Vous êtes sur la page 1sur 131

Ciencias de la

Comunicacin I

Quinto semestre

La Patria (1962),
Jorge Gonzlez Camarena.
Esta obra ilustr la portada
de los primeros libros de
texto. Hoy la reproducimos
aqu para mostrarte lo
que entonces era una
aspiracin: que estos
libros estuvieran entre
los legados que la Patria
deja a sus hijos.

Estimada, estimado estudiante del Telebachillerato Comunitario, este libro


fue elaborado pensando en ti, forma parte de una coleccin que incluye
todas las asignaturas del plan y los programas de estudio.
En su elaboracin participaron profesionales y especialistas en distintas
disciplinas, quienes tomaron en cuenta tus necesidades e inquietudes. En
estos libros hallars contenidos y actividades que contribuirn a que logres
un mejor desempeo ahora que cursas la Educacin Media Superior.
Tenemos la certeza de que con los materiales didcticos del Telebachillerato
Comunitario, con el apoyo de tus maestras, maestros y con tu propio
esfuerzo, tendrs un mejor aprovechamiento escolar y contribuirs al
bienestar de tu comunidad y de Mxico.
Te deseamos xito en esta importante etapa de tu formacin.

Distribucin gratuita, prohibida su venta

Ciencias de la
Comunicacin I

Telebachillerato comunitario. Quinto Semestre


Ciencias de la Comunicacin I
Secretara de Educacin Pblica
Aurelio Nuo Mayer

Subsecretara de Educacin Media Superior


Rodolfo Tuirn Gutirrez

Direccin General del Bachillerato


Carlos Santos Ancira

Autor
Eduardo Daniel Libreros Galicia

Asesora tcnico-pedaggica
Direccin de Coordinacin Acadmica

Servicios editoriales
Facultad Latinoamericana de Ciencias Sociales (FLACSO)
Coordinacin General: Lorenzo Gmez Morin Fuentes
Editor Responsable: Mara Teresa Galicia Cordero
Diseo y diagramacin
Instituto de Gestin e Innovacin Educativa (IGIE)
Jos Pedro Corts Xiqui, Maritza Sosa Ameneyro y Vanessa Alejandra Valadez Gutirrez

Derechos reservados. Secretara de Educacin Pblica, 2015


Argentina 28, Centro, 06020, Ciudad de Mxico.
ISBN: 978-607-8229-89-5
Impreso en Mxico

Prefacio
Estimado estudiante, el libro que tienes en tus manos fue elaborado pensando en
ti, en tus necesidades e inquietudes, como un instrumento que te apoye ahora que
estudias el bachillerato. En sus pginas encontrars contenidos y actividades que
son fundamentales para que, paso a paso, puedas alcanzar las metas que esta
asignatura te propone para el semestre.
A ti te toca, ahora, sacarle el mayor provecho a este libro, que es fruto del esfuerzo
de un grupo de profesores y especialistas. Si lo haces tu amigo, lo aprovechas al
mximo y lo combinas con el apoyo de tu asesor y de los dems recursos didcticos
que estn a tu alcance, seguramente ampliars tus competencias y habilidades
para construir un mejor futuro para ti, y contribuir al desarrollo de tu comunidad, de
tu estado y de nuestro Mxico.
Te deseamos el mayor de los xitos en esta importante etapa de tu formacin, el
bachillerato.

Tabla de contenido
Ciencias de la Comunicacin I
Presentacin general ................................................
Enfoque para el desarrollo de competencias ....................
Cmo est estructurado este libro? ..............................
Simbologa utilizada ................................................ .1
Con qu conocimientos cuentas? .................................1

%ORTXH,'HQHVHOSURFHVRGHODFRPXQLFDFLyQ
Introduccin a la comunicacin............................................................19
Qu es la comunicacin? ....................................................................19
Elementos del proceso comunicativo ..................................................22
Barreras de la comunicacin ................................................................29

Bloque II. Caracterizas y aplicas los modelos


de comunicacin
Comunicacin verbal ............................................................................. 40
Comunicacin escrita .................................................................. 40
Comunicacin oral ....................................................................... 42
Comunicacin no verbal ........................................................................ 44
Modelos de comunicacin..................................................................... 46
Modelos de comunicacin masiva ....................................................... 52
Modelo de la tuba de Schramm ................................................... 53
Modelo de McLuhan .................................................................... 54

Bloque III. Relacionas los tipos de comunicacin


con tu contexto
Tipos de comunicacin.......................................................................... 64
Comunicacin directa .......................................................................... 65
Comunicacin indirecta ....................................................................... 65
Comunicacin unilateral ...................................................................... 66
Comunicacin bilateral ........................................................................ 67
Comunicacin privada y pblica .......................................................... 70
Niveles de comunicacin....................................................................... 72
Comunicacin intrapersonal ................................................................ 73
Comunicacin interpersonal ................................................................ 73
Comunicacin intragrupal e intergrupal ............................................... 7

Tabla de contenido

Bloque IV. Vinculas la cultura con la comunicacin


pblica
Cultura ..................................................................................................... 82
Multiculturalidad ..................................................................................... 83
Cultura de masas.................................................................................... 87
Globalizacin .......................................................................................... 89
Globalizacin de la cultura .................................................................... 90

%ORTXH9(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQ
la sociedad y cultura actuales
Origen de Internet................................................................................... 98
Recursos disponibles en Internet ......................................................... 104
Navegadores ............................................................................... 104
Buscadores .................................................................................. 105
Mensajera instantnea ............................................................... 106
Wikis ............................................................................................ 106
Redes sociales ............................................................................ 106
,QXHQFLDGH,QWHUQHWHQODVRFLHGDG.................................................... 109

Glosario................................................................ 119
Apndice .............................................................. 10
20

5HIHUHQFLDVELEOLRJUiFDV .......................................... 12
Crditos ............................................................... 12

Presentacin general

La asignatura de Ciencias de la Comunicacin, como parte del programa educativo


desarrollado a partir de los principios bsicos de la Reforma Integral de la Educacin
0HGLD 6XSHULRU WLHQH FRPR QDOLGDG SURSRUFLRQDUWH ODV KHUUDPLHQWDV QHFHVDULDV
para que puedas incorporarte exitosamente a estudios superiores (universitarios,
tecnolgicos o cualquier opcin que elijas de acuerdo con tus intereses), debido a
que aporta elementos para un desenvolvimiento profesional dinmico y competitivo.
Ciencias de la Comunicacin I es el primero de dos cursos que se desarrollan durante
el ltimo ao de tu educacin de nivel bachillerato. Debido a que pertenece al campo
disciplinar de Comunicacin, sus contenidos buscan desarrollar en ti la capacidad
de leer crticamente, argumentar tus ideas y emplear los recursos tecnolgicos
disponibles a tu alcance para dos cosas muy importantes: analizar profundamente
todo aquello que se transmite en los medios de comunicacin y disear tus propios
contenidos para exponer una visin distinta y creativa del mundo que te rodea.
En el curso que ests por iniciar, el plan de estudios busca establecer relaciones
entre las distintas materias que lo componen. Por ejemplo, este texto cuenta con
actividades que exigen que leas, investigues y redactes cuidadosamente, por lo
que utilizars las habilidades desarrolladas en las asignaturas de Taller de Lectura
y Redaccin y Metodologa de la Investigacin. Informtica est estrechamente
relacionada con el desarrollo de Internet y, debido al carcter global de esta red de
informacin, bien nos servira poner en prctica nuestros conocimientos sobre una
Lengua Adicional al Espaol, no te parece?

86

Enfoque para el desarrollo de competencias

Qu es una competencia?
Una competencia es el conjunto de conocimientos, habilidades y conductas con las
que cuenta una persona para realizar exitosamente una tarea (Tourin, 2010). Con
el enfoque para el desarrollo de las mismas, se busca que mejores distintas caractersticas que te permitan actuar de manera ptima en cualquier mbito en el que te
desenvuelvas, incluyendo el acadmico y profesional.
Por esta razn, en este apartado te presentamos las competencias que se abordarn en el curso y que sern la base para los contenidos y las actividades que incluye
este libro.
Competencias genricas

Atributos

1. Se conoce y valora a s
mismo y aborda proble $QDOL]DFUtWLFDPHQWHORVIDFWRUHVTXHLQX\HQHQ
mas y retos teniendo
su toma de decisiones.
en cuenta los objetivos
que persigue.
 Valora el arte como manifestacin de la belleza
y expresin de ideas, sensaciones y emociones.

2. Es sensible al arte y participa en la apreciacin  Experimenta el arte como un hecho histrico


compartido que permite la comunicacin entre ine interpretacin de sus
dividuos y culturas en el tiempo y el espacio, a la
expresiones en distinvez que desarrolla un sentido de identidad.
tos gneros.
 Participa en prcticas relacionadas con el arte.
 Expresa ideas y conceptos mediante representaFLRQHVOLQJtVWLFDVRJUiFDV
4. Escucha, interpreta y
emite mensajes pertinentes en distintos  Aplica distintas estrategias comunicativas segn
quienes sean sus interlocutores, el contexto en
contextos mediante la
el que se encuentra y los objetivos que persigue.
utilizacin de medios,
cdigos y herramientas
apropiados.
 ,GHQWLFD ODV LGHDV FODYH HQ XQ WH[WR R GLVFXUVR
RUDOHLQHUHFRQFOXVLRQHVDSDUWLUGHHOODV

79

Presentacin general
Competencias genricas

Atributos
 Elige las fuentes de informacin ms releYDQWHVSDUDXQSURSyVLWRHVSHFtFR\GLVFULmina entre ellas de acuerdo a su relevancia
\FRQDELOLGDG

6. Sustenta una postura perso-  (YDO~D DUJXPHQWRV \ RSLQLRQHV H LGHQWLFD


nal sobre temas de inters y
prejuicios y falacias.
relevancia general, considerando otros puntos de vista  5HFRQRFH ORV SURSLRV SUHMXLFLRV PRGLFD
sus puntos de vista al conocer nuevas eviGHPDQHUDFUtWLFD\UHH[LYD
dencias, e integra nuevos conocimientos y
perspectivas al acervo con el que cuenta.
 Estructura ideas y argumentos de manera
clara, coherente y sinttica.
 Propone maneras de solucionar un problema o desarrollar un proyecto en equipo, deQLHQGRXQFXUVRGHDFFLyQFRQSDVRVHVSHFtFRV
8. Participa y colabora de manera efectiva en equipos
diversos.

 Aporta puntos de vista con apertura y considera los de otras personas de manera reH[LYD
 Asume una actitud constructiva, congruente
con los conocimientos y habilidades con los
que cuenta dentro de distintos equipos de
trabajo.

 Reconoce que la diversidad tiene lugar en


un espacio democrtico de igualdad, de dignidad y derechos de todas las personas, y
rechaza toda forma de discriminacin.
10. Mantiene una actitud respetuosa hacia la intercul-  Dialoga y aprende de personas con distintos
turalidad y la diversidad de
puntos de vista y tradiciones culturales mecreencias, valores, ideas y
diante la ubicacin de sus propias circunsprcticas sociales.
tancias en un contexto ms amplio.
 Asume que el respeto a las diferencias es el
principio de integracin y convivencia.

108

Cmo est estructurado este libro?


Inicio de cada bloque
El libro que tienes frente a ti se ha estructurado de tal manera que puedas aprovechar al mximo las lecturas y actividades que se te proponen. Al inicio de cada
bloque (cinco en total) se incluye una breve introduccin acerca del contenido aborGDGRFyPRVHRUJDQL]DUiWXSURFHVRGHDSUHQGL]DMH\ODVFRPSHWHQFLDVHVSHFtFDV
que se desarrollan en cada uno de ellos. Antes de esto, realizars una actividad
diagnstica denominada Con qu conocimientos cuentas?, que te permita evaluar
qu sabes del tema que vas a estudiar y cules son las reas que puedes mejorar.
De igual manera, encontrars los propsitos del bloque y los contenidos conceptuales, procedimentales y actitudinales que se obtienen a partir de los objetos de
aprendizaje. Esto quiere decir que sabrs para qu vas a estudiar el bloque, cules
son los temas que vas a aprender, qu pasos tienes que seguir para obtener ese
conocimiento y qu actitud se debe fomentar al desarrollar una tarea, como la constancia, disciplina y el trabajo en equipo.
Este apartado culmina con la exposicin del tiempo destinado al desarrollo del bloque y los productos que elaborars como parte de tu proceso de aprendizaje.

911

Cmo est estructurado este libro?


Desarrollo del bloque
En esta parte del bloque obtienes, por un lado, informacin sobre los diversos temas
sealados al inicio y, por el otro, las habilidades para desarrollar todo tu potencial
en la materia.
Para que puedas distinguir con mayor claridad estos momentos, los contenidos
llevarn el ttulo Aprende ms y Actividades de aprendizaje, respectivamente. El
SULPHURVHUHHUHDORVFRQRFLPLHQWRVTXHQHFHVLWDVSDUDDERUGDUFDGDXQRGHORV
temas expuestos, mientras que el segundo est relacionado con las actividades
que realizars. Los apartados con el ttulo Sabas queHVWiQGLVHxDGRVFRQHOQ
de proporcionarte informacin adicional sobre alguno de los aspectos tratados en
el bloque. Cuando veas el ttulo 3DUD LQLFLDU UHH[LRQD quiere decir que debes
responder algunas preguntas que te ayudarn a comprender mejor lo que vas a
realizar. Finalmente, como complemento del proceso de aprendizaje, se incluye un
JORVDULR FRQ OD GHQLFLyQ GH DOJXQRV FRQFHSWRV TXH SRGUtDQ VHU GHVFRQRFLGRV R
poco familiares para ti.

12
10

Cmo est estructurado este libro?


Cierre del bloque
&XDQGR OOHJXHV DO QDO GH FDGD EORTXH HQFRQWUDUiV XQ DSDUWDGR FRQ HO WtWXOR
5HH[LRQD VREUH OR DSUHQGLGR, donde se te proporcionar una sntesis y algunas
LGHDVFODYHTXHWHD\XGHQSUHFLVDPHQWHDUHH[LRQDUVREUHHOFRQWHQLGRTXHDFDEDV
de aplicar en las actividades propuestas.
Es importante que tomes en cuenta que todas las actividades que realices sern
la base de un portafolio de evidencias que servir para valorar tu desempeo en
HO FXUVR 3DUD D\XGDUWH HQ HVWH SURFHVR VH LQFOX\H XQD HYDOXDFLyQ QDO GH ORV
aprendizajes adquiridos y los instrumentos necesarios para que puedas medir tu
progreso en la asignatura.

Por ltimo, recuerda que el trabajo que ests a punto de iniciar no lo hars solo.
Colabora con tu asesor y tus compaeros, siempre con una actitud de respeto y
trabajo en equipo. Este libro es tuyo: disfrtalo y aprovecha al mximo el contenido
que ha sido diseado con el objetivo de impulsar tu crecimiento acadmico y
personal.

13
11

Simbologa
Simbologa que facilitar
tu proceso de aprendizaje
Diseo instruccional
3DUDLQLFLDUUHH[LRQD

Aprende ms

Actividad de aprendizaje
Apoyos para reforzar el aprendizaje
Glosario

5HH[LRQHPRVVREUHODDFWLYLGDG
Sabas que...
Cierre del bloque

14
12

Con qu conocimientos cuento?


Para empezar, es necesario que analices en qu nivel se encuentran tus habilidades
de comunicacin. Existen muchas maneras para comunicarnos, pero en todas ellas
siempre existir una parte que genere la informacin y otra que la reciba. Con los
siguientes ejercicios podrs poner en prctica tu capacidad para formular ideas,
construir un mensaje y transmitirlo, tomando en cuenta distintas caractersticas,
como el pblico al que va dirigido y la eleccin de un lenguaje apropiado.
Instrucciones: lee con atencin el siguiente texto y despus responde las preguntas
correspondientes. Al terminar, revisa las respuestas con tu asesor. Puedes consultar
ODUHWURDOLPHQWDFLyQGHODDFWLYLGDGTXHHVWiGLVSRQLEOHDOQDOGHOOLEUR

Se ha demostrado que el baile es uno de los mejores antdotos contra el


estrs y el mal humor. No en vano es un gran estimulante en la produccin
GHHQGRUQDVODVKRUPRQDVGHOELHQHVWDU
Bailar es una especie de meditacin activa que permite alejar de la mente
las preocupaciones y tensiones, otorgndole al cuerpo una libertad que
habitualmente le negamos. Todos podemos conectarnos con nuestra ms
ntima esencia si dejamos que sea el cuerpo quien asuma su capacidad
sanadora, aunque esto nada tiene que ver con los diez minutos de
JLPQDVLDTXHSRGDPRVSUDFWLFDUDGLDULR/DVLQYHVWLJDFLRQHVFRQUPDQ
que el baile aumenta la creatividad y la autoestima. La persona se siente
ms relajada, receptiva y llena de energa. Entonces, al regresar del
trabajo o del estudio, baile en casa. No importa el tipo de msica que
SUHHUDSRUTXHDYHFHVQRVHQHFHVLWDGHXQDFDQFLyQSDUDGHMDUTXH
su cuerpo se libere a travs del baile. Hablamos de la msica interior,
del ritmo que su cuerpo es capaz de expresar tarareando o cantando
a pleno pulmn para liberar lo que siente. Todos tenemos una meloda
interna que la mente reconoce como una partitura con la cual liberar los
sentimientos atrapados. Quizs sea una cancin entera o unas notas
sueltas. No importa, slo necesita dejar que suene en su interior y que su
cuerpo siga el son.
Fuente: Universidad Nacional Hermilio Valdizn. (2009). Estrategias de recuperacin
de la informacin: Relecturas por prrafos. Programa Nacional de Formacin
y Capacitacin Docente PRONAFCAP. Disponible en http://es.calameo.com/
books/0003556050865a1670a05 [Consulta: 10/06/2015].

4XpWtWXORFUHHVTXHUHHMDPHMRUORH[SXHVWRHQODOHFWXUD"
a) La gente y el baile.
b) Ms salud con el baile.
c) Ponte a bailar.
d) El ejercicio del baile.

15
13

Con qu conocimientos cuento?


2. El texto no menciona que a travs del baile se consiga la:
a) creatividad.
b) libertad del cuerpo.
c) alegra.
d) relajacin.
3. Si quisieras platicarle a algn amigo lo que acabas de leer, cules son las ideas
principales que destacaras de la lectura? Redacta al menos tres ideas:
a) __________________________________________________________
b) __________________________________________________________
c) __________________________________________________________
4. Utiliza las tres ideas que expusiste anteriormente para redactar la manera en
que le contaras la lectura a tu amigo. Puedes utilizar un lenguaje informal, sin
HPEDUJRUHFXHUGDTXHVLHPSUHGHEHVUHVSHWDUODVUHJODVRUWRJUiFDV\HYLWDU
el uso de malas palabras o groseras.
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
______________________________________________________________
5. Ahora, con las mismas tres ideas, redacta la manera en que le contaras esto en
clase a tu asesor. Utiliza una estructura ms formal y procura ser lo ms claro
SRVLEOH\DTXHGHQRVHUORTXLHQUHFLEDODLQIRUPDFLyQWHQGUiGLFXOWDGHVSDUD
entenderla:
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
_____________________________________________________________
______________________________________________________________
9HULFDWXVUHVSXHVWDVHQHO$SpQGLFHDOQDOGHOOLEUR(QpOWDPELpQHQFRQWUDUiV
todas las retroalimentaciones de cada una de las actividades que vas a desarrollar.
Lo importante es que vayas evaluando tu proceso de aprendizaje con los
instrumentos de evaluacin que estn includos en el desarrollo de las actividades
de aprendizaje.

16
14

BLOQUE I
'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Bloque I

HORAS

Objetos de aprendizaje que se


abordan
Introduccin a la comunicacin
Qu es la comunicacin?
Elementos del proceso comunicativo
Barreras de la comunicacin

Competencias disciplinares
extendidas del campo de
Comunicacin


Utiliza la informacin contenida en


diferentes textos para orientar sus
intereses en mbitos diversos.
Establece
relaciones
analgicas,
considerando las variaciones lxicosemnticas de las expresiones para la
toma de decisiones.
Debate sobre problemas de su entorno
fundamentando sus juicios en el anlisis
y en la discriminacin de la informacin
emitida por diversas fuentes.
Propone soluciones a problemticas
de su comunidad, a travs de diversos
tipos de textos, aplicando la estructura
discursiva, verbal o no verbal, y los
PRGHORV JUiFRV R DXGLRYLVXDOHV TXH
estn a su alcance.
Determina
la
intencionalidad
comunicativa en discursos culturales y
sociales para restituir la lgica discursiva
a textos cotidianos y acadmicos.

Desempeos esperados
al concluir el bloque


(ODERUD VX SURSLD GHQLFLyQ GH


los conceptos de comunicacin e
informacin; lenguaje verbal y no
YHUEDO FRGLFDFLyQ \ GHFRGLFDFLyQ
a partir del anlisis comparativo entre
ellos.
(VSHFLFD OD LQWHQFLyQ FRPXQLFDWLYD
que se presenta en diferentes tipos
de situaciones y los elementos que
intervienen en el proceso.

Productos de aprendizaje







18
16

&XHVWLRQDULRFRPSDUDWLYRGHLPiJHQHV
'HQLFLyQJXLDGDGHFRPXQLFDFLyQ
/LVWDGRUHH[LYRSDUDLGHQWLFDUORVHOHmentos del proceso de comunicacin
en un texto.
3UXHED GH UHVSXHVWDV OLPLWDGDV SDUD
distinguir las barreas de comunicacin.
5HSUHVHQWDFLyQGHODVEDUUHUDVGHFRmunicacin.

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Introduccin
El hombre siempre ha requerido transmitir diversas cosas: desde necesidades
hasta sentimientos, por lo cual, los distintos procesos que lleva a cabo tienen una
QDOLGDGFRPXQLFDUVH3RGUtDGHFLUVHTXHHQVXVLQLFLRVODFRPXQLFDFLyQHUDYLVXDO
y auditiva debido a la forma en que los primeros seres humanos utilizaban gestos
\VRQLGRVSDUDWUDQVPLWLULQIRUPDFLyQ(VWRTXLHUHGHFLUTXHODKXPDQLGDGFXHQWD
FRQXQDJUDQYRFDFLyQFRPXQLFDWLYD\TXHpVWDQRVyORVHGHVDUUROODDWUDYpVGHOD
SDODEUD *yQJRUD3DGLOOD 
&RQ OD HYDOXDFLyQ GLDJQyVWLFD TXH UHVROYLVWH DQWHULRUPHQWH WH GLVWH FXHQWD TXH
H[LVWHQ PXFKDV PDQHUDV GH WUDQVPLWLU OD PLVPD LQIRUPDFLyQ WRPDQGR HQ FXHQWD
ODQDOLGDGTXHVHSHUVLJXH\HOS~EOLFRDOTXHHVWiGLULJLGD3RUHVWDUD]yQUHVXOWD
importante que profundices en los elementos que conforman la estructura del proceso
FRPXQLFDWLYRFRQHOQGHTXHVHDVFDSD]GHLQWHUSUHWDUORVPHQVDMHV\GHVSXpV
FUHDUGLVWLQWRVFRQWHQLGRVTXHFXPSODQFRQGLYHUVDVIRUPDVGHFRPXQLFDFLyQ
7RGDHVWDLQIRUPDFLyQODHQFRQWUDUiVHQHVWHEORTXH\SRGUiVSURIXQGL]DUHQHOODOR
TXHWHD\XGDUiDFRPSUHQGHUVXLPSRUWDQFLD\DPSOLDUODYLVLyQTXHWLHQHVDFHUFD
GHODVGLVWLQWDVIRUPDVTXHHPSOHDVSDUDFRPXQLFDUWH

Mapa de objetos de aprendizaje


'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Elementos
del proceso
comunicativo

Barreras de la
FRPXQLFDFLyQ

Emisor

0HQVDMH

)tVLFDV

6HPiQWLFDV

Receptor

&RGLFDFLyQ

)LVLROyJLFDV

3VLFROyJLFDV

Canal

'HFRGLFDFLyQ

Culturales

5HWURDOLPHQWDFLyQ

19
17

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

3DUDLQLFLDUUHH[LRQD
$ULVWyWHOHV GHQLy OD FRPXQLFDFLyQ FRPR OD E~VTXHGD GH WRGRV ORV PHGLRV GH
SHUVXDVLyQ 26XOOLYDQ 6HJ~QOD5HDO$FDGHPLDGHOD/HQJXD(VSDxROD
SHUVXDGLU VLJQLFD FRQYHQFHU D DOJXLHQ FRQ D\XGD GH UD]RQHV SDUD TXH KDJD R
SLHQVH DOJR GHWHUPLQDGR &RPR WH SRGUiV GDU FXHQWD FRPXQLFDU QR VH TXHGD
~QLFDPHQWHHQHODFWRGHWUDQVPLWLULQIRUPDFLyQVLQRTXHEXVFDREWHQHUXQDUHDFFLyQ
SRUSDUWHGHTXLHQHVODUHFLEDQ
(Q HO VLJXLHQWH HVSDFLR UHDOL]D XQ GLEXMR HQ HO TXH UHSUHVHQWHV D XQD SHUVRQD
DOHJUH'LE~MDODFRQFXLGDGR\GHIRUPDGHWDOODGD1RLPSRUWDTXHQRVHDVHOPHMRU
GLEXMDQWH VyOR UHFXHUGD TXH GHEHV SRQHU HPSHxR HQ HO GHVDUUROOR GH WX WUDEDMR

&XDQGRWHUPLQHVHOGLEXMRPXpVWUDVHORDXQFRPSDxHURGHWXFODVH\SUHJ~QWDOH
TXpHOHPHQWRVGHODLOXVWUDFLyQOHSDUHFHTXHUHHMDQPHMRUODDOHJUtD
3XGLVWHFRQYHQFHUDWXFRPSDxHURGHTXHWXGLEXMRUHSUHVHQWDXQDSHUVRQDDOHJUH"
/RV HOHPHQWRV TXH HOLJLy IXHURQ ORV PLVPRV TXH W~ FUHHV TXH UHHMDQ DOHJUtD"
&XiOIXHODUHDFFLyQGHWXFRPSDxHURFXDQGROHSUHVHQWDVWHODLOXVWUDFLyQ"/RTXH
DFDEDVGHUHDOL]DUHVXQHMHUFLFLRGHFRPXQLFDFLyQVLQD\XGDGHOKDEOD\DTXHD
WUDYpVGHOGLEXMRIXHSRVLEOHWUDQVPLWLULQIRUPDFLyQXWLOL]DQGRRWURVPHGLRVDGHPiV
GHREWHQHUXQDUHDFFLyQGHODSHUVRQDFRQODTXHFRPSDUWLVWHWXWUDEDMR

20
18

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Aprende ms
Introduccin a la comunicacin
$QWHVGHODDSDULFLyQGHOOHQJXDMHORVSULPHURVVHUHVKXPDQRVXWLOL]DEDQGLYHUVRV
PpWRGRV SDUD JHQHUDU HVD DFFLyQ GH FRPXQLFDU *UDFLDV DO HVWXGLR GH YHVWLJLRV
DUTXHROyJLFRV HV SRVLEOH DUPDU TXH D SDUWLU GHO SHULRGR (ROtWLFR 
DxRVD& QXHVWURVDQWHSDVDGRVFRPHQ]DURQDXWLOL]DUJHVWRVVRQLGRV
GLEXMRV\SLQWXUDVSDUDWUDQVPLWLUVXVH[SHULHQFLDVFRWLGLDQDV *RQ]iOH] 
6HJ~Q GDWRV FLHQWtFRV HO Homo Sapiens FX\RV UHVWRV PiV DQWLJXRV FXHQWDQ
FRQ  PLO DxRV FRQWDED FRQ XQ WUDFWR YRFDO PRGHUQR TXH OH SHUPLWtD SURGXFLU
XQ OHQJXDMH DUWLFXODGR HV GHFLU TXH SRGtD JHQHUDU VRQLGRV \ HVWUXFWXUDUORV SDUD
FRPXQLFDUVH /DLWPDQ   7H LPDJLQDV FXiQWRV PLOHV GH DxRV \D WHQtD OD
FRPXQLFDFLyQ DQWHV GH TXH DSDUHFLHUD HO OHQJXDMH" (VWR VLJQLFD TXH KDEODU HV
VyORXQDSHTXHxDSDUWHGHWRGRHOIHQyPHQRTXHUHSUHVHQWDODFRPXQLFDFLyQSRU
ORTXHHQODVVLJXLHQWHVSiJLQDVVHUiVFDSD]GHDQDOL]DUFRQRWURVRMRVFDGDXQR
GHORVHOHPHQWRVTXHODFRQIRUPDQ

Aprende ms
Qu es la comunicacin?
/RVSULPHURVLQWHQWRVSRUGHQLUHOSURFHVR
GH FRPXQLFDFLyQ IXHURQ UHDOL]DGRV SRU
$ULVWyWHOHVDSUR[LPDGDPHQWHHQHODxR
D& *RQ]iOH]   (VWH OyVRIR JULHJR
HVWDEOHFLy OD EDVH GH WRGD OD FRPXQLFDFLyQ
utilizando la siguiente pregunta: quin
dice qu a quin? Sus aportaciones en el
FDPSRGHODFRPXQLFDFLyQKDVLGRREMHWRGH
SURSXHVWDV WHyULFDV \ PRGHORV TXH LOXVWUDQ
el poder del argumento, es decir, de las
razones que se dan para probar un punto y
ORJUDU XQ SURSyVLWR HVSHFtFR 'H DFXHUGR
D ODV LQWHQFLRQHV GHO RUDGRU HO PHQVDMH HV
construido para que cumpla con las metas
SODQWHDGDV SUHYLDPHQWH )RQVHFD  3ULHWR
GH$OL]R 

21
19

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Sabas que...
$ULVWyWHOHV IXH XQ OyVRIR JULHJR TXH QDFLy HQ HO
 D GH & 6X ORVRItD VH EDVDED HQ FXHVWLRQDU
todo para obtener las respuestas mediante la
H[SHULPHQWDFLyQFRQODUHDOLGDG6XUHODFLyQFRQOD
FRPXQLFDFLyQWLHQHTXHYHUFRQODRUDWRULDS~EOLFD
HQGRQGHHOFRQWDFWRHQWUHHORUDGRU\HOS~EOLFRHUD
LQPHGLDWRSRUORTXHSRGtDSHUFLELUVXVUHDFFLRQHV
6iL] 

Actividad de aprendizaje 1
InstruccionesREVHUYDODVIRWRJUDItDVTXHWHSUHVHQWDQDFRQWLQXDFLyQ\UHVSRQGH
OD VLJXLHQWH SUHJXQWD 4Xp FUHHV TXH OH HVWi GLFLHQGR HO SHUVRQDMH$ DO SHUVR
QDMH%",PDJLQDDOJRVLPLODUTXHWHKD\DSDVDGRHQDOJ~QPRPHQWR(VFULEHWX
UHVSXHVWDHQHOHVSDFLRFRUUHVSRQGLHQWH$OQDOFRPSDUDWXVUHVSXHVWDVFRQWXV
FRPSDxHURVGHFODVH
,PDJHQ
3HUVRQDMH$

Respuesta:

3HUVRQDMH%

,PDJHQ
3HUVRQDMH$

3HUVRQDMH%

Respuesta:

*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

22
20

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
$XQTXHODVGRVLPiJHQHVSUHVHQWDQXQDLQWHUDFFLyQ entre dos personas, es
HYLGHQWHTXHpVWDHVPX\GLVWLQWDHQFDGDFDVR6LJXLHQGRODSUHJXQWDquin
dice qu a quin?,SXHGHVYHUTXHHOSHUVRQDMH$OHGLFHDOJR TXHW~HVFUL
ELVWH DOSHUVRQDMH%(QFRPXQLFDFLyQHOSHUVRQDMH$VHGHQRPLQDemisor,
PLHQWUDVTXHHOSHUVRQDMH%VHOODPDreceptor(VHDOJRTXHHOHPLVRUOH
GLFHDOUHFHSWRUVHFRQRFHFRPRmensaje(QHOVLJXLHQWHHVTXHPDSRGUiV
DSUHFLDUJUiFDPHQWHFyPRVHOOHYDDFDERHVWHSURFHVR

Mensaje

Emisor

Receptor

Interaccin:       W  La
maestra form grupos de trabajo para que los alumnos interactuaran entre s.
9LVWR HVWR UHH[LRQD OR VLJXLHQWH TXp WRPDVWH HQ FXHQWD SDUD GHVFLIUDU
ORTXHVHHVWiQGLFLHQGRORVSHUVRQDMHVGHODVIRWRJUDItDV"6XSRVWXUDOD
H[SUHVLyQGHVXURVWURRDOJ~QRWURHOHPHQWR"5HFXHUGDWXUHVSXHVWD\DTXH
ODUHWRPDUiVPiVDGHODQWH

23
21

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Aprende ms
Elementos del proceso comunicativo
(QWRGRSURFHVRGHFRPXQLFDFLyQVLQLPSRUWDUORFRPSOHMRRVHQFLOORTXHVHDH[LVWHQ
WUHVHOHPHQWRVEiVLFRVHPLVRUPHQVDMH\UHFHSWRU0iVDGHODQWHHQFRQWUDUiVODV
GHQLFLRQHVGHFDGDXQRSHURDQWHVSRQDWHQFLyQDODVLJXLHQWHLPDJHQ

,PDJLQDTXHYDVSRUODFDOOH\GHUHSHQWHDSDUHFHIUHQWHDWLXQSHUURFRPRHOGH
ODIRWRJUDItDODGUDQGRIXHUWHPHQWH\PRVWUiQGRWHVXVFROPLOORV/RPiVSUREDEOHHV
que hayas entrado en su territorio, por lo que decides tomar otro camino para evitar
XQDVLWXDFLyQSHOLJURVDWDOYH]FUX]DQGRODFDOOHRURGHDQGRHOHVSDFLRGRQGHVH
HQFXHQWUDHODQLPDO$OYHUHVWRHOSHUURGHMDGHODGUDU\VHGDODPHGLDYXHOWDSRU
ORTXHUHJUHVDODFDOPDDOOXJDU
6LJXLHQGR HVWH HMHPSOR \ WRPDQGR HQ FXHQWD ORV HOHPHQWRV EiVLFRV GH OD
FRPXQLFDFLyQSRGUiVGDUWHFXHQWDGHTXHHOSHUURDFWXyFRPRHPLVRU\WUDQVPLWLy
XQ PHQVDMH GHO TXH W~ IXLVWH UHFHSWRU (VWR TXLHUH GHFLU TXH OD FRPXQLFDFLyQ QR
OD UHDOL]DQ ~QLFDPHQWH ODV SHUVRQDV VLQR TXH GLVWLQWRV VHUHV YLYRV H LQFOXVR
PLFURRUJDQLVPRVVLJXHQHOPLVPRSURFHVRSDUDWUDQVPLWLULQIRUPDFLyQ

24
22

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Emisor

0HQVDMH$OHMDUDXQLQWUXVRGH
VXWHUULWRULR

&RGLFDFLyQGHOPHQVDMH
ODGULGRIXHUWH\DJUHVLYR

Receptor

Canal:
Aire

0HQVDMHUHFLELGR(VFXFKDVHO
ODGULGRIXHUWH\DJUHVLYR

'HFRGLFDFLyQGHOPHQVDMH
interpretas el tono del ladrido y
GHFLGHVDOHMDUWHGHOSHUUR

En el esquema anterior puedes ver que el perro transmite un mensaje, es decir, la


LQIRUPDFLyQTXHEXVFDKDFHUOOHJDUDOUHFHSWRU(VWRORKDFHDWUDYpVGHXQcdigo
que, en el caso del animal, se traduce en ladridos fuertes y agresivos que son
WUDQVPLWLGRVDWUDYpVGHODLUHTXHVLUYHFRPRXQcanalSDUDKDFHUOOHJDUHOPHQVDMH
7~ FRPR UHFHSWRU FDSWDV HVWH PHQVDMH \ OR GHFRGLFDV )LQDOPHQWH JHQHUDV
XQDUHDFFLyQTXHHQHVWHFDVRHVODTXHHVSHUDHOHPLVRUFDPELDVHOUXPER\
WH DOHMDV GHO WHUULWRULR GHO SHUUR$ HVWD UHDFFLyQ VH OH FRQRFH FRQ HO QRPEUH GH
UHWURDOLPHQWDFLyQ

: 


25
23

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Actividad de aprendizaje 2
InstruccionesOOHQDORVHVSDFLRVYDFtRVFRQODLQIRUPDFLyQTXHVHWHSURSRUFLRQD
HQODWDEODVLJXLHQWHSDUDFRQVWUXLUXQDGHQLFLyQGHFRPXQLFDFLyQ3XHGHVJXLDUWH
WDPELpQFRQHOHMHPSORGHOHVTXHPDDQWHULRU\ORVFRQFHSWRVYLVWRVKDVWDHOPR
PHQWRHQHOEORTXH$OWHUPLQDUUHYLVDWXWUDEDMRFRQD\XGDGHODVHVRU

mensaje

UHWURDOLPHQWDFLyQ

proceso

FyGLJR

Canal

&RPXQLFDFLyQ
Es un ______________________ TXHVHGDHQWUHGRVRPiVVHUHVYLYRVSDUDWUDQV
mitir un ________________________, utilizando un ______________________ en
FRP~Q\DWUDYpVGHXQ________________________GHWHUPLQDGRFRQODQDOLGDGGH
REWHQHUXQDUHDFFLyQTXHHVSHUFLELGDJUDFLDVDOD____________________________
*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
3DUDTXHODFRPXQLFDFLyQVHJHQHUHHVQHFHVDULDODSDUWLFLSDFLyQGHGLVWLQWRV
HOHPHQWRVFRQHOQGHTXHVHOOHYHDFDERFRUUHFWDPHQWH6LQHPEDUJRHV
WRVHOHPHQWRVGHEHQVHJXLUXQDHVWUXFWXUDHVSHFtFDSDUDTXHODLQWHUDFFLyQ
HQWUHHOHPLVRU\HOUHFHSWRUVHDYHUGDGHUDPHQWHHIHFWLYD$GHPiVH[LVWHQ
DVSHFWRVTXHHQRFDVLRQHVPRGLFDQODWUDQVPLVLyQGHOPHQVDMHSRUORTXH
UHVXOWDLPSRUWDQWHLGHQWLFDUORVSXQWRVTXHSRGUtDQLQXLUWDPELpQHQHOSUR
FHVRGHFRPXQLFDFLyQ

26
24

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Aprende ms
Elementos del proceso comunicativo
$OJR TXH GHEHV WHQHU VLHPSUH HQ FXHQWD DO GHQLU OD FRPXQLFDFLyQ \ TXH
SXGLVWH DSUHFLDU HQ OD DFWLYLGDG DQWHULRU  HV TXH HV XQ SURFHVR \ FRPR WDO
LQFOX\HGLVWLQWRVHOHPHQWRVSDUDTXHSXHGDVHUJHQHUDGD
2EVHUYDHOVLJXLHQWHHVTXHPD

Z
Z


D
D






Canal

D
D







Z

(VTXHPDGHOSURFHVRGHFRPXQLFDFLyQ




)XHQWH5REELQV63 -XQGJH7$  &RPSRUWDPLHQWR
RUJDQL]DFLRQDO0p[LFR3HDUVRQ(GXFDFLyQ

(VWHHVTXHPDWHVHUYLUiSDUDFRPSUHQGHUPHMRUHOSURFHVRGHFRPXQLFDFLyQ6HJ~Q
5REELQV\-XQGJH  ORVHOHPHQWRVTXHORFRPSRQHQVRQORVVLJXLHQWHV
 (PLVRUHOTXHFUHDHOPHQVDMH
 0HQVDMHHOFRQWHQLGRTXHHOHPLVRUTXLHUHWUDQVPLWLU
 &RGLFDFLyQ HO FyGLJR TXH FRPSDUWH FRQ HO UHFHSWRU SRU HMHPSOR VL HO
HPLVRU\HOUHFHSWRUKDEODUDQGLVWLQWRVLGLRPDVQRSRGUtDQHQWHQGHUVH
 &DQDOHOPHGLRDWUDYpVGHOFXDOYLDMDHOPHQVDMH
 5XLGR HQ FRPXQLFDFLyQ VH FRQRFH FRPR UXLGR D DTXHOOR TXH GLFXOWD
HO YLDMH GHO PHQVDMH D WUDYpV GHO FDQDO 3XHGHQ VHU WDPELpQ HPRFLRQHV
IDOODVWpFQLFDVHQHOPHGLRTXHHVWiVXWLOL]DQGRSDUDFRPXQLFDUWHHOOXJDU
HQHOTXHWHHQFXHQWUDVODGLVWDQFLDGHVFRQRFHUHOVLJQLFDGRGHDOJXQRV
FRQFHSWRVHQQWRGRORTXHSXHGDDIHFWDUHOSURFHVRFRPXQLFDWLYR(Q
HVWRVFDVRVODFRPXQLFDFLyQSXHGHVXIULUDOJXQDVPRGLFDFLRQHV

27
25

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

 5HFHSWRUFRPRVXQRPEUHORLQGLFDHVHOTXHUHFLEHHOPHQVDMH
 'HFRGLFDFLyQ HO SURFHVR TXH OOHYD D FDER HO UHFHSWRU SDUD GHVFLIUDU HO
PHQVDMH
 5HWURDOLPHQWDFLyQ HV OD UHVSXHVWD TXH REWLHQH HO HPLVRU XQD YH] TXH
HO UHFHSWRU KD GHFRGLFDGR HO PHQVDMH &RQ HVWR VH FXPSOH HO FLFOR GHO
SURFHVRGHFRPXQLFDFLyQ

Sabas que...
(O HVTXHPD GHO SURFHVR GH FRPXQLFDFLyQ FRPR VH
OH FRQRFH DFWXDOPHQWH IXH DGDSWDGR GHO WUDEDMR GHO
QRUWHDPHULFDQR&ODXGH(6KDQQRQFRQVLGHUDGRFRPR
HOSDGUHGHODWHRUtDGHODLQIRUPDFLyQ6XHVTXHPD
VHEDVyHQDVSHFWRVPDWHPiWLFRV\WHFQROyJLFRVSRUOR
TXHFRQVLGHUDFRPRHMHPSORVGHIXHQWHGHLQIRUPDFLyQ
una secuencia de letras en un telegrama o el uso de
OD UDGLR \ OD WHOHIRQtD 6X 7HRUtD 0DWHPiWLFD GH OD
&RPXQLFDFLyQEXVFDGHWHUPLQDUODIRUPDPiVHFLHQWH
SDUDWUDQVPLWLUXQPHQVDMHGHWDOPDQHUDTXHHOUXLGR
QRLQX\DGHPDQHUDLPSRUWDQWHHQHOSURFHVR
Fuente de
informacin

Transmisor

Mensaje

Receptor

Seal

Seal
recibida

Destinatario

Mensaje

Fuente de
ruido
(VTXHPDGHOGLDJUDPDGHXQVLVWHPDJHQHUDOGHFRPXQLFDFLyQ

)XHQWH6KDQQRQ&(  $Mathematical Theory of Communication


'LVSRQLEOHHQKWWSZRUU\GUHDPFRPUHIV6KDQQRQ$
0DWKHPDWLFDO7KHRU\RI&RPPXQLFDWLRQSGI>&RQVXOWD@

28
26

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Actividad de aprendizaje 3
Instrucciones: en binas OHDQ FRQ DWHQFLyQ HO VLJXLHQWH UHODWR 'HVSXpV LGHQWL
quen y escriban en el espacio que corresponde los elementos que conforman el
SURFHVRGHFRPXQLFDFLyQ$Sy\HQVHHQHOHVTXHPD\ODGHQLFLyQGHORVHOHPHQWRV
YLVWRVDQWHULRUPHQWH&XDQGRWHUPLQHQUHYLVHQVXWUDEDMRFRQD\XGDGHOGRFHQWH
Binas: 

0DUWD \ 7HUHVD VRQ KHUPDQDV 0DUWD HV OD PD\RU


\ HV PDGUH GH 5RVD TXLHQ IDOOHFLy UHFLHQWHPHQWH
Tere ayuda a Marta a vestirse para el entierro de
5RVD
TERESA: Deja que te ayude (Revisa la ropa y elige
XQ YHVWLGR SDUD 0DUWD  Siempre pens que esto
se te vea muy bien. Vamos a ponrtelo ,QWHQWD
FRORFiUVHOR D OD KHUPDQD  Est bien as? (Viste
D 0DUWD \ OH DFRPRGD HO YHVWLGR  Recuerdas
cmo nos pelebamos de nias cuando intentabas
vestirme?
0DUWDVRQUtHXQSRFR
MARTA: Eras una malcriada.
TERESA (Acaba de acomodarle el vestido y acaricia
HOFDEHOORGH0DUWD Te ves muy bonita.

29
27

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Emisor: ___________________________________________________________
0HQVDMH__________________________________________________________
__________________________________________________________________
__________________________________________________________________
&RGLFDFLyQ_______________________________________________________
Canal: ____________________________________________________________
Ruido: ____________________________________________________________
__________________________________________________________________
Receptor: __________________________________________________________
'HFRGLFDFLyQ_____________________________________________________
__________________________________________________________________
5HWURDOLPHQWDFLyQ __________________________________________________
__________________________________________________________________
__________________________________________________________________
__________________________________________________________________
*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
(OUXLGRHQODFRPXQLFDFLyQHVXQHOHPHQWRTXHDXQTXHQRVLHPSUHDSDUHFH
HQHOSURFHVRGHEHVHULGHQWLFDGRFXLGDGRVDPHQWH(QHOHMHUFLFLRDQWHULRU
SXHGHVYHUTXHDXQTXHQRH[LVWHXQUXLGRFRPRQRUPDOPHQWHVHFRQRFH
VRQLGRVIXHUWHVRGLVWUDFWRUHV VLWHEDVDVHQODGHQLFLyQTXHOHtVWHSRGUiV
YHUTXHDTXtHOUXLGRVHGDSRUODVHPRFLRQHVTXHDEUXPDQDOUHFHSWRUSRUOD
PXHUWHGH5RVD(QHVWHFDVRHOHPLVRUWLHQHGLFXOWDGHVSDUDFXOPLQDUHO
SURFHVRFRPXQLFDWLYRSRUHOUXLGRTXHVHSUHVHQWD
([LVWHQRFDVLRQHVHQTXHHOUXLGRHVWDQJUDQGHTXHFRUWDGHQLWLYDPHQWHHO
HQODFHHQWUHTXLHQFUHDHOPHQVDMH\TXLHQHVWDEDGHVWLQDGRDUHFLELUOR&XDQ
GRHVWRVXFHGHVHGLFHTXHKD\XQDEDUUHUDGHFRPXQLFDFLyQ

30
28

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Aprende ms
Barreras de la comunicacin
5HWRPDHOHMHPSORHQHOTXHLPDJLQDVTXHYDVSRUODFDOOH\HQWUDVHQHOWHUULWRULR
GHXQSHUURDJUHVLYRVyORTXHHVWDYH]QRHVFXFKDVVXVODGULGRVSRUTXHFHUFDGH
DKtKD\XQDHVWDFRQP~VLFDPX\IXHUWH

 %DUUHUDV ItVLFDV VRQ LQWHUIHUHQFLDV TXH VH SUHVHQWDQ HQ HO DPELHQWH HQ
GRQGHVHUHDOL]DHOSURFHVRGHFRPXQLFDFLyQ /RUHQWH -LPpQH] 
/DVPiVWtSLFDVVRQFRPRODVGHOHMHPSORDQWHULRUHQGRQGHORVVRQLGRVVRQ
WDQIXHUWHVTXHVHLQWHUSRQHQHQWUHHOHPLVRU\HOUHFHSWRU2WUDVSXHGHQ
VHUODVSDUHGHVORVREMHWRVTXHGLFXOWDQHOFRQWDFWRYLVXDOODGLVWDQFLD\
FXDOTXLHURWUDFRVDTXHItVLFDPHQWHGLFXOWHODWUDQVPLVLyQGHOPHQVDMH

%DUUHUDItVLFDUHSUHVHQWDGDSRUXQD
pared que se interpone entre el emisor
\ORVUHFHSWRUHV

31
29

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

 %DUUHUDV VHPiQWLFDV VH RULJLQDQ FXDQGR VH PDOLQWHUSUHWD HO VLJQLFDGR


RORVVtPERORVTXHFRPSRQHQHOPHQVDMH $OERUpV $XQTXHHOVHU
KXPDQR FXHQWD FRQ HO OHQJXDMH SDUD FRPXQLFDUVH FRQ IUHFXHQFLD ODV
SDODEUDVWLHQHQVLJQLFDGRVGLVWLQWRVGHSHQGLHQGRGHOFRQWH[WRHQHOTXHVH
RULJLQDODFRPXQLFDFLyQ3RUHMHPSORVLDOJXLHQWHRIUHFLHUDSRURWRVSDUD
FRPHU OR PiV SUREDEOH HV TXH QR HQWHQGHUtDV D TXp VH UHHUH 3RURWRV
HVODIRUPDHQTXHOODPDQDORVIULMROHVHQSDtVHVFRPR$UJHQWLQD%ROLYLD
\8UXJXD\\VLFRQRFLHUDVDXQDSHUVRQDGH(VSDxDWHGLUtDTXHORTXHW~
FRQRFHVFRPRIULMROHVHOORVORVOODPDQMXGtDV7HGDVFXHQWDTXHDXQTXH
HQHVRVSDtVHVVHKDEODHVSDxROH[LVWHQSDODEUDVGLVWLQWDVSDUDGHQRPLQDU
ODPLVPDFRVD"'HLJXDOPDQHUDODEDUUHUDVHPiQWLFDVHJHQHUDFXDQGR
HOHPLVRUWHGLFHDOJR\W~HQWLHQGHVRWUDFRVD6LJXLHQGRHOHMHPSORGHODV
MXGtDVHQ(VSDxDHVSRVLEOHTXHDOHVFXFKDUHOWpUPLQRPXFKDVSHUVRQDV
VHLPDJLQHQDXQJUXSRGHSHUVRQDVTXHSUDFWLFDQHOMXGDtVPR
 %DUUHUDVVLROyJLFDVVHJ~QOD5HDO$FDGHPLD
GH OD /HQJXD (VSDxROD VLROyJLFR
HV DTXHOOD FDUDFWHUtVWLFD UHODFLRQDGD
FRQ ORV yUJDQRV GH ORV VHUHV YLYRV \ VX
IXQFLRQDPLHQWR 8QD EDUUHUD GH HVWH WLSR
WLHQH TXH YHU FRQ SUREOHPDV RUJiQLFRV GHO
emisor o del receptor, como pueden ser la
SpUGLGDGHODYLVWDVRUGHUDHOVXIULPLHQWRGH
DOJ~Q GRORU ItVLFR R PDOHVWDU TXH OH LPSLGD
FRPXQLFDUVHHQWUHRWURV
%DUUHUDVLROyJLFDRFDVLRQDGD
SRUODFHJXHUD

 %DUUHUDV SVLFROyJLFDV WDPELpQ FRQRFLGDV FRPR EDUUHUDV SHUVRQDOHV VH


UHHUHQDODVYHFHVHQTXHODIRUPDGHSHQVDUGHXQLQGLYLGXR YLVLyQGHOD
YLGDYDORUHVHPRFLRQHVHWFpWHUD LQX\HHQODPDQHUDHQTXHHPLWH\UHFLEH
XQPHQVDMH $OERUpV 3DUDFRPSUHQGHUPHMRUHVWHSXQWRLPDJLQDSRU
XQLQVWDQWHTXHHVWiVHQXQHVWDGLRGHIXWEROYLHQGRHOSDUWLGRGHWXHTXLSR
IDYRULWR&DVLDOQDOGHOHQFXHQWUR\FRQHOPDUFDGRUHPSDWDGRHOGHODQWHUR
GHWXHTXLSRORJUDPDUFDUXQJROSHURHOMXH]GHOtQHDOHYDQWDVXEDQGHUD
\ VHxDOD IXHUD GH OXJDU LQYDOLGDQGR OD DQRWDFLyQ 6HJXUDPHQWH HVWDUtDV
PX\PROHVWRSRUODGHFLVLyQGHODEDQGHUDGRPLHQWUDVTXHORVGHOHTXLSR
FRQWUDULRIHVWHMDUtDQODDQXODFLyQGHOJRO(QHVWHSURFHVRFRPXQLFDWLYRHO
HPLVRUHVHOMXH]GHOtQHDPLHQWUDVTXHW~IRUPDVSDUWHGHOS~EOLFRUHFHSWRU
GHO PHQVDMH 7H GDV FXHQWD TXH LQWHUSUHWDVWH OD LQIRUPDFLyQ GH GLVWLQWD
manera que un fan del equipo contrario, aunque ambos hayan recibido
HO PLVPR PHQVDMH" (VWR IXH SRUTXH ORV GRV SLHQVDQ GLVWLQWR \D TXH VRQ
LQXHQFLDGRVSRUHOFDULxRTXHOHWLHQHQDVXVUHVSHFWLYRVHTXLSRV

32
30

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

 %DUUHUDV FXOWXUDOHV VH GDQ


cuando existe una diferencia de
conocimientos entre el que emite
HOPHQVDMH\HOTXHORUHFLEH8QR
GH ORV FDVRV PiV FRPXQHV GH
barrera cultural es cuando dos
SHUVRQDVKDEODQGLVWLQWRVLGLRPDV
WDPELpQ FXDQGR HO HPLVRU XWLOL]D
conceptos especializados y el
UHFHSWRUQRVDEHORTXHVLJQLFDQ
8QHMHPSORGHEDUUHUDFXOWXUDOHVQRSRGHU
FRPXQLFDUVHSRUODGLIHUHQFLDGHLGLRPD

3RUHMHPSORVLXQPpGLFRWHGLFHTXHSDGHFHVGHRGLQRIDJLDOHHQWHQGHUtDV
LQPHGLDWDPHQWH" /D RGLQRIDJLD HV HO WpUPLQR PpGLFR TXH VH XWLOL]D SDUD
UHIHULUVHDOGRORUGHJDUJDQWDSHURQRHVFRP~QTXHODVSHUVRQDVDMHQDVDO
HVWXGLRGHODPHGLFLQDFRQR]FDQHOVLJQLFDGRGHHVWDSDODEUD

Actividad de aprendizaje 4
InstruccionesIRUPDXQHTXLSRFRQWXVFRPSDxHURV/HDQORVVLJXLHQWHVWH[WRV\
VHxDOHQODVEDUUHUDVGHFRPXQLFDFLyQTXHUHHMDQFDGDXQRGHHOORV&XDQGRWHU
PLQHVFRPHQWDWXVUHVSXHVWDVFRQWXJUXSR\WXDVHVRU
6LWXDFLyQ

Barrera de
FRPXQLFDFLyQ

 (VWiVGHVFDQVDQGRFRQWXDEXHODFXDQGRGHUHSHQWH
WHGLFH3iVDPHODVSDQWXDVVROIHULQR
 (VWiVDSXQWRGHUHDOL]DUXQH[DPHQPX\GLItFLO\SLHQ
VDVYR\DUHSUREDU
 $EUHVODVHFFLyQQDQFLHUDGHXQSHULyGLFR\OHHV:DOO
6WUHHWDEULyDODEDMD\HOtQGLFH'RZ-RQHVFHGHXQ
 SXQWRV 
 Vas caminando por la calle, cuando de repente ves a
OROHMRVDXQRGHWXVDPLJRV/HKDEODVSDUDVDOXGDUOR
SHURHQHVHPRPHQWRVHDWUDYLHVDXQFDPLyQ
 7XDVHVRUGHPDWHPiWLFDVHVWiH[SOLFDQGRFyPRUHVRO
ver un problema, pero anoche te desvelaste y tienes
PXFKRVXHxRSRUORTXHQRORJUDVSRQHUDWHQFLyQ

33
31

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
8QDEXHQDFRPXQLFDFLyQVHGDFXDQGRODSHUVRQDTXHFUHDHOPHQVDMHWRPD
HQFXHQWDRWURVIDFWRUHVGHOFRQWH[WRTXHSXHGHQLQXLUHQHOSURFHVRFRPX
QLFDWLYR5HFXHUGDTXHQRHV~QLFDPHQWHPDQGDUXQPHQVDMHVLQRFyPROR
PDQGDV\FRQTXpQDOLGDG5HFRQRFHUODVEDUUHUDVGHODFRPXQLFDFLyQHVHO
SULPHUSDVRSDUDGLVHxDUGLVWLQWDVHVWUDWHJLDVTXHWHSHUPLWDQVXSHUDUODV

Cierre del bloque I


5HH[LRQDVREUHORDSUHQGLGR
Desde sus inicios, el ser humano ha sentido la necesidad de comunicarse, y antes de
ODLQYHQFLyQGHOOHQJXDMHXWLOL]DEDJHVWRV\VRQLGRVSDUDWUDQVPLWLULQIRUPDFLyQ+R\
HQGtD\DXQTXHODVSHUVRQDV\DSXHGHQFRPXQLFDUVHPHGLDQWHODVSDODEUDVVH
VLJXHQXWLOL]DQGRRWURVPHGLRVTXHFRPSOHPHQWDQHOSURFHVRFRPXQLFDWLYR'HEHV
UHFRUGDUTXHVLQLPSRUWDUORVHQFLOORRFRPSOHMRTXHpVWHVHDVLHPSUHFRQWDUiFRQ
ORVHOHPHQWRVEiVLFRVTXHVRQHPLVRUPHQVDMH\UHFHSWRU
7HQSUHVHQWHTXHODFRPXQLFDFLyQQRHVJHQHUDGDVyORSRUHOKRPEUH\DTXHORV
GHPiVVHUHVYLYRVHQPD\RURPHQRUPHGLGDWDPELpQUHDOL]DQHVWHSURFHVRTXHVH
RULJLQDFXDQGRHOHPLVRUEXVFDWUDQVPLWLUXQPHQVDMHFRQXQFyGLJRHVSHFtFRTXH
HVHQYLDGRDWUDYpVGHXQFDQDOFRQHOQGHOOHJDUDOUHFHSWRUTXLHQORGHFRGLFD
\ JHQHUD OD UHWURDOLPHQWDFLyQ (VWR FLHUUD HO FLFOR FRPXQLFDWLYR VLQ SHUGHU GH
YLVWDTXHHQRFDVLRQHVGHEHUiHQIUHQWDUVHDOUXLGR\DYHFHVDODVEDUUHUDVGHOD
FRPXQLFDFLyQ
Estas barreras pueden ser interferencias que se presentan en el ambiente en
GRQGHVHUHDOL]DHOSURFHVRGHFRPXQLFDFLyQ ItVLFDV PDOLQWHUSUHWDUHOVLJQLFDGR
RORVVtPERORVTXHFRPSRQHQHOPHQVDMH VHPiQWLFDV SUREOHPDVRUJiQLFRVGHO
HPLVRURGHOUHFHSWRU VLROyJLFDV TXHODIRUPDGHSHQVDUGHXQLQGLYLGXRLQX\D
HQODPDQHUDHQTXHHPLWH\UHFLEHXQPHQVDMH SVLFROyJLFDV RFXDQGRH[LVWHXQD
GLIHUHQFLDGHFRQRFLPLHQWRVHQWUHHOHPLVRU\HOUHFHSWRU FXOWXUDOHV 

34
32

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Para esta actividad de cierre del primer bloque, tu grupo se dividir en al menos
cuatro equipos de trabajo. Cada equipo preparar y realizar una representacin
que incluya todas las barreras de la comunicacin estudiadas. Para esto debern
ser creativos y utilizar lo que tengan a su alcance para presentarla ante el grupo.
Lo primero es crear una historia y hacer que todos los miembros del equipo acten
HQHOOD'HEHQHVSHFLFDUHQTXpOXJDUVHGDHOSURFHVRGHFRPXQLFDFLyQDVtFRPR
la situacin que lo genera. Trabaja con respeto y colabora con tus compaeros
SDUD TXH OD DFWLYLGDG VH GHVDUUROOH GH OD PHMRU IRUPD 'HVSXpV GH UHDOL]DU OD
representacin, el trabajo de tu equipo se evaluar con la siguiente lista de cotejo y
rbrica.
Marca con una X la casilla que
corresponda, y asigna 1 punto por
cada contenido abordado en la
representacin.
Representacin

6t

Total

No

%DUUHUDItVLFD
Barrera semntica
%DUUHUDVLROyJLFD
Barrera psicolgica
Barrera cultural

Evala la calidad general de la representacin


Elementos de la
representacin

Lugar en donde se
da el proceso de
comunicacin
Situacin que genera el proceso de
comunicacin

Ejemplo

Excelente
(1 punto)

Regular
(0.5 punto)

Necesita
acompaamiento
(0 puntos)

La calle, la escuela,
WXFDVDXQMDUGtQ
HWFpWHUD
Situaciones de la vida
cotidiana en las que
utilizas la comunicacin (una conversacin con un amigo,
una llamada telefniFDODYLVLWDDOPpGLFR
DVLVWLUDXQDHVWD
HWFpWHUD 

35
33

loque I

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Evala la calidad general de la representacin


Elementos de la
representacin

Demostracin
de la barrera que
interrumpe el
proceso de
comunicacin

Ejemplo

Excelente
(1 punto)

Regular
(0.5 punto)

Necesita
acompaamiento
(0 puntos)

Poner en prctica los


conceptos de cada
barrera descrita en el
EORTXH ItVLFDVHPiQWLFDVLROyJLFDSVLFRlgica y cultural).

La representacin fue clara y creativa.


El equipo trabaj activa y respetuosamente
&DOLFDFLyQ

Autoevaluacin
5HDOL]DXQUHFXHQWRVREUHORVDSUHQGL]DMHVREWHQLGRVHQHOEORTXHLGHQWLFDQGRWX
nivel de avance conforme a la siguiente escala:





([FHOHQWHORJUpHODSUHQGL]DMHGHPDQHUDLQGHSHQGLHQWH
%XHQRUHTXHUtDSR\RSDUDFRQVWUXLUHODSUHQGL]DMH
5HJXODUIXHGLItFLOHOSURFHVRGHDSUHQGL]DMH\ORORJUpSDUFLDOPHQWH
,QVXFLHQWHQRORJUpHODSUHQGL]DMH

Revisa a detalle con tu profesor y/o con algunos compaeros aquellos aspectos
donde sea necesario reforzar los aprendizajes.
Nivel de avance

Conceptuales

Contenidos

36
34

&RQRFHV ORV RUtJHQHV GH OD FRPXQLFDcin.


'HQHVHOFRQFHSWRGHFRPXQLFDFLyQ
Reconoces las partes que conforman el
proceso de comunicacin.
Reconoces las barreras de la comunicacin.

'HQHVHOSURFHVRGHODFRPXQLFDFLyQ

Nivel de avance

Procedimentales

Contenidos

Argumentas la importancia de la comunicacin en la historia del ser humano.


,GHQWLFDVRWURVPHGLRVSDUDJHQHUDU
la comunicacin, adems del uso del
lenguaje.
Contrastas las distintas barreras de
la comunicacin considerando las caUDFWHUtVWLFDVGHFDGDXQDGHHOODV
Analizas los elementos que conforman el proceso comunicativo para minimizar el ruido en la transmisin del
mensaje.
Nivel de avance

Actitudinales

Contenidos

(VWDEOHFHVSDUiPHWURVpWLFRVSDUDOD
transmisin de mensajes.

Adoptas una postura de respeto y colaboracin en el trabajo en equipo.

37
35

BLOQUE II
Caracterizas y aplicas los modelos
de comunicacin

loque II

Caracterizas y aplicas los modelos de comunicacin

Bloque II

16

HORAS

Objetos de aprendizaje que se


abordan
Comunicacin verbal
Comunicacin escrita
Comunicacin oral
Comunicacin no verbal
Modelos de comunicacin
Modelos de comunicacin masiva
Modelo de la tuba de Schramm
Modelo de McLuhan

Competencias disciplinares
extendidas del campo de
Comunicacin


Productos de aprendizaje










40
38

Redaccin de carta informal y formal para


fortalecer habilidades de comunicacin escrita.
Exposicin para fortalecer habilidades de
comunicacin oral.
Tabla de entrevista personal para fortalecer
las habilidades de comunicacin no verbal.
Prueba de preguntas no estructuradas sobre
los modelos de comunicacin.
Exposicin grupal sobre cinco situaciones
de la vida diaria en la que se apliquen los
modelos de comunicacin.
(VTXHPD JUiFR GHO PRGHOR GH OD WXED GH
Schramm y el de McLuhan basado en la informacin de un medio masivo de comunicacin.
&DUWHOTXHUHHMHHOXVRGHORVPRGHORVGH
comunicacin.
Exposicin individual del cartel para poner
en prctica las habilidades de comunicacin
oral y no verbal.

Utiliza la informacin contenida en diferentes


textos para orientar sus intereses en mbitos
diversos.
Establece
relaciones
analgicas,
FRQVLGHUDQGR ODV YDULDFLRQHV Op[LFR
semnticas de las expresiones para la toma
de decisiones.
Debate sobre problemas de su entorno
fundamentando sus juicios en el anlisis y en
la discriminacin de la informacin emitida
por diversas fuentes.
Propone soluciones a problemticas de su
FRPXQLGDG D WUDYpV GH GLYHUVRV WLSRV GH
textos, aplicando la estructura discursiva,
YHUEDORQRYHUEDO\ORVPRGHORVJUiFRVR
DXGLRYLVXDOHVTXHHVWpQDVXDOFDQFH
9DORUDODLQXHQFLDGHORVVLVWHPDV\PHGLRV
de comunicacin en su cultura, su familia
y su comunidad, analizando y comparando
sus efectos positivos y negativos.
$QDOL]D ORV EHQHFLRV H LQFRQYHQLHQWHV GHO
XVR GH ODV WHFQRORJtDV GH OD LQIRUPDFLyQ \
la comunicacin para la optimizacin de las
actividades cotidianas.

Desempeos esperados
al concluir el bloque


(VWDEOHFH ODV FDUDFWHUtVWLFDV GH ORV SULQFLpales modelos de comunicacin partiendo


de un anlisis comparativo entre ellos, con
ODQDOLGDGGHXWLOL]DUORVDSURSLDGDPHQWHHQ
los diferentes contextos en que se desenvuelve.

Caracterizas y aplicas los modelos de comunicacin

Introduccin
Para este momento ya te habrs dado cuenta que la comunicacin es parte indispensable en la vida del ser humano, sobre todo porque gracias a ella es posible
transmitir ideas, emociones y necesidades que te permiten interactuar con tus semejantes de manera ptima.
+D\TXLHQDUPDTXHODFRPXQLFDFLyQHVWiFRPSOHWD~QLFDPHQWHFXDQGRHOHPLVRU
y el receptor entienden el mensaje del mismo modo (Benoit, 2002). Otros mencionan que la interpretacin del mensaje debe considerar el entorno en el que se crea
el mismo (West & Turner, 2005). Recuerdas cuando hiciste la actividad de aprendizaje 1 del bloque anterior? En ese trabajo creaste un dilogo que describiera lo que
HOSHUVRQDMH$OHGHFtDDOSHUVRQDMH%2EYLDPHQWHSDUDKDFHUORWRPDVWHHQFXHQWD
YDULDVFRVDVTXHDSDUHFHQHQODVIRWRJUDItDVFRPRODSRVWXUDGHFDGDXQRODH[SUHVLyQGHVXURVWURHOOXJDUHQGRQGHHVWDEDQHQQGLYHUVRVDVSHFWRVTXHD\Xdan a las personas a transmitir informacin. Todo esto tiene que ver con elementos
verbales y no verbales en los que profundizars en este bloque, adems de utilizar
algunos modelos que complementan el proceso de comunicacin que ya conoces.

Mapa de objetos de aprendizaje


Caracterizas y aplicas los
modelos de comunicacin

Comunicacin
verbal

Comunicacin
escrita

Comunicacin
no verbal

Modelos de
comunicacin

Modelos de
comunicacin
masiva

Comunicacin
oral

41
39

loque II

Caracterizas y aplicas los modelos de comunicacin

Aprende ms
Comunicacin verbal
Cuando escuches el concepto comunicacin verbal, debes remitirte siempre al
uso del lenguaje, el cual consiste en un sistema de signos conocidos como letras
\ SDODEUDV TXH WLHQHQ XQ VLJQLFDGR TXH XWLOL]DPRV GH PDQHUD FRWLGLDQD SDUD
LQWHUDFWXDU %DHQD  0RQWHUR   (VWH WLSR GH FRPXQLFDFLyQ VH PDQLHVWD D
WUDYpVGHODHVFULWXUDRELHQPHGLDQWHHOKDEOD\VHFRQRFHQUHVSHFWLYDPHQWH
como comunicacin escrita y comunicacin oral.

Comunicacin escrita
&RPR VX QRPEUH OR LQGLFD HV DTXHOOD TXH VH UHDOL]D D WUDYpV GH OD HVFULWXUD
$QWHULRUPHQWH YLVWH TXH ODV OHWUDV VRQ VLJQRV FRQ XQ VLJQLFDGR HQ SDUWLFXODU
La comunicacin, con la ayuda de signos, pudo haberse manifestado desde los
hombres prehistricos para expresar emociones o describir el mundo que los
rodeaba (Gonzlez, 2008). En este sentido, podemos encontrar representaciones
GHDQLPDOHVJXUDVKXPDQDVKHUUDPLHQWDV\FXDOTXLHURWURHOHPHQWRTXHD\XGDED
al hombre antiguo a comunicar diversos conceptos. Posteriormente, los vestigios
ms antiguos de un alfabeto se encontraron en Egipto, en un lugar llamado Wadi
el-Hol (Valle Terrible), que datan del ao 1600 aC (Clayton, 2015).

Sabas que...
Ls pinturas rupestres ms antiguas que se
conocen se encuentran en una cueva en la isla
de Sulawesi, en Indonesia, que tienen 39 900
aos. La imagen representa a una babirusa,
que era una especie de cerdo primitivo (National
Geographic, 2014).

)RWRJUDItD0D[LPH$XEHUW*ULIWK8QLYHUVLW\$XVWUDOLD

42
40

Caracterizas y aplicas los modelos de comunicacin

Sin importar los avances tecnolgicos que ha desarrollado la humanidad, la escritura


VHKDPDQWHQLGRFRPRHOPHGLRPiVHFD]SDUDGHVDUUROODUFRQVHUYDU\GLIXQGLUHO
FRQRFLPLHQWR /HyQ0HMtD 2UWt]8ULEH 3RUHVWDUD]yQHVQHFHVDULRTXH
desarrolles tus habilidades de expresin escrita, ya que es uno de los puntos ms
importantes de tu formacin escolar y profesional.
6HJ~Q/HyQ0HMtD\2UWt]8ULEH  ORVUHTXLVLWRVGHXQDEXHQDUHGDFFLyQVRQ
los siguientes:
 Claridad: utiliza correctamente las palabras y los signos de puntuacin,
adems de ordenar las ideas que escribes.
 3UHFLVLyQHVWRVLJQLFDTXHGHEHVGHHVFULELU~QLFDPHQWHORTXHGHVHDV
\QRJHQHUDUGXGDVVREUHHOVLJQLFDGRGHORTXHUHGDFWDVWH5HDOL]DXQD
adecuada seleccin de palabras y utiliza sinnimos para no repetirlas en
la misma oracin. Ve directo al punto, por ejemplo, en lugar de redactar
experiencia que no se olvida, mejor escribe experiencia inolvidable. Si
tu escrito es formal, tampoco te extiendas en frases como la no aceptacin
del documento. Escribe en su lugar el rechazo del documento. Esto es
ser preciso.
 6HQFLOOH]KD]XVRGHSDODEUDVFX\RVLJQLFDGRHVWpDODOFDQFHGHOPD\RU
Q~PHURGHSHUVRQDVHYLWDQGRHOXVRGHPDODVSDODEUDVRJURVHUtDV
 2ULJLQDOLGDGXQHVFULWRUHHMDHOFRQRFLPLHQWR\ODFDSDFLGDGH[SUHVLYD
de quien lo elabora. Por ello, es importante que practiques la forma en
que escribes para alcanzar un estilo propio. Apyate en la lectura para
conocer nuevas palabras y utiliza un diccionario. Finalmente, adopta el
hbito de leer siempre lo que acabas de escribir, para detectar palabras
UHSHWLGDVHUURUHVGHUHGDFFLyQRIDOWDVGHRUWRJUDItD

Actividad de aprendizaje 1
Instrucciones: para poner en prctica tus habilidades de escritura, en tu libreta vas
a redactar dos cartas: una para alguien a quien le tengas cario, y otra dirigida a una
persona a la que debes escribirle formalmente, como por ejemplo, al presidente o
jefe de la comunidad en que vives. Considera los requisitos de una buena redaccin
vistos anteriormente. Al terminar, compara tus cartas con uno de tus compaeros y
UHYtVDODVFRQD\XGDGHWXDVHVRU
Guarda el desarrollo y solucin de esta actividad en tu portafolio de evidencias.

43
41

loque II

Caracterizas y aplicas los modelos de comunicacin

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
La escritura es un aspecto sumamente importante en los procesos comunicativos que desarrollan las personas, ya que permiten, por un lado, plasmar
ideas que dejan constancia impresa de los hechos que ocurren a su alrededor,
y por otro, difundir el conocimiento gracias a la lectura que otros hacen de las
ideas previamente escritas. Adems, dependiendo del pblico al que te dirijas,
debes considerar el objetivo que persigues para poder adecuar tus escritos.
Lo mismo se aplica a la comunicacin oral, que es en la que profundizars a
continuacin.

Comunicacin oral
&XDQGR XWLOL]DV OD FRPXQLFDFLyQ RUDO SRQHV HQ MXHJR KDELOLGDGHV ItVLFDV H
LQWHOHFWXDOHVTXHWHSHUPLWHQH[SUHVDVLGHDVDWUDYpVGHOKDEOD(VWRIRUPDSDUWH
de tus capacidades para producir y recibir el lenguaje, es decir, el intercambio del
dilogo con tus semejantes y la comprensin del mismo (lvarez, 2003).
Cuando conversas con alguien, debes considerar ciertos elementos para hacer que
las dems personas te escuchen. Utilizas el mismo volumen en la voz cuando
HVWiVHQXQDFHUHPRQLDUHOLJLRVDTXHFXDQGRHVWiVHQXQDHVWD"3RUVXSXHVWRTXH
no. En esos casos, y dependiendo del lugar y la situacin, disminuyes o incrementas
la intensidad del sonido de tu voz, adems de ajustar otros aspectos, como el tono,
la velocidad y el ritmo (Fonseca, 2005).
Cuidar estos aspectos es muy
importante para mejorar tus
habilidades de comunicacin
oral, ya que esto puede
determinar la efectividad del
mensaje y tu credibilidad ante
las personas (Mehrabian, citado
en Decker, 1992).

44
42

Caracterizas y aplicas los modelos de comunicacin

Actividad de aprendizaje 2
Instrucciones: con ayuda de tu asesor, tu grupo se dividir en equipos. Cada uno
elegir un contenido que todos los integrantes del equipo conozcan. Puede ser la
WUDPDGHXQDSHOtFXODXQFXHQWRDOJXQDKLVWRULDGHWXFRPXQLGDGXQDQRWLFLDLPportante, uno de los temas vistos en tu materia de Historia o algo curioso que haya
sucedido en la escuela ltimamente. Cuiden que cada equipo elija un contenido
distinto para que haya variedad.
Ahora, cada equipo dividir la historia que eligieron para repartirse el contenido de
la misma. Por ejemplo, si eligieron un cuento y son tres integrantes, a uno le tocar
el inicio del relato, a otro el desarrollo de la trama y al tercero el desenlace de la
misma. Una vez que realicen esto, van a exponerle al grupo el contenido elegido,
cuidando los siguientes aspectos:
 'HQLUHOWHPDGHOTXHYDVDKDEODULQGLFDEUHYHPHQWHHOFRQWHQLGRGHWX
exposicin antes de iniciarla, y cul es el objetivo principal.
 Estructura tus mensajes: piensa antes de hablar. Procura que las frases
que pronuncies sean ordenadas y coherentes.
 (QIDWL]DODVSDUWHVLPSRUWDQWHVGHWXUHODWRKDFHUpQIDVLVVLJQLFDDXmentar la intensidad de tu voz en los puntos que consideres ms relevantes o interesantes de la parte que te toc contar.
 Utiliza un lenguaje claro, limpio y concreto: no le des muchas vueltas a
tu relato. Cuida tu forma de hablar y evita utilizar palabras altisonantes o
demasiado informales.
Cuando termines de exponer con tu equipo, evala tu trabajo con el siguiente instrumento:

Excelente
(2 puntos)

Criterios

Bien
(1 punto)

Regular
(0.5 puntos)

Necesita
acompaamiento
(0 puntos)

Total

'HQHVHOWHPDGHOTXH
vas a hablar.
Estructuras
mensajes.

tus

Enfatizas las partes importantes de tu relato.


Utilizas un lenguaje
claro, limpio y concreto.
Trabajaste activa y respetuosamente con tu
equipo.
&DOLFDFLyQ

45
43

loque II

Caracterizas y aplicas los modelos de comunicacin

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Cuando expones algo ante un grupo de personas, o incluso cuando platicas
con tus amigos, ests aplicando la comunicacin oral, por lo que es importante
elegir las palabras adecuadas y estructurar el mensaje de tal forma que quien
te escuche comprenda la informacin que quieres transmitirle.
$GHPiVVHJXUDPHQWHDOH[SRQHUQRWHPDQWHQtDVLQPyYLOVLQRTXHDFRPSDaste tu discurso con movimientos de manos, gestos y posturas que complementaban la informacin de lo que le estabas platicando a tus compaeros.
Este complemento se denomina comunicacin no verbal, y es muy importante
TXHFRQR]FDVVXVFDUDFWHUtVWLFDV\DTXHWHD\XGDUiPXFKRDPHMRUDUWXVKDbilidades comunicativas.

Aprende ms
Comunicacin no verbal
Has estado con una persona que te dice que se siente bien, pero algo te dice que no
HVYHUGDG"3XHGHVHUTXHVXPLUDGDUHHMHWULVWH]DRWHQJDXQDSRVWXUDHQFRUYDGD
\ORVKRPEURVFDtGRVHQQSUiFWLFDPHQWHWRGRVXFXHUSRHVWiH[SUHVDQGRDOJR
que contradice la informacin que esa persona te acaba de decir.
Tus movimientos, gestos y posturas son
herramientas muy tiles para generar
comunicacin. stas son empleadas de manera
consciente e inconsciente, dependiendo de la
situacin en la que nos encontremos. Conocer
VXLQXHQFLDHVEiVLFRSRUGRVUD]RQHVSULPHUR
si eres capaz de leer el lenguaje no verbal de
otra persona, podrs saber lo que siente, piensa
\SRUTXpUHDFFLRQDGHGHWHUPLQDGDPDQHUD\
segundo, si controlas tu comunicacin no verbal
conscientemente, podrs utilizarla mejor, lo que
te ayudar a persuadir a la gente para divulgar
tus ideas y generar una mejor percepcin hacia
tu persona (Bar, 2012).

46
44

Caracterizas y aplicas los modelos de comunicacin

Actividad de aprendizaje 3
,QVWUXFFLRQHVUH~QHWHFRQXQFRPSDxHURGHFODVH\VLpQWHQVHXQRIUHQWHDORWUR
3tGHOHTXHWHFXHQWHVREUHXQDSHUVRQDTXHOHKD\DHQVHxDGRDOJRLPSRUWDQWHHQ
su vida. Puede ser un familiar, algn amigo, uno de sus profesores, el entrenador
deportivo, entre otras. Utiliza las siguientes preguntas para que puedas guiar la
conversacin:
 4XLpQHV\TXpHQVHxDQ]DLPSRUWDQWHWHGHMyODSHUVRQDTXHHOHJLVWH"
 Has intentado transmitir lo que te ense a alguien ms? Y si no lo has
intentado, cul es la razn?
 4XpOHGLUtDVDODSHUVRQDTXHWHGHMyHVDHQVHxDQ]DLPSRUWDQWH"
 Adems de esto, cul de tus habilidades, gustos o conocimientos te
JXVWDUtDFRPSDUWLUFRQDOJXLHQPiV"
Ahora pon atencin a los aspectos que incluye la siguiente tabla. Mientras tu compaero te dice sus respuestas, vas a observar su expresin facial y corporal, elementos indispensables de la comunicacin no verbal. Registra tus observaciones
en el espacio correspondiente.
Comunicacin no verbal

Aspectos a considerar

Expresin facial (mirada):

Te mira directamente cuando responde las preguntas?


Hacia dnde mira con mayor
IUHFXHQFLDDOKDEODU"4Xp
HPRFLRQHVUHHMDQVXVRMRV"

Expresin facial (gestos):

Hace muecas? Alza las


FHMDV"6RQUtH"%iVLFDPHQWH
pon atencin a todo movimiento
en su rostro.

Expresin corporal
(ademanes):

Mueve mucho las manos?


Cruza los brazos? Se toca la
cara o juega con su cabello?

Expresin corporal
(postura):

Se sienta derecho? Est inclinado hacia adelante? Cruza


las piernas? Observa cualquier
movimiento que haga con su
cuerpo.

Observaciones

Este ejercicio requiere de mucha atencin de tu parte, ya que debers recordar los
SXQWRVLPSRUWDQWHVGHODLQIRUPDFLyQTXHWHSURSRUFLRQDWXFRPSDxHURDVtFRPR
detectar todos los elementos relacionados con la comunicacin no verbal. CuanGRWHUPLQHVLQWHUFDPELDUROHVFRQWXFRPSDxHUR$KRUDpOWHREVHUYDUiPLHQWUDV
UHVSRQGHVODVSUHJXQWDVTXHWHKDJD$OQDOFRPSDUWDQVXVREVHUYDFLRQHVFRQHO
resto del grupo.

47
45

loque II

Caracterizas y aplicas los modelos de comunicacin

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
La mirada, los gestos, los ademanes y la postura complementan el mensaje
que el emisor transmite al receptor cuando se realiza el proceso comunicativo.
7HIXHIiFLOUHJLVWUDUORTXHGHFtDWXFRPSDxHUR\SRQHUDWHQFLyQDVXVPRYLmientos? Ms all de esto, es importante que practiques tu habilidad para analizar la expresin facial y corporal de la persona con quien hablas y controlar lo
que expresas a los dems con la ayuda de la comunicacin no verbal.

Aprende ms
Modelos de comunicacin
&XDQGRGHQLVWHODFRPXQLFDFLyQHQHOEORTXH,WRPDVWHFRPREDVHODSUHJXQWD
formulada por Aristteles quin dice qu a quin? Esta cuestin representa un
modelo comunicativo que busca sealar cada uno de los elementos que componen
un proceso que no slo transmite informacin, sino que hace que esos elementos
LQWHUDFW~HQHQWUHVt
$GHPiV GHO HVTXHPD EiVLFR SODQWHDGR SRU HO OyVRIR JULHJR HPLVRUPHQVDMH
receptor), existen otros tericos que, con el paso del tiempo, han considerado los
IDFWRUHVPHGLRVHIHFWRVHLQXHQFLDVTXHURGHDQDODFWRGHWUDQVPLWLUXQPHQVDMH
haciendo que la comunicacin deje de ser algo meramente prctico para convertirse
en un objeto de estudio.
En la siguiente tabla encontrars algunos modelos que se utilizan para analizar el
SURFHVRFRPXQLFDWLYRDVtFRPRLQIRUPDFLyQUHOHYDQWHSDUDIDFLOLWDUODFRPSUHQVLyQ
de cada uno de ellos.

48
46

Caracterizas y aplicas los modelos de comunicacin

Modelo de Aristteles:
6HUHSURGXFHHOHVTXHPDTXH\DFRQRFHVFRQHOQGHTXHWHQJDVDODPDQRWRGRVORV
HVTXHPDVGHODFRPXQLFDFLyQ1RROYLGHVTXHVHEDVDHQODSUHJXQWDTXLpQGLFHTXp
DTXLpQ"

dice







Modelo de Lasswell:
El esquema de Harold Dwight Lasswell (1902-1978) complementa el elaborado por Aristteles. Se agregan dos aspectos muy importantes en el proceso comunicativo: el canal
y el efecto del mensaje.
en
qu

dice

Canal

con
qu

  

 

  




Modelo de Lasswell y Nixon:


Se introducen dos elementos, complementando el desarrollado por Lasswell: las intenFLRQHVGHTXLHQJHQHUDHOPHQVDMH\ODVFRQGLFLRQHVHQTXHpVWHOOHJDDOUHFHSWRU
a

dice









   








 

   

 

Modelo de Shannon y Weaver:


'HELGRDOXVRPDVLYRGHQXHYDVYtDVGHFRPXQLFDFLyQFRPRHOWHOpIRQR\ODFRPXQLFDFLyQDWUDYpVGHODUDGLR6KDQQRQ\:HDYHUDJUHJDQHOWUDQVPLVRUDVXHVTXHPDOD
VHxDORLPSXOVRTXHHVDFRPSDxDGRSRUHOUXLGR\ODOOHJDGDDOUHFHSWRUTXLHQGHFRGLFD
el mensaje.
Mensaje

 

 
 

Seal emitida

 
 

Seal recibida


 

 

49
47

loque II

Caracterizas y aplicas los modelos de comunicacin

Modelo de Schramm:
6FKDUDPPUHYROXFLRQDODSHUFHSFLyQTXHVHWLHQHGHOSURFHVRFRPXQLFDWLYRDUPDQGR
TXHpVWHQRHVOLQHDO(QVXPRGHORHVSRVLEOHYHUTXHWRGRVORVHOHPHQWRVVHFRQHFWDQ
en donde el mensaje es el elemento en comn, adems de tomar en cuenta las experiencias del emisor y el receptor.

 



 




 



 

 









Primer modelo de Berlo:


David K. Berlo optimiza el proceso de comunicacin al colocar en forma independiente
HOFRGLFDGRU\HOGHFRGLFDGRUVHxDODQGRTXHHOFRGLFDGRUVHHQFDUJDGHDGHFXDUHO
PHQVDMH\HOGHFRGLFDGRUGHKDFHUOROOHJDUFRQVXGLPHQVLyQRULJLQDODOUHFHSWRU





  








  





Segundo modelo de Berlo:


Con este modelo, Berlo enumera los factores de la comunicacin humana en cada etapa
GHOSURFHVR$TXtSXHGHVYHUHVSHFLFDGRVORVTXHLQWHUYLHQHQHQODIXHQWHHQHOPHQsaje, en el canal y en el receptor.

  
  
  
!
 
 
    



   



  



 

 


 
 

  
  
  
!
 
 
    

Modelos de comunicacin
Fuente: Gonzlez Alonso, C. (2008) Principios
EiVLFRVGH&RPXQLFDFLyQ0p[LFR7ULOODV

50
48

Caracterizas y aplicas los modelos de comunicacin

Actividad de aprendizaje 4
Instrucciones: Ahora que conoces algunos de los modelos de comunicacin, vas a
UHH[LRQDUDFHUFDGHODVFDUDFWHUtVWLFDVTXHREVHUYDVWHHQFDGDXQRGHHOORV3DUD
HVRYDVDFRQWHVWDUODVVLJXLHQWHVSUHJXQWDV$OWHUPLQDUUHYLVDWXVUHVSXHVWDVFRQ
WXSURIHVRU
&XiOHVVRQORVHOHPHQWRVTXHDSDUHFHQHQWRGRVORVPRGHORV"
__________________________________________________________________
__________________________________________________________________
&XiOHVVRQORVHOHPHQWRVPHQRVFRPXQHVHQORVPRGHORV"
__________________________________________________________________
__________________________________________________________________
 &yPR FUHHV TXH WH D\XGDQ pVWRV PRGHORV SDUD H[SOLFDU OD IRUPD HQ TXH ODV
SHUVRQDVVHFRPXQLFDQ"
__________________________________________________________________
__________________________________________________________________
__________________________________________________________________
&RQVLGHUDVTXHpVWRVPRGHORVSXHGHQDSOLFDUVHDVLWXDFLRQHVGHWXYLGDFRWLGLDQDHQWXFRPXQLGDG"&yPRFXiOHV"
__________________________________________________________________
__________________________________________________________________
__________________________________________________________________
__________________________________________________________________
*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

5HH[LRQHPRVVREUHODDFWLYLGDG

'HTXpWHGDVFXHQWD"
7RGRVORVPRGHORVGHFRPXQLFDFLyQFXHQWDQFRQHOHPHQWRVVLPLODUHVVLQHPEDUJRFDGDXQRIXHGHVDUUROODGRFRQHOQGHFXEULUGLYHUVRVDVSHFWRVTXH
LQYROXFUDQHOSURFHVRGHODFRPXQLFDFLyQKXPDQD(QODVLJXLHQWHDFWLYLGDG
SRQGUiVHQSUiFWLFDORDQDOL]DGRFRQHMHPSORVTXHYHVFRWLGLDQDPHQWHHQOD
FRPXQLGDGHQTXHYLYHV

51
49

loque II

Caracterizas y aplicas los modelos de comunicacin

Actividad de aprendizaje 5
&RQD\XGDGHWXDVHVRUWXJUXSRVHGLYLGLUiHQVHLVHTXLSRVGHWUDEDMR&DGDHTXLSRGHEHUiSUHSDUDUXQDH[SRVLFLyQVREUHDOJXQRGHORVPRGHORVTXHDSDUHFHQHQ
ODWDEODDQWHULRUH[FHSWXDQGRHOGH$ULVWyWHOHV(ODVHVRUDVLJQDUiHOPRGHORTXHOH
WRFDDFDGDHTXLSR
$KRUDW~\WXHTXLSRHOHJLUiQFLQFRVLWXDFLRQHVGHVXYLGDGLDULDHQODVTXHDSOLFDUiQHOPRGHORTXHOHVWRFy3DUDHOORWHQGUiQTXHDQDOL]DUFXLGDGRVDPHQWHFDGD
HOHPHQWRTXHORFRQIRUPDFRQODQDOLGDGGHTXHVXWUDEDMRHVWpFRPSOHWR5HFXHUGDVHOUHODWRYLVWRHQHOEORTXH,HQGRQGHLPDJLQDVTXHYDVSRUODFDOOH\WH
HQFXHQWUDVDXQSHUURDJUHVLYRTXHWHLPSLGHHOSDVR"(QHVHHMHUFLFLRVHWRPyXQD
VLWXDFLyQGHODYLGDGLDULD\VHDQDOL]DURQFRQHOODWRGRVORVHOHPHQWRVGHOSURFHVR
FRPXQLFDWLYR(VRHVORTXHWLHQHVTXHKDFHUHQHVWDDFWLYLGDG6yORTXHDKRUD
DQDOL]DUiVRWURSURFHVRTXHHVXQPRGHORGHFRPXQLFDFLyQ
3DUDH[SRQHUWXWUDEDMRHVQHFHVDULRTXHXWLOLFHVPDWHULDOGHDSR\RHOFXDOGHEHUi
VHUSUHSDUDGRDQWHVGHODSUHVHQWDFLyQ3XHGHVXVDUGLEXMRVUHFRUWHVIRWRJUDItDV
RFXDOTXLHUPDWHULDOTXHWHVLUYDSDUDUHSUHVHQWDUHOPRGHORTXHWHDVLJQDURQ\H[SRQHUORVFLQFRFDVRVGHODYLGDGLDULD(VWDSDUWHGHWXWUDEDMRVHUiHYDOXDGDFRQ
HOVLJXLHQWHLQVWUXPHQWR

Criterios

Muy bien
(2 puntos)

Regular
(1 punto)

Necesita
acompaamiento
(0 puntos)

([SOLFDFDGDHOHPHQWRGHOPRGHORGH
FRPXQLFDFLyQTXHOHIXHDVLJQDGR
3UHVHQWDVLWXDFLRQHVGHODYLGDGLDria relacionadas con el modelo asigQDGR
8WLOL]DPDWHULDOGHDSR\R GLEXMRVHVTXHPDVLPiJHQHV 
5HHMD FUHDWLYLGDG HQ HO GLVHxR GHO
PDWHULDOGHDSR\R
3UHVHQWDOLPSLR\HQRUGHQHOPDWHULDO
GHDSR\R
7RWDO

52
50

Total

Caracterizas y aplicas los modelos de comunicacin

$QWHVGHODSUHVHQWDFLyQUHFXHUGDTXHHQHVWHEORTXHDERUGDVWHODFRPXQLFDFLyQ
QR YHUEDO 5HWRPD DOJXQRV DVSHFWRV GHO HMHUFLFLR TXH KLFLVWH FRQ WX FRPSDxHUR
VREUHH[SUHVLyQIDFLDO\FRUSRUDO\DSOtFDORVHQWXH[SRVLFLyQ3URFXUDDGRSWDUXQD
SRVWXUDDGHFXDGDQRMXHJXHVPXFKRFRQWXVPDQRV\REVHUYDGLUHFWDPHQWHDWX
S~EOLFR6LpQWHWHVHJXURGHWXWUDEDMR\UHpMDORDOPRPHQWRGHWXH[SRVLFLyQFRQXQ
WRQRGHYR]DGHFXDGR2EVHUYDODVLJXLHQWHU~EULFDODFXDOWHD\XGDUiDGHOLPLWDU
DTXHOORVSXQWRVHQORVTXHQHFHVLWDVPHMRUDU

Criterios

Muy bien
(2 puntos)

Regular
(1 punto)

([SUHVDFRQFOD2FDVLRQDOPHQWH
ULGDG\XLGH]ODV
es claro en sus
'RPLQDHOWHPD
LGHDV\GHWDOOHVGHO
LGHDV\GHWDOOHV
TXHH[SRQH
WHPD
$FW~DFRQVHJXUL6HJXULGDGHQOD GDGHQODH[SRVLH[SRVLFLyQGH FLyQGHVXWUDEDMR
VXWUDEDMR

9RFDEXODULR

7UDEDMRHQ
HTXLSR

6HFRRUGLQDFRQ
VXHTXLSR6HQRWD
TXHVHSURJUDPDURQWXUQRVGH
H[SRVLFLyQ

Puntos

1RVLHPSUHDFW~D 1RH[SRQHFRQVHcon seguridad en


JXULGDGHOWUDEDMR
ODH[SRVLFLyQGHVX UHDOL]DGR
WUDEDMR

(VFDSD]GHXWLOL8WLOL]DYRFDEXOD]DUXQYRFDEXODULR ULROLPLWDGRSHUR
DPSOLR\VLQUHSHWLU DFHSWDEOH
SDODEUDV

Da a conocer su
RSLQLyQSHUVRQDO
FRQUHVSHFWRDO
$UJXPHQWDFLyQ WHPDUHVSDOGDGR
HQHODQiOLVLVUHDOL]DGR

Necesita acompaamiento
(0 puntos)
1RGHPXHVWUDFODULGDGQLFRQVLVWHQcia en sus ideas

8WLOL]DXQYRFDEXODULROLPLWDGR\
UHSLWHSDODEUDV

Da a conocer su
RSLQLyQHQIRUPDSRFRFODUD\
ODPD\RUtDGHOD
LQIRUPDFLyQHVGHO
DXWRU

No da a conocer
VXRSLQLyQSHUVRQDO6HDSR\DDO
HQRSLQLRQHV
GHDXWRUHVXRWUDV
SHUVRQDV

6HSRQHGHDFXHUGRHQHOPRPHQWR
1RSURJUDPDURQ
WXUQRVDXQTXHVH
QRWDFLHUWDFRRUGLQDFLyQ

1RVHSXVRGH
acuerdo con su
HTXLSRVHSLHUGH
HOWLHPSRSDUDLQLFLDUODH[SRVLFLyQ
\QRKD\WXUQR
GHSDUWLFLSDFLyQ
GHQLGR
&DOLFDFLyQ

*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

53
51

loque II

Caracterizas y aplicas los modelos de comunicacin

5HH[LRQHPRVVREUHODDFWLYLGDG

'HTXpWHGDVFXHQWD"
7UDVODGDUORVPRGHORVGHFRPXQLFDFLyQYLVWRVDODYLGDFRWLGLDQDHVXQDPDQHUDHIHFWLYDSDUDTXHWHIDPLOLDULFHVFRQVXXVR\VREUHWRGRFRQORVHOHPHQWRVTXHORFRQIRUPDQ'HLJXDOPDQHUDFRPELQDUHVWDH[SHULHQFLDFRQOR
TXHVDEHVGHODFRPXQLFDFLyQQRYHUEDOWHSHUPLWHIRUWDOHFHUWXVKDELOLGDGHV
GHH[SUHVLyQ\ODIRUPDHQTXHWUDQVPLWHVXQPHQVDMH7HGLVWHFXHQWDTXH
QR VyOR HVWDEDV IUHQWH D XQ LQGLYLGXR VLQR TXH WH GLULJtDV D XQ FRQMXQWR GH
SHUVRQDV"$KRUDHVLPSRUWDQWHTXHUHH[LRQHVHQHOKHFKRGHTXHHOPLVPR
PRGHORGHFRPXQLFDFLyQSXHGHVHUDQDOL]DGRDJUDQHVFDODLQYROXFUDQGRDXQ
S~EOLFRTXHUHFLEHPDVLYDPHQWHFXDOTXLHUPHQVDMH\SXHGHVHULQXHQFLDGR
DWUDYpVGHpO

$SUHQGHPiV
0RGHORVGHFRPXQLFDFLyQPDVLYD
$OJXQDYH]KDVDFXGLGRDXQFRQFLHUWR"(QJHQHUDOFXDQGRHODUWLVWDRJUXSR
UHDOL]D XQD SUHVHQWDFLyQ SURFXUD UHYLVDU TXH WRGR HO S~EOLFR SXHGD HVFXFKDUOR
FODUDPHQWH6LQLPSRUWDUHOJpQHURGHWXSUHIHUHQFLDODPD\RUtDGHODVFDQFLRQHV
OOHYDQXQPHQVDMHTXHSRUVXQDWXUDOH]DHVFDSD]GHOOHJDUDPXFKDVSHUVRQDV
3DUD HVWR GHEHQ DSR\DUVH HQ GLVWLQWRV PHGLRV TXH OHV SHUPLWDQ OOHJDU D XQ
PD\RU Q~PHUR GH R\HQWHV GHVGH ORV PLFUyIRQRV \ DPSOLFDGRUHV TXH XWLOL]D
HQHOHVFHQDULRKDVWDODJUDEDFLyQGHVXVPHORGtDVHQXQUHSURGXFWRUPXVLFDO
ODV GLYHUVDV IRUPDV HQ TXH VH WUDQVPLWH HO DXGLR WLHQHQ TXH YHU FRQ PRGHORV
FRPXQLFDWLYRV GLULJLGRV D ODV PDVDV \ TXH QDWXUDOPHQWH EXVFDQ JHQHUDU XQ
HIHFWRHQHOODV
&XDQGR HVFXFKHV VREUH FRPXQLFDFLyQ GH PDVDV UHFXHUGD TXH VH UHHUH D la
comunicacin que busca llegar un gran nmero de personas (VWR LQYROXFUD HO
HVWXGLR GH ORV GLYHUVRV PHGLRV FRPXQLFDWLYRV LQFOX\HQGR ORV PHQVDMHV TXH
JHQHUDQODVDXGLHQFLDVTXHEXVFDQDOFDQ]DU\FyPRHVWDLQIRUPDFLyQODVDIHFWD
7DQ   &RPR SXHGHV YHU HVWH FRQFHSWR VH UHODFLRQD FRQ ORV DYDQFHV
WHFQROyJLFRV TXH SHUPLWHQ OD WUDQVPLVLyQ GH PHQVDMHV D JUDQ HVFDOD FRPR OD

54
52

Caracterizas y aplicas los modelos de comunicacin

UDGLRODSUHQVDODWHOHYLVLyQ\,QWHUQHWTXHHYROXFLRQDQGHPDQHUDDFHOHUDGD
SRUORTXHHQHVWHDSDUWDGRVHDQDOL]DUiQDOJXQRVPRGHORVTXHWRPDQHQFXHQWD
HVWDVWHFQRORJtDVSDUDJHQHUDUODFRPXQLFDFLyQ

0RGHORGHODWXEDGH6FKUDPP
8QRGHORVPRGHORVSDUDDQDOL]DUODFRPXQLFDFLyQPDVLYDHVHOGH:LOEXU6FKUDPP
TXHVHPXHVWUDHQHOVLJXLHQWHHVTXHPD

! "

   &



 


 
&
  
&

 


   


   
  
 


   
  ( 
 

)#     
 
  

       & &  '

7XEDGH6FKUDPP
)XHQWH0DUWtQH]9i]TXH]
)  &LHQFLDVGHOD
FRPXQLFDFLyQ,0p[LFR
6DQWLOODQD

 6DEtDVTXH
:LOEXU / 6FKUDPP VH LQWHUHVy SRU
ORV HIHFWRV GH OD FRPXQLFDFLyQ HQ ODV
SHUVRQDVHVSHFLDOPHQWHGHODLQXHQFLD
GH OD WHOHYLVLyQ HQ OD HGXFDFLyQ \
la creencia de que los medios de
FRPXQLFDFLyQGHEtDQVHUUHVSRQVDEOHV
GHODVSHUVRQDVDODVTXHKDFHQOOHJDU
VXVPHQVDMHV *RQ]iOH]$ORQVR 
(O PRGHOR GH OD WXED GH 6FKUDPP VH OODPD DVt SRU VX VHPHMDQ]D FRQ HO
LQVWUXPHQWRPXVLFDOGHOPLVPRQRPEUHDGHPiVGHODDFLyQTXHWHQtDHODXWRU
SRUORVLQVWUXPHQWRVGHYLHQWR

55
53

loque II

Caracterizas y aplicas los modelos de comunicacin

(VWHPRGHORH[SOLFDFyPRXQPHGLRPDVLYRGHFRPXQLFDFLyQLQX\HHQHOS~EOLFR
6L WH MDV TXLHQ JHQHUD HO PHQVDMH REWLHQH OD LQIRUPDFLyQ SRU GLYHUVDV IXHQWHV
GHVSXpV OD GHFRGLFD OD LQWHUSUHWD \ OD FRGLFD SDUD HQYLDUOD DO S~EOLFR PDVLYR
eVWHVHFRPSRQHSRUJUXSRVHQORVFXDOHVKD\XQRRYDULRVOtGHUHVGHRSLQLyQ$VX
YH]pVWRVUHDOL]DQHOPLVPRSURFHGLPLHQWRTXHKL]RODSDUWHTXHRULJLQyHOPHQVDMH
\ORYDORUDQWRPDQGRFRPRUHIHUHQFLDVXFRQWH[WR$TXtHVGRQGHSRUHMHPSORWX
IDPLOLDFRPSDxHURVGHHVFXHODYHFLQRVRDOJXQDSHUVRQDFX\DRSLQLyQUHVSHWDV
VH FRQYLHUWHQ HQ IDFWRUHV GHWHUPLQDQWHV SDUD TXH LQWHUSUHWHV OD LQIRUPDFLyQ GH
GHWHUPLQDGDPDQHUD

0RGHORGH0F/XKDQ
(O WUDEDMR GH 0DUVKDOO 0F/XKDQ IXH LQXHQFLDGR
SRU WUHV VLWXDFLRQHV GH VX WLHPSR HO DXJH GH
OD WHOHYLVLyQ OD LQWHJUDFLyQ HQWUH OR YLVXDO \ OR
HOHFWUyQLFR DVt FRPR ORV RUtJHQHV GH ,QWHUQHW D
WUDYpVGHOSUR\HFWR$53$1(7 Advanced Projects
Agency Network) 0DUWtQH] (VWRLQGLFDTXH
HOPXQGRHVWDEDFRPHQ]DQGRDOOHYDUORVVXFHVRV
ORFDOHVDXQDHVFDODJOREDOKDFLHQGRODVGLVWDQFLDV
PiVFRUWDVJUDFLDVDORVDYDQFHVWHFQROyJLFRVOR
TXHSURSLFLyTXHODFRPXQLFDFLyQHYROXFLRQDUD
8QR GH VXV SRVWXODGRV PiV WUDVFHQGHQWHV IXH
FRQVLGHUDUTXHHOPHGLRHVHOPHQVDMHLQGLFDQGR
TXH HO PHQVDMH \D QR SXHGH VHU FRQVLGHUDGR
~QLFDPHQWH FRPR LQIRUPDFLyQ VLQR TXH ODV
QXHYDVWHFQRORJtDVKDQJHQHUDGRTXHORVPHGLRV
HOHFWUyQLFRV VH FRQYLHUWDQ HQ H[WHQVLRQHV GH
QRVRWURV LQX\HQGR HQ OD IRUPD HQ TXH QRV
UHODFLRQDPRV ,VODV 

0DUVKDOO0F/XKDQ

6HJ~Q0DF/XKDQWRGRPHGLRWHFQROyJLFRHVXQDSURORQJDFLyQGHDOJXQDIDFXOWDG
KXPDQD VHD ItVLFD R SVtTXLFD VLQ HPEDUJR RFDVLRQD TXH XQ VHQWLGR UHGX]FD
VX FDSDFLGDG \ GHVDUUROOD PiV D RWUR GHSHQGLHQGR GHO TXH VH LGHQWLTXH FRQ OD
WHFQRORJtDXWLOL]DGD 0DUWtQH] 8QHMHPSORHVTXHYHUODWHOHYLVLyQGHVDUUROOD
QXHVWUDFDSDFLGDGGHODYLVWDSHURDOPLVPRWLHPSRVHXVDQPHQRVRWURVVHQWLGRV
FRPRHOWDFWRRHOROIDWR
(QHOVLJXLHQWHHVTXHPDSRGUiVYHUORTXHVHGHQRPLQDFRPRleyes de los medios,
TXHFRQVLVWHQHQFXDWURSURFHVRVVLPXOWiQHRVHQHOLQGLYLGXR\HQODVRFLHGDG

56
54

Caracterizas y aplicas los modelos de comunicacin

Extensin
Qu aumenta?
La tecnologa amplifica algn rgano o
facultad.

Caducidad
Qu disminuye?
Cuando un rgano o facultad se ampla,
otro disminuye.

Efectos de la tecnologa
y los artefactos en el
hombre

Recuperacin
Qu recupera?
Los medios recuperan lo obsoleto.

Reversin
Cmo cambian sus efectos originales?
Las formas, cuando llegan al lmite de su
potencial, invierten sus caractersticas y
se transforman en algo nuevo.


/H\HVGHORVPHGLRV(OHPHQWRVGHOPRGHORGH0F/XKDQ
)XHQWH0DUWtQH]9i]TXH])  Ciencias de la comunicacin I.0p[LFR6DQWLOODQD

3DUDFRPSUHQGHUPHMRUORVSRVWXODGRVGH0F/XKDQWRPDFRPRUHIHUHQFLDHOXVR
GHORVWHOpIRQRVFHOXODUHV&XDQGRVHXWLOL]DEDQ~QLFDPHQWHWHOpIRQRVMRVGHEtDV
HVSHUDUDTXHODSHUVRQDHVWXYLHUDHQVXKRJDUSDUDSRGHUFRPXQLFDUWHFRQHOOD
+R\HQGtDJUDFLDVDODWHOHIRQtDPyYLOSXHGHVOODPDUDDOJXLHQVLQLPSRUWDUVLVH
HQFXHQWUDHQODFDOOHHQODHVFXHODGHYLDMHRHQFXDOTXLHURWUROXJDU,QFOXVRSXHGHV
HQYLDUOHXQPHQVDMHHVFULWR\DVHDDWUDYpVGHOVHUYLFLRTXHSURYHHODFRPSDxtD
WHOHIyQLFDRSRU,QWHUQHWVLFXHQWDVFRQXQWHOpIRQRLQWHOLJHQWHRsmartphone(VWR
D\XGDDTXHQXHVWUDFRPXQLFDFLyQVHDLQPHGLDWDSHURWDPELpQKDRFDVLRQDGRTXH
HO WHOpIRQR FHOXODU GHMH GH VHU XQD KHUUDPLHQWD FRPXQLFDWLYD SDUD FRQYHUWLUVH HQ
XQDQHFHVLGDGGHQXHVWURVWLHPSRVFRPRSRGUiVREVHUYDUHQHOVLJXLHQWHHMHPSOR
TXHWRPDFRPREDVHHOPRGHORGH0F/XKDQ
Extensin
Qu aumenta?
/DIDFXOWDGTXHDPSOLILFDHVODSRVLELOLGDGGH
FRPXQLFDUQRVHQFXDOTXLHUPRPHQWRORTXH
KDJHQHUDGRXQDGHSHQGHQFLDKDFLDHO
WHOpIRQRPyYLO

Caducidad
Qu disminuye?
/DIDFXOWDGTXHGLVPLQX\HHVODGLVSRVLFLyQ
GHODVSHUVRQDVGHFDUHFHUGHXQGLVSRVLWLYR
GHWHOHIRQtDPyYLO

(IHFWRVGHODWHFQRORJtD\
ORVDUWHIDFWRVHQHOKRPEUH
Recuperacin
Qu recupera?
5HFXSHUDHOFRQWDFWRIUHFXHQWHHQWUHODV
SHUVRQDVTXHDXQTXHQRHVItVLFRVH
JHQHUDDWUDYpVGHODFRPXQLFDFLyQTXH
SURYHHODWHOHIRQtDPyYLO

Reversin
Cmo cambian sus efectos originales?
(OSURSyVLWRSULQFLSDOHUDIDYRUHFHUOD
FRPXQLFDFLyQ$KRUDHOWHOpIRQRFHOXODU
WDPELpQHVXQVtPERORGHSRGHUHFRQyPLFR
GHSHQGLHQGRGHOPRGHORTXHVHXWLOLFH

57
55

loque II

Caracterizas y aplicas los modelos de comunicacin

Actividad de aprendizaje 6
(OLJHXQRGHORVVLJXLHQWHVPHGLRVGHFRPXQLFDFLyQPDVLYRV

Televisin

5DGLR

3UHQVD
SHULyGLFRVUHYLVWDV
KLVWRULHWDVFDUWHOHV

,QWHUQHW

&RSLDHQWXOLEUHWDHOPRGHORGHODWXEDGH6FKUDPP\HOGH0F/XKDQ\VXVWLWX\H
VXVHOHPHQWRVFRQLQIRUPDFLyQTXHKD\DVREVHUYDGRHQHOPHGLRGHFRPXQLFDFLyQ
PDVLYRTXHHOHJLVWH\TXHVHXWLOL]DPiVHQWXFRPXQLGDG*XtDWHFRQORVHMHPSORV
TXHYLVWHHQFDGDXQRGHORVDSDUWDGRV&XDQGRWHUPLQHVHYDO~DWXWUDEDMRFRQHO
VLJXLHQWHLQVWUXPHQWR

Criterios

Excelente
(2 puntos)

Bien
(1 punto)

Regular
(0.5 puntos)

Necesita
acompaamiento
(0 puntos)

Total

$ERUGD HO WHPD WRPDQGR HQ FXHQWD OD


LQIRUPDFLyQ SUHVHQWH
HQHOOLEUR\HOPHGLR
PDVLYRHOHJLGR
([LVWH XQ GHVDUUROOR
OyJLFRGHLGHDV
(O GLVHxR GH ORV HVquemas es cuidadoVR \ UHHMD HPSHxR
SRUSDUWHGHODOXPQR
/DRUWRJUDItD\UHGDFFLyQVRQFXLGDGRVDV
(OWUDEDMRVHHQWUHJD
OLPSLR\HQRUGHQ
&DOLFDFLyQ

*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

58
56

Caracterizas y aplicas los modelos de comunicacin

&LHUUHGHOEORTXH,,
5HH[LRQDVREUHORDSUHQGLGR
/D FRPXQLFDFLyQ YHUEDO VH UHHUH DO XVR TXH OH GDV DO OHQJXDMH SDUD WUDQVPLWLU
LQIRUPDFLyQ*UDFLDVDOFRQMXQWRGHVLJQRVTXHORFRQIRUPDQSXHGHVHVFULELU\KDEODU
SDUDGDUWHDHQWHQGHUORTXHVHFRQRFHFRPRFRPXQLFDFLyQHVFULWD\FRPXQLFDFLyQ
RUDOUHVSHFWLYDPHQWH
$OKDEODUHQWUDQHQMXHJRKDELOLGDGHVTXHWLHQHQTXHYHUFRQHOYROXPHQGHYR]
HOWRQRODYHORFLGDG\HOULWPR$GHPiVODFRPXQLFDFLyQQRYHUEDOFRPSOHPHQWD
HODFWRGHOKDEODDOLQYROXFUDUHOXVRGHOFXHUSRSDUDWUDQVPLWLULQIRUPDFLyQFRQOR
UHIHUHQWHDODH[SUHVLyQIDFLDODGHPiVGHORVDGHPDQHV\ODSRVWXUDTXHDGRSWDHO
HPLVRU
)LQDOPHQWH ORV GLVWLQWRV PRGHORV FRPXQLFDWLYRV SHUPLWHQ TXH FRPSUHQGDV HO
GHVDUUROOR GH OD FRPXQLFDFLyQ JUDFLDV DO WUDEDMR GH HVWXGLRVRV FRPR$ULVWyWHOHV
/DVVZHOO1L[RQ6KDQQRQ\:HDYHUDGHPiVGH%HUOR<HQFXDQWRDORVPRGHORV
GHFRPXQLFDFLyQPDVLYDORVDSRUWHVGH6FKUDPP\0F/XKDQWHD\XGDQDHQWHQGHU
ODIRUPDHQTXHORVPHGLRVLQX\HQHQHOS~EOLFR\ODLPSRUWDQFLDTXHKDQDGTXLULGR
HQODKLVWRULDFRQWHPSRUiQHD
3DUDHVWHFLHUUHYDVDGLVHxDUXQPHGLRPDVLYRGHFRPXQLFDFLyQHQODIRUPDGH
XQ FDUWHO WDPDxR GREOH FDUWD (Q pO DSOLFDUiV OR HVWXGLDGR HQ ORV WHPDV VREUH
FRPXQLFDFLyQ HVFULWD \ ORV GLVWLQWRV PRGHORV GH FRPXQLFDFLyQ SDUD GHVSXpV
H[SRQHUOR IUHQWH D WX JUXSR HQ QR PiV GH FLQFR PLQXWRV FRQ HO Q GH SRQHU HQ
SUiFWLFDWXVKDELOLGDGHVGHFRPXQLFDFLyQRUDO\QRYHUEDO
3DUD HO GLVHxR GHO FDUWHO GHEHUiV VHU FUHDWLYR DO HOHJLU HO PHQVDMH TXH GHVHDV
WUDQVPLWLU\FyPRYDVDLQXLUHQODJHQWHTXHORYHD(OWHPDVHUiOLEUHSHURWHQGUi
TXHYHUFRQDOJRUHIHUHQWHDWXFRPXQLGDG3XHGHVHUTXHTXLHUDVGLIXQGLUXQHYHQWR
TXHKDUiQHQWXHVFXHODRSURPRYHUHOQHJRFLRGHDOJXLHQFHUFDQRDWL3RGUtDVGDU
DFRQRFHUDOJXQDDFWLYLGDGTXHUHDOLFHQHQHOOXJDUHQTXHYLYHVFRPRXQIHVWHMR
XQHYHQWRGHSRUWLYRRXQDIHULD1RWHOLPLWHVWDPELpQSXHGHVH[SUHVDUWXRSLQLyQ
VREUHDOJXQDFDXVDFRPRHOFXLGDGRGHOPHGLRDPELHQWHGHORVDQLPDOHVFyPR
DFDEDUFRQODGHOLQFXHQFLD\HOXVRGHGURJDVRWDOYH]LQYLWDUDODJHQWHSDUDTXH
HVFXFKHXQSURJUDPDGHUDGLRROHHUXQOLEURTXHWHJXVWyHQQSRQDWUDEDMDUWXV
LGHDV\WUDQVPtWHODVFRQVLGHUDQGRWRGRORYLVWRHQHVWHEORTXH

59
57

loque II

Caracterizas y aplicas los modelos de comunicacin

Instrumentos de evaluacin
3DUD HO GLVHxR GHO FDUWHO WRPD HQ FXHQWD HO VLJXLHQWH LQVWUXPHQWR FRQ HO TXH VH
HYDOXDUiWXWUDEDMR

Criterios

Excelente
(2 puntos)

Bien
(1 punto)

8WLOL]DOD
LQIRUPDFLyQ
HVWXGLDGD
HQHOEORTXH
SDUDHODERUDU
HOFRQWHQLGR
GHOFDUWHOGH
IRUPDFODUD\
FUHDWLYD
*UDPiWLFD \ /DJUDPiWLFD
RUWRJUDItD
\ODRUWRJUDItD
son adecuaGDV\UHHMDQ
una redaccin
FXLGDGRVD
$WUDFWLYR
(OFDUWHOHV
PX\DWUDFWLYR
HQWpUPLQRV
GHGLVHxR
GLVWULEXFLyQ\
RUGHQ

8WLOL]DOD
LQIRUPDFLyQ
HVWXGLDGDHQ
HOEORTXHSDUD
HODERUDUHO
FRQWHQLGRGHO
FDUWHO

,QIRUPDFLyQ

/DLGHDSULQFLSDOHVDOJR
clara, se neceVLWDPD\RU
LQIRUPDFLyQGH
DSR\R

Uso de los
modelos de
comunicacin

6HGHVWDFDOD
LGHDSULQFLSDO
\HVUHVSDOdada con
LQIRUPDFLyQ
GHWDOODGD

3UHVHQWD
HUURUJUDPDWLFDO\RUWRJUiFR

(OFDUWHOHV
DWUDFWLYRHQ
WpUPLQRVGH
GLVHxRGLVWULEXFLyQ\
RUGHQ

3UHVHQWDFLyQ 6HHQWUHJyGH /DHQWUHJDIXH


GHOFDUWHO
IRUPDOLPSLD
HQHOIRUPDWR
HQHOIRUPDWR VROLFLWDGR
VROLFLWDGR
aunque con
SRFDOLPSLH]D

Regular
(0.5 puntos)

Necesita
acompaamiento
(0 puntos)

&DVLQR
XWLOL]DOD
LQIRUPDFLyQ
HVWXGLDGD
HQHOEORTXH
SDUDHODERrar el conWHQLGRGHO
FDUWHO
3UHVHQWD
HQWUH\
errores graPDWLFDOHV\
RUWRJUiFRV

1RKD\HYLGHQFLDGHODLQIRUPDFLyQHVWXGLDGDHQHOEORTXH
SDUDHODERUDUHO
FRQWHQLGRGHO
FDUWHO

(OFDUWHOHV
UHODWLYDPHQWHDWUDFWLYR
DXQTXHSXHGHHVWDUXQ
SRFRGHVRUGHQDGR
3DUHFH
KDEHUSRFD
LQIRUPDFLyQ
UHFRSLODGD\
VHSUHVHQWD
en desorGHQ
5HVSHWy
SDUFLDOPHQWH
HOIRUPDWR
\HVWiPX\
VXFLR

(OFDUWHOHVEDVWDQWHGHVRUGHQDGRRHVWiPX\
PDOGLVHxDGR
1RHVDWUDFWLYR

3UHVHQWDR
PiVHUURUHV
JUDPDWLFDOHV\
RUWRJUiFRV

/DLQIRUPDFLyQ
SUHVHQWDGDHV
LQVXFLHQWH

1RFXPSOLyFRQ
ODSUHVHQWDFLyQ
VROLFLWDGD

&DOLFDFLyQ

60
58

Total

Caracterizas y aplicas los modelos de comunicacin

3DUDODSUHVHQWDFLyQGHOWUDEDMRYDVDUHWRPDUHOLQVWUXPHQWRTXHXWLOL]DVWHSDUDOD
H[SRVLFLyQHQHTXLSRHOFXDOSRGUiVHQFRQWUDUDFRQWLQXDFLyQ)tMDWHTXHDKRUDSRU
VHUXQDH[SRVLFLyQLQGLYLGXDOVHVXVWLWX\HHODVSHFWRGHOWUDEDMRHQHTXLSRSRUHOGH
WRQRGHYR]

Criterios

Muy bien
(2 puntos)

Regular
(1 punto)

Necesita
acompaamiento
(0 puntos)

([SUHVDFRQFOD-

2FDVLRQDOPHQWH

1RGHPXHVWUD
claridad ni conVLVWHQFLDHQVXV
LGHDV

Domina el
ULGDG\XLGH]ODV es claro en sus
WHPDTXH
LGHDV\GHWDOOHV LGHDV\GHWDOOHV
H[SRQH

GHOWHPD

6HJXULGDGHQ
ODH[SRVLFLyQ
GHVXWUDEDMR

9RFDEXODULR

$FW~DFRQVHguridad en la
H[SRVLFLyQGHVX
WUDEDMR

1RVLHPSUHDFW~D 1RH[SRQHFRQ
con seguridad en VHJXULGDGHOWUDODH[SRVLFLyQGH EDMRUHDOL]DGR
VXWUDEDMR

(VFDSD]GHXWLOL]DUXQYRFDEX- 8WLOL]DYRFDEXOD- 8WLOL]DXQYRFDODULRDPSOLR\VLQ ULROLPLWDGRSHUR EXODULROLPLWDGR\


UHSHWLUSDODEUDV DFHSWDEOH
UHSLWHSDODEUDV

Da a conocer su
RSLQLyQSHUVRQDO
FRQUHVSHFWRDO
WHPDUHVSDOGD$UJXPHQWDFLyQ
GRHQHODQiOLVLV
UHDOL]DGR

7RQRGHYR]

Puntos

Da a conocer su
RSLQLyQHQIRUPD
SRFRFODUD\OD
PD\RUtDGHOD
LQIRUPDFLyQHV
GHODXWRU

+DEODIXHUWH\
+DEODFRQFODFODUR6HOHHVFX- ULGDGSHURQR
FKDELHQ
VLHPSUHVHOH
HVFXFKDELHQ

No da a conocer
VXRSLQLyQSHUVRQDO6HDSR\DDO
HQRSLQLRQHVGHDXWRUHVX
RWUDVSHUVRQDV

+DEODFRQPX\
SRFDFODULGDG
7DUWDPXGHDWUDVWDELOOD
&DOLFDFLyQ

61
59

loque II

Caracterizas y aplicas los modelos de comunicacin

Autoevaluacin
5HDOL]DXQUHFXHQWRVREUHORVDSUHQGL]DMHVREWHQLGRVHQHOEORTXHLGHQWLFDQGRWX
QLYHOGHDYDQFHFRQIRUPHDODVLJXLHQWHHVFDOD





([FHOHQWHORJUpHODSUHQGL]DMHGHPDQHUDLQGHSHQGLHQWH
%XHQRUHTXHUtDSR\RSDUDFRQVWUXLUHODSUHQGL]DMH
5HJXODUIXHGLItFLOHOSURFHVRGHDSUHQGL]DMH\ORORJUpSDUFLDOPHQWH
,QVXFLHQWHQRORJUpHODSUHQGL]DMH

5HYLVD D GHWDOOH FRQ WX SURIHVRU \R FRQ DOJXQRV FRPSDxHURV DTXHOORV DVSHFWRV
GRQGHVHDQHFHVDULRUHIRU]DUORVDSUHQGL]DMHV
Nivel de avance

Procedimentales

Conceptuales

Contenidos
,GHQWLFDV ODV FDUDFWHUtVWLFDV GH OD
FRPXQLFDFLyQYHUEDODVtFRPRORVSULQFLSDOHV
DVSHFWRVGHODFRPXQLFDFLyQHVFULWD\RUDO
'LVWLQJXHVODVSDUWHVTXHFRQIRUPDQHOPRGHOR
GH 6DXVVXUH \ ODV DSOLFDV HQ OD FRQVWUXFFLyQ
GHOVLJQR
([SOLFDVODLPSRUWDQFLDGHODFRPXQLFDFLyQQR
YHUEDODOWUDQVPLWLULQIRUPDFLyQ
5HODFLRQDV ORV PRGHORV GH OD FRPXQLFDFLyQ
FRQVLWXDFLRQHVGHWXHQWRUQR
'HPXHVWUDV HO YDORU GH XQD EXHQD
FRPXQLFDFLyQ YHUEDO DSOLFiQGROD HQ WXV
HVFULWRV\H[SRVLFLRQHV
5HDOL]DV HMHPSORV GH ORV PRGHORV GH
FRPXQLFDFLyQ WRPDQGR HQ FXHQWD OR TXH
VXFHGHHQWXFRQWH[WR
&RQWUDVWDV HO XVR GH ORV PRGHORV GH OD
FRPXQLFDFLyQHQODLQWHUDFFLyQHQWUHLQGLYLGXRV
FRQHOSURFHVRTXHLQYROXFUDDODVPDVDV\ORV
SULQFLSDOHVPHGLRVPDVLYRVGHFRPXQLFDFLyQ
&UHDVFRQWHQLGRVTXHVLQWHWLFHQ\HMHPSOLTXHQ
HOVLJQLFDQWHVLJQLFDGR\VLJQR

Actitudinales

$SOLFDV OD FRPXQLFDFLyQ QR YHUEDO SDUD


LQFUHPHQWDUODHFDFLDGHWXPHQVDMH

62
60

&XPSOHV FRQ ORV SDUiPHWURV GH FDOLGDG


QHFHVDULRVHQODHODERUDFLyQGHWXVDFWLYLGDGHV
5HVSHWDV OD RSLQLyQ GH WXV FRPSDxHURV
GXUDQWHODVDFWLYLGDGHVHQHTXLSR
'HPXHVWUDVWXVDYDQFHVDOFUHDUSURGXFWRVFRQ
FRQWHQLGRVUHOHYDQWHV\ELHQHVWUXFWXUDGRV
7RPDV FRQFLHQFLD GHO WUDEDMR UHDOL]DGR SRU
WX DVHVRU \ FRODERUDV FRQ ODV DFWLYLGDGHV
DVLJQDGDV

%/248(,,,
5HODFLRQDVORVWLSRVGHFRPXQLFDFLyQ
FRQWXFRQWH[WR

loque III

Relacionas los tipos de comunicacin con tu contexto

%ORTXH,,

+25$6

Objetos de aprendizaje que se


abordan
Tipos de comunicacin
&RPXQLFDFLyQGLUHFWD

&RPXQLFDFLyQLQGLUHFWD

&RPXQLFDFLyQXQLODWHUDO

&RPXQLFDFLyQELODWHUDO
Comunicacin privada y pblica
Niveles de comunicacin
&RPXQLFDFLyQLQWUDSHUVRQDO

&RPXQLFDFLyQLQWHUSHUVRQDO

&RPXQLFDFLyQLQWUDJUXSDOHLQWHUJUXSDO

Competencias disciplinares
extendidas del campo de
Comunicacin


Productos de aprendizaje




+LVWRULHWDTXHUHSUHVHQWHORVWLSRVGHFRPXQLFDFLyQ
&XHVWLRQDULR VREUH FRPXQLFDFLyQ SULYDGD \
S~EOLFD
(VFULWRVREUHHOUHHMRGHORVWLSRV\QLYHOHV
GHFRPXQLFDFLyQ\ODVFRQVHFXHQFLDVGHOD
GLIXVLyQGHODLQIRUPDFLyQSULYDGDHQXQUHODWR

8WLOL]DODLQIRUPDFLyQFRQWHQLGDHQGLIHUHQWHV
WH[WRVSDUDRULHQWDUVXVLQWHUHVHVHQiPELWRV
GLYHUVRV
(VWDEOHFH
UHODFLRQHV
DQDOyJLFDV
FRQVLGHUDQGR ODV YDULDFLRQHV Op[LFR
VHPiQWLFDVGHODVH[SUHVLRQHVSDUDODWRPD
GHGHFLVLRQHV
'HEDWH VREUH SUREOHPDV GH VX HQWRUQR
IXQGDPHQWDQGRVXVMXLFLRVHQHODQiOLVLV\HQ
OD GLVFULPLQDFLyQ GH OD LQIRUPDFLyQ HPLWLGD
SRUGLYHUVDVIXHQWHV
3URSRQH VROXFLRQHV D SUREOHPiWLFDV GH VX
FRPXQLGDG D WUDYpV GH GLYHUVRV WLSRV GH
WH[WRV DSOLFDQGR OD HVWUXFWXUD GLVFXUVLYD
YHUEDORQRYHUEDO\ORVPRGHORVJUiFRVR
DXGLRYLVXDOHVTXHHVWpQDVXDOFDQFH
'HWHUPLQDODLQWHQFLRQDOLGDGFRPXQLFDWLYDHQ
GLVFXUVRVFXOWXUDOHV\VRFLDOHVSDUDUHVWLWXLU
OD OyJLFD GLVFXUVLYD D WH[WRV FRWLGLDQRV \
DFDGpPLFRV
$QDOL]D ORV EHQHFLRV H LQFRQYHQLHQWHV GHO
XVR GH ODV WHFQRORJtDV GH OD LQIRUPDFLyQ \
ODFRPXQLFDFLyQSDUDODRSWLPL]DFLyQGHODV
DFWLYLGDGHVFRWLGLDQDV
$SOLFDODVWHFQRORJtDVGHODLQIRUPDFLyQ\OD
FRPXQLFDFLyQ HQ HO GLVHxR GH HVWUDWHJLDV
SDUD OD GLIXVLyQ GH SURGXFWRV \ VHUYLFLRV
HQ EHQHFLR GHO GHVDUUROOR SHUVRQDO \
SURIHVLRQDO

Desempeos esperados
al concluir el bloque


64
62

5HODFLRQDORVGLIHUHQWHVWLSRVGHFRPXQLFDFLyQFRQORVGLIHUHQWHVFRQWH[WRVHQTXHVH
PRYLOL]D IDPLOLDUHVFRODUODERUDOHWF SDUD
GHWHUPLQDUFXiOHVVRQORVPiVXWLOL]DGRV

Relacionas los tipos de comunicacin con tu contexto

,QWURGXFFLyQ
3LHQVDHQXQGtDQRUPDOHQHOTXHDFXGHVDFODVHV,QGHSHQGLHQWHPHQWHGHTXH
XWLOLFHVXQPHGLRGHWUDQVSRUWHRWHWUDVODGHVFDPLQDQGRHQWXWUD\HFWRREVHUYDV
DRWUDVSHUVRQDVTXHDOLJXDOTXHW~HVWiQGHVDUUROODQGRGLVWLQWRVHMHPSORVGHFRPXQLFDFLyQODPDGUHGHIDPLOLDTXHUHJDxDDVXKLMRGRVKRPEUHVTXHFRQYHUVDQ
DFHUFDGHODVQRWLFLDVPiVUHFLHQWHVXQJUXSRGHMyYHQHVTXHOHJULWDDRWURGHVXV
DPLJRVSDUDTXHORVDOFDQFHWRGRVHOORVWLHQHQDOJRHQFRP~Q\HVTXHVHHQFXHQWUDQLQWHUDFWXDQGRGHGLVWLQWDVPDQHUDVHQXQPLVPRFRQWH[WR
3DUDFRQRFHUFyPRVHHVWDEOHFHQODVGLVWLQWDVUHODFLRQHVFRPXQLFDWLYDVHQHVWH
EORTXHDQDOL]DUiVORVWLSRV\QLYHOHVGHFRPXQLFDFLyQTXHSRQHVHQSUiFWLFDGHPDQHUDFRWLGLDQDWDOYH]VLQGDUWHFXHQWD&RQHVWRUHH[LRQDUiVDFHUFDGHODIRUPD
HQTXHODVSHUVRQDVHVWDEOHFHQYtQFXORVHQWUHVtFRQYLUWLHQGRDOSURFHVRFRPXQLFDWLYRHQSDUWHHVHQFLDOGHODYLGDGHOVHUKXPDQR

0DSDGHREMHWRVGHDSUHQGL]DMH
Relacionas los tipos de
comunicacin con tu contexto

Tipos de
comunicacin

Comunicacin
privada y pblica

Niveles de
comunicacin

&RPXQLFDFLyQ
GLUHFWD

&RPXQLFDFLyQ
LQWUDSHUVRQDO

&RPXQLFDFLyQ
LQGLUHFWD

&RPXQLFDFLyQ
LQWHUSHUVRQDO

&RPXQLFDFLyQ
XQLODWHUDO

&RPXQLFDFLyQ
LQWUDJUXSDOH
LQWHUJUXSDO

&RPXQLFDFLyQ
ELODWHUDO

65
63

loque III

Relacionas los tipos de comunicacin con tu contexto

3DUDLQLFLDUUHH[LRQD
(Q DQWHULRUHV DFWLYLGDGHV KDV YLVWR TXH GHSHQGLHQGR GHO S~EOLFR DO TXH SLHQVDV
GLULJLUWH HO PHQVDMH GHEH PRGLFDUVH adecuando VXV FDUDFWHUtVWLFDV DO FRQWH[WR
GHOUHFHSWRU3HURQRVyORHVRWDPELpQHVLPSRUWDQWHFRQVLGHUDUHOOXJDUHQHOTXH
VHHVWiOOHYDQGRDFDERHOSURFHVRGHFRPXQLFDFLyQ
InstruccionesHQWXOLEUHWDUHGDFWDXQHMHPSORGHXQDGLVFXVLyQHQODTXHKD\DV
HVWDGRLQYROXFUDGRUHFLHQWHPHQWH\DVHDFRQDOJ~QIDPLOLDURXQDPLJR3DUDHOOR
HVSHFLFDORVVLJXLHQWHVSXQWRV
 &RQTXLpQWXYLVWHODGLVFXVLyQ"
 3RUTXpFRPHQ]yODGLVFXVLyQ"
 &yPRWHUPLQyODGLVFXVLyQ"
&XDQGR WHUPLQHV GH UHGDFWDU WX HMHPSOR LQWHUFiPELDOR FRQ DOJXLHQ GH WX JUXSR
$KRUDFRQEDVHHQHOHVFULWRGHWXFRPSDxHURLQWHQWDSURSRQHUOHXQDDOWHUQDWLYD
GLVWLQWDDODTXHVXFHGLySDUDWHUPLQDUODGLVFXVLyQHQODTXHHVWXYRLQYROXFUDGR
&RQ HVWD LQIRUPDFLyQ UHH[LRQD Qu tan importante es la comunicacin para
llegar a un acuerdo cuando se entra en una discusin? &RPHQWDHVWDSUHJXQWDFRQ
WXJUXSR\HODVHVRUXWLOL]DQGRHOFDVRTXHUHGDFWDVWH\ODVROXFLyQTXHWHSURSXVR
WXFRPSDxHUR
Adecuar: acomodar algo para que se adapte a las circunstancias.
Rol: funcin que una persona desempea en una situacin.

$SUHQGHPiV
7LSRVGHFRPXQLFDFLyQ
6RFLDOPHQWH KDEODQGR OD FRPXQLFDFLyQ MXHJD XQ rol PX\ LPSRUWDQWH SDUD HO
HVWDEOHFLPLHQWRGHUHODFLRQHVHQWUHODVSHUVRQDVTXHFRQIRUPDQXQDFRPXQLGDG
3HURDGHPiVGHHVWRORVDYDQFHVWHFQROyJLFRVKDQJHQHUDGRTXHHVWRVYtQFXORV
VHGHQHQRFDVLRQHVFRQD\XGDGHRWURVPHGLRVTXHYDQPiVDOOiGHODLQWHUDFFLyQ
FDUDDFDUD(VWRSURYRFDTXHODJHQWHSXHGDLQWHUFDPELDULGHDVVLQODQHFHVLGDGGH
TXHVHHQFXHQWUHQHQHOPLVPROXJDUORTXHSURPXHYHHOORJURGHDFXHUGRVUHGXFH
HOFRQLFWR\IRPHQWDHOLQWHUFDPELRFXOWXUDO

66
64

Relacionas los tipos de comunicacin con tu contexto

En los siguientes apartados conocers los distintos tipos de comunicacin que se


dan entre las personas, tomando en cuenta factores como el contexto en el que se
inicia el proceso y los medios que se utilizan para generarlo. Adems, podrs ver un
ejemplo que te ayudar a comprender mejor la informacin, para que posteriormente
seas capaz de crear los tuyos.

Comunicacin directa
Cuando platicas con uno de tus amigos
frente a frente, compartiendo un espacio
y tiempo simultneo, se dice que
establecen una comunicacin directa,
inmediata, sin intermediarios (Zayas,
2011). sta tambin puede darse entre
dos o ms personas. Aqu pones en
juego la comunicacin verbal y no verbal,
incluyendo otros elementos como edad,
sexo, clase social, circunstancias del
momento y el lugar en el que se realiza la
comunicacin (Martnez, 2014).

Sabas que...
La ropa dice mucho de ti al transmitir un mensaje.
Debido a que forma parte de tu comunicacin no
verbal, es conveniente que, adems de cuidar la
manera en que hablas y te mueves, presentes una
imagen cuidada y limpia.

Comunicacin indirecta
Ahora imagina que necesitas contarle algo urgente a tu amigo con el que estabas
platicando anteriormente. Para esto vas a buscarlo a su casa. Tocas a su puerta,
pero nadie te responde. Entonces decides escribirle una nota pidindole que te
busque lo antes posible. Pasas la nota por debajo de su puerta y te vas. Un par
de horas despus, tu amigo llega a tu casa dicindote que vio la nota y que de
inmediato vino a buscarte.

67
65

loque III

Relacionas los tipos de comunicacin con tu contexto

Este ejemplo es un caso de


comunicacin indirecta. En ella los
interlocutores estn separados por
el tiempo, el espacio, o por ambas
cosas al mismo tiempo (Zayas, 2011).
Sin embargo, pueden comunicarse
gracias a un soporte tecnolgico,
como puede ser el papel, el telfono o
cualquier otro medio que les permita
transmitir un mensaje sin estar cara
a cara.
Las cartas son un medio de comunicacin
indirecto, ya que las personas no comparten
el mismo lugar y tiempo, pero aun as
pueden establecer comunicacin.

Interlocutor: cada una de las personas que toman parte en un


dilogo o conversacin.

Comunicacin unilateral
Algo que debes tener presente es que tanto la comunicacin directa como la indirecta
permiten que el emisor y el receptor intercambien roles, es decir, que ambas partes
en algn momento de la interaccin desempeen el papel del otro. En el caso de
la comunicacin unilateral, el proceso de comunicacin va en una sola direccin, lo
que puede darse por dos razones: limitaciones tcnicas o estructuras de poder que
hacen imposible el dilogo (Martnez, 2014).
$ TXp VH UHHUH HVWR" %XHQR HQ HO SULPHU
caso, piensa que cuando miras la televisin,
existen pocas oportunidades de que puedas
interactuar con las personas que aparecen en los
programas que ves cotidianamente. T recibes
el mensaje, pero no puedes comunicarte al
mismo nivel porque no cuentas con un soporte
tecnolgico similar que te lo permita.
(QFXDQWRDODVHVWUXFWXUDVGHSRGHUVHUHHUH
DODGLFXOWDGGHHVWDEOHFHUXQGLiORJRFRQXQD
persona a la que no se puede acceder con
IDFLOLGDGFRPRXQDJXUDS~EOLFDHOGLUHFWRUGH

68
66

A veces los polticos desarrollan una


comunicacin unilateral, debido a que
no existen mecanismos para que las
personas de algunas comunidades
puedan dialogar con ellos.

Relacionas los tipos de comunicacin con tu contexto

XQDHPSUHVDLQX\HQWHRHOJREHUQDGRUGHWXHVWDGR(QHVWH~OWLPRFDVRW~UHFLEHV
su mensaje gracias a los medios que tiene a su disposicin, pero en ocasiones no
se abren mecanismos para que los ciudadanos puedan hacerle llegar sus mensajes
de manera personal.

Comunicacin bilateral
5HFXHUGDV OD DFWLYLGDG GH UHH[LyQ FRQ OD TXH LQLFLDVWH HO EORTXH" 6H WH SLGLy
que recordaras una discusin que hubieras tenido con alguien y cmo concluy.
Posteriormente se te plante la pregunta qu tan importante es la comunicacin
para llegar a un acuerdo cuando se entra en una discusin? Para responderla
estableciste un dilogo con tus compaeros para ofrecer alternativas de solucin
DQWH DOJ~Q FRQLFWR (VWR HV OD EDVH GH OD FRPXQLFDFLyQ ELODWHUDO OD FXDO VH
caracteriza por ser recproca, adems de ser la base para establecer acuerdos.
Para que exista debe haber respeto entre ambas partes, adems de la disposicin
para escuchar.
En este tipo de comunicacin, los interlocutores realizan un consenso, se expresan
e intercambian roles, favoreciendo el intercambio de ideas de una manera efectiva
(Martnez, 2014).
Recproca: implica una accin que es intercambiada entre
dos o ms sujetos cuyos resultados afectan a todos ellos.
Consenso: aceptacin, por parte de la mayora de los
miembros de un grupo social, de determinadas decisiones
o acuerdos.

Actividad de aprendizaje 1
Instrucciones: con ayuda de tu asesor, forma un equipo de trabajo. En esta ocasin vas a crear una historieta o cmic (tamao doble carta) con tus compaeros en
donde representen los cuatro tipos de comunicacin (directa, indirecta, unilateral y
bilateral).
Para la historia de su proyecto debern tomar situaciones del lugar en que viven.
6HDQWDQFUHDWLYRVFRPROHVVHDSRVLEOHHLQFOX\DQGLiORJRVTXHUHHMHQXQDLQWHraccin entre los personajes.

69
67

loque III

Relacionas los tipos de comunicacin con tu contexto

Para elaborar la historieta toma en cuenta la siguiente rbrica con la que se evaluar.

Criterios

Excelente
Cumple con
todos los
requisitos
solicitados de
forma sobresaliente

Bien
Cumple con la
mayora de los
requisitos con
una calidad
aceptable

Regular

Necesita
acompaamiento

Cumple con algunos requisitos,


presenta diversas
carencias

Tiene importantes
FDUHQFLDV\QRUHHMDOD
capacidad del alumno

0.5

La historieta incluye
situaciones relacionadas con el contexto
de los integrantes del
equipo.
/D KLVWRULHWD UHHMD
los 4 tipos de comunicacin vistos hasta
el momento (directa,
indirecta, unilateral y
bilateral).
La narracin de la
historia es gil, ameQD \ XLGD XWLOL]D XQ
lenguaje adecuado.
La narracin se presenta de forma grFD HQ YLxHWDV R UHcuadros que integran
el pensamiento de los
personajes y el texto
del narrador.
La historieta cumple
FRQODVHVSHFLFDFLRnes de formato, adems de estar limpia y
con una presentacin
de calidad.
&DOLFDFLyQ

70
68

Total

Relacionas los tipos de comunicacin con tu contexto

Sabas que...
Las historietas o comics eran, en sus orgenes, de carcter cmico (de ah el
nombre). Pronto se descubrieron las grandes ventajas que proporcionaba este
medio para comunicar ideas, gracias a que integra narracin, dilogo y dibujo
(Junta de Andaluca, 2013). En la imagen se aprecia un ejemplo de Mafalda,
historieta creada por el argentino Quino.

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Conocer los tipos de comunicacin (directa, indirecta, unilateral y bilateral) te
permitir reconocer la manera en que interactas con las personas dependienGRGHORTXHHVSHUDVGHHOODV$GHPiVH[LVWHQRWURVIDFWRUHVTXHPRGLFDQHO
intercambio de informacin y que tienen que ver con analizar si sta puede ser
compartida con alguien ms o si se debe mantener de forma privada.

71
69

loque III

Relacionas los tipos de comunicacin con tu contexto

$SUHQGHPiV
&RPXQLFDFLyQSULYDGD\S~EOLFD
Cuando le cuentas un secreto a una persona, esperas que no le cuente a nadie,
YHUGDG"6LQHPEDUJRVHJXUDPHQWHWHKDWRFDGRH[SHULPHQWDUFXDQGRDOJXLHQQR
UHVSHWDWXFRQDQ]D\ORSULPHURTXHKDFHHVUHYHODUOHDRWURWXVHFUHWR(VHQWRQFHV
cuando la informacin que compartiste con una persona de repente se convierte en
DOJRGHORTXHWRGRVVDEHQPRGLFDQGRHOREMHWLYRLQLFLDOGHWXFRPXQLFDFLyQ
Cuando la informacin que transmite el
emisor al receptor slo les compete a ellos,
decimos que esta informacin es privada. En
esta categora puedes incluir los sentimientos
que compartes con alguien, algn problema
que tengas o informacin importante como el
lugar donde guardas tu dinero. Ahora, cuando
la informacin que compartes le compete
a varias personas, como los contenidos de
tu clase, la fecha de una celebracin en tu
comunidad o el discurso del presidente,
entonces decimos que es pblica.
Compete. que le interesa a alguien una cosa y est dentro de sus
obligaciones o responsabilidades.

/HHFRQDWHQFLyQHOVLJXLHQWHWH[WRGHOSVLFyORJR\OyVRIR*HUKDUG0DOHW]NHTXH
GHQHODFRPXQLFDFLyQSULYDGD\ODS~EOLFD
La comunicacin se efecta de manera recproca, como por ejemplo,
en la conversacin personal. Esto quiere decir que las partes cambian
continuamente sus papeles de emisores y receptores, de tal modo
que el proceso comunicativo se realiza de ida y vuelta. Si lo expresado
se dirige exclusivamente a una persona o a un nmero limitado de
personas, decimos que esta comunicacin es privada. Por el contrario,
si la intencin del informante es que el mensaje llegue a cualquiera que
est en posicin de obtener acceso a l, la comunicacin tiene el carcter
GHS~EOLFD 0DOHW]NHFLWDGRHQ'HOD0RUD 

72
70

Relacionas los tipos de comunicacin con tu contexto

Sabas que...
Hay veces que la informacin privada se convierte en pblica a travs de
distintos medios debido al inters de la gente por conocer ms de, por ejemplo,
alguna persona que ven en la televisin. Es entonces cuando diversos medios
de comunicacin aprovechan esto para publicar secretos que deberan tratarse
como informacin privada, pero termina siendo pblica por los aspectos
mencionados.

Actividad de aprendizaje 2
InstruccionesGHVSXpVGHOHHUHOWH[WRGH*HUKDUG0DOHW]NHUHVSRQGHODVVLJXLHQtes preguntas. Al terminar comntalas con tu asesor y tus compaeros.
1. Redacta tres ejemplos de comunicacin privada que realices en los siguientes
lugares: la escuela, tu casa y la calle.
________________________________________________________________
________________________________________________________________
________________________________________________________________
2. Redacta tres ejemplos de comunicacin pblica que se dan en tu comunidad.
________________________________________________________________
________________________________________________________________
________________________________________________________________
3. Cmo crees que afecta a una persona cuando su informacin privada se vuelve
S~EOLFD"
________________________________________________________________
________________________________________________________________
________________________________________________________________
4. Cmo evitaras que tu informacin privada, o la de alguien que aprecias, se
YXHOYDS~EOLFD"
________________________________________________________________
________________________________________________________________
________________________________________________________________
6HJ~QORYLVWRHQHOEORTXH\DSDUWLUGHWXSURSLDUHH[LyQTXpLQIRUPDFLyQ
FRQVLGHUDVTXHGHEHPDQHMDUVHS~EOLFDPHQWHHQWXFRPXQLGDG"
________________________________________________________________
________________________________________________________________
________________________________________________________________
*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

73
71

loque III

Relacionas los tipos de comunicacin con tu contexto

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
5HH[LRQDUVREUHODGLIHUHQFLDTXHH[LVWHHQWUHODLQIRUPDFLyQGHXVRSULYDGR
y aquella de inters pblico depende, en primer lugar, del respeto que debes
darle a la intimidad de los dems, considerando las consecuencias que puede
tener el difundir aspectos personales de la gente que te rodea. En segundo,
conocer la informacin que debe manejarse pblicamente en tu comunidad te
permitir mantenerte al tanto de las necesidades que existen en ella, adems
de poder colaborar con el crecimiento y la mejora del lugar en que vives.

$SUHQGHPiV
1LYHOHVGHFRPXQLFDFLyQ
Adems del tipo de comunicacin que utilices, existen algunos niveles en ella que
te permitirn seguir un proceso de intercambio de informacin dependiendo si lo
realizas de manera individual o que involucre a un grupo del cual formes parte.
Cuando elaboras las actividades de este libro, sin darte cuenta ests abordando
ORVGLVWLQWRVQLYHOHVGHFRPXQLFDFLyQ$OUHH[LRQDUVREUHORTXHVHWHSLGHDQWHV
de comenzar tu trabajo pones en marcha un proceso en el que los conocimientos
y habilidades con los que cuentas se comunican, por as decirlo, dentro de ti, para
seleccionar los que necesitars en el desarrollo de la actividad. Luego, si la actividad
es en parejas, te renes con un compaero y comienzan a realizar el intercambio de
informacin entre los dos para entregar un buen trabajo. Lo mismo sucede cuando
haces un trabajo en equipo. Los equipos son grupos de personas y, al ser miembro
del mismo, interactas con los dems integrantes dentro del grupo para llegar a un
acuerdo. Posteriormente, tu equipo compara y contrasta sus conclusiones con los
otros equipos del saln, lo que hace que se genere un dilogo, ahora, entre grupos.
1RWDVWH ODV SDODEUDV HQ FXUVLYDV HQ HO SiUUDIR DQWHULRU" (VDV SDODEUDV VRQ
la clave de los conceptos que vers a continuacin sobre los distintos niveles
comunicativos.

74
72

Relacionas los tipos de comunicacin con tu contexto

Comparar: encontrar las similitudes entre dos cosas.


Contrastar: encontrar las diferencias entre dos cosas.

&RPXQLFDFLyQLQWUDSHUVRQDO
La comunicacin intrapersonal es la que se da dentro de ti 6H UHHUH D OD TXH
XQDSHUVRQDUHDOL]DFRQVLJRPLVPRSXHGHVHUSDUDGDUVHiQLPRVSDUDUHH[LRQDU
sobre alguna accin que realizamos o vamos a emprender (Universidad Popular
Autnoma de Veracruz, 2013). En este proceso, el emisor y el receptor son el mismo
individuo, y aunque se ha dicho que la comunicacin se da con la interaccin, es
conveniente que valores tambin la manera en que t mismo te das el tiempo
para razonar y pensar en distintas cosas que cumplen con la misma estructura del
proceso comunicativo.

&RPXQLFDFLyQLQWHUSHUVRQDO
Es aquella que se origina entre los dos componentes del proceso comunicativo
(emisor y receptor) de manera personal. Cuando sta es directa, puede considerarse
como la ms completa debido a que se pone en juego la comunicacin verbal y
OD QR YHUEDO %DHQD  0RQWHUR   /D FRPXQLFDFLyQ LQWHUSHUVRQDO LQGLUHFWD
tiene que ver con las mismas caractersticas y ejemplos que revisaste al abordar la
comunicacin indirecta, que es a travs de algn tipo de tecnologa

&RPXQLFDFLyQLQWUDJUXSDOHLQWHUJUXSDO
El grupo constituye la unidad bsica de una sociedad, ya que gracias a la formacin
del mismo, un individuo puede establecer vnculos que le sirven para encontrar
a otras personas con intereses en comn. Cuando formas parte de un grupo,
estableces procesos de comunicacin con los otros integrantes para transmitir
LQIRUPDFLyQ\UHDOL]DUXQDWDUHDHVSHFtFD
Piensa en las veces que has participado en
un equipo deportivo, ya sea para practicar
basquetbol, futbol o cualquier otra actividad.
Durante el juego debes aplicar diversas
estrategias para comunicarte con el resto
de tus compaeros de equipo y lograr un
objetivo en comn, que sera ganar el partido.
En este caso, realizas la comunicacin
intragrupal. El SUHMR intraVLJQLFDGHQWUR
GHRHQHOLQWHULRU\HQFXDQWRDinter, se
XWLOL]D SDUD VHxDODU TXH DOJR HVWi HQWUH R
HQPHGLRGHGRVFRVDV

75
73

loque III

Relacionas los tipos de comunicacin con tu contexto

Por eso, en el segundo caso de esta seccin, al decir comunicacin intergrupal se


UHHUHDOSURFHVRGHLQWHUDFFLyQTXHVLJXHQGRVJUXSRVSDUDFRPXQLFDUVHHQWUHVt
Obviamente cuando practicas uno de los deportes mencionados, tus compaeros
y t se enfrentan a otro equipo, y deben establecer una comunicacin para que el
MXHJRVHGHVDUUROOHFRUUHFWDPHQWH(VWRVLJQLFDTXHHVWiQSRQLHQGRHQSUiFWLFDOD
comunicacin entre grupos.
W palabra que se aade al comienzo de una palabra para
formar otra nueva. Por ejemplo, incluir: aceptar algo; excluir: rein (dentro) y ex (fuera).

&LHUUHGHOEORTXH,,,
5HH[LRQDVREUHORDSUHQGLGR
La comunicacin juega un papel muy importante para establecer relaciones entre
los individuos de cualquier lugar. Adems, los avances tecnolgicos han generado
que estas relaciones puedan darse incluso cuando las personas no se encuentran
frente a frente.
Los distintos tipos de comunicacin (directa, indirecta, unilateral y bilateral) te
SHUPLWHQLGHQWLFDUODIRUPDHQTXHODJHQWHVHFRPXQLFD<DVHDHQSHUVRQDRSRU
algn medio, lo importante del proceso es establecer vnculos con tus semejantes,
DGHPiVGHUHH[LRQDUVREUHODLPSRUWDQFLDGHTXHHOLQWHUFDPELRGHPHQVDMHVVHD
UHFtSURFR\SURPXHYDHOGLiORJR6HJ~Q0DOHW]NHHVWRTXLHUHGHFLUTXHHOSURFHVR
FRPXQLFDWLYRGHEHUHDOL]DUVHGHLGD\YXHOWDDGHPiVGHYHULFDUVLORH[SUHVDGRVH
dirige exclusivamente a una persona o a un nmero limitado de personas, para ser
FDOLFDGDFRPRSULYDGD3RUHOFRQWUDULRVLODLQWHQFLyQGHOHPLVRUHVTXHHOPHQVDMH
llegue a cualquiera que est en posicin de obtener acceso a l, la comunicacin
ser pblica. Lo anterior resulta muy importante, ya que te permitir valorar cundo
debes mantener la informacin como privada, y otros momentos en los cuales debes
H[LJLUHODFFHVRDODLQIRUPDFLyQTXHVHFODVLTXHFRPRS~EOLFD
/HHFRQDWHQFLyQHOVLJXLHQWHFXHQWRGHOHVFULWRUFRORPELDQR*DEULHO*DUFtD0iUTXH]
Procura analizarlo bien, ya que ser la base de la actividad que realizars para este
cierre del bloque.
Algo muy grave va a suceder en este pueblo
Imagnese usted un pueblo muy pequeo donde hay una seora vieja que tiene
dos hijos, uno de 17 y una hija de 14. Est sirvindoles el desayuno y tiene una

76
74

Relacionas los tipos de comunicacin con tu contexto

expresin de preocupacin. Los hijos le preguntan qu le pasa y ella les responde:


No s, pero he amanecido con el presentimiento de que algo muy grave va a
sucederle a este pueblo.
Ellos se ren de la madre. Dicen que esos son presentimientos de vieja, cosas que
pasan. El hijo se va a jugar al billar, y en el momento en que va a tirar una carambola
sencillsima, el otro jugador le dice:
Te apuesto un peso a que no la haces.
Todos se ren. l se re. Tira la carambola y no la hace. Paga su peso y todos le
preguntan qu pas, si era una carambola sencilla. Contesta:
Es cierto, pero me ha quedado la preocupacin de una cosa que me dijo mi
madre esta maana sobre algo grave que va a suceder a este pueblo.
Todos se ren de l, y el que se ha ganado su peso regresa a su casa, donde est
FRQVXPDPiRXQDQLHWDRHQQFXDOTXLHUSDULHQWH)HOL]FRQVXSHVRGLFH
Le gan este peso a Dmaso en la forma ms sencilla porque es un tonto.
<SRUTXpHVXQWRQWR"
Hombre, porque no pudo hacer una carambola sencillsima estorbado con la idea
de que su mam amaneci hoy con la idea de que algo muy grave va a suceder en
este pueblo.
Entonces le dice su madre:
No te burles de los presentimientos de los viejos porque a veces salen.
La pariente lo oye y va a comprar carne. Ella le dice al carnicero:
Vndame una libra de carne y en el momento que se la estn cortando,
agrega: Mejor vndame dos, porque andan diciendo que algo grave va a pasar y
lo mejor es estar preparado.
El carnicero despacha su carne y cuando llega otra seora a comprar una libra de
carne, le dice:
Lleve dos porque hasta aqu llega la gente diciendo que algo muy grave va a
pasar, y se estn preparando y comprando cosas.
Entonces la vieja responde:
Tengo varios hijos, mire, mejor deme cuatro libras.
Se lleva las cuatro libras; y para no hacer largo el cuento, dir que el carnicero en
media hora agota la carne, mata otra vaca, se vende toda y se va esparciendo el
rumor. Llega el momento en que todo el mundo, en el pueblo, est esperando que
pase algo. Se paralizan las actividades y de pronto, a las dos de la tarde, hace calor
como siempre. Alguien dice:
6HKDGDGRFXHQWDGHOFDORUTXHHVWiKDFLHQGR"
Pero si en este pueblo siempre ha hecho calor!
(Tanto calor que es pueblo donde los msicos tenan instrumentos remendados
con brea y tocaban siempre a la sombra porque si tocaban al sol se les caan a
pedazos.)
Sin embargo dice uno, a esta hora nunca ha hecho tanto calor.
Pero a las dos de la tarde es cuando hay ms calor.
S, pero no tanto calor como ahora.
Al pueblo desierto, a la plaza desierta, baja de pronto un pajarito y se corre la voz:
Hay un pajarito en la plaza.
<YLHQHWRGRHOPXQGRHVSDQWDGRDYHUHOSDMDULWR
Pero seores, siempre ha habido pajaritos que bajan.
S, pero nunca a esta hora.
Llega un momento de tal tensin para los habitantes del pueblo, que todos estn
desesperados por irse y no tienen el valor de hacerlo.

77
75

loque III

Relacionas los tipos de comunicacin con tu contexto

<RVtVR\PX\PDFKRJULWDXQR<RPHYR\
Agarra sus muebles, sus hijos, sus animales, los mete en una carreta y atraviesa la
calle central donde est el pobre pueblo vindolo. Hasta el momento en que dicen:
Si este se atreve, pues nosotros tambin nos vamos.
<HPSLH]DQDGHVPDQWHODUOLWHUDOPHQWHHOSXHEOR6HOOHYDQODVFRVDVORVDQLPDOHV
todo.
<XQRGHORV~OWLPRVTXHDEDQGRQDHOSXHEORGLFH
Que no venga la desgracia a caer sobre lo que queda de nuestra casa y
entonces la incendia y otros incendian tambin sus casas.
Huyen en un tremendo y verdadero pnico, como en un xodo de guerra, y en
medio de ellos va la seora que tuvo el presagio, clamando:
<RGLMHTXHDOJRPX\JUDYHLEDDSDVDU\PHGLMHURQTXHHVWDEDORFD
),1

'HVSXpV GH OHHU HO FXHQWR YDV D UHDOL]DU XQ HVFULWR GRQGH UHH[LRQHV VREUH ORV
siguientes puntos:
 &yPRVHGDQORVGLVWLQWRVWLSRVGHFRPXQLFDFLyQHQHOFXHQWR"
 &yPRVHUHHMDQORVQLYHOHVGHFRPXQLFDFLyQ"
 Cmo la informacin privada se hizo pblica en esta historia y cules
IXHURQVXVFRQVHFXHQFLDV"
5HH[LRQDPX\ELHQVREUHHOFRQWHQLGRGHOFXHQWR\UHODFLyQDORFRQORTXHYLVWHHQ
este bloque. Al terminar, revisa tu escrito con la siguiente rbrica.

Criterios

Excelente
2 puntos

Bien
1 punto

Regular
0.5 punto

Necesita
acompaamiento
0 puntos

Total

Expone la informacin de manera clara


y concreta.
6XHVFULWRUHHMDXQD
SODQLFDFLyQFXLGDGRVD\ODUHH[LyQVREUH
el texto ledo.
Existe un desarrollo
lgico de ideas. La redaccin es coherente
\XLGD
La ortografa y redaccin son adecuadas.
El trabajo se entrega
limpio y en el formato
indicado por el asesor.
&DOLFDFLyQ

*XDUGDHOGHVDUUROOR\VROXFLyQGHHVWDDFWLYLGDGHQWXSRUWDIROLRGHHYLGHQFLDV

78
76

Relacionas los tipos de comunicacin con tu contexto

Autoevaluacin
5HDOL]DXQUHFXHQWRVREUHORVDSUHQGL]DMHVREWHQLGRVHQHOEORTXHLGHQWLFDQGRWX
nivel de avance conforme a la siguiente escala:
4 = Excelente, logr el aprendizaje de manera independiente.
 %XHQRUHTXHUtDSR\RSDUDFRQVWUXLUHODSUHQGL]DMH
2 = Regular, fue difcil el proceso de aprendizaje y lo logr parcialmente.
 ,QVXFLHQWHQRORJUpHODSUHQGL]DMH
Revisa a detalle con tu profesor y/o con algunos compaeros aquellos aspectos
donde sea necesario reforzar los aprendizajes.
Nivel de avance

Contenidos

Conceptuales

Conoces los tipos de comunicacin.


Distingues el uso de los medios
tecnolgicos en la comunicacin indirecta.
Explicas los
comunicacin.

distintos

niveles

Reconoces las diferencias entre


comunicacin privada y la pblica.

de
la

Nivel de avance

Procedimentales

Contenidos

Produces contenidos que representan los


tipos de comunicacin.
,GHQWLFDVORVQLYHOHVGHFRPXQLFDFLyQTXH
se dan en la interaccin entre los miembros
de tu comunidad.
Contrastas diferencias entre comunicacin
privada y pblica a partir de ejemplos en tu
contexto.
Debates los efectos de la comunicacin
privada y pblica en tu comunidad

79
77

loque III

Relacionas los tipos de comunicacin con tu contexto

Nivel de avance

Actitudinales

Contenidos

80
78

Respetas el trabajo de los dems durante


tu participacin en equipo.
Aprecias los distintos tipos y niveles de
comunicacin en tu contexto.
Valoras los contenidos y actividades propuestas
y te esfuerzas por cumplirlas correctamente.

%/248(,9
9LQFXODVODFXOWXUDFRQODFRPXQLFDFLyQ
S~EOLFD

loque IV

Vinculas la cultura con la comunicacin pblica

%ORTXH,9

10

HORAS

Objetos de aprendizaje que se


abordan
Cultura
Multiculturalidad
*OREDOL]DFLyQ
*OREDOL]DFLyQGHODFXOWXUD

Competencias disciplinares
extendidas del campo
Comunicacin


Productos de aprendizaje







Entrevista sobre costumbres y tradiciones


de tu comunidad.
Escrito sobre una propuesta para difundir las
costumbres y tradiciones de tu comunidad.
Cuestionario sobre algn programa de teOHYLVLyQ FRPR UHH[LyQ VREUH OD FXOWXUD GH
masas.
*UiFRGHOPRGHORGHODWXEDGH6FKUDPP
VREUHODLQXHQFLDGHXQSURJUDPDGHWHOHYLsin en su comunidad.
'HQLFLyQSHUVRQDOGHJOREDOL]DFLyQ
&XDGURGHGREOHHQWUDGDFRQHOUHHMRGHORV
contenidos vistos en el bloque.

Utiliza la informacin contenida en diferentes


textos para orientar sus intereses en mbitos
diversos.
Establece
relaciones
analgicas,
considerando las variaciones lxicosemnticas de las expresiones para la toma
de decisiones.
Debate sobre problemas de su entorno
fundamentando sus juicios en el anlisis y en
la discriminacin de la informacin emitida
por diversas fuentes.
Propone soluciones a problemticas de su
comunidad, a travs de diversos tipos de
textos, aplicando la estructura discursiva,
YHUEDORQRYHUEDO\ORVPRGHORVJUiFRVR
audiovisuales que estn a su alcance.
9DORUDODLQXHQFLDGHORVVLVWHPDV\PHGLRV
de comunicacin en su cultura, su familia
y su comunidad, analizando y comparando
sus efectos positivos y negativos.
$QDOL]D ORV EHQHFLRV H LQFRQYHQLHQWHV GHO
uso de las tecnologas de la informacin y
la comunicacin para la optimizacin de las
actividades cotidianas.
Aplica las tecnologas de la informacin y la
comunicacin en el diseo de estrategias
para la difusin de productos y servicios,
HQ EHQHFLR GHO GHVDUUROOR SHUVRQDO \
profesional.

Desempeos esperados
al concluir el bloque


82
80

Vincula la cultura con la comunicacin pblica, a travs del anlisis de algunos mensajes y productos culturales encontrados en los
contextos donde se moviliza, para ligarlo con
la cultura local, nacional y mundial

Vinculas la cultura con la comunicacin pblica

Introduccin
/DFXOWXUDHVXQRGHORVFRQFHSWRVTXHHQRFDVLRQHVVHSUHVWDDGLVWLQWDVGHQLFLRnes dependiendo del contexto comunicativo. Hay personas que relacionan la cultura
con la preparacin o conocimientos formales que tiene una persona, es decir, que
tenga un ttulo universitario, que haya ledo mucho y conozca bastante sobre diversos temas. Sin embargo, el concepto va ms all. Segn la Declaracin Universal
de la UNESCO sobre la Diversidad Cultural publicada en 2001, la cultura es el
conjunto de los rasgos distintivos espirituales y materiales, intelectuales y afectivos
que caracterizan a una sociedad o a un grupo social y que abarca, adems de las
artes y las letras, los modos de vida, las maneras de vivir juntos, los sistemas de
valores, las tradiciones y las creencias. Esto tiene que ver con diversos aspectos
que involucran el lugar en el que viven y las costumbres que desarrollan las personas a lo largo de su vida. Por esto, la relacin entre cultura y comunicacin es muy
importante, sobre todo, con aquello que tiene que ver con los medios que se utilizan
SDUDGLIXQGLUODRLQXLUHQODPDQHUDHQTXHpVWDFUHFH\HYROXFLRQDFRQHOSDVRGH
los aos.

Mapa de objetos de aprendizaje

Cultura

Globalizacin

Multiculturalidad

Globalizacin
de la cultura

Cultura de
masas

83
81

loque IV

Vinculas la cultura con la comunicacin pblica

3DUDLQLFLDUUHH[LRQD
InstruccionesFRPRLQWURGXFFLyQDOEORTXHYDVDUHH[LRQDUDFHUFDGHODGHQLFLyQ
de cultura que se te proporcion anteriormente:
Cultura es el conjunto de los rasgos distintivos espirituales y materiales,
intelectuales y afectivos que caracterizan a una sociedad o a un grupo social y
que abarca, adems de las artes y las letras, los modos de vida, las maneras
de vivir juntos, los sistemas de valores, las tradiciones y las creencias.
Fuente: Declaracin Universal de la UNESCO sobre la Diversidad
Cultural, publicada en 2001.

1. (QWXOLEUHWDYXHOYHDHVFULELUHVWDGHQLFLyQSHURHQODIRUPDGHKDEODUTXHVH
utilice en tu regin, es decir, la manera en que te expresas cotidianamente.
2. 'HVSXpVHODERUDXQGLEXMRTXHDEDUTXHWRGRVORVHOHPHQWRVGHODGHQLFLyQGH
cultura.
Cuando termines tu texto y el dibujo, comenta con tu asesor y tus compaeros
ORVLJXLHQWHFyPRLQX\HHOOXJDUHQHOTXHYLYR\ODVSHUVRQDVFRQODVTXHPH
relaciono en mi forma de expresarme? Utiliza el trabajo que acabas de realizar para
complementar tu respuesta.

Aprende ms
Cultura
La manera en que te expresas forma parte de tu cultura. Todas las costumbres que
tienes, como preferir cierto tipo de comida, la msica que escuchas, la forma en que
vistes, expresan algo de ti, y no se limita a la manera en que hablas.
&XDQGRHVFULELVWHFRQWXVSDODEUDV\H[SUHVLRQHVODGHQLFLyQGHFXOWXUDHVWDEDV
WUDQVPLWLHQGRSDUWHGHWXVH[SHULHQFLDV(OGLEXMRTXHHODERUDVWHWDPELpQH[SUHVD
algo, ya sea por los elementos que incluiste, el cuidado que le pusiste a su elaboracin
RHOLQWHUpVTXHGHVSHUWyHQWLODDFWLYLGDG7RGDVHVWDVFRVDVVRQPDQLIHVWDFLRQHV
GHWXFXOWXUD\pVWDVHFRPSDUWHSRUORWDQWRVHUHODFLRQDFRQODYLGDHQVRFLHGDG
con la interaccin que desarrollas con los miembros de tu comunidad (Baena &
Montero, 2012). Debido a esto, debes darte cuenta que en el lugar donde vives se
da la multiculturalidad, cuyo concepto explorars a continuacin.

84
82

Vinculas la cultura con la comunicacin pblica

Aprende ms
Multiculturalidad
0p[LFR HV ULFR HQ FXOWXUD GHELGR D QXHVWUR SDVDGR SUHKLVSiQLFR \ D ODV PH]FODV
originadas tras la colonizacin espaola. Y aunque en algunas ocasiones se habla
de ello como el choque de dos culturas, te podrs dar cuenta que en la actualidad
este intercambio de costumbres y tradiciones ha generado grandes ejemplos de
multiculturalidad a lo largo y ancho del pas.
Segn la UNESCO, que es la Organizacin
de las Naciones Unidas para la Educacin,
la Ciencia y la Cultura, la multiculturalidad
presupone respeto a las libertades
fundamentales, como la libertad religiosa,
la facultad de expresar libremente tus
opiniones y el derecho de participar en la
vida cultural de tu comunidad por decisin
propia. Hablar de multiculturalismo
WDPELpQ HV UHIHULUQRV DO HQFXHQWUR GH
culturas y tratar de encontrar acciones que
fomenten la convivencia armnica entre
las tradiciones y el mundo actual (Ibez,
citado en Chanona, 2011). Siguiendo
HVWDVGRVGHQLFLRQHVHVSRVLEOHDUPDU
que la multiculturalidad lleva implcita la
libertad y el respeto a las costumbres de
los dems, adems del valor que se le
debe dar a las mismas para preservarlas
ante el avance de la modernidad.

Actividad de aprendizaje 1
Instrucciones: con ayuda de tu asesor, forma un equipo con algunos compaeros
de tu grupo. Van a investigar acerca de alguna costumbre o tradicin que exista en
su comunidad. Pueden preguntarles a sus familiares o a alguna persona especiali]DGDHQHOWHPDSDUDFRQRFHUHORULJHQ\HOVLJQLFDGRGHDTXHOORTXHFHOHEUDQHQ
el lugar en que vives. Para ello respondern las siguientes preguntas en su libreta:

85
83

loque IV

Vinculas la cultura con la comunicacin pblica

1. Costumbre o tradicin celebrada:


2. Cul es la historia o el origen de la costumbre o tradicin que se celebra
en tu comunidad?
3. 4XpVLJQLFDGRWLHQHHVWDFRVWXPEUHRWUDGLFLyQ"
4. 4XpHOHPHQWRVVHLQYROXFUDQHQVXFHOHEUDFLyQ WLSRGHFRPLGDDGRUQRVYHVWXDULRGDQ]DVFDQFLRQHVHWFpWHUD"
5. 4XpKDFHVSDUDSUHVHUYDUODFRVWXPEUHRWUDGLFLyQTXHVHFHOHEUDHQ
tu comunidad?
Guarda el desarrollo y solucin de esta actividad en tu portafolio de evidencias.

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Muchas de las costumbres y tradiciones que se celebran en diversos lugares
son una mezcla de varios factores que aportaron personas de distintas culturas. Este intercambio se hace posible gracias a la convivencia, en un proceso
que tiene que ver con la interaccin entre los diversos grupos que conforman
una sociedad determinada.
Cuando se habla de multiculturalidad, generalmente se asocia con la idea de
YDULDVFXOWXUDVTXHFRQYLYHQHQXQPLVPRHQWRUQR6LQHPEDUJRHOWpUPLQR
WDPELpQVHDSOLFDDOSURFHVRHQTXHXQDFXOWXUDKDFHVX\RV\VHHQULTXHFHFRQ
elementos de otras culturas (Jaramillo, 2011). Estos elementos pueden ser tan
complejos como los educativos y religiosos, hasta aspectos que se adaptan
a nuestra vida cotidiana, como la manera de vestir, de hablar o los productos
comerciales. Un ejemplo de ello es el uso de los pantalones de mezclilla, que
IXHURQHODERUDGRVDPHGLDGRVGHOVLJOR;,;GXUDQWHODpSRFDGHOauge de las
minas de oro en el oeste de Estados Unidos. Los hombres que trabajaban
en ellas necesitaban pantalones de un material resistente y cmodo que soportara el rigor del trabajo duro (Velarde, 2012). Con el tiempo, el uso de los
pantalones de mezclilla se ha vuelto comn prcticamente en todo el mundo,
y seguramente t cuentas con al menos un par de ellos.

Auge. momento de mayor elevacin o intensidad de un proceso,


un estado o una cualidad. Ejemplo: el auge del turismo se produce en julio y agosto.

86
84

Vinculas la cultura con la comunicacin pblica

Sabas que...
Los pantalones de mezclilla o vaqueros son,
sin duda, una de las prendas favoritas del
mundo entero. Actualmente, adems de su uso
en diversos trabajos pesados, la mezclilla se ha
convertido en un cono de multicultural debido
a la rpida adaptacin que tuvo en distintos
lugares y culturas (Trujillo, 2003).

Actividad de aprendizaje 2
Instrucciones: con base en las preguntas que contestaste en la actividad anterior,
vas a elaborar un texto en donde desarrolles una propuesta para difundir esta costumbre o tradicin fuera de tu comunidad. Cuando termines tu escrito vas a evaluarlo con la siguiente rbrica.

Criterios

Excelente
(2 puntos)

Bien
(1 punto)

Regular

(0.5 puntos)

Necesita
acompaamiento
(0 puntos)

Total

Expone la informacin
investigada
de manera clara y
concreta.
Su propuesta es
FUHDWLYD 5HHMD
XQD SODQLFDFLyQ
cuidadosa.
Existe un desarrollo lgico de ideas.
La redaccin es
FRKHUHQWH\XLGD
La ortografa y redaccin son adecuadas.
El trabajo se entrega limpio y en
el formato indicado
por el asesor.
&DOLFDFLyQ

87
85

loque IV

Vinculas la cultura con la comunicacin pblica

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Cuando los elementos de alguna cultura salen de su lugar de origen para establecerse en otras, se da un proceso que tiene que ver con la difusin de las
costumbres y tradiciones de un lugar en un contexto a veces muy distinto, pero
por la capacidad de adaptacin que tienen estos productos culturales, se convierten en un fenmeno a gran escala que se conoce como cultura de masas.

Actividad de aprendizaje 3
Instrucciones: la cultura de masas tiene mucho que ver con la interaccin entre la
cultura y los medios masivos de comunicacin. En binas, recuerden algn programa
o telenovela que hayan visto por televisin y respondan las siguientes preguntas.
Cuando terminen, comparen sus respuestas con el resto del grupo.
1. Cmo era el lugar en el que vivan los personajes que aparecan?
2. Cmo se expresaban? Haba algunos personajes que hablaran distinto que los otros?
3. &yPRHUDODDSDULHQFLDItVLFDGHORVSHUVRQDMHV"4XpURSDXWLOL]DEDQ"
4. En la trama aparecan algunas cosas que pudieras relacionar con tu
FRQWH[WR"3RUTXp"

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
En algunos contenidos que aparecen en los medios de comunicacin, podemos ver ejemplos de la cultura que no necesariamente corresponden con la
tuya. Sin embargo, puedes ver que algunas cosas son similares, y esto se
debe a que gracias a la difusin de diversos elementos, los mismos se combinan con otras culturas, haciendo una mezcla muy heterognea.

88
86

Vinculas la cultura con la comunicacin pblica

Heterognea: 
Asimilados: aceptar una situacin o adaptarse a ella.

Aprende ms
Cultura de masas
En la cultura de masas, la propia cultura, la vida privada, el pensamiento y otros
DVSHFWRV FRPLHQ]DQ D VHU GLIXQGLGRV D JUDQ HVFDOD \ SRSXODUL]DGRV D WUDYpV GH
los medios de comunicacin (Magalln, 2010). Diversas comunidades han visto
que se exportan algunos elementos de su cultura y que son asimilados por otras
sociedades alrededor del mundo.

Imagen A

Imagen B

La imagen A retrata algo que seguramente conoces y has consumido, que son los
tacos. La imagen B es una variacin hecha en Estados Unidos, llamada ensalada
de taco. Como ya habrs notado, el elemento cultural fue un platillo tpicamente
mexicano que fue llevado a otro lugar y adaptado a las costumbres del mismo,
variando algunos ingredientes que se utilizan ah. ste es un pequeo ejemplo de
FyPRODFXOWXUDGHPDVDVLQX\HGHPDQHUDLPSRUWDQWHHQODYLGDGHODVSHUVRQDV

89
87

loque IV

Vinculas la cultura con la comunicacin pblica

Actividad de aprendizaje 4
Instrucciones: renete con el compaero con quien realizaste la actividad anterior.
A partir del programa o telenovela que eligieron, retomen el modelo de la tuba de
Schramm visto en el bloque II. En su libreta van a sustituir los elementos que aparecen en el modelo con la informacin que saben sobre el programa o la telenovela.
Apyense en las siguientes preguntas:
 4XpLQIRUPDFLyQFUHHVTXHGHFRGLFDLQWHUSUHWD\FRGLFDHOHPLVRU"
 4XpWLSRGHPHQVDMHWUDQVPLWH"
 4XLpQHVHOS~EOLFRPDVLYRTXHUHFLEHHOPHQVDMH"
 Cmo incluiras a la comunidad en que vives dentro del modelo?
 Cmo te incluiras t en el modelo?
 Cmo crees que se da la retroalimentacin en este caso?
Cuando terminen, comenten la informacin en plenaria con su asesor.
Guarda el desarrollo y solucin de esta actividad en tu portafolio de evidencias.

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
El modelo de la tuba de Schramm, utilizado para evaluar la comunicacin colectiva, fue impulsado por los avances tecnolgicos. En este caso, la televisin
funciona como transmisor del mensaje de un emisor hacia el pblico masivo,
el cual lo interpreta dependiendo de su situacin cultural. En el caso de la cultura de masas, este intercambio de informacin y la adopcin de nuevas costumbres, tradiciones y valores suponen el principio de un fenmeno conocido
como globalizacin.

Plenaria: que cuenta con la asistencia de todas las personas que


forman un grupo.
Moldear: formar a una persona o grupo para que desarrolle cualidades determinadas siguiendo un modelo.

90
88

Vinculas la cultura con la comunicacin pblica

Aprende ms
Globalizacin
/HHODVVLJXLHQWHVGHQLFLRQHVGHglobalizacin:
1. Una primera idea de globalizacin
dice que es el proceso de reducir
barreras entre los pases y
promover relaciones econmicas,
polticas y sociales ms estrechas
(Tabb, en Saxe-Fernndez, 1999).
2. Es el aumento de las relaciones
sociales a nivel mundial que enlaza
lugares distantes de tal manera que
los sucesos locales son moldeados
por sucesos que ocurren a muchos
kilmetros de distancia (Giddens,
citado en Mittelman, 2002).

Actividad de aprendizaje 5
InstruccionesGHVSXpVGHOHHUODVGHQLFLRQHVGHJOREDOL]DFLyQUHH[LRQDVREUH
los aspectos ms importantes de las mismas. Ahora crea un concepto de globalizacin con tus propias palabras que incluya las dos ideas anteriores:
Globalizacin es __________________________________________________
__________________________________________________________________
__________________________________________________________________
Guarda el desarrollo y solucin de esta actividad en tu portafolio de evidencias.

91
89

loque IV

Vinculas la cultura con la comunicacin pblica

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Como puedes ver, es posible considerar como aspectos positivos de la globalizacin la reduccin de las barreras entre los pases, que fomentan la integracin en muchos mbitos de la vida de sus habitantes. Sin embargo, un efecto
que genera a nivel local es que las personas poco a poco adoptan costumbres
TXHOHVVRQLPSXHVWDVGHPDQHUDJUDGXDOJUDFLDVDODLQXHQFLDGHGLVWLQWRV
elementos, como pueden ser los medios masivos de comunicacin.

Aprende ms
Globalizacin de la cultura
En general, la principal diferencia entre cultura de masas y globalizacin es que
en la cultura de masas, un elemento cultural sale de un lugar para insertarse en
otro contexto (como el ejemplo del taco que viste anteriormente en este bloque),
mientras que en la globalizacin, entran distintos aspectos de otras culturas para
combinarse con las costumbres y hbitos locales debido, muchas veces, a la accin
de los medios de comunicacin. En este sentido, hablar de una globalizacin de la
FXOWXUDVLJQLFDODPDQHUDHQTXHODFXOWXUDGHXQOXJDUVHPH]FODFRQWRGRVHVRV
HOHPHQWRVTXHHQWUDQHQHOODPRGLFDQGRODYLGDGHXQDFRPXQLGDG
Recuerda el caso de los pantalones de mezclilla que viste en este bloque. Como
sabrs, esta prenda fue utilizada por primera vez en Estados Unidos, y con el paso
del tiempo se ha convertido en un artculo de uso comn en muchas partes del
mundo.
Otro caso de un producto proveniente de ese pas es el refresco Coca-Cola, creado
HQSRUXQFRURQHOGHOHMpUFLWRGHOVXUGH(VWDGRV8QLGRVOODPDGR-RKQ6W\WK
Pemberton. Por medio de estrategias publicitarias y comerciales, Coca-Cola ha
llegado a todo el mundo y multiplicado sus ventas y ganancias (Flores & Visone,
2007). Ambos artculos han pasado a formar parte de la vida diaria de varias
comunidades, y como puedes ver, entraron a la cultura local para combinarse con
las costumbres y hbitos de las personas.

92
90

Vinculas la cultura con la comunicacin pblica

(VLPSRUWDQWHTXHFRQR]FDVDOJXQRVIDFWRUHVTXHLQX\HQHQODJOREDOL]DFLyQGHOD
cultura. Segn Fernando Martnez Vzquez (2014), en general podemos hablar de
tres aspectos importantes:
1. /DH[SRVLFLyQGHGLVWLQWRVHOHPHQWRVFXOWXUDOHVDWUDYpVGHORVPHGLRVGH
comunicacin masiva.
2. La construccin de modelos de ser, parecer y actuar, creando estereotipos.
3. La devaluacin de la herencia, costumbres y tradiciones de contextos
locales.

Sabas que...
Los esteretipos son imgenes o ideas aceptadas comnmente por un grupo o
por una sociedad. Presenta de manera simple la realidad por medio de distintos
elementos como atributos fsicos, comportamientos y valores. Un estereotipo
muy extendido es que, en algunas historias de televisin o pelculas, el malo
es representado como alguien fsicamente feo, mientras que al bueno lo
retratan como alguien bello, siguiendo reglas que poco tienen que ver con la
realidad.

93
91

loque IV

Vinculas la cultura con la comunicacin pblica

Cierre del bloque IV

5HH[LRQDVREUHORDSUHQGLGR
Todos los hbitos y las costumbres que tienes forman parte de tu cultura. Adems
de esto, eres heredero de una mezcla que pasa por tu pasado prehispnico
y la colonizacin espaola, que genera uno de los mayores antecedentes de
multiculturalidad que existen.
La diversidad cultural se debe asumir de manera respetuosa considerando las
libertades individuales y el derecho de las personas de participar en la vida cultural
de su comunidad. Adems, conocer el proceso en que una cultura hace suyos y se
enriquece con elementos de otras culturas te permitir entender mejor el contexto
en el que vives.
La cultura de masas se da cuando distintos elementos de un lugar se difunden a
WUDYpVGHGLVWLQWRVPHGLRVSDUDH[SRUWDUVH\VHUDVLPLODGRVSRURWUDVVRFLHGDGHV
DOUHGHGRUGHOPXQGR7DPELpQKD\RFDVLRQHVHQTXHHQWXFXOWXUDHQWUDQDVSHFWRV
provenientes de otros lugares que se combinan con tus costumbres y hbitos.
Cuando esto sucede, hablamos de una globalizacin de la cultura, lo cual puede
darse por distintos factores, como la accin de los medios de comunicacin, la
construccin de modelos de ser, parecer y actuar, y la devaluacin de la herencia,
costumbres y tradiciones de contextos locales.
(QHVWDRFDVLyQYDVDUHH[LRQDUVREUHORVYLVWRHQHOEORTXHXWLOL]DQGRHOVLJXLHQWH
cuadro.
Concepto (con tus
propias palabras)

5HHMRHQWX
comunidad

'LEXMRVREUHHO
UHHMRHQWX
comunidad

Multiculturalidad
Cultura de masas
Globalizacin
Globalizacin de la
cultura

Instrucciones: copia en tu libreta el cuadro anterior y escribe la informacin que se


te pide. No olvides redactar el concepto, con tus propias palabras, de cada uno de
los temas vistos en este bloque.
(QODFROXPQD5HHMRHQWXFRPXQLGDGGHVFULEHXQHMHPSORGHFDGDXQRGHORV

94
92

Vinculas la cultura con la comunicacin pblica

temas que veas o hayas visto en tu comunidad. Hazlo en forma de relato para poner
en prctica tus habilidades de comunicacin escrita.
Finalmente, elabora un dibujo que represente el contenido que acabas de relatar.
5HFXHUGD KDFHUOR FXLGDGRVDPHQWH \ HQ OLPSLR FRQ HO Q GH SUHVHQWDU XQ EXHQ
trabajo. Al terminar revisa tu trabajo con la siguiente rbrica.

Criterios

Uso de los temas vistos en


el bloque.

Necesita
acompaamiento
0 puntos
Utiliza la informaUtiliza la informaCasi no utiliza la
cin estudiada en el cin estudiada en el informacin estubloque para elabobloque para elabodiada en el bloque
rar el contenido del rar el contenido del para elaborar el
cuadro de forma
cuadro.
contenido del
clara y creativa.
cuadro.
Muy bien
2 puntos

Descripcin clara y
Profundizacin
sustancial del cuadel tema.
dro y buena cantidad de detalles.
Cuadro bien organizado y claramente
Aclaracin sopresentado, as
bre el tema.
como de fcil seguimiento.
Cuadro sobresaliente y atractivo,
que cumple con los
Alta calidad en criterios de diseo
el diseo.
planteados, sin errores de ortografa.

Presentacin
del cuadro.

La presentacin
fue hecha en
tiempo y forma,
adems de que se
entreg de forma
limpia en el formato establecido.

Regular
1 punto

Total

Descripcin ambigua del cuadro;


algunos detalles no
FODULFDQHOWHPD
Cuadro bien focalizado, pero no
VXFLHQWHPHQWH
organizado.

Descripcin incorrecta del cuadro,


VLQGHWDOOHVVLJQLcativos o escasos.
Cuadro impreciso
y poco claro, sin
coherencia entre
las partes que lo
componen.
Cuadro simple, pero Cuadro mal
bien organizado con planteado que no
al menos tres erro- cumple con los
res de ortografa.
criterios de diseo
planteados y con
ms de tres errores de ortografa.

La presentacin
fue hecha en tiempo y forma, aunque la entrega no
fue en el formato
establecido.

La presentacin
no fue hecha en
tiempo y forma,
adems la entrega no se dio de
la forma establecida por el
docente.
&DOLFDFLyQ

Fuente: Centro Universitario de Desarrollo Intelectual (2013). Catalogo de rbricas para la


evaluacin del aprendizaje. Disponible en http://evirtual.uaslp.mx/FCQ/estrategias/Material%20
de%20Apoyo/cat_rubrica.pdf [Consulta: 28/06/2015].

95
93

loque IV

Vinculas la cultura con la comunicacin pblica

Autoevaluacin
5HDOL]DXQUHFXHQWRVREUHORVDSUHQGL]DMHVREWHQLGRVHQHOEORTXHLGHQWLFDQGRWX
nivel de avance conforme a la siguiente escala:
 ([FHOHQWHORJUpHODSUHQGL]DMHGHPDQHUDLQGHSHQGLHQWH
3 = Bueno, requer apoyo para construir el aprendizaje.
 5HJXODUIXHGLItFLOHOSURFHVRGHDSUHQGL]DMH\ORORJUpSDUFLDOPHQWH
 ,QVXFLHQWHQRORJUpHODSUHQGL]DMH
Revisa a detalle con tu profesor y/o con algunos compaeros aquellos aspectos
donde sea necesario reforzar los aprendizajes.

Contenidos

Conceptuales

Explicas el concepto de cultura.


Conoces los diferentes aspectos
componen la multiculturalidad.

que

Reconoces el concepto de cultura de masas.


Comparas los conceptos de cultura de masas
\JOREDOL]DFLyQHLGHQWLFDVVXVGLIHUHQFLDV

Procedimentales

Analizas el concepto de globalizacin y cmo


LQX\HHQWXFRQWH[WR
Analizas el concepto de cultura y lo relacionas
con tu entorno.
5HH[LRQDVVREUHORVHOHPHQWRVTXHLQX\HQ
en la multiculturalidad y la cultura de masas.
Elaboras tu propio concepto de globalizacin.

Actitudinales

Discutes los efectos de la globalizacin de la


cultura en tu comunidad.

96
94

Valoras tu propia multiculturalidad.


Respetas el trabajo de los dems durante tu
participacin en equipo.
Valoras los contenidos y actividades propuestas
y te esfuerzas por cumplirlas correctamente.

Nivel de avance
3
2

BLOQUE V
(VWDEOHFHVODLQXHQFLDGHLQWHUQHW
en la sociedad y cultura actuales

loque V

Qu aprenders y cmo organizars tu estudio?

Bloque V

12

HORAS

Objetos de aprendizaje que se


abordan
Origen de Internet
Recursos disponibles en Internet
Navegadores
Buscadores
Mensajera instantnea
Wikis
Redes sociales
,QXHQFLDGH,QWHUQHWHQODVRFLHGDG

Desempeos esperados
al concluir el bloque


(VWDEOHFH OD LQXHQFLD GH OD ,QWHUQHW


FRPRPHGLRGHFRPXQLFDFLyQHQODVRFLHGDG \ FXOWXUD DFWXDOHV D WUDYpV GHO
anlisis de los diferentes discursos encontrados en la red.

Competencias disciplinares
extendidas del campo de la
Comunicacin





Productos de aprendizaje





98
96

Lnea del tiempo en la que presentas el


RULJHQGH,QWHUQHW
(QFXHVWDVREUHHOXVRGHOD,QWHUQHWHQWX
comunidad.
Tabla sobre el impacto social positivo y neJDWLYRGHOXVRGH,QWHUQHW
Escrito sobre la experiencia que tuviste en
HOSDQHO(OLPSDFWRGH,QWHUQHWHQWXFRmunidad.

Utiliza la informacin contenida en


diferentes textos para orientar sus
intereses en mbitos diversos.
(VWDEOHFH
UHODFLRQHV
DQDOyJLFDV
FRQVLGHUDQGR ODV YDULDFLRQHV Op[LFR
semnticas de las expresiones para la
toma de decisiones.
Debate sobre problemas de su entorno
fundamentando sus juicios en el anlisis
y en la discriminacin de la informacin
emitida por diversas fuentes.
Propone soluciones a problemticas de su
FRPXQLGDGDWUDYpVGHGLYHUVRVWLSRVGH
WH[WRV DSOLFDQGR OD HVWUXFWXUD GLVFXUVLYD
YHUEDORQRYHUEDO\ORVPRGHORVJUiFRV
RDXGLRYLVXDOHVTXHHVWpQDVXDOFDQFH
$SOLFDORVSULQFLSLRVpWLFRVHQODJHQHUDFLyQ
y tratamiento de la informacin.
Determina la intencionalidad comunicativa
en discursos culturales y sociales para
restituir la lgica discursiva a textos
FRWLGLDQRV\DFDGpPLFRV
9DORUD OD LQXHQFLD GH ORV VLVWHPDV \
PHGLRV GH FRPXQLFDFLyQ HQ VX FXOWXUD
VX IDPLOLD \ VX FRPXQLGDG DQDOL]DQGR
y comparando sus efectos positivos y
negativos.
$QDOL]DORVEHQHFLRVHLQFRQYHQLHQWHVGHO
uso de las tecnologas de la informacin y
la comunicacin para la optimizacin de
las actividades cotidianas.
Aplica las tecnologas de la informacin y la
comunicacin en el diseo de estrategias
SDUD OD GLIXVLyQ GH SURGXFWRV \ VHUYLFLRV
HQ EHQHFLR GHO GHVDUUROOR SHUVRQDO \
profesional.

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Introduccin
La Internet ha revolucionado la forma en que la humanidad transmite informacin.
Representa uno de los mejores ejemplos de comunicacin, tecnologa y comunidad
TXHH[LVWHQPRGLFDQGRODPDQHUDHQTXHODVSHUVRQDVLQWHUDFW~DQHQWUHHOODVVLQ
importar las distancias y los recursos: basta con tener una conexin a la red mundial
y automticamente ingresas a un universo de informacin con oportunidades casi
LQQLWDV
Hasta hace algunos aos, platicar con otra persona a travs del audio y el video
era prcticamente un sueo. Actualmente existen diversos recursos en Internet
que te permiten ver y escuchar en vivo a alguien del otro lado del planeta, y a
su vez, esa persona puede verte y escucharte al mismo tiempo, lo que permite
generar una comunicacin inmediata, ms barata y sencilla que comunicarte con
ella por telfono. Del mismo modo, podras escribirle casi a diario gracias a los
distintos medios disponibles, como son el correo electrnico y las redes sociales.
Sin embargo, la gran cantidad de informacin disponible en estos medios hace
necesario que desarrolles diversas habilidades de anlisis para que seas capaz de
distinguir los contenidos importantes de aquellos que no aportan nada valioso para
tu crecimiento personal y el de tu comunidad. En este bloque descubrirs en qu
consiste todo esto que te acabamos de mencionar, para ampliar tus conocimientos
sobre Internet y aumentar tus posibilidades de comunicacin.

Mapa de objetos de aprendizaje


Navegadores
Origen de la
internet
Buscadores
Estableces la
LQXHQFLDGH
internet en la
VRFLHGDG\FXOWXUD
DFWXDOHV

Recursos
disponibles en
internet

Mensajera
instantnea

Wikis
,QXHQFLDGH
internet en la
sociedad

Redes
sociales

99
97

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

3DUDLQLFLDUUHH[LRQD
,QVWUXFFLRQHV: guiados por tu asesor, van a realizar una lluvia de ideas para generar
XQDGHQLFLyQGHOFRQFHSWRInternet/OXYLDGHLGHDVVLJQLFDTXHWRGRVYDQDDSRUWDU
opiniones y puntos de vista de manera individual para llegar a una idea que todo
el grupo comparta. Para comenzar, en una hoja de papel, responde a la siguiente
pregunta: Para ti, qu es Internet?
$KRUD W~ \ WXV FRPSDxHURV FRORFDUiQ ODV KRMDV FRQ ODV UHVSXHVWDV HQ OXJDUHV
visibles del saln de clases. Con ayuda del asesor van a ordenar las hojas de tal
forma que junten aquellas que contengan elementos similares, y despus elaboren
XQDGHQLFLyQJUXSDOGHORTXHHV,QWHUQHW\DQyWDODHQVLJXLHQWHHVSDFLR
Internet es _______________________________________________________
__________________________________________________________________
__________________________________________________________________
'HVSXpVGHDQRWDUODGHQLFLyQDODTXHOOHJDURQFRPHQWHQORVLJXLHQWH
 'HTXpPDQHUDLQX\yWXH[SHULHQFLDHQHOXVRGH,QWHUQHWSDUDFUHDUWX
GHQLFLyQ"
 Para qu has utilizado Internet?
 Crees que puedes utilizar Internet para algo ms?
Comenten las respuestas a estas preguntas en plenaria con tu asesor.

Origen de Internet
Para familiarizarte con la historia de Internet, revisa el siguiente texto.
2UtJHQHVGHOD,QWHUQHW
La primera descripcin documentada acerca de las interacciones sociales que
podran ser propiciadas a travs del networking (trabajo en red) est contenida en
una serie de escritos desarrollados por Joseph Licklider, informtico estadounidense,
en agosto de 1962, en los cuales habla sobre su concepto de Galactic Network
(Red Galctica). l imagin una red interconectada mundialmente a travs de la
cual las personas pudieran acceder desde cualquier lugar a datos y programas.

100
98

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

El concepto era muy parecido a la Internet actual. Licklider fue el principal responsable
del programa de investigacin en computadoras de la DARPA (Agencia de Proyectos
de Investigacin Avanzados de Defensa, en ingls Defense Advanced Research
Projects Agency, que es un rea del Departamento de Defensa de Estados Unidos
que se encarga de desarrollar nuevas tecnologas para uso militar) desde octubre
de 1962. Mientras trabaj en DARPA, Licklider convenci a sus sucesores, entre
ellos al investigador del Instituto Tecnolgico de Massachusetts, Lawrence Roberts,
de la importancia del concepto de trabajo en red.
Un paso fundamental en el origen de la internet fue hacer dialogar a las computadoras
entre s. Para explorar este terreno, en 1965, Roberts conect una computadora
TX2 en Massachusetts con una Q-32 en California a travs de una lnea telefnica,
creando as la primera (aunque reducida) red de computadoras jams construida.
El resultado del experimento fue darse cuenta de que las computadoras podan
trabajar juntas correctamente, ejecutando programas y recuperando datos en otra
mquina a larga distancia. Sin embargo, el sistema telefnico de ese entonces era
WRWDOPHQWHLQDGHFXDGRSDUDODODERUSRUORTXHVHFRQUPDEDODQHFHVLGDGGHRWUR
tipo de conexin.
$ QDOHV GH  5REHUWV VH WUDVODGy D OD '$53$ D GHVDUUROODU HO FRQFHSWR GH
red de computadoras y rpidamente confeccion su plan ARPANET (Advanced
5HVHDUFK3URMHFWV$JHQF\1HWZRUNSRUVXVVLJODVHQLQJOpVTXHVLJQLFD5HGGH
la Agencia de Proyectos de Investigacin Avanzados) publicndolo en 1967. En la
conferencia en la que present el documento se expona tambin un trabajo sobre
el concepto de red de paquetes a cargo de Donald Davies y Roger Scantlebury.
Scantlebury le habl a Roberts sobre su trabajo con Paul Baran, que consista en
un documento sobre redes de paquetes para comunicacin vocal segura en el
mbito militar. La palabra packet (paquete) fue adoptada a partir de este trabajo
y la velocidad de la lnea propuesta para ser usada en el diseo de ARPANET fue
aumentada para mejorar la conexin remota.
En agosto de 1968, despus de que Roberts y la comunidad de la DARPA mejoraron
ODHVWUXFWXUDJOREDO\ODVHVSHFLFDFLRQHVGH$53$1(7'$53$ODQ]yXQSUR\HFWR
para el desarrollo de uno de sus componentes clave: los conmutadores de paquetes
llamados Interface Message Processors (IMPs, Procesadores de Mensajes de
Interfaz).
La conmutacin por paquetes comenz a establecerse en septiembre de 1969.
(VWRVLJQLFyODFRORFDFLyQGHGLVWLQWRVSXQWRVGHFRQH[LyQOODPDGRVQRGRVTXH
se refera al lugar en el que habra una computadora preparada para conectarse a
ARPANET. Los nodos que se establecieron fueron los siguientes:

8&/$

6WDQIRUG

65,

8QLYHUVLGDGGH&DOLIRUQLD

8QLYHUVLGDGGH6DQWD%iUEDUD

8QLYHUVLGDGGH8WDK
Se siguieron conectando ordenadores rpidamente a la ARPANET durante los aos
siguientes y el trabajo continu para completar una red funcionalmente completa,
as como tecnologa adicional de red. Cuando en los nodos de ARPANET se

101
99

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

FRPSOHWyODFRQH[LyQHQORVXVXDULRVGHODUHGSXGLHURQQDOPHQWHFRPHQ]DU
a desarrollar aplicaciones y a transmitir informacin, quedando ARPANET de la
siguiente forma:

Estructura de ARPANET en 1971 dentro del territorio de Estados Unidos.

En octubre de 1972, se organiz una gran y muy exitosa demostracin de ARPANET


en la International Computer Communication Conference. sta fue la primera
GHPRVWUDFLyQS~EOLFDGHODQXHYDWHFQRORJtDGHUHG)XHWDPELpQHQFXDQGR
se introdujo la primera aplicacin estrella: el correo electrnico.
En marzo se cre la aplicacin de envo/recepcin de mensajes de correo electrnico,
impulsado por la necesidad que tenan los desarrolladores de ARPANET de un
mecanismo sencillo de coordinacin. En julio, Roberts expandi su valor aadiendo
el primer programa de utilidad de correo electrnico para relacionar, leer, almacenar,
reenviar y responder mensajes. Desde entonces, la aplicacin de correo electrnico
VH FRQYLUWLy HQ OD PD\RU GH OD UHG GXUDQWH PiV GH XQD GpFDGD )XH SUHFXUVRUD
del tipo de actividad que observamos hoy da en la internet, es decir, del enorme
crecimiento de todas las formas de comunicacin persona a persona.
)XHQWH/HLQHU%0&HUI9*&ODUN''.DKQ5(.OHLQURFN//\QFK'&
Postel, J. Roberts, L.G. & Wolff, S. (1997). A Brief History of Internet. Communications
Magazine. Disponible en http://www.escet.urjc.es/~iae/documentos/Practica3Original.
pdf [Consulta: 26/06/2015].

102
100

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Actividad de aprendizaje 1
,QVWUXFFLRQHV: forma un equipo con tus compaeros. Con la informacin anterior,
elaboren una OtQHDGHOWLHPSR que muestre el origen de Internet y su desarrollo.
Toma en cuenta lo que ha sucedido en tu comunidad.
/DOtQHDGHOWLHPSRHVXQDVHFXHQFLDTXHFRQODD\XGDGHLQIRUPDFLyQ\JUiFRV
(es decir, con dibujos o ilustraciones) retrata acontecimientos y procesos colocados
HQIRUPDOLQHDOFRQHOQGHGDUWHFXHQWDFXiOHVRFXUULHURQDOPLVPRWLHPSRFXiQWR
tiempo duraron o cmo se relacionan. El siguiente es un ejemplo de lnea del tiempo
que retrata las distintas edades de la historia de la humanidad para que te gues al
realizar tu trabajo


)XHQWH9i]TXH]/HyQ( 5HGLQJ%RUMDV*  /tQHDGHOWLHPSR'LVSRQLEOHHQ


http://www.prepa9.unam.mx/historia/documentos/4.pdf [Consulta: 27/06/15].
Imagen: Revista Educativa El Arcn de Clo (http://www.elarcondeclio.com.ar/)

Por ejemplo:

Debern ser lo ms creativos posible para la elaboracin de su trabajo. Revisa muy


bien el texto que leste para que ayudes a tu equipo en el diseo de su lnea del
tiempo. Pueden incluir dibujos, recortes o cualquier elemento que les permita presentar su trabajo de la mejor manera.

103
101

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

$OWHUPLQDUUHYLVDWXWUDEDMRFRQODVLJXLHQWHU~EULFD

Criterios
Seleccin de
los hechos relevantes

Organizacin

Creatividad y
calidad

Imgenes

El equipo trabaj activa y


respetuosamente

Necesita
5HJXODU
DFRPSDxDPLHQWR Total
SXQWR
SXQWRV
Realiza una seHace una recopiElige sucesos del
leccin adecuada,
lacin aceptable
tema sin demosfechada y cronol- de la informacin
trar una seleccin
gica de los hechos ms importante del cuidadosa, por lo
ms importantes
tema.
que omite sucesos
del tema.
importantes o incluye algunos de poca
relevancia.
Es capaz de agru,GHQWLFDDOJXQRV
,GHQWLFDDOJXQRV
par de forma adehechos que le
hechos, pero el
cuada todos y cada parecieron relevan- WUDEDMRQRUHHMDXQ
uno de los hechos
tes, pero se aprecia proceso de organirelevantes. Expone cierto desorden
zacin adecuado.
de manera ordena- en la relacin de
da los sucesos y las los sucesos y las
fechas, respetando fechas.
la relacin entre
ambas.
Presenta un trabajo Desarrolla un
Presenta un tracolorido, llamativo, trabajo aceptable
EDMRTXHQRUHHMD
limpio y original con y limpio, pero no
aspectos creativos
los datos necesaUHHMDXQHVIXHU]R ni de cuidado en la
rios.
creativo para la
exposicin de los
exposicin de los
datos.
datos.
Selecciona imExpone imgeNo utiliza imgegenes de calidad
nes adecuadas al
nes, o no estn
relacionadas con el contenido del texto, relacionadas con el
contenido del texto, sin embargo, son
contenido del texto.
adems de colode baja calidad y
carlas de manera
no estn colocadas
formal y correcta.
de manera formal y
correcta.
S
En ocasiones
No
Bien
SXQWRV

&DOLFDFLyQ

104
102

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
ARPANET fue el SUHFXUVRU directo de Internet. Aunque su origen tuvo que
ver con una organizacin militar, esta red de comunicacin evolucion hasta
convertirse en un medio que cualquier persona puede utilizar para obtener
conocimientos y ampliar la visin que tiene del mundo. Sin embargo, debido
a que todos pueden crear contenidos en la red, hay veces que la informacin
TXHHQFXHQWUDVQRHVGHOWRGRFRQDEOHSRUORTXHHVQHFHVDULRTXHUHH[LRnes en tres cosas cosas: primero, cules son los recursos ms comunes que
encontrars en Internet, segundo, de qu manera analizars la informacin
que vas a obtener por este medio y tercero, cmo generaras contenidos para
utilizar internet

Precursor: Y

Sabas que...
El primer correo electrnico en la historia fue enviado en 1971 y contena el
siguiente texto: QWERTYUIOP. Este conjunto de letras las puedes encontrar
en la primera lnea de los teclados de las computadoras, cuya estructura est
basada en las mquinas de escribir.
)XHQWH <DUHW ,   )LUVW 0HVVDJHV RQ 7ZLWWHU ,0 7HOHJUDSK DQG 0RUH
1HZVZHHN 'LVSRQLEOH HQ KWWSZZZQHZVZHHNFRPUVWPHVVDJHVWZLWWHULP
telegraph-and-more-79479 [Consulta: 27/06/2015].

105
103

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

$SUHQGHPiV
5HFXUVRVGLVSRQLEOHVHQ,QWHUQHW
Observa el siguiente esquema. En l se encuentran los principales recursos que
podrs encontrar en Internet.

Esquema de los principales recursos disponibles en Internet.

Navegadores
Son herramientas que nos permiten conectar con Internet desde una computadora
y ver las pginas o portales (Ballestar, 2006). Como su nombre lo indica, a travs de
ellos puedes navegar por el mar de informacin que ofrece la web.

Logo de Internet Explorer, navegador que viene


integrado en las computadoras con el sistema
operativo Windows, de la compaa Microsoft.

106
104

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Web.   /     

Buscadores
Los buscadores emplean programas de computadora que saltan de una pgina
a otra en la red, recogiendo pginas y almacenando toda la informacin en una
gigantesca base de datos (Ballestar, 2006). Cuando utilizas un buscador, escribes
palabras clave sobre la informacin que ests buscando. Por ejemplo, si quisieras
VDEHUVREUHHOVLJQLFDGRGHODVOHWUDVwww que aparecen al inicio de las direcciones
de las pginas de Internet, aparecera lo siguiente:

Ejemplo de uso del buscador Google.

Google es el buscador ms popular de Internet, y se reporta que mensualmente es


utilizado 1.17 billones de veces por gente alrededor del mundo (Smith, 2014).

107
105

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

0HQVDMHUtDLQVWDQWiQHD
Cuando se habla de este recurso de la web, existen dos variantes del mismo: el
correo electrnico y el chat.
Antes debes saber que la mensajera instantnea permite el intercambio de mensajes
entre dos personas conectadas a Internet (Ministerio de Educacin y Cultura, 2013).
La principal diferencia entre el correo electrnico y el chat es que el primero permite
DOPDFHQDUORVPHQVDMHV\DXQTXHHOFKDWQRODYHQWDMDGHHVWH~OWLPRHVTXHHO
intercambio de mensajes es inmediato. La mensajera instantnea ha evolucionado
hasta incluir el intercambio de mensajes de audio y video, incluso en tiempo real,
como el servicio proporcionado por Skype.

Skype permite a las personas comunicarse con audio y video sin importar el lugar en el que se
encuentren, ofreciendo la oportunidad de conectarse con varios usuarios a la vez.

Wikis
Esta herramienta permite a las personas realizar trabajo colaborativo en la creacin
de contenidos en una pgina de Internet (Ballestar, 2006). Para que comprendas
PHMRUORTXHHVXQDZLNLSLHQVDTXHHVFRPRFXDQGRW~UHDOL]DVXQDDFWLYLGDGHQ
HTXLSRHQODTXHWRGRVDSRUWDQLGHDV\JHQHUDQXQGRFXPHQWRHQGRQGHVHUH~QHQ
precisamente, esas ideas. El ejemplo ms conocido de una wiki es una red llamada
Wikipedia, que es como una gigantesca enciclopedia en lnea en donde puedes
obtener informacin escrita por distintas personas que saben acerca de un tema.

5HGHVVRFLDOHV
3RU~OWLPRXQRGHORVUHFXUVRVTXHVHKDSRSXODUL]DGRHQORV~OWLPRVDxRVHQWUH
las personas que acceden a Internet es el uso de las social media o redes sociales.

108
106

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

stas son plataformas de comunicacin online


donde el contenido es creado por los propios
usuarios, facilitando la HGLFLyQ, la publicacin
y el intercambio de informacin, lo que ha
revolucionado la forma en que la gente se
comunica. Los tipos ms utilizados dentro del
social media son las redes sociales, los blogs
y los servicios de comparticin multimedia
(Universidad de Murcia, 2011).

Online: /
        

Edicin: 

Esquema del social media.


)XHQWH8QLYHUVLGDGGH0XUFLD   Glosario de redes sociales y Community Management.
Disponible en http://www.um.es/cursos/promoedu/redessociales/glosario/ [Consulta: 27/06/15].

109
107

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Actividad de aprendizaje 2
,QVWUXFFLRQHV: en esta actividad explorars el uso de Internet en tu comunidad.
Para ello vas a realizar una encuesta a tres personas que conozcas fuera de tu
escuela que hayan utilizado esta red. Pueden ser miembros de tu familia, vecinos o
algunos de tus amigos. Utiliza el siguiente modelo de entrevista:
Nombre:
Rango de edad:
 6 a 10 aos
 11 a 15 aos
 15 a 19 aos
 20 a 30 aos
 31 aos en adelante
Ocupacin: _________________________________
1) En dnde entras a Internet?
a) En la casa.
b) En la escuela.
c) En el trabajo.
d) En un negocio que renta el servicio.
Otro: _______________________________________
2) Para qu utilizas Internet?
a) Buscar informacin.
b) Utilizar el correo electrnico.
F  8VDUUHGHVVRFLDOHV )DFHERRN7ZLWWHU 
G  9HUYLGHRV\HVFXFKDUP~VLFD
Otro: _______________________________________
3) Cules consideras que son las ventajas del uso de Internet?
__________________________________________________________________
__________________________________________________________________
4) Y las desventajas?
__________________________________________________________________
__________________________________________________________________
 &UHHVTXHHOXVRGH,QWHUQHWWLHQHXQEHQHFLRGLUHFWRSDUDWL"
__________________________________________________________________
__________________________________________________________________
6)
Y para tu comunidad?
__________________________________________________________________
__________________________________________________________________

110
108

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV
Con la informacin obtenida y guiados por tu asesor, van a discutir los resultados
que obtuvieron en las encuestas aplicadas en tu comunidad. Utilicen los siguientes
puntos para dirigir el anlisis:
 Cul fue el rango de edad con la mayor cantidad de usuarios de Internet? A qu crees que se deba?
 Desde dnde entra a Internet la mayora de las personas en tu comunidad?
 Para qu utilizan Internet la mayora de las personas en tu comunidad?
 $QDOLFHQODVUHVSXHVWDVVREUHODVYHQWDMDVGHVYHQWDMDV\ORVEHQHFLRV
personales y para tu comunidad del uso de Internet.
 Cmo podran generar contenidos y difundirlos a travs de internet de
apoyo para apoyar a tu comunidad?

5HH[LRQHPRVVREUHODDFWLYLGDG

De qu te das cuenta?
Cada persona es responsable de la forma en que accede a Internet y hace uso
de los contenidos que ah existen. Ya sea que lo hagan para obtener informacin o como entretenimiento, saber utilizar la red, en nuestros das, es de gran
importancia para el desarrollo de la comunicacin.
Con la actividad anterior has comenzado a profundizar sobre el impacto de
Internet en tu comunidad. Los aspectos que encontraste con ayuda de la enFXHVWD\ODGLVFXVLyQFRQWXJUXSRWHVHUYLUiQSDUDDQDOL]DUODLQXHQFLDTXH
tiene este medio de comunicacin en la sociedad actual.

$SUHQGHPiV
,QXHQFLDGH,QWHUQHWHQODVRFLHGDG
En relacin con el uso de Internet, existe algo que se denomina brecha digital, que
VHUHHUHDLGHQWLFDUFXiQWDVSHUVRQDVHQXQSDtVFXHQWDQFRQDFFHVRDODUHG
mundial, adems de la cantidad de habitantes que saben utilizarla y cules son los
usos ms comunes que se le dan.
6HJ~QLQIRUPDFLyQSURSRUFLRQDGDSRUHO,QVWLWXWR1DFLRQDOGH(VWDGtVWLFD*HRJUDItD
e Informtica (INEGI), en Mxico existen 9.5 millones de hogares que cuentan con
conexin a Internet, lo que equivale a 30.7% del total en nuestro pas, es decir,

111
109

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

aproximadamente uno de cada tres hogares mexicanos pueden conectarse a


Internet. El mismo INEGI reporta que entre las principales barreras a las que se
enfrentan los usuarios para contar con el servicio de Internet se encuentra el acceso
a dispositivos necesarios para conectarse a la red, ya sea por no poder adquirir una
computadora o cualquier otro dispositivo electrnico que les permita ingresar a la
web (Galvn, 2014).

Sabas que...
El analfabetismo tecnolgico es la
incapacidad de algunas personas para
usar las nuevas tecnologas, tanto
en la vida diaria como en el mundo
laboral (Rueda, 2006). Cualquiera
puede ser un analfabeta tecnolgico,
independientemente de su nivel educativo,
clase social o posicin econmica, por
lo que resulta importante conocer las
causas por las cuales un individuo no
sabe utilizar alguna tecnologa actual.

A pesar de estos datos, el uso de Internet se ha convertido en un medio de


comunicacin que actualmente tiene un impacto muy importante en la sociedad.
Para que tengas una idea ms clara al respecto, lee con atencin los siguientes
textos:
,QWHUQHW8QDYLVLyQGHVXLPSDFWRVRFLDO
Lo cierto es que nunca en la historia del hombre habamos estado tan bien comunicados,
ni se haba llegado a este grado de acceso barato y directo a la informacin. El salto que
supone Internet implica un gran impacto social, lo que se est llamando como la nueva
era de la informacin.
Tambin veo otra idea positiva: es una forma inmejorable de enteramos con veracidad
de las noticias que ocurren en pases pobres (econmicamente hablando). Recordemos
TXHHQpVWRVVRQGHPDVLDGRIUHFXHQWHVD~QORVLQWHUHVHVFRORQLDOHVGHORVJRELHUQRVGH
pases occidentales. Estos lgicamente esconden noticias muy crudas que, de enterarse
OD RSLQLyQ S~EOLFD FDGD YH] PiV VHQVLELOL]DGD HQ HVWRV WHPDV GH GHVHTXLOLEULRV
ecologa y sostenibilidad), no las tolerara.

112
110

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Hoy da Internet es un medio en donde no existen todava legislaciones claras. Si bien


los medios informativos tradicionales estn fuertemente controlados por los dueos
del dinero, cabe preguntarse si acaso ocurrir lo mismo con la web. De ser as, sera
difcil alguna revolucin o reaccin popular, ya que las dictaduras, asociadas siempre
DDFpUULPRVFRQWUROHVKDQDFDOODGRDVXVSXHEORVRSULPLGRV$KtVHUHHMDTXL]iVHO
compromiso: es preciso establecer mecanismos que eviten mentiras, fraudes y errores
que pueden llegar a ser muy graves, pero a su vez, se trata de que ste no lastime
seriamente las libertades personales.
Es importante resaltar que en Internet, en cierto modo, va implcita una idea importante:
la ecologa. Aunque parezca extrao, si se analiza con detenimiento se ve cmo puede
reducirse el gasto de papel gracias a la edicin electrnica, tanto de revistas como de
libros, cartas, notas, circulares, etc.
Si bien es cierto que estamos mejor comunicados en general con todo el mundo gracias
a la red, deben analizarse los cambios de hbitos que esto est provocando. Queda
FODURTXHKD\XQPD\RUQ~PHURGHSHUVRQDVFRPXQLFiQGRVHSHURDOPLVPRWLHPSR
puede estar disminuyendo la relacin de persona a persona. As pues, parece paradjico
que un aumento de las comunicaciones pueda producir que disminuyan las relaciones
interpersonales. Por ejemplo, antes era casi imposible resolver las cosas cotidianas
fuera de una empresa, centro escolar, etc. Ahora, gracias a Internet y mediante el
correo electrnico, es posible realizar aisladamente casi cualquier actividad. Con esto,
lo que queda claro es que las relaciones interpersonales, fsicamente hablando, pueden
disminuir y con ello se pierde una parte del trato humano directo cuyas consecuencias
estn por verse.
2WUDFXHVWLyQLPSRUWDQWHHVODOODPDGDFRORQL]DFLyQFXOWXUDO1XQFDDQWHVQLQJ~QPHGLR
haba permitido que tantas personas se comunicaran a tan bajo precio (ya que exista
el telfono, pero a veces, debido a su costo, era impensable). Con esto, muchos temen
que se potencie la cultura norteamericana, dejando de lado cualquier otra opcin. Esto
HVWiHPSH]DQGRDSUHRFXSDUDDOJXQRVSDtVHVFRPR)UDQFLDTXHYHQSHOLJUDUVXOHQJXD
frente al dominio del idioma ingls. La Unin Europea, sensibilizada especialmente por
la rica diversidad de los pases que la conforman, ha iniciado proyectos de investigacin
para poder expresarse en las lenguas maternas y entenderse con el resto de internautas
gracias a potentes programas traductores.
El problema ms grave lo veo en los pueblos que hoy da quedan excluidos de la red,
como por ejemplo, muchos de los habitantes del Tercer Mundo. Por suerte, hay varias
organizaciones dispuestas a defender la diversidad tnica en el planeta.
El ocio parece que de momento se lleva ms del 50% de Internet. Los nios permanecen
una media de tres horas en Internet, mientras que los adultos slo estn conectados una
hora en promedio. Esto queda plasmado en los contenidos de la red, ya que hay una
gran cantidad de juegos en donde los ms exitosos son los MUD (Multi User Dimension),
TXHJUDFLDVDODWHFQRORJtDGHORVFKDWVSHUPLWHHOMXHJRRQOLQHGHP~OWLSOHVXVXDULRV
aunque estn en los lugares ms dispersos del planeta. El crecimiento de estos juegos
se debe, entre otras cosas, a la interactividad que permiten.
Cabe destacar el impacto de Internet sobre la educacin. Es realmente increble por la
gran cantidad de posibilidades que se presentan, desde la enseanza a distancia hasta
el complemento que puede aportar para los mtodos tradicionales. Lo cierto es que
se trata de una ventana abierta al mundo que, sin duda, ayudar a nios y jvenes a
tener un mayor conocimiento de su entorno. Adems, la interactividad que caracteriza

113
111

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

a Internet la hace amigable y les invita a adentrarse en todo un mundo nuevo con
SRVLELOLGDGHVLQQLWDV
Hemos de decir que Internet ha creado una especie de brecha generacional entre
profesores y alumnos ya que, a menudo, se da la situacin que los nios saben ms que
los adultos sobre algunos temas de informtica. Aparte de este problema, se debera
analizar cul va a ser el papel de los profesores y los alumnos ante le nueva situacin
creada con Internet (ya que la red contiene casi de todo y permite consultas online).
Las redes ciudadanas estn teniendo mucho auge, tanto es as que se habla de ello
como el nuevo paso en la evolucin de Internet. Esto ha producido un cambio en el
XVRGHODFRPSXWDGRUDTXHSDVDGHVHUXQDE~VTXHGDVROLWDULDDXQWUDEDMRHQHTXLSR
TXH LPSOLFD SXHVWDV HQ FRP~Q GLVFXVLRQHV \ DPSOLWXG GH SXQWRV GH YLVWD (Q HVWRV
momentos, pienso que son las redes ciudadanas y las comunidades virtuales quienes
PHMRUUHHMDQODLGHDGHLQWHUDFFLyQTXHHVOD,QWHUQHWeVWDVOOHYDQDFDERXQDWDUHDPX\
valiosa: hacer llegar y ensear, gracias al voluntariado, la tcnica y la prctica de Internet
mediante capacitacin, tanto para utilizarla en las comunidades de vecinos, como para
ayudar a aquellos analfabetas tecnolgicos rezagados del avance comunicacional.
Tenemos ante nosotros un mundo que parece en s mismo un pas virtual. Esperemos
que realmente sirva para mejorar la convivencia y los ecosistemas de este planeta
llamado Tierra.


114
112

)XHQWH(VFREDU/DEHOOD&  ,QWHUQHW8QDYLVLyQGHVXLPSDFWRVRFLDO


5HYLVWD%XUDQGHO%DUFHORQD,(((6WXGHQW%UDQFK1~P$xRSS

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Lo positivo y negativo de Internet


A los que nos toc ser padres de nios pequeos y adolescentes en esta era digital, no
podemos ignorar las redes sociales e Internet. Nuestros hijos vivirn y se relacionarn
usando estas plataformas, y antes de que se convierta en un problema o que nos tome
por sorpresa, entendamos lo positivo y negativo de que nuestros hijos usen Internet.
Lo positivo

Lo negativo

3XHGHQHVWDUHQFRQWDFWRFRQVXVDPLJRV\ORV
que viven fuera de una manera fcil e inmediata.
*UDFLDVDPRWRUHVGHE~VTXHGDFRPR*RRJOH
podrn hacer ms rpido y mejor su tarea.
3XHGHQ FRPXQLFDUVH FRQ QRVRWURV LQPHGLDWDmente en caso de una emergencia.
3XHGHQFRQRFHUGLIHUHQWHVFXOWXUDV\SDtVHVD
travs de imgenes y videos sin tener que salir
de la casa.
7HQGUiQLQIRUPDFLyQVREUHORTXHSDVDDOUHGHdor del mundo de una manera inmediata.
(VXQPHGLRFUHDWLYRHQHOTXHSXHGHQDSUHQGHU
muchas cosas, desde cmo crear un programa
WHFQROyJLFRKDVWDFODVHVGHJXLWDUUDHQ<RX7XEH+D\XQVLQItQGHFRQWHQLGRVJUDWLVSDUDWRGRV
los gustos.
3XHGHQ SHUWHQHFHU D FRPXQLGDGHV HQ UHG VLQ
WHQHUTXHHVWDUHQXQDPLVPDFLXGDGRSDtV
+D\HGXFDFLyQHQOtQHDJUDWXLWD
/DFRPXQLFDFLyQVHYXHOYHXQGLiORJR3XHGHV
interactuar con los que hacen contenidos y tambin puedes producirlo.


+D\ FRQWHQLGR QR DSWR
desde el terreno sexual, hasta el
violento.
(VWDU HQ FRQWDFWR FRQVWDQWH FRQ
compaeros de la escuela es un
DUPDGHGREOHOR\DTXHVLH[LVWHDOJ~QWLSRGHDFRVRGHQWURGH
la misma se puede convertir en
acoso por Internet.

6RPRVHOSDtVFRQHOPD\RU FRQVXPR GH SRUQRJUDItD LQfantil.

'HVJUDFLDGDPHQWH WDPELpQ VRPRV HV HO SDtV Q~PHUR
uno en trata de personas y abuso
sexual infantil. Un pederasta tarda alrededor de 15 minutos para
tener imgenes o video de tu hijo
o hija y hay redes criminales que
buscan nios y jvenes.

6HSXHGHFUHDUXQDDGLFcin a las redes sociales y chats
VLQRH[LVWHQOtPLWHVGHWLHPSRGH
uso

3RUFDGDXQRGHORVSXQWRVQHJDWLYRVTXHYHPRVTXHH[LVWHQHQ,QWHUQHWYHPRVODJUDQ
UHVSRQVDELOLGDGTXHWHQHPRVFRPRSDGUHVGHVHUJXtDVGHQXHVWURVKLMRVHQHVWHWHPD
No hay que satanizar el medio ni asustarnos, ms bien debemos ser padres presentes
y conscientes para ensear a nuestros hijos a manejarse con valores y de una manera
segura en Internet.
Algunos consejos para lograrlo son:
 Las computadoras y otros dispositivos deben usarse en un lugar visible
para que podamos observar lo que hacen.
 ,QWHUQHWGHEHWHQHUXQWLHPSROtPLWH$VtFRPRQRGHMDPRVDQXHVWURVKLMRV
YHUWHOHYLVLyQWRGRHOGtDQLYHUWRGRVORVSURJUDPDVGHEHPRVPDQWHQHU
control en el tiempo que estn conectados a Internet.

115
113

loque V


(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

(QVHxDUOHVTXHXQDYH]TXHXQDIRWRJUDItDVHVXEHDDOJXQDUHGVRFLDOR
DXQFKDWVHFRQYLHUWHHQDOJRS~EOLFR\QRKD\PDUFKDDWUiV1RKD\TXH
FRPSDUWLUQDGDTXHQRTXHUDPRVTXH72'26YHDQ
6XV FXHQWDV SHUVRQDOHV GH )DFHERRN \ RWUDV UHGHV VRFLDOHV GHEHQ
manejarse de forma privada en donde no todo el mundo pueda ingresar a
YHUVXVIRWRV([LVWHQPDQHUDVGHSURWHJHUODSULYDFLGDGGHODVPLVPDV
por lo que es necesario informarse acerca de las opciones que se ofrecen
en esas redes.
(QVHxDUOHVTXHVLOHVOOHJDXQDIRWRRYLGHRGHEXUODGHDOJXLHQFRQRFLGR
HQXQDVLWXDFLyQFRPSURPHWHGRUDFRPRSRGUtDVHUXQGHVQXGRSDUDUHQ
HVHPRPHQWRODFRQYHUVDFLyQ\ERUUDUOR6LWRGRVKDFHPRVHVWRHODFRVR
por Internet pierde fuerza.
'HEHPRVGHYLJLODUORTXHYHQ\ORTXHGLFHQQXHVWURVKLMRVSRUODVUHGHV
VRFLDOHV 'HSHQGLHQGR GH OD HGDG KD\ TXH VHU XQ SRFR DVWXWRV SHUR
WHQHPRVTXHYHUORTXHSDVDHQVXYLGD\JUDQSDUWHGHHOODHVWiHQOtQHD
6L )DFHERRN X RWUDV UHGHV VRFLDOHV WLHQHQ XQ PtQLPR GH HGDG KD\ TXH
respetarlo. Los padres son los primeros en romper este tipo de reglas que
justo existen para su proteccin.

&UHR TXH PXFKRV GH ORV SXQWRV TXH WRFR VRQ GH VHQWLGR FRP~Q SHUR VLJR VLHQGR
testigo de cmo muchos padres lo ignoran.
 

)XHQWH9LOOHJDV$3  /RSRVLWLYR\QHJDWLYRGH,QWHUQHW


([FpOVLRU'LVSRQLEOHHQKWWSZZZH[FHOVLRUFRPP[EORJORSRVLWLYR\QHJDWLYRGH
LQWHUQHW>&RQVXOWD@

Actividad de aprendizaje 3
InstruccionesFRQODLQIRUPDFLyQTXHOHtVWHHQORVGRVWH[WRVDQWHULRUHVWHGDUiV
FXHQWDGHTXHH[LVWHQDVSHFWRVSRVLWLYRV\QHJDWLYRVHQHOXVRGH,QWHUQHW9DVD
delimitar estos puntos en relacin al uso de internet en tu comunidad en el siguiente
HVTXHPD6pPX\FXLGDGRVRFRQODLQIRUPDFLyQTXHVHOHFFLRQHV\DTXHpVWDVHUi
la base para la actividad de cierre del bloque.

116
114

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

5HH[LRQHPRVVREUHODDFWLYLGDG

'HTXpWHGDVFXHQWD"
3DUDHVWHPRPHQWR\DKDEUiVQRWDGRTXHHOXVRGH,QWHUQHWUHTXLHUHGHXQ
HMHUFLFLRGHDQiOLVLVSURIXQGRGHWXSDUWH(OREMHWLYRGHUHH[LRQDUVREUHHVWRV
SXQWRVHVTXHWHFRQYLHUWDVHQXQXVXDULRFUtWLFR\UHVSRQVDEOHWDQWRGHORV
FRQWHQLGRVTXHHQFXHQWUDVHQODUHGFRPRGHDTXHOORVTXHHQDOJ~QPRPHQWR
producirs y difundirs a travs de la red global.

&LHUUHGHOEORTXH9
5HH[LRQDVREUHORDSUHQGLGR
Los recursos que te ofrece Internet han evolucionado a partir de sus inicios con el
SUR\HFWR$53$1(7(QODDFWXDOLGDGSXHGHVHVFXFKDU\YHUHQYLYRDXQDSHUVRQD
que se encuentre del otro lado del mundo en tiempo real, pero adems de eso,
SXHGHVLQWHUDFWXDUFRQHOODGHXQDIRUPDTXHKDVWDKDFHDOJXQRVDxRVSDUHFtDXQ
sueo.
Aunque el objetivo inicial de Internet tuvo implicaciones militares, rpidamente se
FRQYLUWLyHQXQQXHYRPHGLRGHFRPXQLFDFLyQTXHSHUPLWtDWUDQVPLWLUOHHU\UHVSRQGHU
PHQVDMHV(VWRJHQHUyGLYHUVDVIRUPDVGHLQWHUDFFLyQTXHYXHOYHQQHFHVDULRHOXVR
de estrategias de anlisis para marcar una diferencia entre los contenidos positivos
disponibles en la red y aquellos que no representan algo valioso en el ejercicio de
la comunicacin.
+R\HQGtDODVSRVLELOLGDGHVTXHRIUHFH,QWHUQHWYDQGHODPDQRFRQDOJXQRVIDFWRUHV
TXHSRVLELOLWDQHOXVRGHODPLVPDFRPRORVEXVFDGRUHVODPHQVDMHUtDLQVWDQWiQHD
ODVZLNLV\ODVUHGHVVRFLDOHV'HQWURGHHOODVHQFRQWUDPRVTXHODSRSXODUL]DFLyQ
GH KHUUDPLHQWDV FRPR *RRJOH 6N\SH :LNLSHGLD )DFHERRN R <RXWXEH SHUPLWHQ
que las personas compartan una cantidad enorme de contenidos entre usuarios de
varias partes del mundo.
Con todo esto, cul es el futuro de Internet? Antes de pensar en ello, es necesario
TXHUHH[LRQHVVREUHHOLPSDFWRTXHWLHQHHVWDUHGSDUDWL\WXFRPXQLGDG'LYHUVRV
ejemplos negativos que van desde la disminucin de la interaccin cara a cara
KDVWDODGHQRPLQDGDFRORQL]DFLyQFXOWXUDOQRGHEHQGHWHQHUWHDQWHORVEHQHFLRV
que se pueden obtener del uso de la red global.

117
115

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

7RGRHOSRWHQFLDOTXHSXHGHH[SORWDUVHHQiPELWRVFRPRHOHGXFDWLYRVRFLDO\OD
comunicacin sern posibles si los usuarios toman una actitud responsable sobre lo
que ven y comparten en Internet.
3DUDHOFLHUUHGHOEORTXHYDVDSDUWLFLSDUHQXQSDQHOTXHVHOODPDUi(OLPSDFWR
GH,QWHUQHWHQPLFRPXQLGDG3DUDHVWRWXJUXSRVHGLYLGLUiHQFXDWURHTXLSRVGH
trabajo. Cada equipo elegir a uno de sus integrantes para que los represente en el
panel, y ser considerado como el experto. La tarea que debern desempear los
dems miembros ser asesorarlo en su preparacin para el panel, ya sea aportando
datos extra a lo visto en este bloque, experiencias propias u opiniones basadas en
VXVUHH[LRQHVSHUVRQDOHVDFHUFDGHOLPSDFWRGH,QWHUQHWHQODFRPXQLGDG
$OQDOGHHVWDDFWLYLGDGGHEHUiVHQWUHJDUXQUHSRUWHHVFULWRHQHOTXHH[SRQJDVWX
UHH[LyQDFHUFDGHORVFRQWHQLGRVWUDWDGRVHQHOSDQHODVtFRPRGHWXH[SHULHQFLD
al participar en el mismo.
(O SDQHO HV XQD WpFQLFD JUXSDO GRQGH XQ FRRUGLQDGRU \ XQ JUXSR GH
H[SHUWRVGLVFXWHQVREUHDOJ~QWHPDHQIRUPDGHGLiORJRRFRQYHUVDFLyQ
frente a un grupo de personas.
Instrucciones: para realizar esta actividad se necesita:
 Un coordinador: en este caso ser tu asesor.
 Cuatro expertos: compaeros que sern designados por cada uno de los equipos.
 Auditorio: integrado por el resto de tus compaeros de grupo.
(OWHPDFRPRVDEHVVHUi(OLPSDFWRGH,QWHUQHWHQPLFRPXQLGDGeVWHFRQWDUiFRQFXDWUR
VXEWHPDVGHULYDGRVGHORYLVWRHQHVWHEORTXH3DUDHVWRHOJUXSRGHEHUiSRQHUVHGHDFXHUGR
y proponer los cuatro subtemas, cuidando que se relacionen con el tema principal.
La actividad se desarrollar bajo la siguiente estructura:
Antes
A cada equipo se le asignar un subtema de los que previamente eligi el grupo. Los miembros
GHOSDQHOGHEHUiQSRQHUVHGHDFXHUGR HOFRRUGLQDGRU\ORVFXDWURH[SHUWRV SDUDLQWHUFDPELDU
LGHDV\UHDOL]DUXQSODQTXHJXtHODH[SRVLFLyQVREUHORVVXEWHPDVDWUDWDUHOWLHPSRFRQHOTXH
disponen y la estrategia a seguir para que el ejercicio sea gil e interactivo.
Mientras los miembros del panel se ponen de acuerdo, los equipos debern comenzar la
HODERUDFLyQGHVtQWHVLVLQIRUPDWLYDVTXHOHVSURSRUFLRQDUiQDVXVH[SHUWRVSDUDDSR\DUORVHQ
su preparacin. Adems, cada equipo redactar tarjetas de preguntas que sern entregadas al
FRRUGLQDGRUSDUDTXHJXtHHOGLiORJRGXUDQWHHOSDQHO
Durante
Al inicio, el coordinador presenta a los miembros del panel y formula alguna de las preguntas
previamente elaboradas por los equipos. Uno de los miembros del panel inicia la conversacin
\VHHVWDEOHFHHOGLiORJRVHJ~QHOSODQUHDOL]DGR
(O FRRUGLQDGRU LQWHUYLHQH SDUD KDFHU ODV SUHJXQWDV \D SODQHDGDV RULHQWDU HO GLiORJR FHQWUDU
el tema y subtemas, superar posibles tensiones entre los miembros del panel y estimular el
GLiORJR$TXtHVLPSRUWDQWHTXHHOFRRUGLQDGRUQRHPLWDVXVSURSLDVRSLQLRQHVVLQRTXHSHUPLWD
a los expertos desarrollarlas.

118
116

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

Cinco minutos antes de terminar el tiempo previsto, el coordinador realizar una conclusin
general del tema y subtemas previstos.
8QDYH]H[SXHVWDVODVFRQFOXVLRQHV\UHH[LRQHVHOFRRUGLQDGRULQYLWDUiDORVPLHPEURVGHO
auditorio para que realicen preguntas a los expertos con base en el contenido que se discuti
GXUDQWHHOSDQHO\ORVFRPHQWDULRVQDOHV(VLPSRUWDQWHTXHORVFRPSDxHURVTXHIRUPDQSDUWH
del auditorio participen activamente en esta etapa del ejercicio, ya que esto enriquecer la
experiencia del grupo y la retroalimentacin hacia los miembros del panel.
(QHVWHSXQWRORVH[SHUWRVUHVSRQGHUiQDODVSUHJXQWDVIRUPXODGDVSRUHODXGLWRULRWRPDQGR
en cuenta el tema y subtema que prepararon.
6LHOFRRUGLQDGRUORFRQVLGHUDDGHFXDGRUHDOL]DUiQXHYDPHQWHODLQYLWDFLyQDOS~EOLFRSDUDTXH
VHUHDOLFHRWUDURQGDGHSUHJXQWDV\UHVSXHVWDV'HORFRQWUDULRSURFHGHUiDFHUUDUODDFWLYLGDG
Despus
(O SDQHO QDOL]DUi FRQ XQD FRQFOXVLyQ H[SXHVWD SRU SDUWH GHO FRRUGLQDGRU VREUH HO HMHUFLFLR
UHDOL]DGR$GHPiVOHUHFRUGDUiDOS~EOLFRVREUHHOHVFULWRTXHWRGRVORVPLHPEURVGHOJUXSR
GHEHUiQHQWUHJDUFRPRUHH[LyQDFHUFDGHODDFWLYLGDG
Al terminar la actividad, cada equipo evaluar su participacin en el panel con la siguiente lista
de cotejo.

Participacin

([FHOHQWH
1 punto

Necesita
5HJXODU
acompaamiento
0.5 punto
(0 puntos)

7RWDO

6tQWHVLVLQIRUPDWLYDSDUDODSUHSDUDFLyQ
de su experto.
7DUMHWDVFRQSUHJXQWDVSDUDHOFRRUGLQDdor.
(OH[SHUWRVHSUHSDUySDUDVXSDUWLFLSDcin en el panel y colabor positivamente en la dinmica del mismo.
(OH[SHUWRSXVRHQSUiFWLFDVXVKDELOLGDdes de comunicacin verbal y no verbal.
(O HTXLSR VH RUJDQL]y FRUUHFWDPHQWH
para entregar los contenidos y planear
su participacin en el panel.
(OHTXLSRVHPRVWUyDWHQWR\HVWXYRHQ
silencio durante el panel.
(O HTXLSR SDUWLFLSy DFWLYDPHQWH HQ OD
ronda de preguntas y respet la participacin de los dems.
(O HTXLSR DSRUWy FRQWHQLGRV GH FDOLGDG
al panel.
(OHTXLSRSXVRHQSUiFWLFDVXVKDELOLGDdes de comunicacin no verbal durante
VXSDUWLFLSDFLyQFRPRDXGLWRULR FXLGDGR
de la postura, gestos, expresiones faciaOHV 
(Q JHQHUDO HO HTXLSR SDUWLFLSy DFWLYD \
respetuosamente.

&DOLFDFLyQ

119
117

loque V

(VWDEOHFHVODLQXHQFLDGHLQWHUQHWHQOD
VRFLHGDG\FXOWXUDDFWXDOHV

$XWRHYDOXDFLyQ
5HDOL]DXQUHFXHQWRVREUHORVDSUHQGL]DMHVREWHQLGRVHQHOEORTXHLGHQWLFDQGRWX
nivel de avance conforme a la siguiente escala:





([FHOHQWHORJUpHODSUHQGL]DMHGHPDQHUDLQGHSHQGLHQWH
%XHQRUHTXHUtDSR\RSDUDFRQVWUXLUHODSUHQGL]DMH
5HJXODUIXHGLItFLOHOSURFHVRGHDSUHQGL]DMH\ORORJUpSDUFLDOPHQWH
,QVXFLHQWHQRORJUpHODSUHQGL]DMH

5HYLVD D GHWDOOH FRQ WX SURIHVRU \R FRQ DOJXQRV FRPSDxHURV DTXHOORV DVSHFWRV
donde sea necesario reforzar los aprendizajes.
Contenidos

$FWLWXGLQDOHV

3URFHGLPHQWDOHV

&RQFHSWXDOHV

&RQRFHVORVRUtJHQHVGH,QWHUQHW

120
118

'HQHVHOFRQFHSWRGH,QWHUQHW
Reconoces los recursos que te ofrece la Internet.
Reconoces los aspectos positivos y negativos
GHOXVRGH,QWHUQHWDVtFRPRVXLPSDFWRHQOD
sociedad.
Argumentas la importancia del desarrollo de
Internet en la historia del ser humano.
,GHQWLFDVODLQXHQFLDGH,QWHUQHWHQODVRFLHGDG
actual.
Contrastas las ventajas del uso de Internet con las
desventajas que pueden generarse considerando el
analfabetismo tecnolgico.
5HH[LRQDVVREUHHOXVRGHORVUHFXUVRV
disponibles en Internet para aumentar tus
posibilidades comunicativas.
Analizas el impacto que tiene Internet en tu
comunidad.
7RPDVFRQFLHQFLDVREUHHOXVRGH,QWHUQHWHQOD
sociedad actual y en tu comunidad.
Respetas el trabajo de los dems durante tu
participacin en equipo.
Aprecias las diferencias de opinin que se
presentan durante el anlisis de los contenidos
presentes en Internet.
9DORUDVORVFRQWHQLGRV\DFWLYLGDGHVSURSXHVWDV\WH
esfuerzas por cumplirlas correctamente.

1LYHOGHDYDQFH
4
3
2
1

*ORVDULR
t Adecuar: acomodar algo para que se adapte a las circunstancias.
t $VLPLODU: aceptar una situacin o adaptarse a ella.
t Auge: momento de mayor elevacin o intensidad de un proceso, un estado o
XQDFXDOLGDG(MHPSORHODXJHGHOWXULVPRVHSURGXFHHQMXOLR\DJRVWR
t Binas: grupo de dos personas.
t Comparar: encontrar las similitudes entre dos cosas.
t Compete: que le interesa a alguien una cosa y est dentro de sus obligaciones o responsabilidades.
t Consenso:DFHSWDFLyQSRUSDUWHGHODPD\RUtDGHORVPLHPEURVGHXQJUXSR
social, de determinadas decisiones o acuerdos.
t Contrastar: encontrar las diferencias entre dos cosas.
t 'HFRGLFDU: descifrar o interpretar el contenido para entender qu te quiere
decir el emisor.
t Edicin: revisin y preparacin de un contenido antes de ser publicado, considerando aspectos de calidad.
t HeterogneaFRPSXHVWRGHSDUWHVGHGLYHUVDVFDUDFWHUtVWLFDV
t InteraccinDFFLyQRLQXHQFLDTXHVHGDHQWUHGRVRPiVSHUVRQDVRFRVDVSDUDLQWHUFDPELDULQIRUPDFLyQ3RUHMHPSOR/DPDHVWUDIRUPyJUXSRVGH
WUDEDMRSDUDTXHORVDOXPQRVLQWHUDFWXDUDQHQWUHVt
t ,QWHUORFXWRU: cada una de las personas que toman parte en un dilogo o conversacin.
t 0ROGHDU: formar a una persona o grupo para que desarrolle cualidades determinadas siguiendo un modelo.
t 2QOLQHVLJQLFDTXHXQHTXLSRHVWiFRQHFWDGRD,QWHUQHW\TXHJUDFLDVD
ella, puede conectarse con otras computadoras para formar una red de comunicacin.
t 3OHQDULD: que cuenta con la asistencia de todas las personas que forman un
grupo.
t Precursor: que va delante en el tiempo o en el espacio.
t 3UHMR: palabra que se aade al comienzo de una palabra para formar otra
QXHYD3RUHMHPSORLQFOXLUDFHSWDUDOJRH[FOXLUUHFKD]DUDOJR$TXtORV
SUHMRVVRQLQ GHQWUR \H[ IXHUD 
t Recproca: implica una accin que es intercambiada entre dos o ms sujetos
cuyos resultados afectan a todos ellos.
t 5RO: funcin que una persona desempea en una situacin.
t :HEGRFXPHQWRGH,QWHUQHWTXHSXHGHFRQWHQHUWH[WRJUiFRVVRQLGRVR
animaciones.

121
119

Apndice
5HWURDOLPHQWDFLyQ
(YDOXDFLyQGLDJQyVWLFD
1. (QHOWH[WRVHSODQWHDQGLYHUVRVEHQHFLRVSDUDODVDOXGTXHVHREWLHQHQDWUDYpVGHO
EDLOHFRPRHODXPHQWRGHODHQHUJtDVXFDSDFLGDGFRPRHVWLPXODQWHHQODSURGXFFLyQ
GHHQGRUQDV\DQWtGRWRFRQWUDHOHVWUpV\HOPDOKXPRU$GHPiVVHPHQFLRQDTXHDXPHQWDODFUHDWLYLGDG\ODDXWRHVWLPDSRUORTXHHOEDLOHWDPELpQEHQHFLDDODVSHUVRQDV
en el aspecto emocional. /DUHVSXHVWDFRUUHFWDHVE
 (QODOHFWXUDVHPHQFLRQDQEHQHFLRVGHOEDLOHHQODFUHDWLYLGDGODOLEHUWDGGHOFXHUSR
\ OD UHODMDFLyQ 6LQ HPEDUJR QR VHxDOD TXH D WUDYpV GH HVWD DFWLYLGDG VH JHQHUH XQ
VHQWLPLHQWRGHDOHJUtDLa respuesta correcta es c.
3. 3DUD HOHJLU XQD LGHD SXHGHV XWLOL]DU FRPR UHIHUHQFLD ODV SUHJXQWDV TXH UHVSRQGLVWH
$GHPiVGHHVWRVHUHFRPLHQGDTXHHYDO~HVFDGDSiUUDIRSDUDJHQHUDUXQDVtQWHVLV
3RU~OWLPRYXHOYHDOHHUFDGDSiUUDIR\DTXHQXQFDHVVXFLHQWHXQDVRODOHFWXUDSDUD
captar correctamente el contenido de un texto.
4. \'HEHVFRQVLGHUDUVLHPSUHHOS~EOLFRDOTXHYDGLULJLGRWXHVFULWR2EYLDPHQWHQR
YDVDUHGDFWDUXQHQVD\RHVFRODUGHODPLVPDPDQHUDTXHHVFULELUtDVXQDFDUWDDXQ
DPLJR6LQHPEDUJRHVFRQYHQLHQWHFXLGDUVLHPSUHODRUWRJUDItD\ODUHGDFFLyQ\DTXH
eso dice mucho del cuidado que le pones a la elaboracin de un texto.

%ORTXH,'HQHVHOSURFHVRGHODFRPXQLFDFLyQ
$FWLYLGDGGHDSUHQGL]DMH
,PDJHQ6LFUHDVWHXQDIUDVHTXHUHHMDHQRMRGLVJXVWRRPROHVWLDFRQVLGHUDQGRODSRVtura y gestos de la mujer y del hombre para dar tu respuesta, hiciste bien la actividad.
,PDJHQ6LFUHDVWHXQDIUDVHTXHUHHMDDOHJUtDRDPDELOLGDGFRQVLGHUDQGRODSRVWXUD\
gestos de la mujer y del hombre para dar tu respuesta, hiciste bien la actividad.
$FWLYLGDGGHDSUHQGL]DMH
(VXQSURFHVRTXHVHGDHQWUHGRVRPiVVHUHVYLYRVSDUDWUDQVPLWLUXQPHQVDMHXWLOL]DQGR
XQFyGLJRHQFRP~Q\DWUDYpVGHXQFDQDOGHWHUPLQDGRFRQODQDOLGDGGHREWHQHUXQD
reaccin que es percibida gracias a la retroalimentacin.

122
120

$FWLYLGDGGHDSUHQGL]DMH
(PLVRU7HUHVD
0HQVDMH'HMDTXHWHD\XGH6LHPSUHSHQVpTXHHVWRVHWHYHtDPX\ELHQ9DPRVDSRQpUWHOR(VWiELHQDVt"5HFXHUGDVFyPRQRVSHOHiEDPRVGHQLxDVFXDQGRLQWHQWDEDV
vestirme?
&RGLFDFLyQ,GLRPDHVSDxRO
&DQDO(ODLUHSRUHOTXHYLDMDODYR]GH7HUHVD
Ruido: La tristeza de Marta por la muerte de su hija, ya que eso no le permite recibir bien el
PHQVDMHTXH7HUHVDTXLHUHWUDQVPLWLUOH
Receptor: Marta.
'HFRGLFDFLyQ0DUWDKDEODWDPELpQHVSDxROSRUORTXHSXHGHGHFRGLFDUHOPHQVDMHGH
7HUHVD
5HWURDOLPHQWDFLyQ0DUWDVRQUtHXQSRFR\UHVSRQGH(UDVXQDPDOFULDGD

Apndice
$FWLYLGDGGHDSUHQGL]DMH
1. Barrera semntica.
 Barrera psicolgica.
3. Barrera cultural.
4. %DUUHUDItVLFD
5. %DUUHUDVLROyJLFD
&LHUUHGH%ORTXH,
6LLQFOXLVWHXQHMHPSORGHFDGDEDUUHUDGHODFRPXQLFDFLyQHQWXUHSUHVHQWDFLyQSXHGHV
sumar 1 punto por cada una en la tabla de cotejo.
6LHOHJLVWHHOOXJDUHQGRQGHVHGDHOSURFHVRGHFRPXQLFDFLyQ ODFDOOHODHVFXHODWXFDVD
XQMDUGtQHWFpWHUD \ORPHQFLRQDVWHDQWHVGHFRPHQ]DUODUHSUHVHQWDFLyQSXHGHVVXPDU
SXQWRHQODU~EULFD
6LUHSUHVHQWDVWHVLWXDFLRQHVGHODYLGDFRWLGLDQDHQODVTXHXWLOL]DVODFRPXQLFDFLyQ XQD
FRQYHUVDFLyQFRQXQDPLJRXQDOODPDGDWHOHIyQLFDODYLVLWDDOPpGLFRDVLVWLUDXQDHVWD
HWFpWHUD SXHGHVVXPDUSXQWRHQODU~EULFD
6LSXVLVWHHQSUiFWLFDORVFRQFHSWRVGHFDGDEDUUHUDGHVFULWDHQHO%ORTXH ItVLFDVHPiQWLFDVLROyJLFDSVLFROyJLFD\FXOWXUDO SXHGHVVXPDUSXQWRHQODU~EULFD

%ORTXH,,&DUDFWHUL]DV\DSOLFDVORVPRGHORVGHFRPXQLFDFLyQ
$FWLYLGDGGHDSUHQGL]DMH
6LDGHFXDVWHHOFRQWHQLGRGHODSULPHUDFDUWDFRQVLGHUDQGRDVSHFWRVVHQFLOORVHLQIRUPDOHV
hiciste bien la actividad.
6LDGHFXDVWHHOFRQWHQLGRGHODVHJXQGDFDUWDFRQVLGHUDQGRDVSHFWRVIRUPDOHV\FXLGDQGR
tu redaccin, hiciste bien la actividad.
$FWLYLGDGGHDSUHQGL]DMH
6LW~\WXHTXLSRHOLJLHURQODWUDPDGHXQDSHOtFXODXQFXHQWRDOJXQDKLVWRULDGHVXFRPXQLdad, una noticia importante, uno de los temas vistos en su materia de Historia o algo curioso
TXHKD\DVXFHGLGRHQVXHVFXHOD~OWLPDPHQWHFRPHQ]DURQELHQODDFWLYLGDG
6LVHRUJDQL]DURQFRUUHFWDPHQWH\FXLGDURQORVDVSHFWRVTXHVHPHQFLRQDQHQODVLQVWUXFciones, desarrollaron bien la actividad.
5HYLVHQODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV
$FWLYLGDGGHDSUHQGL]DMH
6LIXLVWHFDSD]GHVHJXLUODH[SUHVLyQIDFLDO\FRUSRUDOGHWXFRPSDxHURDGHPiVGHSRQHU
atencin a las respuestas que te dio, hiciste bien la actividad.
$FWLYLGDGGHDSUHQGL]DMH
1. $XQTXHQRDSDUH]FDQQRPEUDGRVDVtODHVWUXFWXUDGHOSURFHVRGHFRPXQLFDFLyQQRV
indica que todos cuentan con emisor, mensaje y receptor.
 6FKUDPP \ %HUOR VRQ ORV TXH XWLOL]DQ ORV HOHPHQWRV PHQRV FRPXQHV DO WRPDU HQ
cuenta el campo de experiencia, las tcnicas de comunicacin, actitudes, nivel de
conocimiento y situacin sociocultural.

123
121

Apndice
3. 6LWRPDVWHFRPREDVHODUHVSXHVWDDQWHULRUUHVSRQGLVWHELHQHVWDSUHJXQWD\DTXH
ODFODYHHVWiHQODLQXHQFLDGHOFRQWH[WRHQGRQGHVHJHQHUDHOSURFHVRGHFRPXQLcacin.
4. 6LSLHQVDVTXHWRGRVORVPRGHORVYLVWRVSXHGHQDSOLFDUVHHQPD\RURPHQRUPHGLGD
y utilizaste ejemplos de tu vida cotidiana, respondiste bien esta pregunta.
$FWLYLGDGGHDSUHQGL]DMH
 6LHOHJLVWHMXQWRFRQWXHTXLSRFLQFRVLWXDFLRQHVGHODYLGDGLDULDHQODVTXHDSOLFDURQ
el modelo, y analizaron cuidadosamente cada elemento que lo conforma, comenzaron bien la actividad.
 6LXWLOL]DURQPDWHULDOGHDSR\RSDUDVXH[SRVLFLyQ\FXLGDURQORVDVSHFWRVGHODFRmunicacin no verbal que se mencionan en las instrucciones, desarrollaron bien la
actividad.
 5HYLVHQODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV
$FWLYLGDGGHDSUHQGL]DMH






6LHOHJLVWHXQPHGLRGHFRPXQLFDFLyQPDVLYR\DOJ~QFRQWHQLGRTXHKD\DVYLVWRHQ
l, comenzaste bien la actividad.
6LVXVWLWXLVWHORVHOHPHQWRVFRQODLQIRUPDFLyQGHOPHGLRGHFRPXQLFDFLyQPDVLYRTXH
HOHJLVWHGHIRUPDVLPLODUDODJXUDGHDUULEDGHVDUUROODVWHELHQODDFWLYLGDG
3DUDREWHQHUODUHWURDOLPHQWDFLyQGHOHMHUFLFLRVREUHHOPRGHORGH0F/XKDQXWLOL]DHO
ejemplo que se encuentra en el contenido de este Bloque.
5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV

&LHUUHGH%ORTXH,,

124
122

6LHOHJLVWHXQWHPDUHIHUHQWHDWXFRPXQLGDGFRQVLGHUDQGRWRGRORYLVWRHQHVWH%ORTXH\
fuiste creativo para hacer tu cartel, comenzaste bien la actividad.
6LH[SXVLVWHWXFDUWHOIUHQWHDOJUXSRHQQRPiVGHFLQFRPLQXWRV\SXVLVWHHQSUiFWLFDWXV
habilidades de comunicacin oral y no verbal, desarrollaste bien la actividad.
5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV

Apndice
%ORTXH,,,5HODFLRQDVORVWLSRVGHFRPXQLFDFLyQFRQWXFRQWH[WR
$FWLYLGDGGHDSUHQGL]DMH
 6L WRPDVWH VLWXDFLRQHV GHO OXJDU HQ TXH YLYHV SDUD UHSUHVHQWDU ORV FXDWUR WLSRV GH
FRPXQLFDFLyQ GLUHFWDLQGLUHFWDXQLODWHUDO\ELODWHUDO FRPHQ]DVWHELHQODDFWLYLGDG
 6LUHVSHWDVWHHOIRUPDWR GREOHFDUWD IXLVWHFUHDWLYRHLQFOXLVWHGLiORJRVTXHUHHMDQ
una interaccin entre los personajes, desarrollaste bien la actividad.
 5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV
$FWLYLGDGGHDSUHQGL]DMH
1. (QODHVFXHODFXDQGRSODWLFRFRQXQDPLJRGHVSXpVGHFODVHVVREUHDOJRSHUVRQDO
(QPLFDVDFXDQGRXQIDPLOLDUPHFXHQWDGHVXGtDHQHOWUDEDMR
(QODFDOOHFXDQGROHSUHJXQWRDDOJXLHQODKRUDHQHOFDPLQRDFDVD
 Un anuncio en una barda.
Un programa que escucho en la radio en donde se informa sobre aspectos de mi
comunidad.
Cuando los vecinos tienen asambleas para tratar asuntos que le interesan a toda mi
comunidad.
3. 6LWRPDVWHHQFXHQWDDVSHFWRVUHODFLRQDGRVFRQHOUHVSHWRDODSULYDFLGDGGHODSHUsona, respondiste bien esta pregunta.
4. 6LH[SOLFDVWHDOJXQDHVWUDWHJLDTXHEXVTXHSURWHJHUWXSULYDFLGDGRODGHDOJXLHQTXH
aprecias, respondiste bien esta pregunta.
5. 6LFRQVLGHUDVWHWHPDVTXHWLHQHQTXHYHUFRQHOSURJUHVRGHWXFRPXQLGDG\ODFRRperacin entre sus habitantes, respondiste bien esta pregunta.
&LHUUHGH%ORTXH,,,
 6LHQWXHVFULWRWRPDVWHHMHPSORVGHOFXHQWRSDUDUHSUHVHQWDUORVWLSRVGHFRPXQLFDFLyQ GLUHFWDLQGLUHFWDXQLODWHUDO\ELODWHUDO FRPHQ]DVWHELHQODDFWLYLGDG
 6LHQWXHVFULWRWRPDVWHHMHPSORVGHOFXHQWRSDUDUHSUHVHQWDUORVQLYHOHVGHFRPXQLFDFLyQ LQWUDSHUVRQDOLQWHUSHUVRQDOLQWUDJUXSDOHLQWHUJUXSDO GHVDUUROODVWHELHQOD
actividad.
 6LHQWXHVFULWRDERUGDVWHODPDQHUDHQTXHVHXWLOL]DODIUDVH1RVpSHURKHDPDnecido con el presentimiento de que algo muy grave va a sucederle a este pueblo y
cmo los personajes del cuento la reciben e interpretan, desarrollaste bien la actividad.
 5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV

%ORTXH,99LQFXODVODFXOWXUDFRQODFRPXQLFDFLyQS~EOLFD
$FWLYLGDGGHDSUHQGL]DMH
1. 3RUHMHPSOR'tDGH0XHUWRVODIHULDGHWXFRPXQLGDGXQDIHVWLYLGDGUHOLJLRVD
 6LHVFULELVWHHODQWHFHGHQWHKLVWyULFRRORTXHWHFRQWyDOJXLHQVREUHHORULJHQGHOD
creencia popular elegida, respondiste bien esta pregunta.
3. 6LLQFOXLVWHODLQWHQFLyQTXHWLHQHODJHQWHGHWXFRPXQLGDGSDUDUHDOL]DUHVWDFHOHEUDcin, respondiste bien esta pregunta.
4. 6LLQFOXLVWHDOPHQRVGRVGHORVHOHPHQWRVPHQFLRQDGRV WLSRGHFRPLGDDGRUQRV
YHVWXDULRGDQ]DVFDQFLRQHV \VXGHVFULSFLyQUHVSRQGLVWHELHQHVWDSUHJXQWD

125
123

Apndice
5. 6LH[SOLFDVWHDOJXQDHVWUDWHJLDTXHEXVTXHSUHVHUYDUODFRVWXPEUHRWUDGLFLyQTXHVH
celebra en tu comunidad, respondiste bien esta pregunta.
$FWLYLGDGGHDSUHQGL]DMH
 6LHQWXWH[WRGHVFULEHVGHWDOODGDPHQWHWXSURSXHVWDSDUDGLIXQGLUXQDFRVWXPEUHR
tradicin fuera de tu comunidad, desarrollaste bien la actividad.
 5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV
$FWLYLGDGGHDSUHQGL]DMH
1. 6LGHVFULELVWHHOHPHQWRVFRPRODVFDVDVTXHDSDUHFtDQSOD]DVFDPSRFLXGDGHGLcios, playa, o cualquier otro aspecto del lugar, respondiste bien esta pregunta.
 6LPHQFLRQDVWHODIRUPDGHKDEODU ODYHORFLGDGHODFHQWRHOWRQR \DOJXQDVGHODV
expresiones que utilizaban los personajes, respondiste bien esta pregunta.
3. 6LGHVFULELVWHVXDSDULHQFLDItVLFD DOWXUDFRPSOH[LyQFRORUGHFDEHOORGHRMRV \OD
ropa que utilizaban, respondiste bien esta pregunta.
4. 6LQLPSRUWDUVLDSDUHFtDQFRVDVRQRGHWXFRQWH[WRORLPSRUWDQWHGHHVWDSUHJXQWDHV
HOSRUTXp"6LDERUGDVWHORVGRVSXQWRVUHVSRQGLVWHELHQHVWDSUHJXQWD
$FWLYLGDGGHDSUHQGL]DMH
3DUDYHULFDUHVWDDFWLYLGDGEiVDWHHQHOHMHPSORTXHDSDUHFHHQODUHWURDOLPHQWDFLyQGH
OD$FWLYLGDGGHDSUHQGL]DMHGHO%ORTXH,,
$FWLYLGDGGHDSUHQGL]DMH
*OREDOL]DFLyQ HV HO SURFHVR GH UHGXFLU EDUUHUDV HQWUH ORV SDtVHV \ SURPRYHU UHODFLRQHV
HFRQyPLFDVSROtWLFDV\VRFLDOHVPiVHVWUHFKDVDXPHQWDQGRODVUHODFLRQHVVRFLDOHVDQLYHO
mundial y enlazando lugares distantes de tal manera que los sucesos locales son moldeaGRVSRUVXFHVRVTXHRFXUUHQDPXFKRVNLOyPHWURVGHGLVWDQFLD
&LHUUHGH%ORTXH,9
 6L SDUD FUHDU HO FRQFHSWR WH EDVDVWH HQ OR YLVWR HQ HO %ORTXH FRPHQ]DVWH ELHQ OD
actividad.
 6LHVFULELVWHHOUHHMRGHOFRQFHSWRHQWXFRPXQLGDGHKLFLVWHXQGLEXMRUHODFLRQDGR
con ello, desarrollaste bien la actividad.
 5HYLVDODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV

%ORTXH9(VWDEOHFHVODLQXHQFLDGH,QWHUQHWHQODVRFLHGDG\FXOWXUDDFWXDOHV
$FWLYLGDGGHDSUHQGL]DMH
 6LW~\WXHTXLSRUHYLVDURQPX\ELHQHOWH[WRSDUDHOGLVHxRGHVXOtQHDGHOWLHPSR
e incluyeron dibujos, recortes o cualquier elemento que les permitiera presentar su
trabajo correctamente, desarrollaron bien la actividad.
 5HYLVHQODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV

126
124

Apndice
$FWLYLGDGGHDSUHQGL]DMH
 6LVHOHFFLRQDVWHDSHUVRQDVSDUDDSOLFDUWXHQFXHVWDFRPHQ]DVWHELHQODDFWLYLGDG
6LGLVFXWLVWHORVUHVXOWDGRVFRQWXDVHVRUEDViQGRWHHQODVSUHJXQWDVLQFOXLGDVHQODVLQVtrucciones, desarrollaste bien la actividad.
$FWLYLGDGGHDSUHQGL]DMH
 6L EDVDVWH WXV UHVSXHVWDVHQHOFRQWHQLGRGHODVGRVOHFWXUDVFRPHQ]DVWHELHQOD
actividad.
 6LLQFOXLVWHDGHPiVH[SHULHQFLDVGHOXVRTXHOHGDVRTXHOHGDQWXVFRQRFLGRVD,Qternet, desarrollaste bien la actividad.
&LHUUHGH%ORTXH9
6LW~\WXHTXLSRVLJXLHURQFRUUHFWDPHQWHODVLQVWUXFFLRQHVGHOHMHUFLFLRGHOSDQHOFRPHQzaron bien la actividad.
6LWXHVFULWRLQFOX\HWXUHH[LyQDFHUFDGHORVFRQWHQLGRVWUDWDGRVHQHOSDQHODVtFRPRGH
tu experiencia al participar en el mismo, desarrollaste bien la actividad.
5HYLVHQODU~EULFDSDUDFRQRFHUORVGHPiVDVSHFWRVTXHVHUiQHYDOXDGRV
5HYLVDODU~EULFDTXHDSDUHFHDOQDOGHODDFWLYLGDG$SOLFDORDSUHQGLGRHQHO%ORTXH,,,SDUD
conocer los dems aspectos que sern evaluados.

127
125

5HIHUHQFLDV
5HIHUHQFLDVELEOLRJUiFDV

























$OERUpV&DEDQLxD3  Comunicaciones interpersonales(VSDxD,GHDV3URSLDV(GLWRULDO


OYDUH]6  /DH[SUHVLyQRUDO4XLWR/LEUHVD
%DHQD* 0RQWHUR6  Ciencias de la comunicacin I6HULHLQWHJUDOSRUFRPSHWHQFLDV
0p[LFR*UXSR(GLWRULDO3DWULD
%DUy7   La gran gua del lenguaje no verbal.(VSDxD*UXSR3ODQHWD
%HQRLW $   Decir o escribir lo esencial en pocas palabras: hacer la sntesis. (VSDxD
(GLFLRQHV'HXVWR
&KDQRQD2   Mxico, una nacin multicultural5HYLVWD1XHYD9LVLyQ6RFLDO'HPyFUDWD
$xR9,,1~PVSS
&OD\WRQ(  La historia de la escritura. (VSDxD(GLFLRQHV6LUXHOD
'HOD0RUD0HGLQD-  Explicacin y anlisis. Taller de Comunicacin I. Mxico: UNAM.
'HFNHU%  El arte de la comunicacin.0p[LFR*UXSR(GLWRULDO,EHURDPpULFD
)RQVHFD5 3ULHWRGH$OL]R/  Las emociones en la comunicacin persuasiva: desde
la retrica afectiva de Aristteles4XyUXP$FDGpPLFR9RO1HQHURMXQLRSS
)RQVHFD6  Comunicacin oral. Fundamentos y prctica estratgica.0p[LFR3HDUVRQ
(GXFDFLyQ
*RQ]iOH]$ORQVR&   Principios bsicos de comunicacin.0p[LFR7ULOODV
-DUDPLOOR(  Los indgenas colombianos y el Estado. Desafos ideolgicos y polticos de
la multiculturalidad.&RORPELD(GLWRULDO&yGLFH
0DJDOOyQ5RVD5  La transformacin de la cultura de masas. Aura y comunin ftica.
5HYLVWDGH&LHQFLDV6RFLDOHV$3267$1~PHQHURIHEUHUR\PDU]RSS
0DUWtQH]9i]TXH])  Ciencias de la comunicacin I. 0p[LFR6DQWLOODQD
0LWWHOPDQ-+  El sndrome de la globalizacin. Transformacin y resistencia. Mxico:
6LJOR9HLQWLXQR(GLWRUHV
2 6XOOLYDQ -   La comunicacin humana: grandes temas contemporneos de la
comunicacin9HQH]XHOD)RQGRGH3XEOLFDFLRQHV)XQGDFLyQ3RODU
5XHGD*DUFtD1  El analfabetismo tecnolgico. 5HYLVWD&RPXQLGDG,EHUR1~P
SS
6iL]$  El arte-ciencia de la comunicacin: la Retrica de Aristteles. Mxico: UNAM
6D[H)HUQiQGH]-   Globalizacin: crtica a un paradigma. Mxico: UNAM.
7DQ$6   Mass communication theories and research.1XHYD<RUN0FPLOODQ3XEOLVKLQJ
Company.
7RXULxiQ /ySH] -0   Artes y educacin: fundamentos de pedagoga mesoaxiolgica.
(VSDxD1HWELEOR
:HVW5 7XUQHU/  Teora de la comunicacin: anlisis y aplicacin. (VSDxD0F*UDZ
Hill.
=D\DV $JHUR 30   La comunicacin interpersonal. (VSDxD (GLWRULDO $FDGpPLFD
(VSDxROD

(OHFWUyQLFDV





128
126

%DOOHVWDU0  Introduccin a la Informtica: las nuevas Tecnologas de la Comunicacin e Informacin (TIC) en el aula. 'LVSRQLEOHHQZZZXYHVaEDOOHVWDWHPDSSW>&RQVXOWD
@
)ORUHV3 9LVRQH6  El impacto de la empresa Coca-Cola en la actualidad. Memorias del XVIII Congreso de Investigacin CUAM. 'LVSRQLEOHHQKWWSZZZDFPRURUJP[FXDP
VRFBKXPFRFDFRODSGI>&RQVXOWD@
*DOYiQ/   Conoce de la brecha digital en Mxico.8QLYHUVR3<0('LVSRQLEOHHQKWWS
XQLYHUVRS\PHP["S >&RQVXOWD@
*yQJRUD3DGLOOD'  Validacin del Proyecto Marta como ayuda tcnica a la comuniFDFLyQSDUDGHFLHQWHVDXGLWLYRV8QLYHUVLGDGGH$OPHUtD'LVSRQLEOHHQKWWSVERRNVJRRJOH
FRPP[ERRNV"LG <%$4$$4%$- SJ>&RQVXOWD@
,VODV2  Marshall McLuhan, 40 aos despus. Revista Latinoamericana de ComunicaFLyQ'LVSRQLEOHHQKWWSZZZUHGDO\FRUJSGISGI>&RQVXOWD@
-XQWDGH$QGDOXFtD  Educacin secundaria para personas adultas nivel II. Seccin de













Educacin Permanente.'LVSRQLEOHHQKWWSZZZMXQWDGHDQGDOXFLDHVDYHUURHVDOEROXW&/1,,E7SGI>&RQVXOWD@
/DLWPDQ-7  El origen del lenguaje articulado. Publicaciones del Programa Nacional
de Etnobotnica de la Universidad Autnoma Chapingo'LVSRQLEOHHQKWWSZZZFKDSLQJRP[
EDJHEDJHSGI>&RQVXOWD@
/HyQ0HMtD$% 2UWt]8ULEH)*  La Comunicacin Escrita en el Proceso de Enseanza Aprendizaje. 'LVSRQLEOHHQKWWSZZZDFDGHPLDHGX/DB&RPXQLFDFL&%QB(VFULWDBHQBHOB3URFHVRBGHB(QVH&%DQ]DB$SUHQGL]DMH>&RQVXOWD@
/RUHQWH-$ -LPpQH]$ULDV0(  La comunicacin en salud desde las perspectivas
tica, asistencial, docente y gerencial. 6FLHQWLF(OHFWURQLF/LEUDU\2QOLQH 6FL(/2 'LVSRQLEOH
HQKWWSVFLHORVOGFXVFLHORSKS"SLG 6 VFULSW VFLBDUWWH[W>&RQVXOWD
@
0LQLVWHULRGH(GXFDFLyQ\&XOWXUD  Alfabetizacin digital.'LVSRQLEOHHQKWWSZZZFHQWURVPHFRUJX\LQQRYDSRUWDOOHPHQVDMHULDBLQVWDQWDQHDSGI>&RQVXOWD@
1DWLRQDO*HRJUDSKLF   Las pinturas rupestres de Indonesia tienen casi 40 000 aos de
antigedad.'LVSRQLEOHHQKWWSZZZQDWLRQDOJHRJUDSKLFHVQRWLFLDVSLQWXUDVUXSHVWUHVLQGRQHVLDQRWLFLDXWPVRXUFH\KRRXWPPHGLXPSDUWQHUXWPFDPSDLJQ\KRR>&RQVXOWD@
5HDO$FDGHPLDGHOD/HQJXD(VSDxROD  Diccionarios.'LVSRQLEOHHQKWWSZZZUDHHV
>&RQVXOWD@
6PLWK&   By the numbers: 80+ amazing Google Search statistics and facts.'LJLWDO
0DUNHWLQJ6WDWV6WUDWHJ\*DGJHWV'LVSRQLEOHHQKWWSH[SDQGHGUDPEOLQJVFRPLQGH[SKSE\
WKHQXPEHUVDJLJDQWLFOLVWRIJRRJOHVWDWVDQGIDFWV>&RQVXOWD@
7KH)UHH'LFWLRQDU\HQ(VSDxRO  Diccionarios'LVSRQLEOHHQKWWSHVWKHIUHHGLFWLRQDU\
FRP>&RQVXOWD@
7UXMLOOR3RODFR0-   Incremento de la produccin de tela de una industria textil. UniverVLGDGGHODV$PpULFDV3XHEOD'LVSRQLEOHHQKWWSFDWDULQDXGODSP[XBGOBDWDOHVGRFXPHQWRV
OLLWUXMLOORBSBPM>&RQVXOWD@
8QLYHUVLGDGGH0XUFLD  . Glosario de Redes Sociales y Community Management. 'LVSRQLEOHHQKWWSZZZXPHVFXUVRVSURPRHGXUHGHVVRFLDOHVJORVDULR>&RQVXOWD@
8QLYHUVLGDG3RSXODU$XWyQRPDGH9HUDFUX]  Tipos de comunicacin: intrapersonal e
interpersonal. 3URJUDPDGHO7DOOHUGHDQiOLVLVGHODFRPXQLFDFLyQ'LVSRQLEOHHQKWWSZZZ
XQLYHUVLGDGXSDYHGXP[GRFXPHQWRV%DFKLOOHUDWR9LUWXDO&RQWHQLGRVB3(B83$97ULPHVWUH
7$$&XQLGDGWHPDSGI>&RQVXOWD@
9HODUGH2  Denim8QLYHUVLGDGGH3DOHUPR'LVSRQLEOHHQKWWSGRSDOHUPRHGXVHUYLFLRVBG\FEORJLPDJHVWUDEDMRVBSGI>&RQVXOWD@

Crditos
,PiJHQHV\0DWHULDOLFRQRJUiFR
Depsitphotos Images
3iJLQD 
&ODXGH(6KDQQRQ
KWWSVZZZLFNUFRPSKRWRVDUVHOHFWURQLFD
3iJLQD 
3LQWXUDUXSHVWUH
KWWSZZZJULIWKHGXDXKXPDQLWLHVODQJXDJHVVFKRROKXPDQLWLHVUHVHDUFKSHUDKXVWDII
3iJLQD 
Marshall McLuhan
KWWSVODHPLQHQFLDHQSHUVRQDOHVZRUGSUHVVFRPPFOXKDQEORJMSJ
3iJLQD 
Historieta Mafalda
KWWSZZZUHYLVWDDUFDGLDFRPZVEXVFDGRU,QGH["TXHU\ ODVPHMRUHVKLVWRULHWDVPDIDOGD
3iJLQD 
0DSDHVWUXFWXUD$53$1(7
KWWSVZZZLFNUFRPSKRWRVFDVHRUJDQLF

129
127

Secretara de Educacin Pblica


Subsecretara de Educacin Media Superior
Direccin General del Bachillerato