Dev et Vishnu. Bien que certains Commentateurs aient donn des significations diffrentes quelques-uns des vers, tous cependant s'appliquent aux diffrents aspects de la Dev seulement, et non
des diffrentes Devat.

15. Bhvrthadpa, par Brahmnanda666, environ 1.700


grantha.
16. Par Mallabhatta.
17. Par Mahdevavidyvgsha.
18. Par Mdhavavaidya (Bibliothque du Collge du
Deccan).
19. Par Rmachandra ; environ 3.000 grantha (Bibliothque du Collge du Deccan).
20. Par Rmnandatrtha.
21. Lakshmidhara ; son commentaire est bien connu du
public, et ne ncessite aucune prsentation. Il a t rcemment et excellemment dit en caractres Deva Ngar
par le gouvernement de Mysore.
22. Par Vishvambhara.
23. Par Shrkanthabhatta.
24. Par Rma Sri.
25. Par Dindima (Bibliothque d'Adyar).
26. Par Rmachandra Misra ; environ 1.000 grantha
(Bibliothque du Collge du Deccan).
27. Par Achyutnanda (imprim en caractres bengalis).
28. Sadshiva (Bibliothque orientale du Gouvernement, Madras).
29. Un autre commentaire anonyme (Bibliothque
orientale du Gouvernement, Madras).

666 C'est le clbre Bengali Paramahamsa, Guru de Prnnanda Svm, auteur du

Shatchakranirpana. Brahmnanda est l'auteur de la clbre Shktnandatarangin.

30. Par Shrrangadsa.


31. Par Govinda Tarkavgsha Bhattchrya ; 600 grantha. Il semble donner aussi le Yantra pour chaque vers.
En outre, il dit que le dieu Mahdeva s'est incarn spcialement en la personne de Shankarchrya pour rpandre
la science de Shrvidy.
32. Sudhvidyotin, par le fils de Pravarasena. Ce Commentateur dit que l'auteur de cet hymne fameux tait son
pre, Pravarasena, prince des Dramida. Il nous raconte,
propos de la naissance de Pravarasena, une histoire trs
particulire. Comme il tait n une heure dfavorable,
Dramida, le pre de Pravarasena, d'accord avec son sage
ministre, du nom de Suka, le jeta dans la fort, de peur
que lui, le pre, ne perdt son royaume... L'enfant clbra
Dev par cet hymne, et la Dev, qui il avait plu, l'leva et
prit soin de lui dans la fort. L'histoire dit, pour finir, que
l'enfant retourna au pays de son pre et devint roi. Par son
ordre, son fils, le prsent Commentateur, crivit
Sudhvidyotin, aprs avoir t pleinement mit ce Shstra mystique, Shrvidy. Ce rcit, cependant, apparat
quelque peu fantaisiste. Je me procurai ce manuscrit au
Malabar mridional avec beaucoup de difficult. Il donne
la signification sotrique des vers d'Ananda-Lahar et
semble tre une prcieuse relique de littrature occulte.
33. Le livre des Yantra avec Prayoga. Il est trs rare et
trs important.
En dehors des commentaires ci-dessus, nous ne savons combien il en existe encore sur cet hymne .
La clbrit d'Anandalahar et le grand nombre de
commentaires qui lui sont consacrs sont la preuve de
l'extension et de l'autorit du Yoga que nous dcrivons.

Concluons par les mots du Commentateur de la Trishat


: Il est bien connu dans les Yoga-Shstra que le nectar
(Amrita) est dans la tte de toutes les cratures doues de
souffle (Prn), et que, Kundal s'y portant par le sentier du
Yoga qui est baign par le courant de ce nectar, les Yogin
deviennent semblables Ishvara667 .
Cependant, les Chakra mentionns ne sont pas toujours ceux du corps, dcrits plus haut, comme semble
l'indiquer l'expos suivant, dont on remarquera le caractre particulier, et qui est tir de la Shatchakra Upanishad
de l'Atharvaveda668. Il s'agit ici, apparemment, de centres
cosmiques dans le culte du Vishnu Avatra nomm Nrisimha.
Om. Les Deva, venant Satyaloka, parlrent ainsi
Prajpati, disant : Parle-nous des Chakra de Nrasimha669
; quoi il rpondit : Il y a six Chakra de Nrasimha. Le
premier et le deuxime ont chacun quatre rayons ; le troisime cinq ; le quatrime six ; le cinquime sept ; et le
sixime a huit rayons. Ce sont les six Chakra de Nrasimha. Maintenant, quels sont leurs noms, demandez-vous.
Ce sont Achakra670, Suchakra671, Mahchakra672, Sakala-

667 Sarveshm prninm shirasi amritam asti iti yogamrgena kundalingamane

tatratya tatpravhplutena yoginm Ishvarasmyam jyate iti yogashstreshu


prasiddham (Comm. du v. 1).
668 Bibliotheca Indica, d. Asiatic Society (1871). Les notes sont empruntes au

commentaire de Nryana.
669 L'incarnation de Vishnu comme homme-lion.
670 Anandtmaka ; dans l'tre d'Ananda (la batitude).
671 Bon, parfait.
672 clatant (Tejomaya).

loka-rakshana-chakra673,
Dyuchakra674,
Asurntaka675
chakra . Tels sont leurs noms respectifs (I).
Maintenant, quels sont les trois cercles (Balaya) ? Ce
sont l'intrieur, le moyen et l'extrieur676. Le premier est
Bja677 ; le second, Nrasimha-gyatri678 ; et le troisime,
l'extrieur, est Mantra. Maintenant, quel est le cercle intrieur ? Il en existe six (car chaque Chakra en possde un) ;
ce sont le Nrasimha, le Mahlkshmya, le Srasvata, le
Kmadeva, le Pranava, le Krodhadaivata (Bja), respectivement679. Tels sont les six cercles intrieurs des six Nrasimha Chakra (II).
Maintenant, quel est le cercle moyen ? Il en existe six.
chacun d'eux appartiennent Nrasimhya, Vidmaha, Vajranakhya, Dhmahi, Tannah, Simhah prachodayt, respectivement680. Tels sont les six cercles des six Nrasimha
673 Le Chakra qui par les Shakti de Jnna et de Kriy protge toutes les rgions

(Loka).

674 Le Chakra du sentier atteint par le Yoga.


675 Le Chakra qui est la mort de tous les Asura, ou menteurs.
676 Autrement dit, chaque Chakra se divise en trois parties : intrieure, moyenne

et extrieure ; c'est--dire Bja, Nrasimha Gyatr, Mantra.


677 Le Mantra racine.
678 Autrement dit le Mantra. Nrasimhya vidmahe vajraraklya dhmahi tan-

nah Simkah prachodayt. (Puissions-nous contempler Nrasimha, puissionsnous mditer sur ses serres pareilles Vajra. Puisse cet homme-lion nous conduire.)
679 C'est--dire les Bja suivants : Kshaum (dans Achakra) ; Shrm, Sa Shakti

(dans Suchakra) ; Aim (dans Mahchakra) ; Mira (dans Sakalalokarakshanachakra) ; Om (dans Dyuchakra) ; et Hm (dans Asurntakachakra).
680 Ce qui signifie qu' chacun d'eux sont assignes les diffrentes parties de la

Nrasimha-gyatri dont il est question plus haut.

Chakra.
Maintenant, quels sont les six cercles extrieurs ? Le
premier est Anandtm ou Achakra ; le second est
Priytm ou Suchakra ; le troisime est Jyotirtm ou
Mahchakra ; le quatrime est Mytm ou Sakalo-lokarakshana Chakra ; le cinquime est Yogtm ou Dyuchakra ; et le sixime est Sampttm ou Asurntakachakra.
Tels sont les six cercles extrieurs des six Nrasimha
Chakra681 (III).
Maintenant, o faut-il les placer682 ? Que le premier soit
plac dans le cur683, le second dans la tte684 ; le troisime l'emplacement de la mche du sommet de la tte
(Shikhym)685 ; le quatrime par tout le corps686 ; le cinquime dans tous les yeux (Sarveshu notreshu687 ; et le
sixime dans toutes les rgions (Sarveshu desheshu)688
(IV).
Celui qui effectue Nysa de ces Nrasimha Chakra sur
681 L'Atm comme batitude, amour, lumire ou nergie, My, le Yoga, et le

dernier Chakra qui est la destruction de tous les Asura.

682 C'est--dire : comment effectuer Nysa ? Cela est expliqu dans le Shatcha-

kranirpana.
683 Kshaum Nrasimhya priyt chakrya nandtmane svh hridayya na-

mah.
684 Shrm vidmahe suchakrya jyotirtmane privtmanesvh shirase svh.
685 Aim vajranakhya mahchakrya jyotirtmane svh shikhyai vashat.
686 M'ira dhmahi sakala-loka-rakshana-chakrya mytmane svh kavachya

hum.

687 Om tanno dyuchakrya yogtmane svh netratrayya vaushat.


688 Haum nrisimhah prachodayt asurntaka-chakrya satytmane svh as-

trya phat.

deux membres devient habile en Anushtubh689, gagne la


faveur du Seigneur Nrisimha, le succs dans toutes les
rgions et parmi tous les tres, et, la fin, la Dlivrance
(Kaivalya). C'est pourquoi il faut effectuer ce Nysa. Ce
Nysa purifie. Par lui on devient parfait dans l'adoration,
on est pieux, et l'on plat Nrasimha. Sans lui, d'autre
part, on ne gagne point la faveur de Nrisimha, et la force,
l'adoration ni la pit ne peuvent natre (V).
Celui qui lit ceci devient vers dans tous les Veda, devient capable d'officier comme prtre dans tous les sacrifices, devient pareil un homme qui s'est baign dans
tous les lieux de plerinage, un adepte de tous les Mantra,
et pur au dedans comme au dehors. Il devient le destructeur de tous les Rkshasa, Bhta, Pishcha, Shkin, Preta et Vetla690. Il est libr de toute crainte ; c'est pourquoi
il n'en faut point parler un non-croyant691 (VI).
Bien que ce Yoga soit universellement accept, il n'a pas
vit quelques critiques de la part des modernes. Le passage suivant, entre guillemets, est un rsum692 de celle
exprime par un Guru instruit l'anglaise693, et que j'ai
reu d'un de ses disciples. Il eut pour origine le don du
689 C'est--dire qu'il devient capable de langage, pote. Il connat le commence-

ment et la fin de toutes choses et il est capable d'expliquer toutes choses.


690 Diverses formes d'influences spirituelles terrifiantes et malignes.

691 C'est--dire quelqu'un qui n'est pas qualifi (Adhikr) pour recevoir cette

connaissance. Ici se termine l'Atharvanya Shatchakropanishat.


692 Si mon rsum, traduit du Bengali, souligne quelque peu le caractre dplo-

rablement acerbe de l'original, le critique, j'en suis sr, ne s'en plaindrait pas.

693 Il est toujours important de signaler le fait, car il influence gnralement la

manire de voir les choses. Dans certains cas l'esprit est si occidentalis qu'il est
incapable d'apprcier correctement des ides hindoues anciennes.

texte sanskrit de Shatchakranirpana et de PdukPanchak.


Le Yoga, comme moyen de libration, s'obtient en entrant par les portes de Jnna (la Connaissance) et de
Karma (l'Action). Le Yoga est incontestable batitude, car il
est l'union du Jvtm avec le Brahman qui est Batitude.
Il y a, par exemple, la batitude physique, qui peut tre
grossire ou subtile. C'est une erreur de supposer que
parce qu'une mthode de Yoga procure la batitude elle
assure de ce fait la dlivrance. Pour tre librs nous devons nous assurer cette Batitude particulire qui est le
Brahman. Il y a quelques sicles, pourtant, une bande
d'athes (les Bouddhistes) dcouvrirent la doctrine du Vide
(Shnyavda), et par la vaine parade d'une nouvelle espce de Nirvna Mukti fermrent ces deux portes qui donnaient accs la dlivrance. Aujourd'hui ces portes sont
dfendues par trois cadenas.
Le premier est la doctrine selon laquelle on atteint
Krishna par la foi, alors qu'Il demeure loign s'il y a raisonnement (Tarka).
Le second est l'erreur des Brahmo, qui pensent, la
manire occidentale, qu'ils peuvent matriser le Brahman
informel et immuable en fermant les yeux l'glise et en
rptant qu'Il est le Pre plein de misricorde et d'amour,
toujours occup de notre bien, et qu'on Lui plaira en Le
flattant ; car le culte (Upsan) est flatterie.
Le troisime est l'opinion de ceux pour qui tous les
actes religieux ne sont que superstition ; pour qui
l'gosme est le seul bien, et dont le plaisir est de jeter de
la poudre aux yeux des autres et de s'assurer la louange
de ceux qu'ils ont ainsi aveugls. Vishnu, afin de provo-

quer la disparition des Veda dans l'ge Kali, se manifesta


sous la forme de l'athe Bouddha, et permit la publication
de diverses fausses doctrines, comme celle des Arhata.
Rudra fut affect du pch d'avoir dtruit la tte de Brahm.
Alors il se mit danser, et un grand nombre de Rudra
vils et malfiques (Uchchhista), dont les actes ne sont jamais bons, sortirent de Son corps. Vishnu et Shiva se demandrent l'un l'autre : Pouvons-nous faire du bien
ces gens ? Leurs manifestations partielles promulgurent
alors des Shstra opposs aux Veda, adapts leur tournure d'esprit athe, afin qu'ils leur permissent peut-tre
de s'lever des choses suprieures.
Avec de telles critures, Dieu dupe les mchants. Pourtant, nous devons maintenant distinguer entre les Shstra. Ce n'est pas parce qu'il est dit en sanskrit : Shiva dit
(Shiva uvcha), que nous devons accepter tout ce qui
suit cette annonce. Tout ce qui est oppos au Veda et la
Smirti doit tre rejet. Des ennemis des Veda694 pour lesquels furent conus de tels Shstra, certains devinrent
Vaishnava, et d'autres Shaiva.
L'une de ces critures fut le Tantra avec un systme de
Yoga matrialiste appel Shatchakra-Sdhana, lequel n'est
que tromperie de la part des Guru professionnels, qui
n'ont pas hsit non plus rpandre de fausses critures.
La seule mention d'un Shstra tantrique nous remplit de
honte.
La Shatchakra-Sdhana n'est qu'un obstacle au progrs
694 Aucun Tantriste, je pense, n'admettrait cela. Il dirait que c'est l'ignorance

(Avidy) qui voit des diffrences entre Veda et Agama. Le critique se fait l'cho
de certaines attaques occidentales.

spirituel. La Batitude que l'on atteint, dit-on, en conduisant Kundal au Sahasrra n'est pas en discussion, puisqu'elle est affirme par ceux qui disent l'avoir prouve.
Mais cette Batitude (Ananda) n'est qu'une espce suprieure et momentane de Batitude physique, qui disparat
avec le corps, et non la Batitude qui est Brahman et dlivrance. Moksha ne s'obtient pas par l'entre au Sahasrra, mais par son abandon, en perant le Brahmarandhra
et en devenant sans corps695.
Le Tantriste cherche demeurer dans le corps, et
obtenir ainsi peu de frais la dlivrance, tout comme les
Brahmo et les membres de l'Arya Samja sont devenus
des Brahmajnn (connaisseurs du Brahman) peu de
frais.
Le Nectar aussi s'obtient peu de frais chez les Tantristes. Mais ce qui s'obtient peu de frais est toujours
sans valeur ; on l'prouve en essayant de retirer quelque
fruit de ses efforts. Et cependant tous les hommes sont
attirs lorsqu'ils entendent parler de Shatchakra.
Beaucoup sont tellement plongs dans la foi tantrique
qu'ils ne sauraient dcouvrir rien de mauvais dans ses
Shstra. Et l'Hindou d'aujourd'hui a t jet dans une telle
confusion par ses Guru tantristes, qu'il ne sait ce qu'il
veut. Il est accoutum depuis des sicles au Dharma tantrique696, et ses yeux ne sont plus assez clairs pour voir
qu'il est aussi vritablement inacceptable pour un Hindou
que pour un Musulman.
695 Il est exact que la Mukti ou Kaivalya complte est sans corps (Videha). Mais il

existe une Mukti dans laquelle le Yogi conserve son corps (Jvanmukti). En vrit,
il n'y a pas abandon , car Atm, comme le dit Shankara, ne vient ni ne part.
696 Cela atteste, en tout cas, sa large extension.

En ralit, ces personnes (au profit desquelles ce Guru


fait ces remarques) sont remplies de Mlechchhat 697, bien
qu'aprs tout l'on doive admettre que ce soit un progrs,
pour une crature telle qu'un Mlechchha, d'adhrer mme
une doctrine tantrique. Car si mauvaise qu'elle soit, elle
vaut mieux que rien.
Il n'en reste pas moins vrai, que les Guru les trompent
avec leurs paroles fascinantes au sujet de Shatchakra.
Pareils maint faiseur de rclame de notre temps, ils offrent de montrer leurs soi-disant Lotus ceux qui se
joindront eux. Des hommes sont envoys dans le but de
rassembler les gens et de les conduire auprs d'un
Dkshguru (initiateur).
cet gard les Tantristes sont tout pareils aux recruteurs de coolies pour les plantations de th 698. Le Tantriste
dit qu'il y a rellement des Lotus ; mais si rellement les
Lotus sont l, pourquoi ne nous dit-on pas comment nous
pouvons les voir699 ? Et l'on suppose aussi qu'il existe des
697 C'est l un terme de mpris qui remonte l'poque o l'on voyait dans

l'tranger un objet d'hostilit ou de mpris. Tout comme les Grecs et les Chinois
appelaient barbare quiconque n'tait pas Grec ou Chinois, les Hindous de
l'cole exotrique appellent tous les non Hindous, qu'ils appartiennent des
tribus aborignes ou qu'ils soient des trangers cultivs, Mlechchha. Mlechchhat dsigne l'tat de Mlechchha. Il faut porter au crdit du Shkta Tantra qu'il
n'encourage point des ides aussi troites.
698 Ceux-ci parcourent l'Inde, persuadant les villageois d'aller travailler dans les

plantations de th, auxquelles ils sont alors conduits par des moyens qui, pour ne
pas dire plus, ne sont pas toujours dignes d'admiration. La vrit m'oblige dire
que cette allgation, selon laquelle les Guru emploient des agents pour s'assurer
des disciples, ne repose sur rien. Les Guru dignes de ce nom sont, c'est un fait,
trs difficiles pour l'aptitude d'un candidat l'initiation.
699 Les livres et les Guru prtendent le faire.

Devat, des Dkini, des Yogin, toutes, tout moment,


prtes l'examen 700 . Et puis, comme tout cela est matriel !
Ils parlent d'un Parashiva au-dessus de Shiva, comme
s'il existait plus d'un Brahman701. Et puis, le nectar est dit
couleur de laque. Eh bien, s'il en est ainsi, il est une chose
grossire (Sthla) et visible ; et comme un docteur peut
alors exprimer ce nectar, il n'est nul besoin d'un Guru702.
Bref, le Shatchakra tantrique n'est qu'a un bonbon
dans les mains d'un enfant . un enfant capricieux on
donne un bonbon pour le faire rester tranquille. Mais s'il a
assez de bon sens pour savoir qu'on lui donne le bonbon
pour le distraire, il le jette, et trouve la clef des portes fermes du Yoga, appeles Karma et Jnna. Cette mthode
de Yoga fut chasse de la socit hindoue il y a des sicles.
Pour prs de 2.500 ans Shankara703, en dtruisant
l'athisme, extermina aussi le Shatchakrayoga704. Shankara montra ainsi la nullit des Tantra. On essaye aujourd'hui de les faire entrer de nouveau dans la socit hindoue, et il faut de nouveau les dtruire .
L'auteur de la note ainsi rsume a omis de remarquer,
700 Ce ne sont point-l choses qu'on fait voir la drobe n'importe qui. Seuls

voient, dit-on, ceux qui ont matris les grandes difficults de cette voie.
701 Il existe un seul Brahman avec ses diffrents aspects.

702 Ce nectar est dans le corps. Ce qui est perceptible n'est pas toujours une

chose aussi grossire que celles dont s'occupe la mdecine.


703 C'est la tradition hindoue relative l'poque du philosophe.
704 Quand Shankara discutait avec le Kplika Krakacha, celui-ci appela son

aide la forme terrible de Shiva nomme Bhairava. Mais Shankara adorant le Dieu,
celui-ci dit Krakacha : Ton heure est venue , et absorba en Lui Son adorateur.
(Voir le Shankaravijaya de Mdhava, eh. XV.)

ou ignorait peut-tre, que les Chakra sont mentionns


dans les Upanishad, mais il a tent d'expliquer le fait
qu'ils sont aussi dcrits dans les Purna en allguant que
les Chakra puraniques sont en conformit avec les Veda,
alors que les Chakra tantriques ne le sont pas. Il admet
que dans le Shiva Purna figure une description des six
centres, mais il dit qu'ils n'y sont pas donns comme
ayant une existence relle, et qu'il n'est fait mention d'aucune Sdhan base sur eux. On doit, prtend-il, les imaginer seulement dans un but d'adoration.
Dans le culte extrieur Deva et Dev sont adors dans
des Lotus semblables. En fait les Purna, dans cette manire de voir, convertissent ce qui est adoration extrieure
en adoration intrieure. Si, d'aprs le Purna, on adore un
lotus intrieur, il ne faut pas supposer qu'il y ait l en ralit quelque chose. On adore seulement une fiction de son
imagination, bien qu'il soit dit (il est curieux de le noter)
que cette fiction assure certains avantages l'adorateur et
que celui-ci doit commencer, selon notre critique, par le
Chakra qu'il est qualifi pour adorer. On ne voit pas bien
comment se pose cette question de qualification, si chacun
des Chakra n'est qu'imagin. On attire l'attention sur le
fait que dans le Linga Purna il n'est point parl de l'veil
de Kundal, de la perce des six centres, de la saveur du
nectar... Le Purna se contente de dire : Mdite sur Shiva
et Dev dans les diffrents lotus .
Il existe donc, prtend-on, une diffrence radicale entre
les deux systmes. Dans la description puranique des
Chakra tout est clairement expos ; mais chez les Tantristes tout est mystre, et comment en vrit pourraientils, autrement que par cette mystification, exercer malhonntement leur profession de Guru ?

Les Bouddhistes pourront discuter l'interprtation de


leur Shnyavda par ce critique, comme les Tantristes
contesteront son expos de l'origine de leur Shstra. L'historien mettra en question cette affirmation, que Shankara
a aboli le Tantra. Car, selon le Shankaravijaya, son uvre
ne fut pas d'abolir aucune des sectes existant son
poque, mais de les rformer, d'tablir entre elles des liens
d'unit, et de les engager suivre toutes, par leurs diffrentes mthodes, un idal commun.
Ainsi, quand bien mme Krachaka et t absorb en
son Dieu, la secte extrme du Tantrisme qu'il reprsentait,
celle des Kplika, continua, dit-on, d'exister avec l'approbation de Shankara, bien que sous une forme modifie
peut-tre, sous son chef Vatukantha. Les Brahmo, les
Aryasamja, les Vaishnava, et les Shaiva, peuvent tre
blesss par les remarques de ce critique dans la mesure
o elles les touchent. Je n'ai pas m'occuper ici de ces
sectes religieuses, mais limiterai mon sujet les observations que je vais prsenter en rponse.
La critique, en dpit de son pret pieuse envers des
formes de doctrine que dsapprouvait l'auteur, contient
certaines remarques justes. Mais je n'ai pas m'occuper
ici d'tablir la ralit ou la valeur de cette mthode de Yoga, et il n'est pas de preuve valable, sur l'un et l'autre de
ces deux points, en dehors de l'exprimentation et de l'exprience relles.
D'un point de vue doctrinal et historique, cependant, il
est possible de rpondre. Il est exact que Karma et Jnna
sont des moyens d'obtenir Moksha. Avec Bhakti (la dvotion), qui peut participer du caractre du premier ou du

second, suivant la faon dont elle sexerce705, ils sont tous


deux contenus dans les huit mthodes de Yoga.
C'est ainsi qu'elles comprennent Tapas, forme de Karma
yoga706 et Dhyna, mthode de Jnna yoga. Comme on l'a
montr, le Yoga aux huit membres (Ashtngayoga)
comprend des pratiques de Hatha yoga, comme Asana et
Prnyma. Ce qu'ont fait les Hathayog, c'est de dvelopper les pratiques et l'aspect Hatha, c'est--dire physiques.
Une juste conception du Hathavidy reconnat qu'il est un
auxiliaire de Jnna, par quoi l'on obtient Moksha. Il n'est
pas moins vident que toute Batitude n'est point Moksha.
Une certaine sorte d'Ananda (Batitude) peut s'obtenir
par la boisson ou les drogues, mais nul ne supposera que
c'est l Batitude de dlivrance. De mme, les pratiques
du Hathayoga peuvent procurer diverses formes de Batitude physique, grossire ou subtile, qui ne sont point La
Batitude. Pourtant on interprte mal le systme en question, en le dcrivant comme purement matrialiste. Il a,
comme d'autres formes de Yoga, un ct matriel, un aspect Hatha, puisque l'homme est grossier, subtil et spirituel ; mais il a aussi un aspect Jnna.
Tout Yoga fait sa place l'exercice mental. Le Jva tant
matriel et spirituel la fois, discipline et progrs sont ncessaires sous ces deux aspects. Kundal est veille par le
705 Ainsi les offrandes, de fleurs, par exemple, la Divinit, participent de la

nature de Karma ; alors que Bhakti sous son aspect transcendant, o par amour
du Seigneur l'adorant est fondu en Lui, est une forme de Samdhi.
706 Si, pourtant, nous considrons ce qu'on appelle les trois Knda (c'est--dire

Karma, Upsan et Jnna), Tapas et les pratiques semblables font partie d'Upsan Knda. La dfinition donne plus haut ne concerne que la classification
des Yoga.

Mantra, qui est une forme de Conscience (Chaitanya).


C'est celui dont l'tre est immerg dans le Brahman , qui
veille la Dev Kundal par le Mantra Hmkra (Shatchakranirpana, v. 50). La Dev est Elle-mme Shuddha Sattva707 (v. 51). Le sage et excellent Yogi, envelopp dans
Samdhi et dvou aux Pieds de Lotus de son Guru, doit
conduire Kundalin, avec Jva, Son Seigneur le Parashiva dans la demeure de la Dlivrance l'intrieur du pur
Lotus, et mditer sur Celle qui exauce tous les dsirs
comme la Chaitanyarp Bhagavat (la Dev dont la substance est la Conscience mme) ; et en conduisant l Kundalin, il doit faire que toutes choses s'absorbent en Elle .
La mditation se fait sur chaque centre dans lequel Elle
uvre. Dans le centre Ajn, Manas ne peut s'unir Kundalin et s'absorber en Elle qu'en devenant un avec la
Jnna-shakti qu'Elle est, puisqu'Elle est toutes les Shakti.
Le Laya-yoga est donc une combinaison de Karma et de
Jnna. Le premier indirectement, et le second directement, ralisent Moksha. Dans l'Ajn sont Manas et Om, et
l-dessus le Sdhaka mdite (v. 33).
L'Atma du Sdhaka doit se transformer en mditation
sur ce lotus (v. 34). Son Atma est dans le Dhyna de Om,
qui est l'Atma intrieur de ceux dont la Buddhi est pure. Il
ralise que lui et le Brahman sont un, et que Brahman est
seul rel (Sat) et tout le reste irrel (Asat). Il devient ainsi
un Advaitavd, qui ralise l'identit du Soi individuel et
du Soi universel (ibid.). Le mental (Chetas), par la pratique
rpte (Abhysa), est ici dissous, et cette pratique est
l'opration mentale elle-mme (v. 36). Car le Yogi, en mdi707 Sattva, Atisttva, Paramasattva, Shuddhasattva et Vishuddhasattva sont cinq

formes diffrentes de Chaitanya.

tant sur le Mantra par lequel il ralise l'unit de Prna et


de Manas, ferme la maison suspendue sans support .
Autrement dit, il libre le Manas de tout contact avec le
monde objectif (v. 36), afin d'atteindre l'Unman Avasth.
L est Paramashiva. Le Tantriste ne suppose point qu'il
existe plusieurs Shiva, dans le sens de plusieurs Divinits
distinctes. Le Brahman est un. Rudra, Shiva, Paramashiva, et tous les autres, ne sont que des noms pour les diffrentes manifestations de l'Un.
Lorsqu'il est dit que telle Devat est dans tel Chakra,
cela signifie que ce dernier est le sige de l'opration du
Brahman, opration qui sous son aspect Daiva est connue
sous le nom de Devat. Selon que varient ces oprations,
de mme les Devat (v. 44). C'est ici dans l'Ajn que le Yogi met son Prna l'heure de la mort, et entre au sein du
suprme Purusha, qui tait avant les trois mondes, et
qui est connu par le Vednta (v. 38).
Il est exact que cette opration, comme d'autres encore,
s'accompagne de pratiques Hatha. Mais elles sont associes la mditation. Cette mditation unit Kundalin et
Jvtm avec le Bindu qui est Shiva et Shakti (Shivashaktimaya), et le Yogi aprs cette union, perant le Brahmarandhra, est libr du corps sa mort et devient un
avec Brahman (ibid.). Le corps causal secondaire (Kranvntara Sharra) au-dessus d'Ajn et au-dessous de
Sahasrra ne peut tre vu que par la mditation (v. 39),
lorsqu'on a atteint la perfection dans la pratique du Yoga.
Le v. 40 se rapporte au Samdhi Yoga.
Passant au Sahasrra, le texte dit : Bien cach, et accessible seulement par grand effort, est ce Vide subtil
(Shnya) qui est la profonde racine de la Dlivrance (v.

42). En Paramashiva sont unies deux formes de Batitude


(v. 42) : Rasa ou Paramnanda Rasa (c'est--dire la batitude de Moksha), et Virasa (ou la batitude produite par
l'union de Shiva et de Shakti).
C'est de cette union que naissent l'univers et le nectar
qui inonde le microcosme (Kshudrabrahmnda), autrement dit le corps. L'ascte (Yati) dont le mental est pur est
instruit dans la connaissance par laquelle il ralise l'unit
du Jvtm et de Paramtm (v. 43). Cet homme surminent qui a matris son mental (Niyatanija-chitta), c'est-dire concentr les facults internes (Antahkarana) sur le
Sahasrra, et l'a connu, est libr des renaissances , et
ainsi atteint Moksha (v. 45). Il devient Jvanmukta, ne
demeurant dans le corps que le temps ncessaire pour
puiser le Karma dont l'activit a dj commenc, tout
comme une roue en mouvement tourne quelque temps
encore aprs que la cause de son mouvement a cess.
C'est la Bhagavat Nirvna-Kal qui accorde la divine
connaissance libratrice, Tattva-jnna, ou connaissance
du Brahman (v. 47). En Elle est Nitynanda, qui est la
pure Conscience elle-mme (v. 49), et que seuls les Yogi
peuvent atteindre, par pure Jnna (ibid.). C'est ce Jnna
qui procure la dlivrance (ibid.).
Le My Tantra dit : Ceux qui sont verss dans le Yoga
disent qu'il est l'unit de Jva et d'Atm (en Samdhi).
D'aprs l'exprience de quelques autres, il est la connaissance (Jnna) de l'identit de Shiva et d'Atm. Les Agamavd disent que la connaissance de Shakti est le Yoga.
D'autres sages disent que la connaissance du Purna
Purusha est le Yoga ; et d'autres encore, les Prakritivd,
dclarent que la connaissance de l'union de Shiva et de

Shakti est le Yoga (v. 57). La Dev, par la dissolution de


Kundalin dans le Parabindu, effectue la dlivrance de certains Sdhaka par leur mditation sur l'identit de Shiva
et d'Atm dans le Bindu. Elle agit, en d'autres cas, par un
processus analogue et par la mditation (Chintana) sur
Shakti. Dans d'autres cas encore le rsultat est obtenu
par la concentration de la pense sur le Paramapurusha,
et dans d'autres par la mditation du Sdhaka sur l'union
de Shiva et de Shakti (ibid.).
En fait, l'adorateur de n'importe quelle Devat particulire doit raliser qu'il ne fait qu'un avec l'objet de son
adoration. Dans le culte Pranava, par exemple, l'adorateur
ralise son identit avec l'Omkra.
Dans d'autres formes d'adoration, il ralise son identit
avec Kundalin, qui est incarne dans les diffrents Mantra adors par des adorateurs diffrents. En somme, Jnna est Kriyjnna et Svarpajnna. Celui-ci est exprience
spirituelle directe. Le premier est constitu par les mthodes de mditation qui y conduisent. Il y a ici Kriyjnna, et lorsque Kundalin s'unit Shiva Elle donne Jnna
(Svarpa), car Sa nature (Svarpa), comme aussi celle de
Shiva, est cela.
Aprs l'union avec Shiva, Kundalin fait Son voyage de
retour. Aprs tre plusieurs reprises alle Lui708, Elle
fait un voyage qui sera, la volont du Yogi, sans retour.
Alors le Sdhaka est Jivanmukta ; Son corps tant conserv jusqu'au moment o le Karma actif est puis, et o
il pourra raliser la Dlivrance sans corps (Videha) ou Dlivrance suprme (Maivalya Mukti). Le rvr Matre et
708 Cela est ncessaire l'obtention de l'aptitude. Par la rptition l'acte devient

naturel, et son rsultat devient permanent la fin.

Prcepteur , Shankarchrya, dans sa fameuse Anandalahar, clbre ainsi Son retour (v. 53) :
Kuharini, Tu rpands sur toutes choses le fleuve de
nectar qui ruisselle des extrmits de Tes deux pieds ; et
lorsque Tu regagnes Ta place, Tu vivifies et Tu rends visibles toutes les choses qui taient jusqu'alors invisibles ;
et en atteignant Ta demeure Tu T'enroules de nouveau
comme un serpent, et dors .
En d'autres termes, alors que Sa monte tait Layakrama (dissolution des Tattva), Son retour est
Srishtikrama (recration des Tattva). Selon le v. 51, le Yogi
qui a pratiqu Yama et Niyama, avec les autres mthodes
de l'Ashtngayoga, qui comprennent Dhyna et le Samdhi qui en est le fruit, et dont le mental a t ainsi matris,
ne renat jamais plus. Rjoui par la ralisation perptuelle
du Brahman, il est en paix.
Que la mthode dcrite ci-dessus soit ou non efficace ou
dsirable, il doit apparatre vident, la lecture du texte
qui en donne une explication, que le Yoga, dont l'auteur
affirme qu'il est la cause de la Dlivrance, n'est pas simplement matriel, mais qu'il est l'veil de la Puissance
(Jvashakti) de la Conscience Cosmique (Jagachchaitanya)
qui fait de l'homme ce qu'il est. Le Yogi prtend ainsi se
procurer la batitude de la Dlivrance en y entrant par les
portes du Karmayoga et du Jnnayoga.
Un auteur Brahmo709, adversaire du Tantra au point de
dcrire la diffrence qui le spare du Veda comme aussi
grande que celle qui existe entre l'Enfer (Ptla) et le Ciel
709 Gyatrimlaka Shatchakrer vykhyna o sdhan (Mangala Ganga Mission

Press).

(Svarga)710 , ne nie pas l'efficacit de la Shatchakra Sdhan tantrique, mais l'oppose la Gyatr Sdhan vdique dans un expos des deux mthodes que je rsume
ici entre guillemets.
Les Chakra (dont l'existence n'est pas discute) sont
placs aux points de runion des nerfs et des muscles 711.
L'Ajn est le lieu du Commandement. Celui-ci se manifeste dans l'acte de Buddhi. Si le commandement est suivi,
le Sdhaka devient pur en son esprit (Bhva) et dans ses
paroles. La parole s'exerce dans la gorge, la rgion du Vishuddha.
Le Chakra situ immdiatement au-dessous est appel
Anhata cause de sa liaison avec Nda, qui se produit de
lui-mme dans le cur. Le Vyu dans Anhata est Prnashakti. Ici, quand on est libre de pch, on peut voir
l'Atm. Ici le Yogi ralise : Je suis Lui . Le feu est au niveau du nombril. Le sige du dsir est la racine du
Svdhishthna.

710 L'auteur non orthodoxe que nous citons, rapportant cette parole suivant

laquelle pour atteindre Siddhi (la ralisation) en Shruti (l'tude et la pratique


des prescriptions des Veda), le Brhmana doit suivre le Tantra , demande, conformment son opinion sur ce dernier Shstra : Comment ceux qui sont spars du Veda peuvent-ils obtenir Siddhi en Shruti ? Cela ne fait que rpter ce
que l'on reproche communment au Tantra, savoir d'tre oppos aux Veda, ce
que nie le Shstra lui-mme. Le Kulrnava Tantra en parle, au contraire, comme
de Vedtmaka. Naturellement, prtendre se baser sur le Veda est une chose, et
c'en est une autre que de savoir si tel Shstra particulier est d'accord avec lui en
fait. De ceci les coles hindoues discutent, tout comme les sectes chrtiennes
sont en dsaccord au sujet de la Bible, sur laquelle toutes se prtendent fondes.
711 Cette dfinition est inexacte. Comme on l'explique plus loin, les ganglions

physiques ne sont que des correspondances grossires des Chakra vitaux subtils
qui les animent.

Dans le lotus le plus bas, le Mldhra, sont les trois


Shakti de Jva (Ichchh, Kriy et Jnna), dans un tat inconscient et non vitalis. Le Sdhaka, avec l'aide du Partm sous la forme du feu (Agni) et de l'air (Vyu)712
veille ces trois forces (Shakti), et finalement, par la grce
du Partm, il est uni au Turya Brahman.
Autrefois, la Sdhan commenait au Mldhra
Chakra, c'est--dire que ceux qui n'taient point Sdhaka
du Gyatr-Mantra commenaient par le bas, au centre
infrieur. Il y avait cela une bonne raison, car les sens
(Indriya) taient ainsi matriss. Sans cette matrise, des
dispositions pures (Bhva) ne peuvent tre obtenues. Si
l'on n'atteint pas cette puret, alors le mental (Chitta) ne
peut trouver sa place dans le cur ; et si le Chitta n'est
pas dans le cur, il ne peut y avoir d'union avec le Partm.
Aussi la premire chose que doit faire un Sdhaka estelle de matriser ses sens. Ceux qui ont ralis cette matrise sans fixer leur mental sur le Seigneur (Ishvara) 713 ont
d passer par maintes pratiques difficiles et pnibles
(comme les Mudr, les Bandha, etc., mentionns plus
loin), qui taient ncessaires pour la matrise des Indriya
et de l'action des Guna. Tout cela n'est point ncessaire
dans la mthode de la Gyatr Sdhan.
Il est exact que les sens doivent tre matriss dans les
712 L'auteur fait ici allusion aux pratiques dcrites dans les textes, par lesquelles

on aspire l'air et fait flamber les feux intrieurs pour veiller le serpent endormi.
Le Partm est l'Atm Suprme.
713 Cette remarque ouvre des aperus qui ne sont point sans valeur. Il en est qui

suivent la voie de la dvotion (Bhakti) ; mais ceux qui en sont dpourvus, ou la


possdent un moindre degr ?

trois centres (Chakra) infrieurs : la convoitise (Lobha)


dans le Mldhra, la luxure (Kma) dans le Svdhishthna la racine des organes gnitaux, et la colre
(Krodha) au nombril. Ces trois passions sont les plus
puissantes mettre les sens en mouvement, et sont les
portes principales de l'Enfer.
Cependant, la manire dont on doit les matriser est de
placer Chitta (le mental) sur Satt (l'existence) de Paramtm dans ces Chakra. Le Chitta doit tre conduit dans
chacun de ces trois centres infrieurs et matris : par ce
moyen, les passions qui ont leurs places respectives dans
ces centres sont matrises. Ainsi, chaque fois que les sens
(Indriya) chappent votre contrle, fixez le Chitta (le
mental) sur le Paramtm dans le Chakra qui convient.
(Pour exprimer cela d'une manire plus conforme la
tournure d'esprit occidentale : si, par exemple, il s'agit de
matriser la colre, transportez le mental au nombril, et l
mditez sur l'existence de l'Un Suprme (Paramtm) dans
ce centre, non seulement en tant que Suprme l'extrieur du corps et l'intrieur du corps, mais en tant
qu'incarn dans cette rgion particulire du corps ; car elle
est Sa manifestation. Le rsultat est que l'activit passionnelle de ce centre est soumise ; car son fonctionnement
est accord l'tat de l'Atm qui l'anime, et le corps aussi
bien que le mental atteignent la paix de l'Atm sur lequel
est concentr le soi.)
Les sens tant ainsi matriss, la Gyatr Sdhan
commence, non par le plus bas, mais par le plus lev des
six centres, l'Ajn entre les sourcils. Il n'est point ncessaire de recourir la pratique difficile et pnible de la per-

ce des Chakra partir du bas714.


Fixez le mental sur le Seigneur (Ishvara) dans le centre
le plus lev. Pour l'ther (Aksh) il y a l'tre (Satt) de
l'Atm Suprme. L, et dans les deux centres placs audessous (Vishuddha et Anhata), on a la jouissance d'Ishvara. L'union entre Jva et Prakriti est appele Miel (Madhu) dans les Upanishad.
Par Sdhan du centre Ajn, on obtient la puret de
l'tre (Bhvashuddhi), et la puret des paroles suit l'obtention de la premire. On obtient ici le Yoga avec la Devat
Suprme qui est toute-connaissante. Celui qui est libr
de toutes les perturbations du corps et du mental atteint
l'tat qui est au del des Guna (Guntta), et qui est celui
du Suprme Brahman .
Nous pouvons donner pour conclusion ces deux critiques cette parole hindoue, si vraie, cite assez lgrement dans la premire d'entre elles : Discuter la religion
(Dharma) d'autrui est la marque d'un esprit troit. O Seigneur ! O Grand Magicien ! Quels que soient la croyance
ou le sentiment avec lesquels nous T'invoquons, ils Te
plaisent .
Quelque diffrence qu'il y ait eu, ou qu'il puisse y avoir,
quant aux formes et aux mthodes, dans l'Upsan ou le
Yoga, tous les adorateurs hindous rattachs la tradition
antique n'en cherchent pas moins un but commun : l'unit avec la Lumire de la Conscience, qui est au del des
rgions du Soleil, de la Lune et du Feu.
714 Cette remarque semble indiquer une mconnaissance du caractre spci-

fique du Yoga. Si l'on dsire veiller Kundal, l'opration doit commencer, m'affirme-t-on, au centre le plus bas. Cependant, il existe d'autres formes de Yoga
dans lesquelles on n'veille pas Kundal.

On demandera maintenant quels sont les principes gnraux sur quoi reposent les pratiques de Yoga dcrites
plus haut. Comment se fait-il que l'veil de Kundalin
Shakti et Son union avec Shiva ralisent l'tat d'union extatique (Samdhi) et l'exprience spirituelle que l'on affirme ? Le lecteur qui a compris les principes gnraux
mentionns dans les chapitres prcdents saisira aisment, s'il ne l'a dj devine, la rponse que je donne ici.
En premier lieu, le prcdent chapitre aura indiqu qu'il
existe deux catgories de Yoga : le Dhyna ou Bhvan
Yoga, et le Kundalin Yoga, sujet de cet ouvrage, et qu'il y
a entre les deux une diffrence.
La premire catgorie est celle o l'extase (Samdhi) est
obtenue par des mthodes d'intellection (Kriy jnna), de
mditation, avec l'aide possible, au stade prliminaire, de
mthodes auxiliaires de Mantra ou de Hathayoga715
(autres que l'veil de Kundalin Shakti), et par le dtachement du monde ; la seconde est ce Yoga dans lequel, bien
que les mthodes d'intellection ne soient pas ngliges, la
Shakti cratrice et prservatrice du corps entier sous sa
forme de Kundalin est rellement et vritablement unie au
Seigneur qui est Conscience, afin de procurer au Yogi un
rsultat que le Jnna-yog obtient directement. Le Yogi fait
d'Elle son introductrice auprs de Son Seigneur, et jouit
par Son intermdiaire de la batitude de l'union. Bien que
ce soit le Seigneur qui L'veille, c'est Elle qui donne Jnna,
car Elle est Elle-mme cela.
Le Dhynayogi obtient la connaissance de l'tat suprme dans la mesure o ses propres pouvoirs de mditation peuvent la lui donner, et ne connat pas la jouissance
715 Telles que Prnyma, et Asana.

de l'union avec Shiva dans et par la puissance fondamentale de son corps.


Ces deux formes de Yoga diffrent dans leur mthode
comme dans leur rsultat. Le Hathayog en qute de Laya
considre son Yoga, et le fruit qu'il en obtiendra, comme
les plus hauts qui soient. Le Jnna-yog a du sien la
mme opinion. En fait, le Rja Yoga est gnralement regard comme la plus haute forme de Yoga.
Kundalin jouit d'un tel renom que beaucoup s'efforcent
de La connatre. Ayant tudi la thorie de son Yoga, on
m'a souvent demand si l'on pouvait s'en passer . La
rponse du Shstra est la suivante : Tout dpend de ce
que vous cherchez, et de vos pouvoirs . Si vous voulez
veiller Kundalin Shakti pour jouir, par Son intermdiaire, de la batitude de l'union de Shiva et de Shakti,
que vos capacits ne vous permettent pas d'obtenir autrement, ou si vous dsirez acqurir les pouvoirs (Siddhi)716 qui accompagnent cette exprience, il est vident
que vous ne pourrez atteindre au but que par le Yoga dcrit dans ce livre.
Mais si l'on cherche la dlivrance, et si le Yogi est capable de l'atteindre sans Kundalini, alors ce Yoga n'est pas
ncessaire, car la dlivrance peut tre obtenue par pur
Jnnayoga, au moyen du dtachement, de l'exercice, et
ensuite de l'apaisement du mental, sans faire le moindre
appel la puissance centrale du corps. En vrit, la Dlivrance parfaite (Nirvikalpa Samdhi) ne peut tre obtenue
de cette manire que par le Rja Yoga, dont le Kundalin

716 C'est ainsi qu'en faisant monter Kundalin Shakti au centre Manipra, on

peut, dit-on, acqurir la matrise du feu.

Yoga est une mthode prliminaire 717.


On peut aussi obtenir Samdhi par la voie de la dvotion (Bhakti), comme par celle de la connaissance. En ralit, la dvotion la plus leve (Parabhakti) n'est point diffrente de la connaissance. Toutes deux sont ralisation.
Un Dhynayog ne doit point ngliger son corps, sachant
que puisqu'il est la fois mental et matire, chacun des
deux ragit sur l'autre. Ngliger, ou simplement mortifier
le corps, risque de produire le dsordre de l'imagination
plutt qu'une exprience spirituelle vritable. Pourtant il
n'a pas s'occuper du corps la manire du Hathayog.
Il est possible de russir comme Dhyna-Yog tout en
tant faible de corps, de sant dbile, et appel une
courte vie. Son corps, et non lui, dcide du moment de sa
mort. Il ne peut mourir volont. L'extase, qu'il appelle
Dlivrance dans la vie (Jvanmukti) n'est pas, m'a-t-on
dit, un but comparable la vraie Dlivrance. Il peut demeurer l'esclave d'un corps souffrant, dont il ne sera libr
qu' la mort ; alors il aura la Dlivrance. Son extase est de
la nature d'une mditation qui s'enfonce dans le Vide
(Bhvansamdhi), par ngation de la pense et dtachement du monde, opration dans laquelle l'veil de la puissance centrale du corps n'a aucune part.
Par son effort718 le mental, qui est un produit de Kunda717 Soumise Dharma, Yama, Niyama, etc. Dans tous les cas o le but poursuivi

est purement spirituel , il y a Vairgya ou renonciation.


718 C'est ce qui fait du Rja Yoga le plus haut et le plus difficile des Yoga, car on

force le mental se matriser lui-mme. Dans le Laya Yoga cette matrise est
effectue pour l'Adhaka par Kundalin Shakti. Il L'veille et Elle lui obtient des
Siddhi. Il est moins malais d'veiller Kundalin que d'obtenir par la seule force
de sa pense Nirvikalpa Samdhi.

lin en tant que Prakriti Shakti, est apais avec ses dsirs
terrestres, si bien que le voile produit par l'activit mentale
est t de devant la Conscience.
Dans le Layayoga c'est Kundalin Elle-mme, une fois
veille par le Yogi (car cet veil est son action et son rle),
qui ralise pour lui cette illumination.
Mais pourquoi, demandera-t-on, s'inquiter du corps et
de sa puissance centrale, d'autant plus qu'ils sont une
cause de risques et de difficults exceptionnels ? La rponse a t fournie dj : certitude et facilit prtendues
de ralisation par l'entremise de la puissance qui est la
Connaissance elle-mme (Jnna-rp shakti) ; acquisition
pralable de pouvoirs (Siddhi) ; et jouissance pralable et
finale. Pourtant il peut tre utile de dvelopper cette rponse, car un principe fondamental du Shkta Tantra s'y
trouve impliqu.
Le Shkta Tantra prtend donner la fois la jouissance
(Bhukti)719 dans ce monde et dans l'autre, et la Dlivrance
(Mukti) de tous les mondes. Cette prtention est base sur
un principe profondment vrai720.
Si la Ralit dernire existe sous deux aspects, celui
719 Comme il y a des personnes qui associent toujours au mot jouissance

(Bhoga) les menus plaisirs , il est ncessaire de prciser que le mot Bhoga
n'implique point ncessairement cela, et qu'il n'est point pris ici dans ce sens. Au
sens philosophique, Bhoga est la perception des choses, dont rsulte jouissance,
ou parfois souffrance. Il peut s'appliquer toute forme de jouissance sensorielle
ou intellectuelle. Toute vie dans le monde des formes est jouissance. Bhoga comprend en fait la souffrance.
720 Qu'il est possible d'adopter sans approuver aucune des applications particu-

lires qu'on en peut tirer. Il y a certaines pratiques dangereuses (pour ne pas


dire plus), qui, aux mains d'tres infrieurs, ont conduit des rsultats auxquels
le Shstra doit sa mauvaise rputation cet gard.

d'une jouissance paisible du Soi dans la Dlivrance de


toutes les formes, et celui d'une jouissance active des
choses, autrement dit comme pur Esprit et comme
Esprit dans la matire, alors une union complte avec la
Ralit exige que l'on soit un avec elle sous ses deux aspects. Elle doit tre connue la fois ici (Iha) et l
(Amutra).
Comprise et pratique comme il convient, la doctrine
n'est point dnue de vrit, qui enseigne que l'homme
doit tirer le meilleur parti possible des deux mondes721. Il
n'y a pas entre les deux d'incompatibilit relle, pourvu
qu'on agisse en conformit avec la loi universelle de la
manifestation.
On enseigne tort, affirme cette doctrine, que le bonheur futur ne peut tre obtenu qu'en ddaignant de le rechercher ici-bas, ou en recherchant dlibrment la souffrance et les mortifications. C'est l'unique Shiva qui est
l'exprience bienheureuse suprme, et qui apparat sous
la forme humaine avec une vie mle de plaisir et de souffrance. Le bonheur ici-bas, et la batitude de la dlivrance
ici-bas et dans l'au-del, peuvent s'obtenir si l'identit de
ces Shiva est ralise dans tous les actes humains. On y
parviendra en faisant de chaque fonction humaine, sans
exception, un acte religieux de sacrifice et de culte (Yajna).
Dans l'ancien rituel vdique, la jouissance de la nourriture
et de la boisson tait prcde et accompagne de rites et
de sacrifices. Cette jouissance tait le fruit du sacrifice et
le don des dieux.
721 Mondes , parce que c'est l l'expression occidentale. Mais l'opposition est

ici entre le monde (que ce soit la terre ou le ciel), et la dlivrance de tous les
mondes.

un stade plus lev de la vie d'un Sdhaka, elle est offerte l'Unique dont viennent tous les dons et dont les
Devat sont des formes limites et infrieures. Mais cette
offrande implique aussi un dualisme dont la Sdhan monistique (Advaita) la plus leve du Shkta-Tantra est libre. Ici la vie individuelle et la vie cosmique sont reconnues comme ne faisant qu'une. Si bien que le Sdhaka
tantriste, lorsqu'il mange ou boit722 ou qu'il accomplit
n'importe quelle autre fonction naturelle du corps, le fait
en disant et en croyant : Shivo'ham ( Je suis Shiva ),
Bhairavo'ham ( Je suis Bhairava723 ), S'ham ( Je suis
Elle724 ).
Ce n'est pas simplement l'individu spar qui agit et
jouit. C'est Shiva, dans et par lui. Cet homme reconnat,
comme on l'a fort bien dit725, que sa vie et le jeu de toutes
ses activits ne sont point chose spare, garder et
poursuivre gostement pour elle-mme et pour lui-mme,
comme si la jouissance tait quelque chose prendre de la
vie par sa propre force et ses propres moyens, avec le sentiment d'tre spar ; mais sa vie, et toutes les activits de
sa vie sont conues comme faisant partie de l'action divine
dans la nature (Shakti), se manifestant et uvrant sous la
forme humaine. Il saisit dans la pulsation de son cur le
rythme qui palpite dans la vie universelle, et qui en est le
signe. Ngliger ou nier les besoins du corps, y penser
722 Ainsi, dans le rituel Shkta, le Sdhaka qui prend la coupe de vin rpand le

vin comme une libation dans la bouche de Kundalin Shakti, la Shakti apparaissant sous la forme du Sdhaka.
723 Un nom de Shiva.
724 C'est--dire la Mre universelle apparaissant sous la forme de Son adorateur.
725 Sj. Aurobindo Ghose dans Arya.

comme quelque chose de non divin, c'est ngliger et nier


cette vie plus vaste dont il fait partie, et fausser la grande
doctrine de l'unit de tout et de l'identit dernire de la
Matire et de l'Esprit.
Si l'on se laisse guider par une telle conception de la ralit, mme les besoins physiques les plus bas prennent
une signification cosmique. Le corps est Shakti.
Ses besoins sont les besoins de Shakti ; quand l'homme
jouit, c'est Shakti qui jouit par son intermdiaire. En tout
ce quil voit et fait, c'est la Mre qui regarde et qui agit. Ses
yeux et ses mains sont celles de la Mre. L'ensemble du
corps et de ses fonctions sont Sa manifestation. La concevoir pleinement sous cette forme c'est rendre plus parfaite
cette manifestation particulire de la Mre, qui est luimme.
L'homme, quand il essaie d'tre matre de soi, l'essaie
sur tous les plans, physique, mental et spirituel ; on ne
peut les sparer, car tous sont lis, ne constituant que des
aspects diffrents de la Conscience unique et universelle.
Qui est le plus proche du divin, de celui qui nglige et mprise le corps et le mental afin d'atteindre une imaginaire
supriorit spirituelle, ou de celui qui avec sagesse prend
soin de tous deux comme de formes de l'Esprit unique
dont ils sont le vtement ?
On atteint plus rapidement et plus authentiquement la
ralisation en discernant l'Esprit l'intrieur et sous la
forme de tout l'tre et de ses activits, qu'en les fuyant et
les rejetant comme non spirituels ou illusoires, et comme
des obstacles dans la voie726.
726 La premire mthode est la mthode tantrique pour mettre en application la

Si l'on s'en fait une ide fausse, ils peuvent en vrit


tre des obstacles et une cause de chute ; dans le cas contraire ils deviennent des instruments de russite. Et en
avons-nous d'autres sous la main ?
Aussi le Kulrnava Tantra affirme-t-il : Par ce qui
cause leur chute, les hommes s'lvent . Si les actes sont
accomplis avec les sentiments et l'tat d'esprit (Bhva) qui
conviennent, ces actes donnent la jouissance (Bhukti) ; et
ce Bhva, rpt et prolong, finit par produire cette exprience divine (Tattvajnna) qui est la dlivrance. Si l'on voit
la Mre en toutes choses, on La ralise la fin telle qu'Elle
est au del de toutes choses.
Ces principes gnraux trouvent leur application la plus
frquente dans la vie terrestre avant l'entre dans la voie
du Yoga proprement dit. Le Kundal-Yoga est pourtant, lui
aussi, une application de ces mmes principes, dans la
mesure o il est affirm qu'on atteint par lui la fois
Bhukti et Mukti.
On dit ordinairement que l o se trouve Yoga, ne se
trouve point Bhoga (la jouissance), mais dans l'enseignement du Kaula, Yoga est Bhoga et Bhoga est Yoga, et le
monde lui-mme devient le lieu de la dlivrance (Yogo
bhogyate, mokshyate samsrah) 727.
Dans le Kundalin-Yoga jouissance (Bhoga) et pouvoirs
(Siddhi) peuvent tre obtenus chacun des centres auxquels est conduite la Puissance Centrale, et si l'on contivrit du Veda ; la seconde est la mthode asctique ou Myvdn, qui a sa
grandeur propre, mais peut-tre est moins conforme aux besoins de la masse des
hommes.
727 Yogo bhogyate sksht dushkritan sukrityate Mokshyate hi samsrah

kanladharme kulishvari. (Kulrnava Tantra.)

nue de la conduire vers le haut l'on peut obtenir la jouissance qui est la Dlivrance.
Par les premires pratiques du Hathayoga, on cherche
acqurir un corps physique parfait qui sera aussi un instrument pleinement adapt au fonctionnement du mental.
Puis un mental parfait approche de la pure Conscience, et,
en Samdhi, passe en elle.
Ainsi le Hathayog recherche un corps qui soit aussi robuste que l'acier, sain, libr de la souffrance, et par suite
dou de longvit. Matre du corps, il est matre la fois
de la vie et de la mort. Sa forme clatante jouit de la vitalit de la jeunesse. Il vit aussi longtemps qu'il a la volont
de vivre et de jouir dans le monde des formes. Sa mort est
la mort volont ; lorsqu'il fait le grand geste, merveilleusement expressif, de la dissolution728, il quitte ce
monde avec noblesse.
Mais, pourra-t-on dire, certains Hathayog tombent malades et meurent. D'abord, la mthode intgrale est pleine
de difficults et de risques, et ne peut tre pratique que
sous la direction d'un Guru qualifi. Comme le dit la Goraksha-Samhit, la pratique du Yoga, sans aide et sans
succs, peut conduire non seulement la maladie, mais
la mort. Celui qui cherche vaincre le Seigneur de la Mort
court le risque, s'il choue, d'tre plus tt vaincu par Lui.
Tous ceux qui s'essayent ce Yoga ne peuvent videmment russir, ni atteindre un mme degr de russite.
Ceux qui chouent, non seulement demeurent exposs
aux infirmits des hommes ordinaires, mais d'autres
qu'apportent des pratiques mal conduites, ou pour lesquelles ils ne sont pas faits.
728 Samhramudr, le geste qui signifie dissolution : prsent je vais mourir .

D'autre part, ceux qui russissent le font des degrs


variables. L'un peut prolonger sa vie jusqu' l'ge sacr de
quatre-vingt-quatre ans, d'autres jusqu' cent, d'autres
plus encore. Thoriquement tout au moins, les parfaits
(Siddha) quittent ce plan du monde volont. Tous n'ont
pas les mmes capacits ni les mmes chances, soit que
leur manque la volont, ou la force physique, ou les circonstances favorables. Tous ne peuvent avoir la volont ou
la capacit de suivre strictement les rgles ncessaires au
succs.
Et la vie moderne en gnral n'offre gure de possibilits
pour un entranement physique si complet. Tous les
hommes ne peuvent dsirer ce genre de vie ; beaucoup
peuvent penser que son acquisition ne mrite pas les
peines requises. Certains peuvent souhaiter se dbarrasser de leur corps, et le plus vite possible.
Aussi dit-on qu'il est plus facile d'obtenir la dlivrance
que l'immortalit. On peut obtenir la premire par le dsintressement, le dtachement du monde, la discipline
morale et mentale. Mais il est plus malais de vaincre la
mort ; car il n'y suffira pas de ces vertus et de ces actions.
Celui qui la conquiert tient la vie dans le creux d'une de
ses mains, et s'il est un Yogi victorieux (Siddha), la dlivrance dans l'autre. Il a la Jouissance et la Dlivrance. Il
est l'Empereur matre du monde et le possesseur de la
batitude au-del de tous les mondes. C'est pourquoi le
Hathayog prtend que toute autre Sdhan est infrieure
au Hathayoga.
Le Hathayog qui veille Kundalin acquiert divers pouvoirs occultes (Siddhi) et la jouissance qu'ils procurent.
chacun des centres auxquels il conduit Kundalin, il
prouve une forme spciale de batitude (Ananda) et ac-

quiert des pouvoirs spciaux. S'il a Vairgya (dgot) de


ces pouvoirs, il La conduit au Shiva de son centre crbral, et jouit de la Batitude Suprme, qui par nature est
celle de la Dlivrance, et qui, une fois tablie de faon
permanente, est la Dlivrance elle-mme, dliement de
l'esprit et du corps.
Celle qui brille comme une chane de lumires ,
comme un clair, au centre de son corps, est la Femme
Intrieure , laquelle faisait allusion cette parole : Quel
besoin ai-je d'aucune femme extrieure ? J'ai une Femme
Intrieure en moi . Le Vira (hroque)729 Sdhaka, se sachant l'incarnation de Shiva (Shivo'ham), s'unit la
femme comme l'incarnation de Shakti sur le plan physique730.
Le Divya (divin) Sdhaka ou Yogi unit en lui-mme ses
propres principes, fminin et masculin, qui sont le cur
du Seigneur731 , ou Shakti et Son Seigneur Shiva, qui est
Conscience. C'est leur union qui est le cot (Maithuna)

729 Voir Avalon, Shakti and Shkta.


730 L'affirmation des Tantra que cette union est dlivrance (Mukti) est simple

Stuti, c'est--dire, la manire hindoue, surestimation du sujet. Le lecteur europen qui prend au pied de la lettre des affirmations de ce genre et les tourne en
ridicule se rend lui-mme ridicule aux yeux de ceux qui savent. Ce qui se produit
en ralit est une batitude passagre, qui, comme toute batitude, mane de la
Grande Batitude, mais en est un ple reflet qui, par lui-mme, ne met nullement
l'abri d'une renaissance future. C'est la batitude de cette Sdhan infrieure,
comme l'union de Kundalin Shakti avec Shiva est celle de la Sdhan la plus
leve.
731 Hridayam parameshituh. Ainsi L'appelle magnifiquement le Parpraveshik.

Le Yoginhridaya Tantra dit : Elle est le cur, car c'est d'Elle que viennent
toutes choses .

mystique des Tantra732. Il existe deux formes d'Union (Smarasya)733 : la premire est l'union grossire (Sthilla),
union des incarnations physiques de la Conscience Suprme ; la seconde est l'union subtile (Skshma), union
des principes non-agissant et agissant dans la Conscience
elle-mme. C'est la seconde qui est Dlivrance.
Enfin, quelle est la nature, dans un sens philosophique,
de la mthode ici dcrite ? En somme, l'nergie (Shakti) se
polarise sous deux formes : statique ou potentielle, et dynamique comme Prna, qui constitue les forces agissantes
du corps. Derrire toute activit se trouve un fond statique. Ce centre statique est dans le corps humain, en son
centre, la Puissance du Serpent dans le Mldhra (support-racine).
C'est l la puissance qui est le support (Adhra) statique du corps entier, et de toutes ses forces prniques
agissantes. Ce centre (Kendra) de puissance est une forme
grossire de Chit (Conscience) ; c'est--dire qu'en ellemme (Svarpa) elle est Conscience, et en apparence une
puissance qui, tant la forme la plus haute de la force, en
est une manifestation.
De mme qu'il y a une distinction (bien qu'au fond il y
ait identit) entre la Conscience suprme non-agissante et
sa puissance active (Shakti), de mme, quand la Conscience se manifeste comme nergie (Shakti), elle possde
les deux aspects d'nergie potentielle et d'nergie cintique.
732 C'est l, comme le dit le Yogin Tantra, le cot (Maithuna) de ceux qui sont

Yati (qui ont matris leurs passions).


733 Ce terme dsigne la jouissance qui nat de l'union du mle et de la femelle,

qu'elle soit union des corps ou de leurs principes internes.

Dans l'Advaita Vednta il ne peut y avoir, en fait, aucune division de la Ralit. Au regard parfait de son Siddha l'acte de devenir n'est qu'une attribution (Adhysa) du
Rel suprme734. Au regard du Sdhaka, c'est--dire de
celui qui aspire Siddhi (le parfait accomplissement),
l'esprit qui peine encore sur les plans infrieurs et s'identifie eux de diverses manires, le devenir tend apparatre, et l'apparence est relle.
Le Shkta Tantra est une interprtation de la vrit vdantique de ce point de vue pratique, et reprsente le processus cosmique comme une polarisation l'intrieur de
la Conscience elle-mme. Cette polarit, telle qu'elle existe
dans le corps, et sous la forme du corps, est dtruite par
le Yoga, qui drange l'quilibre de la conscience corporelle
rsultant du maintien de ces deux ples. Dans le corps
humain le ple potentiel d'nergie, qui est la puissance
suprme, est mis en activit, sur quoi les forces agissantes
(Shakti dynamique) qu'il soutient sont attires vers lui, et
tout le dynamisme735 ainsi cr s'lve pour s'unir la
Conscience non-agissante dans le Lotus suprme736.
Ce sujet a t si bien expos par mon ami et collabora734 Au regard de Siddhi, pour l'esprit qui est Udsna (simple tmoin, insoucieux

du monde extrieur), le devenir est Adhysa, chose sans ralit (au sens hindou
du terme, tel que l'emploie Shankara). La cration (Shristi) est Vivarta, c'est-dire volution (Parinma) apparente et non relle. Adhysa est l'attribution
une chose de ce qu'elle ne possde pas en ralit.
735 La puissance de la conscience reprend en elle ce qu'elle a projet dans le

monde sensible, et la puissance de la Conscience demeure en tant que Puissance


dtre.
736 Pourquoi ici, demandera-t-on, puisque la Conscience est partout ? Sans doute

: mais c'est l que la force tmasique de My est son point le plus bas. Aussi
peut-on y parvenir la Conscience.

teur le Professeur Pramathantha Mukhyopdhyya que


je ne puis amliorer son expos 737, et je le cite au lieu de
poursuivre moi-mme ma description :
Quand vous dites que Kundal Shakti est la Shakti
primordiale au repos, cela me suggre une analogie (et
peut-tre y a-t-il l plus qu'une analogie) avec la science
moderne. L'nergie cosmique sous son aspect physique
peut tre considre soit comme statique, soit comme dynamique, la premire tant une condition d'quilibre, la
seconde une condition de mouvement ou de changement
dans les positions relatives. Ainsi une chose matrielle apparemment en repos (car il n'existe de repos absolu que
dans la pure Conscience, Chit) doit tre regarde comme
une nergie, ou Shakti, en quilibre, ses divers lments
se tenant mutuellement en chec (ou, comme diront les
mathmaticiens, la somme algbrique des forces tant
gale zro). videmment, dans tous les cas l'quilibre est
relatif plutt qu'absolu. La chose importante noter est
cette polarisation de Shakti sous deux formes, statique et
dynamique.
D'autre part, dans les tissus d'un corps vivant, l'nergie en action (quelle qu'en puisse tre la nature, et que l'on
croie ou non une force vitale particulire) se polarise
sous deux formes similaires, anabolique et catabolique,
l'une tendant modifier et l'autre conserver les tissus,
737 Dans une lettre qu'il m'adressa, en rponse une lettre de moi rpondant

des questions qu'il m'avait poses au sujet de Kundalin-Yoga. Il crivait que ma


lettre lui avait suggr certaines ides sur un sujet d'un intrt philosophique
primordial, et d'un intrt pratique galement primordial dans la vie d'un Hindou , ides que je reproduis dans le texte.

l'tat rel des tissus tant la simple rsultante de ces deux


activits coexistantes et rivales.
Dans le mental, dans l'exprience, cette polarisation
ou polarit n'est pas moins vidente pour qui rflchit.
Dans mes propres ouvrages 738, j'ai constamment insist
sur cette polarit entre le pur Chit et l'effort qu'il implique
: il y a un effort, ou Shakti, qui dveloppe le mental travers une infinit de formes et de changements, mais
toutes ces formes et tous ces changements sont reconnus
comme contenus dans l'ther pur et illimit de la conscience (Chidksha). Cette analyse montre donc la Shakti
primordiale sous les deux mmes formes polarises que
tout l'heure, statique et dynamique, et ici la polarit est
tout fait fondamentale et elle a presque un aspect d'absolu.
Enfin, considrons un instant l'atome de la science
moderne. L'atome de la chimie a cess d'tre un atome
(unit indivisible de matire). Nous l'avons remplac par la
thorie des lectrons. Suivant cette thorie, le soi-disant
atome est un univers en miniature trs semblable notre
systme solaire. Au centre de ce systme atomique nous
avons une charge d'lectricit positive autour de laquelle
est suppos tourner un nuage de charges ngatives (appeles lectrons), tout comme des myriades de plantes et de
corps plus petits tournent autour du soleil. Les charges
positive et ngative se tiennent mutuellement en chec, si
bien que l'atome est un tat d'nergie en quilibre, et pour
cette raison n'clate pas ordinairement, bien qu'il puisse
clater et librer sa rserve quilibre d'nergie, comme
738 Approaches to Truth, The Patent Wonder, remarquables exposs, en termes

modernes, de l'antique enseignement vdantique.

cela se produit probablement dans les manations du radium.


Que remarquons-nous ici ? La mme polarisation de
Shakti en deux forces adverses, statique et dynamique : la
charge positive au centre l'tat de repos, et les charges
ngatives en mouvement autour du centre : ce qui prsente une trs remarquable analogie avec les faits cosmiques, si ce n'est leur image mme. Cette image peut se
retrouver dans d'autres domaines de la science et de la
philosophie, mais je puis me dispenser d'entrer dans les
dtails. Nous pouvons pour l'instant, je crois, tirer cette
importante conclusion :
Shakti, en se manifestant dans l'univers, se divise en
deux aspects polariss, statique et dynamique, ce qui implique qu'on ne peut l'avoir sous une forme dynamique
sans l'avoir en mme temps sous une forme statique correspondante, tout fait comme pour les deux ples d'un
aimant. Dans n'importe quel domaine o nous voyons la
force en activit, nous devons avoir, conformment ce
principe cosmique, un fond statique, Shakti au repos ou
replie , comme disent les Tantra.
Avant d'aller plus loin, laissez-moi indiquer ce que je
crois tre la signification fondamentale de notre Kl tantrique et puranique. Cette figure, ou Mrti, est la fois
relle et symbolique, comme l'est en vrit chaque Mrti
de notre soi-disant mythologie hindoue. Or, la Mre Divine
Kl est un symbole de la vrit cosmique que je viens
d'expliquer. Sadshiva, sur la poitrine duquel Elle danse,
sombre et nue, est le fond statique du pur Chit, inerte et
blanc (Shavarpa), parce que le pur Chit est en lui-mme
Svapraksha (manifeste par lui-mme) et Nishkriya (nonagissant).

En mme temps, en dehors et au del de la Conscience rien ne peut exister, aucune puissance ou Shakti,
c'est pourquoi la Mre Divine se tient debout sur la poitrine du Pre Divin. La Mre est Elle-mme tout activit et
Gunamay (sous Son aspect de Prakriti compose des Guna). Sa nudit signifie que bien qu'Elle contienne tout, rien
ne peut Elle-mme La contenir ; Son aspect sombre signifie qu'Elle est impntrable Avng-mnasagochar (hors
d'atteinte de la pense et du langage).
Naturellement, il n'y a pas division de la ralit en
deux (c'est sur ce point que la doctrine du Snkhya sur
Purusha et Prakriti est imparfaite, alors qu'elle est juste
tous autres gards), mais simple polarisation, du point de
vue de notre exprience, d'un fait indivisible qui est la
Shakti primordiale (Ady) elle-mme. Ainsi, Chit est aussi
Shakti. Shiva est Shakti et Shakti est Shiva, comme disent
les Tantra. La divinit est Gunshraya (support des Guna), et en mme temps Gunamaya (dont les Guna sont la
substance) ; Nirguna (sans attributs), en mme temps que
Saguna (avec attributs), comme il est dit dans un passage
clbre du Chandi.
L'ide que vous suggrez 739 m'claire beaucoup sur la
nature de la Kundalin Shakti. Peut-tre avez-vous tout
fait raison de dire que la Shakti cosmique est la Samashti
(collectivit), par rapport laquelle la Kundalin qui rside
dans les corps n'est que la Vyashti (individu) ; c'est une
image, une reproduction en miniature, sur le plan microcosmique, du tout. La loi, le principe du tout, de la Shakti
macrocosmique, doit donc se retrouver dans la Kundalin.
Cette loi, nous l'avons vu, est la loi de polarisation en
739 L'ide que Kundalin est la Shakti statique.

aspects statique et dynamique, potentiel et cintique.


Dans le corps vivant, il doit donc y avoir une telle polarisation. Or la Kundalin enroule trois fois et demie dans le
Mldhra est le fond statique indispensable, et qui ne
pouvait manquer, de la Shakti qui uvre dans le corps
entier, dveloppant des processus et effectuant des transformations. Le corps peut donc se comparer un aimant
avec ses deux ples.
Le Mldhra est le ple statique par rapport au reste
du corps, qui est dynamique ; le corps agissant suppose et
trouve ncessairement un tel support statique, d'o peuttre740 le nom de Mldhra, le support fondamental .
En un sens, la Shakti statique du Mldhra coexiste ncessairement avec la Shakti qui cre et dveloppe le corps,
parce que l'aspect ou ple dynamique ne peut jamais exister sans sa contrepartie statique.
Dans un autre sens, c'est la Shakti reste inemploye
(vous l'avez indiqu vous-mme, et les italiques sont de
vous) aprs que la Prithiv, dernier des Bhta, a t cre :
rserve de puissance o puisera et qu'utilisera l'activit
future, en cas de besoin. Dans les deux sens, le vtre
comme le mien, Shakti dans le Mldhra est la fois
coexistante tout acte de cration ou de manifestation, et
effet rsiduel de cet acte (cause et effet tout la fois, en
vrit), ide qui apparat sans contradiction relle un
examen approfondi. Il y a l, en fait, ce que le physicien
prsentera comme un cycle ou circuit en action.
Prenons l'uf fcond, premier stade embryonnaire du
corps vivant. La Kundalin Shakti s'y prsente dj sous
ses deux aspects polariss : l'uf, lment maternel, re740 Je dirais : certainement.

prsente un ple (peut-tre le ple statique, et le spermatozode, lment paternel, reprsente l'autre (peut-tre le
ple dynamique)741.
De leur fusion naissent les processus d'volution que
le biologiste appelle diffrenciation et intgration ; mais
dans tout ce processus de cration il est fort ais de suivre
le cycle. Shakti s'coule hors de la cellule germinale (l'uf
fcond), s'empare d'une matire trangre et l'assimile, et
par ce moyen accrot sa masse ; elle se divise et se subdivise, puis elle coordonne de nouveau toutes ses subdivisions en un tout organique.
Or, en tout cela nous retrouvons le cycle. La prise de
matire trangre est une activit dirige vers l'extrieur ;
l'assimilation est une activit dirige vers l'intrieur, un
courant de retour ; la division et la multiplication des cellules sont une opration dirige vers l'extrieur, leur coordination est dirige vers l'intrieur742 ; et ainsi de suite. La
force contenue dans la cellule-mre dborde, mais aussi
rentre continuellement en elle-mme, les deux oprations
se supposant et se soutenant l'une l'autre, comme c'est le
cas dans tout circuit.
La quantit de force existant dans la cellule-mre, qui
est statique tant que la fusion des lments mle et femelle n'aura pas eu lieu dans la matrice, est le point de
dpart ncessaire de toute activit cratrice ; elle est donc
la cause primordiale par rapport au corps, primordiale et
aussi prsente sans cesse tout moment.
D'autre part, la raction appele par chaque action
741 Le processus de la fcondation est trait dans le Mtrikbheda Tantra.
742 Ce flux et ce reflux sont une ide familire au Tantrisme.

cratrice, le courant de retour, ou reflux, de chaque dbordement, de chaque dveloppement, renouvelle constamment cette force originelle, la modifie sans modifier
son tat gnral d'quilibre relatif (chose parfaitement
possible, comme dans le cas de tout systme matriel) ; la
force contenue dans la cellule-mre peut donc tre aussi
considre comme un effet perptuel, une chose rsiduelle
et s'opposant aux forces actives du corps. Un grand
nombre d'ides incompatibles en apparence entrent dans
cette conception et doivent tre concilies.
1. Nous avons d'abord une force contenue dans la cellule-mre et qui est d'abord statique (bien qu'elle contienne, comme une graine de dicotyldone, ou mme
comme un atome de la physique moderne, la fois un
ple statique et un ple dynamique ; autrement dit, du
pur repos, n'impliquant aucune possibilit de mouvement,
aucun mouvement ne pourrait jamais natre). Disons que
c'est la Kundalin replie.
2. Puis il s'y veille une impulsion cratrice ; c'est le
mouvement naissant du repos. Ainsi, la Kundalin devient
partiellement statique et partiellement dynamique ; ou encore elle projette, pour ainsi dire, un ple dynamique afin
de dvelopper le corps, mais en restant elle-mme cependant un ple ou un fond statique. aucun moment de
l'opration la Kundalin ne s'est rellement droule tout
fait, ni mme n'a diminu ses trois replis et demi. Si cette
Shakti du Mldhra ne demeurait intacte, aucune volution ne serait possible. Elle est le gond sur lequel tourne
tout le reste.
3. Chaque acte crateur a sa raction sur la Shakti du
Mldhra, et cette raction, sans troubler le repos relatif
de la Shakti replie, modifie son volume ou son intensit,

mais ne diminue ni n'augmente le nombre des replis. Par


exemple, tout acte naturel de respiration ragit sur la
Shakti replie dans le Mldhra, mais d'ordinaire sans y
produire de diffrence importante.
Par contre, le Prnyma ragit sur elle puissamment,
au point d'veiller la puissance endormie et de l'envoyer
percer les centres. Maintenant, la manire dont on nous
montre habituellement la Kundalin Se droulant alors et
quittant le Mldhra pour s'lever vers la Sushumn,
doit, mon avis, n'tre accepte qu'avec prudence. On ne
peut jamais se dispenser compltement de ce fond statique. Comme vous l'avez vous-mme justement observ,
Shakti ne peut jamais s'puiser, mais il faut bien voir les
choses de cette manire .
En ralit, la Kundalin, quand le Yoga s'exerce puissamment sur Elle, envoie une manation ou projection
Sa propre ressemblance (pareille au double thrique
des thosophes et des spirites) qui perce les divers centres
jusqu' ce qu'elle se mle, comme vous l'indiquez, la
Mahkundal de Shiva au septime centre ou centre suprme. Ainsi, alors que ce double thrique , ou cette
projection, de la puissance replie dans le Mldhra
monte dans la Sushumn, la puissance replie ne bouge
ni n'a besoin de bouger elle-mme de sa place.
C'est comme une tincelle mise par une machine
lectromagntique surcharge ; ou plutt, c'est quelque
chose d'analogue aux manations du radium, qui ne diminuent pas sensiblement l'nergie qu'il contient. C'est l,
peut-tre, la plus proche analogie physique du cas que
nous essayons de comprendre. Comme l'exprime un passage bien connu de l'Upanishad, Le tout (Prna) est t
du tout, et pourtant le tout demeure . Je crois que dans

le cas qui nous occupe, les choses sont bien prs de se


passer ainsi. La Kundalin dans le Mldhra est la Shakti
primordiale tout entire l'tat de monade ou de germe,
l'tat latent : c'est pourquoi elle est enroule.
La Kundalin qui s'lve dans la Nd est aussi la
Shakti tout entire sous une forme particulirement dynamique, image dresse du Serpent ternel. Le rsultat de
la fusion suprme (il y a aussi des fusions successives
dans les diffrents centres) dans le Sahasrra est aussi le
Tout, Prna. C'est ainsi que je vois les choses. Dans cette
conception, le fond statique permanent n'est pas rellement puis, et bien moins encore superflu.
4. D'autre part, quand je dis que le volume ou l'intensit de la puissance replie peut tre affect (mais non pas
sa structure et son quilibre relatif), je n'entends pas nier
le principe de conservation de l'nergie en ce qui regarde
la Kundalini, qui est la personnification de toute nergie. Il
y a simplement conversion d'nergie statique (potentielle)
en nergie dynamique (cintique), conversion partielle, la
somme demeurant constante. Comme nous considrons
ici des quantits infinies, une expression physique exacte
de ce principe ne saurait tre attendue.
Aussi le Yogi ne fait qu' veiller , jamais il ne cre
Shakti. D'autre part, la cellule-mre qui dveloppe le corps
ne cesse pas, selon la biologie moderne, d'tre une cellulemre aucun stade de ce processus complexe. La cellulemre originelle se divise en deux : une moiti se dveloppe
graduellement en un corps de plante ou d'animal, c'est la
cellule somatique ; l'autre moiti reste enferme dans le
corps, pratiquement inchange, et elle est transmise dans
le processus de reproduction la descendance, c'est le
protoplasme sminal. Or, ce protoplasme se transmet sans

interruption tout au long de la propagation.


C'est la doctrine de Weismann sur la continuit de la
semence , qui a t largement accepte, bien qu'elle ne
soit qu'une hypothse .
Le Professeur m'crivit par la suite :
1. Shakti tant statique ou dynamique, toute forme
dynamique prsuppose ncessairement un fond statique.
Une activit purement dynamique (qui est le mouvement
sous son aspect physique) est impossible sans un support
ou une base (Adhra) statique. D'o la fausset de la doctrine philosophique du mouvement ou du changement absolu, enseigne autrefois par Hraclite, par les Bouddhistes, et de nos jours par Bergson ; elle n'est base ni
sur une logique correcte ni sur une intuition claire. La
constitution d'un atome rvle la polarisation statiquedynamique de Shakti ; d'autres formes plus complexes
d'existence la rvlent aussi. Dans le corps vivant ce fond
statique ncessaire est Mldhra, o Shakti est Kundalin replie.
Toutes les activits fonctionnelles du corps, qui commencent au dveloppement de la cellule-mre, sont lies
la Shakti, soutenues par la Shakti concentre dans le Mldhra. La cration cosmique, qui s'achve par le dveloppement de Prithiv Tattva (dans un autre sens, cependant, c'est un processus sans fin, et l peut-tre Henri
Bergson a-t-il raison, qui affirme que l'impulsion cratrice
est toujours originale et fconde), suppose aussi un fond
statique cosmique (au-dessus de Chidksha, l'ther de la
Conscience), qui est la Mahkundal Shakti dans le Chinmayadeha (corps de Conscience) de Parameshvara ou Pa-

rameshvar (le Seigneur suprme sous son aspect masculin ou fminin). Au premier stade de la cration, quand le
monde se lve dans la Conscience Divine, il lui faut, en
mme temps que le principe ou ple de Tat (Cela), le principe ou ple corrlatif d'Aham (Je) ; dans le dveloppement
du premier, le second sert de fond statique.
De mme, dans notre exprience propre, l'aperception
ou conscience du moi est le fond qui porte, le fil, pour ainsi dire, qui tient ensemble tous les grains spars de nos
lments sensibles. Le fond, le support (Adhra), sige de
la force statique, se trouve donc, sous une forme ou sous
une autre, chaque phase et chaque stade de l'volution
cratrice. La forme ultime, absolue, est naturellement
Chit-Shakti (la Conscience en tant que Puissance) ellemme, l'infaillible Lumire de connaissance dont notre
Gyatr (Mantra) dit qu' Elle soutient et anime toutes les
activits de Buddhi . C'est ce que symbolise la Kalimrti,
qui n'est pas, d'ailleurs, un simple symbole.
2. Mes remarques concernant la monte ou l'veil de la
Puissance du Serpent dans le Mldhra ont eu, peuttre, quelque apparence de paradoxe. La puissance replie, bien qu'veille, droule et montante, en ralit ne
bouge jamais de sa place ; ce n'est qu'une sorte de
double thrique , de projection , qui se dlie et s'lve
travers la hirarchie des centres. Or, en langage simple,
ce double thrique, cette projection, reprsente l'quivalent dynamique de la puissance statique concentre dans
le Mla, ou racine.
Chaque fois que par Prnyma ou Bjamantra, ou par
tout autre moyen appropri, le Mldhra devient, comme
une machine lectromagntique, sursatur (bien que la
Kundal Shakti dans le Mla soit infinie et inpuisable,

pourtant la capacit d'un organisme fini la contenir sous


une forme statique est limite, et par suite il peut y avoir
sursaturation), un quivalent dynamique, actif, de la puissance statique est cr, peut-tre par une loi analogue la
loi naturelle d'induction, et la puissance statique ellemme n'en est pas puise ou rendue autre que statique.
L'nergie statique dans le Mla ne passe pas tout entire
dans une forme dynamique, la Kundalin replie quittant
le Mla et en faisant ainsi un vide ; cela ne se peut, et
mme si les choses se passaient ainsi, toute opration dynamique cesserait immdiatement dans le corps par
manque de ce fond. La puissance replie demeure replie,
statique, et pourtant quelque chose, en apparence, sort du
Mla : c'est l'quivalent dynamique. Peut-tre ce paradoxe
peut-il s'expliquer de deux manires :
a) Une explication tait suggre dans ma lettre principale. La Kundal Shakti potentielle est partiellement convertie en Shakti cintique, et cependant, puisque Shakti,
mme telle qu'elle est donne dans le centre Mla, est une
infinit, elle n'est pas puise : la rserve potentielle reste
toujours inpuise. J'ai fait allusion un passage de
l'Upanishad relatif Prna. Dans le cas dont il s'agit,
l'quivalent dynamique est une conversion partielle d'un
mode d'nergie dans un autre. Dans le Laya-yoga (ici dcrit), il en est gnralement ainsi.
Pourtant, quand le potentiel infini devient une cintique infinie, c'est--dire quand la puissance replie dans
le Mla devient intgralement droule, nous avons ncessairement la dissolution des trois corps (Sthla, Linga et
Krana, grossier, subtil et causal), et par suite Videhamukti (dlivrance sans corps), parce que le fond statique
li une forme particulire d'existence a maintenant com-

pltement cd la place, selon notre hypothse. Mais Mahkundal demeure ; c'est pourquoi la Mukti (dlivrance)
individuelle ne signifie pas ncessairement dissolution de
Samsra (mondes de la transmigration) lui-mme. D'ordinaire, cependant, comme dit le Tantra, Ptv ptv punah
ptv743 , etc...
b) L'autre explication est suggre par la loi d'induction. Prenez une machine lectromagntique744 ; si l'on
place prs d'elle une substance approprie, elle produira
en elle par induction une espce d'lectromagntisme
quivalente et oppose sans perdre sa propre rserve
d'nergie. En conduction, l'nergie s'coule en quelque
chose de diffrent, si bien que la source perd et que l'autre
chose gagne ce qu'elle a perdu, et son gain est de mme
espce que la perte. Il n'en est pas de mme dans l'induction. L, la source ne perd rien, et l'nergie induite est
quivalente et d'espce oppose l'nergie inductrice. Ainsi une charge positive produira par induction une charge
ngative quivalente dans un objet voisin. Maintenant,
supposerons-nous que le Mldhra, lorsqu'il devient sursatur, produit par induction dans le centre voisin (soit le
Svdhisthna) un quivalent dynamique (non statique)745 ?
Est-ce l ce que signifie rellement l'veil de la Puissance
du Serpent ? Cette explication, je suis tent de le croire,
n'est peut-tre pas entirement fantaisiste.

743 Ayant bu, ayant bu, ayant bu encore , passage du Kulrnava Tantra qui ne

signifie point l'action relle de boire, comme le supposent certains, mais l'veil
rpt de Kundalin.
744 Nous pouvons dire : un aimant , et magntisme .
745 C'est l le sige du premier mouvement, ou Pashyant Shabda.

En rponse cet expos de mon ami, d'un si grand intrt explicatif, je lui signalai quelques difficults souleves
par son affirmation que Kundalin Shakti, en ralit, ne Se
droulait ni ne S'levait, mais projetait au-dessus d'Elle
une manation Sa ressemblance. La difficult que
j'prouvais tait la suivante : d'abord, les livres sur le Yoga, auxquels on doit accorder pleine crance en cette matire, affirment sans quivoque que Kundalin Elle-mme,
rellement, S'lve. Cela est confirm par des questions
que je posai un Pandit tantriste connaissant trs bien
son Shstra746, aprs avoir reu la lettre cite. Comme le
corps du Yog est toujours vivant, bien que dans un tat
d'inertie semblable celui d'un cadavre, lorsque la conscience en a t perdue, je lui demandai ce qui soutenait le
corps lorsque Kundalin quittait Sa demeure centrale. Sa
rponse l'ut que le corps tait conserv par le nectar qui
coule de l'union de Shiva et de Shakti dans le Sahasrra.
Ce nectar est une mission de puissance produite par
leur union. Si Kundalin ne S'lve pas, mais une simple
tincelle mane d'Elle, comment, demandai-je ensuite, le
corps peut-il devenir froid et semblable un cadavre ? Cela s'ensuivrait-il si la puissance demeurait toujours en son
centre, et se contentait de projeter un quivalent dynamique d'elle-mme ?
Il y avait d'autres difficults encore dans la thorie
avance par mon ami, bien qu'il puisse y avoir aussi des
difficults admettre que le Mldhra est entirement
746 Bien qu'il ne le pratiqut pas lui-mme, son frre, auprs duquel il s'tait

instruit, tait un adepte du Yoga. Ses dclarations m'ont toujours paru d'une
particulire valeur. Il faut pourtant se rappeler que, si grandes que soient les
connaissances ou l'exprience d'un Pandit ou d'un Yog, il peut ignorer les implications scientifiques de sa doctrine et de sa pratique.

vid de la grande puissance. Je suggrai que Kundal pouvait tre le centre statique du corps entier considr
comme un organisme conscient et complet, et que chacune des parties du corps et leurs cellules constitutives
devaient avoir leurs centres statiques propres, qui soutiendraient ces parties et ces cellules ; et que la vie du
corps, considr comme un ensemble de particules matrielles (priv de la conscience organique gnrale du tout),
tait soutenue par le nectar qui coulait de Kundalin
Shakti lorsqu'elle s'unissait Shiva dans le Sahasrra. En
rponse, le Professeur P. Mukhyopdhyya donnait sur la
question les vues suivantes :
De la faon dont je prsente les faits, quelque chose,
savoir un quivalent dynamique ou double actif , se dgage certainement du Mldhra, mais ce centre ou sige
fondamental n'est pas puis ni vid d'nergie statique par
suite de cette opration.
Le Mla (racine), comme sige de puissance statique
ou replie, est toujours indispensable. Il est la condition
sine qua non de toutes les fonctions du triple corps (grossier, subtil, causal). Il est, pour ainsi dire, le tampon, ou la
base, contre laquelle toute activit du Jva (conscience incarne) doit ragir ou se replier, comme un canon de marine ou toute autre sorte de canon lourd contre sa base ou
son emplacement. Ainsi, tandis que la Shakti dynamique
ou droule s'lve le long de la colonne vertbrale, la
Shakti statique ou replie garde sa place dans le Mla, et
demeure comme la possibilit mme du soulvement dynamique.
La puissance montante est simplement la contrepartie
dynamique du fond statique. Dire que Kundalin quitte sa

place et s'lve revient dire qu'elle cesse d'tre Kundalin


et devient dynamique. La puissance ascendante est donc
puissance droule, qui n'est point Kundalin ; c'est l'expression dynamique de la puissance nomme Kundalin.
L-dessus tout le monde peut tre d'accord. Mais voici le
problme : le Mla est-il puis ou priv de toute puissance (en particulier de puissance replie) quand cette expression dynamique l'abandonne et s'lve le long de la
colonne vertbrale ? L'expression dynamique est-elle entirement aux dpens du fond statique ? Celui-ci doit-il cesser pour que la premire puisse commencer ?
Je crois devoir rpondre ici par la ngative. Dans ce
cas la Puissance s'loigne et en mme temps demeure :
s'loigne dynamique, et statique demeure ; la Kundal est
droule sous un de ses aspects, ou ples, et demeure replie sous son autre aspect ou ple. C'est peut-tre un paradoxe, mais, comme la plupart des paradoxes, il a des
chances d'tre vrai.
L'autorit des critures, pour laquelle, je le dclare
cette occasion, j'ai le plus grand respect, est-elle rellement contredite par cette interprtation ? J'ai indiqu
dans les deux communications prcdentes la nature de
l'quivalent dynamique et sa relation avec le fond statique,
et je n'ai pas besoin de m'tendre longuement l-dessus.
J'ai toujours affirm que le Mldhra, sige de la puissance statique (c'est--dire replie), ne peut jamais devenir
vide de cette puissance, sauf dans le cas de Videhamukti
(dlivrance sans corps), o le triple corps (grossier, subtil,
causal) doit se dissoudre. Je crois aussi que le point de
vue que vous avez adopt peut se concilier avec cette interprtation.
La Kundalin Shakti est l'aspect statique de la vie du

corps organis dans son ensemble, comme vous le dites


trs justement. La relation qui existe entre la vie des cellules individuelles et celle de l'organisme dans son ensemble n'est pas clairement comprise par la science. La vie
de l'ensemble n'est-elle que la rsultante mcanique des
vies des cellules individuelles, ou les vies des cellules individuelles ne sont-elles que des manifestations dtailles de
la vie de l'ensemble ? Autrement dit, la vie de l'ensemble
est-elle cause et celle des cellules effet, ou inversement ?
La science n'est pas encore fixe sur ce point.
Admettant le Shaktivada (doctrine de Shakti), j'incline,
pour ma part, donner la primaut la vie de l'ensemble ;
ds la cellule-mre la vie de l'ensemble est donne en
substance, et tout le dveloppement du Jvadeha (corps
du Jva) n'est que la ralisation dans le dtail de ce qui a
dj t donn en substance, suivant le principe de
l'Adrishta (Karma). Nanmoins, je suis tout fait dispos
reconnatre aux cellules individuelles des vies indpendantes jusqu' un certain point. Jusqu' un certain point
, parce qu'elles ont besoin d'tre soutenues, dans une
mesure considrable, par la vie de l'ensemble. Bnfice ou
dommage reu par la vie de l'ensemble ragit sur l'tat des
cellules ; la mort de l'ensemble est suivi de la mort des cellules, et ainsi de suite.
Or, il y a naturellement dans chaque cellule une polarisation statique-dynamique ; dans l'ensemble de l'organisme, existe aussi une telle polarisation ou corrlation.
Dans l'ensemble de l'organisme, le ple du corrlatif statique est la puissance enroule dans le Mldhra, et le
corrlatif dynamique est la puissance active (les cinq Prna, qui sont Prna, Apna, Samna, Udna et Vyna), qui
effectue rellement les diverses fonctions du corps.

C'est pourquoi, d'ordinaire, cette puissance dynamique est distribue dans le corps entier, vivifiant non
seulement l'tendue des tissus, mais les cellules microscopiques.
Or la dvitalisation (comme vous dites) du corps dans
le Kundalin Yoga ou le Shatchakrabheda est due, je crois
pouvoir le penser, non l'puisement ou la privation de
puissance statique dans le Mldhra, mais la concentration ou la convergence de la puissance dynamique
ordinairement rpandue dans le corps entier, si bien que
l'quivalent dynamique dress sur le fond statique ou
Kundalin Shakti n'est que le quintuple Prna, d'ordinaire
rpandu, maintenant rassembl, retir des autres tissus
du corps, et concentr au long de la colonne vertbrale.
Ainsi, d'ordinaire, l'quivalent dynamique est le Prna
rpandu dans tous les tissus ; dans le Yoga il est concentr le long de la colonne vertbrale ; l'quivalent statique
ou Kundalin subsistant dans les deux cas.
La polarisation ou corrlation est galement maintenue : dans le premier cas entre Shakti dans le Mldhra
et le Prna rpandu ; dans le second cas entre Shakti
dans le Mla et le Prna concentr le long de la colonne
vertbrale.
Peut-tre est-ce l une explication satisfaisante de la
froideur, de l'inertie croissante, de l'insensibilit, etc., du
reste du corps dans le Kundalin Yoga, dont vous parlez
dans votre lettre. Gnralement, dans le Yoga, le Prna ne
se retire et ne se concentre pas compltement ; le Prna
subsistant, et la vie des cellules, maintiennent le corps en
vie, bien qu'il soit inerte ou semblable un cadavre. Dans
le cas d'un retrait et d'une concentration complte, les cel-

lules meurent et le corps se dsintgre.


D'autre part, si dans le Kundalin Yoga la puissance
replie tait simplement et compltement droule (c'est-dire dynamise), alors il y aurait excs plutt que dfaut
de vitalit par tout le corps ; rien ne serait soustrait de
l'nergie dynamique dj disponible dans le corps, mais
quelque chose s'y ajouterait, la puissance statique dans le
Mla devenant cintique, s'levant dans la colonne vertbrale et influenant les tissus voisins.
De tout cela, je me risquerai conclure que la puissance statique la base de la colonne vertbrale, sans
s'puiser ou devenir autre que statique, provoque ou produit un quivalent dynamique qui est le Prna rpandu
dans le corps, maintenant rassembl et concentr le long
de la colonne vertbrale. Les tapes de ce processus peuvent tre indiques sommairement comme il suit :
1. Tout d'abord, il y a une puissance enroule la
base de la colonne vertbrale, et son corrlatif ncessaire,
le Prna dynamique, rpandu par tout le corps sous ses
cinq formes.
2. Dans le Kundalin Yoga une partie du Prna dynamique dj disponible est employ la base de la colonne
vertbrale d'une manire approprie, et par ce moyen la
base, ou plus particulirement le Padma (lotus) quatre
ptales qui reprsente ce centre, devient sursatur, et ragit sur toute la puissance dynamique (ou Prna) rpandue
dans le corps, en la faisant se retirer des tissus et se concentrer le long de la colonne vertbrale. Ainsi l'quivalent
dynamique rpandu dans le corps devient l'quivalent dynamique concentr le long de la colonne vertbrale. Telle
est peut-tre la signification de l'veil du serpent.

a) En ragissant de cette manire, la puissance enroule n'a point perdu son quilibre gnral ni son tat statique.
b) Le mode opratoire de cette raction est difficile
indiquer, mais c'est probablement (comme je l'ai suggr
dans mes communications prcdentes) soit : une conversion partielle de la puissance enroule infinie en la sorte
d'influence qui peut rassembler ainsi le Prna rpandu, et
le concentrer le long de la colonne vertbrale ; soit une action inductrice, analogue l'action lectromagntique, par
laquelle les Prna sont rassembls et concentrs. Dans ce
dernier cas, il n'est pas besoin d'une conversion de l'nergie statique. Nous aurons peut-tre choisir entre ces
deux explications, ou plutt les coordonner, pour comprendre le mode opratoire. En langage mathmatique, le
Prna diffus est une quantit scalaire (ayant une grandeur, mais sans direction), tandis que le Prna concentr
est une quantit vectrice (ayant la fois une grandeur et
une direction dfinie).
Supposons, enfin, que nous assistions avec un Divyachakshu (il intrieur) au progrs du Kundalin Yoga. L
quelque chose de comparable de la foudre concentre
(Tadit) s'lve du Mldhra, et accrot son lan en montant de Chakra en. Chakra, jusqu' ce que l'accomplissement soit atteint au Paramashivasthna (sjour du Suprme Shiva). Mais regardez en arrire, et vous verrez que
la Kulakundalin est l aussi dans le Mla, enroule trois
fois et demie autour du Svayambhu Linga. Elle est partie
et pourtant elle est reste, elle est demeure, et Elle revient Elle-mme. Cette manire de voir n'a-t-elle pas le
soutien de l'autorit des critures et de l'exprience du
Yogi ?

Laissant les dtails de ct, le principe essentiel parat


tre qu'une fois veille , Kundalin Shakti, soit en Ellemme, soit, comme le suggre mon ami, en Sa projection,
cesse d'tre une puissance statique qui soutient la conscience du monde, dont le contenu n'est gard qu'aussi
longtemps qu'Elle dort , et, une fois mise en mouvement, est entrane vers cet autre centre statique situ
dans le lotus mille ptales (Sahasrra), qui est Ellemme unie la conscience de Shiva, ou conscience extatique au del du monde des formes. Quand dort Kundalin, l'homme est veill ce monde. Quand Elle
s'veille , il dort, c'est--dire qu'il perd toute conscience
du monde et entre dans son corps causal. Dans le Yoga, il
passe au del, la Conscience informelle.
Il ne me reste qu' ajouter, sans en discuter plus longuement, que ceux qui pratiquent ce Yoga le dclarent
plus lev que tout autre747 ; et le Samdhi (extase) atteint
par lui plus parfait. La raison qu'ils allguent est la suivante : dans le Dhynayoga l'extase se produit par dtachement du monde et concentration mentale, conduisant
la vacuit de l'opration mentale (Vritti), ou faisant se
lever la Conscience pure libre de toutes les limitations
du mental748. Le degr atteint par ce dvoilement de la
conscience dpend des capacits de mditation (Jnnas747 Je ne dis pas que je l'admets, ni que c'est un fait. Seul en peut juger qui a con-

nu toutes les expriences de Yoga. Je ne fais ici que constater.


748 Que la Christian Science appelle, je crois, le mental mortel . Dans la doc-

trine hindoue le mental est une manifestation temporelle et limite de la Conscience ternelle et sans limites. Comme il s'agit d'tats diffrents, deux termes
valent mieux qu'un.

hakti) du Sdhaka et du degr de son dtachement du


monde. D'autre part Kundalin, qui est toutes les Shakti,
et qui est donc Jnnashakti elle-mme, produit, une fois
veille par le Yogi, la plnitude du Jnna. En second lieu,
dans le Samdhi du Dhyna Yoga, il n'y a point d'veil ni
d'union de Kundalin Shakti, qui s'accompagnent de batitude et de l'acquisition de pouvoirs spciaux (Siddhi).
De plus, dans le Kundalin Yoga il n'y a pas seulement
un Samdhi obtenu par la mditation, mais un Samdhi
obtenu par le pouvoir central du Jva, puissance qui porte
en elle la fois les forces du corps et du mental. L'union
ainsi comprise est dclare plus complte que celle ralise seulement par des mthodes mentales. Bien que dans
les deux cas la conscience corporelle soit perdue, dans le
Kundalin Yoga, ce n'est pas seulement le mental, mais le
corps dans la mesure o il est reprsent par sa puissance
centrale (ou, peut-tre, sa projection), qui est rellement
uni Shiva.
Cette union produit une jouissance (Bhukti) que ne
possde point le Dhynayog. Alors que le Divya Yog et le
Vira Sdhaka ont l'un et l'autre la jouissance, celle du
premier est infiniment plus intense, tant une exprience
de la Batitude mme. La jouissance du Vra Sdhaka
n'en est qu'un reflet sur le plan physique, un jaillissement
de la vritable batitude travers l'amas touffant et les
entraves de la matire.
En outre, quand on dit que l'un et l'autre ont la dlivrance (Mukti), ce terme n'est employ dans la Vira Sdhan que dans un sens figur, indiquant une batitude
qui approche le plus possible sur le plan physique de celle
de Mukti, et un Bhva ou sentiment d'union momentane
de Shiva et de Shakti, qui dans la Yoga Sdhan la plus

leve parvient la Dlivrance radicale du Yogi. Celui-ci,


au sens plein et littral, a tout ensemble la Jouissance
(Bhukti) et la Dlivrance (Mukti). D'o la prtention de ce
Yoga au titre d'Empereur de tous les Yoga.
Quoi qu'il en soit, j'abandonne ici mon sujet, avec l'espoir que d'autres poursuivront l'tude que j'ai commence
dans cet ouvrage. Elle me semble, avec d'autres matires
du Tantra Shstra, et quelle que soit leur valeur inhrente, digne d'une recherche qu'on ne lui a pas encore
consacre.

VIII. PLANCHES DES CHAKRA

Printed in India ; (Reproduced from SERPENT POWER, Published by Messers Ganesh & Co., (Madras) Ltd., Madras17.)

Quatrime de couverture
L'image que les Occidentaux se font du tantrisme dcoule gnralement de certaines manifestations spectaculaires ou dgnres qu'ils
ont eu l'occasion de voir ou, bien plus souvent encore, qui leur ont t
dcrites aprs avoir pass par de nombreux intermdiaires. En ralit,
on peut compter sur les doigts les Occidentaux qui ont t vritablement initis dans les enseignements et les cultes extrmement hermtiques que comporte le tantrisme. Arthur Avalon est un de ceux-l et
sa Puissance du Serpent nous apporte une connaissance tout fait
vridique du tantrisme. Le lecteur ne doit pas cependant ignorer que
ces enseignements, parce qu'ils sont absolument vrais et extrmement puissants, sont infiniment dangereux et qu'il ne doit pas s'y
aventurer sans un matre authentique.
Jean Herbert.