Académique Documents
Professionnel Documents
Culture Documents
three nucleotide sequences. The ribosome then calls for the appropriate transfer rna, which is
the opposite of the codon the ribosome detected. Each tRna carries an amino acid, and once it
binds with the complementary codon on the mRna, the amino acid joins a chain of amino acids.
Once the chain of amino acids is fully finished, it is released from the ribosome and folds itself
into a complex shape, forming a protein.
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGL
RDGRPEIQLHN
Mutations: A variant hSHBG, with a point mutation in exon 8 (GAC AAC) encoding an
amino acid substitution (Asp327Asn), which introduces an additional consensus site for
N-glycosylation