Vous êtes sur la page 1sur 3

Need to Know

The type of protein we are using


The purpose of the protein
How the protein is made
What the body would be like without the protein
Can a person live without the protein
What diseases arise if the protein is damaged or not present
How are we going to present
What the protein look/what our model will look like
What is the makeup of the protein
What amino acids create it

Name:Testosterone-estrogen Binding Globulin; TeBG


Formal Name: Sex Hormone Binding Globulin
Purpose: The sex hormone binding globulin (SHBG) test may be used to help evaluate men for
low testosterone and women for excess testosterone production. It may be ordered in
conjunction with other tests to evaluate the status of a person's sex hormones, testing their
fertility. In the body, it binds to the sex hormones and allows them to be transported through the
bloodstream in an inactive form
What it does and where: SHBG is a glycoprotein, a molecule that consists of a carbohydrate
plus a protein, mainly made by the liver but is also found in brain, uterus, testes, and placenta. It
binds tightly to 3 sex hormones found in both men and women. These hormones are estrogen;
dihydrotestosterone (DHT), and testosterone.
What would your body be like without it: Women with low levels of SHBG more likely to have
higher testosterone levels, which can lead to androgenization; developing masculine
characteristics, menstrual irregularities, decreased breast tissue and skin abnormalities. Low
SHBG is often associated with polycystic ovarian syndrome. It also raises the chance of
contracting of cardiovascular disease
Decreases in SHBG are seen with: Obesity, pregnancy, undernourishment, use of oral
contraceptives, menopause,Polycystic ovary syndrome, Hypothyroidism, Androgen (steroid)
use,Cushing disease
How it is made:
The appropriate part of a strand of DNA is switched on, and an enzyme called the Rna
polymerase attaches to it. The Rna polymerase splits the strand of Dna and uses free
messenger Rna bases in the nucleus to create a messenger Rna that is the opposite of the Dna
chain. This messenger Rna is modified slightly, then it leaves the nucleus and enters the
cytoplasm. In the cytoplasm, a ribosome bonds to the Messenger Rna. This ribosome then
reads the mRna and creates a string of amino acids. It does this by detecting codons, chains of

three nucleotide sequences. The ribosome then calls for the appropriate transfer rna, which is
the opposite of the codon the ribosome detected. Each tRna carries an amino acid, and once it
binds with the complementary codon on the mRna, the amino acid joins a chain of amino acids.
Once the chain of amino acids is fully finished, it is released from the ribosome and folds itself
into a complex shape, forming a protein.

PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGL
RDGRPEIQLHN

Mutations: A variant hSHBG, with a point mutation in exon 8 (GAC AAC) encoding an
amino acid substitution (Asp327Asn), which introduces an additional consensus site for
N-glycosylation

Vous aimerez peut-être aussi