Vous êtes sur la page 1sur 473

gai % Q1%rgI=raa mass:

gftiw n? % faritu iwasi

HISTORICAL DRAMAS IN HINDI (KHADIBOLI)


WITH SPECIAL REFERENCE TO
HARIKRISHNA PREMI

by
P. A- SH 1:.\1I.\1
r. q. unt:

Supervisor :
13R. 1\'- E. \'ISV\'AI\'A'.lII AI\'lCR
Professor 8: Head of the Deparment of Hindi
University of Cochin, Cochin-22

THESIS SUBMITTED T0_TI-IE UNIVERSITY OF COCI-[IN FOR THE DEGREE OF


DOCTOR OF PHILOSOPHY

I977
lhie is to certify that this thesis is s
bonetide record of work carried out by P.A. Shelin
under my supervision for Ph.D. and no part of this
has hitherto been enhlitted for s degree in any
University.

\/53?;/TA4g4a!4
Departnsnt of Hindi.
University of Cochin Dr. H.E. VISUANAIEA AIIAR.
Cochin 22 H.A.(E1ndi
Ph.D
& Sanskrit)
supervising Teacher.
KIO E

be work In carried out in Department


of Hindi. University of Cochin. Cochin - 22 during
the tenure of eoholerahip awarded to me by the
Univereity of cochin. I ainoerely expreee I:
gratitude to the Univereity of Cochin and the
'un1m-any Grante Cenniuion for that. kind help
and enoourageaenta.

larch 1971 a& Pot. SHEHIH.


......f..'."..1...

sn'a'aIIFtmrI?:na"=-:'rat?1a!11ma1zrs:nfrq-1
M&tht1z-f"-3u1'Ima1'm 'l'3113?-l'Q'l1?|$ =Iru":
zadwtataaliuiu mwn a=Ita<91%nrrfaa=rmt matu
w wrartcgamwaautw Tm Wwsarrnu
aataamawarritawawmwmvaaianwuutta
*ca=naiI aamrmin mwrqaa waa3r11aa=rn
urn! w utwmxfiaaimfaza mauv
qI?aal vdtailnmaff maarmmlturrmiu
aumwamwaummmmnmmwm
mqrtmmunwltaiaauni, 3I'lT-RFII'lT$=Ils':'IF!-r
aatunasuaniu mww tqw&=\'taz9faz11tra=Ir
a1 $:41atmnT1'tmTIIIH8F:'<=r-mwlmiu

mtmqkmattmawwiauvf in
I='rmatrTIaurr$z=rrr=t't7{vI&I1t8=Iw.'a? a-1aI1a't
a=Iranaau=r=I=trnum=rT?n1#r61alaT&<IrreItr=ttum=rn
#"I1t?I4?-8utIwa'rra1?Iia"*IuuTtlG1!fIdIIliI
am tnhammain #m&t3faI1fm=rraI mmum.
mr.=rra'd-12::-uI1mat.a1tz'1a1I trT5'{at= iaarrsnz
Min aIma=r&1zn-1 awratrnu-Im=r:a19nWI5rm:=r
wrnmin wrnmadnaammwaunit, W 8
?Ia11f1=i=na*u-1 tmawnhunavqiimtu
1U8FlU:aInrdT tannin
tnataeqrai-'tnrIna?T#1%Ii1fm=I1z"a'|t1%n11'er
wmksadvdtuadwcrfomtiagvmaziuintr
mnwrasrufnawaacin amvamwaur 1'-1'l'R1
mvaatiun amwvawwfetrfusmtanw tn
wlfmw-z1UItrIu mamamad arwaianawt
Wmvdmawamin
a11au:1ui; '1'I=r.'tiat91%m1fms=1ztr::rquaarr
mum mi nmaemmmm asrrhlva ll-TH arr
mini: ltrmswz wtaammsamuaas rm
mim w3um&@RI11fHa=Ivza1 mwaumin
truarI1rai'1I1'=rliT:dWItI1. aIIa!a1IT
I[IaI'tru=1tmaIavdmftmaTr8ww'=Izrraa1iI
nfIi3atravrUt1'43aIt:u=1zrr=R&u%vz:taI=un=s1}1Ir:ra#qrz
mararaammmmaammmmuu aasram mm
*4 mwawimknvrvuaiwunwqmwwwirw
qarirmftiu
:ruv;Eaau:12Il tartan. :3 #1\=r.'rmfIarau1=rIza
ima I1-T'l'il=|'liH crlcat-ii:

==uaIa\rrmi-'trrqIIi=ir3t31a11Ii1ar=rvz'a1 it
11I:raar|mtIzm1uta:fvdwnwru1mr11Iz.raa1$12r1ir=Ia
an! mmutnmin 2ItaIat1II=ra'1TEr<1amw1 3
lElU'IlB'lf|'|WfWT6I1II|l'?I'3I
q1"aa1'at:1ai:'1'qI'IWt8@faI11'tIu711tul
anurnf2I6H1'nIHI2IanI'Hnia1a'1THn1a3uTm'al1IF1u1
l'\ll31F|f3?I'lTl'-"I'l<.'7| aniwmlmmmf
mtiamtmmwvlwrrnmiu aamm gut
aawmrwmammmm ummmsmmm 3
rtnm uaamuumutiu
manrrra-3: '11'rqI1&m& 3 Ill1'l"G
n? tmaa'm' wmwwmuanmamm in
mmmmwmnmamanmmma an
a1?:nattI=xa1a1raa1%sIrt=rIz1H1?II1aat=rIz1!1=:aaT
new mm 1=ar:=ra'!I[I<T'3|:I=Ii.?=I1E?iT1%II11I=rIz=l
mmiaamrnmarraw mum?-WW1 Ina.
rmmavdmsum -it miltainmann Ilma
t111'tereatir1EnaavelfareIaa=I=It1r1?su1nu1is'atra=n'
Imnwtmimmmmmm I1'tIPT
mammamu r-1=nta1 arutfuaaamwnm
mmrmtlmdi waaanurmiumawm a!
it m=nta=rrau1rm=rm=u-ans adazzgramrtzaiznuaaa
mmmmnwnmw emit
wm . t?1?mfa=IIzwrr$wI1ra-11
=5-ma-1in ut4raIa?=nm-attmwmatrmara
eavauuatmtnaifwitttm !'-'l 367%:
wtnnwvwarwruaaiazumumu I'&=r
Ihm3aunI<Qua5Ia1a=rnsm'r313<=r<*rI1q=I'1=cEH ,
a=tI' awrwrrm1a'-if &1=n=aTirmrnauaw:rdu=I1a11
in I} aaiuwiimaftranmraain

znmmaaaamawarwanaeurmmmzfa as
ann-'m>:rcrru1:1=Iti, azzfwaar am=aarI=m'tn=rc7r (I

I3 :msmta1a1=1amaa1 amzmtmm
mm t-nar #1332119?! Haiti! rl1?I'--TriI
qammatmaanwmnmmqammwmm

mi:
auucawwmvdmiamztm-$11m=:=Im=p1mq
mamwinaaumwuwmtw am i!
FIIF-I'\=rI?.'lI

aa 1! a=rsm=n1=,n1a'1 aurmrwaqm as
trrar1{1~vFI1zrnIna=! urrzrt qr =1 qt Huh

?m
dii
fem-9'<3u 1- 10-21
=I1E?9r'!i1-13I=lfEl'{aI=lT3=I'-l1'\-i
nmaawmmntat-wrmcuawaaama-ama
mzaaraadlmd-wtaaavu tmutmm t
arrauusan

mm-u ::11ruraTt1'a11ttI15=rrEu:: c;.2zes


Ilummcaaa-trunaraxmrvaaam
vrw-wrt'c11uma1= 6-'rl1?ll'I!1l11l'!'f%IT'l'ITll-31-l'W=F
watc;n1q1azrnTrrarIrraa-r;a$nwIga3I3a:a1Ea1-Th
x1=sTi1TIa=:~ntiI1;u%1ITI=1r1Jz-uTa1uqarH1=*Ia=4rI'
&ft=r=a- z=ft;m%rr;taa1n;ar'ameaau-a11'm
marlaxt-=tntIu1%t:a1=1;mtu1c*Ia=r=J2r;11eI1arm;at1t=r
_mwanf;I3=Ia=;mwarrnru;-uarw1aa1=I
i=I'ntetI=I;z1tmaIz=I;IaT-tfe1traarsn1mu=r14=l1I
twraatTm'a: mu:-mmenhmma aw-_
1=It1wrraTarca~a"rr-x?fan11i=I1'as:ufm1u1 vd
an-#1z1rs=nzu::B1=na&T:rqim-#1n1fea =nz1s
3I'?Il-ElT=Ili.|liH''l.1l|1T-a''Td'l'l-?F
mmmn-mm-awn 81%m==ramIrr-(s)=n
n11a11Ha1au=rId-Tf!,:ta'([q1t?1eI11WI5 =Ir'us;
IIIfha#1'a1nRni=na1s. mmmmwn-(2)wm
dl'qI-li1HFla:B11=lIE?l'=l;'m'&1Efl=IF'd3iT!Fl'GF
aTl9-I1TlIa=It$(3)fEI=m'dl=aa1 $!fliI'~'I$f?{t ii:
wz=nw=n=da'acnH-F:-aafn

611191-2::1Q='t$l1?-I'l'lf%I15=rIzIIi::U'I:\1zt6i'1T13'H=rEl E70-15:

v?n1fw=Im1 sru115tu1a-aan'ah'-1111
mauvdmwmammaf-ammamwnm
w=I-n'PF{Fd1arq1111=I1ct(IeeI-I915)
WT?:=n=IT'E(n9Ie-I935); I1="f=\=IT=m(u9se it
amaatt)-!trr#I;t=r1zatetz;=n=1913ut3u111t4a=11a'as
mm-mmmuwnm-mrwnww-mwmn
rr3f*I11IIF'I11i-l'mniI"daT-111113111-FriITI=1T

ammttbir-mnvfrmnrm-swam-mam-an
war-wpr-aamm-wn-aauanaaerqn=ann1?v

,na-=trre*rv;Ttm-nvrcnwrftr-arns-vruaua-new
11"~sI-faR=ItTa1T-mlaw-ttlr emu a
I-111'':-qaiazx-a1311rl#{-c[a'tratT-Ian2{r
I151 d-'rahr-arrtIa-afwd-'tTr-1't- mam-m
arrqan-mwd-a1P=IH'r-ahrtaif-=w'=nwa&a
nan-alarm-a1vna'-mrerm-arwramvatiw-arrfm

""""
Trm-1'9-mcrm=rrza1 awamramnatdu

cg 151 -15

I|'1'P'T4T$l?I'd=l1'(II-1Ei1'ill'T-'T|3
wrtw-maataaaaat-mwairmmnm
-'#t3=Im mmm-mmmnmtmmw
ma mmrma-maaanmmmwr-airman
it-Qmvqm-mw=r8aamTa=I1Tqfau1 atqdrl
iftd-TqIz1T afavqrarrvdwn-imram-a'I
-a=ea13aYa-a1P=P11=I-a1Irr=1t-a=a3uutrr- w
u-uh!-maawil ma-#=1't&11I1%I=11<u-gm!
'Rt-1iIaftrru-sra?rr-a=it=rta1a-i1T11s1'
irmvawat-ma? 3IT"l'-1TU11IFEFx'-I'3- tn
mz-ham?-amm-Him-WWW
nrwiarm-atasnvmi-Fn'r=um-urvalm
i1f3H1H1I3=lE7-F-l1DT-EFF-=l'|1-FM'I

aw:m- 4:: I'qIv_I'=1:r_&_xfIfv1_11_%=1rca-T___}'IIi:'[aat:: q;.199-24e

1'r<12ra1a1m- 1':raa1ru\11I1r-'rva
umawayaa-wmaavual-arravaat-muvuat
Iawvm-ntaut @f?1'!'lIiFPEIi?:l-W'f3I?.'3f
TIIi.ftIa131=IauT GTEEFI-111-Tmqwntvd
aa;1%ratr&1az1-=I-?tt'n-arm=ra1-$:rmu1w1%nu=I
a1aTawfmarenu1a=r=rdTwm1-Tlwauvuat-1i=-rglisln
van:-wa1?Ian1ann'=I-wrnitugainvawaaaarwr
mm? d'ta1ananwara-1lI1s'-uTm1T1%at51:3q-uat
mmw-mmnaarf-nmrmvdwiiuav-an
wqarmm-altvanauwmwm-qnamam
-Fnrfl

arm-5:: tqvrimamutmawzmmua 1-24'7-2s

mmuahrxxqtaaartati-Hcrnd-rfaazuaq:
mm1'e'=Tr$=uzaT it fa1aamm3a:a=rerIv-aqmar
vafte11qaa1wra=II-avfa:avn-unr:1:7sa1- mmm
am=Ia1~buaIwrnfI{~iItIIaT ar1hI-=t~1Iufaa'19d
watt? zrafn%1tIf'a eF-aT-rsd$TeIaaIau1
1muTvelIa1=n" arrfm-awa-it1a'rr-na1- we
ma1a:1=a1t-u1Ii*a6u11ava-=rr1'r11n1=a1n11%a=I=I1-rt an
m=nam1amr=rm-ammn-aauqwaaamrr an
arm-q'na*raraau2;'vI-ma1I3'anIanu-1- ear
uzIz&1=z1-zrtaaur-uzfu=r-=Inra-rrrtvr- Erma
=rm-=naaa1-mwtmmmrahuwl-Funds
atria-6:: l1r1&_I#t31%I1z1Iu=I1a11%m1Haa:: I;-23%-4;

wnimtmvawrawrc-wm=Iqn-nu
qn-maqn-mm tftqIv1c1'r&x>1c=m11%n=11z"a-I
u1anI'fartII

$33:-tdamwn-aqaqat-wmm(327-322)
(I!c[a')uTzfIr1-t1atF=:aua1=I=u1za:-11aasm'=r(511%u_a)
1Jr1af=u-Eurraam-uuu(s2s1aarm)
_t1I_:_gr_r:- Wan mm a-Ia - Ba-1manz(a=J 134-1s3)- !I'c1'la
$ a1%r(|294-I295) - II'[l(I3o2)- uh! t ql|i.'(I3o6
ma) - a1:nr(u3o|)- am-fan: (.1509)-an m%1'rt(n5n)
In an ( u535)- am an (|s44)- aw #Tr(|ss7-I559 )
fauna! (us4eus14)-qIfhI( use:-u1o5)~aIr-1 a1 F|Fl(I679-)
1700- an (neo-I192)
ggrg int? (mos-uaoa)-11'm1(Ie|7-se22)-!fIrI=1=I
man. atrr ar:1=I(|es1 - aw:
UWGITT
3132.2133
:.448451
I-ww a1%'a&1%nrI1'tm=utal mum c;.45z-4'70
2-1TI1T-Hliivdaiam
3-maant d-Tqen (Tim)
4.mmnn't znqm (rm)
5-a1ntaar'e-171513511 mam (at)
strutldtqdt (JWT)
taut:-um

WR'54TtI'l'tT'lI

azmmmmmamm aafnuurumsain
wnI1mmmnmimH=I1a1@!a1m1
'F::|qETFl'c?f'i,FF?l'll'FII|l-T %Frq1m=I=*la=tm'aa-I-Tr
i|AHa=wT'=1a1ta$ruaia8Tfafha1iua?1:u1aI'eI!GtI%P
:mmI1
'a!|'l1'l*Til"=lEEi'|If"('x1=llH'l'1'!?I

""<*11i1=a1ia'=uv1IrwFti_11I1rrIra-13u'(')
m'aw=rr:usa1&dm itn=I=I1zne1 r=n'rI3=m'
itatiu
ms H-frlfli ataauau it
cumin at-I18cniriimIza1=1.11m.a'rqa-=12u.au1hx.n1==r
mmmwmmmmmamma wman-aaua
iuwaauamaa-a1n=nu11i.1a=aamnaw4%11i:=wusurm
u-rf11=naa1isu14=ear1'ari,a1=s?f1%Ia2srft.a~rIFamraar1!'Ii
au=Fzu1ari,?fIa'tI'=;a:u-me--I avnumin mwvauavaa
a-tn:-faIizuzH=r urrazrcm Iwataw facaazn
a wlmiu aa:1%I1i=F=I1=m'1 aifrrat-R11 mi Hrr
anwwtarraia

(1Ei?IFI3'-'|'lZF-1-'1-'lIFI9?i'lFIT317lT3T!Tl'liT)
11

=IIZ45{H1TEll7lFrIII'l'3n'TF|i-'I1111l1!I
masumm mamrwaaammumwamwiu tr!
wm1%nsi,aaa:smrtrathl mmmuhmadma
aam. man=1=z=ml crraasan mqdmmwaqaf 8
wnaaflusm-rziriratiu mtaaaqzaumqsfmmrw
attmmammaaummawmv tammatarin
amammnama &mtri:1au1=11a1a=usaT aqann
ummarmmaraawtiaamca uIr,u1aT
dtatv-.a=1d-ra1q.x'rIa=3=1tn'af aaa-m.m-at am
=l2_?RlTB!1"fHTU?!f4*1'IEf?-Tl3=I3FIE''l3i|T3iI

ammaammwmgmww
rm=n=zzmat' GI$IIl={!l~'=ll!FIIIl['#'.f?-H 3Fl5fFlllHT
in lR.'1F!1"NFl'l3'I1'?.F=IH1I1

'=n=rH1aWn==1=rnaru1=m1aw=:(a)
%nwM :a
ad1'=n=I1 suntan? gaaa'r=n=n
mrmmmammaiamwrmaarmrtanvmzu
'-'1a=nun

wgtawmxmaenaarauznariu mum
zrti=IIza= nawatmcmaamua ii

I-Irtaan=II:m1ra-\tm- u. 9u=ra=:1a- l|2


l=,|i'-l1E?li1'l'-'l'i!I-t[- 2o-w=r11u-1I- I964
12

u1=I1%Ina1a1i|a1TaIaati=rza!r.a-1aatT=rf1=
m1cI=ff atliaiirlaf wanna? rwlmatmi,
arcrnalautsitatzuaiaauaurarraauafin
atra sr1%IItima!ta=1zratI?:'mz11i.:ra&11t\u
-ttrrmqimi--'=rraama=I8m:aa]i H-T nu
tiT|1'3|u-'lftFa-iFT!.a~ifaafa?1'rtrifgrn.n'f
trez. aifqn, are! ''FI6Tv1T H!'IF-'IE111'liTT'3 I
II=ruTrq1DIi=1~ww=f=sI.anntrn=rv &I%wa=mar,z;n2?t
veveauatxrm.a?rfa=naT3fav==z1iuBIT ma-=r=r 12
aru1ara1iuzn=1'rc\i1&zuuu11" uImtra:I=en3a1a1,m=I'r
ari :rmrt=na1ar.assn1'-'vi't itwtwuarmti
amt? a1faqa1x=I1u=1=ia-1'-ua1err%uv:n9za22a1=1Ta:vrc1ra
tutu? a?tIrl'Hl?a'K-n,amf11a%I$r1Ii1a~'a1aT Sta?
atia'r:rtiaf=II-21'zm'&1r_=fsr1=Itarta1IIi|

aftaaaaa. :tta=In-tmTrrul. rira=I$qma'a


git, auaar-mama. a=.=aa'.'af mniaanavtwtararm
aiqzmttnat f=|=a'ta#ataw''rm1-'=41e1=ra7ta=ratTsrIH1?t1tt
in ttnliwaqti. cra:=its:1%ruiI' '
=11:-41asmumm=nfaaa1a main mum
raI=un1a1T a'ta&a1=i1z'ea?+'t4rrIa1mzrT\IIa=rIs*arfw1rtttI'

|, nnla 1| 3 copy of life. 3 Itrror of ountola and a reflection


at truth - fhoory of Dunn. ltooll.
13

i|=lIa6e'FI1'~5IdT%a=I1 HfH<?a1i.'I111?-wta FFIIW HT


awaa1u=ru=r.=ra1=-ma1iu lzmmrttrdtnnmarua-1
uwwlmin maummtmumafrdqmdt arr
manitari: mmmeiraqmmmmwmmm
Qawtammzwmfmmmamin Rmqrr mm
tI'uanmuurdTa'tTa=gau'ari.ard=a1zaaTuwTa=I1%r
1167?: airmzararracmrmqnmqlwt a7dTII=I1
wmmimawdr mrmaemmggdumrda
uraazfrwlauarzu ammusmaaavfqmmam
zrsrarxaaanair a'r=rI'<.'ar ft'tr:maaIin 22151113 mm,
Thmmmammmwmmmammr
:raqrI$=rr:~l it 1!TTlua%|=rIz=IsrT11m(4eo1-c[-)'aI13
=1rr=s'=nzaae|a1I=rcrqradtq'au1=n';fav1rRra-?;;a1. "''
anrczv 1I=i=7fFrL13!tHI.'ea&13;rnlH'H9IE&wFc'I=1a
atTrazten=rna=ltfa-a1Tz;a'=l5r'vawuas'it aamwrmadraa
aaruraamau1ana1miaafaao:me,urunuutama av
srrra1'I'IrcI=rtu1rrIPIH91a:mIw=rcru'

wtmmamrwnrwai -- "rmmraruiama
9u=I=rIaws'n1aam=Ifhaq'a1natrm1auaraafTrac1a air
um-mlammzamrmaiwm. Tray! tan-a1md'ra=r
u1a1trl'at1|"2~aIa: EIIi.*'3I?=l1E.'EF31{d'l'll17l9ll3aI1l'*

1- arraz an F1lTlUWFdT6?lTWN=l'l- m'rr=r'n'tar-cwso-:5:


ma I970
2-w11=Iurraarr1=a=n1%1a'aTnttzIcm11atm-TwI=Jt11ta1rr
IE_'a'<1I'a1#-teen, q;-I2
14

rm, uamaummmmwmamamammk
m1,a1ItaIa1rwaua1m1=frwI=au1a=ra1i|=11a1i-mftaw
srntatwruamrm-agvqazmwmanmaiaut-mnu
qn$rIhIa?l7:Ii.mwIfiuwhca1anatIunp11S=rramw
3a1II1'ruTmrr'~aHmatiu" ' an-'t1mwaa3'rurI2Iart
'1f=IFPW-'i1!1fWI"*ff??I.a'I'f.".-HEs"{"3F
a1 ttrata:m3tav=rrcauran23a=aa=:a1Fceatr=rirn"2
l%ITa'=F:'a.*c11?dT<\?TrEs1m=IIUui1vI3-'lca11-1'raI=h
m1awaa'mqa%u rrI=1EIiTtee}tre=ItT11f=cfHI1qfI'a*
n?I1?.-*arIa1?TwnUa:==1arr11,dTd=Ia-I=IaT=I=rfIr rraanam
m=farIiI=1a=IIe1:eaTaaa13;a?F1Tatf&a1a[IcI=I1T|=tIzaaI1tr
aqmrwiretn mmmrmkmmiumqnaa
mtmnaditmavmwwmmminan
ta1Iu1rrarraII=raxarIaatR:rn&favi.arq1I'a:rrru1n3
swanzatrwwramaahin-3
wwawhunnmmwmmdmw.
'E(=1T)'=1'=7Nii'-'I"fET(=lif. artmwt. trfam
=rd1 arm, Er!IFlT~T1TEIl'T|3lTI=|T%ITl'\'-ITia'?T?Il13l"=l111T
maa-t<taraFI3*%| GFIG at-rnn=tm7rw4mtn'
39--p-no-g--Q--oo--snug-C--unjpo-4
|-f=~*!tHIftaI-92aai1r-1ufrqlzI- crma1=Fza1uTH-E;-Ins
2- I!=1=IafzI=I-e.'r-Trr+1artII==Ia321-E;-I42
-3--ml-=rIEFI-=II-':1sI?u"!II1!5-i=IrI- I955-q;-5
wnwwmmmmmwamiarnmanmd
ai'1wu[dT3er|!1crna-'rTn313=I1z'd-TrI=It1=itmtEI a-Ram
=Icr3,1i'rrI=lTa1<ira=IdT11iTaI1EiTa=I1traTEI3|' ' mam
'{Bf=l=llGff3iTl=I3rER1I?lU'{1!FI1mT3fi51=il?=iT
mmarmmawaum aurrllvtaavaaum 3
III! tftzgaiv 2
am: altqau Iu1'uuTa:tEla1?fs=I1zi't
TIaatiu1w1E=FIa:1'11=srw3t1af!I'612ra:a1?a1iI=iR6h1
arrmH=n1"af!=mIc1 vdrrer<IenTam1=c wzvtnwnsf
trraraat r5=Ira1ararau:raaa=IIaatTm=;1%Irau:u=I%
rmarmtaamauaanmqoitr
ivfaamcasrma
@Fmaar=rrrr 1Td\111=7fI=l''J6Rit&Tf-rl1'Fl
fiwzrrarariu T813 alaamaa, Tn-q'u=I, arIan'-faarr. 'mcr
rrcna. -3a-qsn. mm, atqmatna. na-maasa'iTar=nrau

n-m11muT!a-=u1ua1u1t-qi1I=Iha-'wI- u9e3-t[- 22-2:


2' Draaatie Ierk :|.a used an a geed deal new-a-day: tn the cure of
mental and nervous disorders. a fact which seen to support the
view that pretend ganee are valuable outlets for our teenage.
Sole pnyahlatrtete neon:-aye their patiente to act out things
that have uetreued than and this in eoaettnea done in groups
eo that the aeabera of the group have alee the advantage of
helping ea other. - he Anatoay of Draaa - lla,1or1e Boultaa.
3 umII1I e'93e
1G

-nuumm'amratun mnamsuwamn miw #m


umaarammarmmanmaumvaa arsn1=Ia1
in aa:B\1ra"ta11t=IuaI1rIrfr11'c'1ri| mrlt-fIIt=I1'ar .
ummwzni aaugrwamunnfausninaan
azwnmain
wmamaar iuutva mmmavam
m1'=Ia$uHuT11%ruaT:aqa(I3-111ltaauIat)arrI3tH
ttgaaanumtaiv "
\TW"'5F'7"'Cq!Tl$'Il'!TFlTl?1-=|IE3T a1ara1=a=mu
1-am
wdhduma a mwmnamnq.
wwaaarw uainttfu-1: I
mm-can-=1 ua'i:tr9'd?!'EI
=rIcexq=fa1'3&v.'vmaqarnn1au'2
alI=!~?d=lF=I11'f3*3

am vaawt '
mmmwd
mm| m
. . . . . --{mnm-L3Enaqa---J:_-----------
I-(ll-') mm mm
(evaqaarlarnztf 1/ I5
(Ir) usmaazrmfitaumaaamaz
HEW-'t'II3!Taa'1q H3/23
( $1unm0
2-=l1ClI!1T-9Wl6lIJTl-C[- I4-I5
17

mmm mmm#mmu"
mfawmaimzaaawrmmanqmwmt
ttr :rn1v:1=ra-1'=I1alTt1%n1tBfI!nanaaI=I1a*asrw=11tI1s
aamalaatamxdaaamatinmmnrwrautiftwmzw
am=IaT acne! iaaanaaaruaarawmatraanmn
H:%1rF=I1i'cit-Tr3|aIa:a=I15ria'lasr=?6nT=Irt =rll
trea1efrrw16vR a1urw3crr:Ta1%mvtM1a=rra=7tu'e7r
1'2: am:crI6a=iat:r=I1T11=1ta=1 mm-3 aT=I::=m
mwwuminwawfair =I1E1iI12'=n 2:13:51
nmmaafrawlmamuemiarwfunataaw
afzwainamimaumaauizmiaamwui
srzr :raa'r1rtnEIavr8a=1a,aa=rru'1?1'riae?ta1%rantEI-at
maahwmawfumattqamiaram
$HmiIa=IalatI'a'i1~nzari| 3W!1T utatadwa
ifamaaaatraaarrnau
mmtrmdmmmmumrmww
wmmwwmmmgtmio mumaacuitfam
II-Tic-1131! a-'faiq-wautt man azrranm
3?!-'!fE\"|ll|lT6&|' avmwaamaazsrmvdauh
m a='aa18'3|H1tE:T it 62 aT1f-r!1EI$%Ha1
i>I%I1mai=rvz'aT asmwaitrrreaudwrmatrxlr-git
H-'l?nfl':3I
OOOOOO-OObOOO--n-_o Q Q Q u - . Q o o o Q Q O - o o o no
18

mmarmuaqaamamadausrvlawdrm
mmtpftaaudvanmummaavmti:-@rcrIqr
vdwraHIfm1iII:Ia1=rIfa?sRlIaaritawrnaaIa%,mfrfa:a
ran uuIu'rIa11?3.a2z1au1=1a1m=I1=nf vatfawr aw:
amdrgaaarrarrd-1savau'c11ra1raa1 at-{mu-rt-11161
H-rain TR-ltm aPfaaI'taTa=Itr|trFuatt1a:na:x=2r
a1a%udaIgsIu'a1%umammmmau1mera=a mm
ttgnnmrinmivaammqmmaii am
maaqeat arwammau-'

tmmammm aunlzaa rfrifnavlzf


1h==IwiEITa1%| ne43a61&=!.'r=m'IH331'ravlI'!V
ur=r=Im==I ganzm 1943a marmnwwunfmmt
mfwranwatmmdwavwnwrmw
acuaarlftumm mtwraa ttmzfa-1*l=tI
':rawa=nra-1 a1maIuaau=ra.-mvwaw3uswtavr=rn
wawtrnfmn awtsaamafaraawawaar
ma? aeinrrniwaatww q'rr-pa-3'94:
Umlinaziriu Ww arvamnraiaawwmaan
muI=i'uI6Ii=IIavrrIauaaa=1ata11nasrmatTm: fem at

u-=:'t&3Im'I1%Rsau=rITi|1 ?f%rs1e'rB4'f'I
-61-Iftwafr-q-we
19

tI=n=Ia13aItIIr1'uTI=3 wataiiaumitain 1*-I IlI


TF!I(II!@11$1fiI?Tl=iIE!ili1I'l111.3117II1EHH!ff
aurautaaauiamddtrmiu '-1lE?Ff|EI3I1Hl'lI
ifuacmifvrlzamwniaarmiammamnrfr
fu1=:r=m1iuav:u1a=11uTsra=mIaa911~mcra*IT Ina
z:'1a=n.at1zfta=I1.afra-1~=Iaw.TH.ma.a11?aaa'! F$f9Il'-'-WIT
min wawaianrarrwv waatra mt!
ari.tnT={au1wuwa1gaau'I=I1?mnm*3s=t1etz$tIa!h
I11BT(uTrFIa.:rnu1tvI2:,t1?!!%I=F.14tn1nivdvuf&'r) it
1-al wzrrtairpznwwui mwrmm in 11?!
iawvwasamawfuuiwwma mun-1| Iiltili
m=2=IItr==ua?h?ar'3n e't=rr=mnI rr-=r=ua IF'tE'|?|W
gziinaamrftvamltmmqqfarftaxnuuuwm
ua=I1aIavuu=1wtaaca1nariu=m:aia mama
twara'1a1I.at=ttan=nrat'f=r!lI fl=~*.'r=nza1 mt
-wmuaa lrrfrwmuf E-f6|'91I@1T allti
uw12nua=Ita1.fat1-1I~rqIa1aI=I1a1-I au1=I1<zn11%m1 aium
1! wrrrtIam"t=r=rra1 mauuawaqwwaa
rth fIn1a=irts3fanr:I=Iaaena1'nwra=111ar1%I=I=I
maflT-ttIm'a'1 arumtgzgatiu marla tra
d?l21lilI!fdT, arrmamraw. Tl-(tu=3a=na11?':Im-tttwila
ii mmis
mumawaraammd
ammaw wnmmwwmwim
20

qi!t=1'tmi:
I-rHr<rx=I'rt?1?I1'rftIti=rnz1's -thtrnf
2-=dr&@I'aa1ftui=I1ad-I u1d1a=Iwnwmu=I-zrrmutrraraa
3-fi=r3<1?II%IaH1zI*@I{auqf?aufar1Tir6mIi1uhaTe=Iutfr
4-I't=:'ra\91era11i*Irs=rIzu't 5: aw-1Im1=I-Tr=m=Iu=n
5-=?.'T&1?i?re1fwme"a1 ataftqlaauua-I=1auu1%u
5-=~.*r8@n1rct=rre'a1 3 Tf-6? 1'-16:2:
1-I'=v:raTI=IT1atx?f61i1f\-Ia=rre<mT ili-HT3=l376liRF|-9'!-'lZGT
a-fe=e'ra:Ttna'ra"r&x31em1tIa:=1raa1 arraa=nenuam=I-av-ammTqa1a
9-rEIw3?1trRIL=rIEht awmamasu2I=r-a11==rmsmwu=nf
no-wawamatfaaaww-antmwain
n-ir&Ttz=I1a'=1Itrra-=u=fr<isr1f=IaaIu1zr=c-at-Trsatnutrf
uztrrql-t&=(r3=naa~l wrataaanaaunatlrvw
u-mqar&m-aufaaaaa%ra.naa- raumwla
1. walmrtwiaumwamzmav
I'qIr&r$@fa'srfeu=rIz1 awanmaaw
a':12!aq,'a'u=i=I1naI%u

mqnmaukarmrmwawkwm-awn
srarc.a#i1=rmnrt1%m.51l?:==TH.T|'4FTfH=d.-dT=It:a
tam! crtwimtihwrwwn fi=:'r&a1zuIIIu'6arl6a
wwnw it 4r1=r=nzru-zrr aazaimwiaaaaarnmiu
1?t=Iz1t=a='I'3t1'r&\3fa'entIti=I1z'cf a?a11rrru=I1=rrfaitihm=f an
mmnmmmiu rnwua=warmau1e.a.11=v:ra=rrqu
21

mmrenata=m=mmT t6't3qfaaa~1aIam=Ium:=nm
TIT?!

I1'(?I3"1I-'fTP|"|T'~I=lEE'3%9Trl'l11'l=|1?.'?
w mmmmiatxmaafrwm airmfttw-"an
1!211i|i5T**rertt%11m$war amrmmawmam
aqatfaaatml atmavrwrgvtaauqnwcfn
W ~1,:rwa=1$rvasaFrII?1t1wa1%INTaau'sI4I1'eu'dIu=1
mwmaammgnm atwuuatma '5fF.'THI
?13TR1'd3I3f'a?1'Ca~TTalE[I!ffGJ3il=lT-l=!Tf|1
aar=na1vwUa=rtaqaa1=rif win mltm :5:
uT'I1=l3aFI3Tt!a=I1?IBl1*8?h"{?Imf$3TI?3a=I7J'alII
'l(iEdTauEIYi1EHHaq1%I'=1|zz:%r{l'M:!q'I'-Elihu
va:;I%m'Br1trfrTa1ftmui'=rarra1lIan'razva=1a1=5zfn=I
mtu m8u'rhIatTarc.?3I1tdT2?aaata$taafini'I1t
tttqiz awaawaanuaammnmin mmw
8ntt:niH1'a11~aa1iisa=u1g1iiaa'!'ra:-nara=mn.mavm11a?T
B'l'=n'lPlvllYJ!l=l':3S'Ca#l =rI mat in Hmlwta
rmmaiuaaizm-mnm%mama?aawamavamamm1
i: am: #r&=nr:?f fl ammaanwww at
awmuwnwmin
22

.*t:tarut-akvtzkakiriiicakxi-***ar*i:i:ik5:*wt#'k**i'1r''I'

3i i
WFIGINW

mmam-mum =u-an
I-ll'I-I-I-1-II-|l-l i3 E ill-SI-I-I-It-ll-I
23

UN! UVTIU

11'a'maT#fa111a was

T-Izur
11%m1uoz1I,taT6frH8d11T'I sqalil
11aa.1.-am-Qwwrr, t'Glan'fif!a''s=In6IW 3-16Iu'211I
6lIfa1"!i11[d'E5HI'iTi1T?HI1'f'{3II|'3lFWff(1a'5m'I *5
tr|i.t3|?[d')3Fl-WF*l'H\1FElE[RH ruasawfa 'lf?f!'ll!Il.'El'T
mart -
'1ria'nmm'aw:%I2I: a1ru1H:'
2/|o//
qufa zrtI=uauata9'd-1'r1a1m. MPH?
maxi, arttrmiu trct-an a1t1'am!1Iv.'wa:qI=mI'fa1i
iaazrcnwztfzsiu aim. a=1r4rI%vaaatr111'-zrw-i-!m11%:trtt=rd?uaa:
nwitmmaamvhmmummammain
mmamama m:~:t'tII:a=tir=1T'1Ifa1
Htxnzsrr-I.-wn1=ren(;......)a=ramu=nvr in? muum
TETfT1-T~lIf3Tl3'l!II3Pr9'I'HH?FUI3E1=|1TfW{3||
'1'f1aH#t1%n1!r!waYdta.TI3wIma'-Iwiazf F93

..n=m1a;a:-an-we |E[-4'16-6I'TlEFl-TT?|l1?EETl'!Fl
2. 0:-1:13: - A non
I1-to Putrtdgo ltynologiul Dictionary of laden hgnnh
3.289.
3. he hart Oxford haul Dictionary. second Bitten.
no 0310:! Dlotioury or Iuluh ltynoloa - Rd. 0.1. Onions
o2o
I:lnto17 - I.at1n'l1oto1-1:; Crook - historic. Inning or
uovinc by onqury.
24
13:11 '3I"(')

"
wrrmmrar imuzmun mbunmai
acmimwwinmu uauumtvt. viii-mquzrtvaas, PE!
umqmz \1'fuEtIE'a1a,3I1I11T=I31'Ha1NU|3rI=I1fEa~'3I

1tfi1?IuiHufawgawn5qn'(2)

6Illfa"\ltlFlFIl?FtlIU'F{l1W|'E1=l6l13i=I!1TaT1J'F
!l=I,i1?lT.H11'1'FGliW6T'l1?t|Ua7f3l6-TTF|1=Il
nminmawmauwmiufwmaiamaa
mawznutmmmdmmraauw azsrrra 8 aarr
Fi1=|&-:

uyqmamvaam siral"
-=nrIIrrta- ararrsn

6II'JI''lf<1I1'Ha'1trH1=RI6Il1'. rt umer H13


d'rs.1i-cIailHI1I=In11m1m|

mmanmwnawmmaitmam
wmmaavwraitvdtnuanwreaiawmm
awifaurm tiummtrrnamaammmma
'21vaa-zwutneTi3e1avfan1=Ra1'am(3)

u-t:tra=u'=r- 51-{fF'=FRl: cg-szana


2-13I'1q,'rPIt!-ta1a1-*!ftIrrIa1'N:: :6-ms/4/Io
3'w3?d:
I1cItIl4:q,'l'l11TUtl:!E&kq?I'|5J3?FFFv1=ITl-II
- umtr mm: 4/I5/4-/2|O
25

wm
awn=:a1au=ri:

Find alrra rtrm" (I)


avmtmnaaavfaszmqtn. 1lE[FI,a'lU3Il
mm. azrnv; naammwmwmmaammnad
9:.WT|

d=iT'l21'36I'-',1'EI1T'l1FI1tHt=IT"ltIla=IrE1 Tra
E"4'fITF|T avumngarrn
Imqwmwwnaamfmaaumnwraw
wa1%rz?aa1fa1Ii112'rdirl'3;nsu?ant;sInI%r unwarn
uammcamtwmtwmmra
azmr3't?aarIi1:uE1Ifaauart='<1I1%I ma:--(2)
mm? a'mf GTETHGRTEIETEIETHPE
miaawiu
wumqr da&1=I13e1a|'(3)
1'l'FT6FTl'lTFI!WEI7fI-I1=l1=1|!1'dF11'=a'a'I=l

Tr:rq=I=:Tt=N1Ta-1=I1nvc'aar=1tzH'2n " (4)

qtnwmdimwmnmadwfaqavnac

(n) aar mine: - 5:4


(2) mamw - I/3/38
(3) i1=z1I=tau1=III1 7/I/I
(4)q;11w1fae1tI:11=:qvI1.'I*er-=Rta'-a!aTt:=ra'rr. mfzzg-:4
28

i|I1'rPIa7?11atwr=I1=I1aI=3a1=rtf1'aaTaraaa1II;11=I
qrmquaisamadiwmrmmamtmdmanu
Hammad =Iat1t1eII1FIEFI'a.1iraa1aT,1=i'1fi=r!1nit
en1=nr1f=I1T nI=ttata=mIuaur1%q1vn1=Iaa1=r awn
uaamwahtvawammaamr away
cmcnmafwm acnmasznnariu ma.
air-rl-5.1-'mt3'tP it alaqwnaamttrsmninqtn
mamanrfaadrtw nrIu1emu1aqen==im'-wfu11taaI't
mfarnuf manmrqrdwmmifa
a1a1v$aerqTez1aa1a'2111=:Im,=tr1=Ia-'raFaa=:9=a1Iri u
aavauzmmmaamiqtnmaanmdtamaamr
mafl a1adIaa1!I_ir-1kzr 21! tmm Rm
tn13a'rI'aaaar%| aavatmvaqtr 1! r3U:ra=a1'a1i1
E3-I1TrHF|H'il3U'i!1l=Iq?1=1?la1'El1?l7iITi7I'l3
a'Il1'1'PIa=nI-Ta-1ammaa1aT duru'n4I'rzrr6u1=rra'=I1aaar%

at-1 qaamwmwgrammmiu
EEI3
' Imraamwadvaawlwqwav
Ir5il'l'i-'IIP?ltI1'lR1?l1= mmmdamwnm trr
wmenwmmrmu
*lTlx-TlTI'{d:

witmaunvaurmmw-aiwnmzn
a1-nI==9m=.'=1:u1- t-Iuaitaaitsrnaannwuwm zrtr
2'.

nqaammqltiairaumawuavitaanu at
mIrta'-1a1aTa?tsnau| E-tFIvl'.i'-f!ff6i1TII =rd'f
iIa=HarIa-11'atwc'-rla aha-T=frrHutI'-tr=I31aTie
@'e1tnaiatara1=Ienua=rI'6' a'r19m1a asqahtaamaw
ccnquaraarrariutumnvcrna ammmm aa
atI=1uaa'raua=:aT sham? a-1a1trI=Iaf tn maa
{arrUHl3IITl?1Ti,11!3nIa12sr;r:1%IT=ITtau'TI"(I)

=rrmv1c1TasrmTu1am1-:7 arrman 3
mn -vn%:maaqa1 znquawiuma qawmaamw
uawaasf aanaaufweinmaaaaanamwwmmva E1
adraw. aitmn-----Iimardwaama it
'3! a?ft41=Ia"?T=11%strtraa~1a1I'14%!I=r!h(2) tt-s-Iaru"ra'r=r

nttmawmmaarrraarmmamugtwmizs

trrain)
r1%urraa1a1ea1=em1anaaraa:mmra11=avw3znrt1taa1:31v
am?-maraaiammearaatamwmgwt mi
airgrmmumhnaairuafananvmgw ah na1e!tv~s=?*=

hawue armaqcnmwanammuaa

I-HI?I.IIla?'rma;Ia ---61-11'~h7u=rr -I1-H9-I20


anTra1aa1a'u1=Ia!Tcwa --rq1az1nIzTam=rr

:-avl?rIm=raau(we1)--- d-aamz-11a3W -1- so


28

1't=-a1en1ar<rz?u3r:taaaru111is'(')a1-1111'm:ga.tfd.1m
itrmmmmmrad aq_aa:raasravan-cni,a?fI=I=I
R13Tf5lWHFl'ITlT731I1|l1'H?lT?:'U'3;6I''3DI
arfH11atI-ITIH1WJ=rI1-lTlHRf|IfHfr1Z=l13T
a:Ia11?ar%u"(2)'s'b"11t'nt1aTfI11=a=cafIsa13aaa1T1?t
a11cmT.nafranI=ra1q,1= arm! 3-f93.i''3f@lF'lI'!'lHP?F
aIn1!Hn=I'3|m?ra11%Ia114:1aw?4.au=1Ta=11rar1=1au1UaqT
xauarranaymnafsrvan tflmritaaarqan
aTa'<Iru=r=rdfuaraIav?rraenu1uz=rIa1T amman-3-umma
nsz audraruawmmiatumamm am
Wm? ital-s-'Iat8Trs=I'la=I1ai13I'vfr=n!l uigavaurriraniia
iutmqamamamaqmtaamaqluqam
n-=11 <armH=1u7:1Iiraafm11-5-c:1%u'(3)u%11'n=fr1Jczr:;iz it
11?ru'I%i1a={3fiIta=Iar!IaT&rIf&IFra~aE1?:u5l3I() "
Ffzatta P63! l"1'I'6Wd-||Tl"t|=lFlIF-I1=|El'i---
'arraraa1'@tTa1T?r3m1$ta'rI=tr311%1vra|1-1rrH11=I
qua amra a:r:rrava1=nin-- (5)

(n)nrrar2:vfcra111a:r=Ia2: - at-uamuta-srata=I1
arudam, 202013-aa
(2)fl=~."fI|1-'I'<fl - =e1-mazam-aaa1w
61- !l61'l6'lE'T-Rla'-IT
aant1un='I-uses
(3)mq?1z.=H1crm - an-fm'rc:T1'rrIa=.'a1m cg-no
(4)mm=n-I - !r~=1r'u=fruu q;-sno
(5) Hatawrl-Im, a:m'atTHa=rIE?-=Ia'l'l=I-t;-I2-I3
smnmawvro I967
29

wmmqana:
|JIIFl1T'l1?rITFlil1-|"k-ITl'E1%"'T1*3=IT-I1alrI'

hasuar, 12'-I1ai1aTataaff mmmtm at i1*'l|


maa artatin tmmarahna-ua1I=rarrart ah 611-'|T'l"6
ma-1drataa1=I1iu mmdimauani aT'Iz=naT want!
uqarmmiawnmgnimmtmn an
a1taaaa=[Iil=TrarI=e'I'

a-fr&naramT't11mwsm=Irf6mu1ri
(HIIEIr)a1a?fH1=IaTta=Iana3H12I11#IVaaTaria\T
W9aTTa?fn1=Ia1a1vI=aa=rrrri|u1a=tn1=f1nn1aIdTawI'aIa?t
mwmmmmammmmrwmin am: am
n=yJ111m&FII=r|' Ttuaaa1I'2ara'rrae1nai- mm
tn=Iaa<m'esawttTcmaaadu=I1aaT arqahiu mmaama
qmummataumuaazmmaaiaammmzwrat
enama1n1asrzaaarra1atr,arraa=ua1~ra=ua1a:12mua1z:r1=uanzrr
a1"na:aUtrm'aa1=rriI"

aaaaamrtmmqalaum u
utaauamamaaammaam :1a=naafnI=I i:
C C Q o C C D - Q Q C G C Q C Q Q o Q Q Q Q C o Q Q - Q o Q - Q - Q - Q

I-3f%vmnatEt(a1%I'aI923)-dataaawz nn
am-ett-(gnsrama-1tFcIuuu q;-usaaqa)
2-I%"Z!ai-=ITaa;mI=a: '1T'T| 9''l'l8=l'I
tfazmnf -W1<'iR1I{-334-335ta{qa)
3-1nrrHE!f=I- '{ll}'<'2I"ll[-I34 aa
30

mmmgimmmqaa, zmtramf, aaaw ah


dim! acrn_?avaa%in'
asraa=ITi1'T1Itraa3I{a'a1 IHGITI-'\'-R. Pd
1aT!al' m%I " 2
mw-ma
mriIdrar1'tI1FI"e'Ir1'rr=rrrfaTr'wI' Inaa
=mtn1=1't111'in m$rcrf't\m1u1' ti'rn21'ri- 'rfaau: ma:
mfm1au"a1a$etanfI?-(I)truHI=n(2)1'uaa1mu1==I
!t=m 1'-1anT$r6umrarrourI1'e 'taIcr-1ra7H&aam'r n
j train 1Ja1a1t:t3aaI'rzwa1T6:f. Iarra?I'r\11"at
_tmra1a1m:rau1aF1a%a'dar1uaraH'3u" cum
afta1mfr<ua?ta:rI=21:1?ti- "mmatiamaa mzn
wn'I==Iat%u"5

un-cn211%:qa1= ata:n~a:r:

stvmazuaaaam mmmm a
I-1a=aT3e?1aa1RI=rIaa1El11c1s1\1aa-tw=1ar:(c;-zoa-qqa)
2' . . . at history has to touch ll um. :11 and outing
in out an antoudnto. our own mutton. our own donut
"Ind1n- that on it touch In - In I111. Sound Id. 1961.
319.14-15.

-3-Hrfrazaftalar 1JI1a't1uq;- qadarm I956


4-anawaw 1Ja1aTIvq;-2
5-qmmme zmuamt;
31

nruntT1%IaatIHfu1aIaIItq:a1a=|1iH3an'a1wi19mFa
aama1aI1=Fzd'raaaq1t"mriI"

ua1aTraa1amifE5"m1&an1*arr3I:1?1 turn
=rn1:auuratamau1%;1aard.ma1 aTdaauTa-rtn:'aa1a113a %
uhatmmamwmamrawmtm
ma.oo 2
asnngnrranfrnumftaznzerrauwriu
a1r=Ita3aFFt-ruvr rmwiairmadazwn ?m'IITTl_.1I
iIa1r8avrarraarn=*ta=I=r,a1=1aamaarui|aa::ra
mammwmwmmadwmianawawwmaa
my qarmmmwmammnnammt-min
n?,tuaan11uu:fa=Ia'1%Ia3,:raIiI%11%:wdaa"r1n::Iaa1am11n
-a1.:ra5Iaz-mtg? tilts-1aaa1maId1%mar1wI"#na=c
atuwmntaupfi-''naI1!1IwreIat=I'? G7'If<i'l1T'h
d'HIHH11J'3IHl?JUfT=lTTF3'7l1?:rH'3 aaarf
IaEdT*rIit,1%Itr 'eraI'fT1?.=ImIITamTE~I'-nair1,]JIar ah
maz afiurwammm aw=n=raraaama=:a-mar-at
are1aI{lc1u1oI4q*cI&r1TIzTI"4=I=~7d-T6u1=1ra1aIIT Hrm
maaaramwaaraiuaamnmaqcqvana-amunmaua

I-H1aIa135t11%Ia1%Iaa=I-m1uIa=i"Jv?I-E;-3u(u'6a1n91I)
2-mfta:ra1h'H'm -1Ja1a11=1 -q;- 3(m1\1tI95s)
3-mfmmel -T|'lTTd'|=' -t;-n(utr=r:u9se)
4-n?! -warr -t[- 5
32

:tu1a1i|cII1%i!1rm'r11=rs'1rrrr=1a:r:=1a1?=IT=a=It'uT 3a'{w1z'-I8..E

mawnmmmmgnmnwmmwwmmmin
wmdumwammffmwnmmn ?-'1trI1m tns
IFIIT 4'rq1Fa=raa1%I*Fa=Iu?u'T atmsrrnatiaamftazatr
dT6Ia1[IH$FI?trRI=I1=aERITU'{1TI'4TT9I31h3'3l3|31?F
twmmarataaaqwuaznmnmmtiammm
mm: 1*nuH1'wP.tr2U13a'<4rfkaI1a1a=rI?Iaart{It" In
lm maiuaammwmmam aqn rm
a=r1%I'aiaT13rcraacra1'rH=a1a=I11?rr'3uaasraa=IHu1fma1
qrrql annqfu 3=I=H!1'tv'tcrPI|' 3611FFIEIT-3TI'|1WE|-ET
in a%36'F|TT{1l6(|?'IWTT aiaaqa autazaai
,wI7<=rT?mzr&ra11m%na=I1s1au=ri-n1=Iaarfaat1tra=r?rFIfI
a wwmuimmmiuahmanww
writ a1aa'=[I?1t1a=r!aa191I:=n'tarTirn,a'ciTrnHn1aII'2

trmar1aaT=IT arm:

iataawlw-Hraztglaz 11TlT31=ITiJ=ll'~fT
r:ra=IdraI1a:mi|" 3 mmzmmmmmaamn 3

2- mrax mt ah q;- no
3. It in tunlnontally an oxprouion of 1.110 tlrn tho noun:
ot luuugo - An introduction to the stud: of Litorutu-0".
Hudson. 3.10.
33

vmawazai : mmarratesuawiainrmaka
maammmwarimiamwaunamwraaanmvnt
mlira-c2w=Iar=rz$Ttinn,=fa1z:naaa7avranr=I1au"

itr2s1aa1mrcruenc5a1w1er:r=aarr:1ncrara'=Id-1
Tm. mwma-mmmiatnqnmimama
aaaaTftdTaa1?1I%|arIarrauaa1T&1*taFa1%Ia1a:aatTarIi
sz1a=nu;=fq'rqaf a?tmWwa1%n"2

lTf3?-IFEi'E-1'ElFIa?I1To11:

mfea:erd11a1ra14<c1Itt1'1iI=ItrwpnaaT zirwt
arr-In-rw=Ia1=1T it gaaqnaaqiaaratumnm
3I=I=zII1'r%3'1a1iI

mm-gdmm Waz
;r__'.=!1'<TIF"3l1?|'!TFlET-"3 mrmwwar
wanwmaanmatnam-nmiu t=nfm=n=Iar:Iaaa1au:
mwamtmqan ravfwlt
2': hour: or Lttorntu-I - mo Iollok and man in-un.(ta-nu.)
1 3:80 PI11'C1g
1. no dootuu of art in our nut in to ta-unlit fl.-on the null
of runs: to the null of feeling the truth that you-bola;
for In cantata in that bone uutod touthor and to not up
in 1 plus of existing roicll 01' 90900: *1! H3810! 01 004
Ihioh is love. which I! an rennin to In the an of nuns
M133 . . . ' that in Art? - Loo hlntoy. p.12.
34

=ia11Ta?I=rrasavzstIiIaHaTr=Ia'r1aarrzrI1 are
nmcrairrnn au1=naama=Ia-1va9wrran::
u?Ia'i1i,1%I1=I<a''I%rit,11crrrat4n1q'n1%IaTr:!faakfrI
a=rmtrm=z=T a1afanIa=n'5,Hrri-"mn1=1aT anamnw
iIEarRI=rr9'i.=I:2t3trn'r mmmaamwahmaqm
i1'd'ri|":Ham1a't ara11aan193tLfa1d-'raTr'cuGI1.cfaI
if 1Ifa'3z1art=n%u"'

mnmahzumaaw a|%vr1rIt-ta-I9rrIircI2r1a?,
2.-=r=1 zwaaInI=IaaTat2wd1Er4TaTt9z;a11d-r_1'nB=1=IaiT=II'3I
aapIttrfmzrrqa=In=Tta=1ra'=IzTara1a-afraid-Twraa1a1suaTu1aI
iuaIanfTr=F:{aara%Ii:- "aa1aata1a1'=a=asaa1m3m1?fm
tmT mumiramwrawimniutcummmmqainta
11tfrt3i!xa83Igt8aan=ITta=Iat!aarrv?.'1umn3waT GT
zn%'a1arru6=II6=Iu1f?:mTraraia111%'d'r Tc?-taltm
&Hn1=I?Ia13aIm'\anzIn=I1far-1a:azazTa1%,crTat:3au'rFa
a'r=ftala1iah1'ard'raTaagiI'2

qraxauaiaummiatafam, =rra*I7,
au=Imt1mzm=n,wa3a'a:tnraa<:ra=z#muvtaaz;cda1wi, Fi
rattmw qstuwftamamimmawtama a

|. hduwun of art - llooloun Donn. p.88.


(fi=raFtTnTr6TaI?fera1fI'a=ITctr-t1ua"a*r-c[- soittna)
2.=amm-nawnm-amam*37-mm'vna=zwI-tapas
35

11aIin amwmtrtmmmwaannahm in
1l%1tIn'-Jira-t=rIItIa1a1ifEiaIa1i1ladTa=I1aT a1=Ir;rt
~'II'lCl'El?lT9'7|-I3FIT"ffl-t'tTd1f'3 9d:ra&11I1a3K=r913=mra~1'nit
Hane51z$'tisIFaftaIinaarIFrIzfrI111ru1enamFa311%Itra
i1nazsTF1mrmmm=IaI11umaRaamaw12mn--
"ax-zinFrdti1tIr1!wIIr1!r!1aTItrt1ImrTrFtr?t
aw!-3I1FI114~?tl17??11t"111'tfEITi!i'fEl%T!' ualiittdt
nawnaqaiuuaanafwuaunminvammm
!lI@ff=FE17'Ff'3I:'g'H?l1f|I|T=lvF|I~3F11Il=|
nurrawmmm-em? aramamahmmmriramaaa
awmairrgw aamw %frarmWdftFta1a$=TrI'--
tltmamrittrmtn ar11FInrIrarIltIIaTarsm2ft=1$aI@T
ammammaaaamaamwmmmqawqmm Il'5?fT
a=aa111ta1Iam=Ia1a1fr\a11EI$rauatlI''t1'<1Iwd-T rm
ma1a?Ie11am-avrIawtI=tr81a'Ia1t1traarraan=1
"11a'-rltra-ia:1'3tarfrd'ttE.*uT mmnmin amaa tfam=ra1
'nIatvfUaTn_9Trn%1an1Tfar1?:rnaNaa1=I1i1%ra%u1=dt:ra8n1a
'%l1=Iil|'3,i1TF3r31EI?!?Iifl=lT3IET area! aaa
atTmt=Ia\TIaeI=Ituaaa1h:a1'---atnarzxiuaaamaw
a1qauia'tra=nItf=I1=aTwI1a1f1=Ifin' 2

u- felt an Elma: mm- 61-I-um=rrrm ml-rgss (am: #1914)


2-Inmu -at-anuamveaseaa-qa
36

zsaruessaawrwmm g?"
aan1a1a5tnaru-r:-avznarraIz1zarrawff 1fa1_1HdT
a11a1%nsIII't=1tTlTiwa1crH.if at-m1i.aTTa=u1JI 3
l'f3'"1T.3I=lUlPiFT36l|11H,,l'H3l1FIU5T!1T,1'lFlFGI'd
taa mamwaara1II'Hi,l arm-2sa1a=rr-*.rianm
wmaamammhimmmam anan
utarI1v{=tna1rIa1f%r.w=f.Tman=IT1asa=Izta1tIs' a1a
13 avamaunmdmair a?1=III?ua~t1r1tI3I"'

u11meTr1amw='1= itanrad-'tit=rft
arrrawazaru-r:Ira't:arsm=rr%u mrcwarrnawaamaura am
in a'r*eInran1atuftwt=I&aa=uararaTa=I3aa-,n'-1?:-rte.
arrudvl-I%t'cwt3a1=1irr?t=IraIa1in rm tnawtamfa an
anacnmu=z=raaita1iI%a=Iat3ma=Iznwm1a1mi,
Imaamaaimummminnmaaiwrmaiu
talvatqt-tqufn1=Ia3:aiI mmvmmaamaaqml
mara rwmmwwiumwmmrwinmmm
a=mmT. mi! am=I=1t11aT maatammi, am at
a=IiIa114rw11?IHlTa1i|Tt9\1lda-1aiTwmlu%Itm
f?::art=1m11?u::'tan1aarzu5Ia'a1%n"2
31
ttmmmgawwanwaauki
II-1mi|=Tf'm-aawuzmttnw amawananzwltfamaarr
.f }Z..2.1 1." ;.;..'..l;'.{.2.'. }..I ;.I..I...'.. 135}. """"" ' '
(tnmm{ma1a'Ta=Ien111rhn?w1%:'aTa-31-nnI=Fra3:aH
IF-l|d=IT - t{- e age
2- mmavu - na=rratrnf- mm n9s9- I1-353
37

Stat?! =r mafnaruzftmavn-um. mtiuhirrafrum


dTma=I!?aT.a11hzs6TTII'fIt1'c:'d#I,an1a8rl1a=Ia1aza=1i!
aura mauadr mdrnarmdmimamiuq
mmwmtmmaanmhmmmmmmwm
nawnmtasmamiaawmvmmqmammmaeuataan aw
mmamimamnmmwmhaawatamvma um
wa1%aua1tmrad'r=1ra=rIaIT at13wn-exam T1'!'lGEl-'rl'~T'iTl=l
;rawwan1auT31=za11a1in"'

mwmmammwwamminam
msaTratn1=Iaa'tn1=I3tIa1'a1%, :I=IdTaraI11aIIf aiwm
aanwmammiqaarnmmqnmwrm a-HI
mminrmaiamamtnwanmmmmm
awmmintmaaatwlmmw main-n 1313!
mm it srzs1'rqa:a~1daaa'ravt1%nrmtaaua?rr#r1t
sm=IaTa13I'212au1ai%ra1-I1amrarIerP2lrHdTIir
aanfarannamavsqa a1'uaIiI
cra3a'23112sra1f!'aacu=:I=4a1Tn(n1aItar

|Ei56H11'FITf3l'l3fI1?l1'lH'-F1fHEElTJ

(TT|';Er7.'!F'-l-!WlT-C[- asscrqja)
& 91 1fatrertnt=c'a'I-tiIu1wmn<a1a
2: q;-22
.3. ltntory also hit: togothcr pooplo so rated by an am:
019000 - '&nkupou-0': notary nan - 3,3,3, gugn,
ll ilrrouion. 1956. 3.55.
38

wmainawvammawminwmmsv
waatqwaim -'m#t?a&t1cI11trztarIa41:aIu'aaH 2
I'e'wUsIt:rIIfunsTIti1r!I1?tair!1cr'a=1arIa!msiu 1133113
mfuexd-TwFIIirGI1=I1::t'l'r31%1=i114Ixa'-a'?I"'

Hi1-sazvdafazrcr &sn=::

IfatramI=aHr=rm#arrurrcrTa=u1 mahm-3
aamwnmtamanuwawhaamaamamnwmiu
iewimzamqanfmamminmmmamu
aawa1a1=tta=dT1artaau1autaura=arurIwad=g=fanrrarrI?Hr
mfaavlam, aamtm wntfamaafw
aTIn!m1Tsi1t3, atare7r=raIw:r3t:fta=I3aa: rzs1'?'c1rI
a1ftaun1=Ia1a1maVrcrrqUua13waTuIn=I1ifanTd~TUIim iarr
Hamil I-Ra:rtI81?wa=I=I=rI!1 aaaaeawrmaamaail
mmratammamammmrwzaw
wmnrmmmwc, aam1maT1Itrq 3
arcI1'aTtfrBaa1?nin-3a%i- "Imm mum at:
win-wdagmwuilminau <:I:a3axu'-:~'IuadTl$=I'a1
antlrnztaaxuauaa Rename? aTlII!IT!?|'l'3. CHM
a-fatncmdnatmr maa. adaxamaa
:m'Tvrm=Itru1aIiIau=umEr auaauwatnmarr} I
z?u'Zt=a Tvlumamtxnmiaamnwmi

I-\1lTI=I1|11'HtF!r'i=l-'IEFlId=lI-BFTlG|1EffWP3II-Q}!
aau-Hr1H'=I1?tIT:ra't8w-gw euaarmaznaincrrrma
#r91'enI=11t?#c:'?II1"atma_gIa1 itwl. =IIu1%1.5ta
a1Tmaa=aRau%I1%:ih9I1aurraTq=1_aarwrvwIau1*IfH,u=:#
=n=IzfIuwa"l mmqaawauwm main---3 sra-ma
1'|I:iaI=Iftrr-rd .3n=3Iaa-r1?ra1.qu'.uIa1'i#t III
a mwfaaiu-mwnaanaakrmamnrmmmm
a1aaI1arnfai|"'a?-:.utuyr31%tI'r-rutI=I1=Ia1{c2I am
=vmma'-mi ata1:ETa=r armatmmmmmi u
rIsu=1a21*1arrsttIIIi1sauI1I%ItnIaTat!Il'Ia1t1r i
trail a'3fI1E'PrITctri=I ftletiimandlil
atggmm a1frIaTaaacrIiIaaTaiFa=I mt!-rt:
aIaIariwuawT=$ra11uIh3a:=I11a1a1%|m'I-c ariii?
?6IT!l'FT9'1=l15Tl11D='?1f?I!1'FId?f6I'Il1A a=n?ar%n"2

arat=mfmaT11%un1craa1HzIt3.au1aar
i7.muT1%IaTT1a=rnInraa=I7a=Iaw11%I'trGra?TH11*t?a1=I
ahtruaqcvfi, Flidw mar-ft naziuwwamtm
aaslaararm-mz1=1 aimaamaaarswaard aamin
art-araIaqa1=rarIa1a11=a=:21aa1nz111a1au1a1%1a1a1ntau_d
run-H:-3uau:a1avu1=aa11a=rrwa1a4raaza%mvaurr ll-T
mamamm amamwa mvmrinaliiimu
.;mm' 'mm' ' -crgnina """ I=n:na " ' 'T...]{{.;.};""'
($n11tIaau=arH:wa;R193uw:#=#r1=cdr)
2-n_z141s=rIzaT tfaimaa :61-n=1a=: cg
=- .';;::.':..::::'*.::',.'::;.*'..-'..:.:'.':..:*'='.... =-M
(1:-1%. EL'tP<ilR'ET'6Il115FlG?."'|'- '{-.3|3)
40

air. 1?n=I=Ii1, ua, trrariaaru19'~'=I1Taammn"'

F|"5f?JI"3l'?5e'II'!!-T-3l'Tf?11!1'e'{?."l=IT inrati
fm. r."t= IGI1!?JH-?iT=I1=IHaHl'%1TiI={3ElEIHI1I ah
aiawrnmwmataaanauui. :'I= mmaw
tit 59'Fl3H6I.I'.Cr'TIII

Tff!'I'&1H-l'I~i'!T<".1I'~IFl'l131" an wmwiam
craiatlta-11%: TR-1!1I7$r1l9IFI?RI'!TFlEWE=lB, ramh-a
q6:IIa=na aT=rf1vrmT qrarza-maxi, aI=a--:=na-ama1a1*=s
1ti5=Iuz-Ittalhmazataahautilfnawtf uatioavmnk
aw. m:nvamm'estr1tI1au1 aavrm-tuaatawwariu

=r!11rrauT1'u1aT iarcnixa gaamula


mnaiamzwrruuaarmmiu =lli'?RFl'TEltaIl'5
aarnwl 3vT13!3il'l15l1'lcI'l'3II315l=IEI1'l'lf\*1C awmal tn
armtca mmwmr a---mvmmaamuaa
awmwmmmmamminmzfmmwmmm
arFa1rd-atita-Wnaaaw an namrammairmaamm
ah'tna=rIa1 amazmqma awramamamaazmmn
#a:12:Tara=rtf.aI=rrzd~1srrtrarrarIium1a1=I{!1{atm11t
a:m3cmrrwu!tn8ua=ra'c'I!n2w11cIz1'nTra-'r1?,as=rar
aaaquaerwmmanaaaaammahmumrmaaaqn
raIan'esaIf=I=I'l trraamnata-1u=nzwrra11a1i|11'au'aarr.

I-f~:I=t-n=I1PI -tI1E-n1=rm- -3r1tf111==I-'i.'!lEl -I-,.|48-I49


41

I1'II'rHI11I1'|"INl'6IfT?l'd1TTq{1|=[=I u31aTuai,e'rlE=Iznf
a1'lta=raaz't= ianamsrrrmwaammutma
lvinzramrmnmaril Wszmrtnrfauaquaana
wgraunumaaamaiamaaaiwtwmriu a=Irru1q'nIa
n1=I1%nsaaaenve!a:ernann<&qa-ttIIdtmTa1i|11*t-:a1*emTrtI3' at
mawrmiuiaauwmmnwnam :m=a1an.Uad'ttrm-I
wIm8#rm,:m3ura'1ma aa't=1-a=1=ifuz=rIe*trI??11ztuIWztI
1=l9?u'=l3aIa;iT|'aTtUHH1?III=Tl11],3?ItI1'?R|w1'H9WT
mwaagmmmmmwmmmam
va=ru_s mtwfaatmaaaau n1'aa1ishfuz=.'mf at aa
aIIaTa1srtaaart3rrta1a1'&o'~11a=i8a=aT am"? mart
artqirmtt ETHHTI "'

1111"IaTTItat=IIt$GITtvailnaIati1t
lTT1'1l'rEl'&T'F1==l3a'lf=ElE'ElirI'$'fQTFlTl1I1kT3i an it

H-*i'3iTI35|1T3'=I3~3l1'FtI1T?FII1313i1Zl'lI as at
3I'I,J'!'ITI\'=!TlIF3iz1T11a'?6aT1l11kT3II'13? lI'I'|'FlvITH1|iF
??IT3IH'i'lTI'IFE1?fiT6T1*-FIl!{lT|'ll tn:-Ia-1w H13
1:: :ia1mII$TUH3arntn1E[n'a1maTq,'saVr=II
crargazmraammn tlmarrazmmarifanuuwae
aawmzwzmrmmmavmmrmaaaanmr
3.'!'I??IlI|7|Il'Tl'l'1"x-1l'I'Tl'Iff=-l'<T aarerrifarrnnatfrzrtr
1lI3TT3TF1?'Ef?I71T3vTl"|1P|ElTE3TIU'B)=fEE!-TT #

u-?m1a~':m=nm -uqfavdww - rIa=r~r-={- I3!


an-rrw-a1'm=naasn1am=:Ims wmunaw? tn
rea1.a1azauaa,~.;ta;rarm1a?rzm1=tra1aaasa:rravz1=1rz*H
21:1: alaa-11=TraITrmaa'-11%| at=Iz-h1a11=i'ri.=r1u'<1'ri,=I
z>1aTu1ati|aaa:tI=1Ta111R-I1t1TwratT141n-in Imaarrtnratar
if%IIzTdu't=II5tarraaPu1a'rTa'rfEu1aTI!kTa? Eran
arr?:[-'+1=Ia7E=I1t=r$1|=I11T11:1'm=r11 l?11TF1i-1T7ffHT In
mmnauzgtn a?r1m=T9taautarnaa?mF:raaman
Itmmmaamimazralanwaamditm
mahmmu n=rr1mazrc=rt aamtmmmnmw
aa1arcrra1a1r1%I#=:'raq':8ua'ta=I1#%da;rn*rtmu ?Tlfl|T
1Ia1zza'rta'1Ta!1=TriGI11tarrTca1rnI|wa=wat:uaITrr
m3l%aa7r1wauTaIraa1iatTa"rI=Tr3rm41GI11tm'I1%=3iI"

aazuvutriftraaan 11?:zma-Trait am
mmqurmimmanawmaazmmanmnmaama, am
umwvandtuazwautmaarrdrwgain Inrraurrar
=rrarr=1=T aa:=nat:rmfrnar1%1!.an=1I1%maarn-avaa1'=II
3Q'q1U3-FH_U=''!HEI?T,H1TH|RITf3I7:-lFl3
Iazariu---z1=I1.rtaau=Ir=#'ITi|1'?-IkI11mTa'111TI*2rar1
tnwrtdwumtnaz zrrarlztrzgzwtf im,mv
=rrc'm-Tra'um=IufEI12:rur<TI'a:1w(t'a5tl%'dFu11?M1)aam1 zntrta
ami:atz=:maa1=7wr Immiumlqewyfdnamr
43

zrrawmitmwrr zuaw-=nir=1Ta1f:vmit zraa


a=-fail uwzatarwwmmaatwaanaamzramcrrdaw
FI1uewaaaaIa'taerTi1=Ia1a?q==Iar1'-T
Zl'l"6l|?l'-ITlTi5I3I tmtrzxf-aaI1?=ItraI1r!f-iTa1a=:t.1?rIi-'t
an! aqmazamalifanw uafeferur. aua
aa1ai|"'
=nawrr,11?m1uarrtamIrnm-:11? ml
aawmvmemmu wdtm hwama
I1ari.2raf=rIzar.rr1=I'Et:r{:ua1m-3u1wm=Ia'raris11%111aarr
idfaaz aiaamvqzaawmrcvarrauraafra
mvdmuatmwtlarainaiummnwzwrrmmt
a1a1m'a=tmarIw3m=m aTcmaIaa1a a'c=IIza-arrrzrrerrt
ma? ahau 2nIaI=r arran =nzmrrm1a-Itamwa
a3'raa-ifaaimurn war'&.f1fe1u-euarrzuaahaantlra
Fl3rFItITlE?16lT titan;-avzxw wsaaafswmarfu
FII'fIlil-'f6IfI1F!T!'<H?FIT'3I

Iimaanahwmmrrmurdmrm tram
u==1anz-auawawuamuaarrgsummai arwwn an
Iazmwwuartinmwmawamtanmwnm
FrnIPrtrraII vaw'$a1I1'rtrTu11Tm!Iz=rIa1T ?FlW{Ii'cfl"l
I;rtaaarmt%IsrFaa11=ImT astauawvdwnwrwraanutntnaw

I-W734"-*="F3-1%" -arrq-72
(1'l=1'r3\51a111IIs=I1zd~l 1n5maa- cg-4|)
44

2nwu<I8sITa$ra1m%|a1-mcriwuawrm i
-'t1%I'e1*err~srInn=1aa2:'1 aa1t1aa=Im-clri. rratau-an
asaamaaamwqamgarwhueawrmmwuqemw a
aqmvaumiraawmmimraamqnawtu
a=ra11a=a'raI%utacrarrr!f%ra1sI%a=IaIr:f1=zs8*sI11=Iar mt
amass:-ama t1r=r!1Tt4'I=I.afa'tw.1iI!lwrvadtt?sI=I as
ii=I91?PJ1aTvsIaat~ua=Ia'1u3ri|"'

timtuwamn
mm-cfmni-amtfzrntaaatwmamaamnam
1'!1i1aa?Tq=nu1aaar331%wzuw&tI155arsa5Tas1EtaI?I
3| f=ra3u1HHtnAIta3IT=a:?rt[5a1a'ar5's#1%Iz=a=I1a&t1ta#
mini, m3=rrH13=I'a13'1Taf' imamuiam
=am1ut:}aIuuu1a61a=a1u=;aa=rw%. eraa-cr famlcrra at
qa1ar&'-Trarfwi. m =rzrrwtI1Prmum31ta122f=Ii1ar% ar
=n':=v3a=iqaiaT 'aautata1mar%n2

M:f.nUQ_ 1_,:3|n,o-.t can it


t~**-" asaslmzzrrrztt uir=zTr<1r In arr
- Q Q C - - a Q - Q Q C C Q Q D O C Q Q D 0 Q Q - C G Q O C Q 0 O 0 Q oxccca

I-a11*lE5HTfi?~'rafTana1a1T-7PFI1aa=:!FI-ua=t1$t|}u93

2-1"a124:-II-.220-23-x3=mta?IaI';1aT
(flqauzar -tT1l'la|3~11'-t[-20. Iawacratrat)
45

rmi|v'
I ihs loo lnoyolopaodin Iritaaioa o 3'am53
aver-T I1rmaIatrTii:1'eIrr=a1?I2n'3n "

I- It soons to no noro than ovor tho duty of tho trus historian


to find out tho roal proportion of things to arrangs his notor
ials according to tho striotist rnlos of artistic porspootivo
and to too) oonplotoly out of sight all that any ho rightly
ignorod by as in our paasago ooross tho historical stags of
Iorld. It in this favour of disoovoing that is roally inp
ortant that distingnishos tho trno historian tron tho noro
ohroniclon. in Ihoso oyo ovorything is inportant particularly
if ho disaovorod it hinaol!' - India ihat can it Ioaoh Us?
lax lnllor. pp.14-15.
2. i.historian has to snhjoot his sonroos to a sholo sorios of
prolininary invostigntions. lirnt oonoo ortsrnal oritioisn
ainod at dotornining Ihothor tho souroo aro appropriato and
odoquato for tho particular task in hand.
ones a haitorian has dooidod through tho application of
oztornal oritioisn on tho ooureos that aro rolovant to his
purpooo. ho not nort by 'intsrna1 critiaisI' nako suro that
ho fully undorstands Ihat ho has solootod' - tho loo Encyclo
paodia Britanieo. Vol. 8. 15th odn. p.958;
Hwanavatahiavwfawat.
alriaquaiaabairdrwaawamamaiuawamw 1!
wamranawnwaaanmanmtaanaanwrtwarn
t1cmraa?rra?Ta1za2$1Tz7aTai1<rm21IvatT-34&a&m1.'z1?a
Rra. mtqhf. uwarfruf. qrrcm, ma, =:1a1&aaITI?H1%r!Ta
awrauwnawv <arnaTqa-mar-Earxatrama. 12:3
rdqamarawm araqiqarmfaunm
itatin irtzmrrzrqqaiwaaltw fai1wa1Ir!'r2n'a=nza3qn
!'TnT WrarrrHvT:IaaTi?aI#faiertHrltaI$r11Ifa1a in
a_ra1iI"'
1fa11w:rrma=naiu1=r=rr aaaa man
mmgwiu avuztwdr fiifmdwumammmw
attumagrqumwvaauaammmuuammiu W111?
t=:1a1atr11%mraarritftcIa1?uiaa1a=m:a-*d~1T9wraa:t
ufzanwmtwrmsrnwnauttrauamtiu

amawmammumwamvumv
usTruatan=IT1=sI3aqi=rz'-Ila atFe=I1fs'n'U=Iufta7#r
=n!1 arraaan wuaarnvammfdrdrariiauiarnat
=r4T maamarananminamqaafraunumwma
in =nza'rttIa=1I1eI,t=fa1T111ql%r.r[r1as11=ra?rI1%1utr1=n1
tm1atntiIa111t8'auta1T?:quzttt1t=trn1aT%I=PraTaaaIi.P'a

u-wwaammama: anmuwakn cg
47

mmmrreauwzrammnnaa ataramana-annwawasa
nvf=I'II11?rmarra1Wz=IIaT a-11aa1wtamaaan=nn$a1i|
n=a=rIza~z=wam~qa'2swra3?%ti1?:Ht::%n1t:ni#1=It?Iaufan=Ir
IsTa1m?uaq2mznc[faTua-31%|

=ruzmrrt-wan? a?rvIz=naff a?rm=n4'tcru1


aardvaaarcwfwatinmtltmarravmmrafer
iunmmmmmumaugrwimmgnumazm
amwmmiu I17-Itmatrnnitavnaamavtatmtwtll
twimmwmrcrrwnmnwraammma w
aiuarrwzzatauitmin 1amaaa1q1%tm=Iarma21r3m
aiim m'=rratatrt1I=IItl1a1Ta-'1=TrIItnt1%1rraa1T rm
mrmmammaqimqaw znataI'1T=Izrreu1=ImaI?rF
mcrqamaammwrruagric 'l-l'E1'|a|'T$f?5llT ah
IGi?lTi!-l~3Ir?t?I\31v1'!Tf%I9=lPi'| TGf%a!=lEIT1?Iq3?|TiI'
aatmwmqaaauwramaaiuanawarqwdfaaaraanniaa
tmaartmmmmamwaaummwahrarnm airman?
q,=mnaa=m mmmdwmmmamaqamaiumwn
uwamamrmaimmwavmr trraatm amen:
UI$r9'!JTI=IG'T?UaiH1Zi5Fl'JPTIT"t.m11?E=n!fI"2

I-a112'aa=1a5IiI?I1aTI=11=-aF?u1a1an11=IareI1aI3a-q;265
2-arlis-f=t:Frrn1q-itaI=natf1Tn=IE?ar:zsarcI1=c[-9o
(9\1I:'3?fa'<rR1z==I1a'm-ammra=zaTaft- 11- )
t1%m1aarrrn1?afTV1!PT"T"
-.;_-as! a?a%rHaa'a1a?THtawI=trars<sTvai@aIarqTrT1???3
mmtwwmaanaaaaai a mam:-a.m vrarrsr
arrza-I-11i| u'f*3=IT"Tf3IWt67 aqqma am"
l1-15'-'iIE?:'~6'Tl'l"43F|"3$ ammrmmww '1
min a1*I1F<.6%FH~T3'"3'*'*''''?''' %
mEIFG'!f11%IwHW-m=7tI1aflhFUi1Tfr9'7fl1Tli.(:37|T5'
mTaq=1TFGaEI3?lIl3'fEIlE=llWT1'?IFrH3ifA%\I"W
g;q1fqaf5aq=udT'{?;|F=|?1T6Il%'T1?'I'I3T?I1?W39a7aT
in inwaifatrazni. tawa a-'ttrIlEI=it<.*=I-iIiIl'* 5iT|
-3'; {&Tt=Ila-rrE$Ti1T31?l'1lT-I'rHP'i6lT1TT|'i'TEW?U
-Q 00'

n1=Iaa1tiI3qInaua=Ic{.'3L|'|?'5'
[Ta;[11jENi6f?l?'I'd?1T'=ITHIT:IFFd'3|E'11!RT
fumggaaaammtrwmmmnam
awewmtmaqaanor-:1'i'lt 9a1!1e:raa1iu"2

..gg;aaara-man-=rra-ax -antulvrawr =[
2!o1stoy is his eppendix to Her end Peace vrites:- in
histories end es srtist describing e historio epoch hes two
quits differnt tests before then. is an historic would be
wrong it he tried to presest en historical person in his
entirety. in :11 the oosplerity of his relation with on
sides of life. so the artist would toil to perfors his task
eere to he represent the person sings in his historic
signitiosnoo. . . . e histories hes to desl sith the rosults
49

?i%rt42I=rraa'cr'-Ir=I1:

vatmamaaatawww Hr-hm
far1%nta11==rI*e1=Ierra'raa1 ad? 1! :
aaaam --"231=euz11%rzs=rta7:-ttm11waa1:a1==ra1sIIIIIasrr
in atarnad-'t:[1=1'1 dutaf=rI=Ir1%1=rIiI"'

mzmummamaarwfnna an
maadwmfaiwnmwaatnwanmardaa a-Ta
-.1va11=Iz1aTwi:-nmamrm-iv1'mana1UH'1
#T!=Irata%1%aaa1'3taI6I1=IIaarI'PIztrd'I1EI1T 3$T%mftIa=rIaai
a=rc11i, nmammmummawqmmmwmiu

of an event. ths artist with the {set of the event. . . .


Iithsr {ran his on sxpsrissos or from his lsttsrs. Issoirs
sad accents, tho artist rssiisss s es:-tsis wont to himself.
and vsry ottsn ( to tsks tho sxsnpls of battle) the deduction
the historian psi-nits hinsoif to asks us to tho sotivity or
such and such srliss prsvs to is ths vary opposits of artist's
dsductions.

|- im1a1zn1=ulaadTaT:a115v-arruz-3':f n
(1t=z'rnTIar3?1I11ma1zav-aa=rI'aaa anzm=I- cg-Tr-3:2-ernq;-4e
WW)
Ii$IqHT=1nriTt4Ii,=TIrom1TUta61ar'3I qtuzrnatsva t?
awmmmiuavaaaaammiarazqtaawrmm
iaehmaamenwutavu $Ian1"aa=IIza 3
qamwqadmmmtmatammwm ammr
:rau1T3a1a1ia1'I=t#amUH(ai1I?1)tEIzad-rift!
qu=*,aawa1,1a1inan1aTraatnvrau=1qarufr1%1aq-arriwn
arr9'|"'
vavatamm-imna
amrmatmmiu ataafkwrrniaawc
at-cI1%_axzfH2u&e:sne;rera1ia?Taaf=Iram~Tr=3~1%tn2I$
iaz$tvamar1%I1a1a=r$ama:fauaIvra*ruaaiu'2

n Hotiosary of Literary ferns so


c.-Irrrntm
ufrmt3Faz1ItIa.wu1n1at-3|"arIa121'Tma=:uaerm@1%I
numazmmmmqiaimmwrmqamu

|.n-nauanuo -GIT!-lE'lT~IT:t[-52
2, nskeepeare - His life. Art and character - The Rev. 11.].
Hudson. Part II.
3. A trans dealing Iitl events from history. especially critical
and ersoiei episodes in the esreer er a ruler or outstanding
ailitary personage. A Historical play is synonysous with
ohmlniile play. although the latter 1. sore likely to deal with
incidents involving only one neaor character and to lake 31-ester
use of psgoantry (coresatiens, settle scenes. state funerals)
than the forser. - Dictionary of Lite:-an terse lsrr: es.
p. 184.

4-EFHFIFI-*1'|"TI-EL-25
5|Fi'l1fl3I'~'=ITCT1if5l3?3fa'!I'|P"i!T EH3

amalw1'crzr1'ar%|= 1?! mrrwmanmi it


hmmummiwdwamunamrqrrmn

I%t'gsrqrI3;rIaa1sam1:i7=gaa1 sm
l112Iar=I1a"a~a-1T311cr1"I1=Hazru1zTtt11'3n ma EM! 3
nra1a,aHrFa-1atrt;m=n1c1ts-mtrraasuauvsfmdtnaln
Wacaqaarumi. 1fa11unraaarm1%m1marurr4a1ar% n
wmwtmmmm u3t1urr&atl1a'a1 amaammnr
m.akqI=aavam=tu1aanfeu1a11ufamaaia?rqaa1a+aaaum
uaiqamaimnz aivrqaavamaw it
add! mum-1 acmaumaa-t-a%|a1am'rrna=zum
mama--~-mamqm nasaai-2-nvawrraaans
If=tuenfcI'n2rIta1wa-Era-t rr%=3i'amaP:a2:1m=az1.trT
{watt ur=IaI.a1Tan'amrtatra1zIraTa1i,au=Trz1t
'nam:t-I=I'f an mi! qiuwaauaiu {213 n?
amamvaataaiaazaawrravu qatnat
iahaquqqw i1c'3Id?f=Il=li'6Fll=lTITTI
i, ammm utrrnarrasaarmria B a: main
imaaaraxawuamrunawaminari;
amvmaraaarwtgfqunnuminmarnmai
arra'rw'1*amre1aI1iszrrz.uw1na!rmi-a1%rftn=r

..a=amn-m}m%'.m: " Tmaz " ";.;I """"""" "


(n -mmmimw-Q 209)
Wwwtmmnazawm 1! it
zmaiamrtmuawvmmm
a.1trrau;=r"miu mrarrwnmamamwtaatrmmqa
mtizwnvanu T1=:re:<nfata=fI aiamamqusqm
6lF7l5J\"fi1=l1=|Tv3l'J'=lI?=T1'ir<i1I$lHI3I TlI(3<!'<;II1T3fIF
UT|=l%Tl?.'!if aitsrtaaaiei mwvdtraaanamvf at
mm aqrwmnmmwhzwamiutmamar
a11IzfI a-tm1=rva=p'a1at,aaa1%a=i armuaaeaurz
Tnaummwnmatamavmaraqfaaara it
a1Tar:ca'a'rrarr='11=Ia1=I1a11amaiu =|T':E=.<T?1?I'arH.31l'5T
mmdmwmmrmawmwmmamv mu
srarH1Es2Iraua=Ia13s;cuita1arI=Ia1eTurm'aiwraa1
=z1aTwTIIa;d-'ruTaFrrtrimR':nm,w11iHa1a1a1n1vIai%r
wmwwgaummduwaazammmmiua
1sa%aatrT5rP aarrgr-xatrtrzitl i?R1'afI=I1ze &:n{I?m3
dw amamawnuatgfiu amt---mm:
Hzammatzumutrnaqnft a=ca1a1tr1r
aaarmitmiu maatqaiitatwtuaig
1=aamaT3.%tara$traufanmaa1=1aa-m1im1m1Tn=,Isu1
mwwwammmammmmwwrmni am
!Ima1a111aa'm1i|'iq3=Ia 1=I=rrza?l arzrtmftat
iuTa1mU91%IarIaw11n1.wnarP3aI1TaP
m#a1,naFawt1E1=Tr=}.anraazsT,13t'aszmut arr:-11a=Im':
aFa:u1=ntfr1=t=rIr1a-1raara1is aiamma-cat
g . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . - .
|. Lootnrqfn and notoo on ahnlnaponro and other nrunatiutn
s;!. coloridgo. p.81
(J7. Cs.)

ma=H$Taqf{warI;r=!11=rIza1 min !I'HT31'-I|3'l|1ll'-I


mwnwmaawmaminmwarmmaamattluva
maa? tcI1a'wI=Ia1=rr=I1a*cvarr$ra1'a1=aIa?m*iu"'

Imama I-'lT'F|3lI'3 at
vaatituuttummiamadtanmanv am a
a'<a1u=Hrmarr=I1n mmwcsammwmwawusn
ts ma aafnnaqmwml aH?aa:T=I1za-arra'=nraTr
n1qIzI't3iah'a=HIz=m aawrarmraflwaltinaaa
=n'ca:a-arrama maaaaamiaqmmamam main
ianmaamaw aI'3a1\rmasrm=am-aim aw
u?lk3a=3HIT?-IlGiF=lR3lTTEEI1'[IHElH1'T
taranaaa avfnna111a=4z.+1aarar?+.a:ua1z;n-awn: qa
'ln1%nrrI'\=1=s3t|"2 aufm arm-1a1?IeI11rt1zs=I1z'mrra1r
Smtmannmmsammavmzmaaz mam
wqriin 3 aqqmanmw aaamidzl
u-Ie=a'ta1Tn'rma13'I%:tIfaa=rra"a:sr-waqzm-.:;-1o.:r7:a' H
2-'iII1!:'3\3fI'!TlEE=llE-':'s'-TI1?.'1!'fvMf-|=[
3. It 1e however to be noted that vhereu in gnernl thelincleih
Iritere tended to avoid using material from the put ee
cenentery on present. American euthere have tnded to pursue
e path dianetrioelly opposed to thin and to seek for thenee
which night e:I.d then in expreuing social Judgenente on the
twentieth century - World Dunn. A. lieoll. 9.854.
54

anunhriamazvfwtaaamtaawumml
wcaaaamiu qnmwqamevwzmsr #5111
ammmammmwaamnmmwmam
mintrmaavrnlmia mam-1r mm
. 11$TrR-Iii. 2EI1a=wa1TI'aal6IcrIf&acI1'ai|"'

mzamtmmmmwmkr st
mqmsmanaazrmvamugawmmaamaacraimwa
ammnmvatmaimmunwawn aaqatmw
numaitaqmamwwamamaqqwamaarn
mntmwtain

aammmiravuaarfautn
wwaanmmamqaaz awtrdnawtaaariv t?
'e11ai=I1z*atTa=n qqainmm azrautrttw
an-gaascxqm-arnnari+. mmamnmamm it
!'fari,.- "srravmavaarrimrimamaltw
qwarn=lta=d'twa11a amfttmtmqaaum
namtamumamitvmamaiauarnmwa r
n1?aII1'q'a13Iaz%Tw=rIE'I-=3 III-1:RtrII?a1, Wars 13
waavranwa-3 ?m%TI=Iwa=rIe*13-acrtTwLxTrm'artTmu'2
amuammmammmamamw mt. aa:1=1

no zarrr-%aaT-q-1
(wrammmmmm-awm-qnoow)
2- Iwtimmawl itm-EFHGH-T 39113113)
tnrmwmrmwzmzsav tu1u=na 131?
aa:1a=Ia1aanf,t'm&ma1ft=nawr =?92r=H%werriu'1aI1wa
amsu Ifit=ra:Iax-113211?-':.31cI'a1Ti=Ia=I12d-I it-rei11'#t't
fh'l'iI'T?!TB?H1EEf11?Ii1'HTIE-la'3UtI1tlaTiI
i UT=Tl1I9'GlTE|=|T3TT1gI1%JE'm'$13=IEI1EIaT4f|i'3i-
--amqtmaagmauavaqnauanwaaamswamw
i tmanmaw a*r=:n*anrai,1=:rcm1%umr
6'tadT3t11zIn1-rt. 1=I'GI|'i1'.IE|'GT"l'T,'|TQ'L'~Tl'RJ1|?Tv|'? in?

II=I18Iel'il=i'r'oiu-I qaxfgtlinawmutmuzmamqa
8au=IdTa111EInaIana;3,aa1f5IrmarrIfa'mfm#a1a=l25
dWr<%a1s1=1!t:&uvmaatT13natr'11-:rrauna1=uru=Nf12'u1u"2

Itmqamartmamacpfaa tn
uumr.=H1.@I%m11%:rs=rtaa1 arrivaaaxatemuaatinurwr
35ElG|1'$T1'l'l'H'c' mwqaatfaamwaqwurm
-3: wrvzzttra-1'2t1tn1'=rIza':rI!ntaz1%=su1r1%maT?:f#drtF
RIq1r1flaiu'9I<!II' ufrqvliitau-e.'3w4IIaia?r
qatmauam amwamrisaammmu
'1t=1'aTr'1?1w=rI=1aauI=I2w1rx?a%1?Hd-r6Tt-Ia1tIa=r an
t1T=Ia1aan'rTI211'3u

mzmmmwmimahmwua
Mari, 2n%uamw=:'rn=I'1qaaru mamamaaai mrr

I-|11=l-'!T\Tg|'T33f-Il't'-if :4-dauxi I958


2-?l?I'iTR1EUF?J1H:q'q1eI?3EriT:I1-113=?IrC[- crqqa
EF|TT=lI(?IT=|T6'F3'i3IaF-FiBEl3q'ITU=l31E('}H?TE{T5?l ta
'3Wn3rnr#r3nsr%a5T<7=11?a?:at3a'a'm'aTHIa3nIF
t1?ru1Ha1<aI=>ra1r=11ia"'

aaL3fat1I=r=rraa-1 =riTa=naI:m?m
3EliIH=1TfGl=lU1If?-l!1H?!=rlE!?I'EI'Ufil1=|TII1i'a'!TI ems
I11=nz1s3m8=rr<mTmMHT vdaqiam 5! am:
i- (I)m'3uI?u$a'aIaira?fn1=I3IPII1H911&1=I1alT
(2)n=3Ian1trra5=niaiH-taarlau l3Rl'!TfH=|1E3i~l?J'lH
=ma=[=fa'<=?!Iu??tFIBTa1iIniIaIa1TaTt91%ra1IaF=rIE-1 3
wtmaa-'raTa111ruaTrtIi:I i!:ruf~h1Em%:- Eta-1~*Ia=Ia
aamrunyuawaanmatumauamaaerwaaarma
$3-1Tl"It-I133 P'd!1'11'RlR1T nvmam
in iwafmwndwwiamarmiw
l"l"-'|'1T9'51T'3l$FI3l"2

I0 World klln. 1. Iiotllg ).B5I.

2-IHr$'$1?I'l1I?6Tti1'q1?-EI?=tr?I1iI6I3!11EI'=I

(mmamm - uunaw Isssq;-I71)


57

tmsazaamu
IEBBSSSSSSSSSBSBBBBBS

WFW

9|'!1W=IEd7 mawtm IF!


armsrwtatamrin ataw V1T?[trI3UTFl:"6lFJ qr
Irra=1r=rmturs1a1init:
mwam mWm
JI W
ma uhmwmm
=l'!T-'-l9'GF.': "'

wmalawaiawrrummaamauna
turf! auwamtairtwmuquaxeraawammaaaaa
=sI2tzsraFIa1=f6?fa:rnI=I1iu1tIanarwtt1at%1is;rIt:qwuu1=uaa
ma! aanamrmrznaznqrmazaamn-nn%raHnau-at
in era: mmmrmt =r u3aIarrtrI5a1dT
acrra-1au1a1 amus-zsma=na=trnmi. am: m6a=Ir-Ta=I=!r
mnn d?aa-rai-a?r=ra=ma1a1=atTsr=matfari| area
wmwammawmmaaimwmaafram aar-11
dadmmqamiurwmmaaamafwmwmi an
aaataaaumiaasdriltwraanuanmwmafl
taazraamatiu

u- a=znars - mE cg-1a:-132
(Ramwe: anmiast Tr=IHrnT1a=I1aT-uu=H$ 1953)
58

tmrmmammlwvtqa
3mrtvt.<31cm11t1=Itz2.=a"rraTau131avau=tt1'mra1?zuqT
I'nUT%'ElT1IEl'=l1131l?Ia?I:F-6'7-mB'3bT6't1?ri1
i--'---31':-'r6r.tTua'=Ir.tTIira'a, rrtn
tmrairuqqasmmmuwzamaaam
qannnaiu sarfatiaaaarumanmvavma
waI?R!IwIRIr?n'I:ra=1ttttrmt$ataHa11THt 3
It1?sR:l1?a1i'aIa12n' '

3I'?rI1mH1a"a1 aazma mm at
Ri,(f$'a1;f$f311TH1={ilT1?'1!1'H~fTH3ali13'3ilT
iwmmmnmmminwmmnqwmn
f'tcI=rIz'di TEllRllii8IPtIalI'l=|'?lHiaIl?!lt'('d'Ff=l
nT='1ral'rq-I'r1TIiI

aawau11=r>dqi=a=Ianarrtuq
uamaaamamuwm
nqtaacrframcr=Fua1aIu'aaI=3au" 2

mnwmwammwimwmn
immmwtammmmwwm ah%I1a=rIauT?e1
3-an ma Tamrar amtelz auwfarsrat a
m':ri'tn"- a=:tescrTamzatf=Id-'r3, ucrragan

I-fh=dTa@1%ra1a=s=rrza? 11%mmaa:e1-a=1a21.q-as-esitagqa
2-:mui:lI=1au -qlwwam q-24-25
13|'!1TH5'-112753 mmiuitfri irihl
aiTt=;a1fa%rrra1=1=:an=I1a1IfIua1iraa11T-IrIaTa13=rz1s
mrauzavvamaarduaammam =1'r=:rq1ra?f=m
uaawmmiuamammmnvmmwmammarm
mmuaqvraaawwu tuwzaimwamamam
aIIum=1=1a6Ir[amIIz=irIraiI1inuI{era'rais"'aa:
wzaarwawmaailttltmmrmraanuat
niftlmzl aaxramvu mmnmmiwma
a'u?a1Il=I1aI1=aYaiaiar=sitar1iH=1tau1I"2

a1'taIa-I:
6'55

ifl=IlZ?$2iI7{l1(TFI'!l'-lff,.1_'-aIa!l-'!<!'l$iI
zmmamatvwwiu mhanvadnfaa
acatt aatgaatmsaiu nwamuwtm
I=ItTaNn=m1a1 uatiuammmaaumnti.
zrmwrriunmr twain
u1?=rIzesrtau=1ai1 itrlmurafr
alaa Fitwmrietmamummmmiutms
=na'a-1 3q1N?az2:1au1a1Ttfa1=rT,IIItif&tI?:mral1=Ia=ttIrrar
a=nF-mrhmmsafmaanmwams Imm ammu
!fli1T'i's|qT.TUaTGfEl1?1IiIUl1@1=laBjf&l1'T it
1. utoru-y smug. - U. 1-; Int. Pu:t-I;I-. L183: . . - . - . . . -
2. no events . . . . should in nude to have nah sequence:
and u-ranunont u to approach :30 near :30 pouiblo to truth.
:.c. akangor-poouch European noon of Dunn. p.62
60

agawamatmmin amwrrvaaaannwaaamrar
'31 afraf-mr 1E.'7=F<"hTT9T"|l'|lTl'5-F313 drmmaanwwm
tmmmmmqkmmmimrmamma
Uatianauqiaamzimin afhmmuwnwcawrr
an1iI=7f!=s=mHtI1a1 a~f?=i1a1fIv.watd3fe1a i
au am: new era? 3to=nsn=Iat=1I2'nt=1%=:rtaT I
'|'EPI{l3513HGl5=1T5I1=l'Q|l3*F%ff1?i1=lT
'm?1'$3l6F!JIHTU|W'3i3R1Fl|tl'ETTHT9T'1N'
dwtawad-Tfu1'marrI2'=I1 aamaaaxtamtunnva
3R-mfiaazzriu =i1z-ds EI1?l?1'-'*lI'T1?'|?1TG|'lIIT-B1Ti=IG<=lT

an as-n wmr mmtataar aartaaw


tqnarnulmtwlama area-an tmmauqaa
a11aatrr%Ianuaz ii-l=l3l<7E'l'a"ff-=HT13iI'-'IEo'fTHT1i't=fr
I'l<1t%uairlI=I=i't-3trIzt1tIa'rcz:1$u=IrrI:Wf TEN I
uaamammqawwnairfwmw
TlII1'G'F1q'd?fIT?3Q'T11f=IlE?$flB311Efa1t=rfT
ran

wcmI$rz1%1a! ait &fraIi=ITRa=I


cra'srm1v1r=n=:ar auu? 31-n mi:-wm 9'6
arraaaa airararrzarnaaa eravia Wit
waef-'IenmItaTta=I1ttIz=;n uatafanramma
mrnmauammnaa aiwaavamwm
mazrrin mmwaamammmmmm,
u.fr<*.'t&I%11rra=rIaa?I 9! 1feru1=.raa-1-I=hr:rI:[- eeaaqa
61

araaaTaiTI'BaI'zn<a1E11t.2?tr=IIa=rE='1{ca1s1u;arI#Ina'Tr
Fat r ETIFIFIITIF-I irnn 3:121 a-twana-'Iu'm1%r
EHTI2-=I1sa'aI 11en3=n'-=n'a1 ararsmaaxaitrmma
gr -3 on

TNT?

?f''ElR=lR'T r!-ila-cTIaqI1%m2zi|
aaaqnaahngnaraaknin mwaqninv
ummquh ab=m1nFnaraara1%n iI5ardIaqrrv1'rI=nz;ntIa1
i,qr1=Tttrimefta'iTraa1wa'Tr Tl'l'T'I1il.'f'fT
a??ri|FIaz?I=Ia'c!taiqnzfrm1a'cfnI=1aK1Hu1n1a-1;ru?'1
Wzmmwatwummtmt a-a=1m1e1'rr-m-1:
in ?I'i1lEI'='1'I uwmmaawazmawmnuwaw
-3...
1?-mTa=I1a=ran=iHa=InratTa1i a-ad-T
ammermaiunnzmravvn maaqum
&'mI3FR:ri#HrunwcrI6tsd-Tu1ira=ruaa1av%arrT!=I1a11'w
Haj H=nIaH!'t.=rI!1.ai111acrrtrarv2 "mwmmm
1w|13a=,;atv1,tnat-I1u1'cIIia"Zt:radTa1taT1BIzs;:2ia, alsnat
?."6IfTT=lTi9W1E?fdNq?!-ITElI=1?=1Til1Wl art! a
B'a'II.faEII=ItIIza a3iaarsrae=I={=s1=I1=an<v.ai:1fl rm?
ea? qamwgaaawmmww itcu qt w

I-=r!ta?rnTIarae"I%111I%urr=rIzts:aa=I1eqza1t1a=I-t3uzaT
cg. so-taqa
62

maavaaeraarmms amqm mauamattt


1: uoaam an arftaarramazmlai mas
n'tmfrTa'-w ftmr-mma~1sral'Ia1=ndIaIi nd-rmq=ra1m
1'|*i'f~?'3l'!'-=I1'-l'i5i'fa'lH|"I'!3TdT-hl=I taimqvfiam mitt
\13\l1E-'nT3FIUl'I'fl3"'I'

aammmvaatm.
an-a-11a ararufaaitu. auvsr-1au1a'-1a-M
an-rramn uwwawruartmqnaqramaadatuiai
trammmmwmahrnqqwmmwm
a1fwI.qHafFa1a-1awrra~*HIa1m amarrmat-=rn
wgwwuatw muttlvnlvamuia

EI?It"l:
Q-gain
HIHIHTW ?1t1=:rcsarur'e!n%,:-1
1%-'t=1'r=rwa~T~=r.1=zI=rIm3srerr11 aanrrimtrmaazaa
q'uTwtiEa2sfraI%a'fTtn1nn1nn19t1=1emriua1aI=rtw
aTtrs1ua1it=rraa'rrmaa:ataefq1=taa1=rr1=I1m1tva<r?ie1-
uara criarcnt azfTUu"1crrrza-t, zmquttsreaaiavd
sreeraqaaadwqtaawniu EIHBYFTFWMEIETQTTEIT
mTuTd'a1s1'3!I?$HmIIu'tat1T!eEIat'TTnTH1#lT33i1u1 a
u1aTaTaa1=uzz1a'ranmr1irsrma1i.m1ru2r*rrx31a1rrtIzsa1ap
63

zrtwqamt'r1anaiI=H?tr-.s?rra:|a3=[a=r a1'arat=-I an
ar1m1iI'a1iIaa:s=?r?tv6Ia=trEa1a1aa?1IiI'

<91iI11%Itr=11zua-3arFaa1a1arr9?:1=Ia"t#
mania? asuimmaiwl TI3$iI=l3 aaawn=I-4'l1avscrfr
ait.arIart=1%1arr.a!1twLni%+a1a.ua-u1=I.ma1.dah=rrrn'=s
uz.a1ia1==m1=~urLmnrm.ua=n1e1aa.a11a'whm1=rra cm
Mzwmmgwaiu ft==;'t8&fa'e11i1ai=I1z3?I awmrturtr
qaivtmzairm-Erna. a-1tafezvn11ififi=5ILan1tutrr,
aanmavmmawdvtqrdqamanam
uariirerrh TIarra1'=Fa,ma,trnwa11tvrI1ftqrr 3
3I1z:|cs"e11eI3q=aa'i=iII:1zI:WtP1IrfI=smz<:~l sI=n1aIr in-r
=II?GG7qT31H=|13'3Ii17fH1T3'1WvT'H'i\?l
wtinmma a?=rI'craearrm%#1i-n1fHa=rIza3 aw qttft
nunnarlarriaawvaferrrazrlal mai'ta1#,aru
%I6arua1aI%a?tau=tzi1u1a=adt?a'1'e1=I1a fn'-iT=iI'YtiI'2
wmsnmwwmamammwwmmmrnwm
Il~:n%I

=naa mmmmmmmm
iwadtnuferaunawauauwmzmiu maradnn
mazs mmtwimmw mm w&
u-wimmmma-wwmwain up
2-f!=r=m'a1 aVtIa=rl%rtia=1I%I=t1r-31-!tI1'm=:I1?IU.wI=I19a=fs24
3-BHw$@fattm=rra1:s-aid! <[-34:R;I
64

ar1J2vzsIatnTzTd1z1amraIfaarI=I1t?1%t1faa=r1z'd1 rem
a-Twin aaama ggwavta-tanuaasvldwaaatam
wimaaammardumwmwamqamqqw
iramnavdummrirmn aitav rfaat mm
I11Trta5ia'rea-t1a11\1raa=Trtra11IIii1Iiart==1T|I=mT 3
t>fItrt21aa11?m:uT9me.1aIt=arna1=fnn==Fuqur1au1i
-~arearawaamuaa1rmawvn,uaa:ara=;enamtaramtn
#tm1%uf.fnu'ruauav:. il6l1|l=[H.EITG'~'n'I"f.1Nl$'liIi=
w3u1aT6uIaJ1=Ih3a1i3?ta}Ta=IqTar1'aaIIrI%II?=1r.a1?raIa
F1613. mamaatw. ma~i1=waruT wrrI@r=I1 tm
u'Irai!i'tearIui'nit1't1-a1@alT=1r:=?1tm"re.a1a v"
\*1c1tr4rs=I1z' mawmrnmruratwraaa wlrr
a1a1i- "@fa<afHa=I1aal zsrww:m8t3famftaaan.ura'srtw
u~twn.amwataa11u1aqaa3a1da@m1fmsararanqa=I
crraIt!IavInrts1?n%u{ra'c1ta3wII=I,II?IraI1 mm
awanatmiaamaaalaaivmvma, 3Il[1'-T6
EH11! aIan181it%vm&qarmuIa,:maavI na
'11fQ?3lP'G$11=|1q?fFl?1rT'TlIiT,TTJI1|'Il
trqlizai-3f?m11En=IIac11 mzrcssiaiu auzsawguaar,
rmmmamavrwttminvaaiafaagqrarmaa
uunuaaiuzmtamaiwai dfauat-rriat tm=n1't
aua@1%m1fta2r=rIa*a=wrTiI"2

I-167-?.'fF|TEIIT|?fH -ar|a1zf11=a=:uaa-q;-5:4
2-fu='raurana1=rrml arrasn1a=waru:a=r-at-r=rra=I=Ja1:
q;- 82-Wlti-I97!
1?1't-1trRw=I1a'ea:- Wm

FI|'-'lI'3:
I-mzar Ililnaiauwdiriitu
2-=nz*a mqzrzmmu
3-nuatamaudwu
4~:r:'3uII

vI1nHata1tI=rd-'t1EI1t:_
awammvamiumad steam
naaum miwannwlztmawnt a1=arrr%F"a
vmarrmin
-a-uq1n?1%I11I%=i1z*a:

Fi 'lfH'l'lI?5I-r6tW|'l'i."'E!1$fFl!tT-II
in aaq'=I1dar=;aarinu1=v:IIttsnI=Iu1a.uE=rIs>'.ara1art=rs?1%t
trliiaiin =rIz'cm1'n9icn:1faau1al aaaaittrafl G! In?
Etta-1Ta-'ti|a1a*<za-1Tm1rm1Taa:u1%Iau1a'1 that arra
3 a1w=:a-m1 aanmeaaravaardwmdnmawwn
trakzwitiu unmmumwmmwramu was
wrraitfitmtazwrrusatiu <a1'taT=rImure:td'r
a"rTmHmI=I11=nu3aIi| duaaraafcannda
GrMtTuqw@lcmm=rraaanuai1'3i|"'

u-fI='.r&13-rctRIzs=rIza1 ilrmraaaa:a1-1'-at:-I;-an
37:1: mnmammm av.-2n'taTnzta-1'afs=au,
aI:r=I1'rrurrrarat1m1a1ttaru'1I

H3I'!1fFRF=rIE?5:

t=I=rIza?l i1rIaIn1=I=r@faTIitI=:'-issaufa
Iuumrmmmmatinnafraammamrr trr
:'aiumtru=1rsrwI=I=rra1?I%a1fcrs1ta1iatra14wra;aa1
a=i a'raa1'a1a1a1I aawmammammiu :ru':avI==nu
srawmzar-'u'dwru1'u
-'EIFI?f?I'!11=I1EH}

Fi wammamnamumaiuw
mammaiwaavamwmmatmmnwa
mutmammazaarrazaa-ra-1waa1w9nam=Imm
%u11u1pIz1trzwr=t#Ir$zrat1r'zsIa:1=Iax?I?1a11*1a=I1z'ca*in '-Ira:
aamvfdwwn i:=tm3f'atIftIa=a1aIa1Ia'a1=Ia't#
3Iav:rtr=r1n'tz<?aT1t.211=1v:1i1s1rl'#u=1'41ar!?ett' mm
vrrmraruaarin
a1a&a1tnTcrT:

=nawrra-c'na$:mqrra3atr=rra1wa%
mwrwmwnamzmwazawanaia
n-91ifI=IarE11=I@femiitaa*=I1zau
-2-=rvJIs1e1't=I?I%I'aTItIts=rE6I

3-6lTFRF?l?lE?FI?|3TRF=lTE?F|
13lF1%:
ztn-srrara-nr::a=raza:1ma%:
I-we-11sn1=13m1ns=na1aI
2~afram=I>I%II11a=nzc$I

we-nmn=I=rIza1 E! !?."-=|'II-"il'l'lEl1''U|T
ua=ra1ati|t=Inz=nal aniauartasraaar-3|
Hawitai 191?-I'e1rzs=rIaE&%v
mmaainaqnmainmmwfautnaamuqyf Elf!
ma. murrtwarra 1raw#a1:3=r:a'aaarra1a:-:1:-c-raas-ct
ql m1a= Wlaaii aauammvai azmuaaasmrtrt
trait wanammaadrnaamuwranrwraamva
1131?:

afwnnmumaamawwwmaw
titamaiiattmawaritaie mmmi maazlm

"
wmmmgmur-im mmawmmnwmm
mawwwamnm 'I2I1ad-T{I'arIf'1''fIEHITt=m
t iwaantaqrfari, auarcnmm am i
awn warumaamnmu auunnauarqlrmt
tarfa mwwwqawamwmmma at"!
wa1iaTtT?5nawarmndaaaui!I<wI1#ta1vsa7
zmwimwnm 1=I?a1%|

awwwmin
68

I-3|?-\'!z11Izi't1I('I=1TfaiI

2-3l'-l'!TRr5GIIE[|a=I'IEH
3-tau-ftq'r4sHIE'5I

?i'l1lEI=ll<.:- mwnmiluwnummarwi
Tunis Fimvgimrruwauarsamia 1113 211131.12!!
I1avat11IaTaera11tdTr1Ia=In3rn11ariat31%m14IsnICru=IET
323213-q8!21uT9=n1a1a'?=Is'1-u1FantE1a*1ra1-1=t=I1aaT
maa:u'qmn1=Iaarz=Iamaaafr.navza1srIa1n1azm arr-r
arlaunzrrl-(Tm eru12:atv?3a1at-Ia! vt6l1=lT?I7lT'(1| 3
amzltrniaraautw tea=1=n=.1'&o"'
- W3 mmwmmmmm
qvariu 2t1d'rcmIa9aaIua1at1%1a'I5EIwt=rmt'rm
it t=I=I1a'a'1 1% mqmmammarwlauaamw Tuna
qanmmzwsmin
=hm a.-txaqy.-,mfg_q1-qqz
mmsrr. mam rruan-armanniaaawmmariueaam
avzsaacrarersrrzzz utrnatitanuaaaatarznuw
mrni-mwammwwauuwvamaqamwnaa
zmwraawdwuwmwonnaau
auamwwvdumaaamm acnaa1 ahrlcait
nan mammaauaaianuuhmaumvh. mmni an

I-fI==.'r=naa1 errIi:n13fta1Iza-m: 61-!l'|F\-l=IR-I'6t[- 26l


69

amimmnamimaazradvm mm-rrtreaauam
=Irc$rcruu1asrr3aa?rri!:=1rql1ata3s"'

Qttffktfkiiiiittiek 81'5"
Iiri'**"a.*:.*$':E**3r.k**sc'k

n-Ii=r=rsza-1d-Tlaxfrtizrrlitmr-5mFan1E=Izs-=[-305
70


3... 3 3 3.
71

': f~{?I?il'-1 GI?-11212::


tll-'5H%I=$H%=

mrammm :: ma ear mm
3833888?-=3==8=============:=============

fret @m1Ia=nz arraatzatma


u?rdr-*uI'nq1'it'_w1n:rsts|n2:2iTTIa='I1-1=:~'s*dHtrrII1s rm
Itltzdulfmawr qnawaraatavjerwruuuamqwtfn
ddrmawrtmtaai an:-:ermarra=tr1aqwa=r1zrr=1IrrI*f.
mqmmtaairmgmmawmwn immar
tdzil aaewaamwtauatnfmu A361 '3: aaar
mwraamimtmtxqimuammamqz
an |?El'81'fF{~5'l'EI'R"lTTH!1i'-I713! 11rma1I: niaat
easwaaammafgwmaranasanamam am-rurn
artu - t:aTnfHar3m3''tI1%I3crraIuTmaTfIal
a1'x?IEw:r1i11?Irnsrnie1ma=i!rnTtr?1,a'ta'a1?n1
am=ma=11itm-?ma-rr3%ueaa1mdI araaqtavaraarmr
=1ya51ma=1:irFaa1NIrF11dIrtImIFaII1Tl<TIuI1%ttm
mhnzaimeaawa mmmaanwmaangararawrmn
Inamaff 2sr;rIwa:a1n?':ra11azal%a'1??a1aFrnaaarIaa'uaT
aaanmqmmmmmaimmwammn an at
v:m1raa11tZ1=?:=:'1 amm nqzaaa aiuufdmniqatn
=mF1HI"-s aEI1TffEI1I=I?Tl&IF:!'4Ta?Fa1?~I?IiaI'riI1aza#3
wamnimaamamwmamalatuam Ema cra
T15F|1=l-T*1'Fi=ITiiT33I1T?-|31H'THE1'U!3HT!1'=l1 mm
aaavhmmum aratnmmwtaacrtataa-arm:
72

mrmmamwm crr stcr-T


arruazarrawsr-saurrrrcrai ---"us54&a1m1mma
3l=ll'a=I'-'l"llT faaixraumftaal---didt3au
mmmarmvawmtmaamrmmmmu tawqzrma
ll'1fRIE=I'T e11Ja1aIura=ma=z31%ra==rr<:u=1t=trcTa
ram !'=I=II?;a1? lI'Dif=flZ736IHI1a11Tl3!3|'I'3
ih\crterr3L?m1R=ITcaT rwmmmmmnwuquu
mmwwmmmtwaammv writwtmrt
BvTE'~"N5'fFI'14EF=|1E~*36|T6v111T2IfI---'FlWHN= tma
mqafamaamtaana awrazawihmarua
ammahwmms xmaramwmmmma an
nTc1rti1t:zmazar a~t=I1erWra'qII"'

mmama aumma \"=l


aarcrra mmaarcniu
Wraaam 1'-F4 :38: msazi
11aaawr Ha |9l6 531935 at:
qruardm - H=4'n9:7aI1a am
inE=nawat 'r7$=111=?lE-N3 amrrrrr
rIr=1mwxaf|' lnata vitamin m1#v.=rd1?.aa:"r2:,'
=l'E1I9'G1?5?I'1l=I=llE?FP?FHTT?FIT=I1E7i-'lTGTlGrd?lT'3l

W''l6iaE11::111T3=;P3EI3qfI:

rrmaawamammmmqwwwqmz
a=na:m; """ W ' ' .g..-;, - W ------ -
t[- 232, um 151- 11:13 2021
i: Ieeo Ta'=TIai'dT'#Ta19un?-1111m'=1Izi|111
mmhmwmmummmwmrmamm
1aa1i1?ia=na1sia-acmr9=16IItstIa'av5ru'qzI:rrtrn:r
1artaa;rH'H61T=Id'I=Ianwrt1a amaam ms
a=:1-:=ra1;r!Ha=rarcrv1|=rmr,=r:rtr3nTril:1i|a=u1?u=r
?=Id1=ItrIa1wI=;'rwttiw1Ia'r=I:raita!11?t-?I'4Tnu1=11 a1fl"v
5t1rt'c'I1u=rr<:atrIa%a=!=il asraaa am.-rarunnquam
rIa1aFl1iII=Ia*r%3=!1?:iri1=x?I1i'tl%IIi=II~Er11I1cR1T ah
=Iat1=Iuum1'=I=af-IfEsu1I;"

wmmih dram-|7Efau=:z?:t'-1=at
mmwrcwmwhnmaai ataagvmu E1
wmzwqanmzarmaratuaaau awsiavuqcaa
itriwruaqmajdraamataaraaaammqaa
urtvnahml ?tInzrrttIra=na:qatar Isa: i1
'=na?aIT'aru=I=1=If6mu

=TK1El'r:

daaxmganqmaq
ufndmwsawramamn airn"-{ail mum, Ff
qa?f=I$?:rs?&cIarr-aaIi?yaa=1= tr'cqa?ar*3eT=:-1
a-tar?-'aiuTqa?T?rTa=ftrTq'221itaa3gvatmt
nrawmarmauqaamuanmaemvsamnagamwam
I-f!z=<.'t=I12.'aarr-.am1zt=fa=I-c;-49 am nee:
2-=tn#z;a1a'errat~rr-uurrum-cg-442:s anaem
fzarurawaa 2oo4
74

mwnawuanhnam =w=rIta1'crtm.u1
nmamannmammimwmw
r'.'ataItr-'-ur?ua~rHuiI1 sr=mIe1aa1a aan at-'r=31ua1 P2!
v3=:1araratiIa'rr'a=I=I1w%rn:mmrtfran'I=I1%ra1fama:=r
mama? maarur ier? ramnanauium
ia!rarr|cIih3--ua1%I1=w=I?fd-r38t1 tli arrlrr
criariu znawu-531! arm -una-TaII:atrnu~a'18
mniaugztifamatnmuauamruiuawv ma
IarIuTtanaarara:11Taaa1=Iu1aazsaar1a1=tta?d1 3
f=IaEanari.aTat:raa'ri1aT wmmmnmmiu
mwamawnwaamtatwqawnarmarzt
fl
tIrI=Tr=rI=uaIa afawqwaaw amt:
$r'f6t1rt'am=rIf'raI a-taq'-IE-rz a1aa1atn2=I1 I'M.
aa1.*a=11a1'flra1 H-1z:n=H1'rm=rrn1,a=i zvamiarfrr.
aIa?q-wfratrtmftamat ammma amrmraxaa
?:1,H=I1a.trfa'rdqI%Ia'T?a1a1!Taz11.1%vr&Ivy =11?
a-raaatumIvarIatuaa1u$=1qTtI3tIa:u1aan1a1aarr tn
mtwat-zrtrwn?'rz;ur=ra=;na1%1zraa?wt1E!I%|'trn%=
=nat?dT3a1111t<=a?aratrra1aa:aarasI1aa1at*1vrren11
T'i|El"l$l~lll'9'l'c'IE|T'3I armrtfrftlznrari fdH111'
'c1IzI=111Tha=iIr::tr=rf.cra;aeI=a'Fa' vdarmzamat
dhwaamaarvdmmarmmmwialn it
wt-iriu maaaamvsmmammaamaa.
u-tln.*Ta1zaaafrau1I=ImuvIfhw-aa1=IIu1a7q-42-unnmsse
7.5

emu? zntr.=faam1, emmqqwam aamcrmnawaum,


Wradtuzvwmvmiaiaarmnwn it
mm

=m1'rPffr|=IIa's-tr:

nmwwmiaaaananrznrtf
zimamtammwmazwmwdtinaimwu
Twnuvrlaariaw-1na?:a'rav11a'ta&1n'<t1a aatn
arawturmiu 214113 atmiq'r11=n11w-fawn?! 113 a
mwain gmmqwmamrgsqarmca
amt Ratscrra1caw<v.'1=1rI;=I: a1arr1-rt?-:cr1'11aq,'e1I1'?a1c't
1'2 aIt'rrr:n1ai1tau=1aaraa-taa131i~wa=r:TI=iU;a1E=3trn
am mmril

=rl1'l'n1ntr: Tmp'I?.'rH (I897)

mtqntmamaazamam amnr
1TlTl'F|19'c'IlEf&l7T&Tl?!1Tl'GI'rJIT3l'ilE<9I|F|"3I mrrwwqarn
au1:=Ia'na1=rHm'caaaTa-1TPII%Ia'er;w:raI1aI%:aIa-aTa1
qtqamwnawmmwuawaummawamnwaan
atatr7ttrc=ira'rI1 3muarrIae1'rd-rcr31f'z 1-lara=1=aaIrqvr'
QCQ-Qcccac-cocononooocohccdvucooccn

I-at-=?3T=I1z:a\1a-s'rI?zarrH -emu aam


q;- :63. qam |96|
76

maamin au$a'1 atiaasuivarrmatuai


maamammaaa znmuzma-Tmuia-ataTm
a-1aaau1=I1m1z1t1arar*aua1a1s=I1n vaawrmumaw
mmiiaavraamwmvmtfdwa I1=I: n:
!1'1Bcf?l\Ta'E3'C'1|ITGT1Trl?|Ti?I

-In-?Fe;qnrframmm1la3ana11a"a
m=nzcni1 wlxmmmammadgmmwau
in 61-tT=FI1!z1Jar{Ii:a'cm=I1ma=I1z?n3faw z1f:
naawaaamamwumtwnaaneevmumia
atatrH=:%ITrac=rIa'u935$awEII11Ta1?|"'

a'Htrrnn=lT@Fau1Iam: mam war - I884


mmwm anwmmiomtr
1ntsifF?n2Frnan1uf1&IaeHauIa1a=17n2?t1&t9T!a
%nfeF%TIa1:rnaT=3zmz:ca'=raIm&azavqqw it
=1'n'1=n"tI1au mnmwaaafuiwimaminmm
qai1H'<a$rTm#rar1I?|I= TI?-In11l'tl amt
InaTta=ra11%fIarI%3u12r=II2av;wFas?a1aI'2n<t4'? '0'-I115
-vrrarrn-armararm1vaarm=nqaamara
anwmmmmafafiguanvnmmmwriw
iI1P!'Ei''TFllE5TTP1T6m7'|x1ZFI6F'1cTf3I3117.'
=mc1a'rum am191'I=1Ta1I=IaIa1%| #rrert1wa'aadt
3;-TE!-7-I'3f'E'|l3v"=|T awmaaatn

I-fFl.'T=|TE?=o' mfaa: H-TTfEIi'|'x'=l: e;1ssT=r-nu uca zq;-227


ilntrmvr. I958
TFlFEZ3d'T : 6fIa1=11I151a'mz1tI(|ae5)

mamamqzmmaimmrirwra
=mrd1uw1?a1iIm'ara1mfaaaBT =rn:an=nza:1'-+==Ita'r
min ='FT1TE"C[!H|IUT49lFIEW=l'l-'{1'|'W'd'?F=I3
=rrra' T-fr111"3I

ttrnm': w'.aIIawm'ar
wnmfamamwmmammzam
rugaumaavazwrwmmwmn t1ma1cr1=m
wntnaqmaaazmaqa 3a!i1'I{aIlaTm'tI&H'a1iu
tr1'11?tma1i.:rtnTa"Ia?a1i| 1Tra=i1IT1a1'r3
Imrana=r1iaTna=r ara2m={arrc1'r%u mmaaafm
aa1tq1amrrfa1atrarTTPnI1tTrau1~ercr'aa1%nqT1mI=
=11fa=a=paf 6l='f=liT?34'f21II1'6T-1'!1fFl1iF'dl'|?Fl?IE
$r1rrn1'r%|

EIti\=sTIa'1't : 111'awrTiaTT(Ie9o)

aaawmmadawwm
=rIaaua3Twn'rTm3t?-IvaIq=1raT1a?-*ua1Eft!aarIT=IT'n
mwriuvammmnmwaiamwtgri aia
nfqamaaamaigaaaamwmtawramnma
rrrratsrta1awa1iraiIatarcaiaI2m=Ia1Tur?arn
a=z1aa1ta1csa|a1%wt=a=v{I=+1a?rI3=1aiI=rrwn1trHv;<wnta1
in mwmrmarmraaammsmmvazaav
7=|'TFli?fd7~'|'5T arr-1arrnaTarR=n1ra:'taT'cfr3|

altrrttr : 1'lt=I'l=I*'a'IIt- I895

m1a'wITi'taT4'rw 't1TsIU;fd'I'lIP'&
wlmamqauitmin amtrzmi-=vd?rwn=nai:raaan=n
\hU'IElE'{?!TI3I

atIqra1=rarrmIaII=1arram=1 qa
amtniitraaaniain ar=rt1itnTta1an34u_
ma=rra1ftaa'r$, 5-B1 anaaw #131117 1!
5.s=r1'3as1TruT1t-saaIunw1urca'afsrn11'&tu'r =rr'a
Iarrmqrmwrrmiu aurnaatnmt-rrarr aar
aaufitqa;3traUarrz?a1'3uacam1I1w,T-rITeI=I1aa
1:ral111I1%IrIaa-twin Uaz$r11=frqa?d'rI1at=I1a~1cn1n=i1a'r&
uI$amaUI3a1ari.u1%1z$'r=1a1qTa;zaTm#ra=IaTatiI
amarlftmtumz ct-a11a=tma=u1tn'-I395
wvuitnmmaawatwan aufr
ammmammuhwwmmi. mmaama
uummwuamamtia :m5t11'tatt=mat ar=r-Tr IT
mu-Wmrin amrliqaraaertlatrwatmar
amttwa-1=[-1a?td1arrm1a1u

am: mumw
aa1:w1.'t=If-haanmrrrmtai an
\J Pf"\

a=I1aIn1?=Ifta-'rq;a-I aI11a?zra=itrrTriTea%i,&ea=1tT
znT1a1=}q1a.au1r1a1amI%| 3q1aaIa1:rqv.'I=IztI=11 it
HFFN E133 'tF3 d*'annq: a eaten? 3 GH[5FR %u'nHH
au1d'rtnz'Tium?taT2a1in

Iqz ammnmmnsosm
ml-?Im=IEITrlaTT1%w3aT32;=:wa3=IIEE
wwxawmmqmammlklmwmin =rrwHaTEta1
d=H$HEWIIE''f'%I a%aRu ia n eri H
n1m=:iar%| mvaaaumrqrum. ua= itzgqw an?
5-aC[a'U'R@ei3!6~"lT3HT'E$-iq'FUGI&Ta-FETWVJESTGWF
azraraamvaraawraris asuwammiawa
tt;I5\1IT1I(aTu=1TI?a13a"'

irurrar qTEha1'1=sr-nsos
E Ummrwamamwrmnam
aiamamqaaitaitn aarm. mmavnrar
dwtrmiu iIa1%3Tm: awn-cu, mmrawm
zsruaualza ftvamin
"-'lTTqT1'|"!1=('I'T9"FlR' (I908)

qzmmvdgcqcrama :9 gear!
ugmmd-tcr11a2I, aa qaaumtiammmaiurmat
80

Iii: QEIITIV-I1l*ttTaIu=1T-a111brirra'<*aTI1Tra'|'Eiis

d'tTtI=IT: a1?-IT1Fn2I(n9|3)
r-111tsa:z:1 mamamauituf
term-Iircv =fIEEl'l"l'lTIlCLT mmamm. aI'1'c11'eh.=Irm a~"'l
ihwcrlaa aqrauwmiu aantaqttmima
ufe?ra?taa1=?m%n1vI1I1rt&Tra1:r!rwIt?a1iaeua1:r:1!Fr7;I
nvnrnaammia quit wwaanqaaazfauqi
aTiaiuaazI==I1Tatr3t1f=Ia'rT wtu r$rtI=1rntIara1
vmarakmimsmwmimam
agar amaznmanru Itri111='Ir.==rrfrI?a1=Ia111.'a1u='1a-1
a1i=I lTI?l??T3I muTu=mT?;d11TavTarRmrIazs1=1I
'a1'Il3.W?RW31-ta:rTi'I

$33-7'1: ETUHHWE
uzrarrm nwtmawaa
It-T-atanin wwaaaummaaanmmmm
13211%u#R~Ii1Ivu1a??taamz=rit iT|TI?JT. anaa,a=:=Fr.
trmusmmmu W a=m1-win
wrmzm: arn=rmwac
|'Gf'lH31"(TT'l'dTF?!H~'I3flP
uqztaraamruaqmarvaarvamentunwatuzwmat
*3: 11'E=l1Z'l'l5'1HiTW3I'l1TTqTa-'Dl13iHT W411 a=I=a1a211va
aa1IIz=rIeT arantatramar min
81

U|3|'Til'fHT 3a1aaaa=rIuz5ad'I1a1n1','Tf|u1a
1111 TIez1=rttaa"Ia=H:1'11?I=tr'.,(Ie93). "rr=1=1"t!Hrnfqt-Iltvl 1-Tr2:',
(.a9e)ma=:-amaqa-=umsnn, yrammmrrmqawrutrrr-'
3ta':lTTa1ataaisrirz1t:~HTtzr'(Ia97), arrsmrcqi-1'?a'211'Fe!
11wfe'(|9o6). |1TTl1Tl'\iIl(l9o8),!1'T!l'TT J-azrcI'tfruIf1i'ta1=Tr '
(I9I5), smnmv '11=:TI"Ia1tIII' (l9I5) arm $rI1Iai
=rr<m11?-I211 arraliraa ax-fraat%I

Ia8I_tu9|551%t11=313I1fIzi=rIz1i iIHrn1-'-1
uhani qtdrarariu mmmnwmwwmumm
ammmqaawrmmmwmwmrmiu maaar
nmwnwaiaqigwaaravmmawqmamm TIFI
mrmatfaaaarmu-fqnin umanammaaun
autma&a?={a1fazRrTfhasm=I1a?lr;Ia'ar?tTi|a1Eu~1Tr?K
mmaamw asrrusaaarrrqn-2:raar-erwerawcmiuezrasr
mireairnqumraaaumqadt 9aan1111=rua &
avaaaasrtaarraaaar m5=rma=rraTna:r92rc=Imr mu
'&u=1Iav.d't, uqtrnr, rsaargnrrtai '='P:|1iiFf, ntrmrcravcr,

I-(6n')'1Tl?'r{!J1=l1?JFIIf&'\I-6'1-fI=4'l'.I!IEl up :75
(en)s1Tt3=*:6FI11=rmz'trc1fm-s'r-111d1=I12t1%arftt1;-233
2-fl=."raTIII=ITlbr3@1?I'I1I!=tlZi: aa'-lW=I=I:
W3 IO2.l04.|O5.|06,IO8
82

ammmh. -pr. EfITm=11T, a-'=:1FIua?taf't'ai.TI11'rarzI


a=na=I3%nftavsa?r{21wTuuf-?!TII?.fIIIaa1a1srII={:$tu

wmawwramuumwmma
aarariu mnzamaaaraaawuanllwqaqfhma
nfiu mvaamwm inmmammmiu
1=I=rradT mmvawm mrr
Irttrltalmtiu a=TIHdTuaFdT3a'earn1;-1rr'<1tu=I1'tT=tT1ixr
tfI=tmzrrnan1ad-'r1l?-zz 1=a=rlcm:+ mawmuwqn
Il'f1'1fE'ZlIII1\%'l'=H1I"I'fftrlFI=m~'n'Ii-1Tt1fI 'c=I6i=Il litllIT?9Il

awmaammn z{\Iv:H=ua1aT ircru amuadzavan


gnaturuaeuarmaaw $1=I=IaIItrztr=111'rzft'4I'-'-Itarur a
91H11aI{l%Iaiu=Ifn'=11a?dT'$srrh1al;I=trqarI%Iu1 mam
titvdwunammazwwragvwlzmi-" n
=1fI%IaTmtftaIuftrIawI=rftai,qd'r1%fI17zTe1t3.ITa:rarnaIa
m|at41i.au'Pu14?rr=I=wIat'uuIe:4rr%,an=Ir<aa:=rIafI=1a'ti ,
aIu=fra1iaTm=1?1rwuaIIfa1H=rat=itiutI mam
'aria?Tmav;=Ian=1ru-'Ia=Ia-16!ra'=IItTaIa?Ta-atitilwdf
at,atruff?rmrn1Ia?IEuuf=traa'n1=I11=rrau1aH'Ua11=Iai1'3,i
::=I1"aw-'c1a'1 zrd'tarIami:'

mam? amaaaa manna: mu


are:-(tin mam, uqunr. a=m'e1r. qa=rrlr<sI|'l%'=I11?m'n=IH1a

n-~arr#~:=Iramaefruu=nmq;-42:. du1='es-aa'mzm
=riI2H9rta~'wH1-2004
83

trI%r&amarw!f1m3R=wawna1'aa1-atin'q13an:tfuI
qmauaamlmmm 1n21an&ta?IPTItI51, 9'51-n5sT=I
mailaaramfun z1=t-=r6=I tnf a'h'I11%Id-'r=R1f1a1rna=I
almraun" '
a1%n=rurr?H:arIaI=I =naa1iI R'Fff4TG
a=In1a1 a1srq:='9rri|'amTTn'rII1=uIz1i!1aI$IvfIz={
uftravez-Irlr-11 it u?d1aHhn't-nraaT{aTnsriI1EiaTflEIIFIiI8
munazamrmnmwancnalmardaawnin

ammihwammawmw
afavmnfiu an!mtr=nz'c5l I-h?f<1'd1ItiaI<h11<1I:11'r-I1'cTr
is Wrtamam *3 aa=11_vat1tI'aIma9I%iu%a=1aI8_t
v:!f=Is'1liIa"r-1=1a2:t1TTr=I1Ef@11u11%Ia'?Iza.l 37&1'H3l~'IEl_
=naa11'l "n'1a1:1Ia~ta1uIzm1<I91=I!ttIa'?rnT;r_wIa-r tra
!1a'El1'1lElT-T'=li!iT'Et=rP1lTlIl " 2=|'lE'-<$1' i-l'I'lIN|"l
tFr::iqzqt:wi%r&e11nai=tsrmtI3aa1t1?.I'11?rI1tI3 B1?!
Fla-Ta:nIrI1a?tI:I1Eraa'a1I=5taI1'a121atn1a zmn'=rd1 mtatm-an
mmmwifaarrgumarattag an
anuaaa'TI'II1aa=rmI" 3

I-mmmammr-Pmum-Q20
amarzirmmmeananmmmnam-mat
2-1I=r31?I<1'd1ns=I1a?n'1 11? r-msraar-31-u=1a'a. E;-I53.autI
3-ft:a'r$z?I%I'd1ftRn=IIa*cil tI%mctaa-a1-u=1au,=[-n53
ttaamaam - 9'HlZ?I'Tl=I=I'lZG(I-9I6v-
============================ I936)
=====:8==3

w=frad1uaIIrd-Tqmizamawnmu
mnmwnwaammrmammmmtuaawh ira
airmwnaarmman itmauaaataza
I'rI:=I=rt1%IaaIT3Ti,a1is-=11-'Ir:1:=I=I11%I21'1 d7tJ11a1$aI2ITII<Ta
ahmqaahwmanfn Wrumtrclmmw
rllaatnatrruaml Earn vrhtI=:1ta1=1rfH=I,e1f.tI1.ia1=1,
a1'a~1=atm131%:q1 EITF?fl11?l3T$Tl TIN1=1r8=n=IaaI
mtrfan mahmarrewrgvn

eiiacmaaurt-c:$1E11iF=IunT,t1:r1=8
a?T~m1a=T armnmtgamrmmwm
Ta=11aTI%2?Ia=u1-ufuKaTI3rK-I==n1=11 anantm aw:
mmdzimw mawqg 1=ll'c'I
urn! ammamremrmammamcngaananq
gunanamaqraaxwzmn

mmrcia aiwfta-cf*rgaw1mr%
H11?1l3?53!T\i?Ea1I1T?TlU=|lH1'1T:!?'@"JTP'=53l=
amwvamrirazfru aammmmanadumm
crtq11asaau=nw1Iaa'a111I aammatqtafwl ?RlF|c'7F-I
mw gsrafranarin aragemnuunausantran
ammumiaarcrasramtwrrawmazarn zwmtnirarm
mu tKrararR"1a= vre-*uI1'wu=II1 aswawrmn
*l111l=I1'3a'=l16TEf!Iv'T%I1?HF1F1GTl31=lEFTm3UTEl
85

9"!f=Ia-1'3arITrIa1f!aII1rUtr56an1'rfi.1fa2fl i'tan;at=ITcHa=II
CI'%BEFETl=I--'=lT36I'acEl mhw C|?l?f=l&"FlIT6T|
"%7I:ra'1=s=n1aTtun8a1zrva'a=:1=I*erd1v;1Earra$F=d~r em"
m'|%11u=n8ia qnaaaaarmmqmammaanacpr
atazrmaam 21-T=113a11h ~-'

mzwra aituunnnatmruaia
araaar =Hrrrctrad1%Ta1=rIz-$1 dttanaiuarfiuutraa
Pqmawmseaviwmmmwwnmwha =nz1s
iawansrrautu aaaayaitaqaammau akin
awamtamanragua aarmauqtlwrrml am
sma=l'tenalaa1 a1aa1a*r:mI=:a3=rIzrm1i? '-17:TI=I?-ITGI waa
twin at-=I"t=:&aam'rt!aa1i1 t1=Ihf-Ira t1'ua1=I an
crqrmrawa an 2 wmaqaawmammqwm.
I=rua1aI=nrs'1 aaawawartuutfmtmaamtrwntm
drwnacaraiauawrarufaxtaurraaretami iii
erd=aIa1'e.'Ta1i1=IaWI(aarIa-1wn12u1I'3 a-mama an
wmmmqaumwmmmvmmmmn
@f'a11fI=rIzif muvmariu mm 3 araarr =nza

I-=tamtna1=rIzal ?H1'5I'ca*6IEI21=l-*6"!-T|=|1'=I1IEl
l[-90-Slll'=l11l'l I91!
2-arIa==:'r=1r:" -a1-='t=a-t;-n9=Ian=n1mu1 mo
3- srarcama ftm =m:as- s1-mnr msrw w (pa. '3[|2.9?FH-'1-I975
86

?3?:
(I) iia-I-9-I-59: "unt (I9Is)
2)13m=I (I92I)
(3)441?-Iratla (I922)
(4)a=z1FI (I928)
(5)a=:IFI (I93|)
(5) natar-r-Tr (I933)

T-1m2a1 Sqawuwia
a1~'mw3;Ra-PIa-taIu=IrcI1- "1Iu'cIaIaaiIa=I1II1taI1%IuI
aIIn1aIrcrf11n13?Ia-*ta1cIv~aIa1=aaInIz1aatlaIiI--- fm
mmmmmammmawmm arr
vurnmirmmammaiaamagagu
IaIzn%I " 'I:r<4Iz%aIu-=Ia-<:2zz:arIc;I%I'&I=:rrIuII:rraI:vI 3
aIztII'dt#I3Trma1Iaa3=In'c1I2111?-m1Ha?aTaIu=1THafEdT
m=IaIa2srwIta=n'23=1aaa1=IIuIaIu=tr1a=IIaIT aIIamIrra=I'mI

Twit (|9|5)
tsInz=IIsrII1=I=rIm='#sI1=IIz5I ntaa1,
uIIaI:aT.a=IIaa'Irn=nIarwIa=n1mu1niu1%Ia1 aftsnaarsm I
uIitzrr$TI<sI19\1Ia-I7:I1'=IaI'rqar-II:-w=rrfdauu:zIrg_aa amt
11na'=If&vaIuaI1uII TFEl'#f3F?f%FIF*1TFfllElTT!I?H,Fi,
n=rIIwuTarI9=I'Iu1%1IIIa1=Ifa1I=IITs'IE-Iari. 1'Iazr!IrzI1a=1'I
min mahatmeauwrmmamin urtammm
uta=e11:aa=rnvta'r8=1mn1m,:m8#uaarmitznm
n'a1a1fha=Irwmsa=au1ra-mri.tx1ra1aTa11arr=I"T=:1Jawu
aI$r1aIra1aIisWcr47r&:=I1aTattrnI=r3rrIEt1kIIrT
srar qcamwanm-arimsuuhwuadwgaarwaamaa
tramaah 1'u=Xr&a=;'w=I'?='J=*IaTmFawa?In1 at
math Wu=1ta1'tnz'1 ua'az1=IaT2araa1maatai
ahrmmmmmwrmaawain
wqammmmamwmmamm
t1t!juarr%n'asra[zntm"a1a afn 9rHw:$=naaf a1
udtaer=3a1atan=:nsra12tnft1t=Iu1i"tFm1t=IIz1stsrat
Ia=ummunw.aah=tva:h1ta1ra1aazaTcnmu"' am:
i =naT awgaxwmwmu d1a=i=Iq1I2fI elf:-nmazza
uyfwagfis 61-manma-Tmuz=I1a auazcr #
1truteTt1tqfa$aaa'ra?Ia=:1'aF?IaT1Iu1iI"2

1'a=II1a1iI&<saHrTTq=tdTm=1t lm
mmmwm mmvmaanumw il
:53 I=r|=a-n arrafTU=!'Ftta uaehtrmatzm-almqa
fITF!IT3I?at?Il#a1ItIT%[11$IU=!'5HFl.II?!fI$ttiI

u-sm.'3=nz'a-1 wmmauwi-armrauwwunf
t[- 33- dan1qfa- the am?
2-1i=dr=r1za?t Eirtrrliatiatiltt-6'1-!1TI=?r=rrI<~Ia::c{-I07
9u'=H1anu1-I91I
R113

'Wm'a't<1111ai1r3ua=Ia=rer14l!a
in Wmmmmmwmmmmmmtzwiu
maamzqaarmnazzuawmazamt 3-'-33!! a
1ra'r%nzt= vaqafdrarmqeais zt=T awwm
itmin mmmaunmmiaaatadgtwma
wrmalavtruvma-iamiu fa!tw:mat=nTerIaa1i:=rr2a
arza1=-1as1=:rnuen1ra=:aararaw.'ta=r1ar%n =:t=? aqarcrraa
nmamin Iauswawmaaruawcar anrIa111a'rsnam-1
a-rain wmmlwmmtammmin amit=n'8a
aIu'3Iq'ul wmmrrtgvw-umummmia

msdtaTqnztru=n2:an1vt91=:tI=It1=c1
uaaiitftrztf drc1ar$mrqITHanm1aT aiaawm
uvmmiu =rrr?aaaaa1a1 awuvwfau am 3
m1-at aiaiamn armwzawmmrwallair
znh uaIaTt41n3Ta3.au1enaeruT=1't'ttI1Tu'1.=z:I=rzI-T uh
arn1=FziI=ItRT ffnI1awrFtzarPna1arn1IH=Ia%rri|

wnanmmmawaruhnan H11
'3'41=F~7lII=1l1I=lqT11T-1lIl6ImRI7-t5ElFU2I?Fl?Ii-3 uuaath
an aaumiu intrcaraidmr a-=rI=rrimashiu"'

I-rm -can zgunaa-aafqzzr-I;-25-t1n:1a-1w


wwstfgzualartraamtiartru 3E[lfIJ'l7I'JElTIl
i. mvqa:rf:fzna1amfa=rH1. am=a1ma==|1a-rn1=faI!:
ahT911aa1?iti1' '

sru17.'m'-u=I1c'a1 1? Ir=f$=rr-=:cI'rw
aaralrlrrlat Iiw anzrtiu tmnut am
E'-rill?-f"!F=R1=lGFEliU=rIa1?IIiI -is-"az1l=I_
1mt'faIaaatnata"u f*'.iTl'U1R'HTFI'_
au2Ia'r6Iai1laITtra~cfi??HT a1I=IfcI=nar3 fdT|'"'=|1l
azn=r maafaqa mrmmwrfurhm was an
n?cTa=It?itamcrn=rr'u1m-wra1a"2

mmwimmmamm
nazrtmzatm. ailaraimrmar adutfrmzmis
iif Frimrratil

mIrmam1'au=rrr11=taa=n8m=f
anaawtmmrmtgaamrwlaainhzaawwt IT-Tf
mudrtanarezn narin mmtmnmsluaittth
{H

1-H: irIIraiuIT2tarIuau'3=r1%ra-1?iarifn'anTnTnafra-'HIa
q{1B?lIiI6IItl3HHFIH-klElEr'l11TT"lIEI1f?|T
Swlnctnmiahikmvwdgaaimmrmmiu
Immaamaanmagamtmmanvanm
a1a=z'ra=rraI'3u ara aiwranarvalaarimmnm
rn:u=r't= aa.'r=ITmtrTarss=Ftaur&.ara1?uaata%t1tiI
a=z.'I11'c--I aimmwmmmwnmwinmiv and! 8-.
aataraauagimarin maaamamna mu
aamIaa1Iarn4u=IIta1at%i av-crs-a:a&:1uu'raa1a
qcmmavanmanmmmtmmw
mar-swamnfmniu m=11-1rufaacnm1a=na-1'at in

mamwradwwfgviu mm
mmmwmm mmma1t'r1%avI%|ara1m aw
awrau mqrsawiitwwmaamahnaamtawiaa
auamramaa uaaarrnziaa mwaarma Eda
FT'Cf'R''=!T!'?1T3-T|iiT3IfT!<iTlFl,3fl'TWI
89?-I2tnT avncnmnaia ammaeazamnnarrm
l11'liE3 awmw waruaiaqn
ullm urIacr2fatcm9a-Tr8faz?Ewau|" '

Hntgiulani-Ia? dTarrI1f

I-=r=I1z11 it IlE1'llE-?5=Ii=!T-I1-t{-223ll1'=I1$zI2o25
91

azwrruntaiu tmmatqamaaqamazmqqsurzrr am
aaarnmin tmmtzrm1=ratr=FtmFaaa=za1 tr W=IaI
avraasnznari. I:r1'=:fta1r2 atamtaavwmzzaaarau--'

m acrraaa-faanfaruvaaanm
marraaamvmrmria HaUfaravf%1n'aTn=uan'd'ra"r
wqvhatin wwnmlyawmaamuma
111-frin mn11'-%an=rm'-tqafruzwauamti-" NEE]
mmmmtwmaarngmia ruuqut ah
vtrnanwrqn auwtmutmarumin nawru
m1nht:rl't9'a:Ifazmiu2

arena U923)
=I"1lFIlillE'=|T'l'5-'s=II51Tl=1t6H-'1'-l'v?fdF
Iwtzruzra-1qernan#Taaami1,unw.ta=:1Ja afrrtam
8I3!{1lB'Fi'GTT'3I IIITIB-1FEITflc[?ItIZ1'dI'6'l'iT'{Ia=|!l1l@I"i
Wamwmammmin It-suawauraqnrtura a-1
miarwuqamamrmmin tlF'."!l-T at
gun atumuauaaaaataawmmariu araucrcnma
maa=I1tra=unfa-1w1ra=:rrari|\a=c1Jad-11-I1aT1aav:Tt1%211'q

n-wuwa=rza9a=rr(atsI-ssulamwqca-cg-34, Bmrmsss
2-~II'lT?ll'-q'lEITdl!?-t{-54-FIl'&1Elfl-'-(VI
92

mmamaimrwmmmmmavuai ayaab
uarrafn wiamgvrrmahnawmmm
Iaxraz'ra1iu rrttraf1T1=5z1,;aaIu=!taIn1?:!aTsr=I1!T aiaan
g=I: =lT'l'1?ll'3 auwranrraris w=can'-1': rm!
tamtawnam-qamimrawmmahraamwramaa
ainraamin sjruraniuamamanlwrqanatr
?aI1'ta'ft?a'!H1a-1u1rzstaTIiI=aF?Inm1'2a11t't?a?l=I1;
331??-'It11<il6I ta=tIrzrm1FI.aia1tas-1aTnari1 =na1sz
Hmain

a-EI1a1rr=I1<u1aunaraHa=.'11ma?
wawmmzmzmwuamin te aawiinmaa tru
rnwtain tliawwr aaamvfmm
awwhmmtmuawmmi-"vu WWI
'::=I'-1rm=qIa1:rwrra.-m mufamaatmm
vtm-=rtt.ar==a=;ttzaa2:u-raraara amqqwa-&:u~-'

m=<:1J=a. mmmutmmmmm
iI Ia! iaaxr-111! aafrarmqaaahabm
i---=m TElFI''l'9'iTT=|'|!l=r int-nan wt wast
mmmwwqaum i!lTF|7$ti1l=I3'I'|E'lT atma
nsqratwreumcprm-aasm--2

u-mum -craurahxcgoue Wtatmvw


2-am}?-I -uumizsq-38 wrdfwm
93

wwuaimmnaan u1ma
uamwmiu Iamw aiuermwlmm '3
'aYnaI=1Ts=fa1suatrruaar1?u1Iv.'I=rIaT i$'fI"Ialalf
'i.iIFI.=!r.m21atTn!aa=Iia-ltafln armataittaaat 8
atmuazwsanauvarumsrfmamnmiu mt utf
8 ara1w&a@Itrt;Iaata=fa1fw,aI1tfa=m1wrwrzr1uRaa'fu"

R1I?$=rIza1 it vamua; sr!1,vm


zrnzarurwnauiagfin nmwmsganfaaurdtaanm
aaivv3aa=T suntaarIztI&?f2$T1am=a=I1d'ru1aa1a1iIatI:4t%u'
--?arran=ri1 ?a'e1tatIarra1:'c'fuTt#rrn1:v111rrrt'ri,a1=1F
mnmaasamrzawaimswmwrwrlnafn
mwneuazmgquanama-na: mavazttrnqmmim
Hm=r=?rqa=nu13w,a1a'Tn:8anSwqernaa=a12x=r
ttm aamaanu amfcfmdtamaaaweumamrt
iwz
=nza 7-|'!'fti-i'l"'|"l"l?FIU'l'*ff"I~7I?!'6'\|T'a|

Umcmrdamwunmmm Raw
Q . D - Q Q - o . - - - Q Q o - . - Q Q o - . . - - n - o - C Q c - uxcc
I-FF<T'J'-H -ivJfEEF-l{- use
2-tamxa -aauatr-I;-es-es
94

nwuaaaasftwfawtin

mwawwmmqain NT
crrarazirruitu aanawrram avnaatcrfrarrmu
TI1Iawna=Fa7!u$=I1!1%tcr1i1e1a1i|a'PrdII$:ur-H a-1
wtaavmammiuazuamtdvwm
I'tIa=z'ratrt1a1in iPFRI?i1~Tf1?I?Td!'l-T131936-1'T'3*I
n=1ta1ar1wf?Ia=IzaT,ttst{a1:r3aTrar3.UHa'?rr;a'rmI'3|1%tm a
ana=I\11'I1=fra=rrati| nmawmmumawummuamm
arraaviu mmrmmmmmmmu ua=Irnaa"t
d-Ta15!1%rt%Iua21Tqam=r=:a1awu1ariua=::{FIaTn
wwnmaaamumamramn

auarawamaanmmraaw,
ma-aa1u=IT.wr5m-mam. W112:-%en1c.*aIaa=T=1aa1s'
iU'=ITtl~4IT?:TE1?IPE1GI1ET~I3tTII7f3Id1'H%=11FIailT an
m:ra1a1m1=1a=rmm3aaa'r-graaawu uz=na anu
wwnmmaaagam mqamwraamrin
a=a121al a1mavna=~.'=;ra=nza itua1.&a1w=ma-5
=r41I wmtrazuamawmmmqmud trarrr
awmauuzafaawmmmmwadaami
iI"'

I-mwrww-wgamim-q-I64
95

1vt?r=|raa'zrt@qaa2M?rre'e11a|nI<1ua1zRtursFrrasI
Igutfin mil wtahwnqmwriu rtw a
!Iazt?21'4:ar1tara'16uaats1-3-3---"$nI{Ii:31as'ut:411!=I
i---I" ' aam=T?u=':-aP1u'm1=5a atnztmaxaa a
1'*Fl'F'll'!'"ffb'l'l'T!?|T3l avatar?-"1-rnni, iq-aai
1?,&tr=I1i'=Jfa?TI'1td=1i=ri|*rtH{p%r3srvss-'crT=rP1ii
ftrnraweraaemut trr=rP_pT &a%1"

=|'Rdi'cFlFFTF'l?!IEIl6=llE-FBHF3
wufuua? ft min qua-'rq=;art11sz_'tu?a1aTs?'naa1Ti1tr
dmf uwmnznu Tmawmmahaawmm
a-tar?--"&u?unraatr=r!?.nFt1T4'r%nzr4'raa1 arm
a1!IfwfiI'3

mwrwrmatamnmvanm
a1naatwff%IEPI%$t:I4I'|o=1T?:='t3=1q1%Iu1-mdql
vdurram[l%I$n1!=ra1=1r&I%IT13ara-1q!tr9I{;'aia211%,:a=aT
wirkqavawra-*waaraTtaruInIfttrartaTurt'aIuqt%r 4:
m?$qI%ucrrt?4aad't|

n- a=a'r.Ia -rHw-uu=rdzr-q-1n.aad&r1121aa2o2n1%r
2- it-=:'{e= -FFI1'<:'-|J!l'=Ie.-t[-8|
3- $",1'?l -rHI?.-9!ma!a- q;-52
96

Bwmrwaanqiurdum
UElFiTWTa!11d1?il?=l?1=II?RJ1I4@f3T'1=IWdTEPJ1IlT3I
uamwuazuamatymqaaiaamaaiueamw
mgarnaw:9z1=r=ra-r3?q3wz}:=rarcHq-n1i,@t1%z-=ra=:
1J2:au=1urat31%zvTranega:mt?ariua=m:=1a%TervacrI1ga
ta1m=natmm1Jam=17uc=na=rra1%n mmammmm
uaanircrrarrqmitmin muaanmmiu
mmatawanrmmaaawttrnhmariahtm
9ta1aa1Tm'u2rzantrITa1atin:a1Eu'rttnrrd-t9n1.a'3H211%I1=x
9-daraa a1rr=I=,1racrTa~rI'mIIa=IIre'cI1| aaavferduit at
aI?n1arrat3=Iv?taTtifiti,114THt4=r?F{FFI:a1Hrlia=Tr at
quumanvwgaarin @811 awwhmammmam
awrmzntmrrataamnaiz-n1%omu=1ma=:11-a 2:1
rrrrattlzu-1r1%7uerta1%.ara=3vwHnFaqarnnt11vn1arin
a--err-I q,-mia,nauII<era1=raT ereanramaamnr
ataauaqmwqa aharaia wawumwmmm
mi. =IIz*esat$=:I4t=2;*e-a1:=:1=:1,atri=1r1'rsrtrtzrrI9ta1a'
driaamars-aimaiauuiaauairgawm
amiaiaaammammwnmunarmr, traaa acr
nmataunaarw ttnaFa'-1rd-Tm'cw'a1i, era i-era
a=ru1rtartan1=IaT1ircIrv:alti1a1fa%ia:'1'3uInwlt Itawarin
gaanwrmxnaafreaanauramni----qua? am
itaummmtmaarnnammrwmmmam fan!
t atfanaaw mat. uanmfnmrmw arr
ma. mwawwmmmaaaqfmmw ma.--'
srrnzarawgaammamvanrmmaa
1'-1a1a1%aaram1=ri-Iaawnwaawmwarwn aamum
mmaamitaaarifs srmmmaraarruznreaanwm a
arwrz-mtraiiufmdammaava
aaa1a=rri%a=rn %eaf1'a=113? aunzauar-{marina
*n=ru1a1a11%1=1t3:1=a1m'a1?arin"2

muwrmrdtunmzwmanmi, tn
azwsaanaanmrtarrriia an arrama
unmatmmaanmrraranamtmlnitmama
err aa3a1i'r=I1za'1a1a<2wTa1o" 3

5rHw3=Hrl11m=rIzc &I%:1qa
aaawrraarnwwfmrwttmqwmw
umaaanmammaimmmil URN-'
8=m:a~l mgmamwim-rammmm mma
mnunmammwm. wwtlmaa gnu?
-I-xatalfit u!T=r-an -q;-25-211=ra1af19rtas1I
2-[a.11t4=1'r q'.-n:ta?ar- q-as-64
3~1i=Tu1fa?ua1<q1a'tfm1tr-(9'6reum11)c;-67uu'nma-*wI
98

auawwamaanvaafrm, awqnairarnmli. Imfaar


zmmwnmqmwtwwmwmmiu
wareamasamuxmaamanaatqma
in ara:=Fza11aIa=Trmtnaa1a:*ti-"tm1H#m5Ic1a-1
3G|TG|I<'iI'=IFl'51='=|'-ll-'r7Il er-ua=11'l mn Wh=rrcsra1*.'
mawmammzqtmwamrmmiu atzmqn
mmqmmwm mwiraamunamnawqaw
t eaiw-'
uuwaraqzni cnil maftafaaw
6lEI31EIFI1G'3F1T|3'Ei?IIa113FH3l6Il1'l'5%,'l"l3-7ft,
m3a,EfITT.?TlB'1lflEI?I1e1112'@.\1u=lI1ET wwm
auaaamamw min cmr3aTaT iaf &
aamqrwamamgvauanauwrwe-"quwawnma
%Tm1i=faIaFaI;zl(a$ra1't'f 1? a1fa3tI13!a1'?ui|3iI1
91%TI=H1qH=I1aa1 3:113! 3mH?aumm=1aa39aI'd;_=r_I
3I1't$au1!f=I1'-Iain wwartwwawqgat
q:II=IU6?11'l1a1iI3u1ItPr U-Itm='=rII :rT =II=Ial In
afelltnin mlvwawaftaavrazaaeualtamm
fI{wI=a14'rI<luTGI1a1iu "2

2-f&=1r=nzazsrr a2wm?~I=t=[-11-fqa-amt: :95:


99

a-mammnaiwww
atntauurm-I1 d-'Ia=?ar1uaI*3zsrwI=I1T,aI1PIa=rr-=I1'a1 8
aha? 3%-ravrazarrtvth 1'-I3=rIz-I1 maamamamqvf
9\1raU3f,=hfeIzn=al9"'PIa1=Icrua*fraFInI5In13I''

9Iw3qIaxznqa=Ila=Ia-I339 Imam
wgammmi-wwaw i!TT~'v|'ET|1'flTfl=
an-sIt1't=I=aI'=Iaiiarurl::eI=I~1=I=IeII1=I2tII:I'I=I: Ptmuvd :r=I1t
a1m113a<wH1q1%IuiI---amaatatrmmzawaamat
6f|2ili1Iql-I'ar!Inii=*T=rIzutfaa1tI%ua1Ian'$e1an11fq17
vzsarIaI'Ia-1anI=twII=atIa=a'sIa1!I'aIrrfa&o1iI " 2

rGIT=;m'-1=rIa':

I1sIr:2,11!I=I:r:3szI9femI*:Izs=Irca*I'a==II1wi
I) tiazqaaifsrr - I924
2) l11%zIiI=I!l=If'3'!I-1=I!1?=IT'5in (I922)
3)T=|'PJ1'l(E' -qrrmr (I926)
4)aaT=I!1Tf -Tcwf (I929)
s)av1==II2xI:rIr.'=II=z -9'a1cr:I1I1(I929)
6)Tf<a=7.'a&I1II1=t-I -THEE (I935)
'I)a'<:ut'trr1Ic:z -inrttaz (I933)

I-%'I=naal a?riIaaI1%Iu1tI:a1-uII%a=I1fa'aq;-I23
2-HIIINTEIW: -=I=a1;a1'Ta1~'I&dt :t[- 277
100

a)a'<II!hn'\I(t - tTi'Tam1ftI=wI:rt-I'-'-I(I934)
9) 6Tl%I=z.'zm - Inf (I934)
IO) %I1tI=m==Iza11rr - qma (I934)
II)11tqIEI r 'mI'a=II=I (I934)
I2)l1l<Fl3"-7| - 'IamII=I1 (I935)
tm1'mI'"iIilfElI

'=|'l1'3=|Tl'l&'lFF~?JT1'f33!lE|?RT|=|"F1T

qauaraquiumrdmmmaaabnzmtamatww
zIa1iI1'=IIaItITrcI mwmmywrrtmuar at,
aI='I=IaIII?rI1a=rIafl %wraurarraE!IaIaratI'2u?=n, anu-T
mm cII-Ia=IaIzITa1uTb1a-1=rr.I'aI%I=;trFe mahmm
mwraawrirvdaufmmtwwwamm. era
u'~'!t$32a1FIwu8urrtvI1"aIa1ncx-?IITa-1%a'aaIqe1TuTaa1a1
<iI1=II 1=ImIIa=I'IaT aIIt.Itrr3sI=rIz6i'! 1aIIiI

'a1:I'm=1aa11-tI=ma?t=rra=IIva
sI1IqfaG%a=IIawI%JaaITiIi'sIIaI1=:1naurtazI'r9!TaIara
warrai-aIa' aIIcrII-=21? aI?ta=ui GIIEIT!-TF|JF|T,'Tf3?3'F
1cII.1a=1Tm;cua1aa1q2a1aaFuImrIuFa@anaaIa
sIara?? a-:IIir=mI atfarvtseawniaari-vavaun
errf'3I"' EIEIttErl1E?I$Ir:rE'9fRI1fa-'r51a1'GIIa~1a!I=ITrftfr
O O Q O O O O C Q Q O O C O Q Q Q o Q C Q - Q Q Q Q n Q Q u Q o adj

Io=It!FIT'lII:lPJ|=la1!-UYFIQIII -1- 20
avfma-1w zooufa-the
101

amamgami-'rama:fi min-miau uftrat


mmirnqammmrwiaiaanratamm
aI=I=a=IH!1Rf I-!ara1IIT'1a'r?|u'rf=ran1c'f=aIrr3fav
ar u1Im91rta1la"' 1'araauawaarf%ra'Iwu1a:m1'tt
iuaiaqrw 13:15:

<rnz1tn14amaeu1da1g'cTa11?:
iua-'=m=Id'ra1'rtaFaa1'3I =I1a*a-+nt1'cn11'aId'r qua
qiizvduaarm=IrII1%n'aa=n1a1Ta11%a1iIa:avwu:=unaiu

mmmagammtageamcruar a
min m~a1ur1T!rraa'eaT iavm1'#a'f-11'=n=IfSma
am? it fiaaatir-"sta'm%9=1uwt=a1=It-v11u1'tt
zmfev mycuamrdf 1TtF1lT,HEtffZi13??ITI1Iq
t1'rwd3TiI"2

a1u'c:n=II3ae1aT11I(a4'I'Um
an-:3. umammmar-namnuimarrdmm
Ua-1IIeI?I1'3I

w=:n*qIr'I I'a1&af'raat3ara1'm{z:1

4-=I&='r=s'=m 9%:-1;mEt:ee.21-q;-s;e7, 9933


vwar aim mm-ameuaa-I;-use
n-rreren1za1- fqnueza-asmqzu-q-:23
2-" - q'crrua1a-qrzr :22:-q;-I45
102

sarreqnawair E13-a mtnm. aaurmudq


6I"Il'1Imd-TCIf|=ITIa=3TIbcIa-l'U'!I#!'I13 Ilfi
uqw u-raa~a=I15ana?TaIa54ha=rra1n'Wraa=aHIaE1
=1imna':cuI%tft=a=I1:2z1%:wraa=a=1%IIa1araamnvn a-(=1
mmatqwtmvumamiummamcamw
uvaaammsa1tm=:m'crammm1#u'2

H-I1:FEI=.'

mwmauwhawmvamap
tIft4=i=fIza"a{11itn'mr3-cu:z3iIaTT61T3t=1
nammuzarvurfmruaai adn1g&=ramIat=nz
dluwfemu 31*"-I1aT q1a%arra1d-Talirtrlaaaemiu
'n1=I1zaH'maa::l tt=mta"rcn'wTI=ri1 U?I'1?ITI-'-=laN'3
uzI3tFrmttntaf?I6I11%|'ad%11'q{?aztaaTIa1
a'a'Ir~iIa%uatIHnu=:rwasII=I1iia1a?rIfIuT trwmm
amaemwhngmmfammrrmqamm
eIz41aItraaaami.TIvI=TI1%Iu1aa1a1qaa%n"

=arwrrm=wIfuzse-muwr aa
fazniu wwmmmwwwmmqqw &=I4't an
aamr-3: gammmmwaanqnmwmrmiumw
n-.a1:IeTG'-=I'cnma:r IFrraTuPz:-cg-:77
2- Sacra "3.-.===: - TFIIET - qo|82
3-tmmmtatmm-eamwm-Q 7e
103

112Ia1a1-- "#('rt1T1iaTIa'T9niI'fHaaaa1r1ta1n
Imuamammm, ammmrmmaaaa-u
EIEIT mamau "'

mumtunawauvdamwta
vaaawnwmngnfaarmarmranmaagwlm a~1=a=Irn'
anwmn main aamnaauaa asa as-3,
qvfwwuauwmgnfarammdvdannzama
ItadT.a1:4'rt=I13v3a:f=Iuqq1 mnarr%%na'=Ia-1a1=ra
Ixarftuaaft arIarra=ra121I%nx3t=rtrrTr1%=z1?ar1a*sra1T
TIaqaTI=1ra'rn=rafa:t=I1%zan?-m1ra1naFai! mam
vataatawlrmrrrtnnmaarmqnfaarrwrmuin
i. auarmqzgwrariu 11-traauamwaaw afarrzx a
lI'v'l'<?l'-"'\i'd'<'lGfGi1'3!'l :uaT'erII1'ar=rf aaaacn
Enma-aamtrra tema1'r=r|' itaa-cnn"2

'rI'-it373tli.'*Ktt3Hm1H11'
=1=iw1ixIataTT11?aaata'?IaTNra1a 3% aa
F.Iwra1I1avsiInFuTuI%:1uT atmmmaiaamnua
wuurraarltzu? cuTcrTm=ra1aratncran'nu1aa1a:1u
mnmwndnmmmmmzamn

u-a-$11-ufaafcu -l?ITT!I -1- I84


2-{Irma-lz'ft=IucrI1zz-cr!E11-ts-t-111411122:-I1;-33
1 04

uanwmn

an==Irxcm1zfh=z'=1rer=11z-arrrrrvn
wnmmwmmamammvammafmaan In um!
316113: wnmaqzunrragvsrmna-x-at- 1-H'FTf?'1
a1Ifr%,a=mta=I1:%a11aI3$ aq'a1a'aa=|1%,I1aI1aai I,
nwmrmiwnmmaqmawam u=I
aammgcainn a2:1aau%I'a(am:r{u1T=IuTe[11I
uammtg n;m,qa-:~ram:tnaarq= q'rt=T:irIn'(|)
=I1=rratzna=1Ia 313UT!Tm'-ifi
=rel an aw 9-mwqamaaauatvdqawqrrm
au=rI1%m=tr=I1i4ta-1aa1Ttftnt*uTTPn$t%:rti:wIsTu1a'tz1=I
{{IG'l4T,G|=|Uf?I15l3'l36*lTP2$TTmU=|T9FlDIF1dT
nmaunmmmqammmmmmiwnam
arniIa-art=I1,u?I1i1ta'r1;'aqaa%31a1,trrrt1vna:rsr2saIT
dna |1ZlI=rI5II=I-Tff6T$iT aTma=I1z='iIaT mam
aTHFwuaa=I1.13=atlT!1frsMaa1=11,a=a qqwan-3a1a
uta?FaEI=I1=I1-r-1tIz1I16TaI=rIa!1au1a1ai1 3-u11%u'-awn
El-raafila-1t1IIz=1'Ita=r-'II=m Tmaamawwraiuawa
amtailatlnarwauanamuirma an
6l'GI"(T=lT!1TI=|'E5'cFfE|'=lT-lTn=1?l1?E'.FfN1l-T17 zI'rIs1=n

zrratiu 3If\'-IIFI1=F'\ff?311 =1rm1atwa1tn'ma=IaT3


H-1a1aa1hr1T=r a=rI'ar,aEar?!rtm1-I m=u,arrrI,aI
QC-QC--Qcccoc-vi--Q-CuC-u-uuonc-o--
I-uawwn-uca1a1a-qangau-cg-ue-aarnafmzm
rmvdawaamarmraasivaeianaxamat a't
a=IaIziIB1?I1*I=1a=xaTtnaaarra=Ia*T,=I1s1%1'eI1:1rP2&nt1
1=I11al1=1rI%rarmt-aa'rrm1am" 't%IaTt1r11a1a=1na
a=wfHrftta=taata13:-'e1W91&9ri*IfHd7i1tI
aaqvacrrawmmin 3alH~'lTl?v1121T?13d1%3Tlil
3E:v|~3lIT'1I3flTlU'?lI1diT?JT"I3f!TtTTTUH?EI."(2)
I1=r%IiTtrTaTu'a1'r.raI1a1'a?11*3-"arNn'rvI=1a13
WIT-*IIarife1uadI'tarTasn1naaa1aa1aawa1w 113
=rT,a'2u3ut3!I%Ra?HTcI1'{I"

zunafm El #1315
ur aramrmis uanmtviufmrvaiara 3
few. craiurmaqqqaraspaarraflvauwv azsd-1
&11i,f??-Id'I?I3aI?1=l!R3--ail, fvqaleaw
=ra-6, ant~'rErrra3Rm?=nal{1%rta3a1
3GH''|=l3-'1TlT=I'CT 6:173, HnzI=recrT?w3'~IvwPI#r
l't=H'.a'3I"

.5 129.; :5; '92:; 1:. ' '


2-F'MU' -mz-cg no. wmdaaamdqam
3-\mwsrfH311- crm1e1aa-qanqm-tg-I1
4-ra1trsrIcn- rrca1a1zs-ihrqm-q-21
106

mwwmawwaawra
9'I3a=I1t'aa~F.T 1! I'|=lf57E|1T1'l| =fl$?Fla' mur
lwlm -- 7Ha%a1t97a?mFa'a1%6i?T|929
|949ata$imat hatmwcaarm.
arreuaa-Taqam, fa-.'ra=rIzwr qaruu1=ItIatm1{|'

wtllfewzatudrrwqz
3883:-=38

uzamamfeaxzrraaar trr
nmamwmmwwfraammamaqwmmmaa
I1r9'aasa1i|aW*u8=ra1n&2'3a$a'3uzrty,1%a
11T=I?Er6ItI''-1TI'fc1F=!11?aI-a'&1trTr.Fn=I1ie1'iI=IET IFT3
1EI'v:I=IE'=1=a'a1-c:1%ITnaa~'1Ima1fi1?ran11?a1au=1T
rumarmmyqzumearu T3'F|TI3T:l?'-l'!
znaz1d~TTranrfta3a1i't1!tn3|1TEI:aT,u11%11a1,=3=Tr
arwmwawqamlwtummmmm 3
rugwmdarraiu am-I 1?:Ian11%a:a~1=rr=rI=I1=4raue.'
maamtmaru vamunrrwnntfew
iE{TFRTlFTTl1I'~!-3l'9lTl=In|.a3I a=.='a#a1 ah
aH=aa='I4'rtI3tra1aar auaummqmwu aarr
min aim! qamaaa-IIT#ra=}'a-Kauai? ital
cs-Hrrrmewua fami2a:1taaua?ar%uqa1aa1z;aquf
arraatisqqu mmmmaan wan an
rant-fit-ftin 91:11-lIcr5=I1I?a:rar2rtatsTHIr=rGrI%iI
'=cI12axa'ttrcTrsu,au-uiarmIa1t?e}% aT=1~=n{t.'a
li=I1=aiuna1'crrua=Iaa11avTn
10

tuataaeqzzdrrtaui arrauana
aniananaaga aarmm=1raha=raTa1efr (3l'l'=k-TIBIT
a-HTaaaf%m1in tII'r11=I1rfa'a11:aEts:1trrrtI=In7:7Ta?'=b=|a!1=1:;rI
rearm? 'er3T9'!l'F'l-Tfc'~' 1611?: afttqn
mterI!fu1a=II&cH:TaTI-a=II11%Ia1 ausiraiu arr:
u1=ar=a1cm:-nIaa<?u tnataru=u19q=fu'qwva~'aIzaR1r
'3:fi!'6=I117:aII1' raizmaaagmmmrmmwmwtar
axamwruazgfs

ET3'l':!l!1l3TFEq?FI

maawqqqmwawmzammn
?fTfFFIUTI3IPTPG!1?ivtPI5|aTq'Ur"?lf3=T1GIT1iT1d1'fI
a?r@1vsrf:1aneT=a1a-t?c:-rarnzir-3: Pahavmmmw an
qEq3l1!iI1aCI'l?irari'tTT<iIa=I13.Ii=(?I=TWTET64415
11aTIq'ta1aIa:rfra=1a1%ua=17u21rw 5rm2.'fa=I
mmmmmw. rm mrtmnatmin an an :1
qtaufwmaairqmaadmmwmmnqmnmnz :11.
au4taa'rn<?IaaTqu3ta1TaWa1atrara1?7r=2naE11uKa-11%I=v E}
tIaa-ta%a11sErd1ETa'Iaa1Ii11,!Iaa1uT'n
F|1'4TGFJl'3-'E?f'3I 'FI3fdfT17I=I'Bd-r6iTrl'2F!T=TlH~1
=:1EEI:Ir '3"3TiT'|

t31%1'a1fIasarrFI&'31==1"1"3?t1EaraK-1'I=r

crxfz-12:1 Etzmfw aiuaatnmin a"m'fa?1'a11=r


108

it ammitmmavwmaamin Tia-TI1%nr
gznmrnmadmfmawu feuTIuza1%n iE~1'M im
gqwaaecuzmartazarawraraaaaaauasumi-aa tr
a1f*I=IT aamahanmtal ma mi
ummwm Tsuam ataatttaafamaaaui Grd
L3a't'1&?:Tif3'3I" "

=1z2"r1rII1fu-I:m=.'3amv Er"l5|'-I
Faun lf-T*{l?!-fi azwai--n11-a3=,rqr$=rn1
$13-TTW1|r1F!FlG1T6~?,!1?T?EElf?1a=|IEHiTE1R*1T. it
n1qnIRn'3:1Ira1a3fn'ua1ezrI??Ii=4:_a?Ta};aTt3rr:1Ta
ah! uarnarwurmzrra--? rmmmafma mm
a1'c1I=2a1an'ar|1=.'1!e'ri*Ia=tTruMr1%u1 u fats Fm
mn =aaIa'c'da1d17=Ia'Tt:ma1.u?11?=1zTr.1c3&aq=m&rt?a
<a1arr1=rrrs1a1. q'm12rm:~" 11-z=tu'rr=W=r.=aaF=Ir
vdmaamaaawrmzvtui--'tm3a1m
mz,a?Tv:axTa1utn'?Tmarr~41a1'rardTr1ff2?a1aa\a=na
fcuam craafc-ma1%u 3'V-F'?"- T-'Fe'c IT\i
ti-Iaizm =ImtrT6m11'e.u amwmamalrl
WT E73333, '-il 3 TF1 wt--TFa'|TT?'|'gT
ar-TruTa=1a-1a1=xTtrrrrtin"a1:aa1rz%=rIz*a-1 dawaa

I-1'iT5El3TfFIW=l-U''RTiT*1(C-{EFU111Ei1T-I962
2-=Tnma1F1ua=I-:wm1mn:z-mmw
3--"- "-watch-{errata-r{-no
109

=rnafa=I'-t1<~m- 'tr<aa1'ra|u=I1za-T qammfqaazm


irf?-lam-Tcrlzra-t wzamwtiawmarumlgaaar
im"'
=I1z$5u1al 3021 crrnmr a
az:aa:v=:!fHuFaT uruamsuaaiu arqu*eF=:n1rm='rr mam
aramaradanatari, '1a:a$9i'l'rma:fi-zisrfa
zm:m=nan';t:l !liT,|B'?IT'l'EIvt=l1lI'|=IT1'f611TFllHI161?I'-II
twin 1=In=1.aPaItTu'=faIfa1a1UtI'3!Ii%r'3:ra=rI watt
iI"2
maqzzrwaawuwr
=nz* maamaqamznva aqi
Erma-TamTam1=Tralfai| aanwwnmmmanm
aawwwaawaqaanmtuaammmmawwraammn
a=I=qan=narrar#u maammamvmmwmmfaadn
a?'r1vI=I1a=Irnzr:[rHwn'.1%Ia=If111raTaiu1aTs1aa1%u Em
ta=riz1u11'a1:t:1itu=1a11atru1uz1TI1%naaITaT1vI
tiaazufi1'ta7rara1'a1aTra%naI%are1%Irraa1qnarr,u=tI
a1faq'?uI;aa=:=Ia1a'euf%1r&11=IuTa12ari,qTa=1d1T:ra
waqqsm'r=1!TH1'{dn1Ts*Iaa1i|a1cu=I1aza1i1tata1'U

|-fl=?.'f=l'|E'i11T-G|?1=|'|!I=l13I71'-F[-Il611(T!Il31
2-wnauatrwuaa-mvnaw-aitrrqm-cg-es
110

aqrmsmaamlmnaraammm
qamwmmmmmiu utnmaanaugwg
mram'I=uaTa1aattrmat=wz'at5laa1a1eftu=I1tn1aIn
am. aqdvraimaavuyfmaadammmmmnm
tawafarrmattrin arernanfaamtvmmmt an
mnmmmwraahqnmamainm
ammavanqaaawtmmvn

l$I':61'fEI7-W1?!

mad? Hnamimmmwmaum
wI?I11w=I1mi!rPTuaTi111HE1rurhtn'=Ia-1~11ra=Ia1ra11?sa
mrlzniu

tammfrmaawauam
v:'ttTq1'TmIrmartin E'?!'li'23*?-(I)~3Tr~':FF1I'c1TI
=rI a"tm(2)a:z1'=rr211:w#t=Ia1rnn 61$!-|EIlTFlT",Fl
mhmmmjmmmamufmwimu
!n11:s1Tga:331n mnfmqzaamrmwfzumtam
iFT21T1'f3Id'f5q13vT@Ia'f~Ti1T11IlIi
l|fT5!1i-l"1s'-{WRIT am qrmrmraianhitnq trr
1imzsTuwtaTa1a=2IIwm=rPsI'5TIma=I1=rTTI=I1aTrd1iI
a1:I=fa?q%3tIaaarIatvtatam=1Ian=11ua?1%1%raq1%'1'&tH
r:'auI1%1tvznI$fI&I=Ii14aa1aTl1a1aa\trarTuaiz1%
in In&saa1=Ia=ruunanrxrrtnu=I3r?sEnItIaa1 auvfa?
msaamuaaraumawamamrmin
111

Pa'1TTll'T1$f9'5I1FF'd-I"ilT1fUTTFIl

mu=Iaaa'Iz3wf&nrtma=1Izmrr5Ia?fn1=IqnasrtT1%Iav11'ara1
in Nam?-- ana?ITmm1Tt!n1'y1'=rH=nma1iu
aitrmaiauumumdrrnu aueraudua-Ttm
mmmarnmaimmamaa =n=H1irran "'

airf: (aa'til=ImdT)
arirmatzrcwfraaqmamm
irwrraiawtmlaiamauamrii at3d1TTraqaam1'r
mammaaacawwmmuaiu Tlwrc man
11f=m1, aqmmqmafmamnmaravavwwmiv
mrr-I q,zTu'Pff arawrfmarl

UFI1'<.'q'1Fl=l1?.?T &ai=r111't#~:r2!13
?tTrq!THWIz7T d'r~=nn15q1('d'ef=I1?!ITI'us3iu am =nz'es
dqaamnaetawau auammaaanmmamw
aztf I~=I1T=II-211%: =Ir1'cr-=a'-K-1'HI1w:._"rm=I1'z'Ir.'2;{I1 ma-"TNT
aTT91I1~:ni|wa1a3=nzuT ,1?t1Ii=IIl11I?:rm1a-1a1'=I
a1a'a?a%.azma1%u91=Iwqni't 'l'I=rI'c'T1-T araqxanrdm
amaiamadtqwqaaauwzmawiu utIwaIT'=rIz
urn! '11?a1f&1nmaFf=rr=I'r=r<1 I{ar-1W#f1Ti3!9\1' d-T
O--o-Q-Qccco--noaoaccc-ca--co--so
Ion -Rs11%=ea1a-q-49-';:Tre1zs-qwqzu
112

ncrr nlnmiu aazlirrtmavtattarnrnzfaa-:51


arava=au1-rmn=u1 &tre11!1TtrT*1%Ii1Ia=aF&PrI2I''

uawqvmawa wrraraa1u1n=s,#ns.
-reraaasfaramaamiu mrqnarrnaaaawunmuaqma
anmv mtalaannmmnmrian wuhzfa
a=faTra':nwTtI=Fa=:raI:=;anz1f2:u1aI,a1cI'u;zu1 ah narwsr
z5Ta1i|" 2

rmmacmaua =na1rarr Janna


qsutrma air1aFma'-11a11z1mI If-Itmummaagv If!
aaaafmadaamwmwtumwamwwmaww
and-r=rI<aaa=I1rr13ub1?rIai'1 a1q:vrI|aFIarr3'v1w83-' H113
smwqnamrraa-":13-nzmm maamaaamwuaam an
12wrTWf|TI-?Fi1*arTH:Fta1arw3run6Iu=11d1wfiu'3

=rIraian'' 9tHmrIuwsrdu1d-ta1T dim


triaamnavamzdaumanhmftmnu Gram
ward-'rfm u=rrzaa:r atmmrh Grwdancn-a=u
wwar 1%I7=ITl'Iai.'a1'3I

I-l'lFl'$fF'f=l1E~'-P=|'7F-E[~6-=|'|=l19f-I970
2-fF~.Ta1fuwa1qtrq1R-mu -vartzuwm-q-I2
3-m1irqITI=IfQ=~.*t=rrm: G1-1-'|a1=TfTe'fl?.'mi1'-l-[-24!-911111?-I97!
113

cLa'a'cTI'=rlaI mamumuaawm
Fi afwaamnmin tmmqlnauuata gun in
ma? avnmamata mrrrraazzfr crramrrrrava 1%r:==I
aha! i1u1I=azirm'iI" '

maummr rrumfrfttaarmt
int? an1aq;aa1Trwra1=:m mmwrmmawmmmaumm
t1raI'1T1I|11=fr:#qa mammaaaaaamavumaa
arI1aa1?n ea aiawaaantmrmmaaaawaiua
mm '?|1T1l'IeaiTTIlT=|TqE1ITd13ErFI1IU=i''TFl'T-I an
ads-crr=:wza1'r|a?112Iwu=3qw3wrtonntaInarr3ternq<w
mmmwaaaaiummtmn ma=I1uT at
n'=mwa?f=Ianu1n=r3t1aff $Tmq=naTa1ad.'rv.1'I 'ITF1T
nruawwmmamu wwmwmzremaawm? 3%!
=m Tin tran mauve aar-rm-ueaatg'man mm
wwqaanwmwmwtfaw can 5mI3n=f?n3IPri-
ftlqw rt41'T=aTarFca:'=r=&srI'aiE':t=PIa=raruna1u
mI1aT=1'tlc1aa1&t=rfaaII11Ifn=rrEaTrtrHH=maI$=!iT am
aiTTiriI'rl1iB|' man: u1l'<5I?f-IE-r1itlf-IE~rTIIITII1T-I1ttTtr1'l=
1II1IffWlE1t3R1r=ril Ttru HEf=rI=.tFr6I%!vT13!==IH=I1=:I1BIl mm

|- =r3x3Icra1m'ca'rIz*e?t tmnmaa-avau-q-57
=E15Wl'l'?F|"3lT"'l TIZITI

marqamaam IIIm3a@tI11fm=le*.II
mm znqaH==n=:1z=ma%:
irlw (I937)
arm (I940)
awn-tn
am 3 are?
W =====su=a'.-zsu W W
UTWTT

TIWII

mum
mfah
n
am a qr:
an 111 an
arm:
3:: arra
Fl mt ============= my n
than
men
am mm
mum
"3? W
=r:'m
uamw
.11

M ( I937)
fa! ( I938 )
a2:ItITIa=r( I937)
arazqrzrr fi(I94o)
(I940)
(I942)
svfriczm
(I945)

(I955)
(I944)
uu (I949)
Trier aw (I945)
Elmaw (I950)
mm (I95o)) aII1I=I1'n2rII!I
aerra-Ia(I955)
FIGW
GITr<'{lT

0,8! zfrEhiT (I947)


ar=ITtaa1r
mamt1IaI11=Iaaa'n
um
an cTrI=m
6rr~=I1f'I'FI
aunqr (I948)
3I1GTIdI1'rTr (I948)
Ina rt-T611 (I950)
116

emaa (I950) as:-3:3: $133818 atlf


am fatl (I958)
amarqum
Emma
mm 3-.-.-33:3: W Eqf
x-ll'I%''|'El
anzrranm
=I1=n=is=Id'ta

-
a-Prrd- R __ '|1?.'ft1i=v"41'1T

W at ya E-I Q==a=z=: W W
arr narrate 9
nk}:
utakuzz-h=I=rra1s1ru1awft1<wutaa17tT|anrr
azmvaaruuf-qzniaaarwmnmmiuwqnnr
au=mm=:I= Wamamaahatcdarmqzduw
wmanmiwgaanuqwnaawnauamam
g=rat%, mama u1;n1ar31a-ant-1ezr$maaITa'r .
tI!.',trIa'*ir3=1aI31=r=P:Id'Prr m'wwr'Jad-'rtanm=naTrrriI
13-=l?I'E116lq3?=I1311*I1FiI'lFIlTl'i1=IGI1'fri, m'v.'u=ti1
mmqxiaril
117

am?! ms-;wa91?rz1=I1'aT aatmarh


IFf9r?I1TlBI7 IqIn'wtw1iIw1a=na-r9II=Err3 mu!
z1=#r:rzturaarcuaaaaa=awn%rwra1'aaa1%a:ri~(')

BEBE?
'auaa=H=ai=rra@1cm1us=I1aai'auu'naa'n
mI=Ia1s&11T-Imrdafail =rIzr1-11a=I, aw<ar
uzmtiwmnaaddmruwuusarra
Iv'auIrrraII'trqflza-tin anauai:--maa auaumm
i3EiTT'i'il?|TffTI?113I13l5|?1Tll-f%61q'3IF?I-314116711 arr
u1maIrarrr- mwnammgahmin t=rtaTaa=I1.
tertaraaauarnaiauaaiu-2
llTlTi1?fTlTvl''=lTlf'4'fflTl'|')IW>xTFlTEfII1I"G
q'aETaTra1qIz,:rauI=Ia1=I1aTIaTiut13=I1311r3 I3
Iztmmfaiadrmtaruariu aaaztrmatat
arTtxerI1cIriewaa1aarrdam=1a=a1=r|' aTI?rra'rattmir-3:
'nf=n1qa'na, N14511:" nmwrrmnaanma
maa: wmmmwmmmiwmwmmmf
:3 unwmunmamaami; avala-::I?uI111'1vI1:1eIa1a:u=1t
afrmarrrara aamwarmtiwlriu iauiwmmtn

I-aII't3I?ifHT=I1zdi-6'!-=I1w-t{-34-aaf1=1da1=I I970
2-\=|IFI1'lii1I-Eill-\7[f"-I?!-I-'5l'!Tl1l?li'l"l-I937
3-aunnaa - '\"i|'HTl1E- a1a1q!2:- q;-95m1rla1dl=:-tn I963
11.

ilmqlaamiu TPnan1i1tar=;a;3arcta1a11'arrI:anIa-aTIT:I
sqrzrwran-crriu #aar(na'a'atcra%n1aaafca'E=ruTa1=ra1
aratin ara aawmmmtmmii mm at
Tm-1rr=ri'l"ctaTI=aaat1uT mramauntmmfdhar
iiaammwavmmmmrmam. at
arrri-'1ivaanaat.a=l1'1=rITfihI!furfa1=rf=Iuanu1n'
imaI1tnmtI=ITe{lTaI9=!T%?IItaIi|'4a1aTI'aTTIEr1=q'dT
nawmmavwmmiu
=rIz*cs a1a=at9m=faaa1T!tiI aur
'-'Itz&mn'a1m1=ns |?Ef'U=lB1cFlRII'3'lFn'1'-I air
wmzraItu1a=I1tmu1a1 it aairatiu ana:m=rI=aq=n=I
arrztfatzr-I1atTn211'z1a1r6uI3anaatr\Im1uTaIu1a1ram1iI
mqauaanawdairnummmmwv-maiwnmqnaw
aunu a?Tan=1Taun1aart!a1a'tan=IuTTII(1!a?TR;11l'l'd
&=I1=ruTfla.-r?t-z!nu1ra=%qa=I#riIeru1ua$1
a1=ua1n111uura'trTams:ar=1I611a1vamw:riu'2=1Tc" it
aa'a=ara?{Iiza2:rfa1z'rTITd1na=:PTra=[a1sIadT.am'3I=Jvrz'r
q4a,aqIfael1TariTa1zr3=Ilaw:1inmuavauunvIut1%rI1tru
Wfq autmfuwmin
mcwwaamummwiftrsm

u- azm'Ia=:-ttanda- 66'<-lT!~-T- cg-nee


2- =llZdfd-Tl'5|- am.1!Ia=:WIPaT- q-uea-Ia9- wJtH1t2nI- I954
119

aia6tT%1aa'tIun1a??ua1%.aa1mza'nzr&=1rv;z:ra12:au
it mzfamwnmwuamin =nc33cmvraUu1aT
aa.aarfi1t.11na2a.1wnamIta1- mawmnm r
I1ta=I1avar."rav1crIqat1iI

mz-wuwm
=ffa'I4iIranir2s3:p':tra=1&t{aI1md'rwz=I1aITa-t
anrra-r=ne7szkr1a=n'n'%u Wmxamausasqa arm
uqaraaamwau. usa1mnfen'rtan'-II. @=I1tncta=-e1?I'fr
awuumaammzatujuwmwmmgnaaivdtamaar.
?1"'l'?l-l'=I=ldIT'EEI'liFl=I'I, n=Iruc'1tuTIa1tn<1!fd'l'
Irmavwaqaw a-'tt1%a1=a1,arIi1=a':rcrg:=r3:ttr
ittwnammmawmuwmm. ara arsarrtcu
rraa'=ruH1. au1afv;1Iu=fa?taTa-Tran-net-1ne7re'=rrmfI srtaair
111'?|

mi a=:1Frt?=I=Ik1zsrr=1mre*a#I-tatt
=mti. mama at-I=1a:r?ta?ra1-13{2IIaTarTati'r6&1=I1u:1w
aurawwrawuft-ua%a=rrrn=&sI11%I2s9a:n11a't=tararaiu'
wmaquiamwmnmmicnwadamwr ah
a1dr(aann=uua1an1%Ih):?era1TamuT1aamaIuauu
qaqnaimuaagslvmaaamwarin
CI'l=q=rt1Ia=rf| ITETI; Uwaamwaanuqavmr

-nf&=ta?m1m:=I1r I-I If:-nrreraa:-61-u=1au: cg-su


120

aazmaraaaarratin rsaunmanarqaamm an
wta-wmnd'tu=rn aismuulfmarmdlmaaw
IlT6l1FIF|=M"lF1T'lF|lFl'3I "

t_a_1:

manfazmmddamqmh
I1I=s=I1ea: =1I=IqII1T irthifarrawiu nan. ay
mmrqqiwurraqn iIa11a1faIu=1rtkzI%t
zmzmakmmtawqmr aimvautrnmi I
mugm dtzarnvrrritin =i1Zq-'3Hk2I'di=!IiiI
wTau3IaaTraquaa"r?u?a=51FI1a!:a1iTa1Tfav%\i:mva'n
qnta14a11?I13lat1Ta-t!nFaI11TfEr1RttI?TI1| 1a1'
=rr:" aelnqnmmniwcrairaqatmtuadtu
t1rm8I'tu11I=I31:?wra'1Td3aa-rail '2

mwwwwamh Wfld
artammwlmmgaarmvhmqnrrwathmum
askriavannumiumqrmtiwwin
1a1aI3trdrftR1T mmmwmmnaamamtan
anaqavaarauitin mamem mqruiana-lam
winn eftIa11nuutan'=taI:'2trr?ai satma
uiaaratquauaqamtcttawaiiana a-tmrft

|- aU=Iavf!R'r=I1ra-FiFir-=[-I4-azfI=I11a1I- I970
2- 1a1-II,4a-1- Raltztltarwl-|951(ufaa'!111=i'lIu95| itaizqa)
121

arfamtin aaman'=Im=7runrrtPc113Hmam:mtrcrT
q1aa1ia1farIznd1trm=1==I1af#*:It1'Ea1fn%a1%|a=I%n'a8
qutT?a1afmH1TIawn:d1rru5zdT1a=rurIa1' tazm If
U6?I13I112T3d1'3Ta1$r3==I11i111F+EIFI1Ia'dti:
q==:w!tfe1' a=p1r.
arrasrfarn=wrt'tn"
tarwnaraanqfaata-can a rananarranr-11%:
=rT<Tct%na1'ra!raaatrr=ri1 Ii6I1YI'd11T'lTll1E1?l?5T6fF?-IG
1aiIsm6Ih'%Iaa18arrITrcr'r!la1in' 2

fllt

mnatnqmihqnfamawmaauwm
ax. 1tr1I<nf&r1a=c1a-u'qfa1,3'rvaIa=I1.a1?=11a3I?Iv1Iuiu1n
mmaitmtuamaauummiutmawwawu imam
gqwaamwatdam zi'I5tdr.Wtu_I6\1,1=Iaa121r, Fl
nail z:rumena:a=:r=i2a=taraa1aI=x-:rrqzawar-1ri.1=u1a
an! a? aqurrmnautaamwnmin gwzsrw 1?!
aawawfwmansaznmrraam a
(cat, "amh darragaanzsrwr m=I=I1arra11, am
a1traPIaaHr8?r2aaIilaT=Iif aaIu1.3=I?:la-lwuazt

-1- ?a1-awualqurdan-ass-gins-q-n75uTaa1awm
2- =r=1Ha?Tan1IHmI%Iw-avawaimbq-9ouu(d|11g!u'6t;I)

3-gaga-atmrrwrca-mun JG-EI!'lT!~SI,'{-69,1?';Tgr61g:)
122

ant-Iwilarin wcmmaftaauaaasar Emil


3&3
atnfadiramwrdmwarummam 1:?
Wrwmmdamtmwardrmaaiu aa='cTr=rTtI a-1
mmmmmaawmaui at=1rmu1'a1a-tvtart
swarrni-aaa-1a13u qgw maamaarmvmm
5Hnua6mn2!ItrTuaau=1T1%ra213aI1='rum1%7?I VITW
~aaruin=rnnm-maavwn awtnnmmmm
draTa9n<=Im-min aamdianuataurmqatni
saammin anamIa"rrfIIPrrgIc1a'r&?uzTcaEt9wraazncs1%|

2tIa?tmm-I6.TIa%-mvdu1IaIamuT
=rIza-cs-Tritsrawrawarrn uzzdrataicranvdauaa
=maTra=I1arrTItraPamtn'aa%iI i.11i=IdT111a=rIa1=1a
waaawawzemmaaawmrfiu mama
arai-agtaIu'vaqu:tdI2ft%1??a=Iaranua1nm|aa
aaaa?reaax1u=fhmama:-rm=:ra1m.zrcr1aarwn2zin
arIa2trq=ftft=rI1=I*3uanaa'iTtIn1aIRt1tqrcaTiI W
ma=+1a1a1=1aa'r?ara1ataaa1%u ?!I!FI''3'i|lU'HET9l1"|Tvf'5!I
gr I
uzsmzz atqun armmmmiirm
123

main atT2T$1u{II$ta&tIurl1-Trat1umtFrnII1a16=:aam1
in 12r?ttra=r=rnt4111z4u[I'aa1n2ftn1=ra-ta-3-'urra=r
1?-1a=1rtrFa,{[m.'a=aa15imr?t1&a1a1a't=Ii1 reiri,:m=-fr
amwif -EiT|II1?lEIvTl'=fIiI5~:'T1l1=j3'I =rdcv"ra1iI1=Trau1Ia
darr =rI mum: taatnutau am -:t=u1irr?an
mma awcrtaaqaaer =tud"ri'.:I=Ia1uah1=r1%s11t?tI&
Cl1"I=l'CTI iWitra?tarrHIT9'nTa1(|"

=Il utar.uI=lT6I1il6dxIai1"-'Wrt=ITw
tprsiavartriu H|1flW?fTIT63I'TEF17-ITi11f!PI W at
mtu ilttiila-'11!ItiIa1l?I131s1I1T!lar1I'2
i1TFl*1'I??!IiFF1B?lUTlM13'!T3FlTfvHU"ll=l.|UT!T,
ErTlil!J.l1'111f|=l'r'I1I<fIfa=I6'?'rGT?lI 3"T?3"lEF'l'?!ll'''
rm 'tI'di13I=r IETH-TII'rf?:I'-11!1ttr=Ic:c'.'TIl1iI%
=Imtnwf8t4=sfI1i=a'rfr' zrtu2m=nz*a'iI"

Em
mnvimruamnmnz anti!
mamfnmimmawnmwrammuumt it
3a=|T&TI%rEEff:1?rl5tf#9'r151tItJE?3I?lI'(TTFIqT
arafradu$11a1maaart-aaI=rra1sa1a1uaa1T,unWt .

I-maa-azmrruz?-aadau-anqzu-q-uuoqaruusss
2-l|'<5I'?W-"il'-1'35-9Wl!II-{-lo
33-f!=~.*'r=rIEart'-au=rnFI-q- |65|
124

HTl'GIII'UT5IEl=l3.11fHT'?fB'dTHI111I|1'TFiI
nammnawwwmmin aa'l1*rdrrwnma i
u'rt1'r=?ra11a amaawmqenaanvmrtmn =rd1
rrauawtammunwwmmmmuamiu tarmaarua
wtawwwnac iamsawi-"231- quhrqsz
auaraiu mil iaatravazrtdr -115, maaitw
1?5\1tI1Ta1a'm=1tu'trTaImI=I=rl! l1a,tnfGairarruz
H11, ma=IuTa=uIail mTt=r urea-n mairwu
an! =u1t=rmarrga1s1la=Iu=r&IziI'rr=rir ttatatntaar
trait uttrnnaatavugummamaimwiu 3
I1'tFrutri.I anRE!Iz*mta-1'-1aItnaIIurr=rtru''

mvlmmmzqmiwwrrms
mtmwmammtwmwmwmin awn? in
mtawmwaitrnavamwatin II{'1'I=IUTI?III1'l'
?d3#lN1'I:FlI''$aGl11T mmnmmwuzvtmrr
mmmamwmmmwwmagmnmm
in mmwmnqgwuwwawmwmmm
tfaausiatin attaraatmmwnmamvdgnwam
arm! ztarmaatttur:T=I1aarrutRma-ta? 1tt:e11=Ia1=1
wttaiaamhmil nalatmaaanwrdaw
au=tlI=11a=i#a12sttzrI1i-'utz5en=I'a1u~1u1a.I.'r1iI=:I=IaIlT
aItaT'd't!=Ir??wI1aIrta'rTtniu'2

-u- ar=uar- {em an aranqza-t9 :49-cmauf :95:


2- tur!'=IrzawnT-a2r-=I1u=IuI=I-I{-Ias- Raratawm I96!
125

WWW

uaamwwmmuddmmzammaaam-a
mqaiu uI1FIa'Iau31J1aPm39'a1=Iq|qn_1trw'1x=I1t
Ewzxa=1#I1aa=I1au1crn3mIT=I1.aIzEtavnaqarntrRI
1J=c'r!1Ia==:Turaa=ra=Ia1=?a111=nf?=I1.#a=Ia1uiI'a:a nrr
r3I1u1=I1,ud'aza'rva&u11FrqarnttIEnuIa1n12a21uTatv?tI
i1aruTf=Iu=reIdfrcrI%tiI1i-8'-11.a=Iz qrm3tm'HtIa=v:Tarr
nTrt'I!l=II.il=;erGrt=2:ttt1i'I1J:132g{wa-'t'c:u=:21zta'i! iera air
mrrgqwaaruumt. a'PIu=rqarrr1w'r14ameem 3
waTcrTa11=ir=rTmuTwtaIa=11=?=rI.uuzTraawra=FzaTr3v3
Ih1.isI=I&tI1u2r'I1J-Hu1I?=Iarr11=ILaIu~nTtaaqxaawnnaI
!1RI1FIaf11=uI11Ta'fq=iTcr<7rai3a=rI,1=Icn1ruz=IIaT u1=nzav
a mu:-nmnmiu asaramaawaatxamatsava-tr:
awasaanuasaatafai 3-1azI1'IIn?Ia1-Ela
anzmi-unJ-'a=rrca tI%Iu~at=maa=:u"Ir-T asa
*3TTiF'5?H11NT11?-l'!l'EI7l a=I'I=ttr?atwai=cin"'

Hraw awharwalaniu arra1u'awmum


qaawmwaawaaaaa-maravaueuzazawr maa
rrai'-'aratr1'u1zrraIi vavaaaamawmwrin awn
==IIiFI3TTi"11T afrv-'1aa=rI=I1i| mitrvsmmaz
amwmin an-trm*:s1n,au-Ha:ucrrr;a11=:1uunas
aI1uaru1'na?far'&.srI1=IcfiI"2

n-marwzama-arwnmw-U; uunmarwr-:91:
2-!lEf='-I-''l\R, trraafgtu-I;-5|. zu=n1za-1w- 1950
128

*=lTl#:

mqzmwmmamnmmammm
ltiaumzain =tt-aawrtu U|TI-1=I3aEF'fa Imam 3
aIIg_If't!i=\:dTt1ata'Tt!tiI'h1\.'rI111' 3II:!'=Iitla=I 3
l6T|\1TFlf"-?|I'I 6:itwrr'a={$1:aIf=I.tIaI1ta,
iwitmmqnwwlatimamwmava
a1=f%u6rrqr1%'r?;&1-I1:t1T=rtt.a=I3u114a1uti1a=I
8a1a1a'u-ru1au1anarr1a=Irti" mwrqnavrmiu az
a=s1=ua-.=ra reumi--~m1avwawmavg=:eairnq
aa1qI1aaiu"'=ne awmmmaium
EIF3i$=Etia-t@r!1ftIEmiI *ITl#-:3?-WIBEIT Tr'atr
4TI7:m11a1inwn'3=qam1TF=IIi1=IanuT trr1%v3l11v3
WIT ma-f=I~=nmna1iuau11tIT I5~itIIT#{ d-1
qqirfin mwwcguraaivmm
tmwhmriwawmmamzmtiu
11'!!!

wwamawmmmmwmaqm
lI=IIIr-1I&a::fIaan1cmu alitavairadtawdwqt
t?tcrautra'-1131 aft, a1a=md1'ra1. gqumsm. mmiwm
mruituitmii, mrar ;naal?:'a11iI Fmn III
amtdrrn, a=[a'z1=Imaa1. waamwm. 6!1?l'G|ET~'1'Tl', tnfa
127

aftwgai, 1=n1'mBn. 1'rn&=11%=:itrI'fan7Idtwrd=I1aI?T=Irq-I


avmimmay naamuwwmma
wm.mg|..|
atamaaarvaamammmawai
1Rni|ba'r1:I9*s3aa'1!!aTtIn1iI?IiI'I1TiITl1n$
tllltattnaqli aamaI'tTm1uqwFn1vIa18:r=t
ma a=:a{m(qrmwmnaarqaaaauzm)aaama
at-'rIIz=rIu1Ir1rrt:ra=a=1'r2:riu

ntm-11r:

at=nEfI=I'atH.1ta=fr=I1z'eF3I Wmqwqna
arfd-'twr1'd'rqiFaa=rtIeIu1H=tta1ara1%n=nz*as mm an
mwammwnn awnnm-ga1-%1ia=utvrfIra'r'nauma
$amu11e1 rrrsta-"ntns'nar%uc:21=11a'aarrur-era-'twzrra
wlawi-'w=nzar '-an-Trzgiizt-taa8:1tzz=Id-'rn1atpr'
ua=I1a1 a-'tr|nrra='u awrraqurmwwiu VIZ-'-IE7
36lii1HHiElHq'T1?llI313H'liI5!I?I7l?I1'dfTErT|1f
wm1=czns3=rl #1-I'tIr11'-'11'3ral1iIu-riu""

ma-an=1ru2JvIm=ar
aruitrira=rt'tda!a~za*cn1al anm=arauu
mI%a=1tu1%n1%araanaa1vda'kww=fmwuvf1tum1nm<}u
ngonooooooouoocq-coooouononoco-do-jg
n-11=d1=rrazscI1fmura1a1a=rra4aau:n=r-&cu1aw=Ir12:na- -363
9Imn1I- I98
2-=ma=ItTIfI't-t6TI%I=z=1H-FI3==I-I1;-( I959)
128

mmamfawmmumr E
mm. anamaagmana Ef-1|1'I31"1'
il=I1. wazaauvwagaauaw. wawammwaw
rt-n-atlTs3n=r atwuwaarwmatmnaana
mamr-utwmvt an-n. GhIq{I&a1I.'aEna1a'M$l an
GIq,<vTrt'tEI=I=II-1'-1I|1rIE=Ira a-'I12R@PI=rIE gar}:

atfres'!!a1<1e1'a11=In'a1isw=1a!mfr1trf!
awwrmranmiu

WEHG:

mmz[Ic1wu1=1=rraciarau1=rziIart{af&rcr:at
a'trua1a'T3=n'c1Ittt1crrra11a1IITaa1%aauI=wa-Tattrr
va11:rcna=mma1a12mana=nu1-a. anI-nrvatlmrrefratr
maqamavandsamdummaatmrwvmwwwa
in 1FIz!trram:a'a'rrtaaa'aTnnft&I%-r9=1tz'trI
mmmwinmmammmummam
Iaan'a1trrTtr1Ia=Iu'IIarITta1a1i*.arun'nazrIaraTtHta1
aautafaaaalatin amrmmmamnmiu
FF3f=lH'I=I'di&T6IT!TF=luT%G1WlT1tfvT$ITETGi?fi3Ti1
awv;nd1tntfnFuara1.amI1?i=suw=rIait,a12'cI=tI'nan1z:1a
vna1wraita1a1in"

or am =I1aaihT amI=n'nzn m-at-ma 13:15:-t{4ue.dvmva.1=r


129

matwwaarxuhmmzamaqitusuaawx-a
i-"iraicI=I1a-1zrra1rnt11I1ai,favt1t1?=Itf%I31H1a1a1=1at
1: IfrdrrTi|Irnta11%rtu'a7IEIrIHa'1T1%I'nrI12a1FIGIEI
1?'3'E'EI'3rR1!?Eat*ITfl'TT!=Ilf'F1TfI1'H=fIEiit
qeri1ntrTt-aTu%|"'lim1TtI?a11nimaIa1'rIIrl?II{l'tI
mwtmaaa 1? n1%12=ITI't:Bcri|13?t1T?=I'iIIT!t~I|r
8uam2!Ia1Taq=Trw1-c1tasrraqw'aI=*Ia=IaTHrcaaaun
UJTFFIE-ri$Ti!?%?-"lHIl'I-1T36F=IGIEINlT6'J
vmnriwaaamaia 3a1,aaaaa'raa1
amu aa1!m1T=rf %=%U'HIT\"TfWT'l3vTl2

EE__T'=

wraz-1tat=Ia1aaziriarnTrqTTt%Ia'a?erna
:ns11a[IeI911=I=rraan%u1im~1u'r5Ituil ammamawrttit
6113-an-'t8m3Ue1a=rar'frn1=rdTawa1a1n#a'I5hsrwa1tri%a11i_u
:n:21=Iatqw tmmfa'1I=a1.1tafIvaTqt11uT qTr<1'fmm
zraaaa-Tmgqvlmu wmnwaxrmwtzwmdn
?J1IU1=l1!=f.TFIElFa-1?rl!1%l'|'{ltf&'IBHTT.:rHd1E
mmmramtiwaqimmauvuarmmn :rcu=n$T
mwnwwnmaermwaamamammdm snaa
mnmin auvrrla qrrrtainufflawww
uammnwannamariu wqnmargaauvwaazm

u-111saa-m-zttw-c[- eethnaw I960 acne)


2-Traaaa-{a11aa-cg-as (d=H1El-'t'II96o)
130

in aa mmaaqamamin 5l'l'3FPl$f!Flq
mmwniu azu=Ian=1ttt11=:13awx1i1tra=va:m tn
mmaaiu
=Imnrr%m v=fa'ra=f mgmm
i|a=I1mam=3r1rrartfn61. ranqqwawfaqvvgrsiars
uncnazuamuqtaargnumaaqt-maaazam itariuzsrr
ahawvuaataqaqaaqnnaarrzrtawruemt arnum it
nrmmqrtmwmwmamamm waria
tadziff au13aa113izrlE~IiI=11=3TiltnariII'

1?ITd-Taft:
w1112I%IwIr=I=rm:ttIa=z'ra'h't118r;qw
mavr=I-3| Ia=:TzniH1afII2ra\a18aztrTaruT3zruz:r
afttqfszzmu-1IT=I=I1an3z$'rIva=rI=IlzI-! n1ad-'t11r%I=I1as
a=IT=1faa=Ta?aEwazT=rInw1iuan1iEI1araa1a'rqIvI1JIa
tnttauuartatazftaaaairarrai-miarr
<idTitaIiIaNtuI?!1I'N.Ua&qaI1rl1!I1?fI?tI:fr
an-tia-tlT61a,%I=Irrm3u1I'ea=mftIa=Td-1I3m1r!ItqTu:T
Irra.faUI1JaiUu7?trm1im31=1IaGarna1maIrtIrIa-r3
dn'r~1a-rI'u'rRs3u rwzrwcmrnwhrrmwaai 12513
etaarmrratwmaf =m=I=n aammu Fi
wtaetmzaaawnmaqmmmmudqma rra
C Q Q C C Q O O O D Q O Q C D Q C G O O O O D Q O C O O O D C D Q cjcnl

I-1<=d't&@faz11i:azs=IIral tfatmaa '61-1*-Iv:-C;-2:4


131

El, Taiqaa, u'arl'6'ra'TT6I1311laT &'IrI6aa-11u=fr3E1


trrfiu "'
!Tld'3I:

ammguawawtaqamaunaqznuawdvm
T'EH~THIEF'l3tQTl9'3!lI5T|{?3ll"fi13iIT"Ii$fI''E3
nmin tdqilaiqaarrmra-'rm=I.?ruT rm ii
FpaIftIaarr#3areet= zwrt:Ia1t.=1mazcrrdtrnTaarawr-?
3ar!t1'a=IanauaIuira1'=Itaa1=t1auafNushd-Tsr1%11na?9u
4'rwz=u3afIaaarr=rIa' a1'ar'2'|v:!maiN utf, mam
atnrctraara-1uI=Iz1'rsI=Fau:aa1i|" =11a'a=tG'r1113m
it I%ramta%i'-aufrarcunwmaI=I8anatus1araru
mcmwrin mmawmznwuaammmaaw
l!ta1.I%m2fr2fI1'&=Ia1u'natI&trtsatI=11zsv=T6If11T lm
T!1i|''
3lI'K~Tf Eda:
JT' EITL
<'3meftataa~{aaz:'tr.=nau1aT8%r'sIatarIIrrFI1
ur=rIrirr11m?u m"taFr:T:=rIm'f dmmmai vs
ntman 1:-1aana1i,a1a=m:razaerrsumna"E:
faxrin

u- =tr=rzacrrfma1mTa=rrinaawu=I-azu1au=II1a=Er.c[-II1
2-1i==!r=rIzaarrr-aIFm=IEI=I-C;-26:
-3-Eula?!-w_1iIr-tp Ia-|9tI'la?I111a-1"!
132

1Er!I<iT811'=I=Ita=Ir513'FcnT4a=rIzai'.(|) am
Fl'vI'i(2)C4'1J1'(3)'F3"1|

l?=I111T%-:

-1rr&a;aa:1a=rai'rsrftmna-I161 qwsramam
mu, mtrun#aanIa11=1wIftaun111%suaaI$tsIfzrr1tin

~'-m={'.11:

dnnmqmmwmmmiudnmd
wwawmmwrmumrmmqmmtrm
utrm1'a1i1%,anIauaIr1artIm:1'ta&uvIav{u1&arrcfhI
urizrf-'tnaa13ra1in' mi! rnnnvaiunmmwtam
mqumain arra1a'2tu'rnt'a&Iibu1la%aa1:-1a?tna1'n1
waza-Tai,-'uturraw,mrq ammnaztam
tam-2.mr8afta-krMu11%raar1-aarw--ftnan it
mwamarutiil--mtmutniflvwlfm
I-'iTlT|1'EI!T3I'W|{trT5? aamiammmmr
mdnmim 'Ta*m'4ra1dTrri3tr=Iaa:=IarTu'2

Im?-7I21a1a=Iz!f=Ia3Tak2gfaztn=I1GrnuaI
mzatana win n-aarnmtutmraramm ah

r- srazaafraammvmmw-araiiwum-q-423
2- a117,ra-m -|?[-60
133

ammaaaua arrai-"u1m11avraa:ma1a1t-#113 an
await mmw Ianwind1II1aTrdI' rm
Harm. avian-1ilha1-ca=imen1a1.qia=!f-1arrrairawrr
wrawem au r-It=taI1u1aIa1fr1'11raliztf={
aIwm=fr=rtfI"'

;.i'F'5_*.

trtltltfrflftiilfr aI3P:atI-'1'&1I'aqa1I=1
TINI. q1?a'HTIiHr=rII3irI.'&?1a&'n'taaaTTIM=It
immammmmqmmmmwmnmam I!-1
'>tIIm1dTrrI'%|

Ihmtmtmmqwmawmdah
HrahTru'c."atn%i -~-e::rasauuaz.<rrernurra=naa1r
anzwqaasnwwtatcgdal ttrttrn, a=Ia1maa'ft?-Itni
Isz!f=i-mflw-a?T11li=rariiI. uaaa-1'?tIa=IaIiI mitaua
#1:rra2mH=I1T mm. aiztrffnn "2

aza uuurwmzwrrmuqtamt
ttfal-'t=rl!a1va1f=I'Iw'Izir?:!'12'wIua%?u=tIz aria?
mqwiirmnmirwninuqratraamqmudaguaf in
a1"Tai'|=11Ifrwa ttrraaatracrraafm-33175-135
Q Q D C Q G O Q Q Q C O C C Q Q C Q C O O Q Q Q O C C O 0 C Q Q O O Q Q -O

I-amimr -c;- I8
2-1il~'-III-al*5I'l=lTl'lPIT3I5I-if 95
134

1? -''tritI 7:!f8Ta~'rI'u'q1t-I=I'aT a1?."aa~ttr1'aan'I. I


an-arm-traaaamraa H=n'i.wd\faaah1'a1ur=I6lI
akin lattm a1f=111a1=Iarra=,p1ai| 3a-1a1
'-kmalrrain mwwrartwaaaraawrgiat.
aum'zrdranar1{|"'
61'-'I1'!'d-:1T:-l1I'6lrll=I3'T

mawa gnerrarqrmunnazdl
=I11t11(a=Irta-'=fr)a-1in&fwafsm=t1zu1a1=Tu1inarturra1z1
csiinaazfiurarrfarmu !Tl''R1tI'6FFITi?H?36TllI
amram anew aIITii<IIraTarrsI1i.L't1?5a=ITrd-eTr 2:?
BFl?.*3f11'I1TI|FE1l'=lH-f?n'E21I5l1?l'3fl?Ifil'I6IW-?I {ct
:arr,:=aaama=Irtai1'rztInI1ira=I=;1r1tu

IIl'RIl':

'4Tl6lfFIW|Ef?1-'f<la=l-1!l!!ITillIl?l'W=llEF
?JT1?ITI171l1T3i11='f"Gl\1f3'llEI3l'f3P|ffZFlT31iiFlF
aiIT%n$'va1u-I~a\?tu1it5r1ra.nI%nrIzn1. aI1=I=q:
a='n=re=irIrrnaTfm1eIT5uaaa-terranmsTwi1I1Tvrd-TI
aiwnmwnmmmmwtamaafumn aamrra
i1anarrIT6a=rar-1aaraa,aJ1v1,au1ar auttuaasva
4-TiMT?.'rI H1tt=rif G'=l3U1T?t mairawiuaaurus
135

ufsdwmmwmmrarzarmmaammarn 111
tr strsaufaawwrrtttg nan:
s3_mE=
mnaunctamataadwmi
numfrneadrsatauilcrarain 1%z=Id'ri11=tta5erI?d'r
aafi'a'~:mrrr$rina=I1?=?l araril miuur aermaq-a
mndTua1'narra1=na1'tra1f?aIaia:5taismTr&a=I1a111 smar
attima-m ?crri'rvwatIiad'ru1:I1n=I1u=3I?Taitz?a
11f~3I'c':'?<'-IISFIE-1l'tT1'-1Wi?1v*T1=iT3I mm ems I1
auTa1rrIa=tr&nv{a-tn1=v=rn:crTata:nna'rRm11=I11a=I.?a1
iaracamratasrmwaitnamuamnu aita-*r1=H1a
nTa1a-141a-1?c1iuqtvr3=rcrnvI1=tIrIar:aavrtrn=rrn*r%iaatT
11ranan1aa13na1-atanwiratatutaisrmtqevuf
egrarr-rmw1n'tat3u

6IIa1D'I=s'-I:

wt-I ?-IPli?1r6TF".Fl?1T41El'-1lf<-I12"! mam-I


a?I13I

c[a'a?ta1'r:-q=:1a=Knaemf

wmmauiuazwmia cntma
mama-rut-2-Iamqfasravrin titan? adw auf
qrrwwmmfawtnmiuuaaamnmarranf at
136

mummataanaiwaaunwnr 3a-1101 FIa'GIai'f=I1.


wamthmufmaazmarm-dtgatwmqmw =r!a=I1.
aw1$rrr1umarra1acrrx3wz1=I1,a:aanf<am=Irn:dIw$f=s
arm! aiwnmusqrawfaawrlawi au:aa1=rtau1=m
qawmtnarmimwawwtmwawa am-a2$'trrn'
in t wmwmmuazmataanaaimmmark
mmdqmhrvhmwil
IR-'1qT:

aalaamanrrwlaararafautiu ma tr
am=Izsr=rHanfIr5tg=aa1w1%n1%Ia=rI1%az8ur=1uTz=v:?=I
=Ir==Imar3tIal mlaamarragvumnmu 1'-':=InHI-I
ua11iat{naatIwzFar3t=i&Ta1a,mv&IaawtIraTa1
in =rrzar mmaqwwnaimmmmmmnnm
7.-F1~'|1FEI~=liPl3Tr_3'I qrramaqraa tqaitaa nqr
Izmzfarrsraiaiiu Izirrmaawmataqqnaqvawazim
an-auvuaz---uawtaaan~nqw:rasr,an:a1arra11a=z
ar.t':mat111a1,1aRTa-sra1,rtrIEraIa3Tm?fmr.a~fn
am1a1Taa1a1.mFaa'iTaf5ua1ur,u=Fau3nIat=f-3nuat
u1cru1%1aarr$.ae:r-cnwlmaar-:1 atama-ham=nIm=1.
uammwglaarrtnu eaavrurr
md?rwm1tr'manv:fa= m.a~rarar%u-'

arrazIrtaErn=It81!2Ia'nna-er-fa=$tvaaiu1
137

n1anITa=rrarrIfq_aT d-rate."rr!~'tme1'n aanosofdwr


wzattrm mi: =truauu1'mtu=rzt1a=;a1m'-33 lav
aaammtmzmaimmwvammmnum ah"
Hrfrlcrfauzliairiu maimmmammanam
aunataznmin q-'I:uvfwmdmaarrma1ainTIf
Gratin

aauwzaavuuwmrmawuw
satin -'=ntaua'cuanut?a1a1n1anl?rtim=ataal' uam
I-'ta'fI'm'-IIIt1h"'

d'lTdEI :
ju-
mwmmuammmmwmmnm
stain ma=rrca aim-ri:=1arr<'=aaaa'rmuva a-at
mmmawsmrqqwmuawmnwmmwmww
anin mmaaaramaaddmaw-Ewan
zmmrrmamamqwrrawnmvaammmtarmwum
T9'HI'RT3IiT*1E3'E"1'fBH'l?I3IG'Ri331T3HG1Ei1=l
'l'lTl'|'?I1l6hT=|3'l'<= 3''a!i-I~I$t|l1 it aru
wrnts manmmaaazy 3-T :r{=I1z=ru-gvut
rqwzrriiiraqurtraaar ara'r=m=u=r&u'rahwa=a11=
I-I a2nTittftaw:a2-;a-'rmI'"
OQQQQQOC-COG O - Q - P C 0-00093 . Q o Q Q O C D C Discs
n.Ic=e'ta<71%a11%I2n'=rI2a1 E} '!|?l1&'RT<-IEEI-61-11'-1\'all-E[-283
attaawmwmmaiammazm-azmarna-q-ass
138

m_a_nan.
FJua57811=Tti=IIe1sdIiai|anf 3
EIl1tTl'&-T3!-':lT-I. mamm mwmanwfaamzrnl
z'ra111't.'a=u. ma'|e5a1-uqftamafmrrmawn. 1147
mwrdrmauaaasw. !I'stftn'f an-'rn:ma'rcr1'm. an
ummammmwwwaamiu
lmarqun:-Tw=n'ranf
IIE=l1Z'di=r!TTTT:|TU'II=I8a!{!l1=I'i!1'd~'lTa?
Sarw raammmiuwmrqamvrkanwaamammm
iimtqraanarin wtwwummwzuaam
in ='i'FII.W!.=F|'LiI1ma11I'=tI=I=l'I21a[Ra2ilIlTftII
ensqfau1.uTIa1eiTiaaua1q)%4a1=IIt1=nzaarra~1auziu

i'lETWf:-"l'|'l=|'l'l'd'=n'

=nc"a3a11=m nmmaiqam
qmaiWIhHY crrmawmznil HEIFTE-[e wmmm
Gqaerrgavmtnzraujgtrwamimnn
:mtrr8wa=I%=rnI'eraIIaru?tan1Ilaam1%n=1'rrra1=.1 an
arranfin mum? ma-cmmmqu maamm w
armma =n=Hm. wmrtmmmmamrnf
drmmfmauauwsawin autnfmwmfttgaamnuuar
in m'faTIGI1a1T ='1au=1ar-'a:I;1'ntFta1 dr1mrIa1a=I1'#
GI|?I3iEI'Gl"?ll'lFI7lf1. zrtfmrnalamuaanda
139

vt =fr6Iu'=Tf=tI?iI<hGIIim8m'=Ifi3I "ataa{a?tr_
hatrlawrremz-ahrvit mumtwaamwgutd
$HWlTFi:El~'lFI'FI'F'lTT3l~TvlF mawmiqam dal
laiwraiaterasfa-rm%IuItaI?a1%n''

=|T=|I|=B-IEITH:-TT'4'=lTTiT=If

UR1'{I1=|'l'|'$Tl1'~Fftl=ll EIE'~'IlTGHl-'H't?IIl
ahTFIm'a'cI1arravfa%uat=m.'tsa'aUI1=I%mriI =n=na
auaaa-'tI=IIE1raa1a'r!z-=rI"aFrdtTP1ri| =n=nueaam
G-=I'da<':-rwnniai. aawtraaz. mi '3!'l'clT!T=|Ti'lTl?iI?
mcrwwammaniimnrfmmwmmmmm
d!an'aIaII61'triu"2
l4EI1%'El:-11FIF|'l'l'd'Hf

=nza' aamzmmrnunamawmi I
tawaanmaaaiuiaduxaaummza afaaiuaab
mauuarprwa uganan aasatannaur
=r~a qrariralrtttasamuvan-ufwwvammnhat
Wr gain wattmfmifaamnlnhmml

araam3unF11a'tuRHaIt3 1'! n
|'=lT'TI'{iII3FITl|=I%"dT'$ mgaawamiu wrawta
140

aiarrittatt mc1Ia=rraarrt=H.'1=I1 vutrarr


H in =T-ff trans! cn'craai|tIItr1trm(a-'61 W
u1ar8i,antraa1n1a1a1%:"' E18256-l|1TlEI'l=llTfd-'l=lT
i'trl3.il&:--"f*na1iaitI31T=K1rat'a13 13?.
mv aammn =Im:i-m"?
=lE$GdE5 anraamaraamuir
t1'<wla6ir&q't'a1fT6rnra=I1cr11IIfu-1a'{1It=Ias1-3'3: ms
mmaaraammamstam an-an-q=praara1ar:far1-E
wuaatlrrmimiagnawgaanin rlammwit
-ana1tmi1ava=uia1=#tau1arcn'ra:a1=1av:r#.a?awc!atri. id
Ir=fI1ti|1'n1au=frHaHrI'=' rmdarfr atWrI12'=m
Tnmwgdaamm-wmnnnmawwa t7
trnvlasau Trnqntranfzwmr--'1sr=I1z1s&taa=1 ua
if!!!-_=Fa=lGl?dZ$ mwuanuwdermmrnaraan
Ita'3|aIHr$a'm1%1={raTaFIItad't1d1azim!ru'aa 2
u=Ii=rI=If%1zH1wnaTTaFaad't1ta=1tn111t1&e=I1i*,ailaTI
wmgtwaammammawaaaaammmm
am
aammaanmaaau am: aairlraa
mamdiuaammatm. crermi-z1=tra=:fa!tiuaen1r

2. 00 0| O0
I-RlR1fCTFI-l!HI~i7li-E[~27-l'IE|T!i$1'l-I973

3- " " "-11'l1|=lTl'il'Fl|'-5l'5F?|itI -I{- I4


141

utaranrriagmaarmiacmzitnwtnu--'=I1z?a&
cmzr aaqamqmaammiaraaaw ntfuai an
email tmnz-wganiu a1tn6a1aInnIfam=1'msufu1
31:11! aitzsa a-Tau-'-i iITde'I1?~>-EVE!"-'Ttxl|JI3-IllT=II'~'Il1??-11

iv"
aTrra'rw1I%u:- unwnrranf

;rfI<I1'r~iItaefI'rnf1u8t=2tiI1'I=IIz
rtaad-1111' in grrfcmuumrrrrnmadttaimilv
Inmmarmmgwmtummmauun a1'r=11a"=n
13=:1%n=tiIarIin13:a1Ha'1Ttrrm1a1*=Ia-IauzT nan-trams:
matu?aa1a1:!a1a*r37rf1Hau=IIaEsuf=n11an a'1'hI3
wwtmmmrrmammwqirmammm
znnqz-r:rra1ariuaaarznq;1ruo:nmtau-q=nara%ra1aa11:w
1? IT! fterrin '1f=1H:'Hl 3=I6rH=m=I=I'df tn?1I,aa
mtcrrfrraqrnaariu aafaama-ammmmiu
saummmmmmawavmiinmmmmwin

I-daaaarlnw -61-aruf-crlanfnanvi -I973


142

TIil11=IIl-'t=R1fl.'I3~IF. 'naaluacra**en&fa~e, a=r-uamm'


mmammwmrivaamwamnu
ammami. U'Hf=%EFl9P1 tTrt1ta1ariu

T:
aI17=I1iHT:

=nrmw=tmmmvm.H;IEa=ru=aaTmm
mnamtwmmwwmmmwmmmwur in
i'PII3aIl3'd-T'F?11Il'3=lT31I11H3fElFI'MfHfF
=36 anammamamwmniu mar-farqwzrn-ra
gtzwmauataatitrrwwttataarimwrarmrawtnsa
aqgamummfmmatnmawruumaucyr
min ---uaahmairmaa Iaauumaawmar
tmmuzwwrunrazutaarmvrltzmwmaiaavd
awmangrza: $rmwIa1a'iTeFa1iaiT1?zu1tvaa11I" '

qwadtvaavataanaravita arms!
aaantrtawruam astutamrtwin a1=man'-17m-Tri
#11-aaff tiwadwrdrrasaarar, aauiadtfaat
143

ausrair ITFIET-7Tl1f,1*63.1J$I%|'fFI'HT~i3|'53Gl?|TE'1T?113fQ
aT(a=I1a1=1arr1iI??.t-a%:ii:e3nw3$=I1s'u1=sT3a=I1a&u?v5!5
iaaiaaamaa-rah 61'rn=1Iu'tt2q1%-Ia? wamwu
Rntqatzi it--"u=nTaua1=:a'anaa n31rrra:in1=Ia1
aIra1'taq'-1'tar1a it qc*crr~1r3Htn1=a=rm'rSTufIcItra'=I
a1aIaa'ra?a}TU~It3aE':ndTarau1a%Tc%tiua=nau5
II mvwnaraaqnmamananalmmm
lv1i'ra11iu"'

21-arcfaraar-IITI'm=rIzaarri-am=Iar&
31E'f5=I3l|?1tlI?i=lTi$WlT-7f9'fi11=IT11%2I?=ITr at
ag_u1aarrun1II=In1a1zu'awatrnaa-r%IiaI1na1a
f-.il"|Td',6TICT|?l auaiaaamin Wm
51'-llll-l!I=IIlFl3B1a=I'| a-1t,a1'-19!=I??%iu anunu
dvTBaEIa1a'1lIaI amarmmmn mi=fcm1 ags-1
wwhmwm ulzwfrafilaatu

H-ma: GlT|?!IiF5fI'Il'

t|q't$ttHaa?a'=rr:at[r?I,a'e.'Ta1iITw-E11
taatr Mfla-Uf@l?{If'11?T3FFH'PlFd13IilH ah
uar=rf2m,3a=a{a- a-1a|ar-113113: ami'=u=ITmt?a
H-1=runIiu.I112T3r=mfvtd-Ti=ri*a=a1'a1iu3III1T'asrf?1
riu mar aunatmmarisumavacmw a
ra1i=I1i'II1-m11?s-q- 23-uwtdta-M191:
144

Wimmnmcuamaiuawn urn.
atnuiimtauyarquaaranvannin t=h'cr=a=;ua1 arr
mcrazrrmfermfsn-'raa1mrrmI atmasftawmaffr
rth? munmmiu rmnmmvaawaiu rm!!
'J=fITaIiItI=iI1.'aT13{[TI~'vII3tIII qua-'1%iuIIt11.'
qnarwaruamarin Irhzamtanumqammi
atu=II&1i|aaT1a1=I1zsTr1Iz'r uttmati.
auwfam li'f\113=|'I13l[ 12TaftadaTa17n1rr:mm 12:
annunmazmamiu
ms-Ta
h'PI1'd73IITIFlT3,_ HTHTHIRIEHEJH
lgawwaamrmin dwtwsy
mwrwmaadafruarsammr iwrnannmaur
mwqikwmwmuawaamh ah am
umtwannrmaznmmwat 1?-mztgzrct
aartnar ammmmm ra1'a1n1n'a=a'rzz-:3 m-1!
traa-"'n Smtmwaqmaauii dafaaq-vterrn air
i. on
ifanfmuvdmwwrhztwm
nqrmunnmazmwmmmrfmin Irhz
uaIt4Ita1icrn<i=Ia11a121IIFrt=nm:EI'iuataI=wawrra1IVfa
ma? --"=nza w miawrmmafmtaz mum
anaftatiu mmmusmmamaaimmm warn
145

mmmmmaw rn=Ia1|a'I7s-=Itrn':qa1tI1e.ra1unsn
afTI!:aTa=rIaa=1n1aarIuIIwiI" '

=Itcarairun1qz'rcI1um1%muta'ru1aaTg1i1ar
'-1:.-=rdaau1rmua-zarrai --Iawu1=uan'a=I, auma. mwrer
aawaaamngizuv a-airrrd-amagnngataamqmiu
I'a?at"cn=Idai Rmmwmqnimaamuwwwwmm
nvrrd-'r?rrruauarcniI' 3

T2:
l1Tl1.'P-11:

Fnmfmmimmimammwmn
$11?-11p'iu anua1ut1'a1T=mi1nlt"traurit=rvaarn131:
RM araarfawwrmunanwaa
a1atia11uu%z3=Ia'r'=ITma1i|*a1Er:rr8zla1=rt111i1Ii=1I
a1uararI'a-tartatin ahattzammm
wmmmrmamamnawmmmmatdf
emf! T!'6T=I'tfl?trrlaatI*riII7r3l%IP=I'I=l%n\1i'F1kiII6T
atil wait 2I'l$f31'!3'U'I1'l1"l1T13iFfIGT611?!T aarr
mmitlvmnwmnmr 11=I1tra-~.'a1'crriuau-Trirmt
iinv 1'! atar'ra1'I:'aa-Taxi:

'uITta1=Ixz$fI-'-aIant=uaII$tanu11wT

I. mm trwaqiear fl1=.'{{_g151:2'q_%_'tI%1rra-.eI1;9r:3I1ranrr at-1%:


2- iih-Wm=I-#3-thnrwm-ma 20l6
146

9'dv|!l|l'l'3I armnuam adaaamtnawa? 1!-TF=|'i


u!aaarrcn%I"'

anaarrvafhz
$I1azm$@m11waxaaa?aaT=Tn11&1
auuarmttiu
mmawmwnmmmmqmm
ta'wu1a:naaa'ta?uatau'3ztu1i=I1?rranI&I4tu1ntI=I
atamauminmmawawmninawwtmi-s=
i- '3-ian=rr1%ua1tr=r m=rI!f mmmmwar
Whmwmwmaimmmahmaaman
atntmaatzatrnn nail unit zrtanrmitritatan
an-1113:: nriuaruafmaammazavm asanewm
Szauamlrmrraarmuttnnrwtaviairasawatatiu
uIEm'm8aI'3'ua1=:nm.a'aan'Pun=r nlraurrs, RH
masircttfu ataullrrnzff awrmttmanlnwr aq
mmiu Hnumamcrrmuzmmduaamumaamat
i|msa1TutI1ITa1%Hnuvuait1=|ua'31P1tuI1t=I=ra(au9un=1
d-'ta1irI1tartwtrlt)rt%I1rr:ra-*uttt=rdT ITTl?!|\Tl.'
Inwnfmzmarnmmqazmin
=I1EEIa=r9'anfI=trf2trnt1I=I1za3auImEI=1HatE6Irariu

'-m:am'r=nmsutaaqn3=Iwrr 3
O n O D - C O O Q O O O Q Q Q O - Q 9 - Q Q O Q Q Q O O D n . C - - . -1--
147

III? Erwin an1au=Ii-"~1ms atirs-ifzmaa


auaraaznaaiaviawmmma qmtraura-n it
an=zl'aan'ta1ia -- rrtsrc~::tga1 ucm 5lH1|lil'3I
tnttrsnava Qua-r|"'
mwzwmazradmfaawarnadmnaaxa
a1Tw'<kt.wIa=I1a1Ta"n',aimrraT11au,a1I?.'=sfIItaPl
I13a1%w:1vR21n=rIzaarrrfearari1dsi=II1arTzraIn'a
awatarlamwrrmiuarmmawrwraariu W
mmrraznrmtmrarrnnunnmmrmawarczm
a1'r'?Ia11Ia1arrin nf&ta-1aRTmrmz'1=n Wiwm tn
(f:3:a1vwran'rE:'8n'2

azzrnmqraramwwuain an it
umcfdmtitin w qtamawatwwqmin
w{I%ttrr:1a=v!raru-a1azIu%rI=:t=Itaa'i?a1aItaa3TarFaar
mnfd1i'aNTUaaaTatiI"3

EITITE!-1Tl'~'=I'Cl:

11in"-1?Fc'n1ftwtI1a'1' munmumaaa
iai-l=lFT taatutitt-ra qwairwnwmdmm

u-art! artratu-=Tu=r11&41--{=Ia1Uq1a-I;-3:195:
2-rI1'T'caT=rI<IHII'zI-Est-Ilvzaluz-I;-e5:9tI=r1$|912
3~areFfa'=rI-art?-lazirnssv-cg-61:itI$zr}=IawI
14

aIIntawf%|
aaawmmmuamzcamwn
W=Ircsil 251a:-II:a&1ragrcrr=1e8ak1v.;a1=enII:rad-'rux
73'a1uc-1'rz'l't$tauI%u itmdaaamgiwi at
lalitttaruzasah '-11.'rnavaa'ruF4t$!=?.'u'&
=n't =tai.v;a'atTz,I;z:w3rIra=Ie!f=I?uIanqIziIs1-titan
III3tIi?t"aTl1 31':'4H'=I1aaUa[f?arTFI?{a' =11
mavmvg Pnwrmqzamnawaaqiqa GI
IaIi|"'

=n.'rus#raa:=eru'n1ami,aa:9'aatcrca1
mammmmumwimkdmugandqwm =1
annual: amtmanaaqam iaatmd-'tk=4*:3&1ui"
wnuzatiu Uawrilaaar auamnmwt
11&l='#I1TI13'a1z'(T3-a'a'#*9:HraRT1Irn'I'rI!I3i=I
an"?
aammahui-"graham
ia=zt.-'sm=rrI1%4asru1 aau-m.an1ad'ramn.&:aa1n=I1a1T
mmfammwmmmrmmammnm
at-5I1i'ts.dItam1InftI=I1=1==;s*c.1$:arn arfmaaaamwu
t=I=nzaT mqauqfaimma aa?=nI "=ma-I a=m:a-T
a-Ia=3-aa.a=rattrramr<wfam1n21r%n nawwagvww
a=i Ntmmd it atatrmisaaaattitusaw
I-sra17:1I'r=rI.:uaIfI1<x-61-1EIaz1a1uzc[-96. wm-:91:
2-emf u-Imta -nTu=H'r3u
14

laaiu 'a'{1n'aI==1rT. umfauaamnmt, mu'a1'


a=a1'8a=s'?1't=1Ims'2|" '

9'H|'7?FlT?|7-1'lT|?lG=lE~'G1Tf' mtraaw
mmawaammummmaanmamammmw
wauamn 11Tq-I""r.q==1a=Ei1eIarnf.t6=ft1a=:z1H.a=
aamqumrrmkazawttf %11at1a8nw:mu=Im=I1t:aau1d
a1*li1dTI1h<lraTfzlt?B'IfN1|'=I==I&1n=I1ilI
airaaaa-anmrrin 2
wmrrfanmuami II-'tsr5wIa'dII'=I1s':

mtariw t?ratIftw=rraa'1 mlwmd


main wimtaiqdmaraal-wliawrna
amqdtaiumrnaumtmtw 1"lQU?=l!?.!'('1{!6-('3
aatrwn em=aat8arr:=ru'Hna=:I'aa=a:fa't Fat
uaim?I11RIu=tEa?r'31mw1rtwmnItnre'a-Tutwau
ElI!II=|?|TTF(TIllIf*Il=|T*IT=1T?l|T'?tIE?F{3?f it
awhlwww m tnan1=Ia1'=nu=nza Inna
,tm'r-131111 wzznta-T1n'.zd-Tu:Iaurtv:1%s"fmt11%1tra
l3?.'-IT!-"I73-T[d"ll'| zsruacaafaaaawtr an mama?
a<avsIa1Irra1sTaa:=I1dTzerr=I1zt:11T1=Ia,aa-a1aartr
qa=I81!1iHRue%i|tHItr=tt=aIiu"3

l~ I'i=dT=I!z-a=a=I1t-c[-|I7-ft.a'aIH11a1'I- I967
2- Itaaruntlqgnrft-maxatiimn-31-aItmnTa1I%f:-295
3-arrranat 4=wqa=I-azrmhrrwqz-qm
150

5rcITcY<aT3I%11rrr<t=rIzaI t!'n11a-mama
aumquqahmmuaumwmiu ataaramaa
awaksaammwwnaamiwnranqmafawuf
sreifaa-T-'t e-min awwqr ii maaacnuic
vagafitzarrflv a1'a=I19mwf'3uata'nsI"ataHE'=IIz
Itr1'f.Faa=Id~T=5eIa1?1'ruIna91?II?In1%I9aTln1=It1mTtTI
wwrw mlmna a~'1u1a1 31!iJluiI1|i'l?|Tll91"
mavdrutammwmtuan amqfaas
a'awn%rraarasr1=sa1eru:-srnauwaw1mau-rai.af
navdaaawmiu '
Fun:
:N';kIH3'wra'(nEi1'i1t=rtl'-I!1RI6
=rIrmtw=1am=a'r=wcaWI' m~rFa1%m8amaf
urn a1u1Ta-'1?I1a11aattrI=11=aTfawd-Ta'1T1'atneriI"2
=Ita-1 immiaataum-uttwaarqnvvawrrlatta
wamwmwtrhdmmmmmiu mqnaamurus
arumtf #=I&:t-rarataa-'Iz:u1=f1=ri'!I=I'IItmut#zsrsmi=I1Bw:1.
rrr=:x!1=aurc:u%q-s=;1%:q1-a:naahren1aznn1=eu1a1wu1 Sm-=H;arn
amasrraamaumahmamm maaf-5&1 a'+r=rr=m2nmaa
um! aimemarmmauwmamwin
aX8X=X=X=X=X=X=X=XaX:

I-f!=~.*r=I1e1 mmfamram-marlrlau: tpzos


2-f5i"|3?f?|l'IRI!F=lIET iramaas-61-r-Iazx, cg-:44
1 1

* *
*"' :13
C **
************************** m
1: a G U a In II t
-1: 137?! N - am N1. suera ah qrau u.
***'o.***'*************** ***If**
at: arm}:
rrrwaar-ata=1m,aaaazaah:aam
mawwau

ahnavrmmamqanhmqaraln 9'?
erI6(a=:'I9oe.1%I'5=Ida?;'n995)a1ta3ruTau=aTfa u=n was
mi 3aa1arna=I$1im1ant=rrnmareIga1?=Iaua17fa,naaWr
I-"lHl'EfEI%TI?1F|1HTt-|Tl3E'FIET*|?11I =II'q#nau1i.3crI'1.
Ita1=u-1iImIfa1Ia1a=i at man mqmaaaa cm
mwmmmtwairmm etrvftzr gem drawn cm
3a1a'-! azaaacf =,1'urr-11cra1Ia=I|'3aIIT-utrfIa1==i
1Ird'te1'n

"HTE-I33 qlflat
a1'ariI''iI$t&aua'an11%usra11r1%Nn'aa1a1 vdwruava
89-4a=r1'f51'arrfIIa1I 'iI=l33l3$3!|1l3"1T3-7351!!!!
Trtta=Ita1I=1r'a=Fa&uu'?$13?II-11nItI11't1a-Ii! 11 en"
Uwttami-:raqn21f Tll'IaiTlI'a'ftI=I=1tI3.%1GI|J,EYT
nqzaawamvaqlm ad'r1_1zTn Gaff vrz wail?-I1

It in the herd environment thet develop pereona1i1;y",


sir Iilrred rhoneeon G:-eaten (Intel-netienel Dictionary of
lhouahte. Colpilied by John 2. Bradley. Lu 1. nuiioio.
fhenu C. Jenee. 3.554.
15;

wnahrwmmmfqzu wsnwaitmmmaatnm
iiI'I1%qau1rra1|i?rn1IUIrra~3a?fI'uF?I=IurHn1I-
aaatermma a a aauaanawtaaraqauumaerwn a
mazrril taaaimwmil a1ia1=rl1' If
=n anan a1?:at=m iahtt w'=r'uta1a=rr?=1
EITI'FIT1I3.'1'f=tYE3?i!I1'lIFllEl''E1T7Tl'df-fl as
tnuI.'27afwacfma=1=3- 1% a'fiI'lFI6~"l1'T~1|1rl*i'G'l'al
(mega-ndtacrmmtu aim:-':tI=I1uI~-rcWIif&aTI'
'agm'a3tau=Tt'1k w%1iu:raan=:rn1'rIarliv
at-raaruzztvnmirru arena tarmm ah aura
tfcrnttqwdwerwauarnatmi, 'l'tIItI'l'!'Ili1'CFE!
I1a1irraa.itaTa1aa&atin'
immaaanwmwamnm a an--1 11'
dn a=1a:rn=rua-rf =rammrm mmram qr. amt,
mTatI.'Tu1aa1ua1%aT6I%Yra=1&wramT3uI=IwTan1 it
mtawaaan

ammmwu mwl-'tq1=
wtaitauwsraftlarmn dtarwmruvzinaanut
nmadrmamimniuinvdmammwnm Irrraa
irIIa:I'dn :r=I8aI:1rI'1?l1Tqvr1?=1a2:a11tizdT11rI1*r:H=lT11Ia:r
wlatairslaaanfu amwittrnwttaararrniinrm
mummana vrmeznun marr:I=Ia-'Iaa4rtI1=n
15-3

ue.'r.u=IdTs#ts1a=1twn%Ia1=I(qu=1fea1)srra1r1lu1;tIc: at
2na=Ia=Trzfr,u17=u'rrUcrt;Ia:a1TIa1tI%111u1Iint1t trua
wiaaaueaoadnn I93u agaw-rIurI
qamaw
I1taam'r'azrrn11'tI'tra amwaiutm
it armsanun zitmmqamatqwamnfmnmar
mmdaairrmaanwdqfammmmm. um
aIa11arurun 34TF{F'1%lq"ITi!1E<1fd'-1EIfil
1'a'%:'aq%I1aer:FI1u1=fraa1:lIa=IHmIa=Ia'ru'c'ItdI,srai
mm :n1tanaa=iaIaI=Izsd%anwaraaa3t'ta1uaI1Ia1 ,
mi a'ta11ai3area1,aa=T'uH'rrt=wn1c=:'i1 sm111z?|
aaanmamtafqduauw an 3a=m=rf cnt-ta
wimwnltiwaaqmnfu
nIu=Ia1aaa3%.'rc:

rmaauawamwmmwua
Enzfgatammawmm utaami--"iraaai-.'r
#twxwaa'arTuch1uTaIqq1H1T361fera1naa3'T:ta?a?.-1n
a1rIv,iI?n=idTancrl't'tm'u 1?. aaarratim crrq
Ell"Tli'l'!T-ITCTII '13 a1urz1'cci1'aaT7' a'ca'r*ra1." an
=11! m=I'a1%ima=ra*rw1%a:a1ft-na=sa1aT 'u"3 Fair
rmmaarduwaagqnazatmnta a111an1'raa1= aa
tammaa mnmmmmmrmmammm
maaaasmwwaawarrirtwaaauma
mwri-mwmaamavaawuqaqs
=rr91'n m. "e-nxra 6Il'l'1*1-T--lT?1'TT'Tl7{I"3 a
'srwc.a1%=I5I ttr??tuz??h'a'ra1erar;rawram'
ah? 'q;la'6 a1Tt:daUlu'c-srtnwilmttu
mmrakmiwa 117cra'tu"c:'tI--Pa&1n
a==z1't'tcf('rIIaaH=i61em 1% aaan-I itaru-"13 mt-13-3
zz'1an'nn1Hw1=b11aI2ua1 Eta-:2 wrferan :3 awrtr
a=2II=rE'=Iil' I=rc."!| R#trrcI'c.*r3| aramer-1I{13r ma 3
aftrarmammairanmuiu a=urtraran-aarem-aria
a?tT12'au3tra-11tiuItIenzrfdaI&9?~-F$'wIa-!a=ra:aTu,='f
a=tIa1uv:e=Iarrai,aI*is=r=eTwanarrr2rcitisanma=F
asrt31a1mzm=m W3: umaraamwmta
msrqaitmin a=r=rlf afti awmqama-Iua
uamwin euaaas 'er|'aT 'a?ram!1HTsIi?I=:ITiI'nza1
1{IGt=I1TlG13Ttl9f?Hrl=ru!11tIT'f!|-13fvl?al1ati,
zr anamtztt-IzsI?ca~1'al1{I"'
u=farn'a1t1n1w

4r<aEqaim*rI1ah'zs=fa1'r'aI=& ann
c=ra1am'arra vara1Ta=!19l'9nra3.fi:iI'=I1n?stnn'aa1wer;I
vlmu adruwcraaw \1rm&=ru :ra'rarrqErI=I1
utfatm-T uurmtarnwtitaitamznaaatmliv I

I-flW=|?'|Tli3'T-l11F1'i'>T-C[-I40-|4l-Q-#I'd?FHTIMI':WFH9fI969
(aw-artnfi-Izplf)
15E

Wtutaluaittmrmavwzra H=m'lrTT=rITTI'~iI
an-I'ua am '11nqztaaan1q1IaI2aarTaz;-3'15-cm
--"&I1?stzrrFaartfr3trcrm11umIaut3a!cuaTmi|''

Wrmaw imaamaiaummai
aawwtwruzmnwtmuarwmmumaaavra
ammvmmwmwraawmrz draw? I3U<x=IT?=II =1
mam
#r?td-'r=mvcu.a1:

nqanrftna nwrumiwrarrta
an nas qrmardtrmtwratwt arrdlimmn
umvammaamumaaahmatwn aaiam
'f?:83WI?I!1'3=C31TilT3f31'I'lRfF=la1ll7l3-I
u-1aara'rtr=n'n 1%rl'Nrtar amumaaainima
wawmwfmnaummaamin ummwwmaw
anwwudmrrmaanaan wa
rrarnm-'uIrgaar-aawiua1a aaawam
aaa'rI=1ercr\=~rraifAva1a:111aati1faa=a1frra'3:rawa-crtzn
a=I?Irtd1a=IT1'ur%u#11tI=I%favv1TdIT1I=:3u1z3'amT
la11?mr:m'2-a=a tgamzawamrmluaidtm
wan immwmwntwvaurenqtsfitfl am-M was
mtlwann

u-=rIu=maaaa''r - IIIET'I1|l-t{- :42


2-nwaaraaat - tnaltrn -=[-uuacrqa
aaahwz
wwwwmazamwaaammwm
are-'raT&1' 'qrrar'=nftIan1'a*a1a1ma'dn4a'R3tava1=I1ua1n
an? f1R&a1nrrcrsrrTIaaiI=I fa1=IaIm1m|IE.T 3z=n
Stmitfrra-taaa'r.'ri#1=1eu=I1us1I#I1t%1:vaaa'?t=I1:1tu''
aatmerazumzawr aaaaara11a!Nu1uTI1u1u4r
ans-c-tzsaw---anttaaraazx-ti ma r=ua:1aai=-mm
(:asvuz;uia'tn1'aara1aafs=uva'tI.:fra1vatr{ritrrfn
nsazqaamnaaaamdraanmuatavmwaat
aimwn" 2
wmwmamwaw
IIrrirr=r=r&'e1q1zti31:r#4rIaTEI=1Ta=:Iva'
Wm m=Ia'!a1t9rwIfau'rd'rafn mmuimnf
]I'T'1El?Il?f6iTT&1~1G1@1?iT9\{-l13'a1=IlH3Ell?1T3dECI
H-1'ru1=mttn1af am 4T't'rR='TE umrdtu M
Puarr amamwmamnwwmmaalma?
ia=s7r1a1a=:afhfr.3#znrrr3=1.an1?d1q:a$ uafamu
d*rIa$$r1:{tau=u1ttarr=!1tara1darra!:a7q1t:1:r=t1a=I1a1 at
u'attrIa1'a=.'t Wnwmmll
awaamaam
wtrwmmcwmawrauawarmawp
n-maamaaah -IJTBHIFI -={- :41
-e-amtaa-rafl=et:m: FfI'l=l6TElil'3'I-CITE?!-t1'l'?l5"?f-E[-5
Bunk I960
158

ma Itwtfmaqzqrawdtisuu anmzmrma=tn'fI =~.'tt%w


tfaaw mms
zramf mniawmmvnm
3lFll1=Wg11?l1'6TTl3I1F3'Il'.1ai!fi?J1|E|T!}T
umammsaaumaqaamaw enqalzf
Iiraraudaf 'n1=ratuz1=fIE1aatf#1%w'mi=ftatt'=I1=I2sffa-:~r=Ia=I
FIIIFIERJTI 'ilEl1ITla"3=I143alu=1t1iIEl=lEil'-1fIJTii6'F3
'ma117r'amu:1imurt=r=rIraw:1uwI'GI(Il?1iir5n?u=IfFI1
'-1a=I$=rvz1s1vA1Iu=18a1I1'rtrTa=I:ItirI1a '
anarmdtn Hanesoauinamilaau

i"Tr&=nz'af a7wIn{I

3"1TbTl1'i|=|1?!?|E1UifT'FKRIWFIFI=rKRl,"f37l
mmaa awmmvanaaenrafeai anatmar
qvrmvfaaaaarsrwrrrawaarrmmn iurata-Trait
qwmmawgfmmmaqa auilarrwr 3%?
azTitdrI1Taua=1ar&TII1m.11IausaTTHrn1f?1t5%a=I1
aaraun1satruen11e1tutaarsnna1faz'.u=.ta1r,a.1i=
amnnaqmaamrmwamaaawammita
mmdwmvamwmmlimwmmaawm
cum lTN?I$rI'$l?tlI11T-1|1IITlTH-1|TTf36I=l=l!
aar Tmummwivmamdmaha
v1anuae7Iatrrt=rwt12'a13&m1a?fnI=Iwa=I5:rtaaaI?t aim
159

$l'-TIGTI @1atIIUu1I=I1a1 8qa'rntttrraI=:'11u=IItmru1I


4ta1q'Puttf?:ar=&TcIeHav&t1t1'a=I1aT ztrqizzrra um?
:I==11&zn5t d?fFl1=lld=l1'?-I?Fl9|?|13ll6IEI1'li?Ii3~?iT'4|:IW3
R'?HT!'=lW1=l'l'EI3I aawm mmatummm ah
a%IIa1:'u5ri| HER-fta=III11iIEI Wtm I
i --"I! mmmzwtitmm aurauwti an?
mauaeuaaawauncarsuana. ammavanaamamaaa
a=Icra1aI'1 a-t'rurTi=F~iP! =I'tm=I1%tma1u1,a=I1'r
aarwra1'.mrau mnaammamaaraaamrarn
Jun rltwraaflatnliaalrrt am?-'

Wraru'-?=trcaI %tnt:m1'&=r31ia=!Pa-m El
F3n?!ta=t=rmawuFIIara1%ua=IT9nan=rIzn18rav1Im8
Umit 3'-1aIam=m'vdma=rn5rna8. an was
m=aun=n3vqa1 main 1iIamrw=1=Ir=1fr-manta
~:II11mi-"dr-Ira a1=I=irqfte1Trar=fat!IUtI-'-ta1?nat=Inrn
awmwmwmmmmmmnmwi ah
5aarI1'-11 atvam'-naIrqI$'a1ugawTd'r%| a=i 11511-I a1
wzmeagadlatlttumatrtiu utimftm mm
arr-=namvu tmauitmnwwarfgimmmazu
marr3uI%mn"'

wltrtaarmwtaruwla
tmaauimeavaauaaaafaarraamttmgn it
I-ttliaw-zu-q-1
2-ilaTInI=n-an-1IaIa -cg-(ai)
180

1aI1Ua1n(rztltattI1IfItr=1TIIira~tua-Hi: anftma
maavuugamnn fmgnravmmmwmm
avimmw atraail Qrmnmmzdm
uhnrmmimtwtwmmammmm
aisrfin =Il134111NrtII=I11~a==iu=IuT:\Trt?c:au3"1r3=rIzd1
rmnmatttrilmin aewnwmvmwma
"1NT3F1'fW mmnmmwimamn
agar faiIIIim=aI1?tt'<1aI%rd1wa=1?aru11umaa_l%ia1GIIPTnI

ivitan-1rmzs1aarm-xta strrrltranaaaum
,uu1faa&na=IaTu?&a1a=I1uaIIruIaI9%uIu:atIr<1rfa:sa1:2f
mnwnuaanlavmvuruntvmwrmiu

=rra=nza1anrmau=.'raazvaa11ma asa
mararwmmaatuiu aI=n1n a=uT-wind-1
!rati1a1traIn'aaa11'mula amanauaarmaamiu-"

Tfnwmamwmniwmwwiwr
mmamami---ammum 3 mmam-man
awtftrwumriu *T||?I3T'=!~lW'lHBl11:CI'-'I8IIff=TlE!$T
mrin zrrrttttawrrllavnna-"raII=!ftiI4t3=rIz1I-faIi"tn
in a'aqna'iT<lIa=I$arGI11aI:radI91n#r9Ib1i1II'2

u.taI=nn - I1-45
2-1i?r=rrcaTr-au=rn=rI'-I r{-H5. au-I95:
161

9111313 am=rId'ru1a:

raaraa-1atI1a1%rdv%=1'I=n&z1azs=tIa=I
amnqm vadmawncrnmuwi chum-Iaua=n.
FITI!n?3a1'aaE3a1ItIa3a=?q%I mmrqqaawa
mama aHIa2:natavlf &araaira%a'h'm11112n.
aamaamtmmuaaaarmwi mngleuuramvrfu
anIal-=I1t"l war-1t1'aPau=I=na=In=IafTmma
arrmn

mmmmaivmaamarmaamu
37f?1I3I'l1J$tqElllElTFlTI'-lI'lFTI{liIIi1 -ElI|I'3Ul,
--aTaIwmt-aaIlT3'4aa1:rnuTna'rTiia1a1fi! 11%
ia?ra1u,=:iaaalT1#'=rarm1 aai,=r1-a aw
rtiu aTfd-Tam =r1' a=tHaa1II=aaaa=I=1raa'=I
u1"cf_u1a=1T atauartcnsruaura1-3m-=rr:re1iaaa'n1=rqnm
FPJT W3 H|'%3|1I'?T3 tIl"-1d1=I=IIE'aTUtlWT-Ii|'l'l!
1-atatladdtmaiu ai Rrrzmqdf el 6'1:
W-'I1t1'raT1a#- izqeniltnutfiavai
IIain"
=1ra=Hnu13111uf mmmwnwd
1! aaaamufammn ma-'iaIrraa=i samilnzzn ms
arru=i au=IIuI-"'11tralz"t:ma=Ia:1affzrI'a11T13lvr
162

a1fIiaag?:aq=rra1iaaara1=:s11a3a1Iaa aiflmi
taaimmmrmmwawmmiarmmamm
Trv.=I1n1r$tW1ri|"'

=1r#d1aaaraa'atw1=IT%aTH=rram
'J3'llEiE'f agvawlai artlaw-trmi-&am28==n
mmamnwnmiranmnwumaumio rmrar
am-H wrarsgemrmin wet Iau't'IaaIaT ehrnnauaita
HFna=IiT'i4I'8a1aamI-r=rF!Ia1i|1r1adTT\tr ET!
il'?T*1fal1=ITEIIiP1'I? :ra-a'11'ua!1Ieftu=rI=nn"2

#'r#as!'ttm=rrI2:1 uaragvritm-Trilr
aaH_rdz=r!'I mu a'=Id1dPI naant-r t1't=\=I=Hm|."1f
arm a IE-a=1t{c:eI1rfHru1tifri't3uI4aT, urn
6lB'"uI1atiIa=Iw#rta1IfaTarrrFIr=I1-aaazi1sa1'at
imam: a1'a=It1T=rH3a'-nfwna at in

anwazamagamnasrammmaa
'6!1il':FIl\1'.3'3'l'<rf ff nww aaaiu mnmra
=tIz"'s1a1t%I1aa6I%ruawr2naca1quf<IIaasMt=lr8Fa:'tiIa=I_
tirwlrin

-I-=11za=rrrtqvII#?:mia1aa?rz[I'e1u-Iaunu1t1IaI;m'
I;-2:4. am #1950
-2-1'F=llZ'dREI'T:GlI=l{H. E;-H3
3-611'-'-I3-TFIFI -9&1
163

wmwmtazaravurwaqax
craiu mwmawummamsmmwnmma
aaaarem-adtarmaazaa u=I!=IiT;an'-1'ras'-1'tat!HEr
aimmmw q1a1u"' atauztphmw am
mti--"at=tra''twPfl aiclearm-Ranwazrma
--atm T1p:.'au1iv'aatIiranuTa1I" 2 imam?!
11a8ar:urtt'w1zItcraI=a=na1araatanrrfiu

6lEH|"|=|iTiI-'f6I9P au1zss1rrI=a'R1&?I1t
3~sI11'WJEt*t2H!l-'t6!TE|1tiiT31a=lTa-?I"t'l"I It-tI'anga=I1MtI
'Ih=taI*rx;mzsrtft1n1a-Trrni--"r'!t eanw it
mwmmtn aatrftazawlluia -r
arraa1i72It=1ftt(|I1arrIaa=;faIIl#fti7i|I1"ft
6E7[<1fEITThfl1'FlE|Fd!I'4T%f3T(iTi'-'F1T3lITi3T ah
mqrtezfaa-'rau=trdTaaI1{I"3'ua'ur:aa1ttt[t?4aa an
a=aT?uzrerqIa=11a1aazrr%----?<aIa=I9a~maa%wa-rrare
e11'ra=Tumr<anuwEIaI1ua1.ttau'R=aa=1zterzsntacpf
!E1=rr=Ir(I"

imaiawtawaamutm in
u-awm-utawla. ahtgm-I1-:3: aazf I958
2-m1-(mtrmvtw-1mm)-avfdwmtrq
3- aF!=I-\{ftIait-I1-4-trfaafnsss
4-men! - If"-WI
16'}

asmawmtammarrm-4r-a-113?! =IIuR.a1u1aT.
qe:1a}rm:n'srwfan1m-aia=aaamuaa1naawa=zacpra1
ammma zrtmsau arwmmmziusiauna
ahquamahawmmzain 6l'l=IEFT'=l'F1'=ll<'f'c'itIT
qfartaaalimrh-mfIazqa=wrma1wm3
uax=1%7F1rtsB=1crIvr=:1i.tt&:a'Im\=i'I1'ta1=Iain mw
ammndhamar tiliawfm
u1?:u1=.'-1&T~au#qFrra#r1fer==I'I =:1=I-3a.aua=ian'tir
a=Ia'ern+uaNu:=Im'c"ha='t aaamnr uwrcreariu
ngwmmitmzdamtmmum tatm
tamdmaaiawainlarwmrnmtuam Hi
K-'k41'rz-re=I1=r6a1iu'

i"'=1tatI'Pu=I.'a-l ,tI=I1a3an,a:1q:ari
maraanwaqmwniwi maauifmitrmamnmw
TrI%2:1i'n aasaaaeaacrn wiimm. a=mam=-was
Iavmiu arta1naIv17r"=I1nat1\=nvta=ur3~ra1i-'-
a1T'm=1t:raan2:anwftarrvam1I=aaa5xIa'c'wdu
a-Tmfurcamwndwq-rrarauavnizara ~'n'rfaa'IE-flu? aaiar
tarwmammiaammma-utahmmwvumwt
aalav-mminanntiravmanhqaawnu =I
Wiwrt mnwammmwratamm
'-'l''-'-PIT aura!-Iiran t garrmaqrwfmma
165

mmwm aatalsw-"=11 31EIartn11tT%?"

mawasummarwedtaraauawfmmv
tms mwmwuauaairmmumm atait
93lGIE|1'f9!II?FI6FFl~'1'-1lT*!'33IF-1T|T'f9?Il 13138
vmmmanaaawaammn msa1'r=na1maIarIfa'w
r1tnsIvnTa%a1w31I7s:=IT#u1a-agTqamu'cIrI%?I97!fuTta
vara1T'r6rn-'taI=2ufe7J1|111aaI1a#a1wITqTa=I 'aI=Im
awzrlilatlm

3vn1=Ia'aIa11frt111muTrv3I3=I'au=17I=I1a1
nnaualzzfftwmmmauawruriu trau
ma? 3N;armwrn1=Iaa1a1v!ra1=!ftFru1n=I1d-til Qua-nvn 31
Had unT=I#:!at-.Itf=I1=rcu23u mvawmiwma mm
i-'=rI=+=1arrt:1=rd3U.wJa't=rra1iatan'IH1?rr=r&'f--at
=IEu'iai.artau=I1? aa13|"

Waaaqmmammmuatadn aw
rm? 1! aarmu " w1'reII=lIr1I=5Itta6l8crfa
=rd1 1?: TIl1'ra?rtI3EIIlI"txT:I=I&'4r=I'dT| Wu-1=I=3iHf=I7$
um%u"3

I-=IlzaaIFrqvr'!1aIaaa1TEfaau-I3::.g?:1!I13i_aaa(6
2-an=Ia1rrI=I -I;-4
-3-nn=aa-aim-malwm-=9nwumsFaa1n-an-atnfin
tint;-I40. M1-I111!-I01: I969
166

drtu=w:1t-Iaa=I1Ja1na=I=I1=IaTc%tm ?HE"l|"!I
chanmw I'''f|T'G|?Tl'!1f|'=|lT-l|'I7=|'3T3P'dFlTT
mma1am9azmaWraaa:rmnmrni;a=farr-a1am
a'cuTi'.U=1tntu'na1u1a=1aT|lFI3I1H*at=rl1 mum I
=m=mata=l nfarr=Ia1muv:sa1'r13tn=Ia=z*1I.=iW
8=l%3"k?3-=JFI5l11TAG=lI3|'1T9fR1=I6!11l'iFI1f'33f
t1I11af.aa=1rit@m=rtr arcntm

rwsw
acr3=nz'a1 trqma I-ltdrwalaarrsaw
mnarrc-in mnhtawwmmr W =n:1s
8rwuTan=I1na9aEf?m1i|--"ailxi mrmmurw
im aasmail manmiu ma. =[ma1mia=mau1am
maxmrqscra IT?ti|'' =IIZ'G3.6I=lT\"l'\1Tu!|-TiaI13'4f
ifnz1ava!a1i=Ia1uTuI=II7:trri|ur=I1#neh{Ia1 it
a=u19Ifruri-'-irtwarzat mainmtrmw
utaEI11E1:tN.13ii'u%artttIa=r|!f,1?r=I1w=I?=I? if
a'nz{r=IIz"fnr3a&:rcrgaaTi.a=IHrurtwd-7q1a3arrr=I
t'ta1Ta'-I tra1aqfHarau1a=In'h"2 'q1fm8a:i!21crT
B'FRT3lEf3!E'<!Q'Hf5l'=1l1iT-l|?=1TT9'i.'lP-1Ti:

1F=1TteI'tTand1t7t'n1at'3*IcrI?=I1=Ia11{I
167

ummsanw iaat-anirtaam-wzm
teivamam maatxwnmmmrmm a
qua-11-itzflttiatin mmcamarrwrrarivala
mazaunqreratnf-r aelttnin aruad-'ttavI=Iatc'ttat
aiaiavmftnmnumriuaaaniwqam Hntazit
aamwnwmwewmmn tn=aman=:tm=r It
E,i1FI11f6ITTUq7H)=THU?7!I=|3TTIE'l"'Fll|'IE1'G
3'ra=I aI1'-1a1ara=umaT tr1'ITi4f#uIi:tRT an-HT!!!
a1Iaa?ri|-"Htfl'a:usa1riTa=Ii?sa%1raa!tuIn1uIHI11=I1i|at
maminmmaaamin Gun-tuq1aarrwa1IwI
-WWW-mmmawmwm t.
mmgmmmwtwarnamhuwfmm
mw2=Itarla1ia1aitarI5| u1TaIm:=I.FI'nmaTa:I=1 1?
qarwmamuuiu rmatsragraffrmzsai :9
trTaTn1I\-Isira1'Tauual=I11lIr8arnrruTarlla:t? a1
m-1Inasn1 aataa1fh%rn?a1an=tI(-1d1aTwnta:atta1aT
ia iII'a1unIIfrEraI?rI-1I=%TvR=11I%I!rn'raq=wua
mm wmanuunfawnaarr aruurtzrttqj
n=wat=r1' trrcrmn" 2

mnaufrmmia t1ra1IzI1'a=rra'-T
atIIrw111ar=nza-t1?=I1i"1Ta-ta1%Ia=ri'raTIi'II8tai i.
tI11ia:a=rrvu1~frI't<:rsr@cne'rt?. =r I-man Uwafram
'4fU'FWFUT"lG1=lTi1FI--Umlalfaqa
Ivwa1%.'-aartaI=a: gar-:anH1*eIrr3g=r&I%rera=Ia1a1
7- ' mm ' ' ' '-'q'ar'r'-'q?9' ' ' I935 ' ' ' ' ' ' ' ' '
2- f<NtrI=l - Earn C];-I3.
Iamwmada rmuratn Gaawnwuwihrram
mm? ruuaiwtmwntmtavmarqaw an
qrrartawtfu m1ia:a-tm=n dqaairmaaananid
u1maa1a=It in fa=t9u12mtada1aatrrrmi.I
:ra=rt1'tIl1HIa-1=%ta1flvn saaw-mama matm
mun aatqI1d1=Ifv13=I'T9!h=I=ltai| ta mm
aIiF-nv.'=1tn'-IIa1t=I"'

Nwmawmfu atitew
nmzmanaamtmwaiwnaiuamzram
lnnmausmis Numnm dtnmmaujen
II"|'l'=IaIuiI:r1'=ri'|' cre-?u2=I1a1T-II tr=I'd-'t73tl\-I1J7'E'--'
uuna1.'&=Ir=ru'ra=a1aa=1?aIvf! walamfenim
II-1a<zz=rl'f| qmmarnaxairmnmawnanweraqs
=rd1=Im=na'fau1=I1r it iaammnuaainm
arIat1[flrietIa1z1t\a11=fr.v:1iI=I#a;a'rrIrmr1t.t1uI1t.
trlgztr-i'ITf=I1=I=1TIT| if a=r:raI1t5\1tI=I1Is1=IIqN=rI!fiI
nrrtitmn far-3=Ttaah1n'aanarrara1i,si9I9ru
ia?FIHI1aI1wfi|3an'%w=l'3.Iav:wa'rrTt=rfr
%a#rE3aTrIn1waTarrma'trwmrmirauit
amaaimwiu--wlnwamnuiml
aunarauqqwmwmaaamm armin
169

1! wI=H=3ua%a1tI''n=r=1'if its TrI=ifI=II1=?3aIIn URI


magma-aaza n1=a?tsnaa'=I'l up In mama-an
I'+Icrna1'?rEsrrarIvIa?rar&::2:arrail$Irt1:tuTr:n| GT
unrcrrh mat?-1ta=i enmr aTuarnRa=r
Ima11ivs9?36z?udraq=tta1amrcrI9Iteir?&a1'{;'a11aaTr
qmamdr 3Ea=::uzItflra'1Ta1wwilIa'rt1rra&1%iP=t3H1
1'ti'r=11. utaanwrwu adnaaraatwtaaw
qmwimmtudwwqaairnmintwf
ammmammmiwmw in man! mm
aawmrrammmwmmwmzamauta iwawxrruahr
a-reuznaaaazmaw 3.5131:-r'3'I"'

'4.'P'd?'lrEFl!II11'l1lI'n't1EI1il=I11iT it-IRT
GIT-'IItII=I8PIa-T-11=Iarr%H3I mww--" turn
m7m?ua=41au'r-miumuaa1=riT.aIi==1a=1rwga
qrartmatin vawnamzrmdrpfma
am?maIaz=:aa1i;ausa=rTaTrtn&1aIa18,mmav3.n1
ataI=:Iirt=avIarrzr8I%:l=IsIaI""*

Hwmimhamnmmmnw
arnraanw. azutmnarumammiu
=t3suaia3t~'ta!#t12uauam't1itaa{av'

I-m1=I -IFFIT -[-61


zzaawlqlvrm-waaairqma-a9t1g)8t'Ia'aa'
1'70

marrmaugfi:--'s+'raqIa mmwi, 3
aaJ=aa'rr?,aTI%I-n1t%I$aI=frttargaauT.n1=Iaa1aTT, 3
a1aIIaaaa[Icer3'?,=Iu1i1=:ra1e?ti,=11tn'Ia=IiT=riI
&a'g?II'=W:1'r?| 2utvI1f?t3Bf*H'I=II'-1E11'.la'Y 8wI1'=n=I
=:1T.m1aaz$srr1nrv:rr.a?rufTaIT&91%II'n1=1z1Tua=Ia=rIrt
a'aEaHi1'aG1%1tI1%I'aaI1I" '

|#rilvrIi|'?Ra:

T14! mwmwad aasuaatxzv


qfeuammnsuwnwzranrfn

ammaqammmmmqm d'tqa't=1
T~':I1'-'ff3:

- -Wain
- - - - lira an art: 1!: WW 1311 :'='ll1l~1H.+
O0.-O-C-on--Ono-O-Ono-O--0-0T
| afl W61! I928
2 wIl2m'-I mantra I930
3 an;I1'r1r that I932
4 aI=I&tIuIn' mm I932
5 tImFI=I t?I'auI!s=I1u I934
e marerfaau q\11Pns=rIz'5 was
1 I'Rl1=lN'-1! 9fa11fHE=Irc I93?
3 91'!ih -" 9:93?
9 argfa "- I94-O
171
172

I ' ' ' ' " " f ' ' " '
mfm Em wra
Q Q Q - Q no

tm I960
mfm I960
Wu =nfa-1 neeo
fauaa =itdi ussz
-"- I962
-" 1964
Hml W79 I968
trftu =12": I970
-"- n91o
-" :97:
643

45 -'- :97:
46
47 wwmaam HEW #11! J
48
49
50
173

fawnawufaa Sawwvmma
ta=tra't1a=1tsP1%uqaf,a=:uTannwurra"a7arruaw11tHnr
aha! mwmiu xa:w1a=:ua.za=Ir.=3n1tinaw:.
qmmmaammmaahrmvmmummwwah
armndl -I1=r'ta=mT mrlaqathrafmin 318 RC?
w;11~'-'rIr.qa1it. was. =verzm=ra1fI.'taT=trraIr=1Is11aITa=;
Rl7GT9RI"!E'iI WrI Fddum 1:1
e1a=ft=1&ia:FImla1@rI1f%m=1waTamnau
a1anum;wasavmasawmnaaaa. a'rwaaeftt1raa
lits-2iaIu'nv3anT11=R"rriuTai| 'TIIrw=I#r
mmyamwmmtqrarrwmmtn awmu 3TEll?J
Izccwtdta-111%-111: =c.'Ttn1'l'1a=i?aw\aI=II1'=1'q'rtft1FIn111
qrarrsrc1=1rzIIu1%t=nrFI'=rIt"=suu?u'IfttaI&catnar
ttawaeaaqrqamru-ur znqsz-ma-azna=:ta1a'r
I1=I?trEITI.Ina'EI1:.Im'atmrraIzraTi't11zcIFaI'2tr|
a&1urtfa9d'n'faI'm1&a11#ntIq;uqaiu mIa=IH,1at=1
qiII.I!IatIn=I1.sI1%u!aItIi:=tII'&=IhafE:I=ImIaff 3q1zzm
tmgviwaamnaqdahawraanin tn
dlnaff .w'=IaPaT,a1I!'<amIai=7I?It3=rre*es'tnr4atrrerI=v
waamawmawu Uaauaarmaiara
in wimalvmammatl ata'<;ran=n:raann
unnmaani r-armn=rrcz=Iia. 31%-=It ET ma
mmnaimuemi-'-ammu
174

aawittmmummatwaawnditr
it arrau

Flittirlwz
vautw ifaIu'-1t5'mznai1In'r
i11111'3l-I5lI6ITTU=RliT6|TEFlli|7l=l1!TT!Tf11l

af
#4Ym=1Tt6frt;tau'afaY1%rrri-ma
7flE'l|311-T"|1711"3Il3FlT!f\lI-3Il'3I5IlFI11T 1rcrth tm
mrnattiradaatia

am i! iraalr.
arm =1rra tam:
ammummmn
ah trI'=I=IHI1'q urn"

tn irralilazmannwnaannaa-mud
at-arartartftu
mam
nmmaanmwaaawmmiir =1
C C Q C Q Q Q Q Q O C C C G C O C Q O - Q O Q Q - Q Q Q Q Q Q c Q Q - Q
1 7 J

nvrd-'r1'w1=I1a'tsuf2ntrai'rg't'r=1'a'=:=I13aT=I'uz1T men must


an-irtau 3131:!-"11fITTI?J1.;a=Ib'taIa!aara1v=a1r
Tn: Wwuaamai =HrIza'f #rrmamT dHr3I
mqzuam mmmmmmmwmaimwaa
maamawmaazal u=zIntarI&*ITr|"'

Iirnflrdragvman, qrI%a=n. munfm


amamim wtphaaqnmawnmwaumz a
fsazrramt 3q::~tarliI'at?| rrft-iriaazrmazira
ta11FltlI\1la=I1d-tIEI11WTl'4P=I1@r!iT it me :

a=|a-r=r=Iu=Iaw an
an a=.1=R.' art
m nu mm W! %nv2

mmavaraaaraa nd arr
ham urt$rrFaa=r'l't9wr:maafa-ravats:ua%:
''Fi'3!ITlEl'lBITG|TfrZ'li"fTIFI\E11'?fEl11=I
mimawamralmmamawmm
.---,.I5J@wJwu23
u- a=':=i't3 ii?!
..................... -.
2. -0 I._
39
1'/6

3#l3lI"ra1II:'rtfT:3IT1%21rv'1I'tia1'ihII1=I
=1='<auza1a9Im1aa1a1{aFr|vw8IP*IfrrIr3f:1qwr
=FiI' a1trra=ra~1=I1aa1u'iu a=I=:ffaFa=1q:u'a1Ita:faaraT
rutmwrwxriimwftawramrruenlwm
ifattmrmvma 81aI:ra-=IaTiiI"'

mt mvnamiiwram munwrw
Mimi: a=e=n3ata'%ercrr6I#tIquIa1IIanr
d'h'11=J1|

ii?-I'll!-I

Ta 4td1'rII<.rn11Ia=i14Ta1i=I6aaI'*3I
?.!'-WTT?"l'diI'('fElT1Ti'|-I vtaaria mrmmmwam
Suiaiaafraahraaa maaatzrqqaiu
mama an:aaaamaavn'aq1=azm%.H?I3'w.I%r\.:nna1
8sri?id~Pnan*e:ariattIlT 8rfH~1I=rT1'1=I1I a=I3fauwqu
1v:2r=sIaITa?t1'aIf?=I111=Iffv1a-1Ta=IaT!I=.'1 tarrrtsrqas
EITIHT3:-'

-w-triaunazhuai - am nmrrznud.
Infra? atza'na'l'. an! ?2n<3I=!IlI'Irl'
mngrmfrrfi. H-11 an aarma!
u-1| Ia-cH?IraI'r.ar1Ta-rcrr1%II1n1=1a1I" 2
177

alt?-'ITrI=I'ma1fIa-1!Iti1Er?rEI taaaa
mmtaa FIaaflHr?1aIrq-:'1t $rtrmrri|"-'
wwwmmawwmamntaaiitw
manseueaiu--2 ammmeammwmmmma
guaytia u'=a1Tra-imaa-tla'm3w am am?
al1"=I|1iTF?5GIiTE3E?l6I1'43!I?131113:

~a=ig:rnarrv=n-tr, :3
q1%fn1=IIIia=Ia1:l=a1en
I'Fll'5'FlGT6l'l13,=lT'l?ERii1=I2iTaTl3l
qnqrraiaausti. awsHII=n'mrI&n' 3

___.'"

mmarranuw ia13| qm-T


mt "wiuwaw mmnmmannramfr
alarwwummdwmimtauerwmarrarr 3
1vdwd'rahTrnir'tvFIwrT:r:ruTa'nwz1=Ia1'Tdr

'mIn-1t mum
mnrlmanata
m-'U'(T1T"lTT
GIF-Il'FF|l' =mrIa=1r
178

Ema? :rs:nnrt|"'
=rI1'rsI"l:ta'II='I nazamnmiu mmaulhf
uTd1"&~?Ilil'iI7t6I3aul6IHI=Ifu'I?|' 2

ngiir tdtmitcumurrrdurri
asrrrmhin a1=;ta=1aa1au'-irn-mitq=c ='1lEFlF'l'-I
a-'rd'riI"3

Mwnwmmawmmi
amnmdwr. an. wanqqammrwafaram
If-IIi*|"

=ITt'taTmsau1u'uaiaTa1qzwuf|asra3a
uwtamrrfin
'1: ani aiawi. Ianiaa an
In mi! ?rt't'e'rcT-Iri. :n':n' i3'na1H,
gaagaaiauaaq mmam am"'5
mwwtarqn-Ira it?!-1=rr'l'tnNafgvI-un:=a

I
-mvnm-W -cg-3-I
2- -"- t;-2o-I
3- -"- =1-as-3
4- -"- I;-75-4
5- -'- q-92-4
179

nluw win
en=FaSuutn':

a1{In-1t&2:tf=tiIB4'rata=I=a3quu'ramIT
mun mammmmwwnimnmmmmm
tmwwfaauwmail W aEmaITlTl=l3ElP
marwmqfnmwmmmiufwnmmrn
nae? wmman 3z=I1:m=Ia1?ni:Tra1i

:rr(c=:=ca1tmtrg1tiIia11Ta1aI?
iicrtrara-1=I1;:2:atd'9n atrlman
amar=1rta=MramI mar arran
crranmcrnfrm mahmi am?
Wntugfufmmraauaarramrr?
aIti'raEwafmT=r!TanaI'3=I1m"'

:rcmu=ITaIrd-|II1trI!'tiIi$1Wan1a~tiIt?=I1,
=r3n1'rf dTd=H?=I1i|1rtr:m6ra1|anavJIttI" 2

llI?.1I5l:
mi! WE ncruttarwaamzvin
ualiarwu-rdif in Fi mmmmmw
.5 .=Z. 'a'qZ;}} I '=}.'5; """"""""""""" "
2- aI=Fa 3 III! In - qo 3|
180

=r4T I, mnti-Ewan? w d'r'r=ri'f| "Imf-1' 31113


w(aTa2f)maa?TaIa=Idr3aaw,I%Iufi atrlaalgrail qza
aII12a=Ia#:w1I11r%a}ra=Faa=raaartIe1rm. 6191599168
tcuaazmti a"twsm'6&{u 1-tn "'

anuvnf frmuuiatgammmizinm
rfzwrammaatfn

"-|EIF|1[, aasm, 1'I'frrI2ztaI=i'nI" *

WM

m mammnvamawnwaaqmf
trim crf'tmIaa'! mmnmatmwwumwiu
3I=Tr'3't13wIv=c11'ta6=rrdri fa
wz3ati'zn''a itwcv. 'iz'Tm1az1.'aa=Ia-11'2Iart' am:
tmamfaar mawaiwdl 'aru=ra1art'
umanaawdwvfatrwsmtaumltrfnmiu utaamaaarr
t3r:?r.c[l't{gt=rrc:m trlurrzfiu msa?ta.msana1u. var
a'aa1T.mirrm.vavafgaT arazscanuws-taiaat Iarrn"

rlzuarrtvtr-axaaaftqma-!awm{{1i;ao;acu
181

wnuwawmnzismmwlmwrawrwu
i- -aaaum1waunui1=rtI. autrrram-rcai arr-r
aaastaru-ain unarnmarnaaanazmcraahumr an
II=Ia1u1<:ml fta1aa11uI=Ii|""

In-ufiarrranstaam anmammiaww
anmtwitfasdaati. nimwwzwmwmmt arrwjelar
mam 3. wrawvfriairtatumiaqmada
aria
Mimi 11ra:
!3ITrn1ra1Et{:21a=18=Ita-T anacraariu 3813
cm: manta? ma a=rIra'l'U!1T'I115iwi|I1ll'mIr:'fI1"l'!a1'1
T'QR'f1?'7'l=l'lZGE16lUTfE1FI$'T1I=|3'lF5T
lm -"uwqrrta-'a1arTaTI%i 1ir=nza-|' 1? 11ra=r1?23aI1P'|
awhdammwmvmunamz itvirc vifari
tatmmmin mqizr-I dinarraamuaatiuarflau
stat mammnwmamw ma ma? it ra
.naI=I1ataIImaz:a1a3|ata1zsi1%=1z'erarr9?e3a:IamursmT

IYHaaI.;IW36u1=Im?IT amzwiaaminwmm
:1m:_(?t1tttaa?ui1%:=mm=rra'cI=1rzRtarwrI3a'ara?=:-I
anatio
182

--maau1=Irsiua=4a:-rn1a\Tafrua'tarararwt, awwaa
U'N=I!!i'Fl$'TF|1'i*!'ll-7'Tl'TTEn='-1E11i33l'TI1=lIZ? avtraaums
gag-Ii 90'

t1t%=1|z7:a1cLvf1I:=rIz=:'11%Iai=rIz"&au1=Iava
Ina! 3 trrrcm-"in mmsn am
mama:r=|amaa1'aatru=:m{usrin'mw=I
whmvdaaznqlufrmdtmntauzrrgera ma
mt'\at1nauu1=Its$nm3Iavamuasiu"I1naan-r
=Iaf'mar1nmIt=naTqam?mmui|"n1a1ra11%6
GYHHHT :$ta$:rlar-Ta1avau1a1rwru=rIaT aumra
Inatirlitaata-1 auawiu argra aua131Tma'a&
n=r7a11Tun=I1a1-min. mzrrr-1-aa1u-tuuzwftawaiu
-uafaanararaatzaram-a5a zrasana zirtaaararwam
aanariu 'tnu'zItuI1=ImfZIu~'I:mzHrtraFfTz!-a-Tri
mu ,:ra8amTu1vz:=Ia=nr.a1tm*-n mrtrrrrrrfaw
mm=:a1=Itiu:ram'1=ra=I=1'=ra1=lu1ureIa1eria1a1'*ua it
mam? 3Itrdm.ntfaa1E=Iam5t5IHaurr=Iarin

I- mm -Earl . qo I2-|3um# I958


2- man-wands-mqzu-up 33-34
3- arcl -uutrelis-1\\'a'rru?;m-I;-23
4- HGITSRI -at-1raa1a-qarqgw-cg-so-6:
5- uafa$a1%r-=r|a1e'hs.=Iaf 1:21. 1-47
183

G'l{'3tHT{fE1l' 3-'llEIITl_"'31f3
t_IrIu=I=1.raratw.u1?u1h.eaI=Ir;sIrg1'?-Ia=|1za1 it ma?
'?n1=I=nzaf ar=3wa'qta1i=~z-a1i=mPaaIz$r_u1n=I1'Efa1T
wvua1zwr.rl%n'r-1u'rPua1'a=1Iw=I1aaT aaunzr via-aiuait
'm1a=u=I tnumat1?IuIa:u-:mattzr1=zs?na1tF8trg=rua1'?|

'arIaw.'rtiiTHI
mmiartaauaaatmwau
mrfluri, taa12tR&cn=n" '

'wl?Itw' a?ima4Hftcrl'raaai:
"=IPrrn1iazu1mwnr.
um! natiarrfeaar
aamatf aim
|1'lE'f~'n'r=lIlIIHlcl'll"2

=Tf#au1Im%Iu1I=I1Ed?l 1Tr6i'f vaifirslfmt


B$$I3IU=1T9I6ITf'.1l'1d?fT1W'IiITl37Il?P'tF
tfaautl 8mLuraTwrtava=iuru-" HI
maartlisdtvaaraa-T ma? mmrmmijm
an=1ts{azrtaa-arizu---aa=rIza-T mtracaaratmin

4- mru=IH-qm1da- 'cTrsrn 1:2:-cg 7e


-2-sfatl-arsrneu-ufaaiqm-t;-I2:
184

um1'?n=a-azaramnaamaw a1?II%|wau'-1Iz'dT 3
mil aran=rrTwI%ra=I'cl' G|FlC|'<3f, atTTa1za1=nzaT
rcif rdacn azamnwfiu "'

dw aFu!:hz1t%faHs1'atru1'n'cI
amnril @3173?! wawairaurartrin Wamfm
rm aammamin
mama =r1'9IuEr3Pm'arIata1h
an-uiaarrsmrvaiu rqmwuaraw-znaa. ma
tna=na3T12ra1-r=1=1 mqcawtzraqqwaaqei ah
inf! ?I?I1=iTI3tI1I3?.'T=Itrt=Ta?r!tm=Lf'uIu?f=I1=Ii|-
mt-Tar. dcaawdvarmnativyrr gamtwmmr
muwatul %mI$1%ra1TaIa=IW41artI%a1iu'

amramaaacmama mwmrraw
E113-"l$l"T-I awmrrwaarmwmhsiwtwuam
iua=I'\911rI3z;a1vaaw1ifa1aua1aTa1iaa1vd1faiI%:a=-1
amawummraawwin a'r:ra3tua1a
=nada2r!nm11aatnatiu"3srf-I1=Ia1vI=ri 3
tie! uitzwmqaat. u'raa1ah'a=rrua1a3Tmt111i1

I-l%uaITl?I-u-Taft-ussa q-26
2~11rt?ir:=11<z:u11datr-9u':zr-a1-=ri'F';
-=IIzaa1'rI'q|'I|1r- ETIIWFI-cg-263
3- fr =nzc1-T zit mm 21-1 rm-61-mFa n11'a"cs-t;-211,9u=u1-n97I
185

ma! 1?! I3uT-tlt:r6T3I"'

nitamlavzu

4'ra1rI1'a=n7;2 a nurradvnanw
1iErai|I;u=I.e1a-I a raw:-r-mi, rndta:1Ii7.;!zItr1".f=I
=I=riI'a31'r*PI=II9urIMr awavau-ariuaaraasn
m'11srt. eeI1tI<ar,1irafHraa.91I=1rn'Iara,::117tt1==1.a1I?
#1 l'i%at&k11%ra1=r=1'tatru|' anamrrdatulmilt
aafmwiu

wma

'IH=|'IE?-1$I"-g?'lTl'l3F{''f3l |11?d-I 3
wrt-Ii! rfm -Ema %a'laIfilTIilI,uTI1'tl5Il
tlmniqam, a1$a1snTaz-ft111'ar, aanfaaraamwm
uIrrfa'rw.rana=mmaI"?TTzeWrI wwajaaem. that
a'wIfa'u=I1srm-av%m1=IaIFiumn1'q-1ii1au=I1a?tT
mmaaamaamamaintarmwtnmmmarm
f. n 2

mmfa=rI-izwrmtucmiw qatnrazma
munttwraluaaawaaiazrl-irr:wIa=I1dTawam1inaa1 3

I-1'l=?.'t=rIa1i31=I{!I'F=IaTIEts'c1ir1'-BY-11na't='r =Ii=.'-'[-240
2-lt-Wm
186

aaTm91g.1:;IaTa=?r mcrtavdrtaummavhin
mmnairhammquumrwmawrraiaamtm
u='ttI1aa'rc:'aI111=a184<IrF-aIa=I1'eI73n-

'=rlT wawmuaawnefanammaw.

XXXX
ar1q1tru1=rIz1=I1.=r:1v@riauu'mrrTn'

are! arm it arm gm


imuvqaa 1331'!
Ha: urmm 1-an
Wtarif a:Ta11'I"'
awgwqaauw a rrrccmccraazaraaqa
arlttffititcai
iwmwmawmdgaamwnmn
zratzz &a<ra"r-:3I?rvv&d't1%-cra=Iat3avIT&1?1v
au1cnsa=nun a-mmammnuwqratwqimndt
Su?-IaT?!tE1=If' $rIiIH-Pl EI=ilaiT1I136-l#a1i=fIi3Wl El?
m12rr111Inan.'t~m=I1ata1cI;I'c'1'=rriI" 2

w=rIz'ruaza1%n1tH1IIa#futrw=Itr1i1
1a=1aramariu mama uifatmrmarin atargwa
arraritaaaarruf. Evran, asurai, w wv1_w=r va1aa-a1
Q Q O O O D Q O C O Q C O O O D O Q Q Q C 0 D O O O Q Q Q O O C D Q Q O O C O CC

I- a-n|cm=I -E;-23
2- =llEE!'l-Gill?-'l~3iT5|T-E[o633-93|=Il?!-'l"l - I975
187

aqsararfwl a'1Taaah':rita1at!13amfEEIi1a1
iagsratavvawamraunatmarin mm GIEF?-I
Hnmmmn u1=au1aT&a-nz=rza=1n3:rra1i 3
uuararaarmasm-arinmem zztwwqvraqwzwr
itmmnamaamiu rmwwmwzi,
auvr anaw-'

gzuiu, an-trq.--L 1T~:ET. Eh-Ttrmara, FRilfGl'l'FlHl'T


Vmmmmammmwmmmamm
isrnmwf au=uwn=nTu1aTa.Tai.a=I3arnT?s=Ia1ta'r
tra-'61 1Ia'aIi|tTvamfa=1:aa11uFarFa'a=mf Er?!
a1a1arwr%.1a!nartI=<=1aFa'a\hsfvzl?Ttaa1am?ruT arm
a1'd=narI'{:Faa:11?-Iail tamnatmita mamu
GMEEIIBIT 3aI1tITttrTTI==ml'f9t3Ta?l't'Itl=I1-I Hl~:IT.El'|E1?1"
mtmgdmmmnaiu =1t-alam:rIa $fa1I?=lITl4TIPl
n ramc-m1u11'ai'Gmar=tru.nttaf=f|' a-iwavinvz

4TdTva-fmtm

mwfa-I 3anz'ra1'a1I.'e aq1T=nna~'


=I'mfaT11!1tw-H3: I9529iI'a'aIaal 3u1TtrFaTm
=l?=l!TiI nratmttra-fu=I=I1naI.'aarw1?PiI
wmwmmammm&mmammm
QOCCDQQG-QQQQOQCQQncctco-Coac--you-$1-0
n- fl=T=1EG5T'f11%l-tl'li'l=I~TtT-ll1'?F-6$1=FfRl=
an -m1a=m:=:-e1-=riI==:-q

2- '-'f|Eul'I'l?II?f: wa?aatTq1a:1az$;;:-gtla-aw.
188

ama
n)arraI Sq!-'r(i-'ta1=IRT)
2)=rc=1rP'aa3I
3)tn'zn1'!aaI
4)d=IaI=u1iu
s)a'Ptt=IF:TI
s)1n1!Iw
7)=mt=m(m=in1==T)
S)7iqIIlFIF
9)u'rirft$=n,ti(11Ia_n1=eT)
|o)Itl'=zrm(=rmtn?e:T)
II)I1!a'rcvntr
1?:r=rua1aTIi2%au-qava-ITa2:1 atm=n1i-Ia:
t='eh?fau1t1zt=H:IaTrlf tawaauruzsaiu trllr. Hm
tI=rra.n1tftzrr1:rr=,t=rT=:Iuars?131%IITRrt1T tn'amH
ai,aFzIvafI<mI mmwnwammwmmu

mm 3cm:
wmumaamammwwwmm
PWTif1TI"3Ii38lTT1IT3Fl=I?E1=l?$fIGl=lIP'3 a-1=I=n
walaaaa-57%: ar6a1u%iTf=rrwenu9n1{cazr={a1z1
a1sm1azn'arv3,:raf:nf=rnz:8d=Id'rawratuamris an-tar
zma39'r4IrIaa1at''urr%,:raue*a-n'1r%|aaetcr:r
Irr1%vuIa11ri*?a1a:m1a-*r3t%:va1ar%,ara:mranu
tnuawaaan-na1%u mmqaamwvamfwmmm
189

mar:ru'<?tr?a'ta1uu4'taR'r=a?aIiu =rIz"a: 11111 3


atI=*a'Hhsfa1=z:Ti'uinI-1a1PI%| mvafdr tmw
aim, an1aana:na1Tn1.=1n'tIvfrrfuTvaIT,waTvz!a11n1=:Hr
azamiu

:rcttr'aia:
mi r-uai-n'|a#a=l=I'f a'lFY63a=r6IT3!l
tagvawtamramummuaamm atrfrnwvil
vuma-Itrnqnrrarmmwvmxfwmil

1[TI1'll7ZH

3'1!-:mEru=r<_un1a&an_1'raa1r fem
u*e."-uaIarr=rFz:?n'euarra1tR=t1idTIaI'aaIa11 mardaafawt
in =Ifa=H1faa1?satnfa=aIa1-rT=rrdTIana-
1auaurmq'('=7uaa1a1|a1=:.vawaw$mmaaa-e:r
aiitarrtrrwtmarin aartaaxaiezavaantwrrutraardrn
:rqawnrrt?u1=zn1a'tfw=rifmmn:rsmmm:rmw
atmru aaam P?If=dT!%=IIQg(1al'!'ll'&lTGT
q#ranuaEIa11G11aria'Ifa1ItatI3;=I1%1=I(aTatfa=dr)
amt. watmr=rfI1a1'}n 1I1%1rIrlfIT!a'c1tiIe?-c
gazatutmwiumriu =I'-'fl 1! Hniati I
mqgtiqaawmwlanmain qfaraizgazauzft is
tlhteiril WWW Fm!-I"ririI

Nmmimmxzmmwan
190

a~t1fac?ti| Hnmaaummil a'I=zE:rTnr2:r


win Mwmwmtimymmaav a-I
ummn Flvxrnewmwwsrrwtrmi
wnmuvxcmtzaaw 'n=rurwra1,u'a1Ta1rih55rP
tartmartqa iw,|u1%Ia1'In=TrIw'da6z:aa
iT=I1aI1=lard'i|aI'l=Iv:'ta'l xcvarcrtaramalzta
lratvu

iris?-Ill'3I

wlkzmmmmamwwmm
m.9l?v(ua1zu=tri?91aIa1ma\'t7Ir}a3ar2uSaa'a1TdI
gmartqrrmartariu grwaatmwrmiqari
iaI$uv:#a1aH4taFI{1"'Ifl'.:ranFaIwt6w,UHu=rItia
=IIzmT1u1I!;In1'k39a1*tfa1F?1fa~Tw11aiT.lrml'a
am: &v:=1111GI1=1aTra1*3rar:F'curtnT1rIriatTu1!1T
:ra=arII=IIa1'3u alvmwraawaatcaaeaw
=m=arararr:1Ia=riI tn-wautr-etnzzur.i1-1m.etr;a>ra1zaT
auifrE21ff unmffawrrs WJFWIWW3 I3"IT-1
?$h'aITc'!fma=I'f Emu

aF1TtIFT:

mwmnawawatmawwmm
u?ra1w7rmio nnmaanmaawmqarraswmmualaa
wmarammwmammwua eanmar zit
191

quraa1.=Trtaa:rr.a1"rra*aara1%=Iacruntrzs1mrrziII1a
artan gtlrtgrwamanrangarffmtcrhvrmaur
a1aarraanan_a:~araw;uarraaaanear"ia:aa~1ra1aaa;1=um
afaz1a#mauoa:ra?r?a_u1ar.a1%=aF:a:t.aYmTa
ea-nam:yre:r.znaunuaa1qa1arar%.aTm-awaa
*YriItcr=Izrasatq1%i-u<'iTa=r1'?=I?f=1TiI air-1=En11GI
trIi'a1a'rsInmti$3sWI1a=rfa'1T:raa-ruF?r=wrI'c7tI anfacr
mrmwtawqnnaaadmmzmmwnaknin
frvdmiuimmmai 3aFa:
q;TrHa1ETITITi1'tiIrHatna%aI1TdiaIrfbRII11I21is
TrMTrIawa?aTnaa'nauTz?ir%| Emu-an a-ttlr EH1
tr-nil

ITEM

mqavmuaaramanrfma walrmn
u11a1=I=1:ri#1um=I-arrmn vraavar-raI=ra1am'{ra11r
1traraI.9=Ir:Iita=r I=r!t1T=m 3II?n'i1'5"TG|T-|T=lf3ltFl.
a=I-1I.3~1ar6rHuzvt'azaira?a'RIar I=I'a'IaT:r'('Iz
man a':I1r;,'r11a1'zatr11a.t1=1raatrra1u=trt'3a1=ir&t11ztf8=II1
nmwnauudaawgtmaimu am:-ra1=ncrfa
mmmaar-n'aa11'am1%n arairniradrmrnwrrar
1trn=rr#m'=r~ru1aI,u'tHnaIaTaraatI1;r=11umiruraw=rt'P:
lFl9'l1FIT5TJI.31WTT11T3U'F|?ITT!rlH?lEiT1111t6T6liiIT
maluawmnunaratarmrptai airaautar
192

a=rH1a1a-ainmatrazrwraaiu zrdranaaraauvgrazi
a1aI1atinatau1=n'Rcrrv:21v1'trrnrra1a1%u

mama rdlqztliuavaatauwrwt
IE-I1?TII mlvattfrari-"5i'ra313mrr a11%IaIh'tr=f 3
Ta1=I'lf.EIf|=IGITR-I1iIltI1:'f=Il'1=I1=rI=I.!arw
srrrv-cwarrm =ratgaaa1=Im.a r<n"'

WH'|FT:

ttIIIIIfl=51Ern11=1uI?sai*a111a1=Tt=rvar
I?natt1t1Tfu:reI=hr=af=I~'tak2rrtrT$t=n1r-r?! utaiqt
a1ufmu1IfaI<aima'rq;n3a=nr,nIaru1IwI'T
6FF1IWTi<I~ll?J1attrHFlEl11T=l=IP'IIE!=Fll$ft=Tf6T
urmwq-attinimmraawahu ch? irurrr
maria Tllatrlafnlflril l'R1'-IE1 mi
e;:'urrati*u nta'atart5t=IrunmuuuT1i=q-Iafialutwar
mrrarrail GR}?! tnaTa~3II1=Tr=If6?'rI3't=t1Ea?aIw'-1r
lavanmriu

Gmwruwariaarnmraasmza we
wmwatiu Itqafanwmmutrmwlmmin
nlaarszm mammi-"mm. n1.:ran1ar3

1- limit -(ma? 3u1T)=[-93-mnfItanvr- :95:


193

|'f'|'WiI cmanmtwaaw iaammamrmman


anaqttra-Tiri,tau=Iz?ru&1i;=rra?'Tirfr&'t3| am an
taa:amz8-u=i,a11n1araIvI--=1rrama1nari
fw u=ftra1f=rdf-a:rsn=Id-ram'=r41I"

t=ar|d-T mmmmriafan
8rrmarq=Iqtgereu'asrrqIr'2,;nnrran1TuTt:tsrm=ra1:na-1
-mam

n1q=-1ih-Tn1=I:

mammrawammmam
uwvmmwaammmaarmmawww
u-'rauaT1I1a-ttq*tu1aI?a-r%1111=I1tI3II=rIrrPn='#II1cIi11
z5'r1%aaaaatr8rra'a3d1a=1aa1r~aa3In=ItrTnna11'rT
3a=,;'aIr9araaa1I1;rfa=!1asTam11%u'daa'r81rnatu=trsr1cn
qvfa-'r3a11iuaI3$rH1a1et3a1uu.&aw
tIn1?;w,Ia=raItr=rI=i=Iarc21Il1a1a1Tti1tz3z{wa1'rqa3sir=
9'!-Ha-Ta1%u mmwtmmaawumaunaam
i,au'l!awTtwat%=nvanrrrrrIa1i.zVtTnz?rnrr P?!-?I1
ultltin

mcraf 1racL?il ard1'raIuIf=13'Iarr#8

n-=ra1sn=na -am? arm W22


194

am, :Hatrif araraaut vaazaham ararrrstrqaawm


Tmiamrmawrmaaaraurwamauwt-ail

IrE't'ra=n-{fl1'3:

va-1'&Tn1;aucr1at!mI1=a.wrrauiara=fer
u1=s:a1qariaara&aaaawiur.ataaarrr&a1:-:1n=ru'r
artaru'Pua-immzirwansrarin IHI1m,a<~1'rnhnwa11rtrur
wamtawiuwmmavwaiq
in n=ITrrerrammd1nmurma11Tn, aenqumzatatuam
EFtWF3%lTl1TEi3iT,BNH.'d'f*|N'WT$TI7FtqFITlT3I3'!E{!
I=I=s1nq6{aa1Iawtraa1a1sra?aa'x-a'3ns#fa=r1Ha1=:I.aaT
qtn:zaI'TT=t=1ftTHr:Nr=I1aTn=Ilaa=I1%*?uau=1tIfa1traImI
armaa Fl1f1ITWi"{l'i?~'T"'Ii'IFHFl=l'1=I%l1'3I?l6l1i'!l
atiu a=tmTa=l main qepqaamril

vwrst 't'r6?5?J=lI3.?,.p1I1r=I42FI<'~E-I6!
ma av:Ttni!dla1nu1u1=remauIaait:ia1vIra.=aai#crm
a111!1,t4aiIu2111%aIra'aa1:-rr?:Ta1eRftna-1 311'aTiaz?#a1aluT
Bimmtmiu

FIl=I-ml:

itsmqanaauumt/ilmmwtmauv
tmrri gage: ad! scrsqmaaarzrtzrrnriunta
arrcnam qarmaqwmaunanmnazraaabz
darumu mwmmammwmtwam
195

rnmnrmuaumra t1a=Ian7t&a'a'lrw=m
wnau-yrwmmmfaawarnmn qumarrsmmsrla
E[Ef'lT'lf."1?lT1TlTI TPna1=rrrcr!zz1=41a~t1'--I=TII~=nh'amr1'r=!tr
ztliammiu asrnavammariu t=rIruq1iaI'r'r
riu

we-trttr 1=7f'3?tlaTa$l :66! aki


a1a:hm==rtma=I1al newwaimfturin

WTF-T:

i11tPl%1Tfaa'r3:21in Hlaf it
rynmni. vumwaaaaannmtmrru-.-awn: mat
3=;a:irITmt5TzaI1'ztun'=II611#ri|173!:u1=Ia1Tzwt
in hwimamwuurunwawrwm
mariasranummu Tfimarnfsrf-13wtnanzra1T
uaTe1a'Tat5'n6i1aTri.arcTIu131a1aIIv_aIf'ira1
a1a1inIET&aaarI'R#a1v&<=rdraa3"&mmarr1%trB
a1'cTth1t?m1awT<a1aTa1tTau'9.rtca19ta?tsrn'=I1arm1iu
32man1trrn%I*3aTntarc?I1trzn'cui zRTurzxaa3Iv
aatin

mil [~II_?lifFl111T3vT9'lFfv~'IIiI6l'QHv'3
adummmanmmmrumaw aanam
mwwmamumiu TfI1J1T11Fo:"'.'31fl'\=|'T
am-man&z!art'3tzra?a1a=t attumrenvsa-s=1ua
a1faaT#ItI=rra&aaI11cIau'a1Iat'Ta1a11aT1?u1IwT
196

3T'l'FlI'B'l~'fFFlTFlTCI'6TI '<'IE"1U'FI-l~5|Tl''c'l'7fl6ll,'t'l'
2-n1rarra,r==I1=Iqawa=&u1u1:=rd1 =l?I!56II_1"FITI'!'l?vIT=I1
wmrnawiarain atamrmmi--ta1:titmata1
81;aua:.'a&a\TaII_'cIz'riI'-h11Ta11u1 asrTl'=I-Em-Ia=a'Rd-"I
iTlrai|"'
11'tE'a?f!TtI'*7IElTf8B1?IU=I!l'tHl'r-3I=[l'?-1afltr=
await mwmwaawammmnmmvaammawm
-rana1=i:ns1fTrI'I

itrd-Tvfflsul i!=1=rta=tn'Haam=1=I1=Ii,
w:1=:atahfaua1=!fareI.=Tt<t drmwtatruantcrrsrtwmaat
svanr=srwrra1I!I5tI%1tri-"='11%na=nH==a1,a1ztfa1z.n'tu111a
I=rHa1=-2I.ana'nuHT&[fH1in=Ifc1a'=I8vafd-T=1r&T d'rwail1lNa1'
in" 2
matvardwaaawtqmawuaatma
marpfi-mmauvfwz araaamumuuvaaa
wvnmmnin 2r4Ta=rt-n%fara=!1-u<lta=IrrznI1zf?narTiaw
nara a1I%a=I?:t=1uTttra=aa:a\wram3aa'rnrtr=I=lral~iIa-r-u
&'tE1d-Tin wrgwaassa a=m1a=nafr amzdmaaaa
&awmrfr1a'IIrruru=11am1rzarntaa'n1=iTa12n"

I-tnaRn(aI=ra't amltf :31


can u 66
2-atma uawtwtmnaz-avm'-annwrraugcrtgzzs
-3-wrtmumiualaw-tlwwaiar-=r7F=:
an-amzmmwm -q;-see
197

vwfmmaraamaaairimmnia
an 'arcah 3u1TdTI1ftIarfa=u19uUa1a=11u1v'cwraFr=rIzn1aiI
tiara-1=Imn'a=nza1 mdznraarutiu

9*5I't3rI'=ITE'4lEdi:

E
=I1u=s=+?!=I=rua1fa1IIwga1si| Htl
muanmuqraafmtmaammrqwaamamawm
in qsaawcrrctmulz arH;?rrn1'l'ad5vata1=n maxi u
:raasn=f6=ura1 atumtartwtusatiu esa =Tu=mcr-1
awnmmawfmmmgzumaamin namwmm
an'mailtI=IIa'TtFII?:'an:n'r2.c1iI

I11:

m i#f3rt'l'!IFITll'iErl'3tila=IavT6131I1I31
vacuum-f mtmaqawrmmauliratin

QETTH-'laIt!'3?TIT-fl arl1WI!I?a1a1dfZI9'dFI!I
Rmnvmmwdwrrthmumiu zratnrdwrr
Utrtitlvvmmatmmmtturmmu tr-Ia-t
auntair-nvdmaitataaiu ~:ma:urtmd-that:
miummmmfrmin
T-H31

'ri=1mFaem-1t|tmw1 awif GT-TH!


198

cream-arsttamrssaasyaraazaamcratraaarariuazwm
w1raa1aaIau-mIaa1:hwau*auaarfTitmna1at
a%TTa=1mramu1vnIwarar%u aarsaa-nwawtaram
anarnnaariu aawewmmaaaniamannaunarum
vdmtmwanmganmnnmnamriuamm
ndcimmiummmnhmwaww
aamn"3n aamana mwmamammmin
mwamamrmfrarumuramwalamvarraaviuam
utmqwaaravaauvaamaamariuanaw
aawaaramacgnerrrzawararhmmaaararnmzm
Ittarlfanq-(daft
Fmf :- mwimmq maatfmarrlaareuruwr
-a'r-aris3vuu1%nnwn=1m1ta:tirri|a=I=ftu1%N1Wair=tr|2!
uT;Iarrr.Ia.=1rzuarrraTvurm=zTa1:rurtanarwu rm
WW8WaMmTWl
aa::au=In=II'a=rn1--"wav1t&-uxfI4T=Tartcaza=1a ii
arI\a1elf.s.'t$1II aw1!mT1aItih"-wwrriw a=I
aarr-1ramm-- 'a=IIIt1a=rIE'i=Iu:saI?#'irrrf.a!J=I86um
as a7rEHl-'l|1i1&IG'3l'11I'3ltRI3C[EfiT'W13==IavT
EPi1'aFl'FTWK!1HIftEU!THT91?IlTW=|TCU3aG1d-TU'=
lf Iilt ilflt"

u-I!=~*:T=rraarr-a=:=m1a=r-={-1:3
199

6121! am tr
mqI't#=Yt8x91au11au=rrzu1 n-(mat
200

seT1qi11rt;aU'swI1=ITa%'l'hT6Taawrn1Tiufaa#*ran=rr
e'=zIr:r.a21Tsiifas?.aq=ur=rr-IT.afaa'I'eraI1Ter=ia'r.aqr
aT=rr=:'Fa1IH1Iw'a1irrT-'6nTIETa1T1=I=rhr wr-yzfa
4?r=rmTsTa'aTI1,{$=tT=1@:afurfarafwzrr=ra$err!sI=bIIfaa
1'rt;issrfaa=rremaT.a-'u=a=r1iIa. agamaaamaw
H'rEI=lT$3=3aET9f1TTTf|"J<TTTri='16Ta'r%|v6l:TF'74T
asT$=;Tr1;rtITI'-;TaaTa?rqTa=IT$ar=1%ah1aa
'azfaaTr"1sfsa$a11Tan*rFt1TaTfu.14Tr<1r*TFFH'=|5iHis1'u
arfaasfaaarfnfvrnraerr 3. ananasar -115% .111; a=r Haw? Trig
a?r9rTtIIUI=fi-*(9r%fa'E?IlITT61=IT%.=Ia'faasf=ssrrU1'f$r
a'I1a1'I3?6I=I=I'~rT%:u'=111fHTi=I1=<Ti'I mfma 61aTta1'ITr
%rrrT$'?I=ITi1IeuaT%n&arq=Ttz.iII'41:f=1a5ra"ratI*r
asTw'ua=4=ra|

=rITaruui=rre=IT?uf4:Taf9rTr"g1'aerra?r=nt'=IT=rr
Fli'llTIlT$|'3l3''5liilH1"lTi355FT?r3'Ei1'=l
nsarrtu
201

:=raTsae'ftFaqTf5a'rF=I1rr3za3qrt Tr-fruarus
=f=z1a9sfaer*r'=nfaa4?rHa1'?a1'*I"-a'rTr1;mnTTIWis5rfa
z=qiaTe?rt|1avTvfaaTutqrg=1Fn.*Iq$'trraur=IT
q-ram atTas5rr=r1aa. f41q=t=ITr%:anfaa yr:r=r $13: war
5m=ITt1=u'raf$s11*'{1erv4=Ir=rT6artI

s=m1'e1=fI'FmT alrtr T6175!-'1'EV8 vfzaa $ aerrt


' Tr'T4crr'aqfaaaf$aa1'avrE$=;vTaaaTfqfn=r=rriraf
*tlfW1'l'iTdT|? sroatlti-*r1=I'I'{t- Tnfmerr
waiawsmaiqfatafvaaftafaawfaaafi
trsaa1T5I=rrsf?rtf-sar1*zf$aEr-fa='ra=:TaIraq'aT=merr
twwrawwhrtmrafnnvaqawtat
mwmamwamamnatwmamamau

2- i=IH1'ua>'T'1IIsqT 1;E1I$r. av:-at. 5'-3-we


2.Enoyo1opedia of Religion and Ethios.Vo1.9pP.191
3.Nations1ity is a feeling or oonsciousness or kind
which on the one hand binds together those, uho
have it so strongly that it over rides all differences
arising out of economic oonfliots or social gradations
and on the other serves them from those who are not
of their kind. - I Thoughts on Pakistan "
by AmbCd.kC1'eBoRe
T635W1E3iIF|TI Tr"1'aa'rsastrafr|I$
rrrs=rrta'rw=aa>Trrffra?q==rurta'TwtTaTFa=ITt21T=r
hfII'=I1:a%tsr-1%1=I1?I'=rrI1'r. =P=I'.Ir1a'araa2ITaITiI'IIaTT
HTlT"H6TdEITiiT'l1Wtfa1i3TrfiT"3IE'T|' 2

1~TI$=r's11*'ra=rasa2rasat14s1'r-I'=zerrIzia1safaa=1eI
=rraqf-araarnraasrtn

Tr'I;I'II1z=rc1Tt1=1=11"-='r#F6Er5eIi=II1IIrrai=IT alwrn
t I & emi
(z)=rf=I1fc$v=rr
m=v1Te'tI'awar
(U citffa em rfqaraiwr frwerr
(2) =I1"rrT#r2$aT
no t1=1'=rt$aTaz1TTI*Irfa1mitftaT1q=IHza=aT I

1. Nationality is a spiritual sentiment or Principle


arising among a number of people usually of same race:
residlt on the same territory, sharing a common language,
the same religion/similiar history and tradition,
common interest with common Political associations and
common ideals of political unity "-Gilchrist R.N.
Prinoiples of Political Science-6th edition 13.26-27.
203

U"1'aa'ras1a1a1TirF6nTn1fb$taraTi~TsT=rra1aa1"a'
8| 1'r'~;Taerr$rnTa=1T$ranIr%'TTE141'$TIi=q5mT1
$IartIta'araf=It 1"=Ivrrtir11x'-=rIranr*rcw:rer1aTx=r1":%*r
wwtdatwwmvamwaumrwa
6|
'|~i=I*I'is216I:fiIa=I=IT2aaran=ITI%f~itI*Iar!rr%'
atmntwtynauraaraqfatmwwsafrawnaflyara
aiirtarI<I=I=Irt=n'%*t1=r!1I'<oEI'?IiI*

=I==I-:1=IaI1't:za=rr1er:n$r1(eerr=IrerraI1t1aa.arrwrrtn
amft=3mar1eaTrnIT:- =IraTqFH:aaraIs1=rru ?
eI911%tr='3aa6f=1T*t'1I=Iuaz$awTiwT%:aq*rartcirFna
trrdrt. aIa:?:eH1T3=y4r. an. via. T'aT arrfayfarirmfr

1.our country 13 our home , the house that God has


given us placing therin a numerous family tbs?
love us and when we 1ovI;a family . with lholl 30
sympathise more readily and whom we understand nor
quiokly than we do othera:.. " Mazzinio
(1'a=r arerr Tr*'gTa nTar=rr- 1em1-rruwrcataga. W-22)
?-azfwx-qfriqaal
204

wT=t=ITIaa'r%Ivt15r(a11*t2I%=r@'I111ItI1r1'iar*ra?r
a1'ii'*?rrTF"@'4ri=fa=HttITtI3ToTrT='3'a=I'fr3raq=f1'
raters ~I=I1'taar'r'a?I'v$err$
qqqfaaaavtrtiiwaramtfaenfwffataarmrywar
rIa=riFriI!eI=Itf=sl113FrT%'(f(%a=4TEramf=Irra5T$'
aaaT=r&TETa$aTaTyarrIwmrqFntawWTr'T4cw
a"r=rr=1Tf=I'm%%I

=ITfaIri'9I1*raa=n1trt1%Ia=$ru$aTt1q=1TTr*1'qaT
mmsaadfntaiauwwfawwa
tlwawmqswwwimfrtivlfmmta
ver? T%II14=ti11t:z'arrIquT%tTT{|7lTi5TeiFsa319I
m'c1urI6TtaIe1$ra=?raTfau'fwr't=m=ITa=IT
aTaTe'tIa=rnrf4rea1'a#=rrtaWIii'I'ca'fa3f=ra=ra'r
*i3?WTi'iiEf?$dTH?TV63lETVTtITF$$?~'lTUT
4*Fewfa=fTqararrtfer<I=rar(taw=ITauwaq%r{=ra~raqn
aaTaTiTfdaTar11'-Tn=I1'Fata1fn!tiT1TIg"l=zi1Fu#r
ta?qaaTTI":"merra?reu=r=frtu

2- |1(i1'll Tr4T< arr wfarra : far arfwz 5: ac=ra:faa


are {-1117 =rr1rzIvr. 38-: gm mm-zcaa a aga
=rr'I'rf=ntztr1gararrc'-=IrTqTrrrTmTaTuteITt
Tr-uarkvmkmwnsawfwmnyamww
@IdWT"H"'lT6TiTE''f*FT45/UH?i1'Y$H!l"IT=WT'lT
aTariIaT1'r-1ui1w=uwr=rr-ntsrswawar
tasf=r==rf=r=r=rrI|Taf:3u1=r=6I9rq*(a=1=ruIa1errI=ITI
fs-1'TTTF'=IT*1T%q*'IF?r=$'(=fItu'I'=Insar1a5
yfefI'aa'r=r{Fqa=r1'a=ITarraI'era1=raTaaTt$tr-;=aT1na:r
TTa?:qqq1'Ie'naq*r%aI5Ia!Fnr=utIiewf3|na1F6?ua21T
rIfFa=6'ft5aIHTf'5I5I1I?=R1"lc7T3'TI

rfaaTaa1taTcrrtf$1a1r#Taa?I'tr-gnwarrtf
Iarwtar-nFaewtH'Tt$aTaf=rn11:'% I ur1'=o'$werr$zar#
wITr11=zaT=irafb3asTaTeirt|tdrq1%1:%asTIvTI1rIaa*r
I=11'~:=raTIq*rv;*rr=x'r(ttaIT1aaznTm1ra$raiI=t!111' t
5rwrat|q=fn=;=x=6ra:TawraaTafastf:1*FraartwFr1'f'
au'raTwrI=i=staIa=r"~1Ta-'terrtI

=rrfq'aHzasaTa=rrwa=ITaa?uTa1'ta=r@1t|nIrPq
=m1=wTrTia#T=rf1flB'r'iT*FTIirq=1'H%1'Iai1FairiIT
mm s1arta'3a1'aT=maITa=5aTI'FI1T%u=f'rm1=sr
a6arr1't=IT=wwrruTry-gfatn
2 06

m%us:Tf=rn;=rfunTsI&%e*rwI=rq'4?re1faaa'r1vT
afrr wa're'=IaaT t 6't*-H111: an mat #6 er? alfaa aura
:|l'dli-l'=ll3T!7T'1.5lTVT%fi'TT6i1'GI?{f&H*'1IT
ErrI=rI1II'2Ir|u6avaaT1'!<5wwto'at*aiaNIsdIT=r=r*i=I=H'
asr=rr=IqtaaT=TaTI5I?%:*i'eI=Itrau@rt1=rr'$f5rFq1%a
zfatectaanm err1%1qf=I==rcrr$a1<1E=rT swicasaz
1'r=gra=saTu=IT1t I am'#Ta*a%aa=f$Ta%r=s<rr$$I1T
arq=ITTrI;Tucrr'1IaT'a=rtsTaT=r!ac:Taad;aI1'erws<rreeIITuar%z
rrtg srqfcaa GFIT u=i=rcewI arm =tra=1T 1% cm e=="IT$? arc
%Tl=rI'{Fli1d sT=r4sTweis:1TaT.::T1*rz=rnaTIr1:11H=scrr
?IIIET?:Hs1Iv'..a1*rTI

Eafc a2rrt1cm1faasta:aT :

a1a2rrarrfai=fqIf:'raIa?ras1"6sI?'?t=sTr;iIsTertIu
amwmwvamwamnzarqsmtuwmwwt
wwaww1aaT~fr%aa%&IqT%zWf%6Tn$Te$E
arn=aT%6IeI1aa1'cirUaarrqfiatu=1'5r$Femwve'TT(6:=r
qttfewaurtsfara I "Fert3arT=r1'iuI9t1aaHz$eITq7fT1
$r=rr=Ierr%|

Tr1;TarirII=r#sfqarrq a'1"csaTa$'raTa=r-'I"{rIa
awn: trfr % : arffrfr arfa GFFIT 3-.21 aa"ra =I?r at:-:=rraIf avrr

1.Nat1on is a people ho have become po11t1oa11y


or3an1zed- J.Ho11 and Roeo- Nationality in History
( 1916)- p.vI .
207

=1 Tn9rIcns a'qaa1=R'rf vrsrrwyrta at am am=IT=ri fawn ii


'=l1T"1-'-T1'.fTl TIFF<1T is I ==Ia'=IT=ra=T =I'1r1;a1IEIT iFI'1T3lf

arraf-sa1'=ss<o'en9r#fesEs5I311T=refusTtI1rT=J;qsT='I5m:
ar{=n'zT1rr. Huff-sf$efII'1$sfqaTaa6Tar1*aaa=IT=IEI31=r
i'3'|'3lTiFI' I aIaa1'a1rrrI%Tn|'Faa=w?uT=rwq=ra=r
aTafww1aT=r=t$w:raq*=r arazawmwvuasafarrartn

TI';n4dT$aqaqfaaaca'fisaTEI1'IIT61($-=T9iITis
tfasrrss araarf %r1'r1g1*ac1T r ansafaa arr awn??? vrtrvr
d3Il|1'~'Il'l'TT|

.'-*T :T?*."~lTfT.? T'-":i"'I.'

am an araTf=seu.1eI=-at ah fanrm as aw: qafaf


#1 Qu11"-Id mrr agar 31% =ra'T-Tfiaqf =;.nTTr fafaa . HUT Ema?
hraqqgfifsawtahumqawaut I ietn
*TrI<w1T'#rsurf<rncr=Ir $r=rrsr eirFasc1aT=rq:=:qr%u Irrrr
a=q=r $r erfaerf Ima fr yrifaav atrrn it fang: afar: =saaT
%- 1=Hc1=I1'@:1=IT%aImarr%m IETTTWT I arIa.=IrIT=r8rT<-i#
T<*2E1'W'(qETBo%'$6&6&i9'?T3lE1?I3IGl'rHT$TT.
HEW? R an WW6 a'r<-rm Irf6a' % a='af 3? ram WW3 T'T
errr-ivri-3. V-=I1*rrrT=:Ta=II|'rFt"rIz1aav:f14I%I{:r%|:Ia'r't
q,H1sfa=i.=asrrTanT?uar$I&.=Isf1?rerr=Ir5n<F=s1'aT=r
'~s1ar@'a'rarB. a3'Tai~rTraTI'aa=Prt=aTiaT<1re'arrar%I
6F''lY"=lllT$I6TE5i'i'1"=r'1'l'6%d'<"IT3a?l'5'<fT3ITf'=T'it{
208

II$err3Te;atfarr=a=rraar~I=ITq:s*crr%I

5mTQsufIq1'teiTafa$yfaaaaaaTt.m'ufr
af>'Fd$a1rerrafwI*ri&I&I6ri%fe6rT a6r3?r=r
3writ=IT=tfe1=rav;Ir=r1ta?ts1a1:'rr1"(ai%r?rr1T$6err&- ta
f:=r=ra=Ir=Ue1Ifrfaamwerr$rsfau'r$trtv$2.wI'rrI8'
eff-$f4s=rzz1sfa?raei=ITIz?:qs%-u1rfarr:1TW.=rafarr3rq*:uf
tl'i?iF|'!ITl<TTT aI1=TTI*1~"T=ttcqaa'sf=Iu'r9r:tsr'%
1qsaanaT'(yazeIT=r$a1=rfaI-s1'aT=rr| ? =ta{IIaIe1TefT=r
amartaaaaqwtu%.2Prarw{I%raHa=rI"t
I1a=raFrH?:aI=rrTB=TrIwff?5f6=afiFTsfa11r:'r=_rt-aairr
cfcxaw arm fat qrrm =11 acwa awe Sm=1'rw:t I as rm
-1Tar1T=raTfI1irr*Fr6<1$a3fIurasan&I;fis.:1Ta'aTT!zo*fa
mlqefqaatiamtnwm
twirl 3
arr=r$r=aT-*u $1 srrr'mrai aqqfr a"r*r=Tr
=I1'rd1'aii'efFaarrv12nT=1T=rar(?a% I trr'?:raa='6aT% :=11{ar
$=iTaq4rrTHT$1TBTi'r%'IET31?14?ET*FE6|TT?ET
ms: 3FTT3lEWT'6{'l'1TEr'IT31TI=l5T"l"1$3T{"|7-'lTl Ia?
faerrarzmaararwffaraf I V

2-I=rn'-w=r-tram a'w.1n'r saw;-3-zr=.aour' do we


?-exert: % fawn:-naarr aw afar 5aru.3m(2um
3- - H35? - we-cc
8- argra ar=r arr qr? - tram aak 3'6-u.1ke''=I o.?m?ro
209

it-'FvrmTs=r-T*'I'=I1'(c"qtifex$;IF<1a%'aI1"IaITvr(gUT
qra- :=qqTIanTIa%|3fcmrw#rHTeTmar
gaTIITaIaa1=iT=IsT=rcirFaa?raa%ia=IT=I'6f$IcrascrrIats
1<=5tII=fI"tTH1.iI6=r3.i;:T%|arsaT%z1a$Ta'T.=ur%
arms?-----2
1TTt1 4-T afrfqa Hair air an: =EI:ir 6TT#r a'=Irn1'6'
$aciT$- *rrraswrIcirs1T=ut?rqas37-*Ii*aT'"ITIirT=I1"f
5mf"a'q $t=rr % afr ErIr aI=fu'r'T % a erftcrr wrcsf $1
v1TI1'c3TB|1%m#rr'1TT?'=|T$It.1qGra7rII1TiTer=r5mrq$?5.
fa=ITfr er=I.<=|T=r.=r1c5z1'=I. $67 #216 aIfI1a$1T=r*IriITTa'r

3rq?$I?tI'%za':;'af6zTtmf#|fiH1T1a'Fqa=I
s=r95wtH<Tram?IaI61sa'Tarr=:I'aI=I1FIT%zIa'=I1TdwrtfT
$!a$H%=TI'? =I1I@'aci16faaI'=Iai.T$eiweIi'I:In21asr
fwwnwefaassar-ar:rIerrTa?q11d11a:itfaavrnat-faqir
ut=r.eIas=rrvrqIa=ratr=raias#s=?I-Hsfezzru 3
1'rrII=q=r ii atfaefr n1TciruqT an famtrr cfr %
nTIa=raair14i1Tfq%2iTa:raq=frnT:iIU3rF(=Iafq~'rrtfa=s
m'enTaq=rt=ra1'1T6rnf%m'rI%raqsn%af#sa11qanT=rq@:
613.'wTI. =lTFf qhrvr qr 9% am rt aziur 1r1:carq a=r rre I

2-alga W. f=aTu ah. fmfm 's2a.*~;r~a-ma near do ms?


2- am Irf,:'r=r- aura a'.a<121' 521h3 so
3-atrzx-faamz aiasafur senqqzoa fkeu a'F11vT-eaw
2- Ii'n1==1=r
210

|1T1i'i1iT1T'5Hll'RTT41'I'Ii'fFaiFT1fTiITE=liI
6I=IIIIf<m=rf'IaTa1TaTnri6raTTIi*rE19Ia'r%-=I1'I6'u
fa$ruTf=1u=I%f$=rra'nu=r$a1"TE61T3=raaar
namaaamrqaumwztmamaerammfmf
tmnmwmafwmmtamm
mviwnmmwmfqwwwmw
4:13:13"--- *
%lT"T17TEI$TT~?lTFT=lT1TT!Ii'fF4"1'i'qTrE"l'
ae'f5lz;cu=ITaErat=1'%II'rTI=a=rrfq3==rr1<a1irfaf$f
a(:*T<1'r%aI11;arr"Fc1arra==fI1'(faa111'(=I1atrr=sTI
uttftitz-uaq=rasTtrn*ra3rF6a1"t11fo=I1'(i=T qfasriafi
vrf$fquTarq=1TrrIT1(aTaaITIIT<$U:T|1c5t=iT6==i1T
i'a=I1'tH16'1Ta=Tarrr=ITa=I=IT1Tr~iInHT=rEn|*I=affas
a;:Ta13~5I=iTtraI%&maq9rfuT*ITi~THIcrravra3ws=raf<r=r
qnnnasmwwakwmhfwtmnvm
*ia=ret=svas=ir1'raI1aa=iiT1aezBaaa1'qasTa'=rr'Tasaa1r{IE*rr I ?
a1*r7'tFH=I?rq-riITr1T!TUn=ra?rI'rr$162I:azHrwtaeuaT=r
u:q4%T=h'fa'=err=ua"Ii6Ia'T|aaa=I=rt;f=rfta'farT-an*t1~I'rT
#se,=ssfa7?n1er$riafia'I'5?I=rtr*frfsaf'a*raI'=ru*f|aIw
sHtHIr<rrf#=mfnasar:=fr=ra1FaIaTIT56=sIIITurtwT
ta}a=19rar=r:T=r$T1=Iar=ITaa'aTtcrf:r=II=Ii:'rTrUfT=ss$i5I
$EEil'3-'9!1I1TI1$'i1GITTii"1cilarr=r=r7:ETT3H$tsI1HT

2-am IrFc6t:T=r-q:Ta$-qc;=fgea.11-B-a=.q'a*oT o1aoo?o2u


2-arrfa- new ai=s.vn21T Si"?-h53-?l
211

wqTafaT=:II=nT1a=?:r%%':~=I1(imT=u$riTao=iTaf$r=uesf
t1e=s<rrI *

3'61"! FlTi=|'I WT? ilTT1%'=<fT$=rI'a=I'{ 'rI'=u'. 1"m1x.


tern =r61Tr=IT<o'II'a'ra'arrHB11To'=ra|Ta% I in11==11's'=r
Fl ailra t - amt: ar '=lT'(<iT11 =m:T % I u{V'l'|"TI fr eramcrr
3FIf*'{.B"3.':'Til3T"6'1"IT I ?

aa:F1Ia%'5rffr9ra!13r=1Ta$T'*'M'IT6II't1ti1Faa?r
:rTIaTisranaf'r=iaTf<zrrtI

'|'QiHfT3'T~i?!?f"lvEiI4T11"TlWHT=f3|3N'
aI=a=1fHttwrI=tTa=Ia'r@saT=ffanfuiarf~1a$rTa.a=v$r=IT
auTas=rr%$aa'ntit6hrf3faaierii#sfaa'rr
$r3=nT%=I={fIgUTTt.wFa'Eamartr- am-rtTI.%.aaa1t
q=|1;f=|$|fc1y=I4'r~1ra=:T Ia=n' *;1TfT=|1'a=rrI~I=mT E. 1393:
yrvrf$=1Ta='ms'4-*{aqa'Ta=1qFnar?a:oTft.zn=Isfa'1T4r
"'|'Er1"o"|1|TII'5-'|'3|3

2- 3|TE1El- rTr 8'?-5. near sum 3'8-use


2- 3Fl{ *rm'={- fxefm ei. yam semgr-3-ac
:- eiaiii % f"a61'r - ctrtr ahh SUIT 52?: 515-8.:
212

=IT1qF=I3i}Ifaaq=ITa~cFz1=uf=mT?1=:T%515zzfaaaT'a=Ti5a

$T%aqaTasseirt-'aT5?qiar$Ia=1a'Fna=MIa$ir(1$a6
Tf1'.TiTfvTET3?l3lIT3~'I'rI|' ?ci"lii'1"q5(?|'6'r3i
E I2
$rftr:I11*ri;21arraar'1aPt=Ir=%|=Ifa1'q.=rrer'nE=r.
wfa-HF-IT. =rFtaTI-aTfa arf: H=Ir % fan? $ emit U1; is fan
arryTeIfq$c1T%=rasraIT%'.21 33 I

anIIiT=ITaI-HT=rfisq;a'm1'fa=dT~T~{*1'qdTasT
aTfae1Ta$im=aaar{T3:n?revir5I$i'i5Icrr%u?a1uITITe
1;-a$T%arra'tPr<:urI-a=saa:qTe'a'$ra11t2aari-izraaa1"~ast
fa:1s=st~nT->Fe5z1fc16T6ri5%aI?TITa1$.s=q=|=;-nzavr
EriU'd"5i1Af$F1T5=f%lliW?f'ETf-1HEE3d|''s
i7=I*415I=rF'lq,lii|?l'ii11iaE'l. a=ra1'$a=r'a:1.er=6Tl'I'
'T?i=r5PJF?IEE$16YiF=f={E'fl1H456T|'

F'1!I'-'EE1f='3FlfI5HT35W1TiIF5IEiI'T16l
$Ieirw3u1snTwT%'5rtr=1hffi$eil'I6wfTt':

Tv1'a-faw=s'rerIr=qt. n='raIna=:wcr'2rg%e'r=r3r
aIaasTuTart|*i=raq*ray=-1arraEr=raffaa:TIatt3raTa'a1<:=r
wiar6qa?qT$I*TfaHf:=r=rrzo"q=:t:zw=r=r$nT6*5ra1a*r=rI'f

2- 3lTif- HTr a'I=w1r'aa'r 5211.?-B-an


2- 1aaauTeHT- user ai$.ar2IT'swz.5r-6-as
213

=1sTerFatqa1eIT$rI1$uT|fI%v$?.usTsT=rtaniiTs<*aTarT%
q=r%arq*r3a*a=I=a=Is11:'$fRrr=f&|'

II'$gga1'Fu$ere:qf=r-rlfaqnrgqq
%5afa rsawqru $z<=rr 3. er? =Iucrr =H'er1"c. aratvr crrt
a-saTt'anrrr1qaTa'sfsqaafh;fa$Ia'raqaTasaazq=I=Ira
n?
5TrI1si61=Ia'r'a=tis=a=n a=1=ir'&:T-':&>=i1e11:aI=ITar#:
qT=x1arar$:T2:*e<ara9t$Fa"e'a=r:rurug=ITtraaTaT=ufa'raa'r
$H1<v'.1-'=Is=I1i3:wI'E=I5--I1%-EI1'l'r&i$s 3'1-'t$1E3v'1"T-SE

8N5'7'iW='1?I3W$3f3=IiUT?!=FlTlW%"lGi'1l
qf$ar'a$=I$I=raa=nf'I--T;ITH$taqaTHf$T6?uT
arIarqt,1'.1=qq=a'3tU=86aI1'U=ra*'$sTIiI=r=rYa1Trw"=I*{F4
:T=1fasfa<11i'wraT'tier=rirT. =wz$fa=qa1=I-irfase aI=HTa=r=ir
yfaftafi-I=ir$a"a4TrqTto=r$I=rr 471%: I irr'faa=I=Irirr
Iw$aamav$am%a11a=1-xfniriwqswmatl 3
5HrreI6i=tasra'rfTd%a1$I=I$=Ir=rH=IITI3HasrfHvrI'I%.
EIiFTHfHW?v5I$T*1TEHTETEi'TEl1T%lH3?T&i5|7IT|Td
tsvfnraaanafmanfqrwratdru

1- em-arTr a'u=s.e=aTr 5371- are-us 1r:am ozesu


:- H'{''l'ai- aw 5F5.ET 3%?-3-no
3- $I'Fef11-SET! a'$a's1Tl'|' 5311.913 ems!
9- snrrel win-aatrtr in "-WET sews-an surr siozee?
214

yfaesfer $r5ITvT=rr2I5IIaI11"{aasv:f<o'a_:2Tf=i-r
wmmwmwmwamwmfwf
at 1cr<aIa<o"r?ma=w5fqra=:=r$ra=r$T5zf=rsau@5aEI

name =af!1w5a;(rf=rtI'iI'6'TIaT?wa:TasI=r
$I'>v$ar"cf=rarr'euTi5n1sIrUT=iT=z5Ia. =IraTasr=rrqTa=af=r$
yfaaumfmfrmnfaexmt-- ttIarar=w'aTaraTeIT
a=r=iraI=c:~1F%1cr?%|a?z*d1I1f$T=iT=If%.1qa'r=$TIT'if%.
%'Ifr=ir=If.%.$rfaq*rT1'a%z:ErrfHuf$TI=ir=if%:IuTatr$
91%: c1==61tr i='1U'$aaI =raT' ?

1avrqr=rr:faac~rr'%uarTqrcrr%$=Iia=rav4T
rrrar$;:1<1$a"aarrtrI:vrr:'TtsTr=c%.a:%.E1&|-Ii6%2.HH1'r
aanft. aa3*11'1THIr4rre=rr=H:11nTo=r=stefTBIs11attrraI'
u$ET1iIaIwi'trfaI~'rqT=rHzT-atI=r&2Ia-*T:I1aaarre"rIa1' I?
aa11a?r=rr1aa~'r:s=szo'ra#=?r=rng1:FHaqi?r=rrdT3sa1rra'f5n
%|w1avra=raar8-km qftlnfttzufnaam
a=T<:r=rr=!f14=IraIT:rasaTa1'%ar6n1's'af.1aTs?.a'rBmasr1
- - - - -2I=rfaa3fa9tt4'z#'*cTqn'k|1za='anfaa%&aI1'a
WFIWTWEFTT6TGf$U3f$lTfH'fTTT?T3lIT'
sHTITwa=r%6H-7rTTi5Ha'rHri*Itdfa11ri.z:;fa'I51=TI

2-Asfaerfw-WU aias. war gem-3-3-u efruTr doze am


2- 11r=IT=1'- gm ai=s.a'q=I" 531.512: zoo at: o test:
3- MT? -aTa1:r ai$.ttr'imT' 5224.518 20E aqzf oze '46.
215

<1TazTaI=1r'1q$;lfaaw4Tf:'uznT=IT$Tur'z$Icrr%
E5Ti?G1'TfI#Zcff$T-TT@T$WiqlTH'ri5'Fqi5TIB'Hl'$
=ITa=rtri?Ti==6Ttr=iTart|'Ia1ua1z=rtr1=t==i%aa'rur
f$F3Bf'3F?'8Tq*fQI$16q'5i|'H$Fl5"?|'ET'':
w1ai*raq*ra1'qa?raraiaIq%r=r-=truTHTsa1Tn=aa'reraa-qt
W*raTt1E'=r1m'rIa1'=I11'U=Ta'=IEIfiH6=rfI111aTI1zi
IratI1'u1'a*=raff=+2:TIIt'1rerrfqaT=rfa=ITe=rraT1-sir
t:asIe'ra'+I>f'fI#aa4?ras6r'a'=rr?Ia?rIfa=aa~'?
fraaurwafqaarawdrwffqwffaafaaaqarzmnfi
=rtvrfqIazTtI13.eafc7zuTI$aTcrf(1ar=II3a$ITa=IT
araaru 2

WW1" * f5.TI-?fi".Ii'.

<i1I'cI$iHaTIs1aItI='Ir'c.TIcuT=1'~I'aIaa1"ei=r6T'4To

TFf"4=ITW3TWTE?fq6=lTf3=l3l3E6_I$?WlTf
TaE9Iir21=Ifaa%3rFIaET$IWtr%aT=raT'4Ifqrrq;I$Fr?I
3 lGl={T4?|"%T=rTifiFTa't16?5T13i?EWBTf=QFW1?:T
wammmtanawwwfway
a=1rEr6:==1Tai=f'I91arPi1aaIiEriiIlsfm=srr r
s=rrIamrns-4IsmTt.tuu1Faf=f1rn'TrraTnq1*Ta=r
an=rr=I1::aaf==aTTr6=IaTt?yTufrartaawrTafoaT'z=m.

ii-'~l"s'T=l-IEET a'm*4aaT sen are-32-3?


216

miwwanawimwraarwomvrwn
var$ruTe=r=rI3=traTfw 1 Faaaurwar $q;rr1-rrmu
1=a'rt=ra'r1sT1<sa=ird'1:c;ai=T%-1=qciauT6TTr\';T?raw
'ElT'FEl11'f #9; =17? aI11=rIr.; B. Ema af WT r: :'r3r-'51
n?3a11T3oHsfa?T6I'aTTwIaaT5rq.1qr{=fra*'I
a=afwT3Irrf$6nFwarfdnf%aIa=rI:=ra#|Tarr$a%aT
1wa%----- wIT=*n=rn1=raa=IrTrwttIv=IIarqnT=raT
T6Tt| ?
a1*iT%r1vzaa=5I?i5sa?aTira*crr5aT*=a#*F<o'e q'rIIaf
$1'%=I!TET=l'rF?I'r3.WaT=ITf1"1TT%|II6'TT'55l
aTwaT=rr$I'u'.IrIz;41=6T=rrr?r=rerr$r'F2uf$farra#$r=rn1.us
<r*.=r*'t=rafs1aTIzrern'faTa1'{!T=Irafi1n'rraIr=IrztI
zuwawIaa#r1sT1-re:=tur<9r'rnf- iI1'=x.=rra'nu=r.~=r=rtaa.
6T=sq1"<vTi5aIiTaaftr?T*rT6TaT|w&%ari1aai-uIt1=x;aaTe'
=fa"ft-=I=1'I1T=I3T'Iiu4wrEH$fs*eI*lTi:It1ot:r=I=5Ii=IT
nsdTt|dq=rrqasa-an=rraI%aTIrr6I=rrIf1=!1TwrFI*{=rr
wserrt-awuaawafeunanwwkwfav I
Ia1t1T$i1T!r=uarr-1Tta=nTam'uq9;amr=ITa1;f=IisfI=q=u

1- e1eria$fa6rr- frerrr aim QUIT S11B-El


?- mrsrr - user aim ET 5811. F34:
: faaarwar - nfvrar aim. ET 571aE'B-zxs
TO F 5?

tzr3aaar(TIa11qa'.v2suu'uTziwfu?rfa=err=rfuaw=rrwa
'a$I?IEE 3tT6d'T%-|'T3nr'1'4=I|'E'iilTiIITEFfTE'T1|'
={TIqa=r'1rr Garcia i=I=rr. f'{cIT $T~'1'@T"'l'l'I srrfaarr
aw aafrara =ITaI=ITaIf aI1c:5Ilci E. iHT= wfaa
=st$a=%'wr=1aar(=arryuTaaiIar%-crratwtasqs-aafwt
fa$e5T,fII1vI=I6affcnasr.aI1{$taf%*ITrW1{a'nafn
3:?-s=rae=nkawtfqqftwaaftsfauaquqafqalw
3iTa=IT$ruIaT%.=IIidT%_|6as9raisrrtfqIer6>cr
ff'i|FJ'l'|{WTEliFTf3:'WF|+I3lqfIE'o'f1$6|'|lT
irr=IIrsIcrr'|e;=r<o'rn1%'caa=:=s11-1r;atas13'r%I
taTE'=rarst=a1'ir=rr%?I:rsv<1raaMT=rrrea'rn1rir1'saTt?
$TevWaf:=4ftI?rf=iiItita=rr~e:WTI=rfasI?Iuai)=1far
rIaT=r$ITT15rc3T6*rtIa1=IT=IT=rTisa*fa1w9n3tI ?
aI=IIaIr=1 #raa1'I'1'rv1r!'H=uTar=rara?I'a1:=uarra~T'r7rTq'f1'
35%-f:qe*rTI"asfa5rra%ra'mfqaT=r#:TTi?ffI3atras=11'
aq=rf=Iserr$=rr=11ItrUIT=rcrr$raafa=r=r%sewrraTumwrf
15+iIt*'raaa*i=rIiz'aTu=r{T&aTuf{a=4TT=Iwa='1IaTT1T1=1ia
IaT=raT%aa*rtT%3TITI{=:T|aa3fIaaTa+%rtra'f.
6?ia'e.ft{a'=ITir,5Faa'ea.aii=re>frTrT'T$t?taTI:=rvrnafc
=aT1wv:T'x?HnT I 3

%- 12ma'rvnT- JEET am new sen T8-it


?- rI?W- EFIT aim vravrr saw. 363 ar.
3- HFIT ilT=r-6ITHT|' a'I$.3% ea Sm io teas
218

$1'1ffF"i$T.lTI'F3'1'HcTF-rilT=f-3?JH')WITFW
e%ar%|?aT=fr=rcTr5rrF=a#'F6~;a.avfirr%_Fqaraas*rn%.fm-t
nrs1=I=1Ta'fq;1E"1'T6raT1=ra4F{iIT -v:'r=rr=rc11$rI'I'r*1e
%zn$ra==rr=r ars':uTw=:1'(=rarWE.aI=I*r=i:nl'=nzT':rasrI1r=r
tHT=t$m1zaTticrr=raq=r1qaTi#5r=I$Ia$<?r&.au$rurrIaq3r
nrerqwaistvqradrt|iteqferay"oT:$?rvrffas:=iTq
a1?1vIa=I=vIrrar:T6'rT'iT=I2:aT$r=I1'=I'5n2T=uib'(a%|' 2%
a$rsIe=in1maaTa'raTt=rra.t1==I<rr.=1T=zTaf'(Ias%a~r-11;
83$Ti'I'n'='(rarraqu11q=ro'?sI? ITEi41'I=5rfTfrr=I1'
awwwwaaemmwffaaavvs-Wank
q=aqwT1FHTaif$Tm1#HI<;3WTI
aw511'=ITg=1F=I$fa?&viqT1'%l;a=rafsTaT?1vI1;:rv1'f$r
IHt'Ir=5IqHza*tII%w.aBae.1at|a$annq=Ia*$?'s=irrat'r=i-13

9=1I'tH*=tTaif*'I%$r9=1'%Ia=rra6H11aTr$a
RTE?!-IaT}rrf=a~'FaE=rerarr=rtTr#rr ireIIfr:aTvrnT&|a'=nsI
ynmerr =ITe:$f waaar yrwmasr. IIWTcrrarT'. urT=I1F~1uT'w'r
TTTFiFT9T1T}l<T=IFI3|T35H?1TP163'q?'{VF'f$TFU=T
3T"=d ear I m ffdi arr aarqfw =m;n arfsm 11 c{,E'5"'|'l'?Fl? ma?
$Tr1T6=HI=r|=ai:=IzIa=sa<r$afan'am;1=I=5ter=rraa5f$rrrvaz=I
@: Trtgva =rrI=TITr $1 nrfiaa tara aT1s?=Wr(f *3 am 317%

2-a?r1a"a%=I-near aim. ear sen 13-Ia-as


:ia1fcft<iI=I- H667 aka. near 5211 1,=,rIa-c-s.
3-3l1'(f<l -EH17 an=.trI=a'aT 53:: g'$*
219

T-ZIT-'-til?

aIr?=rta*r' arr ar?=IIrFesv:r=r fr nrawr

$I=iiT{1T'e'ev'tITiT=raT5IT'=6IT{=ITa7fa'HEGi$I'I1=Ifn
=1r'Irfaerr=:'a'raar% I am: wITa*11:aI%T=I=rI1er$crr%'s1Tan1=rr
maaarwIawaraa-rznqrgqaamn-f9ru1+rnfa
=HT=ti1"'ITr6*1Ttza5Iafu5IT=TtT=r$r<~;%Iaa3raTIIkT|r
$aTaf=rFa<Ta'$r"{fa$:trc=qasqTftra EMT? I aw
am =rra$f am mm afdam ta-urn aaf $T gar t-a1"=r
wTErr=ra'r$u$1%'4u?z ea 5I1'U1'rFc1re1Ta

T=.'I'ra'rewI.ez9=: tirar-u3sfc;twfar=r=1=:T@5
TITvI'icIfa:ruwT'=rf=werr%|t1=11a1m'vraT=:tSf=rr1t4f=Fr
Hfa't1T=rasI1s?-a=sTa1a=aWreITa&tan$TWIa'%ata#Iqs%arTHI
=rv*avT<o'r='Iam1TaTqie.$IaT2|=ITa$5ztrar1aaaT1tufasT
aatmkfwwwawatewtfewa
a'ra5qe:aITaI'(a?IE1:aT=1T=11aTtI? ru1aTEI=IT *3
Wvkmtmmhmwwwaf
a1'IuI'm'=r=I1=T?t%- 'I1fIwT$T.11=I~Ir~5v:T.aTatI<TaI1T=r3

2- '=I1'IcfTI =rra EITFWI : Ero=|=Ta;. f-IT! lTfd


33--*:rarI s=;*-UT r - q'te1=rs =r=a.5r-a-m
?- Wrrivvr -mm aim .'=rI'*=raT se'u.',T3-ac
220

a<==1nTT6wWaffaa%w:=taT$TaTa=IT#a'esufHTft$Qaf$f
r6fH1%3Tu1'f=raIrfdrtHiI1W3.ffq6:-I'I.
1-'I1"<~)"taaI1I1=ri6=r?;ra'T$IaI~H'EIW:I|' gTF6T=f$'1EE'$T
1suaaisTPI9ra1~'rf6a?:-=I==r-zFq4=TqarrII=ma5m'r3rirr
aTwrIaa1'<o"r?asftmrs"ra=r{%. ?zf1$aa%aT:aa$r =rra=IT
T|"TE<"lT3l'? err=ITair#=1aIT='rT.3a5a=:?=rt'IIr16r=sarrrra1*r'
aq=I1'qT|a'raTaiT.==rraTs'3ra?;rrE:aq*r1;aas1=sqraT"sw=(
16=1a*1a5%5InfsT11ra'rr3tl=fcsfaqsr|nzcn?s11I*rnT
3sf$=rn5=rrr3IT1ua:ras1e;'eaT=ruT|airaT1Ta'asaeirBua
'rriTa1iT'.=rf==1I:fnrr1'a'rsa'r6'ro'qTIaswta';arra?=-=rr
aa$I?Ta!I'aa1'1'T=trIasa=a=:1q$faeaHtTr.a'qr9nPetfauT
aftatrT%fe'E=rtrIatrarrufe'trr=rafarrwIwIyfaruTIz?ce=ra'r
ITti'Ia'?aTaa1'(aH=11*er=r?r5:Ie'3rtu1'rrrr| 3 '|'lI"|1R'~T
Bi-=iraI3s1aEITU'rfa!IITarFrrI'2IrI=I'e5 aniruatmraart
'=IfiH{T1f*ItfEo'6$ra1=rr*naa'@I5=nF=InT=rarT3'ezf=Ia
='rI"aa=mf$Iuisa"1'| 2n"a-rr=r1e;'r<rr1='I1'rT11a<zerIar:-rm
a=x1hra-'raIiI'I$InT%.---aw*rrr=sd=111rra,ar|fiierr

t-1axaHTEI=I'r- I361 aha. near sea sE"3-6.


?- feaamr=r=rr- EIT aim srrr sem=.r'3-'5:
:- 1zmTa=IT- - is ahr. urraaf ssungts-aw
2- faamaar - sarr aim war 5311. er-3-ma-u:
221

'6W?a$r=1+r=nte:1=r1fa2e1s:=ra'z.awrwaaaamara
TFTT*fT?Fr*'I5I5rru1'fa?rarrfai-*IHBT'qaTf=I;Ta'T
W6! 2 ";'I1''=ITarsII3=ir5ITv1'f$r:r|1a1'I%=IW:a=:=iris
<zx'=I11f=1rg"I1=<Ta'=rPuaaTrrzrr=zT|fa@5I@fa1}=.v1a':I!TI
aw arr I1=raIrf<6r=r$r av dT %. W? are wast 51-an-r
asmTaf$rerr=uarM1=f==:T$Iae$aerr&-awtIaaarTarr<r
$1eRwrr=r=rrerwt:IIs'r=I=mw&+? 11WTf=r=h#s.amrt
'1t1m1-wirarq*rar=u1=r=fraT121z:I mnnaecwa-ma
raarlriittfra-1=r::=uaTf*411fa:Tas1I1a'cmrf%Ia$wfa!T=rt1
11uTrr";'$f=raf:=ru=rarramT1qza'r$|IT=rr3I'a.<1rar
=rra"tzt.ITafTw1"amarf15nqrrn=1=Iaa11It'=rsI1rtim
=aafI&an=a'rasef'anIItran'Im1.twfm"Ptastaana?rarn=h
fa'r1aa=?ra=15F=rWta*1*ryTUr=IzT4=Iir6'*r&na*tawas5rFa
aq=rr=sa"auwro'=ra'FITtI ":Itnarfw1;=rufwaraIwfa'<T=r
asra=n'(a=!1:Iq=:Ta'rt-sITv'rf=r?rIrF5=r=rtuITvir=rcrr
5rrf=aETiT%Ia"'=I65Tu1fiHiTafra$1I=ztI--11aa1=IT1is1
$r=i1=I=I?rn1'1a@1erf*'IITf<zrrarrcrr%Ia=rI=ITaT=uaT$s:o=I
{$T63TF3IV&"1E3l3I6fi5l?$lT6'H?iTTlT6al
rtraIr$rTa*r5cc1r<:'r'r1"wr=rrsr:"rWI@Z=rua=rrt4=:T6r$Wz.
HTcn'=1'1'a1aaa$EII5IaaHa'r's%qa=rIhl3=r=fT3=r$

2- 1ezauTEr=rr - 3811' in . RT $313: Eta-on-M


2- famarqar - 'IFaTI' aim =Ir'=mT sin 3%-as.
3- mTex=rr- =rr'aaT aha. afm sen s3"3-RR?
222

=t1'aa'8r'.tIf?=12Ifti4'rT:r=r3s*1qas$r1<i{r~4fs*ruT| 2
\
aIr=rarr=I1'=1"?arr':nI(Tz1='rr=zeFr1a@~a1'1s- amrrrra-rg
5It$rta1'=If%1asrraqaTvaiwt$tarIv11i1Era?r<1zf$f
=r61afwf<uT?anTas='tIa=rteFr%1a=n'rqTas'v.1za'vrzo'r
'aTHI1ruT?f6a=iT=ITfIq'f$qeTrr1a'urra?rawewT:TaT3twFa
mar: ? :$fae<xrq*r:T1aafavT=rFe5IIT3srI'r'<Tsr=Irr
3"<1'EIVFT9'5|TTF><T$1'3fZFq5II-qd$I?I3---l1qETf
*1I=fr~'x=ra==Fmz aIr13,=I'a*r'=IaTnat1r'IIaTcrr?*ItaI19, <11
fdTT1saETWea=IG6if'If1'q$Tafa1#:a1q,af7I1i=6frH3I
iH3taw=ra'raf1wl"e1HTT13'arw$r=aT=rTar$f:-:'eiuw3FH
a=rIT?iITf<|uutrtn1rqa'aT:a==IT%=rfr:T6T.%'-=r
&frIT9t%ein1aaw=na%I 3 =Ia1(T1'raa=r=1TaIfIaa$='
rraq11f=r6n'T?a1*rIa:T21rasaaar'2IrI~"rrv'rr<o1'=raa%
wvrirrur -rII13=.[f=I-:eir&ITI~iI'lE:T==t1'w~5rI:1=!a'!"r
aq*rs1*z1Fa?uEa=tas1'ra4TIasTirf'r=IsaT=5I.aI1rftPe:'9r<T1:I
i?;T1'<'FTT'!i*i$'QI1iT1E%"5T1Tir'3i1T#fl1T33o
nIattu11tarqr*u1taqif$fE=5a11I|=fT=r$F.1T=1v$t$$I$
=rII#r|<wa#t=rrIaTas1a=r&ns!rsra1TaaT%I=nf!1warr
gaurqa;-rsn*eieriaasra<o-r&rarrm1*surra:raafrwtu

2- am - e'aTr aim. efrqtr 521:. Ire-an


22- aIr=rarr=IT=r-rzaaTai=n, 1lf''IHio3'53-HE
a- arr-r arr an - weir aim. 13%-an f=<fm o
2- IrrII=q=r - cmrrr Fans. eiTeTr sen. 5r-3-=2-cu
223

uaairfastirarrarrftttn-<o'arar=r:%fI<=terrIT1Thmr
aTIf=Iww3am1uraa$aTwfca=i*r2ro:8-uEsnrti'=r
1rrsIntqsc=rauT'fm=r%|a1=ratIa1~rIra@FIV{%II%1a=sBs%I
---a1a611rT1:=>tauL=<1r3t11at1F=Ita1rT{?'r&I
--IrFe'r;'rwt:=raTe7rtrFTU1THa=TwT'?:atrrnaIs'dTu5It'Iaq=ir
a1'qfar=rea'<fr%IH1i=r6fa:T=rerr1-ta<3aTi=n:rra*=ITqaf
waataaqatqadaftaaawwfrvrfafcti
I=rsfaT=rdTf$atIaT=r=ITrt;$;aru1'fx%ust:irrr'HTa'rr1ra$
ar%iT$TqIqT$r=R~na-'(%qTtn1'r1g~11'=1w3aT%a1'(6w
frafaitcrrn
7r='ar$=:Ta1s1tt:a=:=n=rTIdI*a=rr1I*:rf $'l'if'TE'{T
f=I6P1=6'1"fITH=i'I'=rra1'To3IT1Talq#5TUr=II'friIT
fastI%|H1rP==I11T:r=rI'(=IT1(z21a-?I'aT:s*i1<rr1'T%-
fiat-sa?rfrtI*r=rrtrf5n=fraq=?rwfa==aTaIha==IT=r a?rI.'r'r
arI=r$azfrdTaaq='aaTIfa'r11auf$u1!IT6I=*HT6T5I
H-=rrrrc'w' aqTusqq*r=:r'uaT|fTFa~.fss=Tn61rr=?r
$=:arerWaa=ITT='U*T=1Taf%:rI"uW?'6T;Iaarrq1?s=rnIruT|
3f1'T''IE$F:FvTE$E&@'*5Il1T1s$r?T
uTaTaf=rt$arfa"fr*I=ITc:1'm#~'I ilI3rB1"~'16l1"T?l'l"c5'l'-
dTf=sI1'1~aa_u1a.*r12marFaaFuai-*rTt'n9TvTtrra$tal=|=n
uwmgrzawwwmaakdmwwwmm
aTr1T<:5=ra8f$Iu=5a??arrFa$r=.a1'u1=1rtqto'E$taI'
If1TuI1fT2frwrraasaaan*rt3a'fafTwTa'qaiI'wf6&iI'WI

E-'anrt-Tu 5|-51-@'I;'--:31-El-{T-5I;v'.-=.L;T-g;'q-'.l*3:t; ' ' ' ' '


2- am vr HT-I - near aw. 315-33
224

i;TrtIW6rTr'fT#e1R:fIfe'<r=r$T;raI%ra#rra5nT1i4a
afart-s=Iari=Iwr=ra1*tar?==IirFtv'raT=r$=1Tra?uTa1'ttqz
Tl?h'%l!d1i=IIIi=i=I$r'rf3*T 2'a$5rrU1"l5I=lII%1
*i'?Eirt-----=ifa>1:T=nH=ia=I=rr$I'ui5IIT!5n1=aurTarr
1fTVFFlEITl3oF$T?'WT6'r=rTFW1TW|'T%li5lT3l
a1"uI'r1anT'?iiT?nI IIT$r%.IIBaw4I' =IT'Im=I1$aT2=II1=
arm?-qTrrasa1't=TaT8n i||l'(I'161<'|?-'lTT7|'E7''l1"l'Fv:
$art*=nrfarr=rasr5ITv1TI=~nuvT'=r1=Iacrr&|am$a<1r%-irzT
%anurciiaT=.re:Tf6eIaTTuftztea*IITHTT=a11=1TuTfI5ira
PIs'~'F1'I? 6=iITdTi'=1Tf*%fe1"a5I?E$IEiT%;fa=iT
wfaa 'T'=fuT aw 9': am?! iTf6i3TE'T|' aefrtfa arr=rrtn'
tIrar$r=mr=2a-*uis1=1rI 3

3IT?=llf6T=lFlT5'=lT53fHf=l$E6Tf$r6=l=u
asuTaTa1saTksi:ta'aaT%rasnf=:Is?ruarfq%:=rcrr%a
az=r%f=I=rIuT15If5aa*rtirafe1=IsIrft~:1:T=utr=I8. aa=ITsrm.r5z
a1dTt|' 3
=a|'s=rwdsaT$uTwaTa'z=r6raf1T'{r+"I'f
aEruTnih'(aTaIt1'6nTvTa=I'VrTa%tI&$aat --

2- arrcfa -umTra'I-is. afar sen. 518-v=:


?- ant Irfarzrw -1":e?m a'H3. 1l:aira {H.518-W
3- W Ir16<T=t- gm aim qh 'hY%?03
8- 5I1d&I'lEI - xfrarr 617$ 9 =mT' sen. EB'-W?
225

=I1'e?1f'a=1aTa=rsra'T<f$aF<m=t$tn'cv'a*n'r3=I==IT=T$ITB.
Fa=6f9r=?Iar%tm1IIwIterci%aTtIf'r$fwrra=If=<I3s1a=If'UT
amtafwaswerru ?2:a1aTfua'maTTa=iraT'aT1zas
m1af%rau%1aI1T=I=Iwa%I'T~?rT3~'Fe'uraFFHrfe<T=rVtIT6'
aa1rI?3$aI15t1f5I1aTIerrWrarrqTaIaaq111'qTIfIsr
arerrkl Q
:rqq'aafInrrtrrf%<==I1a&1-s3z=ir?raq=:'=1Ta15f*I=I1'I11'I:
rrwfrncrr%:5tFIarFa<rwa?rrvaa=rn1'a=rrt:f:fa:rfvanTiIf$r
ai"T4=I;reqaf=a:Tt|

111,=:I1:qTasrst=.ra1z<'riza=a%a1i-*tt'$Wre'$s1:*5I
aaTI$rr%wa41aa'raqaTruT|aaasTfafaaanaqTs
Wrri=11I$t$ar$aaT=rf':ITt{1'aIaTarT=raTrF:'raa:5fIawfrI
Tr11'qwaTarfaa1tT<1=t$1aa?3t=rr3raq=t=rra$f=6rFI=ITer%.
a'TeHfrq$rafy=iT%areaa%N$rW 11F-m:IIT3I
vI=a=i*rdrT-;(fqarr5Ia'=6f=r1-:ia=:T&-5r3raw*ra1zarfrrU
TrTnar$m1:T$t#arru-awwrknusarawrfraw
TI"II*as1'<8r=rz't$arrFa%I 3

2- slfaerfw -a1'enT ah W 5311- 3-3-22?


2- Bii'|'{- Tear aim. ET 511: .3155-as.
3-Iatavhr-Ifq$r-afmotew
aq111ar=u$T=[fqasr*i=ruaTaTatnaair=ra'%-
s=n'1'r q'r=I1'Iq-1:3. F3i2rTci*F'u@l~1T%!I1i1"TrT3Ig
Iacnr:r=r r=rr=L1"=wr9ITr~-ir =ITl|T?" war asvla we-ra'r
t-=zsa!1qar=tf'Ih'rra%a?J6u=ITT!1f-as=rrIc:a1erTa=I=Ir
arrqttI'*ara$<;w1tu1TI1fai'HItInfaITI %e.$r=rrTa=nsv$oT
$1E?'l$TT5f|.

rvrqr=rarTI11r1a?riiSI=fr1'r-;TqtarcrrarrtrhrUT
=FT?IE1eaaTt- '(!"lf1'l1Y*'lFc'1'Til'rll'=l'l'll1fI4-71'Ell.II?l
a==rT1r&I6er:tr'$<=ri5:aa=afaTai"-aTasI*a*cs=ITa'Trsa
%'aTaIqa6Tr1,=;Tuv2?aarw1'1qaartn='a=raw%'tfq3T1q$
1'F$l5f3TRiiTFql3TFPIf?T3fH?l_TF'f"?$'f
T1'1''W?|--V--lq3I{T?3='f5lHTT?TP$?TTiTT3Ii3
a?'Tar1mIa-'cITI1TTIk=tTa'ra'aT%I""=:*=I5Irr!'(a8r
Iafrrafg-53%- a$far1I=I==rI*I'T$rIz=scrra16q5a9TT'I
BsrTra'i'I1a1:1$mf=lsar$qvrwaTH$6iTnz115ITWT?5fH1aTt7r
$If35B!I?T'TrT<1l6li'35|TT%|i'3f|"T61iITIiT'i|'
aTa1%T1I?vs21iz1$T9n'c5H1'Iiaata$rraiFrriFITa*r3'I--
u1<\\.asTtarcleaI<1aTtsdTciqvr'w1'tqarTwqTaa-*(a1?xrr1Ta
=ra=r$I=rra'r16EI "1rIqfT$aT$=Is?w$=I5I1i=Ig5I<1'=r
rr1er5==aTfqaz-1'1:-53%- *=I1'ITv=n=:raII?a'6'rI'1T=rrT1==I1(?t$uT

2- a=:IIr1'ar<r=r- gaxgta-3 ymo


?- ai:r=r- yagemgaqozea?
a-1"eI1rw=r -WI.-;r*'Es =-e jaqo taut
8-1"|91='{-F|T'i'47=F E: 563-: gm do 28. In
227

3|3l5'T5?IE1$T3f1l-a'&I1iIaT=rrr1uId1aItw1%I
tl1'$'c1f1=I1FF*3-1dT$iT~"E!?Bf-%l'TEI17'1If6"1'?E?ETT
ea:-4TeraT1=rarT=rafrnnrT cr'rfaTa'r=frs=rrrra*c.'|'t
=r:%frHr$ar|a1-asi'IqnT'3sar~11't'II}aT=I=rfamT%
I1ca==rItei1n<rra1-r=u=1waar$aT=IvIIvasn%%iIs=ia%61*
2IiTfT|'cIi71"|'F%I2I1!1$|"1":TFfiFlTnT1H?JlG
ITFtF=I1IwcrrEITTE1:T7r*et1Tf=IdiIFIrasT:r'1&eI%1.Ts-

Sf! wfma =IT=I1'=mr=r I11 $rf=r6r=I $T as r5u'r1.'r3 3 faarfaa


wrwwntavtgqmwwimwwaftaaw
'fl"<I'l'l=l'l"S"T*1'll ?sIfcm1a qssmenwamfs
$T=rFrFI1F5wcrr$r=sa_<IrIerr?I "43il'T{E=+'ETlTiilT={?':1'
dTl5lETIi$T=IHf:1id3iT3'EiT'PiTI|"1dT7f'T6TTiFI
as|fI=.aTafT6rFrtr$=Ir$%qTaT-*(br=a'f$ra1
'?f2l?1'T:'$$3TT3qVFf$??IQT1}l3f'FI3q='E'I'
ei1'dTa?rt:-rra:t=ra*~ra?=r$IarT6r%|nnfqa=xartmi5ra=%1I1E
IfT(*i1'fw=F-1=1sIfaaufa'1'tFe:nT'tIunr'ecrraaise'?6r
$aTT!ff'Iuf&QasafT33'3{Huf1![=keiu53$r3fWf
mawcfammwfwrml "2?m<T=r
TT'dT3:N1'FTlTlqf$T|'FfFlF?FT$JTIi|JHTaTr
$T9Tv1T<1-ya1astTrIu1a??er=1=a%*=ITaTf:wF$fa143$rT

2- ara yard:-aim in nfam sun aura mm tau:


?- M- 5m airmrraaf 52?! -'{-a- us
3- 5Ifc'mT'a: -qaar 5I$p:Tl' 5:21.918 ??-?3 c1TFl'|' o 28. ma
228

E=rFh1Ta3Ia5ai1rE.?o'F4s=Iarrf$rw$setaiiIaIBa1(a
rwtammoanwtswvusvlhtwqa
$fafaa1aT!:aTrqUT'e1{T1;fae7F=IeTra'TerrB|arraTaanrt
ten!Hhv1'3IsT=ITiu'T16Izs$ir1'I'=rT=ri'aa?nT+TrIETaT
ar1TaumyraasrItFaeaurrs+a11inaara:qfaa%*rsnas
91t?anasfEasara:u=4=7='Iaf=I8=ITtIauruva=rfsTnT1%s
w6I*<#Ta=1;af'rf!r&aiT=rrra$r=1T=:q=:'=rfasarra1-{qsrrrtg
atmuTtac11'IsT|a1'{arII =ru21arrcier=Ia'rji15TI'=IaIT
aT%trH1Taqa$r1=|;TaTaTT6rI'2TTV1"rew1TzIa
ifdaBf$=I1TaHTfaaftan=rfIasae?r%-mT
ap'aTadTa'=Ja|q1{qfIq1asItrrwrE:?*a'rTantrrIW1r-Btasur
q:uaa"e=Isa"qT%-tzTuaUr'q1-(aEasnrtI1raTII
=nTa$r3ri$1=zfqq#aaaq?rqaaq#TqIITdTTan=?rF%rrr
I'1~fr$t'TTaT:.?.twIzis$t3saw?aE'7T|iz1o:HnfHaTnI
ew=brIrr $7:-t <fT '3TI=h12tTC*5T qartarr =Ir=rT' rrrg
H331 s3a1"aaaTa=rr "=~\T.Ta";. 1T'[nfT n'raTi=wwa1'a'r
whrvr ana 22 avacrr 3 - Hf?fd$ sa #1 ma
:&:ras1*6T%|1I%aT1TeI=fas?E~$TFav|aa%aa'q1'qT1a'trra1%
Wtmmwrtqawwu1a.%rfaa'w11r%'rTa2zr3I=rI
5s&$=rf==IfwrI$$W5im'Ia$y?$$f3tI-Hiraci.aI'
9$'rI31=rnf=%I'4"rf2:'a.1T11a2rrvuTaTf:%*11=TI'sHTtT
w1a=rf<uf*'rsIsfnI'3iTrrtIa=ITa1'f<a=ra1T=r?-z1$'a=1'<r

2- en'a1<T=r -ttwr aim nwr 581.3%-:5


1- FIT TF6T=f-TE_'6'| aiwzsar S8115?-20.
3- alga qifr-yam 5.3111 .z1w;r-E-2=.5m=I eozexse
229

=rT:1'q'{r'rr1r=IT=n1T%crfasf:f*rvr$T1-'-uTri~'r3I'ITaT1n
-'51 I =IT1:a$=I=irfvrzrf9tu<T#Tv$a1(aaUe:qrIaasT
=m=rrasr%I

ff.ff3..'.3." T fI"T

{T,,*7'11'$1TH'iT=lT?I{'{*lf3=P6E4i'|'Vfl'3ff6?;
tpw=1taicrrar1=~rr=HT a"=1aTzz=rr=r6rt I 9=1"r%T=I=rr=rrai'I
W1Ta$IT1@'uar'?:T<a=r#r?fs'quanTaf$&natu$$rITrFa
qatfar I 1"r?a21=61aIr=a1(15l=asdr=Ta-;II1iIiIT. aa:
TE""53lTT.iE|'F=|fiFlH|"!IiTT"5l?i'F1$|EI3T stirvr
ymaaantaman IrnrI=~r-I .
Fumw . arrafcz. Gav: in am: =rra$f as "l'l"5-11"-I tr a"%f5r
1a=s Wan Yi'I' arr aITza'smT1Icz FMT I 1e=1$a5-=nimrr'
fe11r=1 ah fa;-ma $ an 5: SET 31 am *3?-:1:-:T'rzw =.Te.$f as RTIT
Irr=raI n , '<35uTa EIrf=f$ G1&WT,cnT tcia arr H=-.2; fazn al
6Ha~az$T3qa<'=I*IaT3:r=I*1ai7err=I$aTq=ra ?Is'=Ira=-4=t
Trtr1'T=Ii=I'i:*-rr1'rar-1*rq1"..-?lsza%.\a,'=I1*4a', $TTTe'=i~v'I=rre

Il=Tl"|'l' . am as rain amt 1% sew? Ii1'aT=r


t.a=r='rT1w*r%: ~IaTs$=rs1TrU1T14=Ir1<?*narrIaa<o'=IT=u

2- Mat: m'er~n'. 9%-=0


:- 1a=:T =1Tai=:raT7-d 11 raa=r : rfm '(ea1=i"r.5'I3-:>\s2.2eau
3- Trr=r=ar=r -gm aia. ET 554.3-at-36.
230

if<af=sTeITVr%$Iaqti1er=r?'I1rwfiz::aT=r$?1=I=i%IzITIa1
aT*taTreraa1?'Fa=sfwn"eFatryt;1'aarhzaEITiI:qat'r
amwiztlamwfenwwqmw.
3'(T={T"l5d'?{1~sl$9fc16lTT{'=lT'5I{'<1=lTo :r=r#rErh=I'u'rr
?=FI=trfas"e'ErUW=zf: 1r=5afa=saraTfHaTa=rzrrcrT*rIT
aTa=ITa[tTTa6I1'e*rTI'*arf:aa=IT=iT16=s=31ea=Ias<rr
ah Err1q%afs*w'LaT a'T am; $u w1:a*r% a 1a=-qwnzaserr
$=rTrir1$IrrTr *r5a1=r6T=rar1a?r=r%II-'Fl'I'
=rrfs=s1$FattwqTarfeur1qq$I*r$TtnT=ri11=r$a1=u=r
r=rTa$e:Ir'ar{%r1'a?rq1;r=i=Iar=mTaIrIaraar-=eIcs
qrr=uafa'1a=sr.$Iirew=r=1TaIIT3iars?:'q'w1a't=:?:%
rrrI<1m 31<:sTa$ Vwlwa rcrtr-ta-1r=H=r=ma1x afar:
$|'F|UTqTT$$T6T_iTTiT$TWUTF3Td$W'i3HTTT
crTrasTa'WaT|1a=~5'5Pe<a'=rwaTisfaEatxqsr11'ra'vr=ra=r?r
=viI'er=ra?rIrfaiI<TIatra=IzI='rTT=IrraT1=:"r:I=i=raTv:Taa
arIvIer$=iTs5TI13TP:I'?f6=safR>=rH$aT=r'r=iu'tsIu?=r
Wf~ai1'3rnzTarqraIWaasT5r=r1I9=TT#y?re1@I$aiaIITaT&
i1?Y$'T6'T?PUfi'fETWIITliTTT\fTF$T3i''?ZP5
=ra'r-=rIr1e"<.T=I'rI'efarI2=rTI*IIIT':TTr a'rw==ra:rvIt=t'I'a=rr
I%rrIiuT=I1'IaetT=IT1eI11T1%nfi11=r6rwIr1a-2'=.'r=1asTa*se
a1't"=1"r|'3

4- 1za=:uTw=tr- qaar aiaafvzr sat: 95"?-?&


?ew==w='r1-=5nT?i-aT21T1=i*ea6IT,2eu?
3- 1-'"-'--I ='H aTtnT a.aTa=:T' a?I.'j%-2?U.ir7?IT lo28.'R
231

Sr=?r9ras=tTas;'na14=zrr1asawa$3ae:'=aT=rea-11'taf
8lq=lT1=fH'H=f5TWdI$znI1=6"16l'QI"1T1TI
=rarduTTr\fru1z$aTriTe1T1=a=rsrnT|I1ae1Ta=sr
IaIrcf*11Tadfrarei?r:'ra='Taq3re5=bTaTGITI%rHnIF=raTE->'r
qT$|iTETTFiE!=i'lT'l31fF15=61i'iTT''
?ta1?aT?Q$auT%aT:-ra$rnt%- 3i'IaTa$4uf=rs"r?
q=aseisauTFerns=1%e'f$r%?auTusa1ffI'1r=rrFa=af%'T
arr=1TqT#iraT@:.6I1t1a<6=ITa'fanT=r61'?Hsts1:=ls=rr=I1T'3i
%e,$3=utTQ~iT=rFe'raI1qt1 qearai'I'esI1%Iv;Tii.1%Ia=ir1=Ia*T
an E6 E. xiwan 11%. 3'{$TfTWl'TiI?-1T'6lTT|'
asTacrra$=mT'?auTa*er$raT=rai'a1T=r%I"u1TTT=resf'aT
H$'<'1TI

ytir%arc''acrr$arEITIIT%:n%fa=rI'u1=r6T*r$r
<a1'{1aTT=I2:TtIaiT2aa;r=rarraT?uTa1+a~acrr%
dlfTT67T1'~WlHT*IfR'51T|'H$Htl3r3.=fT|1Tt1$l'E?ilT
arr3rassrnT=t%nsT$ia*'ai=)a1a=T=rTIat:faarra55rawr*csdr
yr=as'?Iaa$112'a'rgaaftt:r|-ruaIe:TqaTaT=frfaua:ra=f
%a=f6aI'Iw=rf61rr I ?

5=sqa>nT=r$rqra?3rraru=wri3=1faraT|;Ir
1'3=1a=1*tasI1T'aTrrT:ta%a'r$ '=.1qTe$aq='I%ar%|am#r
wtrfem =ner=1T=sl 3!-'F{16?=ir=f rr1*aar't=TTTv=na

2- yfaenfw-qra1T a'F6.=rae'r '5-2?-"I 333-tot


?- i'vzaT=f- Wear 51$. gm s:II.9% ao-at
232

wrt- 1s'gaftqaas=rr=r=I1'Ia=IraTa?r=Taf%;I%r.:rI1q1~
%.<1tI1"w%. '?'E5|%I.?

16=qFx=e5=IE$a'r12rr1=Id?'rI$$I!&ra=5I2:TIIa=f
1IIT6?IqIarraroI=IT%=rI1;ta1e:1=I1-1IsraT.;qvsI
1-'I1a-'~"=II{Iee11t"'!Iasrrtgr=I aEaIII$'rar=IIIa=IrI; =rra1a=rr
FII=I1eIT13Is1ta1r=uTy15'aI=I=IsIIIr6cz'vI% I ?

TrT:I1z$qTaTe,.za=Ir=I$faE5I='IrII1uhrrsI=I$ra=a'
arfryvarciamraqaa a1'=re7aaseI=12srIa=s13IaIq=IT=ITv1r=TTruI=I
=I=Ii5I=Ie"qIFcI'c1IT%Ia=ITI1I=I$r;IIrrsI=uT% I 3il'Te%iT%
1-aIs*eHasI=I1*Ic1~Ia=Icrr$rsTv1'r'=5ItI%xr1'6rn're I aa%=IT.:$f*'I
5I~'aITeiaIarrIII2z'=I $(IEI'r3o'a'aTIWIn1I=IaI'r ill?! m6=IaTc5aI=II
1=Ira1qaa'r?II fz'IatITa=IT 'r1eIerIvITc'rgu'rn'I'I<1t'IaI=I?IT
a-*r12I1'rwItuTf=Iam't=ITeIT2sartI5I=sTsIei=IarrIrunTa
wIarr1nrr,aIuI'=rI=IrssnTeiiI$sI=IzI'$tIqcrFeIfrarT11Ur'
1qsaTcI%f$1eIw1;aI=I=InTIatIvrfa?rf=rr7wa?'t3ei1zIt:rmT
I<T%|6seI:I=I1'=a1iIiI5II=Ie5aT=1T!=f I I1=I=I'!I'=ITeII=Itr1'r:=IfcI

2I=rr1I1=I3iLrrfr;?IJ13Ts=ItI'ItI=r=riFTGI1i. iI"7=1;'=<I1"I7=rr1:I

2- am r-:r=I - qefra aim t'I=IvI sea. 553- 223


?- I6==IT aw Ii-WI =ITe.as1 arr q6lT?F aI=aIq=I- arc W tn =r=a.
gm-2 o2.;I=1n oiexat
233

Ta1v'a=raa'HTa;rT=IIaT6*I=sFa=I1z'v3t;vTar(a#s.'t=a
vrywq fr 'zlT6T1=E=1'T fr am-7r W =|'F|'=l&'|"Fl5 w=<=1;=a
1q3~'HTf:It1ra1?1=rH$. 'I'6'7"l1"II1 twafqaa
artrs$ra1"atr1;m? \4$*rr|qsTfer=Iriir(T=rcrre'rTEr
arrIUT1a=q=Ia5|Ta=:8ft_twu;rrz6T|a=HTzw$a1"2I1a=r
=rrn$v'rr ET I :1-ma Q7-art am I aw-1TI%r awrt we Ham
3 : =rasrama-~ar %|$Tfe.$T1.=. 'c1'T(iTT am Fqfama-ma
$*1'5TElQSl14'c5T=lET1'Q.T|i11~i.G1'11Ei?1$$T'FE
$11a=IT=IaT'$r16atrrEI=IT'a1fau4?r=asdI1'f1'raf$rnaart=r
3sfacr?I$Taqara1w1;atf=:a*acrr%-a*idTqT*1ITwq
aa=mTeT tranauf urafwf at =11-cai~($. arm #2: Hair
rrardarrfaa $I=lT6'|"TT I * dag ;mcf=r arr ww c-ctr
asTqu'w=:fa Q arm afz are 11161: =51 rm-W mm Jrvrwfa
a=rTa+zrrvTciar=r1'a=IT=IIrw?;aTtI

e=If\iIaaTiIsa1='tv=qfauaTavf=rrvqnT=I=aIfa3:qTf.?u
asaar- wfwrrs--aaaiw
Tma=aisr$a('IasfwaT=:faq$sTuf5rqvFaIer
arf3aurfarrcir%|"=I?I'fatc}=r4s1'1aTrfTv?rTmi'I5Ia|T

2- artm-gem ai==wnauT 534.313-2?


?- wz-swan: a':=s.erraaT' s.~za.':=3-Is.
3- wq 5nc1=r - c'aTr . TNT 5421.3? zososmn #0 test.
234

asfaeur-W(Ts"f&fasITsnT4I'arsITavfe'snITuarrta
qT='rI6trF<~>a*erarr:rt1z'at-5!?-ITITGrr#ra1asa'1aa6I1T
aFaaarsrT$rnTa=r$tTmsarrwaas=rafI}1a1T$arxrr'mEa'
*'I4r=r5$=ITa'r:a%Im$aq3rqa1=I==I.a=r=iI'atrarfrr
3| aaarnsranaaerrt----%$:$Twfaa
mrrrraIra=zwrtIwIrI=rf.%aza=L?rerfaaa:rryar%n
srrzntl trvqrmfairrtt-UT#qwa$WIaa'9qar
af'{%mr$r6rTTr=iE1*xF*rasTerr%eriierrc1u5:9=aT=TTriT
<Te'=rfaarfT6T%Ia1TTiTd=rafHi->1'aa%T(fra
IHf$16H3iT3ifEu'fiFF11'H5TT5TfHE'F'5l
wavrl? tIrrwraf*91I111=enasTaarr6rqTe'qrfaTrex
sn=a$IEsTB-'aTrI|Taq=raT=ItIanrsIaT'rf1I*cmvn-crr%.
a'TI~i1ere1"a=rqI&a3tarraft1arrI=ru"'rtn af=rn=:f=mT
iI~'I=n:1eT%--wutaaimawrraqwawagma
yarrr3n1' 8l7Tl1fWf6T=lf $w=rI1'raTaIf =rarTr~iTarf aft Hand
arra"r21qa"s$ta%5=I11r'qtaer=sI=fTnyaTwda:Twa*n='
==fa'r=ITfaaITTa:n3Ns'cq=r$T=rrfqrr$I$IIaasaaaiaTIa1*-HI
Tmarrarrr? "s=1T'r:raasTf:'aori:aI*aaqTEasa+*a'r1ia1'a=r

2- a:a' t<i=r- atrrr aha rgarr 5321.333-~93


2- yarrewdw-awrr ahmqst->7 537-I93"?-E.'=-EE
3- wrraqw - 1:567 iii. tram swap:-to
2- aIr=r arr nT=r - traar abs. TE;-32 (mg mt:
235

faaritlsdr 3 as % am qz.aITfaq $m $r =i3Ta=r I safe!


are$a<rr%-=1Ta=,aTave1mr=r$T=faTacrr2ia=IafqT
aa#r=rrafT'-mT$TI11FtiiaTaa=ir=iuT=rrtm.'crr% :"m
a1Ta=ra-?I'=:rart?u@ufqI'a:;F=r=ITa=a<irt- TrT'16T1ITaI1I
Hl'TEi5TfYGiN%"Q'3T3lBi'r$TTra"Ti5'1T$TEI=I;a7{
iW$'?'F'TI=lTTT3H$q{14'SrH3iHTEi,F=TTH|'dT=l?~'f
arrntl ?16=e<.T=r$vrFa1uwtIr&i$T5IF6%i5'l"fWT6FF'1'a
a1m'aqf=IuTt$a?1%-' ma i'r=I14WTriITaIf$6T:'ft'I
=rfuaaauT=IrTUr=u@:a=qa=raT@s1aTaFr%aT2z*1#.:i=1it
3'TTrvnrII=maIT=IIIT-5I=rT='$61"r1*'i=r5"f. aaBFI111T'
&a$5aTao'I5IIns%a=rfarerTaf$aT21f*'I.wTarws'a<~sf
a5Tz1a1?rfatITf=Tarr=rrn'a'r7aTa'r%|ar6%ia=rIT-i1TIiaE?1ia
ear: ma H1acrI'~U~='-I1-icwaf $6mT5:1*vI=I$ art art. a=r=*aT6r
fa *{f"FF6 am=rr Jrtrw NW3 fwf wr star % :3
O
Tai=I%1'az->13r '5THiTll'6 Te? =|T=r<ir1%Ia={waa6Tarra5T'ITenT'
=rI1=I7isrrTta=r3rF<7eTr=ITT'~WIu%I--1'riT=r%'=E$
<:TF{ BUTWT fr 3lTil\"1Ic1'T E. as uTa=r3UTT6'r.ww1a % am
5cT%=TTa'Tem~a5LirTrHarrIT=r'a=ra1wrT-af-frtravrrl
mfaevwtwsfwarfwaaiwwwrwqrramsfl
T1T~ITau=I=IT=IT=I1'q=IT=r. 3lT$l"'3.l'l'-lT1'i*)'l''KlTi7.3F15E5ll"l.|9T

mtm-mqaqmhwmaaatmtaw

2- aIr=r arr =n'=r - serrr a'm=.r!3-=2


?- en'=r arr IT? - eiwgr-ta-to:-to:
:- aIr=r arr lT"-I - user aiwpa-2:
236

t|aT$=sr1IWI6T=raeiaTI'e'au'w=raascrr% ur-Trar
$T11liI5'1L|.3lT=fi5T'1T=l3'lE'5=~i8l1'u{3?Tf=7r
araT=r&uT%-iiIdaiITiITH6TTrTa1*uIsrraf6ITTe'=I=Irr
w1"=r $1"FlT3 cm arxu ur=r'ta*a1 $ emf 5: fs"'-:;mT=r in =n'1'n
%anq$a"a1=zasri=n'rruT6r=iTsicaa%rrant:=r6fIrru$qTI
v=r$rtr2fa=fa11aTfau1$aT=i=IIa==;"e<1T=ta=Tfq-5aF<o'q
I@'9r*3t&ea=IBT=r.aiI'nTwaT?n$v$<1r'fart$fa1!%&:5I
1TI1aiT3-T?=x1aTa"ra1"aIwtITr1=uEfasTanT=r='Irn*st=IT
sfwwaqgnfztwahnuaacrrmfiaaqwwwwar
t=rr=IT6frrrs?-1*=rsIT'r*i=I5TTr'rTci=rr=I1ci1siw'6:T'
annmwwwwtwuafdrt----vafawmw
a!I1'u1TafanTta:a'cuu'qisIq1'IusaI4TEIrtT6Tna=rtrI6T
eqaI:'r:raTTra>'1erc'rraI%ssfw3'?rI 3

wrvxrru View vii tIa=r $ $l"{T

3r=iri'HcniI!w'<fIy5f1a9r'zxiIir=IFc1$56
~vFl"{'Tf T argia uaT1am" $r fasntr 1Tf3'=r$ a'=~Ie5=r$r
a11a1'ra:IT21T|=I1'(eaTus32aT$ffaws1'fasyFaa=af*t

2- win as wr5T -crratr aiaa gm sew grwa-an


?- aIr=r Fl =1T=r - qfra iamrs-223

l- =1?-1 s|TiirI - treat aias- user sat: .5"-ta-ta


237

Tr=I.a17*Te1aTT%ma'ra%Ta1*ga=;=;faerFn1naaar'I

wtawmmnsswuwrkfmuawra.
3fIaa%$rrar1sw1"uf$a5'rTTErItf21ufa*ir116faTIa'r
%nutITTr3faz'Iaw:TaT1Ttfa==rI'Iczt6'raa=IF<1$;13a5asrruT
WW r<TcmT9IT1ET.eI=I1vzT==1rIITa~'reI-=rrera21T|

snfr ?ra=r UTaT $Tvm1'=rr afr % i-=E'ff'T4'1Id


ah: arm tnfama 3--afu al?r4r=1=rr fr err ah an 4r avacrr FT
6Tr=r11?=t1i21T| curt air m?9'raracuT%- as |TTI$rBII%
I?-IT =a1""z % n 2167' $r yaw rruntiaa GFHT gazes 1'-q'ilT Terr?
#62 ararfaq E I mrf:nT. afa*r=r. Tra am: mfr maa
sT=rf=r1wI"(aavr5:d:$15uFada=I=a'f=Ia=TqatI mi
'51If?E[~T Hizl!lT wrzfwaf l =(u='111'rirIf sa-TrU1'1 asrwsz
=5I%retI=rrwfafn13a'tt:qTerr-H1Ta=i:Tuv*u?=awn:r
iadr 3 Fan" turf fr 1enq=I -Mai a'~"r '6umc1 qs'r$r'rr
a'='%wFaa6T$If<.a'Ifaaa1itaqIeI$rI1T=rF arc=rae'r>r : ?

rraracrf $1" 1TTF'T" hr :


QQQ:cQ$

%- :m1:- 1:667 5:--nwsertr sacwana-ax:


?- am- yam aimwfvzr 5eu.'z-as
QTI=IH1=Iuf$T1'avT$I?Iea=y?Q$5:aatIfqaaa1*e#asT
H=%eI arent I 14*F5FFrITrIiiI=I(%I=ITT=r116aII:'r'
hr. aw. mama. eI171"=aa;IarrI&I1'aHtfa-5
iasrfrr mm 72:. myarrtvnfaavra Ti. wfavra am
=rra=rra=1yaa2'. taiamlw v=H1=?rI;;=I=I'l"qftn'f
a11IIifrUT'rrt aT'$rf=u'FT$T5=arre==tfqt11'f1ertTeIf
t=I1'ezrt aau {E$T'57-I1<11"3c1 fr am-rr tzafaa fr am aufaas
arm thn titan frm ta? aqrw qrrr erraa ytrrreir az11a=sw=r'
TafI~1T%a$Icrr"arR?1au3Tcrr% 1 2

a=r%1*~I1T as 1354 {EH6 arfae arrs $7 isra-1 5n=u =st=IT


iq=riIFTF$ =ITaa~.rtsrrIIr.T%3aau a<'r=l~"rqfa'=nfcR
rrrawTa:=r=rrw3IqTTrqraI=I<o'tIfaa$$a1*2zr=I$I=rarr
a'=I?zn'r%-ITGIid<r1bTi5ti=ITii6ITiFTtHTii$El*FT
&auTt1*vuaa.-qesaa4sra'*r=rfarrqqa=a$a+a;ar1aa1rvsTaq>rfa
sTa1tIvs?aaaT%Pasfax=fraT:T=rrfraT7IFaafl'3rq'wTrr
3I=IT1TfiTETf??$'5Hfi&TrE{$TF1'T2i$T
trraawaf |'?ar"I'1'r~*-I1;c1=IT1n=IT-*:'IIT=rrlrtt=3=ua
a'r=s'a=v'auT*uiFc1ar($<'aTa.'rar='r=1s=1=r%- ar'r'aat1?raI1'q=T

Imam. asTe'w'r+*rei*e1a=IT=raT%. a1aFTs'aIFr=r!.'=r$TgaI


uFI1=IfdHaz<TarTHT=r=r'ttwTI'uu*adTI%'Ta1*Ia11z#Irs<o'Tdf
3hTfi?Fh?3'TT$I5f$T5lT9Joi-\131~1iTHTfJ6l7f

2- 1=a=c~:r =rra=s- 1ec.T-H ah 1Taa=r- rms .15-a-as?


2- $*rfq1<':=I- saw 5l$.F|36T sea-as-an
239

I=Iq'vr=I3T'fasqT I 1;TIIacrf3IIe'ITIa=I5IIz$5ITUTqT=r6T%a1'(
asarqkwrfafrnffq kT{i|T3I'l H1'Iq~#rI=n'r$I=Iarr
3iI{'l-Iii faw wrar an &=rR=I1 Fawq % am 3'=FFl'
as arr $r=I I =re;T alrcrr. aI1cIq am-=I=rrzI Fl iF|TT FIT gen +3 I
a1=If=IcrrIIrsn!'Ir;sIgrrqfasa'r?sa1-{=ITa'tII1ra'cIerrt
errwerrt I

I1ta$$:tIIeIa1I3IFHT6TT%tsHr6I?T?TT'1'H
s=I1'tr=iuT=ra'errtz-----=rrIcI=Iq1'qFaiE%-aifraf
u6faf't'1=i1Ia=16'3I%nt1TqTaa'T'TTr1z'Ia:'ra$r$?e1aaIT
a'rrr&.a=ITaruaT'2IT6aIafaITIi:Ii11r?r3sf<-7c:a'(aTaTaTa'r
tIwTIaarraatIa:rq1*1&a'a='aTqa4?r\3I-zI5I=ra1'Ir1s5I
=ruT94T-=rrIo'1-Trs11aa1nTIaasran=rIqnI'=rarr?qa6srITaf=sr
1zas$(Hf6I?3a'14I=rfaIu=IqiIrirtTiTnIH!an=ITaqITaqE>T
aIfTaq=rraWrTITa-:'rI1$I%IaI=11'I:@II3rarr4=f$'aTiI'r!i
af==If:'q5IaTa=rTtsTatIrrIiIIf6h iIItaIsa~'r$5Ia1$;InTa=Is
-r3=rtaI'rriIII=ITcI6TI iTErrcI=IiI1'6'T%IG1=I'WiTi~TaIT'af
$r f=l7'Fl'v.T aT=IT I1"(3'l$i|T3'GiFTi*1l?-'IT~iIT|'T- W3 aaa
.ITacI taa. v$a:TTi#w(T'eeT'wr%'Tm1;asaI$1I$T
I1'Ta1'HT=rr$T?Ia?I%I111'~iT$iTarf=:I=5TGIT=I$e;3I
aaIaIc=rr~aT1;=Is1(-raaI'sT' em eI:~>1:Tta3c'Ir%. cIaHTrf G
EI'HT't1'=I'5cIl3=I$T=I|fI11'r'EIEEir%l:

2- <"5lTl' uwrat-IT ssuqva-an-an


:- ar=r $r =IT=r - IEGT is .513-2Is.1:e"a mo?21eI=I
240

?af3i-3sI9'

'azfaa=ra=IT?1'dI1"(e=iTa's1'fq*=~.**r$I%ztzzad1L=I$
ferawr wqarm-~1T%-' EHTTE2-%'rrt1vr'aT1TuIuT:'tr;aa
31 run 3:611 <.3lT1'TlEI$El"l'l"{1'T3iJ?F'5-I'f"EiriFEl
swraf a=T=|scw*r6'ra%uanaI<v'r3E"I'i=ra=IT'tz:%e<.=rIr3
=r1T|T6lfEI$'TT?-7IT<l'F%.TEi'1fn'?inl6$i?TT"Ti':1
ifian'6Wrtrtanaa=Frw'6r$$r{UT.trr1\=11I*%a$arrtuTIQ
sm$rfer-u'cnaf=u1suf4c1*ra'aT2x'astn1=HFIaTerT=.:'crr%
a=r=1=rt21$ra'21=IT:q6=IrI'azFauarraI=a=iT:a5't:naTaIa1
a*rIn=raTafa?raT11naqb*6r=Irt?a'.1'=qaq=rwu*qw=s?
wtr1.%Iaa8rasI*11'=rT|qzerra1favruf3sas'$Ti=Ia1T=r15:
aarra-*tafteraar1=IaTwITaTnsiqvr'n1'ta1'na=rsrq:1'narr
a%Hsa==IT=r&s=ra1'qT*'{arTaa=ImsT$rI=nI<T|sr-aqfae;
fr $Tar'T=n1"aevrc1 ar-$r'~.'I'r =1 6? a=rT an =IaTrn'aI tr iqfauan
asrTII'r$IH#'rT|? Iv=I5rri'rr{ i'i=:eTtr1r=)T=Ii's
irrI1=rr:aT'rr1'r am=Ir5rziaTa=rrrTc1 FF*JTilT=lT1H==|6f'7{qTl
as asecrr 8- 1=:4faaq~1T =rr=marrw=m:% 8IT{fiR1THTlT CH5
awrw:rIr=1raIa11I1ea'r~=I=are2TctT%, frc;=1T1:qi'i=rea1uT
aa'1vT1'ar11Tqaiq'arraT%I1iiaTas'Hfr1$'eiIfEiaHT
iii-'l"1=l'fE{G5l\i3:F=|Ti'lI'$'l mTI=ra'T 8l'l'~z1lT I 65:
'6z;f6teIl1'fi"{f?a7[3r$'RlT=fqTiTTlT=ldT$rETT<TT

2- alerii as faarah satr aia=.qTimT.s:m.':~a-s2


2- ii5RJ- fah eI'Hs.|ciIa 3211.7-3-as
241

=F1'-1T6'T=rr| WrTI'rar-'1 as=Iw<frase1'6:&-aarqasarl


arq3t6qfaaetrrsT;ar3aa1~c=IT=I1m1T=t$T%u=Is=iTa111=rr=r5I
f=4=rz=r=r$Ii.*r.c1=raasatr$n'?TH4vTTs1Taeiqa%.awa1ss=r
=I1'Nl$6->'rfTW=l3f6TF5?lI1iHGtP1&1=ITl=l;$T<6
rtw. 1aIoa>T an 1:T E. are rr algasir
an arm 5=z$gzraH5q1"ci<mT aTfqaf ah: 812:1 is tIT=rm=Ir~': ah
afE1=sr(T'4fra-.T'4are11*It1m%---- Q f.'aaTEI=rr
$rrr=uq1'a=?r'aqf~aaqaTas14rTeiT1s|a=r-1-Tawz=r%-=I1{n"1u
i1t%:$TE$142z'FTY$H5'LUT311$riil3r'5fT$ I 3'93!
a:1ac1=r1aa'ra-Tr-IT=tr&. <v3r:u=5T14Tq=c'rarT=rafIns%1e:trmT
$ara=rT{5l1'UTtrr%iqTI%. urI1W$rerr=I=rr wit!-'n'
$t5r$T$IuTI=ta"fI9tc1T$n?1y=sF'=r*istItaM?rsu=rcrratI1'1=:
R'T*1=T$TG??T3of$=ffff3IH1'lEi!TElm$f1:1
aumwwaratu 3
'azfa:a*IaararI'?rrdTT1=aT2f$-ItFt'rr=If4Ta1*{Ifr
*=aT=rzITIruT%|a%1'fa&i$TIT=IT=irI=ir*reIn'<;crr
tn: swarm are-rr 8 -- ' ma 15: *a'rf=aan' as &aTf=r=1r=ru'r mfacwa
mic:-raf=:a=u=strnu2fr;aqa>r:rrara1%rrt.a=a=sarar
511'-=1|TIIt6%r%. %u$Ia*6T?. 'aTETINT'5I11T-Ia
$TfW1'tlf=|Ti'I'3Uii*Tilf5fV'f:|'VT$.o1aTii2;T
a1*;=IvTtIFI415raaarra11=r=fTa3r=zT%I

2- nTayTiTI-tr-ear eiI=s.naaT 5211.563-e


'e- Wrr =t=H- qaar a'$.na6r s.~m.3ta-2%
3- fanarararar-1rr'aaT sauqua-axe:
2- fmq-aw 61$-a1'emT' 5:11.313-"H?
242

I1'I?I%"F3=|1rII2IT1iIiaI661..@7T3TI'=*'Tffi
fmT1=1aw?r1WIH:raa|?r:zniar?f11IT6TWw2?rIrIoEnT=r
5ITT!'I=I1s==mar'$saT%-- =r1'{aasafE2-*T3I1'~wf*'I
1er=IT1'vIa TE'o aiiwfa T611. =I1'{c':$I' tmT=r$sir'<'-x=ITt. fr
I'ac.T aw f:=r tsuf $1 anirwr -=Fl"f$'l man 9arr=r *sraI'tI
aa'ra3*yTIT1 ifv:=T=r5r=ITc1 fr Ir(T' E16 Trtwrwarf $1 van H54
?iaT'ea~'rnaasIas1*s'arqIra=rffaw:T aITI1Ie=I=r'r<rr%n1'Ia
$a=nTrarafi'asI:faz'crrsT<iTaT11'tc15Isfsa~:&qz.Tqa'
1<TtI1d3?F|1TWI%rIg<-H wrm R3 1 aadr fr
$faTarrza4?rq:'2aTt:1:-q6T$I'aaT%- s=11"=I=IrTEI%r?
:te1zz1:trraIsuT(I=I1'Icn$TwtIT=I%Iaavz$a?I%m#sfa$Taa1"t
atwr fr area ;aerr % <11 \-,1=r at ayniras ah a=n% 3611-! $38
|q'1TETiTZTllTtffi5T35*T?TFqT'l15T?'l3TA$G
11a=a=6f$TqHaa'H11HrEI6TITaT1ruTHTafas5rFa
arewTTararr=r2'aT1qaT$t<=I=nfarTf=I2n1=u'w=trae*TaTq1*e
nTe"a1*a='|rwrtsq=r3s'=z11'n1r1,'6%s%Icrnzasqiati
=rrIrsrITmaT6rr%wTw1rraTarrair%I ?

r 9ra1;T'at1rrszia3Ifr WciiaT fTT*ITzafadtrf is


1er(+'a"rrarqar $@FTTT6T$3Vl N11 i',l'TTFl?l'$-7-16'1"

2- =r*=t5IT=( - new 55- user sea. we-us


?- FJ<1a'=TTa5I?Il ~i$aiT%1T 'gza.=,r'B-toe
243

afI1TrfTnt14sf1*era=InaWrfsafaI%yi'ri:rasTf*1=33
art=rfi&aaunua{t:a.ta11?r'a1T=rr=uy7Fatazfaa
5I'iTa?T;1I:i?|'E2"f6ETil$TqTrT'dT|'i-F5IJ'f$T
1=rIWTzfrITf *5I'ITH HI "

tam. 6tf|1lT=r-311"? an ti GTITI aafq rr 1:-so WW6


crzzr uwtawra qrtfau sIfert=q=rr'$Tr-aaarrarrs 'lI1i<1ll"f
$ry=ar9t=rcu=IT$r& s Fa11ftt3rIfra;ran%entfdsrFuT$
6I'=I#Fc5s#saraa11rTfqaarmr=ra$Ta"c;'qaar{T I

aI1=1='n1=ufU13I =r:;-*4-?rar61=I6=r'q,tze=IT=r~'asT
qraewa $ Tr~w1sTa=r at 355% fr araw 16' at: gm 67$?
salt Wvwfsriaemmr I 1"c=tTEa1"awL3s
;rF'<1 1=I1s1.'a'=Is=r=r~q=r1'rairTrrrar=IT%IeI6$6err%-ta
qTTFTT1'afa5TtrreraT3r@I=ir13n*gUTrIaw4I'fi'I'{rra=r
1ifer1:IrrIf$t*1=ITE5=rTtaHTIri5II=I"(aI1=I. wwatn
mwwnawawatawfawaww
#rFevzaq=?ra1'fa@:reaT11aTa=rI$T'zrr I arq?{tszaI1*(aT1c1l#
smwawwwmfmfws
rzl ?
aw=ta1aa'hrr3=r$tra8aq=tr6TI':-mTn'(1'aIIu
nT=tarr::=m1ar=.'EaT?uTzTtw<n'fz-6=I1Tr511?={v43

2- 3'uTT - cfrcrrr aii Jrrur saaawz-toe


?- am - sum a'.af21T seq. 3%-33-3:
244

sr=1Tiu'rIw1'a&z4=1s'Iar1'~IrrI'I:re=-1==nf=r1=t1'e uarrnrrr
al$T1'8ti1$m'Ba=iT=rrioWfi)If$I'Ti'if
frmwrtarvrmwaucmwaawfwtnawa
aif|:r=r%e1a&rtuT11'=1ar&:waIfw=afarrI=tarrurua
=ru*Ia=ra'rwTtr@:aqrz1'utr.fwretT=rcrra1tnn=ra%Fn%-an
v5!'aq#s|i'r1ta'rq=Iftt2aqTfaufasrw1It'mrt .' U
rrIzTaaT%wrial5Iiua'r=r=rrnrr{vr'enaa-(aTe'aum=tassdT
t - - - - -- an &'HT|3'f-lcf|7f ah *-warm arrf 3rrrtr='rr=rdr
i1'1r13afTuT1e=rTi*rI'r.eITaw3t5TeT:rf3rcu5m=rq=rfqr6
mthms ? i'F1rVTI73T'=liU.l5'1aI!I=l1"ci$T,i-'l"{"T'l~!
:n..1'B--' s=IT'ta'm Irr=nT ma. u==11T;in11T iaututf
iEaT'Ic1l1"fT{'=ll'liTT'{c1{1=i'TfTciT'=II9liiTi'l'E
u1atrr=a=re*?15Iu%---=n1f$T'tuafaI'Ti'T<N1ufia
=rra=Ir&a1;a n MST! . R121. aI1*(7at=t<rr%ia=Irt Tri=iTfd
iTFI$'f11"itI.=IcI(lT'<2'll 3

anwtnfrfatattatafwawazid
wr?11er=a1'.\ aIiv:ra1*I*2<zr~.T~(t=6rtvT3'rrrt=|Ttatw=re

e- mm? . wear its-wear swaps-at


?- mm-1 - war it - new gang-a-u
3- afrfa'1=<'w -wear aimfrnrtr sin-gr-3-22-re
PO ht) C

%.er=r-mTafl$ FaaHaT*iarlfs'aIrI=:tr=aTar=1T=ra'71%n
as'I1ai5a=IaTafQsaTa3atrrw'T:ah9rfuasqa=IqT1*a==1r
;a#r=rs'%I1-=irTT=nTI1$11n:ai=r3r=1=irf=:afa=rNtIIcrr%
9rcrraf$Tt1zefr:I1*51Ie."raT*re'%IaT*{&awq='h'at'1ifra'%T
*1Ta=Iwraqa'rTFTare111T%%n&rrfarfq=mtaTa=MT
$TatI~4%"t$iITE1a?aeiT3adTaf$IaT11i*T11I?si1Ia=s'I%
=rr1'a=sTa=rerr$rsaa?aa%nar=rizu=i=a=u'aTaf#sarrarrq=is1
a?rfrHTffiiTan=rr*nIT?o'aT<a$&wTa%Tard $1e'=fa"fq;=rcrr n?

9=i1'rfr3stfaa'r1m=rra+*f%'IarFn'eqaaTr'zn11I=rr
#se=u=gfqa=r$qa'va*rIasfafq'IIT=:Iqt&a?6TaTaa:aT~'3fasaa%1s
a'ra$f9rq=Temarra166T?s"fIIT.arPqq:1Ir$=f$TnW'H11urr1
zxT|aa$aTa$fh'uTr-gar$sr=?rw1'TaIaaaaarFHE115ra
1HIT%I3=ifr TrBnaT?rq=1T=5T:'IFaqvtT*raT6'a?6.1
=n=rafr1ramr.a=mrr1g1wa1w=:$raa$I Tr~,=;Iqwa'r
$yuTaf#saTafarraf$a'rIaf3raq=tq;r1sTaT=vI1'-T
rrw;111q1"aar$Ta=u%u=rra~'r1=qaa'wIr.%u$q2111faTa=rarr
aw amzwfkzanasmaawnfwfqqfn fan:
n iIT aI=iI'cI$T ;13=I'rt'I'<:<1'1=IT=r =.'2.TafIaI=a1ci $1 an
mtsui =:r1=r'$ W --'1 arfvraafaa I~."r . aIc?rc'x $1 vgfa as irta=1T<
=TTr a1a1Tf!a2ar'=IsT1a=r:waTIaIIrr*rarrwzai::=s2ff=z'irT=11=1e:

?- =r6"(Ts- mm: &$.WsaT saw. gr-3-no


246'

%T5r$ryra=w1#irr.2atadT$a*ru1fqIaa*eqanF=fa an
t*raTrcasaa1=re'r=rTIfryasa$r.taxaT1anT'=rrtetrFIas
tmahwmwamw iI111T|TT$1"lI
1=I=11vr%1es1t-fwuTy=iTw$'(TI{1'q=ra*raar=I=Ifn%atB
a3fruwv:=1Tv1=:16=r$:vr6<fif:rqai*I=IT:rI1=aix1rn'Tw11a1T%
--- 'eFITt TI"~;m aIT=*-(raw $7 e|ctv21' ma Hrfaaaas rm
a=r1y=rrasare.arfaras:~u'fam=r=:nT~,;Tq=rcrram=re+u
vaT1aa:=brarrwrT#rrI:=aaTaTaT%| =IT1;en'aITt;Tqta:crr
6IT(Iw<sqT3-'F6t!6*'IrnT$=rraasa:T rI1=I'1<araT%r I *

2- 16=~.*r 4TE3'|"( - mm =rPen . 1;-3-223 .%ITr do teat


247
eT1s?'IIaf'(eI=II-vIa'rI1TIv"11Wa1~1=Ici=I=II.IaT=f=iIT
aI1"{Em:a=3I ET3lH-"I17-I tITsrr=I1'fa=Isa"eI=raI'rurrI-ITar
6TaT%aTTaiH==I:#tcrr$IaTfa<1$TTBrrIw*'IIisI=:TaTw
5ITU1r%aI1TIruI=I1sI=rs'rf$tI6z;rir=I-11'I%1TtTaIf%q(ra asl
aI'aT-IHT=I'rfiI$ IwrTT'$rI1cI1"Ii=II:IstIr1aIIa=IT1=IscrrtI
wrr?I:o'I13%':1I1raI1a1(1?I'r1'fars.s aI=Ir=sTfa1a-II:16"fibI
mrr I WI Erfacuwt avrfaas trfrfwfaqf. H=raITaI1 ah
yafad faartrrr Q 3IjcI 31-=I1 aqar aI=I' ar I=IaT's atcn % I

3fIfwr3IiIT9wIsqtI'err1tI$=rra#I=FrII
afuzru %y=aT'tI$:r='I?-Ii:rE='T=15I?IqEt=IT3I1i1'3I1I1'=I1lI=II
awITafa1*caIq?IIeT=iIeI=r$aT=:2IT=r;IfeI18r#T%IaI=I
;InT=rwra=I$'faEan=Iraaaa*ra'aInTI<?1qa=ra'rfIcrr=rr1a=s
%IcI=rr=Is"re:111'aIaaI::I1aIeIsIT>rsraar2fr I aIa:)1=T'r9I:I1'=IrIa:
3'??1T=f$Ti1$f6l11JT?IT I asrrm-I*'IaIrIa6=I1taIeII'=r=Is
=r<I'T1=ITriII Uafir arm =I?r9I$*r1eI1"eIsIaI: aI'=zn=If*IiaT I
a'=''1[aT1a1?-'rIT. f=IwI=rerraI=fzI=rvr.a1wraH>rq=Irz;rs.
iI an arm szfi EFT stw 2IcIT %. iT1cmT'fcItiI ar<==,IancIT #r
Tl'T'Tl's rf=I% hr. e'I5:TmT mi 5ITH'1r!IuT Hfl'5l $1 t
3=lTdFl1Tf3=If?EH|?I1"3lf $TaItI=r=ITa$f~I
%43

=r6z=wauTt2rr=r1:nTarI qtI'e1TaIfaa1=r1-rartIrr$1aw1raan'
yemdl

6|5:l|'I' 1=I=ITIUT ti aqT=Tt fr -=ITar=rr :

aarmti aregaraar fr wrarr EFITGI air aaa Wm


3e=:%aT1sH=I1+=I5I?=u1*tdaTqT1~w#'r1uaTI*r6t:=I1
arrqa'an'fs6ITuf:aft=I=f$=rr=IqIawrEasaf=1?:Tu'IrI=r
rrs%|arrra=1sr=1sfeIrTt=|arh; =r=:T=1IImratH1=Iu*r$II=c
*'arrT'rartr as fa=rFef_aa am 5: 1asq=rr aa'res'% - aregeacrr fa:
Eu=?arr'IrraeIf.a1asatr=':~;aresTEI%. arem%.=I1'=I%ITT
a11$rf=Ia1'tuT4rI=I1c'lc$fEs=s=Irr=1=1'%. aaar'TWa"az%I
uw EIT-'1ldT arm tea =r-a =r4?r rraca'I few ah WK
aH11$ra1a?qr$a5uqza'rcnTI"
;|fIr=ratq=r=iTa$f=Is11TI2zr:a1a=sa=r|$n1W2:wIo'=r
zeseast-%asarT1qar!e=rasTv:rr;an?=uiaT|rqI=i1n
wrmtaqwmmmwtmtnaawwm
$a=I=1*cIr%|fs=;=r=rr"azan>4T =sreirrara=iraI=3211a=r9r

t- =1T'h'fa=nt :13? .\;rIav2- (T1:"' ferrtwrrr arr fs=ar


asaz IT 5HTa- no an1er=e. ahr 1;-as-we a wga 5214
wtwr-tens:
F212-*I'rff$as1'{a'rFiIaTa?:&. a=saTvzI~'aTaI=IT=:I=I'-522':
Ivat=rart afcrr 13.1% I =IITa'qar=vs=|Tq1zas=i3re'"eaTar1iIII"(
atrrf GET! Wet GIT! 69147 23 :11 rf"=n fw ma: WWI
atIITTiTacrr%f=1sasiiaTzo'%nTF61zat1=ITai1q=reiT#tTa:r
qamafqaaraarwrfmuafnraqacnt-aq#mw$T
rf=n-TrHaI1"{fwT$an: i11aI1(a=,-.$a'mrrr=r=raT6*
whqqiarawfmwnviaraimaa
a"e5aufas1aaTaaT1man"tfcrtwI*ttrtatI ='rrqtara?r51sa
ii- vatfer(e$rI=isrirra'aTa=raf.HUT'arfIarr1e11%Ta1waT
em1v|4?rq,fa+zT%FfeIz!;:I5Irq%1H$TIaTa<=rfrnTaq=rrerr
t---Ir=I1'~I$*q,1er=T?rrIae:r=B'=I=rI%I'(=Iu1'zTaIT<rr%|
q'=rtTaaTar{5raw&a=rI*':y&aHr(%1aaaaqfqaaruT
qs*rarraT$Ta91=rw*~rqTaqfaa=r'eT~i'r*z.saf52r=%'e5%"r
iIaTa'qs,wzar=1TI1?;crr%u1aa1za=ITI=rI<tTar'aiT=1$I%tz
=ITaa1*Taerre-naa=rI%11a11I*'aiIiaTa1-(sI=u$rararr=r
*IIarq#sTanTa$ei1f$v:TwrF$I4ai*rI$Taf$IF%
qa1'3T6&%-t?!-*r!I6I1"{3'-=r1u3IiI'rt'11Tr'ITFF{%riI?I'II'
=5I=raITI=faI*tI63r=sTtr==z $IEa.i1aI1Ta$.~m"(%'Iar=i
aifz$aFTaTrr;31rE3FT'T$Eai'TT%=ITi6I1'fWTs"cI%I%t6T
1=ezn:aqTa$=aurr'a1w*twTa*.%.a=a+:aa:ae'4sres+as1a=ra-t.
qf. 2:11;. Ifri-2 .tiT=IT. rrfs a1"($T6 arfa =n'Ia%ar.nT1auT'
asTT'TTT$qaaT=I=1ft:Ii1ia$I=I=rwa;arffr=rffuira'ar=rqa#ra~'T
HT?-nIr(1:uT%|aq*ra1'q$TqI1E|a11aWaTra%'r1a1'$aTn'1
asTwaT=IT1%1$I1sTq1'=I$r*Ifa'aa~T=rra'Tn3=rrnU1'f3raTu'114T
aTa'qTa1'(1R%cr=raaTHT'=awTa=r'6u1vI?ratfr=rfa$r:
aI1'=IT'TIT 5FII'1aa trqnfaa arI~zaav3aw a1'(=isratirarI:aT1'
wwwwvmwwmlwwmm
II6ra3T6T.as=uaTn=:-:errarr=sa=a*{tr$(rwT:rrIiI
e1=I=H?rq,aT1'tHrIT avgaucrr TrfvHr1aTI}F5aI&I'% :

Wqmdmwwamamutm
aewawalwaaewmwwaiwa a1=rr
a"rfau$I% n WET W316 a~=$r=TaI1=razfaa mu rrassamf
:1-rr sfcfrt :- aaaa 1a=I<rr4r1a=rrfaa1'$t.w5u't
$sa =*.t=$aT1=Iesat!f6r!r-aa<aasaT't1amT=ITarsa11=InI
iaastar=rr=:afa'ravT-anq~nasaafaTaqtf&afaE=IT
afaau rasrh e<nsae'r3a1=r%ai*uraTTfasrasf=rITas
a=rsaTt?aT=1TIuf=.fewfGa'5?cunu=iTz;zrr=ra?raIT
w3?r~1WTrafaa==uT=rTa?I&a=rrrNI'I%asT1dTtI 3
mwmwtmaawwmimmw
hr=qaTw1 ara=I1qn=r:r't&t=Is=rw1<={=I1"{e1$r1=:T=1r-*uerr
asrsaa'>fTn'srrf<ra=FrI1'n*q1'raarrrraafwwafw:em

2- :zm- am a'I$.arIBT' siuqia-aa-ae.161I does as


?- am-sen ai$.arr3'r' sail. t_r*2s- at
3- v.=rI"I=If fr qa - WET 5F'FaFIT sin. P340
5! 'ITT-tar.
8- %m- yam a'I=5.aI13aT' sequins-so
nraaerr=r1I6-1izwrF=I==r1'rFq1"5I.1q1'=r=*~ru11Fanfi5a
f41q=reI1i1'|sIWasq1=:T*'t=I*rnT=rr131T=ra"rw~'tH=r?:|
s=rwan'q=rwI=fnw=rI$IHava I
='rrUt1;r;aTa$r==I<H=IT=IsIc*a%I?

i*'I1'3r=Ira=iI'si#:df4i1T%1a51aI5a=rIa tHrT1"eI
1=:u1=e1raHI%rTa#a fw==rarnr'rarr=IaT:-yr =wrw'r1'aI1=a~z
'5l6'T'{T fu"=|5l'I Hair 1%. e"( E"H<oT=IaT euT'ezm iFFiT
$<zT3iTT16Gl'l1lu2TlfT6TqTiTEFlTq6TT6'r3l
6HTIrfe<r=r flax-71waTsI5e:v<nra:aa$t?z- an
qawwnwtamqauafaamr.T6=I=i=tmT=u
1Is=6ffe=aafaaT=FIaaaa1T@<mn$T=rra=rrafa
anTeeas=I1(e11i'awae1iT}:w=rt%ra'a1c'rTar9iffa 3

21*iIt19IaTe?rr=irt1Tfavaff3iiv&'aaITe1z%I:=I1'
faTffaaaTtr$rn=IT5rqrarra%|tamT1aufa=TaTehua$a'r
$s1q1rvn=rfttaar:raartrasIa'=rn'r+q1ivIz=rarra=l11=Frr;a
En

TrrI=q=r aufawmmwvfrta
1crc1TI1'IJ<IFr m I $16E1'!I<l1l1iEiTTillT1Ti'aT

2- wt 1-T =IT=r- 11661 abs I:-3-as ah sic lo?ot?


?- am afarr-1 -gem ai-=5.1s'cim germ;-3-axs 32:4 o oo?o?!
3- am wrw - war lwaatr siwgr-6-2.:
253

=iIaa1Fat*,I4n1TaTcrr%IauaTe'a=I1'a=1T49rf=|=aT
fraevmifnufswart-ufawtaftff
3G*<T41'1TI;=I=h*rn'a=|1=r=r=rTarerr%?1aIaaInTerf-st
es"-HTvrH?:%r3sfe3eB?=rtzraa1uTqr1'a=Isfq=rnaTa=r
3?-=r~wIT1"cszI1$ar?I:1iI1I$T1za=r=ra"fItw=1serrI sarrlrtfr
iR=11Fd-ffqiIsq1'$1EI'?irr1n'a'6rII'8-rin1fl'8I1T
c;'=rT4stasaTswrIararrz=qTaTrt.a=t5wsrttaF=r1rrI
aTa.mnquf:eqIrruasT=aT=rdr.:r?xaftiTtI=s=rIaI
1q3rf:?u3%aatr(*I'rr'aa:fa1=:16I'raa$a'ruT
frqwaftraf1uTarcq=ra1mI=rTaTz$mu=raafarr
arh*='Irnwefi5T6TaT&If4safeta1T=rcfTaT?aT=I%21T5I=i2.TFq=rr=r
ammarrutwmn *aaTI"TqaT=:'f3
1TaqTa5w1-=aaT<un1-eHT=rIaraIawaaqT%
----aTT*itI1'{c1HTsT=r. EI=wIr=rgcrr'wr=Is1:I:o'1qoT
ertr%narP=raT%.19r'I=irena'r16<ufwh:wIf4t1nf=5T
aT3rnU'ri~'Ir$ruTaa6TT6ri.3a*1H31:r1mTa3I1T
qm1uaf(wTII=Ia'rarra111errqa15=1r=3errtaTa=n1aiaI11'wtr
arH1etf$a=r=ITa'avTI1r=rra'=rIe=a=n'aIaqarfuafiifanrfaa
%-wautaguwranaamrmwm
fe.aru11raTBaqff$'anw5I*IT*'I6T$T=fTtasIu=If.vas
aa2nTa=r=It5fI3

2- Ivrrie-WU ai==s,u"rErt'r saa.5tastv. near va-rr=rr


2- 'm'rIi~=1=r-iatr ei$.HTcT' samys-oz
3- wart-cirrr taa.q'a'6r 5:11.333-re-eoqef o E.& H;
aTII"qIzasaTqT6rf*Iw*a1aw:crrV=:Ta1*fI$14aTI
rva-iiTfz$%'I?I$wwwr1'Fqa?rnT=raTas%=III
1B3H1lTa*'IH=E=iE|:ETTilT1'65qI'lBTI6Iq*fB1<1
iHIIFa=r5Ia;Til1'farep=?TfdEI1T<ITTWra%3Icrf3r
- - - - --<11'El'T'$E7'3tIET'.'|'
arr$a1T1'45'I*TTI?iI=T*6TT$Tr=Il?T3'wT$1a=sII=$r
=IT=ra'r'I
5I$'ra1Ri=I*'tHv1a:nrexTa%TaITtrUr=~''rt=I=IT=tT*r=rr
%Ii1T==ITi'TTT|'~I1'(f*15I1T$T1eI1:Tawaa'tHi11==:aaIT
21r|qI=x1uT=t=r6f=rwI<f=I'T'asr1qaT6iafaiaTarrI1arr
iITI'f$13r=i'F=lTf*l=T6l?F3|IT{"F|T|TNf3
=1r=n=I1'aaTtasarr1 1 wswr aI1{Wr=IT IaT=n" fr =IT=n crr=r
%It1f?rf*5I911a1T=I$aqTfa1aEITra6TaTfEn7"F=iqf'a&aTr1Tfa=5
=rafa1'(=r=!t1TI=aTaTrrrna=I1'rer%-----a=nv|='a&=I'==I
$T=rFt'{Ia?pItaTar=rtqTI'aFasITi=r%I5tuIaa'Ta'ar1TIvrT
IraTra%a1'{afanraT=r3TqTwTqTaaaT%faaT=usferar1.
aiaTI1r14$aaqT411vr'='rrwtraf$reiqaeI=u'r=1TaIr$rasaeIz%I
-Ir'==rr=a a11a=+:$.rf*=na11=?ra$.mTa?T3aT%=w
aa=Ir=rcrra'srerrs'a?TqTa%aTa1-smlaa:areaaaaT%-a?
?[TWT'q?T'Q'oWT15IiTHHi,'IlHEl*i'W'-3IP1Tfq5'fUW$T
lrI'Wa'|aTfqwrr=r5=I'rt%11"vIar?1'a=IF=r=1$I1<I1TE-1'5:
trrrwinrqmwam-=aaTnuT.U~?=zaTfaaTerf%un11asn%m

2- zrr:zxr.*r=r -wear a'I$msaT 5&1: I53-?o-??


?- sierra: Rim tlsar aim. T6'O'l' 1:I%-2!-ti sarr do eat?
rTavgznaf't:r*a4rfmfut%traTf:nT|ztrwraw3ts=rr'~n
afsraerri.-=rtterrmi1a==xqraTaTaI=q3sar=rITWT
=tz3a1'Iq=:=vzi5c:aI=Ir=rcrr%'|iaf:=rqr:%saasaTr=11=1fn
wiita==rf21Tt*t1f1qfqTaTuTaTa11I9=a1fT
%I1Ta=r=rr=ra:araTa3TIrfrar?'=Iriifa7Taa1~1aaT|w=rq=r
tr*i9rarqI1T=r$Ta1'aarraa'=re11ii:TIa=ITiHrTa'r=1Tr=11
$aTaq=1r1=ra%a=t5wf%aa=I*'r1q5TsazT:ara'r5Wfea=iTrI?
aTI1<:'1TIT=iTI:vT'a1'(aIrfquT'a1'=Iu'r':r=sTa=rrtata=IT
insar t--- =iTfcmfan' ara'=rr=rm aw: z"r'41'Ta$1"et alfaait
=Ir=IaT'naT.af$rfae1r=raq1'a$Ta*=s1isar{=raTarw=r=ruT
tIiw1a:II'eur1arTHnuq11?'qH=1Ta$fauq,fqu1<m=T'ET=1r
taTfIqr=r=ra=r%rrrrI'|=zs=?r=rr=r@serrvi1*uu=rP4w1'q=ra1'{
e'wf$rar:=s 'azwaT1rPa:znrrr'=sTyTt'ws,ara=rsrruUr"euaearr
qterTs1'Ur$T=u1"a=1a<:3aIT3tavra'ra=HI=r=rw'tI---mm:
='t1aIa=1Tar<Ifimf$T;:1-cc:%a<1=a'r;;*;;1a:T=rf. 6111:-Ifaurrf
=ra"fa=8'aTq1"3saqT=rwFa=11''yrr<uiqf=If%?---trrta
aH1'a!i'a1faaa=avT'miar12fasfmfq$ar-IaTIarr5e:uT
aaTsaaTcrrtIaqT1rar1=e=1s'euwzT=iraTHT1%w1=n7=1'uTa
w5?rI=iFwr'u%1:r%a=wr11sarFu1taaa=q$TeII11'iiaaw4
arrsfev11<r=1r3rvn#af5I11trrn'3 t1TIrr311fc:na=If

2- ym1ei=r- user lhqsar 5311.313-to serrr (intake


2- am: fiti-<"1'TE'lI a'.*-mar saizq-Ia-tau--to:
a-swam ei-=I- gem waser 5211.3-3-w-H2
256

IT=f&31"F<I'~3?I!IT?I=iIT1a*IiI==I3=ITer?'dJ1'-iasrra
a'4=tf$qau=rrfffIT=!=tTtI1'fwfawr=ra?Tavzrw~fza
rse1==I'en*caf%1=I=Ir'aTaf=rtai''rva1'tv1*raf=rrI1'iI1'I
sra'1'($'(fa'=Ia*FasTa=FIT6Taar%III=3Ta{a'rn?=rirrI
Wnaaazawtaqafawwzaawq
a'afarraa'aasraTnfae!I1'a=Ir=rtauT=TIIT.f=s1Izft='6z1I'qIs
1aJTiiHGBlT(za$T6'l'1Ie'%|5|1'U"i"TH'i'Fi
=ITaIrm;1"ciisTqTfqua:st.ar<ns5r=&asa'=r ifsq-ztaartn
a'=I*I'4TWI5fcrw4T.gvnuTiI=rf6T=ITerrFa=eI3*a6r3
-1fa'=rr1eIz I urfrq aT=r'<1Bf$=1=HarrrTr1{iiE"rHTIciT=I
u=rr=1rsrP2sfsa=rr'astaaaTu&a$Iwa%?zIuTn'rIc:nTfa2tf=r
$TeYi5u=IsarqT'=rr6&f$a=fa=HrIawaTi3r%IaI#$
=ra=aafc1T1=ra==+':,fesaT%II1e.'aI?'(%I=r=II=f=fTa1q5rar=.a
aI1'(faar=esfaI;1uu%1~3I1r=Iczt7Is:1$=a=I3saarr-3iI=r=mtIT%'=t1(a
timmwrfasrarmamrmammnsaermx
uaaarqtaqwrafaarrtarsa a'h:axfv4=rrttaT3rw'(a''u
q=1r'ir8fm1fWta?n1"i'rI*vIat%I ?

ar=r$r=IT=r*wrr?avrr'fa=Er-~=T'n1'u=1TwI
$nraraiT?I~3I"IT=ttrrrrt%msItruT%-----=-4
=zra$TfIaq9:rr($ra,a%ru11I:~*rrnaTfaw=f$T1frwraf$T
afara-*tc*i$ae'rra'w4ara=IT%|61#Tar::fmsef:1a2irnafIw'*r

2- narraweiw-serr ahrrear 3a-4.~;r~a- HR


2- aasrasvciq-igarr aHs.=me>r sawra-at
257

$1?-5E=I'(~"1TI a1*efa5I&"*=?l1|"I'6raa=w:fa=1aqT=r
qrartuanalaaarwfazrrrfwwrrfeaauesqrwtfamw
=rFs=rrarr=I=1Ta?I?Ias=saerr%-I1"I=r|va=1r&tt=I1aTt3tI1*(r
Wfderrfqaaetn----wfamaafamr
=Ia'IIIs#a"rf$U=6T'=rBIrI'TrI=a'*en! r$rT=FT1=>z1Ttua=ir
aTs1'f1-?rwqTfn B, 17% Wear? ET. a*r31s"s. a1'Br
i1Ta'r1ct$r.iIT=I%aIE6=I1(rH'rr&.EIW'3=rI"{T?T1q
aar&nsaTs1szasTvrt:fv=rIT=rFaI111zraarTaqa'r=ITe'1=rruT
n? =I=I21Tasr1:1=ITaar=<:a:'rfq'enEI1JzIr=sT=H=2acrr4sr
14IT1=IT2sfa~c:$m*}acrr%-aITfaafrcrT=I1'=fFaI1%.art
'e'*5aqn'z-sI=Ir=IaTb'T%.=Ia"I1aTsa.as3$II=T6>T%Iuwqazya
w=mtasa"ra'rfqarr%.=i=;'~acrr6'Taa$r={=f%.qfa;a=I=irr
anx 5: dim Tsar wrrrrfam afar CIT am am: arfcn $ wfaa %
i'I'I'1"1I=41m'EITTarinr"TcTr?3 95?l'*I3T'Tl'iiFT
iTT|?riIinT3F$aTfqw1Fdi'ri|':WI'HTSm13Vr'u1$T
aa1ar(t<err%.a'=Bas=ar1r6'r=rtaT|arrezz-)1$r=I'rI6=1taa
%FvTrE1r1rrf4a1v3nT=1a3sa11z6a1<o"e=rar1vr&<T='f
F=r=Ia1"Fqastni=:'rirTrar9nmfR1=rrWvn'sv'r'!r
~Iq=lhf=I6=ITa'r3T2.t-ilr-15IW=T3TlvT4-'$=uTa1Tq"1
=sumasa*rart.s=ur'fqes=rq1~r'i&a=:ra9:anFa=r:=2re:rn'*

2-am 3lT=f-dTGTr eiaww-ea gem aio teas


?-3lTf<1- user in-"=s.a1v1T 5211.131-is-2o.*1=s'aaIT'o2ea?
3- 1=:err- war a'I$.=ra6r saa.ar~a-23-as aqzf ics?
2- NW5? * |TT- war sea-gr-3-3 am o tea:
IIT=ITE0'3rTlWl'lFi5Hi'?l1l'3f'5?T aIw=t)11'U1f'Iwr6a
Tntmmfwwawwahwfa
a=3re1T1aenw:rt'taxT=IT<54r6T6T~mst==a'rrr=rr$
iIl1EIIi|'El=T0'i5T eIFn=IT=r%|*HzaiHTaTT=rr1-IT=r$r1;a
6ITIe1H=rITqaTq91aa-1Ta'aT13sq;=ws$T=s=qTtrfI
3=1!iFWI*ITT1Ia6=rHT2'rn1wrararI"eIa?ra'r1{a:raPrr(&aa
,E1'?IBTHi7i'TTlg

9'IT$=1TaivfarrusnETiF&&uTI11'uaaT%I
wwaqhwwmmr lWTI"fTnY$tTl'
am 3I='|r 9: a1'a:T1$ tan #s am? is? fqatr IEFJT n %I
3I=iTv'tTaq3taqq3sfe'=?,Ie<o'n=a=1'Gztrrf{faaI|at::a=af*t
ifctET$ilTEi'|"IlTf@fG' aIqr=ITa$f3i6={:T=11Fc:a1"$f
a5=I1'$rar==a1'5ITc:1I3a1izrr%s 3r=iriTaa~?41$<T=rfaTf'craT'
r1m=EIcrraiTw1*savtr"6r1If-=1TaH=I=f3saI21'$Ta=11=I r:iTf$
anTa:T$raTFdaaFa=f*$u=1m"qaTIerFaT$r=IsTH3a%I
=r1=<Ii?Tqa:avrai:?aa3fE|rfTqTa?xi*rr=r*5=i"r$TI'
aF(=I'tIn?Tm1r=nr3F'% IIrI=I=r awrri
$'ia&HFIa*l'U"iT%-. - - - - --1=a=gafa:anenz=rm
erwr(=1=lI9rt$'TrdT1qtza1'aT:Iaeu=rtI'=rf5:eT11r'
fwr%14=atIrTTTs95faeaaT:aarrI~rraI1'ecrr5f1(
$I=IT3a1Tuaa=zaar(crr%.6afevaawI=r=I3r=rarrT|

2- 116 WT was as an -(wwf $ 1111 ) tt -pa-at SW ote


1=a'rcrIIuTuTrruT%1=os3n?ruu=rff$q=I=raiTrm%aam
awwntwirrwwfuqwwsatw
$fe'aT1-:+TrTF=I1W7-Ii?Iv'TI31=':i-?rTr3aTaa=$TTrs%aIT
<T1IaIT1'1'<1%1':=r*1T<1TfTaI1T=T:f$aTIIr=IIa1'ta1"t
9I'i1Ti=ITar'1=Ir=re7rerr%.awa'r1=111T%I=rfri'?r:TI1aan1arf.
rrzI1wf.au1-zuarmTaf.n1'=r=narafa?rrraa=ia11-garrrrfasr
araIT':=Ftr*r5a=I'aIcIr%.aTiTaasr14'-FFrt.aTBTi?'I'I!Traz.
a"1I'aTT'adlIa$IwaEilITTt|ttra1*1ka1ITe'af
@lFill'?93'=|T=r3I'?II"lT'cI F6=saT'?r=nafr1ni=Fs??r
%I1IF'('iiIal:T=I1$1'?:rrT$iIa*'ITTI4i&II=rHi5IT
Q70 2
uTH1'1"q=I= a=IT=r<rr

9=T!ruT:T1~iIaa=ur=rar'1TIIes.:rrtu*e=rei%eIT5Ir1=e:
lswaTI=i1'an1i'?1aaT=rdTanrr11=rra'?q'=r=rarw'Ie:r"r
srr=aTfw1trwT$tt1I11'=ai-*(*WFsa'uzai1T=ITzisqv|TI1x
aT=ia=i='rFH$Tarrtaa%:qewaT%--wr=f.>'r6a.'==r
afrarma-*rITFt1Tw%zmvufhnaasnafaa1'tatrrwasr
'r5IlBlTTTl5I'aI'1*f16'E=rf21:o8iqr%a5Eo=la'5IHT
$1aEaT=IraTfaIa1'1a:{iTa=rIhFaf=rrT=rafsaI6=I1'IT
wsfaasqtartdfarlzwww Raga.-at
Hifwif-----mdfusufaif

2- mqw - sen iamstrrr gm;-3-ac


260

n1asquT=IT=IeTerr%a11s=I:ra$4I1=II111vI=I=rTa%| 2wrqr=r
aaT=rqTa $5rru1T' ='n:raTqr1qa=' iHlTfcIT yfarrvwar
F'l1=6fI3|TI<IT'll&=l331T3-.Y3liF6T'{'T1T6lT'Ti"IT
TiTa=+f?a'-vae3*'aa=tr%2'=t95rIuTs5rwa:faaer==1T=raf"{
q1emTa'rarFea=Irr1;Tau1sT?_ ?r-mT=Ir;Taa=t1T-1$Tea1e1r=r3T
aaararaaru
1:I=IT1r'-=Tra1Iwas='iT'1Tasa-za1TuTaT'a111
6Terr%asaT=ITfa$aanT=rcrrqI5wreasTaT%--eirq1
i'l1'(l'3i|':>l)TTf"llEb'r$'T''=|'&"1:ETT I-=11-1=IT.HT=I=r.
a'r=;{aT1srIirn%aT<rirsii$=f1=IT$e=F('aiFrTa%Iq?5ar<=I'
sIas=iI'=ratn='uITrazT%tls=r=ta3rar=?}sHti1anT%IB| 3

3r=?r5rrr'w1=l'zf'IfaaIaf3isaq=rH=r
a?raTaq1aa1'%1%aq1*a*II1rqaraTn1'aa?q==MI=ra1'$
a=Ie>T=1r%a1'(a=saT:raq1'=rraaT1"=1TfqaT=rraTaaEI
aq'(ar=r*51aTI4Tfa$fh1r=Iararr4%a1'6:fi5ITTEr1a1=zT=rn'r
%|araTa"rTr'asfa="*=:H':awIa14=I=IT=r"a|autarF=rIaT=r$T
q=I?enTe'*qe'reiT=;6I1$arT%- dimyfaa-Tif
inafst. a==rr=r-$afiH7I'Ir&.tr=I1'~i?i:rr"'iiv1T=rI1Ia=I=1a
3|5I5I1df=IPe{a=ra?raTn=r:.Tfe5af%a,$'f=IT'1a%.f~i=
--ccQu--c-c . - . _ . _ -
2- WTT - Efren-r aha. new 5: 1:. '3"-r:\s
2- I"1"'=|T=l- {arr aiis. wear seimrsa-ea im o new:
3- fq<=r=rr=r - {arr aimseru selwarla-ax
261

HI1TvI!'Iqvrra?r51Ia@rtaITITtrrt.1iI==R<na;a=I*arEFI$
aa#=rE?ffnTaTerr-----f9v=ruzfaau1a~'r=rf
y$=ra=a1~=Ia7r%-=iwTaT'(rsrrfauf$r--=ra1T#HiIvk=inT*r
err&'aaz'f=sr%n=r;'w:crrs=rr%:awTa=rr=r1staTa*r1at-IT
=11'{a='ItaT=raf%|a111m'{qaI?raTt1T=raT=l?raTn$ta'
afaaataanfart-qananwnrrfaefnfataft
nirarsnw-aa:#rq,aqraf*rgr1==a=eraraf:-ran
911rwsHr=1a-MT-1T1qa51q1T=Iarqu:asiaT!f
$Tq1Ia%|'fd'n=I*'Ig!_1H1Tracaa?ufra1q1i:fad
=IqT%-1nrtIu'rIw1$uITv1'a=Tqfetn3I=raaTIa=ar
35'1'T=l1i1T1T1sdf%i7'f6?TTiWTfTEfI=q$
a?=I1'$rqr'awIan1'=Ir'1f$TaRa1'ufisT=nTI'i'r'1e$I*r
=I~'l'lI?~T$Ta3I ?

q31$cfesaui11r15a'aafaaaf$=iIq=rdsTcr=11=:Ta1$f
9'=i1"taq9raTarf5II*I?rT41zzT%a1{3=I$r1aT#;qFra1"r
Wawwqafwlwaahcnwfi
=ztfut'taT=IuT=n=er-w'iT&tusat12Ira7=zTuquT't&a9rf<ns ta
=r1'tc'aaasIaq=rsaaI1'{:f{;ar1 aq=rq'r='awI=rF1m:fq=r

2- am EH-(1TGTr $.33-m-we gm Eio tea:


2- fukw-naar Ta?-n.=r6<~>T 5z1l.$'B-22. 1q14r=ir' o
arrzatn=raIsrf%aa'Fa=r;Iq?'=r$wr'to'urs=rarFa'ae'rwa1TIn:
atwfanf3zsTuf5I$f=a6TaTfrtIt1fesaT1=afh$"eaTr
aTTWqra=s=ar=FrH=t3sur=rrrTaTTarFanTzg'arq=t'rsanaTa
tIaT=nsImaTq=rqT=IT$r$Wa%U=e?f=&aq1a
:T=rv:T=rrF6aTaT?uIfa=rarrwr=rft'I6I=1TiI5q3ra1=uTaT
=rrerr31-I=aTTri1aTIa$I$a'r%3=rirrtaT4fa==IsI1'av13
eaqnnnsmawr Fan =u6Trrrf$-I3Ir*:a1-sr1Iras=mf$
tmwtwmmawawhanmzfwfmf
=1I:5r1vza%1amrw1rr111'-sIrrIa1vIrrfc:=Ir=raTuT'%|

9='iT3tarq*rHTHT1vIas=rraaiI=r1=r*iriITqfa=rfa=Ir
fH=Fl$1TaiFrEr'r'3'<;uiTr3I1%HTf6?5Tl6TsIT=i'T
1'r=IIjiT=IT:T%:n=rr$r5r1*cI1-1f=Itairf$=I1*s=rvIfar=ra'r%I
au=a'~i1iIT=Ifa741*11:11=Iasf$r1wI *?r1r~.are"w'BII=a1
i?F*FHr5l'"f16lT----HH1'3iQ'5!1i1I'I"fE2't'1l'
$Taq3rursf:=<Ta'rtaT%|sufa*cfqTw'rerfzaaaIe'rBI
VHGTLSHEFT *fW6'51"?73'Hf5|'7"Wf<iE|'f$H-ql'If
F=Ia=Frirrf'e'|#iA?atxarrn-'(an1=:as=raTaf%r?

t=uvr'al~r-=:1rF0I:f'-Ia1$r=If:TrI1T$t'a'GaIt2"1T@5
aT*rfisq1'aar6aaaf$TaiaT%'a=I*ra7F$H11IIH"iIaw'f="u'
3ItIII11Ifduf$w5IHWT5r<af1-*a'rIr6311sETi-s11aT

2- IF=a=r (=n+-r-5m rm 4-T )-I1r'~=z<'=IT sin 2& ma"-3-u


2- ir=a=r-qwr aha. wear 5:24.313-N
263

arzahtwfutuamwazhvmau
#fI=rviraqiIrri'aTTfiITrEir=rrw=rr=I:a;,aIr{ar&-1'I'q
=raTsta1'a.s'rrams're'%1a1*=ns'rf $q1"tam:aI1'&c
Twmfmfuaaainyamtmams
$TaT=rrI?t%III61';THt.sIfa#a'r211*IfutI?
an11$Paawrf$uuftIIa?n1'a'rr?ra=I1"sfarrasTI
$t=rnT&'i=t'iair=IF<.zzf$ra=r-11-'r9r$Ttrrv1*T3|=iraItar
3=rf%Fr1Ta=e1IkP:$s=IrrI'a=r'fa?1%: - - - - -
arrq=r*rtrf4frF5an1T( a1=Is<-:'as'r1~azTmsvnf$r?uf
aaTT&TrIsrrT6rN$q'e>'faefa$r6$#r%afiz
1fz=M1HasIf4?re;T:2}%|ua1i=mTa~'rna=rvs*an11a
$'("'lT%|.;
y=Ir9t=Ia'tfa=Tar=Ir*'II1'na1af-rI3o'a=r51'e5E?%T=IT
wrqar1<a6r$%IIT6THm=TtInai;rfa?rTil#s1'afI'1a
awerriarmserrti-ar1=s:'WI'1f.*rt1'dTaIfT=i7rrrauT$H%I
stlrfr sTeseraai1ftr=iI'a<er{%|1?qizo'fn%r=;-5=rmT'tuTq*r
grrarTarta=s:#'P<o"e=iTT=1Tnrw<*riITT'T%|'*aua'ra$r
a3=rr=r7n'aT=ir1w<rr%F$:1eT'I1tsfai?rt3s'a'=t'1I*ritI'=iT

2- F'EFI- new 51$. I361 5211313-t?


2- F+1-'-I- wear aim. sarr Sitlra-2&9
a- V!--I - IEET aim. WIT '5-3'21. we-at
3- =r=.=1' - TSET aha. inuT 524.3%-?u
264

vrr"-1arvsrasT'=r7raITf2'arIrrzzr%aTs1*=1r?

*r!=Fif'fr=1'r=uIafcz=IlIiTEv5T%2:InTIITTrI5lr=r
a3r=I5If<zrr%I=IsasseiTt-w!ra==ITaErqcfra=r'eHfaz
tafaafmcmatfaeaaanatwraawmwfa
fwm asfaruTIIq$Ira%$=rrH=r6=rr$'rw
ar+<*rqraa+aaunxeqr'aanw.gcraerssrraufa:*
1Fq#$=rrz=Ia'uza'rT5asasI=IwtTavrr>%=Ia?3
n=Im'=rH1'?n'1ai1wfdaf?n5Ifayr%n=r5a?a'=aqvTr4rn1'aaT
%|#i1a1*rrf%ra'=maIr%I%- 1r11ar'ra:=I=r1?er{HiarrT
=I?;'Ia.''=IfI$1=-tit:-'rq<==I=ra?"r=r=rz=:f=I=;'-2: utrvasfttz
i:'rl'=FIl'=l=l*'{"fT"Til?

fauaacfqr=rarrF21'=Is'azata1ri:$rITI1r=n:Ta=rT
Qi'f"l'3l5 aaffsra . =1-: a==Hr%aat:g='an=q1a% I 3l'lTl'
arq'a'1'r{<a?m1;raT'$rerhr=rr'alTaT%|9Iar*rIras
rasaT=fr'~=n; s1%aT3 acuTirrTfu'r:.T1ruTrrv=rr GT-irrrtrfmci
?qTB|1TF6=rFsiam1IfB=re'reiI=7r$%Iwsa|=ra'rarr
vqnTazaszat=I=rre:'{=rI=iTa1ear%Iasan=ar=:fa%r
5f*=rs3!1=IsIaw='r11=I15I1twr@seIT%|14aT=rar=|u*5:
mnntmfmamfmswrwwwtn

2- II=e- wsarr ai=mTa=I'r' semi-3-as


:e- iT?-1T- c"'H'I'I eiw1T'~1IrT sew;-3-=o.iqvi o tut
WT-<131Tr 1"asIT=r$saTt-zaarrtrsrt-1Tq=r3=ItI'aw1a=Ii'r
'1iHTTf=iH51'I6T*T'7{3Effil"T"iT"l%'5T|
aI1uIwa$at=a1'rrrTiiiiI'???'1~*=szzf$ra=r=rrr';aT%n6rsTcfr
4s5I%.z.$Tar=iraarrE'{Tt1rqrarTais=I!:T6>Ts1=aT=raIIa1Ir
at-.$rac1*'I% |il7oT1T'rITl1$H1'=l'fiF1E|''16l1Ii'|'|"1'=FTE3
&=I3fiavratt1;1Tn':rarqrr6T=I6Te:Tareav:'atraruranT?

n'ra=i=r*}tTaa11=rvTe=TaI1'a:TarTaa1'qT=111T%|
arrfuqaf ner rv=rr1=1$r1"r*rI"Ny=rru $rqr1q#rr'11: aI=I=rr use
1-FIT-'*lTlT-'c'l'l'l81E$f:i15TlT3Rifl'%-!I2!IT=rH=l1'Tr
=1sea'ar=uIIT=r%n1<-:'eav:I=qae:%|irzr==rl==za' arraImr:rrrI:'r| ?
trqr=rfi=iT:rtvr?5f':nf4trI$au*e2nqIasTaafa5m4h
=ra'tII%.I3TIT=rE'rnTn'T=rrsf&a$aFrf=ITqT=?r
=rTd1'6'{%q'ITWaT?xr%Itrt=q,!r1~"1uTT1Ifaras=IT'e'Iawge'
=st%ITrHraI?Ti?4T==1Ta?raT1iTaq,F-12- w=raa-ea'I=r=r-T
ai=fa1a"=e"f=IT?:HTE>'T-ff%s6T?If?I arcTr%6ITTa6I=rT1=:2i
aq=ir@ntI=rrI111Taa?r%1%IaFt1a5faeiTf7Tf$rn1zrr$=1r'*It:
Ta'raITcrr%|aa<#taa%F$6txa1=1'fa71:?=1TatIu=z'?Iaau*
H1iI=r1=l!ilI=IfETnT-1eIE1T~iI1i?lI%3@T=iT?Ic:TE1'f''
GITFIT fa<a'FqeTa'adTEqu"Tci-raTc1tiT=3Irr1u$rII=mw=rauTdT

2- 1:'r$-saw 55- user '3m.5'~3-an-as. 28.!~'=


e- 1=r=1=i=1-c''q1T aiwzsar seq. 3%-ca-z=.o.i"fqT o tau?
3- I"'r'=lTf-7li'6T aia%.irfzIT gainngva-2%
266

awe

1TT?lflili?EIT$11E3a%T1TT*'l'=f1'7r6Ww1;?lfl?1.I
<1-:err3:r=IsTHrH=IT=:r(a=~'rri'%|3I=nT5raaa1i$1G6T6FIIFT6
IsrH1=reaT$1:Ia'raTI aTa1'rr.='<Ttr=IfraTIaaTIa9"rw%aiI-*(=IT
6TrrI'1T=<L1?=r1isaertzqaerr%f$az1TairrI'$Ta==aTIT%n
wtrtarra1Ea5aaT%--=frerTvIarasfeET'l=1$TITatI "
rFtU1'r=rm=q1'raaTa*reiTqa=u"c1Ta=t1v|a% fazarfa-?$I*rvra*t
in

333$ cccccc C3

3F'Ir=reIIt?r;arrar1=I~af=IaT${mrrq*?ra1't=Iru'1
1'=Iin'rBI=rTTat'HTIt=16'ftaia?T'rfr1'a|fa;,q@rqII%
aTwtTa1'(Er=1T=rIvJfaati=faIrra'I1*q=Iz1fr$I?I%I we
Ir%sa=srurar:6tFaH:=ira=rafr q=I=IT=ru1aaITT%
f=r*I=t=FafE:a5f=rq'=ra'r$TWB1H11a'1I1Tt<IarrT%IEz=rT
wfawrnwaataae=ra'1r61wTI$6err%
- - - - - -- q=rl1a{'IENHITa%f$T?-,f=rEI'=If$T
aaT#$r aI=1H1:Wr'uT I :r=tqT1w1a T=IT=rrE?s%:
3=%5%HT6f%:ma'rInIaT1aaTa=ITu3I ?3i2niII1EI$l:&'I
aTwfart:a=rtnTa=rasf1qaaT.u*ei=r6*ffqacrr.I6=tas?
wrfw$r=I3fnaaa?lT6frrnaa?r=r5WI?9t$Ii2I*F$rqa

2- arcfi $1a'en'e"r- aw iw1T'aHT' 5i?1o'5'%-N


:~- =rsIrs -h a'm=nsaT 5211.533-&=5RI=Iio?&=
267

1TfT3dTT1HTEIEH$1'35lT'6'q"UdTTFd$rE?Il
2:asTt<'arrFu%fiI1srI1a'rr=rTas1aaz:rT.tasa1(=I=ra'rw
f"=aisT=ITa21Tsr(TaTI6rafarrIaz1TqI=IT&1z1qa1'Ia=ITn
r=I11r?I1n1a1e1aTEz=IT=iTr=t:rtra'rvz 'Itt=I1$"r1a'q'=rErr
%FFI=IT'=rIaIrc1T%|ar61e1a1vartIasaerr-15I3rI=:'=I=r
o1w:aasyqvrar:=raq=ITa11r=t15ndTqfaz|T|aa=IvT?i=r
=:=I5FqarraTs=r%aTmt#rr:u$$6TWaTI#aT
f-va=r11fi:aaan1'teusTrra'Ie'a5raazQaaT=ra11f=ren'6a%|
a=rcrrasq1"aaT=rirfe:ea=r=:'af.q"a=:=ra1*a=rasr=s=I3=r6T'| wt
ar=mT%'a=fwqr:T=raafIa1s&a=FIItsui'i6T6T$1"{T5i
war l.g"F4T=fi'T":liITTT'61:TTT5H=l5lr{l1'f
$srFc1aaT=a1q%|ararraaqa-;HT$'aITTa$taI=sa?
a6~'rz'1'TB&&s;f-ca-u=I=I'v=Iar'-. W%I6Tirr':|c:=iTcn
q=rf=ra'I6T$Ti?iUT%6T|&%aTarqtafaarr6
aTa$<o'$*IFtuT=ra1TaI1ie:;nTaHa,'tIsT6Ia?r-:rfq13T
arrIa1'trv<f=sTq+aq=r-1@:=i?rn%avTa%asTTe5Tt:F=I=rI1=I36'T=r
q3$TTTTETtIi?T:1T=ITa1a?r$Tf3a1?itsnTa%rW(
661f'i|T6"|'%|aT=Ta1-iII:a=1'$TI36Ir&%|ar
iqTT#TWT%TEiTT(HBTEi'E'|GHTZ359''(
=iT=1ta6IUH216nba1111aa3r$z=Ita$o Idfrmi
1w=ITatfarr%'8'TR=ruT< iT3lT~a'~l'|?Bi7I'u :r=nH1a

2- f2mTa=rr - wsar sins. mar s.~zrmJ-x3.aI13aT' eioteuso


?- wavuirt-surf ai-as. q1vs=IT' szmar-3-xsz
268

IIahacr=E'rtaTaiTwT$uTdT%PnTrr;:=?r=rrr{11far
I:Iz=I11z1<2:fu=5r:f11'1=|'aT5I=T1a'::T%|---*I'tI'nf$
a=aT=ran'e"GIT=:nT<rr =ra=1a"aarIsI'c'rrI*rI'1'ufa?r&=rr
$rHTIlEc7iT? - - - - - - - -aiwfxr
f=It'21iIn=I1w3=Ifat?rf=brarasfv:'ITafa~'TaaFIT{tasIaTar
ws=Isrrraaerrs"r1-srrBI--~:=:2:T=rarv1=rTs==I a1-ma
ar=rI*FaiHTIa?rrfaf5Iai14ia=Ir(=lT?:&'-$1qaw5Ir&:=IT
$raqf='1fesaarTP:-fee-q,6nf=rEhmIsIfa1=r$trr*a=re1=r$.
=r:I.T B. {1,'=eHIa'*raIr?*=:F=I=!r:=rana I 1T{'TH3'l'i'fd 1':
faafrafafafqwuwafastrkrrwtaafygfa
$=ITe11r=IiifaIr?1IaT?1qTaIa#:?f.aTT~1TIi
=IT$I*fr'=1=a aTaITEa%I----am3ma11=1'%q1i<1d1Tn'
l66i=r|IHTTG*6?si?J(iT|t?-qEll3Ii'(3i=lf
sa$T- arre=n9r<s=rr$T'<a$$19'enT=t*'Itst1a1"~zIc-x?:%-a=I
atf3sqasaa?reu*=Tw=1T9ratq=rfaerr?.%IIGTI
trzrrfaufaiaa FTauT% I 6I1'I""7-13if~2i$|'7.' 6H'I"faTrIf$
a1$'rat1"{='aT=iaT%I

ytirat1TtaI'rx=rtIaIf#sIrT~:=BTfn*err<v'aTsnTa=1'r
a1'sauaaa?rasarF=reTtITa:rTr%taIT'r3s-anaErt|
!T'('l'3ElT 8-- aI11sIT11T1-I=I9azwrrI'ra1aaT'aT=1"6'I

2- wr1=i=1- user mifwr '5$u.5rIa-?u.?\s.?-=


269

''N1'i=|,"l1$i'HT1l$1"if'|TT3T'6TW3"lEI'E$H'T3i
aawwwkwwwwnsmmfqt
3wan=rrwafI4=;UTar=|q<in'%za'ir1vratzn+aITaE|1~ia#stI1"q
eifaaaT1=r=r%$:u=IraT=wzaT=rtasf=re%|&
EFFPF aI1a=rr$Ir=qrIr=r=w%I - - - - --a;rrz=rr'
In-zuw=u=rra'raerr'|t'Ia=Prf-1=f=r.1qzT=r.arFa=T=ra11$T
l3$TfT4TTET|l'l31TilHT'{!-15Hil3'{$i
arT5Fq,$rs11IfraqaT6Ta=1=rH$iFaaa'r1~nu621T"aIaT'a?r
wc=rT#T5i-qsricnrtu

vaT=fTuqf6a$r$aa:%zaTf=a-qazatmfr
?1TqT|39i=r.3ilf$TBTF-t1'H7F$IRTU#'3I36fI1Tl'7
w'1aT$1:w=rqa9rarryqTaarIa%na=rqfauast
aa4Ta'rtf=raT1ginT=r%cnfas:zT%|1=:e;'=ITfa:=sia'r==U1
$rtar 's'c1=r:r-. an;=rr irTseirEn'. aa'Raaan=ire%r
asfa=I*rEI"w3wII.fwenTl5:1l=rrqs"r&!:eirBI5F4=r
ma'r9cuInT4T(#awr#s=rra'qI=1aI1aarartnr1fatr=rha=ras?
arqtreiram1rta1Br-=Ia8aITar%.aTea1a$aq1-refI'arra<aT
=rt?rar| aw4rnf1I1"Is1aewzfaa=ra5HaTto'=nIrrT"1I'$1'6i?
$rF=r:'I1aT*aa%wT>raeTaftaTi5ISI=r=r1;faa6Tw=r1'1Fa

2- wra=i1na6r ei=mhaT sarmrta-as


270

q:fasarqwrs+=:mqravs+' Qir3=1r#aI=Ir1:1'.5=IrfaIs1
WT1'Fira=HI1'aT% I aaaT#ra'arah;rq-amTarraaFaa6I1I
mrwdafmwawanzazafwm
t'e1:'taT'::=1I1weaIstiI-=rvTan:aar=riarr%Ia1"~i a'l=rf=<I$
1i'1"fTE*il:1(5''<TflTTTH'TTiB|'11TEiT=lHTTFB'TH
qfwmar-*a=:man=1Ta 1:erI's'wa%:%Ia1w:Ta'f'HrreI=Ir$
1=rrr=rq1:H#iifI'w=r%iqt1Tn=rT=T-'r6=eITari7s|"6I9=Irr
tt=;aITFIHfi?Tai-T1Te'aTaaRar(!fa<aT%fas
=I1=:Tf*'IaTH=1IIT=r%=rTI1=rIazTh=ra8r:a1TI1iia=rf'=d
fnwaurmmanagfwfaamqaaea
3-ataa*T&$1W11$TsT't=IfWIarr=nTar*3iI1tH1TI1
rn'-a,a1aa-T-(to-erru1viT?'Hii'asI3r:'qT%I?
urraaf$:rq&sQ=fi=($cfazfq1aa=rs1=r$f<-ie3=1TeT=11
$T%ta11irT\.aIarq=:a=c1qHT'iIVTI*r$warr=ra=rdT$Ta<ort
sr<aa%ntaaTu3afa=T$dftCI*TrH<I'eauT%-as
aTiaITaasrtf$a?a4|#:nw3::saM=r{r13rf3raazr
=1'7rrwra'. war?-qr?uT='a1T611s1anr$. nrttnra
ntawmatqawnaffrmnwnffamhsafwr
a'.3*|z=&=r=IT<o'rt1'1ra<-3I.=uTI1IttI9r<T=a' ahrqaf

2- III=I- EBIT eh. aTa=IT' $$!I.3"3-RF-.


2- 3; art! mar ai=5.4'(T sm-Ira-so
271

R3: 3? kemrfaqf trauma E. qtart a111=r=zrcrr. HT. 11%: ah


as=qTIi5attITar%erfrtrr:T.q=If4=ufaeI=5aaT|::rr?1
<I?'Hrn1'1'aa ET?TI31"I-=rl"I'PTIT%'1'Tli=1T'6'TT3Fi'l'(UT
TI.=lTil-(?iq =mfaT=:=tw$l5=TaTI-Nara
frufwllnmhmanalaaf
:rqHTaT'ferTwwT$!iaq''eur=rf=r@9TT.ns=r9rP7e
qT11=ITa=ITe:rF=r$rIrah=rla=r ra=r6aI=,Ia|IH}rT=%
aw3I=ra=rxvrfasaairvT'ies1*=raRI"en faaaafrwu----
$scrr=rrtrr1=ITr5I'i=I=1a"ft|aaz=aT=n*rafeIT=W==r1c1ti
Ii'<ift=i=fr1s~.fairTa*aTazo'r=Mst-*rruTaT<n't|a2'fa=s?4aTvT
a1q=rrrqavrI%aI?TWrT=FI~rIttahsaT1trwTas:'r=rf*i=IT=rwr;
3T1t<.faFi'a%|$aa$IqTaeI?T Elrr ufwaga 1|"}i5'r
a=iii1=TUi?TdT.a:ro'qe)1iTaIrT=mireaT'fayTT<Hi%fvsT
miT:.$Tar1i~4'as1ewzf<111eI1"(=IT1=I'a'y2z=Iisaa1%a1'IH6
awa$aa*fLuIatTawq=sa=r(rv1=I%.wIcia'%|

wnanaaamwaattnw
eIIa%r~7raav1Ta*Fva%tr3Is9r=IIa=|1=i$*eu1=a1a2Ira==Ii=I
rr9r#rnT:=rrauazrana%|aaaa11faw=ra6T$I3I*fr#
H=I1'ai5IIr{f$Tm=ITn1!Ifa~T!IiTHaT$21=rI=fT'{T*=7'
t:'n$16Eaq1vIarTHTarEIT=r14;trrmTa11H111TIH1;{F=IaWT=

9- .acrrw=Ir- qaar aim ET s&q.'{*3-83-W


272

fizz-srHsTtrarr<o'<1=1TasT I-$ll'l''1tzs1"l*1'IT1"-175|TEo'lT61'|"!TI
<3<1}MT.w:fyuTarf%2=rrTTa=rra=sT;:Iaaa=It21TI3i='IT
=lTTTa=rI'q$Te=rfaivraawIrafarTarq=r=ITaa#'*iz1rafuT
33I1T'HIll'rdfVFi"u$If1?T3l?'I8T5IlTH'5(TiTT|

CC

&saTa=rmTa=IIaTafufh=Isaa=rmTsIHTRa'a?r
Hrait1$f6E1T1Tii=tnTaT=i1Ftqf$f$rT5raq1'arIr?r
=rraFfIIra1'n'r&I'

WT-rII=!I=r WENT .=r=rc'rr .freIr=r


n=rqT=r arF:'=ITaa=fi'I9m1Ta-Te:T=I{'ft11'Ia'r*1aI'1q==1rt
1iF|3f3l6HH?$TTT"Ei3idf$R1'%f$'1iW
t&aI1T=I'ar'sTc?r. H=Iran"I'a=BIaTTacira3I=rryza?-1iiIdT
%.am*a$ra=1TqTa=m1rrr=T=ITra$aar%|
aau9=iT=rrTT$1=ffa=Ima%rf=r%Ti5I?n'&Iw$nrr<TI'II-I
lrr;?r1WaT'aIreaT%ra==zTur au=x3rEI(f':iir=rTIvTva==IT=I
qq%ar.qa'a"f1qe'crrnTar1*e1'=n'-zft1=raru:TarreiT%I~H
r.T=I15IHfa?ra6i7tfEiI1'crTa9I=s1ein1a=r&a=1Tw=Ft
!%rTu15?iI"z'=Ia=ra?rroP<3a'r-3FaaiiTI1=T%arq5I%tz'nTfi:
a=I=IT=r #62 rm afcrr B I sat aT=I9r 814% raT aIrI #11? am

2- 1rTFa"m- t1seT amqwr saw;-a-ta


27.

=mefqT|7%'erraswfats"ru*I1m'U'&t=r$fae1~qT6f.
nfawsrtrrft-qtga aiafnawtartsafatrr
arq4ru1'sr=rrF=aavri1=IrrIw=IT=r$tr==I1=|'aai1erI@:
aTsIf=rasro'%.aT3|e*Fe5aTT=rrta'arr=rr=I1*a'r.arawzT
n1s&aaT=I=I=r%Fa=IT=::=ze'I q1:a=a1'q%aFacseiT'rvr
yrtdaferr qra=rr'fazraarna=:=rsTaTI

an1~iaIT{11FITTTTT>f$dIf1=ra14iE|T3rq'{
=rr(TasfaEaIT($rsfra'a==I=rf13uTrqT.:nH3,Ea1'($1at
a:rz'aq1a'{a'3fnTuTetr16aan=ITzat1'ti=:1-*{=Irw=rfaaT'n
$t=rTuTerr%.emI=rr=rii3=iTt$tuir=rrtr$r5:x=<1a=s'(%I
aii=w'Tq;*a19r'i'1e11Ta"ra1a3s=1fa1traaT6=1ttIa=%
TT$f$fGTEEW=s{fi?E'$T=f?TT|3FW=r?3TVTT
q?=1arrsaq=rarr=r%ra=rarq21errttHaT1sw:T.%2"Fas=ra=reIBftr
r41*rarIrIaTdTqTaq?r1aE:11u=qm'Ia%ar6fa#e'a1IvT
=rf=I<o'rIn=TaT=:=raita'?=:zI'f<uT21TnnT=ITaI1TH'aTat1=r
aH=I=ruTaTaT|aTe=ref$rtn1'=rTI%Ta&If*r
ai1=1=t$MnIVr<T|HTrrrf=|a=*6au'eaT$6iEcI%as$aaT #
f:6'c1srItarFr44sr5aerr=rFemaTa*rqTavsIa1'a'an1=c=1'
$rm:c.T Qsarrtrrr =1=arrnT I arraw FT altrtsrr T( 1=TTH$TI'IT3
r'rrc.T$wrr1.r2za$aI1"r=i1'*rr1I,Tw3rar=r-=rrc:%afttrrqriifmf
a:r=rao'rafz=ITan=ITt1=1'nrra%|=rTaTa~'rn1ts'f=naztaTk.
1*rqw9sa1crr1;aTirt=rT =rfan:crr'. wreir-*:3s'w'r$TaFca"TI
as-<o'er1=ree:aa'T?n. frqa=s1"qaT&q21m.'aa?taTa*r$Tz'
=Ir' I mmmmmnmaanawmw
274

trwautcrrt-uaar?=Ierraar11*~1'a=ian=rrzIataaf1w=r|5I
d'1f2l'T7Y$5FriiTiFrZ?~'I1F1FTEfaTd'l=i1't'-GT1-T
amrr !'I6'1TTFEl'1T1i'l*fQIl1"(3il"rT$TQlIT""H!1Y:G7lE
arrz$'{wFma'raaTaTTaT%---I "
9IiT9taan2zT=I$Ta1TI?r1i$a1-H1T%fas$e'l1'T
11TaT1arraTf?a1%WTr*zT=rcrr:1qa$1BT%*{aq#1'a's=af=sr
zlIT3Ftn1'FtTi~TrTIiIITi5TP:'|3aiT?a"T=I<53s2raa
qfaw---iTqara=rtTaiwe=iw-sa=:r=afmaq4=rtfaaf
asraaurt-s%u?wraT='s=a=rrqrwraq==r:1rcrrr=acarr
yen G aa'r{|"u aIIrITe'uT 'qs'~aE: E n vs 117': =raT=r % =r=:% ra
$T=Tw11Ta$U$*(=rqTwF1s%nT6I3$ru=rr=Ia=$FnTuTa
ear-am ma t ah =rruT an aa=n' 151 at :=I1'=M1:f 5: am
asT1'%-aisITemr1rr=rfuT|=rfaavrsTu3a'r21r.I-ere5q1'=r
=aTaI'-zf'IT6T-tr::?1:.=r%eTtra=-;asi5rw==:ururI
mmwef aI1"aI==rr$tartrr3''I" =mITan=Fr
wFaaa!tqr$fe:=1Ta'rfqcn'a=T1=<1T=IT=rure:inTaI'I<f
=EaaT3'---a=w<iIc:$crr2ITE=IT%.af=I'T'az'$farr
asr%n=II1'9r1'rait=rrE. m"raras'r%ITFWn!*ras1auT
artful"

2- 1ranr=r - user aha. wear iu.131a-2?-:3


?- arrs - gem: aiwaatr 's2a.Ir3-ac
3- mm qwr mafexr 5vzh3'6-2%
a- war - wear aim. qqa 5:-..1;w3-an
wITsfrI#s1eIcrr1:a~T*rItrraI'-r=IsraI-rr;as5I1i:tI
q(r=r=rrI'T$raaIs1'q1+21fnarre:'rwa311sIaa#szITasr+a'r
aIrrsIreHaI=rr3eIr%I#Tfcf1=ei=Iti1I=,1=IT#s=I1tT?vIarr.
I?<o*1'qfeIKTTraaT<T1wrrr2IT2zr.utIfazu=Iras=I=I*i
1=6:TtIe?r$yFn3ITwaTIuI1=ITa?r51ta\'%fqmrr=ITTTaI
irir<I=I11aaTaarr2IT.a'e$FaEa=fw1'4?rqT=rrsrr*Ia?ram'
II'ra-Taf eIsassIrB-=Ir=InaI=IasI11r=zfuzIfri*.T:IaI:rr-Irafr
t.1:5ItrI=qa=IrITarfsIfeIaawr%=rr"IT$a=*vIaiiT!I=I=I'(
I"P5nTarrras$faTrwf'1mfcmf1snITw$=srIvTqs=I1'crr
aIaTas=IarraaaIaTtqT=mfIaqratIIrw$Tarr=ITiT
qIaIFeI$1w:'zIIz'IaIIanfqrwrItITast=IT1'Taws1iTerT{
1'u;Ta'TH=rwr"tr$T'qIcrrtIsnaT'c5'aTa"rsaT%a1T1w"rfr.
ifaeIcrr=I'taI1~ic'I=IzIatI=Ir=Ir=s'errt'I a6aIrR3'<T!I.'{5'=r
asriI?e"fa=Irr=Ir =If.asarcI'r$rwTsIx%$ 6-rr#&a3"fiaI=r I
1m'rr1fre7==Iaerr$=INanm=raIq=rrTT=I56$IeITa
qv;-I-tr 1cia&aI1*-(wr(r5rrI9nawUTaas=rrr=I~'rt1tIasIa'r
3 I w=rwTqT%.me$t.a1<otIT=I'%s I =rrfr zmrrt I waft
5rFtI$u1aII'-rmr:n'rqtaaIFa~s.asawrtrIqtr1r
:ra@I%I6'errt%IGfh?eTi'$asTqarza=IIHtIfav>vrra4FI=?r$I3I
Iwerru==nIr=rarr1<I#Iq=-II=IT=ITae"41w1r9Ia=IaI*eaf
$I=ItIaI6=IT3=vgezH=T$IIaT%I"9r-5IT#u65Iar=I'='aB1'nT

tuaawwahmfmaynmawnwwvjg

2- =I=T1cI<}=I- SUIT aF5rT%IT 5~2lh33-'=*'=-=\>

?- eir2IT=I - tram a'I$.=r6<~5r 5211.313-=-a


276

*riIT1=ru1a21TII1za'afIa=iTanTrrr=rfaqT=r?raf%?
<mr<1r#TraT=srar<1:aRaT.1uftarnTaratq=1T=r$T'rr%5a1'I
an'faitgvrrEITI"
-nr*(r$remITI&aruTII=rrt#wI:m=r1r'et:='rfa-a
Wwtlasmmmfanhw
aafmfhwuwwmtnamwzimm
aT$1'tF(I'F6%In'F{w$fETerrIvHauP1T"rrr355rFa
y=iT=rrar3=NI#I'Faeeiq t9'r=r1s$aTfrc.'1iT%|
=}'r=rFs8Ie?1Tart;a'Ir$TnTeri1'ai5Iw5aa?rwr=qT$a11r=r
1aa21ua1TarI3T=r%Ttara=Izfas%|t1s$aqT%=IT='
asrI1'ar;uu$=rr=r'*1TaJIT6T*nra'r%uTen1i5Tz1m=11=1'
'ssa=s1=rrvrrfaren--5n4aaaafaab=tITtHtrI*I$r=rts
a=Ir=1a?r2.faa%na=rna$wrfasTsI1*ara$ra$I14~?'ivTaiI=IT
3=Ws*rH3#%~fdTarrr=f6sTTrrI "1I*rwr=I*'I
Harnwqwdfaaiw satarriarr 'TET=fY${1~il'vul'%<i'lfF
$&Iq1ar5na'TaT%|%f%=rI1Tv1T?6a1'='IcFrvrQas%ra11Tisa1"r
r(ar=sr=r1sTaBr:1TaIirra:aTnu==rs$t%x|srr=iaftrt1=:T
$rm={%-It=fYT6I?I|?T=rtar=h119=:61=4m{=rt<rr'
v15I3r11i111*TdTWIHuTT:T3sfeTce.anrzfFa:ITt:Fa=r1iwrt1
a1*(fazMrar=r(Ta111q?o'8a'a>'r(Vra1'qa=T*rrrarr?=rITiiT
anmufwwnadrnqarqgaww nrr

2- n-rqT=r - qerru aa. war '5a'Im316-to


?- =i=1fc1'R~'.=I- new mtiwr a11.%- 9 o
277

!1Faarr1aa*'I$=1-1r3ari1:=1vT=rr. qrqquqtaaa
=rirTaTirraaTesu1anTa!t=r-wr1si7I1*FI=r1$t':=1*w'<5=1=:r
irT1sznzII:Tataresqa1"cem=rr=r=rt-.=rT-a'r1=a?--
aI1'=1eT=ra'r6?a%faaq1111=rI?-.$trw11=I=1czTI%|aI1=raaf
erraa%=q111as1=II=IT=IaTeT'aT1;UuH11T'nIarr9r$T
aI=m'(fkuTarm|aTtasaTIqa%aT=rFrFwfuqf$zm1
aa5qanIa<~2'r=mTatr$rq=vrr=rr=fTauT11e?.q1aTa|n6"ra1a$
HlT3l$FfEl'T=f$li<93H'TTr??1$TT$TiT|'HT6'f$T
eHrIi'I*v'2rr=r=mffqa'rru?z'a?q=zt1T4aarI'e=rrI"<

q{a"vraq=rnT2z'%Is1af=r==ia=a=I11Ta1@I1a1ITa
afasIavsa.wrvT3s1esEaT1u$raFn=IT=ra1T=i2IiFrW1TEI
EB$'(F5*:lf'GEfT?9"i?'$TETf=rH<a$3T${iT4'l'
q1*Ta%IiIT:HiiTuf=?rqITa,'(T=ITas1?a'a%.
aaca?=q=rr;aa?r11aTrarw=r<%rwa}afq$rI=rfa$crrIttI
q1=rtrf$1eITasI1ar-tar=Ira1=rr'=ftaaT=Iwa2rre'% n1:'ras
a-7rI1Tt1ffii5%1vrIaT=rt2.i5T'=.TeT*a'aI'=rr'$<iTa=rtI
faaarsa-*(=1TaTaerrt|aaaT<I4sa11ia'ra=uwIiaT9t$r
5l6'T=F{ uT% I rgrf =IT=:'r13a$anTt- ar=:I$ras*~ar faraw
rrrqalr =r'taa awxr?-a t ln n f:=r tr qrcrr $ sq a1=:=-1'
=IT=IT13ae1a-r(a'tIaT1;3ia=r'%11BT~a=rq1;ITaT=IT crrsrar I ah
tqrarntf-mT1T=Isa1'aa'aaT&r1=IIiHETTr=ITa?rva?r-cm
TrT1;aaft1as:Q=r61III1iE1%rT1qaT=iT3t1zair:rrT-urr

2- T"l"=lT=f -:?'q a':==mT'aa'r "saw:-gr-3-2-a?


278

ar:I#sa=s*=I1a1It=IqIt31'aTuT|fa5*qw1='faaTIa'a#s
qa qwrt fqcrr a :r<==r-=1 11%. qwrt =ITeirmf=i r Tnaa
emaw"-1THa3ra$rn
fq1rqT=r$ra1:T=r<'rar==IT34stra"r11wrrarrH$
:Taraa?'=I=rqauT I 65lfd1HTT=I11I=lTFId%f1$
aqai=r=Ifw#raa5asT%nr2rT.3Hfata<1a5TU'atHTa}11'I2n
=rzT.aagwTrafI'ai=raf~rar'rras=rTtIsuT2rrI=IirrrrvrT='rI'
a11%1=eIzafwrIaTuTaa*i=|Tarrn1'HHTrT6frruT|::t:
?=IT3i{i535lHTT=r13?n'*?Il3lE='Flo 917. aI?T<1i*2zt
aTv1'fa1qfx?r=aaaT=r<raar:ucrw'=I1*zIr@:e'aao*aTerrsaTBn
arsatI11I$arrf=rI'I$Ti;"qaTwwa*r#rF6o'a!rrt=rfIaa:rIa
$Ea1T3-E1'FI"11'3RTl=l=l6":Fi=|3IEi1'IH'1T=|'EV|!
aITa=unTu%|5rfufa'aTa*':a=r=ITrrT"1I8aTcnTt5aT=1-Jar
$1I't~-isfaI----i:'1HI=tFrEIaT1I'IaIF=r=IT=r=IsTf=I.i1
fqa'r=rrrv=nTFan|s=r$rn3=rsaaTrcsarr6*T%f=saT%rru-*et.
a=m=ITIqT=ITaIwar%|eIa'ra=raIq=rr=ri:1='ta1I1'cu%
a-eaiFrI*5Iarrt1a1'&'.'a1=nT.*r'5q=a I R

n1'ta1'aa=rra|=l?rafcmraTfe.crr#sarr::vT1aqaT
$rq=Ifh'=arr15HTT=I1"qmnrrv:r<rruT|I=1Ta=1Tra=:$iT=?rvT

2- rWr~=I= - gm a'w.sFtr saw gas-aw


?- 1q1rqT=r - strrr aiwraar 531.5"-3-3:
279

aa'6mI'errttT=ifzrT|%I=ITfK5Eg.a$}I\1T5Ii3T1=I1T
#H1'iTqHfuafa*TqT=rFE$feuf<:asaa5Iqn1*afqa'TIaf
'lFT'f?1T|Hq13=I'-13;1T=r61:=l'1T'r1Tll'5J?I'F
arFqarrqatrcrI41~irIaTa=I'rafarrz=FI'Ii=r=I$faE1s21
ir(qT%Iar1=IsfwI1'ai1er=r$rIITt1TaI1aI1"(a11:frAf
1eInzshn5a;$Tarfsrr=r$t=rram=IiIH=I=Ir'aTkI<?>Fi5=r
sra mm #?r31a$u111$1'n1afIer1=WrT$ IiR'ra1
$r1TTvzsT=ra,=rr|t1s'o'a:fhIaaITaf$TqaP4'1rrs=$ra:=rFu
TsnT=ra=rT|fErv1=IT1qa1's%tiI=I3'4T-arr_fai'r(=Ia?!I11U1
B|a's1Ia5rI'=1|I5I1=rrl%trfasTcrTa#s=n.'r=i2zrI
s==H'1Taw*t2I'aI1rawaErvqraaara=rarn=rs'rr4'taTerrE.
q,aT'r{Te1tia1=!IImT$r3aaq=tcrrt'Fasnaw1erw=ITP;|
WET!-'rT?lTE3'GEl1l3TflHEI{3I15'f83'T'v{?'!'o
fHIIT15=rfau=r1eqs1zas@:o'!rH=r=nT21Tn1'a'er%r1=ztawr
faaTsv:='T=raTuTa'a=IIm:T|as=1Eo'raIeirvir1=ma!a=tn'T
sfqswmmqafwatszkttf wtaawrtl
wwwaawmfwnauimwtwnwrkia
vaerrt-uH1vu?r=nT'<r.sE1Iiawf%aafasrfqaTIT?r
aTIt=Ii=1if:etqT6TITr=rIr=iI=r$e=iI'uaf%Ii1i'aTa=IT
aas'1qa=IIT=1$r=:uT'aTarsaTsT?=ra'TarnaTa6crTIa?nTvrrI
%l6*ilT?I$1TVS13F1T'Tii1STEiiI=rT3l2EiIT=f1"1i'E

2- Nr(- strtr aim. =IIIT' 5311. 754:4


280

3=r"1T*i=I'I'%Im'6T=5Iii6rt---qtrwrqsatr
1eIuTsarta$ar%aT=IT1rdrr----a=ra1*=r.v=a.wr:rr=r
ua'I?a4=16aaF111e=rrrf.Tf'6a1a113tfqarraf$r%arI'TasI
e$?Ia1'i1'aa1$*eiT'9rir1f1'11fa$=rIerr=rnIar'q=rwI
tI~=ITII%n'

31%?! T-HF! *lET6T$iEr51='I=r"p1'!1=il4a


aHa1'nw&aIfraawturarrm'Fv?asf%mrI'*=:astfaaaTasaTfi1'=Is
afi-7rT=f~1'r'1IIrrIT'?rfqa1T1%IIT%|tIfua=T=,a'c=q$
=I&rg::'&=rc:'r1"cIc1T95I-=r1;%':aIr*=a=z1"=IE'crr =raIu'r6-uimv
iFI+Tarr<aIwH$r=rra'aaerrt- nmrraaaarrq
q=a'r*tT=If=Iarr1er=q(=I1w;a hwnaqva
=ITa'f3t=irq==rr1'aH-7rTs ErII7:=ITcrrrqr?q=3I=r=r'
fe.arr.usf-'I<:=3$Ta'qaa'11'nTI?aT?<1w=iT6T3br
%nirat3I=5aI1'a1=HHEr1=|'111eIE:=I1'&' =aT5HsHi'raI"
l6ToI$$FtUTf$T'5||'H6Vf=|T'lBdT%siq?
T'TFiEFs=H=TE1lT=fTIt1T%|

3=iraeT'rye1T%fq-{raHa=ia?;'GTIT$aciTsT
irrHar41=1arramTvr=rafaTrrrI5<=':u-'rarfe3rr=ri57:I1Tqar
*-IqaaI1=I=r$a"a:fGn're1'n=H*ITIir tI9=Ir=ram-t=I=r$rTc"u

2- am - c'?I'I{'l' a'mnaaT 5!?-'lsJB-Q


2- Ir=q=r - near aim a'remT' "527ils3"'E-3?
281

2a112I=qaT1q=iT$r6fi;IRa?I'%Ia'=rraq*r=rFqr5;
$aT:arsT=ITa*rmr%|qsrfaar$TanT$rf2=ra:rfaa
a'Te'=ra'r|a1z3sa1artttrr$'1=11=iq=rasnr<Tfut-erfqw
E'1=ITtI=I'6=a'mr%-- n1<1us'Irw'<~fr=I:f=Iw=rwt-am:
a11zfaar=r6"fuvaaTqTaTIT6raafa1%'?HaiTI1aTt4ai1*r
$f14i=r=rr'IFI'5Ta'Tv'san*tfqerrwrtrITa?arraw=rr=tf=stc
TItT1TPW16vlll31$6-Hi?T3'7"6ff5T'Tl"-7i7T\.WT
3a$fqnT=rf'Iir1'B=:-:6"rfrHta'1-F=i15IrvTa'I"4a#sI
----w1a3a=Iir1:=u'$T1'6ae1'=faHia'rI#iyfaaIw*r
$aaH=TaHa6n'I----6H1Tran1*a=Ifqa?r5?q$neirrg
r-rr1ata=IuTar=rr'tra?rai'IT Her 8. sat=sf=I1='nvrPt'11'f'z
1TlWl'1T=I$3r41'I3l1TER1'=i$3?iTlliTUTUEa'{?s'
$1-*urara1{<:T$ra'I'=1' $12

ar~af=I2seI=1Taia6=-I4-?rtz11*e=:T*rvzasfqazw1=rrIT=I7I
fmrknwwrtwmmutmwwtenam
=sra=rrnIs'rrr;|sI1'a:=tI@rhate'raaxfsIrTIT5IT'ra
=s=qTafa='ra=su1"I=1't=raff=w~1raTIaIfI1nTwir=rsf.
wixfrrra qqfngfvaifwaafwik
ntwvmfwwwwwawmanmmwy

2- am. a1-e1r as. m-err sun. gr-3-222-282


282

9:3-crrxrsunmin-*rtTlTerr1quTatq=rTir=<:T<i1asTw=I
?z6TII'(sT6?:%Ifa:*rtITH"~IT=ITfaqf$r<i=tIaaT
=1TIsTa=rasuT*eqfer-HFrTT1I3r&n31"o*eTre'3'wTraia<iT
3--ifalfwfwtmaataatwstqaarfw
a=ir'=FI=IT=Iscrr%Iar'=io'$r=rt=rr'nf=t<o'<rr%<rT:Ea Irw
afqqfwmuazmfawfaarufqfmwwmv.
nrFe=!U=EHTIsraa%n

=?rernTa(1w<r'32:rasra=a=sI=rasqi.-riwnaa
3urf<=snfa%Ta'=IfaITarrz=rPeaa$IaT%.5masta?c
a11TIIz=ra'(hi:r3I"t=I:Ta=i=I*'c1'ra=ra1'{T6sr5I2zTa'r
1"TfE{Iara'$aar%- 6*1T't=m'l"=r1wa1I=rr;1"i5:Ir=~;
Ter=-safz-:'It*1r1o:aTI6'=rr'tt4=rr~:t':fean1 $1m%"=I=ITi1=r
arr aT=rr=t - W 1aT=IT ants-T ilTuT % I t2|TTl' am an:
arr%Iei=ra5T'H?rTT3r&Iqa>"=ITaf$1=zaIfe>aTfirf<=r
ar=3*TTr1-Icaot1faa.aTT=.'I'aa=1T$($T3'rTI---iii
(;IrvT1THI%siz1TI&Fqa=r$F<5Tra1:=rasq?a'crr
rrrwastfarzfwnxnwtsarfrsataaf
$razuTaTassT=1T?=pe;=:r=r1esnfirT:m=i|raIa"rira'(a;arre'
TsaTaTa11T6=IrfrwTfda?ra3f$TaTaaTIjT(a'%I=raT3r
1=a:a1*<=ratrrt=r<r'at?rar'aqs=i=ra

t-"1q1r=rr=r- a'mTr saztwra-=u


2- 'ar==r='rr- gem a''.aTuT ssuqw-6.2
283

3u=fr*t=uTT1'%wTc'm=rIWuT a 1lE35T=lT?II
1-s*eiTuarrHa'6la=FrWrI'$I"rt1aqTTBu*en=if=uIfe'
TBiT'{'{1T'ri7T'?|'iT1Fe3i1El3'$rGIii1<I?IiT=iT
=IT1aIaH5r&$wf'rFqfdha*T6'r%'3riiTI'HaTaf=r1'
a'rf6EI'
nT1?f17Hr=rr=-I*9I=I1'{'1'a'=r1=2zr=r1a*1*-Irral1fa==r=aT=Ir

ararTaTuT|usw1Tir1'=rwz=ifmxararr=ira=11=zei"ra'Irara
vfrn arftI'=s5Fnztast{r+=raETar1%1en'vfr|us1m-=r='1'
wraT=Irawa$ttsa'Tefru=I"nr=raEraa1aras=rasn1a=z
qi.'nr$a=1T=rfaw1;rn2irn%ItwI'nT5=rv:Ta1ar1azaa$1?%
=r(qIaszet.*I<*rrfai?-"h:fraets ? wawfaafr
a1r$I1'raI1$a=aaaaI"e1% qerr EH33-F6YT71lT3iTTH==I1'ts1T
%IiiIIHa?rwz=aI1a<rraII&s*e=:$Te1a='a=rPtIrfa'e1$1;!zar
tn
arrve1f=rasarre"5I=IT1T$Tf<v1f<.t'I1eWrI$sIaqar(UT
=rf'I<vF'm6ra%|f2z<'n4:a=xFia;ra*rt$a11I=rrIT=i*eaTfnnT=r
a%Tw1'a=rrnri'r'1eIe'naan5rawr1T$Tn1*=r=iTar{=rarIrI
y=:r=rwruTi't=-rI'TaraqTerrI3s1a<Taaraae=crrar
W11?T'3ll1(d5T3i'EfHTT%|Ti=|Ti7F"tIE6'fE6i='rE.rqT$|

2- aeri $ =m'?r -serrr aiam1Taa'r' 5:24.363-ca


2- mm user aim. qfaw semgrua-2?
284

Hz Wt11T=rFEIt=I'1=Ic=1r$IfRtI'-'a'TaII'TI1nT$=|T=|r
a1'aerrkIwHT<v1TIauT:rr==i'ras? am=r=r2:*i<o'rir$1aUru
aqarwF'?uTHwr$T3IFta1?:$saT%-a'tqql$m
a'TanTTv$wr'aaas1<<1T$tairq1=rz9'a-rt=ITuqqaT=ra*rs1
":'T3'77"3.Wf$Ti'Fl3fTIET'%TT$TE{$
5P'raTE6ITa1TaTIafa?ranT$=frt?2:Tn$a$1
ait~,reiI$u=arvs'q1*aHT=vITavI1"lr I 239-"IT?"-1'T=lT|'
arrt==IH==trw1~Taaa'r%at'(arar1:a=IWr=a$5renT=r=rruas:=:
alHIa:rIisIc?I%InIsI$r'{;'=iT=ra'r1rI1IaI<=u1*u'r{art*r
iTasqre=s1<ariIwr1'T*'tar1=TIvr#-?rn1'a'aTarrq1(aqf<n'r
8|
i'F1%l5TTf5lTfffr6T1(Ti5TA3'{5"l7r'rEfT?=ff3i16E

TFlT'T%l3lT1.=$r9'_$T=|'rTTf$HH?"Ji-T?i'WfFJTa
aia:ar=IfiVtT5IIn$I3%11n=q=:tI31aI;a,I1r=rra'rv.4erT%.
1=sI'wI=|1'Iwa=r=td?r arr=I=IT-%*{?'ITBI==merra%raaTaq*r
*euTr=rr=r$TI'ITa'aI=vfT1Tt@'%5IaH1*iTIIif=ia3aqtr=1r
cr?1iraairaTe':I'B.=aT=q=I6ta=tTf*==<Tr -'urr%1:6I'Ts1r(
a=w:T11=ra1'n'4rt5r5Ier=rseo'araT|aaaq=ruTfhnTartrrQ:
r=I'u!3rIiai1=:irtavaeaT%-5rtiTuTirraqnrf=maI1(U%rfra
aI"r=r=r'a1rTe:%'rtt:aT&33aq9tfrrfiIt4$6T?~'wTfn=Ir=rr
G'Tl'?'TlT|

2- wrtrr - war alas. aha 5221,3325-2o


2- =merr- saw ei$.q1'=:za'r smgve-tow
285

FI1VI*'laTE''8IFIIfEE')'r8lf$IBT@I$Tl"?l'
emwvmmmnmmmwuw
?l"[5"{TlTH35il5RflTTTiHH?$?35'FFd
wzrik-aqifriaTrwv:aT=z=rrtr=rFaaTaf$T13z:as=rIa=ITI
e=ITa$ar!r5a:HsT=i=;IaTaT*raTE1*%'FfTr=no'erf<=2zTIfI'=a
6T=TT|5Ia'a'fI:=raaTir1'aaT7;iTvrafI1=rnav?ra='tr<o'ra=raT
$rIr=I=1rtTar(%*ear'<itnTei=;T=:f'aaTwz:s Et =rr1raIa
H|'lv1$|}IT=fil1 %Ia=Ia=s:r=%aq=rua=u't~s=rT$rT=r=raT.
arw=ITeIf>es'1IfHan1"a=r6Tawcamsre%z:=rc3aafisTwa'r|
Tr=I11dr=ra'rTa=r'I1TTi|TIf=sTI-'1TT%Tl'Ta=Ha'I*2zG
wfaqi $TQ5l*I$IWlE'{5lFir5l7lF5<I43T3?l5lE3
=r=IaTaTciTrTn'%rerrauTI%efera*ra='Iaa=II3aaa$
a'rIVrFIifTWia'rfc1a=n%I--'*
3r='ar=r=:r1'T1==uTe}a=ITaI'?I!;?r$aTe1a"r=scT21=rrI"rI'
nzfnr aErr14r=?r1=I1saaa-*{:T%I$I='Ir9r:r=rarqf=I1sv;=IFaIzf
ml'11=Ta1?r%I=a13rqh:=i=Ft=1'r aIfTH1'a1e=saI"reI=rirra'r'
aTwrTu=rarrIihua=InrT2zT|&a=r=rr1I=If%s;:f<a aw'r-Eta?
ilTT35l'TEQ'U5iTf1Tiq3f61'?1fE1'I?r1-'r'1$I'?iTTT
aq=rraw=tr=termv:r%a1TqrTa1=r3:1\irerrmarI=wrar%I%ei1'
?f1IHfWT?lTEi*1l47Ia''5'E?1%T$3TW'F1:
qfdnftmiawm yH==r~'J:iri} I =I1nHTTT H|T3Ti~'l"I
asta1*Ia=arr$rarartw?~fra9'T=eFITI=rItna'a=sTa11z3=FI
'I=FTri11zufanr%uTaawemt|am'fwTHam'

2- awrw -wear 5F5RT seu.'{'\z-us-Lou


286

as=ro'$Ttn1'ttTwa#a'e1u@'wrTI---aTI=rI*iI%%:
araTaf$q;qr'3Ta?II=rfasTftIara'rrarfITiFtraa=rraz=r!:F.
fqa'r$T%1T'$r=I=tIa5ra|I=a1*a:yfexa=1=Fr *=n"'.3'?a'(ITlF
16f'eTerrIws%sr*e=rqfazaTaw9rairH=r#raw{H.ra'qr'eo'err
=1T=w'rI'vfr a1-(r1'rsraTa=rnTe'=rrat=I=raiIa=rar're!z=zI5'Fas=r
an4?raTfr=rr=I=rerI=rar=rr5I=rs"fa=Icrr|imTaa'r=rt;
aa$1'afafi?rsiaTa=Tcrr'%|Ief=r=I1'Tv:=ra1*uarr6'6Ta%I
itaawawafmamwaarwawmtlasnv
JrT<iaanu=rsf6aasaTafrfa=aa$Tat-uaT=ra1's*Ta<TI
5T<11=1T|aTaTezT5IIafarT$rnr=ra:rlHII=Iarar'I
iTI=m1$T=:faTaT*rnI=Irasaq=rarrnarfth-sa1Tfaa
FI=|'l'iI'fH<iT3|z

wnfmwwewartmtsaeyr
a'=rhare%z31$fa=rtrI=6=?3Iit$aT=raTa*q(a'vr1srcIarraa=r;I
=gearr=ra1'(%rerr!ITf1einfi?rnTnaraI-1'=It|<nT*e=1T=r
5fa51=rIfawr'1rarr%.iIT=re'?wa1a4rIraarrtn'aT1a1?'=r
trw=r!'n=frasTBI' ?

aIa:6nasaaas%:%f$3r=ir=raq=r=ITaasfem1'a$T5r$,a
anmafytqamrlmwafwaafqmwramqw

1- Flcfl'- scrrr aim. Haw seq. we-as-nu


2- tart-=ni=1 - sarr a'.dTaTT sezmvgwa-=L\s
287

1i'5uaa$=rra*iqTiI5?x%I'11"(cH6?r1aeiitrriiT{<<Tt
gra9r=IT4:'1'i?rTiTir=11=ITaIf$IIeI*}=ITasrfqi'TIf=5:=IT
waav;vr'8--I:sa6=I1'Ia&uv5faT:=irazTes=rT$'r=rrw1'w
E1fT1'3l1T6EIBH1'Id%C1E1:3FBTi1'r1u!l'l:i1T$T'1'7J'f
w=f8|ua'aa=rrIu&ca'far=1:Tafarra=1%o%ua"T=:TT&aI
ususfta %a31aT1I?J1iIsT=rtf$a=rrr'rrt!'ra:T@T
rnraTtIusa?s=r1Iaarsf3sTTVITafa'IaTrFrm'tf$TaaTa
*'Ia3n==IT1mf=fT$arraTar=u1=aaTeiI'|tcsurz=I1teataraT'
$|1afTnf=:If5aTIqi5IaI=a?5=rHTafa=far5mI=ra"fF=ITIt
t&=r1'I$ftarmart=rarrer1=I'r&%<<?1%|

ll'3f.Wf'1=f$"t'i'V|fa'%'T$G1'E1H'1T5I.IB=I15El
aimas fh1T=IcrraIf am ma 3? mfaa assufcx <=rr "am
=isTa1'(a=rfartr=iaTaftctta#$raqTq-fr%i1fairrniTqt2x
311;=a9rarr$aT$6T--a'=5(9*IT)=rra$f*5I1'r1=cx=r
%=Ie'a1'q a=ur~'-sqTvrtIrfaa"aa:1 tait r in WT!
yr=cuarr% I Q

Q- GFIT WW &?o3'%"5E
2-=I1'Teh'=I=rr;uaTfw: :ror;roafr3
=wawrI61t-rvT9=?r-am :E't%I*'-F5-Fa
Ira-3u(z=.&r:)
288

I 5T I WI 11!

mqvraafitamsvmawzni 1: man: an
289

tfrqrrdm3?1em1faa=I:a111tm an

-ntmu11cnrra8maTm=I1s=1 *1 run at
Ha"-aria
I)rWI=IqrIu
2)=tImETI=H;fII
BHWEFW *1"!
mm msrt1'rqI=I'4r3=n:a'l an
aarwmn

:"T_3_"
}n'd=IE1'I=I=rIz:

I-aqaqt -Ilawla 327-322'Iqaf


=a1flPlF?|'Gl'1Fl=|'lEG

2-aa9'a?f=I-IE-Itar 57 Iqa
1J=I=rp=H4a1Faa-1a:

3-mu -mm 523 aavm


V1 3331
4-9a=mar=1-IIz=Iwa tr-1134-753 Ii
290

TENN HHHRI

5-tIaIa3a1"e"t W?FH I I294 I295


6-argt IEWFH Ha I30!
1-qlflrqa Wf I306 I3|6
a-aim ISOI Samn
9-fm I509
I0-IFWHIT I527 it-ITIIIVI
H-tutti?!-I I535
I2-GFITGTH I604
I3-at=I~I=1 I657 I659
I4-latm I646 I676
I5-wnm I66| I705
I6-arI=III1=rI=I I679 I7OI aarm
I7-r! I680 l69I 361111111

I806 I808 aavm


I8|7 I822 8a7I=111
I857
I857
I857
29

aqaqit
wmzavqrrawrmaaxrawm 8 Guild-T
wmwmwwmtmin m9fa11IaazzraI1ra1iBua
wnznfimnraanuwnaarmmtaaaawmar
=a=:=Fr3qaaI'#v'estYn=IrarI=I1#q=rI1iI21Ta1q;fra'rtuTI1=Ia
WIT!

IlB"'Prl1iH39'|3UE$TGTG!aiFIl'Tc.':

azuiwnamawungzuavmuiiaum
3?-Ii.'tIT.'Tl?ITlI'd-'I'%%1'iTITiI 3'ElFRIs'-Ill1?|I1f<3'{l11t6
mmardarm. nfaai|u'HR1"1a1@na?I

aawniawaazrtaat umttmzam
fiu u=Ptma<dIfr@fauf9su1a=rir e~:rat1=c1n1ms13r
iaanmirvgvauunaaxaaaaamaz-a mcrrnm-aria

=I1tzsatatw9sIzrr=?an=na1att1rare;?~'
iT=ru=rura1aPaat?aIat,11Iua=rzir=;quI1f%x."a1ra:rd7-iIirrn
au=1tUqwIa=I1ina1a=IT$ram=I1tI?I1tft1tsEnna1aTfn=r=I'r
triarcir, aaamr-1ad7aa=n?c1riu $61 trrq=nu1 iFl5I'|'ii=Pl
t-I1!m?dT!Iz*-Itl" '
no oxford History of India. Vincent A. huh. 3:-d Eda. pp.87-B8

=F=a'qrnnTra-=11t~Rt6ma?'r-cg-62-dutiusss
fI=I.',Im'r1 -T-Fl'|'E"-'-lT'lT':C[-99
Itmamtlz-natlulrisaumazr
wmrmmmmmmmainrwamdi wanawtlivu
Fla-!1E~IaTtr'tli=r a6q=I1t 'dF:~I9=I1Pla' I?! am
ua1r=;a3auais?!r<wIa1 uaf crtcrfaii watzanir ftaarr
maracrhwmn :61 &TdI'l<1T1lITl'f=l1'T?1'!'I'F|?lTl"!1Il''3t'i
guwammiu-~' a=a-=-at-wsnaaaarmmatasmaaa
q{Iitaq'ul acrlnfiztltttt-1|zrTu' 2aFra1:r=Id1'r
=rlmI zirf%Fd?:aiu1a1TH1urna-t=13I?-|varn1vrzrrdr.9f8
aw =m:'a wtafttil

=ii'm$aFa12'rta11ETI~:a=1=Ir msmriu
miaarmmvlvaduamaramn aawrrmaf
-1a:a'aa=s1=Ira1Tq=n1%ruT tzwltnuamirvamdaawmn
aawwrrmanmdtrdrmwrmmaamrafr
813TGF|TTtT!I1?Edt'1d1T1lqTTE',I3=1%I|U?5f
arm-'1:ra=rr=n|' Run atamri-"waif v{ad'rr:I'
if rirtfrtt-Warltrr nd ttuaruaawuxrararui
faaFrr31;:21a:rr*amm:!1ts"

mmanmatmtmdrmafaqwmmrr
amuata-r3craa1<erI=1au1'a1t1%1tmtn=:auz=113u" 4

1- i''!IaTf6TTl?lI1EI -m1J3?.'I3ad1'-943, smrnhsez


2- "- -'- q;-49
3-6i'1'Ef-9!I=la1G-9lTI!U-I-I2. uu'=H11=nr I972
4-=I=r4TzfqITI=I==ITt?-I-(#1) =#1a1la%meit. cg-39
293

a=?.'1FIa'rma=zT 136:

Wduaitaraqumi starnnn
8azn'rq=I*.'!=I13r'r Run:-zTvaa=1a=I=rIq1aar8urr
in aIm$t1Jtaa'dutra1'a1natRva=cTa1gqua1ierda'h
in-f~rs*=TrirI.aIiu$f;1J:1t=2!ft1aa'rartr!11E PE?rITf\~l'E
1a=I1%u"'1Hw11=1f4tttaa=-Tatjraa-'z11:r&'rd1'ra1uT
9!TaIan3.a=:1Fr8afraa#a'iT=rTa'cq-2-cI1sr=1=Ia'1'?uzrrsrm=I
rcnin 1a=zTa1a=:1Jam=i%-a1aa anarur
macaw: anaTI'Itrit, awmarlui aitartraamfku
Tu%a'tamm:r:n5I2uauu=ran='1Tarf1 I3 ?T'lT|'|'I ztan
wwamwmanmranqqwwmwmataw
arI=warran"

fins-z'r$rt'-l=I1 d-1I?s.Ti:

ftIa=1TamerGc'tHwIIzfre:ItIu;-11={arIt3:,:r=I
ward uqwtqqwr ai=Fa=.'1 BTW, awmaa faam
mam aqramainmmu ifataxnazal
aaPcI=Ia:rTu'r:u1.att3m1ItIaamin"

" uh-: much Leon. 3.1:. Dluknr. 1959. 79486-187.


The Ace of Imperial Unity, chapter IV. Radukuud lukuji. 3.57.

2-f=1*m-um-1?*=?IWi!='-:26
3-1?I:Tl<'1-11fl4T=|T!T-E[-98
=Fzn1ae;m=I11I'm-11-=1Ia1btI1@r-=[-ea
29

wzaaqmuqza mmmmrmqar
~-I2ma:IaII=Ir=I!r3aztrTfnTn%I%a'Tl31=rI??| IT!
9'I:'a3|1G!1"IPdaa#I116F31?ira?IalI3'PIi4a3
mwaaaqaaaummmunuaafmanauaraanmqmt
aa=n.w:n1ara=r.amw?1aart{aa'a2s1z?a"I=?a1aquatT=c1,:au1?t
atauaam 1! trre'1:wrr1%IaIaf=II. m z1= atm
aimaianaafatmauwnaqrmwwtrtawmmieaut
u1.:raarI?rIu1=u.er=:1ttn=fraa:riI manararufcrtatrrilv
mvammawhmfm-tzmmmara
aa a-1x?aaTcrrwTv;{warraTI=I1=;Ir1r3-atIawa=I1'@r
i1?uH8I31vah*Ic=:11fia=saIwrr=r-51' =ra'crr%u1=Ima:1%I=su1-|*
wrdta=nqamaz1sra:aTrarPrtsraaf1'anT:ra=I'srIr-au'1a1iaT
a'fratTa?a1E11=Iu1t1iI1?PqT aatirin RFa'T36iT
wraarmcrerrwrra asaflfmummw
1!t'l5I'&l'3TE'3I3|If3~1T6IIl'3l'7FIiT malauam
Iii-'l'|6TITiTEi'l'l uII3taa21=1su1?WrftEia-Tar!l'rtfaa
aHIt=t=rtza1'?1viIvRaa1ruz=1aa=I!t=I1u3a1.uTnTaa1na1z
=1=Iut6m1=ErarrvutIa=I'41 waamwmm tit
zmwi r1=I11'ru%-1!, ammqm arahmruzn
atatiu

=FcqaruarHrzfawm3atrI=.1=ia"ra1crt1'I=I1zzs
ttIaa1*3atIyf1=ri!t11%I111:t=u=uaiu"=!=ea1Ia'c11tIa1v1!awh

u-m='a1=uqru-azrfeuwraahaxzgra-aw-at-rnua-c;.34-qzmumsss
naumaraiaawza m1iartm11%wmaatTfaiu"

I=frart:F=1'a1ca*Pna=R?!:ra1=tura'r.+n
Hwtmwalmmwnmmmmv
13-urlra-auuaa1u{1iu'a1vttma=13q;:it=n%a1=sTtrI1:IiFmar
11-Ha-11=1Ii1taIaTaT=F?aa8Wa1?m mam: anal:
gvfiirta-1vtraE.1w?:'rrI41=n1I%uaaa11?a1'3fqdTT=rI
awaaa-=R-3aaau'-1w.aIn=TtTma?Tau=1t'a1%aa1sT
ftamianmmamemnsmmanmwwrmw
mmu mwnmaammanmhaavazuagam
a'tvawmafdvi.a-marlalnet-1wrRmaraaIa1 aamiu
wwaamwmmmwaimmmmmww
aarmlamin qwmmaumahavvnuamumt
3-1H?-mfIh1az:3|"2

=1Iz1ia"rzrc9''1Ii5eaIrM1<rziIirI?tTPTTn!I
RF! ft1a=eTcrnf~Haan'I?u1a1 rmaaawwrrart
rYt'3iPl'IT-1'v'R'57FI5ITlE1TafHl51E|1*12i51?J1, :1: ma
I1ftI=$II=IIiI"

rfamwmyrqarniwaarmwvaannai mamm

qaruimfavvrtwafaatram.
1: 2 5.-.2r'n.?..=r4;..' a.:..;; '
-2- =.'1J=$=fa'1T:ra6I2iIa-11II'-azgsal-9;-43
3- lit-tuna - 'lfa'4Hfl1i'=ITl'T- q-no:-:04
296

vrsfazsitia nTa'r:r'aT4avc"ua_= mniaiwmwmn


w, , =|1'lT-11T|1'Tlm1=l'' n =n1m1 aaatammwn
a=u'f-u=rl' mra1n1tnz=:m?=n-azsa IHETWIEIQEIH-r Rwm
tarawrrmz au=n'aaz:'r:mafl mnqm ah
tMa1attr:11saa+rs1Ennrir5!mFra1a'1Taura3awrfa1wa1'n
zH7va1wn?iIuu[1%raIaa=|1rrr&wrT<11uzaui1?a!rIeraIaa3rr&
azrqanmtmmmmiummaam wear
tatmataumwstqrawaxatamatf wraaanwanar
r:r'%,au=Ii. win avartuadtit, a1iam=1'rt1I" ' am:
armvdauqmmaraw-crmamfhuagvranuamk era
awlfawmtil 1
arsrn #f3m_aTrat2;qwa'mm:rwIarr-1
Irm tn1=Emr12na=14-um=I=rra$r=:rTITTIlI=1aIdI'arna-'t
aiamaauruwmmmmlimrn a=aHwr=11'rTm1=1'rif
arma=n&cudT.*-I=3..w1=n:ara'ma:=:r=ra1a1:1'rrr
%'TI=;u2 vita-.1Q=rI!l vwqarfana
F-'19IGID'3lPlCT dtruama NIH-1aIzII=I1Ti1'lI1#a=I.19rl%I.
aua-crIvdd1'taM11%rE!trI?Fv1=1. vaarqwaatmtrwvniva
fIv;Iajt'In1=ft3|u1IviI1tmzs=cT?ta-caa1a13-' W
mmwmmmarwatmmaammmaiu
Co--coo--pooc--on-mono--Q--Q-one---0--coca:
l'5|"1'5|WT-El'dl1II!F-HlIl!!I*- q;-12
2~=FI:=a'qI1I=I11rra-=1tat'url't-E;-cg-68
297

naiwnaamaaaaawmauiu =1-zwt mmirarrmm


tn1faaernz;=Itau'q1maa1?nr|=ratan1a+rra1?rr-3*u 1!
-II'I'%i'tc1 i?W=*v1Tait Pr1''narra't{| '

=rreaii1?aa1:r=tw&e1t-iizxqttzftlar-HTFII
:rata=,;u=r*aIa'c1tut1raraI3a1a1%rIcru-1afs:1ha111i:a:zT
8arm1a1' aaru'a1ra'rrris urraaaawtaruqqw qua
i'l5Tdq1'FFR1HFU_T|UUF-?i&I33'Ri1HF'%IRllF'E'fF3
a=I8a==r=I1um'1 qamu11cF:1atr&rra=rIa.'ilarma1n2H1tr
tmmnz-11 *3: " 2

mwwmiummmwmmmnnmaqau
=7t#:ri'tma111TH1=1I12u1a1?|trtaTaaJil?sarrtI11
Wqammmmmniamummn aa*.I:I!r'uttra=I8trr
ma.-manmzn

2;-11=trtra=r1i:1e:=srsII1I'r=IatrreIe-Itairnwc
fan-'rItua=n'n1a3z'a1=11I1unw=aa%n

Fmdit :
q=II=1'rna=r11aca mmwmma t:=n

u-mm-mm-Ww-was
2- can-14. Eiutory or mm. 701. 1. nouns India. ch. xv.
by UV... lo:
298

me: -~ I vaumaswa aamemaanmaw


wan: Wramwawtitmawwum
mcmrmin mwutiarnutgnaararttfzm
ma-u1u=rI9THI?a1cr=?a1':m mnavmaaauan ma
rm: qtnmamnasaamarqiawrmin arm!
mama sramtn-c'rrinatu1a1 unamarmaua
an'Ina1?ri| uPm=1aI~%I'h"I91Na1ariu awmf
mmawuaamiarammmaamiu at
ammmwsmwmn amiwnrakr itwrr
mmnmmaaaaameaiu arraiawrrcrruaatsr
11nm=I1GrI=Ir'3uq=rI==rrdrrr11Iaraaar'f amrurrawmern
at-:31: ata=z1Frar-Ra? am aasratrarracramtn-cur
in wmmmameuaaammmamwgaamm
wrmternrariu a'l1=11zd-:H=tI-d'iIFrIu

mmmrmauaaaumaaguawti
anamwataaaarmanamwchainmuamam
in 'H=ITtEFI?'s"J2liFiIHwT'T13lfETR'?l''fxIa'!
marmamiatmwmwmmwtqrkwamiu awmaa
twmanuvzirnn i--"a'v1az1H%:''Itra*r-uarua% qq
vz=Fr?:;'nra:rvra%Tarl=trazrra17ava11u1a%a:araturnutrT
in -avmawgn afrruma tr arm! arfama ah
u-'-En: 'mm ' aw ~e.31ar ' ' 'n%fa E ' ' ' ' ' %
INNER HEW - -48
Whutppe, the setup that he End appointed to govern
the leeten lujeh. net lie (eon 13 324 3.0. - Ancient
Indie. Peri I of In Advanced llietuy of Indie. p.91.
llejundu-. Kalikinket Dette.
299

antaaail" '
uaaaarmmaxmaararwrmiuaqaut.
{'r:n'aTTra'-1nc1 upftrrhmiuzrmmisaamavlm
aquramauaaai. mmwaawuyfmin arm a
T:'dTHaita1aTfumaIa'c%iatn1=IaaftatirFaIuTtti|
atnit zau at-aaaitauwrmrnuala ftazztuaiu
H'i'f&IT'l3l&idt1Tl'l|=H~T'I16TTl?fEl1$ET3T4FIE1E
a=I15IarIa1aiI?a1'3,a=iaru=115r&a1 tr1'=nar%s'ra==Iaat
mawumwmammmwaaanmmmh
H-116131

h'9171'd?

rlvxaatl m1I?IatI11??nai1=rr=I
E?I6Il1T4I'3I13I13i-lf?E'Jl1I1?IIil=l-dH'E. an
=51?-:21fcrah*Icn11mvqaa1=r:rqa=w%n1ta-1ir5T=13=I1!u13
u1=aI%m-=1 aanrwcrrmataarrrwzitu

ITaflita!t1T!'I:

umamaaqmamtmaarwmf
ana2uaru12f1J=na'raw1aaa=naa2nTir?ama'1Tatrc:rasrara=I
E'd7lTW2lITvTd1=Tf=lT!l7I31il=FfD5l'9IHT71TT1'333T
mun wiawrdauruaawmwaicpfauramawm
=n=nn mammdnmaqraaaaiamwtmaim
I-5i"3?FI3|'-<'1??Ir~-K31-'Tl!I!TI-t[-98
300

mu, a1arIm=1:raairu1at-t=r\ an maamwum


!f3sd-'t9-I1dT|tue=I1P'=rraa:11?1tm3aa'mT3aa
ttrwrrlvirin" '
mummu:-mmmmamwmmaeamvma
a-'Ia12fu1ag(qIITtf) 111:3 afwiin zratmummrfr
u;navc!=I1u1tata=Ir=I1mTt3n'aaq11.aa1 nd?
aa121aftI=2nv:1a5t2ra-1 a'twi-Ttrdruaamtraivamsavrm
mtmnmanmarinuawmwnmmmma
au=nmaau:aT1mti"na3a'u= wmaaeuaim
Pa:-i'rmrrr'rIiIa=I'41 nn mmum ?F|'|"?<l'-'-I1
nwammmmmmmaa 1411-crcrtmz
nammauqrtaueaamaadluw-mimamm
1w33|1'EICr?'I$rr;1iEtII11'dtiT('a'II"taT3I' 2

maavmmmamawmwaaamvm
airzfm. '34fE?{E, a-rtawa1?J'm1mIa1aaIu-TI
anawwramawmaamnrmmmanm
I=1=f&3=Fr=n=I3t'-r I-IFITI

uaah'rr1imzutaa1a'q<w:

arI==I1II'a-1a2aaszT&1i1trlTa#5t=r'erm=3ua=

Io uknnulityl of N11111: IAJ I111 Pandoy, pp.2az9.


2' '1=1'I'W|1*r- of 3.1.1-win. In: sum Pandoy, ,.z9.
301

mm 3aIn1tFIa=raTa111I%mn2t= crzraaanm wean


awmqqwqvfamuwtfaarmn uaTararI1
H-Tarfl1I=rr=IaTI1Tfa3TrfEm=a1:a1?=I&='#zaTfe;|e1.a=eit
tI'r=Ira=a=I1I=I11 aT|'c13t-'m=f3u!a1'dtIaT rautfu
ararraqarazwnraavv 7f'1'~'J1I ahuqnaaauwtm
na1ran nz-caauiaiaiianwgqu crnaara:Tuunan=I1
new znr;raII~4rr'f1I:raat:aasi:"

=rraar 11'!'17|'T'UT11'3l'E1?1iRI'-"3l5f6IF\-|'|=I

z1{wuTu?JwIai'x=13t{a$=IiTrPrra1fTari3*erw:I,dv:?I1tqTae7t
icrmnafrtutvrwarnmmnfmu nwwmaunw
attfcrtarma-1n'rta'cir3a121T tnrmu HTerc1r=?11=1r
71-'fG|1ilT?Flq1=lFl1T| a61T6aBfaa:*aTere?r='-1i?1E=I'!frrntsaT
6lq35I'fiEfE$TCiTK'WTI6I6'?35f31'HTmf3TG'GEII?J3
fmnzmtn rrtrmwaaamanrftmammawmwm
Irrtvenl" 2
Q O Q Q a . o - o . u Q C Q . Q Q . Q Q Q Q - p C Q Q -1-nos-e
l|- he Pettevelie. the lieitheeutre end Prbhankgdit. .1;
record the deteet end oxpuua at Gerdebhinn (lehunlreditye) by
the Baku through the inetruentelity of the Jean 3.13:
1"""""'- '''1*8 0! Im-U111. in; nu Pullq,
e9-92e

2' """*!I In -opu-nu tron hie tether and mm to :1;


end to hide for his life. eeoonpenied by in. .9-um, .4 ,
" 'u''' ' ' *5 *5 $30?-fill Guidance of hie
nether he etiu renenbered the Iehetriye ideel oi retelietien
eceinat the eneniee . . . ." 'ViI':reIaIlitye oi Ujjeini. Re)
3-11 Pndoy. pp.93-94.
302

cm =rrcaa~'rzrc;rt111ef?1a1ftIar%n ma
arefu amiwmmmamm-maaaaiacmmmwu
m=I"ttr$aTtwaTat=ita3~1'Ia=1aa=Ta:t1az3acr3. mqa at
atrmuaaaaatm, ammwaaanfu

Ira? f<r5*411!':'<v:rzsIaT3t8=11

Brtw f3|41'~13-l?l1R=lI=III, =I=nd'rn


1=r=1ta-cm4aa1rstt1uTnaa1I'm4aa1t1um%n11ausrz
ma. wqrn.aTa'c1raI?ra1qaaa1a1u'ma=1I%rwnI'aa at
HF1R'?I!I61l?FT~fTlE13?l?ifHq1?IIiF|'H'lTH?!TT3FI
-1111:-"t d~T:ItuaqTfaa=rrI=?1aFtIr6n11?.'azuarex 1?
qqwuesiI=t18tira'aea1=11u;=f1:r*I#1%n1ftI=s=rc=11v'au'2

ms=n3=;rIa~1f=:=af1r

a1=n'a"TTmaar.u3aTr mm a-t
=IafHn1EIa93tr39unTPNi?raH1=1bT1=a1$r|I'a=rlai=ITl?aI
3IT'q!1f-f=I|5T9e!f?FlU21=l7Pl|?f1\-T=|'HTiTlTl ::=Iar1=na'r
['f'I31'I{dTT1lI'E311TTl1'T!JTfiIFU'lf.'=I@=lm=I
11aa=$rwa?f=I1%sura1vatraH=Ivqna1erI?uaIa11?a:a=rmr

-1- Vtkrululitya or nmnn. In: ma mug. p.94.


:9 V1-Im-ditra or 1131:1131. 2-: nan runny. pp.1o1-102.
!1'd-|=11c1!T|J3I ukhmmmu
nmmmrazmrqsaaun I ~90
--mvazsaa
303

anaamminaamwlu t=rIf2?u6uat{a1$I3'IN'r
an mwzmwfaaawn f=I1a1'!?3I fdzmtw
aaaaimamumrfatemmadaaxmmmwm.
mvaaaaamwmqadamnmu in au3aITf2r==IIl?aI
3UudrIT=I'fii1a1I6T11aa8u1?1ni:-=11n$rtrGITs1II1 I
atqf1I:t1wraan=muz=I1iu"'

Iwrrfeaxaraxna-,;aia wat-Ivfun
aTe=rIv1?m1ftzaia??r'g9%1a~1Iaainu1uz1t%tn1I?:?u&a'az
Uapa1a~1x=iPr%u*r1Ia;ETr% q1=::4=r&a'atn'9'dm
616113: "2

atIIi?.'aIatT:mt'rrmrnera1atcaaii ma
uaIa1%t1wz?a1&.:ramaq1%Ia:w11:a'm?rI?rarn&afa' an
m-a-answmaamu rumruaami-nwmi
IE1-I 11ma1&r1'(I 13 auuaancrsammmi
teH1a'ra?rrs:u'1s= 3

|. Vikrendttye or Ujjeyini. 33.1 3:11 Panic! H.102-103.


2. le 1e regarded peerleee in the (nu: of the greetnen or the
eeutry - '3! ukrenutye. the naeyer of the eerth. wee done
by enybedfeleeg by him no given en; that wee not given by
othere. and he eeeonpnehed that no not poeetble of eoeenp11eh
sent or ethere". Yikrenutye et Ujjeying p.260.

3-x3E1B3=l-1'HTT$-?{E!11!71-t[-95-QIIWIQ: :9-59
304

=I1z*es3u1af arrimfaaarnmarzair
Izqaw war?! aaaer'3: l'T6TGl'chTl5'l?TFl31?-lT'E?isT?~?
VII/!T'-'IfFl1=l'?I3 favuaa1'2*r=7ta'r=I'Tzrnal?mtu5Ia1.srI=avra'a~'|aai
rm? anma aw. '@:1%=raI=m rrI=rtsv1a|i:a-rantaq,-aa
I=rEl1??J#F|1F|GB3!l-Ttli team: Wfm
maaraimamahravmaanragmramm ma:
an

auaaraaaaaiwreumlyr trmavfauai
vawrtaa1r3aaaa1a1n1=I1i'fvra=nvnrramrwr%-a1ft42s'c=
uaawa1!IarrtrTI"=reIIa1Ta11rq3a-Tnf11'h11r3ar=u'3a3
uwaacraauqa G13 !l?F,1ild'-'{&Tl?lF3T3'='l
vlimin aIa:m1ttf=PfaI:rT=rI trtauuammt
TI'171EWI5r$t;;ar'q"drnu'dl trautlspaa-1IUa%
it a1rn2J13aI%wI=rr11.'a:qrrrt1tra-f a".ra=v;-i=Ifa1=a1= a
awmdfn-zg 3a"-1i'tT3a3T?~'T nu? mawmzamam
wwmawwummmwn aawlzisartzf
II-1iaidTau1=4t=a''t'%nTa11r3a=12?=Iarra#u=tru

Wrmsr. qua, =l'lF|TlG'l'=|'E|irPl3v


aI=1a1a=1a'=ra5?t=1zf|m*aafr:FI=Irana~'|a1=1trI=I1in mama?
qulamnmaaaamanamaanizwragvwswna
mz=17a1aatrn1=I1%u ut=1rn1=n&Iii11=1-=Ia=m5r$aw
aatmtmnmm. mmwmaaamtaaummqam
J~3ITITI'1'El6I=lF||ifiI-'I?:"F!l*?f"|TfR|i!'ElI33 raaa
305

t=r3H=IIII'tITIra%% fdTGIFTr3Il'&-T a~1a'oiEfZi1#I1a:'-+t


5a1fnEf=1aa3l?m*TIaTiI&1?:u5IE3a1'UoafZI=nesra*=13uPr
arraa awma aiaqamtavtvrravwmawns
?~:t5irrIE!a'9?Ita1arTf8iIlI

auat-.'ra=r:u1na1amrerr211n wmaamma
3ITrH1,1i'HW!Io3a11 ?r?.1'c':'rruTirct3=TI:rI$tI1tIE'a:i-YE
amqwiu craazitranr-'1arru a11mamrc1aa=r=rcu1rr1
mammwu

rwqafraaaaramwrrurtm I
aaaeui %m1TqTr:trrqafrasrvr1*IIa=Ian%IaIrt[~:1aT1t Q
U<I=={IEFTFl'IlTl

araz Umwamcwdmwa
arIa'ImTa=nm%a'aara a1%m*err:-rd arqt?cqvfwH3m
ma.-%u m'u1:z=u1errc=:,'e1.e1aa-r 2 am mmasrrr a:

lo Franklin hertoa. "I an not enre that there ie any definite and
peeitive reason for rejecting the Jeinistie Chronicle: and for
eeyiu eeteprieelly thet there In no one): nu ee Yikrene
1171-38 57 3.0. . . .
Vikraloe Adventures. 5.0.3. Introduction. 3. LJIV.
2, need: the story of nlekeeherye Ill written in the thirteenth
century. it on he eeid with eerteinty that it anteiu hieteri
oel neteriele in e good quantity. The llageripruherini
Petrike. Vikzrela lumber Y.8 2000. pp.85-B6.
306

!m1fr'a-=IT1?:'E:$11cLUfana=Ia'1=rIata11?:Iwu
=a=I1tr3itd%tW1r-rafts f3E11Tll1"|?F3l?5iTa=l*11'=ITF311=

aaI=I? aTIfa11:<q=?11aa'arq~:rraanuau=I1=rma2:3HIw
a1g=na=x=mu=m1 'craaaaat=rT.uz=IIa-1sm1=Ia1t|iI#r
=ir=rraa:3=rrna'w1a:iiaa1w1=rar=Iz?u*tI=116~19l1=Ia1a1,
a1a:'mEr=m:'dE1 ird?I''I'W1Tm1I

?=1m'T=- t91vIfI=ia1a1a'tt%u'rra1'3il=I1am1Tataru9atk=ren
mn cni daiaaivqauaa m1Ir'a1t~I?saT\{na 3
mfawaaarmwvaammamqam
FcEI'ar%|n'ea1'a8?;'ai1;zr:arna4=?:3TIa14a=I =.-iunzt
xazufnawnvfcara-i=Iiu3trHn2:=eeffemf'I3a1t1tTrTBITEn1
Tro.:<m=FI- a1a:{auu::fe:a1uxawnw.~mr=:srrarar.aaer
P:Ta1:r=I3={e1Uaa=4:$rt*11a:=riTa1?'I'r=1T.3it<=zsvarm
<=.a'arw=ri--':m1=%'rar<aUaTr$a121I ntmwatav
aT1rr11a3a'aI=1ra1trc'13:"1:ersr111ar=I1za'El 2-1131
FFEH?31I3'WIfEPJ1E1'1%!~i1%Taal'33~lPHEI9?1'3%~I

tnu6I1Ta1uu=Ha5I?!ww=a<3fem1aa=raa%n
=naIsar=n21n't!t Gvaamnvlaiati, a1=tnaa-tUcr:1?-Iazafa
CCGQOOU890-0cooouoocccoco-oonou---Q-ojcco
I-aais-ua?h-nmda-{avian-I1-no-In
307

wsqua.mIam'-111aa-TIa'ti ariazanaaung- esmraa


aqa amavraamaiqrmawxumaa 11113
iatimmwwwrwnta acmzp attar maa
ai'I'raTaaarI=1a=ITu ea'=r=Ia=mrefl
efrrafet mm-aiarmwtmaiaaarrfrtul
1'llful?f!T-"|TtT6T|

mqaammmt
ta-uadhalatzuqracrmriu =13
Hmraxawxsaadrrmanzrrtaatqvravaai inrwramm
a 1tat3usIf%!ftld-Ttrra=I19Ga1?Ia1Ew1au%a1?'IH-arrvftigi
a-trraaatlazn-Iturraiu muimwmav
t:TI'@I%rtIfutsarnrr=rtT 7?: wmtmmiu uItn'=I31?m1
mazutna u-it r-16? f==.aan 61-=1a11&eIamT4T
amwmra wcfarwamcmtfiriumiuncgvm
ta=rmfmaTtwfazrr.mzrtx1aqua1wtrEn1%r6we=11i#=vfa &
mart. I)!-1T$rn=I1=rraa'annrt1ma%.1Gua1i,
a'6abm%ua=I9asn*e1=Ian=2 9'75 '=|'E'FlTTT', trtr
main *lT'l'rft=I'lEl"l'? aTa'1aerra'rrm'r
wfmtrwmwmavmmuuww
umlfiitutatrgauhairlaizat a?Htr'I'i'ru W.
ammmwmmiitaawamwtmv {Erna
Ifrv wfrrwaaavqanmnmafaaquan

I-lWt391'1Iai=I1ca=f tumaa-31 au-(9 266


308

venarmn
tauggaqsaawavjavmrauaanafaaramn
ntwnlunwnazucerarawurqv aiiqrcaaurma
gcrzmuuma-1-arintmuum a='e2T"?sdT1m"r1n11I'
#,a1s1rrn3aaTcra1rr?I=I1=arEua1n a'art1raTIaTWa1'1
d,a1mTItzaTvnaau'2traaaazu=rI 9=5ezm1Trcra-:1?-Itrrn um
HIDFi'1t?rIrIfPl'I1?1TI1lI?r3=IITiIe1U36IQ3TliiI
isfsurau F?at=r&T qa1a1atI'9utria?d'I$?IalaT
tr111?1aar-1nH&t1%ma1ru'ra.aaa=Ia1 vaa1'rrsrPI
uartataamgv drufa"tu,a mamtraaa
rrraiu:utsrGI1trm$mac aaamirin '
araawatwamr rra
mwnwtruaargamaur
maarinrl'ru1a1=rztI'ftmI-?1at??t3az3a-e1vuIa1ra-3.a=aa
u'It1T:I'a?u=r1'I Wwaaaanqzuwmw
n'1'a%uI-Laria3ftIa@thI!TTa?\=n1c:rrv;1:i!a?a-1uTws
maqalwmaimfaw srazgmn cm fem?-ar=:
I3I'1aIf=IIn'a1a=I9! 3.T11T5nTaT.'I|=!TTT{!'T-II'H1Z7 E1
an1i1m=rt maraawdnamaggamwamw
tirarntrularrqnfrdrn
H-uwnwq-anwanquiaaawt Smavaa
|s no litter: and. culture of Indian Pooplo. V01. 1111. no
classical 130. no 39 (1962).
309

aw trraTI rgramanmaaaarm
$atn1in'=rt1'w=Ia'rur,au?:r3,zr$I;vu't aqmnaaaqrm
H111 d'ta1a'=I1d'tI" '

m'tTI91I=a?IaT $arum=IfEtaITa13
waar aamrauqamwtmn EH31
Bawzamacnmmirqrr ammmn tr
gmzm

at--crs1IatIFv=Ir3'=f mam arFavIa1;ra1&


umm mamm
I1Rmwm Wk?
T"BE"1 azmraimw: qamzmitn
HaW wwarnw-mu
qaW mm1w%:
161-1Iu1qrr%:fi:1*rIt~r=1dvIcrtI='r;'1nu"2

=nm acquit?-1i%tI;un91a1mI1a=rI=Iu-r
a#za11-3: mmama 11'ra=i' a=:a2nuait=11 it
vanwamaamnmiu am

:5; """"""
2- m'a=n'- araimkr - cg-394-395
3- -- " -- q;-387
310

'e'E'II1Ei1%Irt'=I1=Iac;-w miaaa
Uaaam. aa=II1zz&9!tmcrar-Karwre.1%n'

rahw qanarv =ITI"mI.


TIai11a6Tttarrz'rUu1iufI1ra1TaT-?I:ra#r[zfaaTiaa
am aiutretrarzzn
"9Tit=F|'F'I'l 3T7."m:
cm=I1=3a1aau1TI=m?mzr:3=ru"2

s=a=?m1qen-amnatsarmgaaaaw :1
r=1auan1=I1iu1=r1?:<a1= aaammamm an
'JllI'=lI wamnaemwatmam. ail r mt
aaurcut a111Tm%smIn'a.1%U1a1fan1i'r
El'l'l?FI3I 5

Haitu1'<'tz==Tzt= $rPa?I1?T6TT1-II1'9
an! an unawfamt. aa-
-=.=rr1au1aa'=-a1rn:cr1%uusvan'

3- *"1- 1-41 loco Inn-C-r. H.c.n. cuuun. lelkinlnr nun.


O5O

2- aTa1T maze. 11319 - q;- see


3. Journal er Auntie Seeiety, pp.a9-9}.
4, Decline of nude: or legal, p.118.
5. Lb p.118.
5- at? '1'WiH - HTEIT - q;- 388
311

ae;wTI=aa1-rraaa1a'afrI- ma11'25te'r=fl
H-tt=trtI%a1:uar$1?tfrraiiI=Ifa??:'&3ra2TII (I)zr=
Iirauauvnferavtiti-=JtihnfGI?'rz-1?a'v,[an-1=I11furI1?-In Rm
imwamvammq mmtmnmi,
ammamma a13f<'1tI=3aa=Ia-'Tq1cml ttaaa1-ari* :
mrfru zatwn-1~31?TI'EiIuan=I&'I=I1=R?wauTra=1$r9!Tt1l it
rrfis am: 3=I=T 31m-3IT=Il vama 9:511
iIa1ti1 I"tHI-E6: WQWRTHT aTt-'19"I15l*\!'fi|t
in

rmwm $anurrIrra2.'a=rrrm
m=1'u:Irr#=Ita??azfr1%mm1armni1 qua! 3%-an
=1rI'Imr, @m=n=I1%u" 3a11't=aa1'r-1?2rIrnaTalr-air-11'1=ar'-"=1
zutna-lvxaamtaztrrqzrra-rav1a'fa'-a1%wriu

u1an=I3n=r Paawaamzmw
an em: a=i"artr-sfBIaT aw--"13 mama: n?
Uafeaaunansfnnaauafavamgaaauwa It-T
'tma==Ie'MrI=I1aaT qzzr Hyud-rerlamtf. Etmar
$r1=n=1ra1fwa1fs FFHT-lT'{61=l %aTzrlr1=U1'r
mfwrmil aruazn-tru" =rEF&'-13'II?3'-'lF1r-<3!-Td

I-'%:I=a'8*I%mz'T -65 I48


2-.rFd-lT-&%E'I'51ViI-q;- see
a-uwlanwairawmam-waawmm-t324-mntnezn
-1- was through the nu. 1.3. mnku. p.260.
5-smmllrm, 11?-r!1'H6|f'T13l![f?I-if-i rim-tg-73
emu-wands-maafqtu-up 59-so
312

8m1witaa1?rrin''

mmamwamwmzmaum
in t amwqnaw aamnamqmvdaatm
aitwmuamnmni. Wrs%a1 mmmmmwmmm
Elvgviu 2
vaqaiamauwwmwhtay aa
mnmaamiu tfavraavrrauvdrzrertrunzin

qamlfam
lR1I3I![2E=I'!TfFI=-1T-H-f13U,]EIV'-'li3l'l5lT

tr fmiu Qtrautatmwmmatauaw
33-ltfi-'I'{!'llGTi: '!1RI=1Ta-1,6ITJ'3ff':-'l'a-r-=I'l(l3lI'
uttn=r$trrsra1wrTaaTH1.avren1%Izswa=a1iuqqw mm
auawqtuvurwuamfaumiivu ?J'&lT'1f?f-t
Uq\m=rriu mman1=Iaue11aTa1-I=1au arauwnnmva
aanamaaa.qaauaaw3tm1aawaercnaz1ma12mavm1
iI'a?r1=1raIu'PuI&fa=I!ra&Ttsr=FI1a221 chi. marrcrcart
aaii-"aanaruaitta1zma=1a-rfama =m at
sgmurra-vmtmeraq-a7t-niaa-q-13
2-~IrTaaT91mIa=rn=:f-3tIa=Irr611-- c[-3|
3~'{F=lF|FI1E6I'fTJ=I'&"rFa1E1-U'C?F!TFl=m'n?I-C|;- 3o3(a13r
91i11=ru11?rtvrtfa-21::-mn1asTIau1ar-cg-2:2-9u=II|9se(a1)
-4-1i=~'."r8t3Fcn1Iaa=rraat fl T?-rHFI->"H=l=1=i!J-ti;-267
313

awm?aa1maau'1nmaarnterta1=n'qun5IfrnHn12a1:"

wamaarpaanmaiwamwmanau
UH3Rl'3i1l3-?IlH?1-111Wld=fllit'3,a3iUR6lFI1?flI
mwaaaimnvarmnhmvqnmw
!lT6Flt=II=iTll'l3IP8uq,'T atfIt=f=t8-1a=vtmm'=rr#1Ir
a1=nanam1s=m mnataa-an qaniwmqtrtanu
trmwammumifawrra mhwrmwnimq-
qmaammarmwmmqnmwamrm arr
una--uum=1'Ia1s=Iif mm, mtauaamfma
.m121rn1'e11I't.wIcI.u'<=1tzrraa1nan1tt:=1T=1atu=1a:It4
=1-'rum=r4l d1.aR=ms?tIzTtr=1"t21a1afa~221u

ultimate-2ta?tnwr:'t=1m11ftaasq1v,(iIiuI=17a'r
aaatfamr sncait 2

vmwmmammmnmuinvmm
Smzmwmnaaataraiimrm am1amt=I1.=Im
n! mmwmm mtaraaaiu murmur:
a =namd-Tnmmtwwafavmmamwr ~n't
auwmua in aaawr tarrrzrav1wa1=Iu1 aw
aarutrua'aiTdratrauz1~ u-1It=nT'c1Ia'-menu-tI=R1f':1

I-mu-uuneu-awafgm-t{-9:
2- (a)1J-'erHmmu1trua-aai:aau1a1a-I1;-use-qaruusss
(an-)1'ho History and Culture of Indian People. Vol 111. no
Clauicd. Ago. 3.37.
314

I1m316'.=wiI1au1'v mmwrtymmwmwn
rma=na-iau-arr-Wtwminatin mama
iarnrd marr1=tII=Ia1 mmasmerilahwamm
ugalnamamgv znar=r1ra'r&a=3 =:rr=n. mm W!
Ummufwtanmmmamawimmawmw
h=xsaIu1Ir(4'r&Ia11Rm=Ie&l ffutmlrlnsmtlms
larr)uIz1'1ra1'12nI

=nz1s8atatsrrrrimueIa.autaw5
t==femaarmaasT=n'v=18qwen=cI,q- aruamwm
aanaatqamwtnzawiqrmtmuzn M tit
mmaaumiu 4l.'Ii=d=I~3N-TIWFHHT awawmtrar
a=HIIrr?=n. 'Tl'3h'-'5T3'II=i.'IIIc'F-1111i11Tl'F1r14't=llI
Fl'l'|=l1lI?|l'l1!F=l1TI11!E-|'E =IE'$TIT?f.7I'U'El[
I?at=rI Eln T\tH9fatIfH1sa1 ttI=IarIl1=Irr
aarmawdna-Immwmaaau Rmuehsarrhzuu
3 tn'cm.auaaa11t8a=11fazrraI1=r.=IuIa1&actan1n1
adan=I1,si.qzui:tn%Fzarqa#trtstuarIw=1arau1=Iit ah
mama:
rvutatruaawrqamtruwaan
=ura=I'4t Wm =ua2s mmnmimanmunaqu
1-If arcruaattrraiu afntmmzmmimmrgiiak
I C C Q Q G Q $ Q C Q C 3 Q Z Z $ Q C C C C Q C Q C C Z G I Q I C Q Q C Z Q C C CC
315

mnh'1a1'Nrun' '

-1-zuawamuauanamuqaanqa
craaqum ntusszaaatamwaztnanvzq-umaaakuurf
Izrcrwnaruwanraawaaariu qmmawamwfamm
m!arqIIrf3a<zT1%tiu1n1 mrn mm
miaamiu qvmazii an1au12rr=rlf.:mzua
tnmvsr Ha-tcinmr-an-I%a1uT2#qw1%Ian1aku|m
a=1n1aTv2!1iat=ftza3at1at<ut=fmrmT!r=r|=I1in

aqwmummmmaulmmfaqsa
maakwmr a?'~n=rHraa=TaEIIuI. vdanam-I1 at
dr1i=at:r2Iuvtu1=I-ns?!11:rit an-mrrtmmammzs
tmiwwil
4Tgaza!#r1'=r'm3tr mmta
in utwrvumtrrwaniu

11%wrHa1aTd-1utff!?r1iutarrn1ta=tn1=I111u1iI
I-'1Tl?liFtWW|IW31TI3-'|5?,FITl'5TT-'3[o eo. M1111-:95? %
11T'raa-1tIIm- Iiruarsruwfat-I;-use. anzn-1954
no wonder that In India. A.x.. Dunn. (1963) 1-67.
3' nu thr n.n. at .202.
3- RTl'.-{Fl H-'[%<-l':T!;'-. u l3"Tm?:I'-=[-se-59, slut: #195:
4-1'i=!{tIrr-T1'a=1'Ia1'rc=I1rr-C;-I39
5-I1Tl%ET1iiFI11El'E-lfl=I1"l'!;7ftFE11T|'H1=f|iI
'8o1octod Inscription. Sarkar. p.394.
Oxford History of India, Vinoont A. hith. p.177.
316

mu 'W3TIl?|'?l'l'I|*Il!FW=IWfT11I'l?|T<?5T'3I W
azza1u?rr'tna$tz-radrq~{I?ra1ttfI=aatc- wit arztia
mmimammmummaaummdm. uz=n
a errrma 'a=Ir=1 a1zm.'a*rz?a1=rdr, tnmetaar
miammmmv. aur=r.-mermarqaai.
trra :m1=l, a-1f=I1=Ii'.mfara=n" '

3'lT'1W'Wl:

a=:t=Iwl raImI1t8m=nz1s@1?1
111tIsa1a1a'twa1-a1u=Iae1a1u' wit win uunelut
qamquarruaraaauavr u'1w=rn='n2wnfIa1cn'
aIa=rla1TairH1'f&UITf}| nataaxmunaatzmin
1-it itaazmr. akin avtcfn vamfataqamar
amn mnlwraaanwamrin
axzxsxnxaxzx :3: at :9: 8

573-111 H31

mumqmmaamqm a-ta:
Rma Iu=n1TIaazrr=rrn=1tt=avrr::i:Nt-'tarI=n1TIasr8
Irt1iw~1ta'-1uTsrtm1a1a1'Rt<"srarIrtan1'atas1ra1| In
1wIaaaTta=I=3aIIa%Hi7rawaw'auE=1kiaTifvI TH
317

qwmzyx a.h==tI=I=1a-I%z1t1'=cafrrr|#=ira=Hrc'-I1a1l
'!=rIaa=IaI1?u1iI

amvaugm awataa
=Im=:13sf!ehtr=r1t1tFra=:a1u'q=rIatIqa=ttvzrI
mamu auntrtwrft Hmatdrn zrqams
am5Ian%tu1utsr1(a&'t1=a1II'narttaI1Iaa'3am1
6ITR5N*1T'1T1'?7fllIlT5?6311IITlii'=ITlTQ'!f313FIII
aTtu1iaiITrau3qa12.1ai1| aamgnmmui
Smuaamamawmhiarmn amtattqai
t?<l'|?3T!a'@1rfrdW=I'1=I1:1l=Nf=I'ftErl'ITlf'IIT7111T
aTa1a$T~3ra'Ie1=1fn 'TI%m1=tn1trr.H?!muz=Ita'r
ua1%v:1I'rafu'tu1=rtatrz1a11rIaTn1rw1?a=l'f9I
utwrliatstatu

amaaqqqarmaaawa a1v:1%aw

=I=Ia1i61aI=n1&1avri'ra=I2sraI2Ja=ITra1|
3T'{t!T-BET?--"ii1=Ii'faa=IHTHEiiFT3aI7*}
$w11u1:mu-111111Fu"1n"2 Immmrmt 3
wnmmmu a1azu=I1-zwnzzmrri--1=uau tr
a=Im'l aaawmtatazniu? aaeur

u-mwmimmmm-9:33-qmausss
zuaumw-mndawmqa-cg 2o
31

mart: ammnwaiwnmwwmt
a=rr1'ra'h't11mI 'ar=Ia'tam1rIa=I=Iua1.errcrftr11
t#ata1'aTdr,a1f?taruz.~rarnu==r!a1 a&I%u1a=1111'
dhs(u'R11r-Iweaa-1ntsaT.11ti1 wavaasnmtw
araamayr araaatvawdro ?=i'| aw
Iaawaaaziu azwanamtaainuacmiuins an-2.
awzetumqfm mntwamwwmmimmnawav
aT=r&amII3Ina?'ru\1atan'ttnw?ain utrnr-watt:
er arrr<1ri$=IIa%uIInu1afru<=rrma=rnIrfwa11=?aIaTr
srI=h'rira11I4taTr3Ii' mmhwwmwm
'I'1TTfCIlBEH-13lF1=lI'1l=1EliIa-E5513! ilF|1T6'l"=l?.'.'Hl
tamrwminwrmaaqmzdmumma

dmammamawm
mmqcnasunmunrrntiaarcmuiw
Ihunmaitraautewmumiangefaawaia at
mmmmrrwmammmmwwm-aim
Iv! wmtmuhn iiatltrmrrarr aaarr
=IW=1=r!traI't'ra=|-'rav~*rr3&tI#r=riT Kiwi: M
tmammawmsuariu azumrutwdn
flstraratevu-1r&ttrr?mrtrmH1. :rqcmlIu11a=ral19&l
arra=rrrIz1=tr$ra1aIarra11a-=11.aaarra1va:tra1T=EI=r1!I

I-DTFMEIII-91FI~3h-Biltlim-I{-20
2-rtaqarrwa zntfam
zRaaa1Ta1r{fIuTI11?=I1. vrrztnuvraumtni-'tu;e1
gfaamrmwruraqamu aeacraumttaaatav
%urrzr=n. =Tr:rm=rri:aI1t1u1a:=:ri*u=m1z1=ri!1a11'ana
a?tTd!1rrau'tuTra1aT111ar 3?!-|'llF?f?U'6l=llv'v1TT|~3lt|-1T
Iwtmsadafr. aatI%Iva1tHnfaaTrurieIia'?u.'va'I=1r:r
rat:-'Nttarrnaqa1=I1. waruaaawawm-at re
:I'qaa'6|'-Wrerlwltsil

mnri--'am13mHm
gnmalaawwrumvatatttnattrt--maa?
wmrilauamdf 3{HT'l'T=IlI?J"l?!I'|~3ldl'c'lf13|-'l1T'FH'~5|'l
nmamu W1a.atua%I&vuvJ:=vuH anrr 113!
-am:--Iama=rraamaqmehm magma
umsanr mamninwmm a? an
um! tramvrzrtatnariu rraalaammavmt
i13iIIU11PIiamTarr1$rm.W1?-IP=lI7I=1=!ta1'aTat
m amt?!-uann wzmnaqaammaw I-rl-1
wmmwmmmimnmn
wauawguamrwmms
avafer1w<am=rraumrranrauRIi=t1=Ia1=Iarata11'a9ut
vawaunaw cwwamuamm. trum
aammttutin lmadwrmru
320

111trn-aarau=n1a1=112raa=I=u:

vawammvaaamvdam
Efli-RFP'!FlE-I1ErT'tTGR1f5;l 361211! msmamuzma
naauwaermuqrmviwawmamuau a1
vxeawarrnzwairsrarrauraacrraamaauaamauema
tlafaazsml lTn'at-11'-1'? Ila!-T if-an-1w= mam
u=nIm vlatarataavtraml a==aa1aua|=na6 3
msrdntanvawc-lttiun tfrtha'ari,aF'aT ma
ra=n itiwrrm mmammmmammm.
a'a3t{ef6ITfrt=11narvv::uIa1s%=dfIaiu!rmI:rttt511
atitraw nIar i'F1T-VIP-I'3lTl"'

lTF1lT33=fF'll'-N?-IT

um1I=I'rra=unIaftn1rfa1ratmnau
mmammz tmtamrrtrmu-rmmmtaa
=r|=l9tEaI|l-?lIt=I?l'II?f!T!T1I\'-lI$fai7?5E=I~3IT*JTI zrtanr-1tm=I
nrmwak vgaaairu am} ilamwna
amammsrrnzaumwunfarrrust =rd1TrIIw=a!In
Irm1z5'rtrl'a1:raanaI:'1rP ?tz1'r.(wiII=n1m'wuI
m)TmFir =r an att'a1=tr3uf=nnlt?a11'i'r21r
nvf':ra#auiazf'-1IIaHn=IIa1Twa=I1n au'3t~m'a?rI=ra'
I-IaLa1=I1ara?Tv:w1q1a1&arIwa1a1(awn1mnf)1?:'aI1=I

I-zT3Ega11~mI=Ia-1tl%rI'rH -1- I32


321

a1aa1=ir|a'saut$az-Iwaqaai crrtra=nrm=z=rt1
Item cmtrtrr aazm zmarznaramat
mtwmwmmammamuwmll Irtra
a1ut=Ra=:1a1e8tn:1:tIrn"=tra1s8m91hIu1arnrrereq'c1
11ru'vxHa1tfaa1a.ahrr=rti1iIsz*re*.aa=;a1Tatra3awa'=It
IrII:u1-u_a~arRr3c11a=I1a1tmin"

amraawuamaawtmuaard tm
ikiu mmimtmmmmwmmalos
azanwrmwqmgarairwamaar marl? 1|111~T~sI'-I1
anuTm1ru1'%qf:-Ia'ai--1trdtI(*I1a'ta)a1aa16=Il11=11
aI111mH(134-753) i8Td1TGIm6l'9?|_11TFlT0 cm
avewmwamwrmmvairwwm drama"?

anrmarrcs itmi,
:I=I'ta1:T!Tcrtf5taaI9na'tTI351dTaIu:1TIaa
aasqrmmu wmvacamqnitarsguavvoair
aavu aigmtmwnmtrhdganmairammawa
duamtawem nmuntamtnaaaidrturfzwaam
auwwzmmaammn vwamrharmaarlk
amamumtadmrmauam arrrmnw
C O Q C O O O C O n C C D C Q O C C Q C D Q C O Q C C Q D O O C O oi

t~ZBqa11?m1=Ia1trI1'Gr -I[- I3!

2-wrtaintmwutqfwu-namtqia-awn 22.1-2:5
32

nac trirmamnrarmtwamtrrqttmin am
mmwhrnzamnmmwwmw
srmarariu Ua mamwmwmamaaaim
13rt1a'a337sana1'a*1I1a1IanTdaa2o5aa1frq,'r
itaamardaawrmiu ataamdaaazvssmz
arhmiu #1331551 daazosaiaseownha
~3i1'l3I u1rt1aaTH=1524I''t1'<3iIl aaitirqt In
dnnzrlun

tdmm amuammammmi
amta-16'-=rdaa77e fl gam arrrrmno seam
valdainsoarnin wuso vzravfia
1163613211 maaammmiwnadawatagam
taamaawunlmqemtin wmnaamm
mmmaumamwmmmwmmu mam
=1ta1f!TifasII=n1=1a=112e1'-1'<i?lITIwIi1Bz:1
2m"'
Imtmwrmmaiwnfammm
tmrnnmtrhdatftrumttmaa
qzmawmmmwmmtammaw mgarm.
I'Hl@fF|FIl31'f?5P.'$I, aanmwtwa

" 13 64'?! mar-1 a1tfau1a- q;-:35 - use


323

=a=ua=n=n. ammmuwwnammumwnqzuitm
faarrr%u11I?=I1npf1I:rt?fatrrtnsiu' '

auvgetnzmal mmwmwnm st:-1%


wsvmawaaquat taut?--1Irwa=I.IarI1arrc
<amua1ma"wmmuH'ua?ui-faa?au'r1w ms
aIl'd6l1i"FrT11f1'~|1'-1'=T(l' #1'ra:zir1maTi?u=IaTtr1eu11'
mTUa&aT:rr=mm&11m1t;a a1=rI1(wa13i)'-T123153
15''ilF?T"f3'Ff1=lfcIIllTI aumrwamaaa
regixwrmmawmwmgarn wkrxm mm?
1=wrrarraT maa-1'rvT-1trr.11~'a'uIa31'sant maa
tmmf cas'1!am.uTTmr=I3n1'a??Twr:raa1:a111a~u
ii earn in aaTtam=tra=IaIa1a1u'+u=uz1#a1aam an-#
u-3| aw mmaammamrwmairmfmwm
m'rrI=r{1=1'f mama? auisrawcrmwarwu wmwnw
iam1TmmrmI=rIm,fawIerm1 uwauaaia
amvacarrmtmaaruztu

NIIlT3~TT3Tl'

waranamtamsmwmaaraa
tnsarrai!H1=rI?Idiw'sren=raiTq,arin1z1va::IewTcIarrdT.at
ruizqwxrtn amamwwmt em} I
3. A comprehensive History of India. 101 1. Ch. 10 p.734.
, Dre 30.0 Ir-In
ummawamamwtawunmmwwma
mu aII=u1UH1i11?trrIrIa1a?a1u'=1r?-ttu11I=1ta=11fruzIa -1
tuwa1a1mzaausu1*3n"'Hu1&It=?=rrc*a:au'aTtI
trrmn Wsrttrld-'rutaa1=I1a1s =tEF=H1tqm'1 iatm
mmuaananarin

amsaaaiamatwarrm #
maatmfiu aI=u1sI"lzu'zI1913a1:sta'!t1r=I'tffa=I111=1=!1:$T
mzrammmmwwgqmfaawartavaranm
a=rI=11muaIn1aT1k Tqrllfat arr
GWFIFHITI '|lEIa'l'31iI=ir!ff.1?I1i-1TII21T.fH1lfHTf21f,l3ITr
I1fiI1m1:r~au'-Ttam11=1TI1=I1I'| uraznalwtati-"ft
i~W'111Hrr1'1!laavtn'iaI'iTa1iI=II=IalI"aa: w
=1'r::'ai n1=raaIawdTu1rr-=nin

a1a1arwI;- aIn1TIaaa:4'raFIzt'=1v1=1$111i47?r11a1d-1t;ar
572.7-rmktarw-n-m#=rteamwhma1mn
Irtirvaanzxaitrriiiaqiizildfirtmrin IKE
ma'zTrrIiIir:raHa116rr-fe1nafaaTza'nIII ':Tna1a3tnt-T
u:Im=1m3'aIm1vdtrfra$armfamaamI=Ina=Ttf%1aruft
mm! mqnauamamversmzai mmmm as
FEHTGIII-"=Ild'f3iIT(lTI6rI=1t1TIfra121'l.Irifaa~'fis
mi ruaasafa-eam'mr=r 21TIlTTF=I-'i'l'FT
mmawrtmmaiavhnmaaarnwmaaawrwu

I-E'lllTWFlGT1I'5TFf -q- I34


32

tlffii-ITGT

mranmmmtaawwntqqu an
avf-'I=!1I6 =EraI%|

tmimaaamrmzaqqwmwmtm
11:aaIa1i1t3nItr:amaaaaz=ta1aa1=11s1z1a1=I1iu '

~3lE|lU'{?FIi= aardaazarraaa
i'15'!ffII'ils1TIT<-I11-'I1'5'l'Cr=|'3I'II1?J" mtmnww
El-'l'al1<m*{?l-T=TIi?trrH'f3*l16IEl1??IlI f 383121
arm aaa rruaI=nuTz;cnz1; aanqznaaqfash
filma wmziamamwamammu
mnwatqztaaau

=.-raaaarmaaaamznaamuumqa
dIaT3aaT3aiT<=I1iftu'afTIaa1&qa=I1ft-Eliirin 13-=I
trm t3mt9na=rttu Mmmimmqm 13'
am?! mmmnnmtnwmaaammmymar
'-'.'Hl='l'-'l1'|=HF|1.'|'-I!1'I, ahqerr vdmqmam
f ttiu

qaafavawwtianaam-ufanxqdf
vamtmartw rrftaanakmmulqamam
I-zteqamwummtmuw-q-sea
321

Il~'H111f6'|'-I'i1'r{=I'!!'l man T!f"%U'I['?8Jfi7I1I 9|!


tamaawmammnwwzarmqwamamsqam
:7r#:r4'r1%u1ur%m:qquspw~+a a6Ia1l-if=Ia1'-1a1Pa-iavgczx
Iirrataasin durr 3mmriramiTi1t.t=1tmaa
=1ita1?trIa-Ittrwialran feartrqaamf-lama i,
1nvrs:ruamaf1-aarqunawutqwauurwh are-.-artmam
rm? 6-1t|'FlI"1HIa1|=l'r:"!I at smun -Ecru-(aim
ar 1'E7t==na=1Tm'f araamnriu mm mm
mawwrcnma mr:=.'Fmt muriwd aaa
mrtra1aair%f2i=1ta%=r:s1-na1Ta'P fl 3dHPtIlTE'l1El'G!T
=rE1'ri1i=aN-ut2'n3tIr=I&fn.ru'P1?=I1n

qatmarrhursmzamwrarmtga
wmmrmammzmwmmviamma
ITI'i|

rnqadxamftgluwdawummwmcqam
t~'!r'r1taI1Tv4:~'rm$rua?r1a1v1n21rqarnzr. mwamzmn
13!ElTFI'lI. TITIHH-'f3(-TiB'!. mnwaqamam
tairm-wtrmwwnmaaiu 5-lFI
a-lI'#1%a11=rsmn=I'f mam: qmaitvarmndlararua
a;c=m1=n. a'ra1=14ta1u\n$e1IT=srI='wrra=I=rr, Wl-T'lTIl1=l
mammmwmzmmwmamawwin

mqaamuiraa-nahmmzaqammz
327

8wrasrt1#tri7au=1ra:<1=Iti.1irrttrz;zzw3ua1=Irsa1a1a'wt
ainmnfzrrmaatgrwmaaiu wmqqwamw
twnarai nazrauawmtargvfahtam
FRFII a'taa1a'{'1=Imt;aT rmamaTarfaarra'rai,z'~!H
maawqmwwrqqwavaaarti mam-'
TaTsIaI7,a11"n11i,a'a$rekfe1=:a'?i'mrr1iI=IaIdTEsff
ll=I'fIT!H1={ifIaTn?a'{lEFfia'lEITWl1%I1=I11f?I3THH1=I
inaB3aaa'a1TntqaasIu11wtnI=c?tI:=ufl*c1%i?nara117ara
11=rztETrd|I"'

mmtmawwasmtamzmarv
n1qaaa1sTq=n1:fc1um$a3mTTI Tlmiu 2 -31'-Ft at i
f!T11<11TH5'FF'qf?6TIl[NI$fW|iTtFT|3TUTaW$
wI=Iat.*rI1nf=IIaa~a-TraIu1=fnITr=18F:?I1'a1i|=rIza'3
alnqm nzqadarnmaatrmarrmn-rnvmmuasm;
1H9'Tl33'm3'*IT3=l|?JIIHlHHI3I1F@H1.
rm. un1%Iat.rqI%uz1 arerHI=I.wmIa EhT"'la'HilFl'F|l
nawariu amavnamwamm-ai aunnrrwrawmfr
C-I1m'l',\1Il"1'II:,t1f'raBIt tuflaanaamrfitarcawmr
nasuatamrvugr mam: Tafvmdurrar
mammamn itwaarlq atmrmm
Rah!-IE-a?tI1=I1ata=r$2t1aTwm=Iarmu3u

I-zIe*t5?ITrat1tiIt1"aI11a~t[-561
2- ---"--- -cg-57o
322

awmwmaruawimazaaw
mn%I'It"r&1mi1maT a-17=IflliPIIrt3aru=1r=\I%waIa=Itr1r
azrf?.'=ItiIa?'rU=I1=I1=Ia7t2I1l=IIaI1 HF=Ittrr3=I3crf't
m1c1aI=:a1fazran1a=faTutf?IfamsNrrzum1%t%r
satrmi wnammqmammmmmminh
wanataaaxv q'em'ratT:n1==Ia1muz?a1%n 3:18
F|1211H!aTH'lTl'-IT=jEr?.|'eI $I=I1u?%|

=Tt=1=Iv%1iii\P7:31'<=I1G1'3.ai=?I15f=I*qzt=;a1

P'311'WT33?H3fUW'U?ETqT$IlHWT'3l41'QHG1_1'-IftliTFF
mzaauuv arunranra-1'arun Pmarwial
i.a1Tvrrcrau3un1z3w1u?Es2:mrtu1a=I1ne'Iaaa11
aatwizrfdfn ntqaraaaiaawtm
!l'1FF-Hill a1a3un1*crr1rata'ar2!t.tu1avarau'#Iaa
Enlzwaaawuaa-cntnzpfuwwdnmtnwrmiu

:- 2I1a=IE~HI'1Ta1a1a'wr3=Ia'tEFtIiz@l7f
H-IW=rE6n'ai'-ammftrarn aargqrwmavs
faavwgaaai aaamwmgvmmnm
in nmmmaqamwaarrmunawqammtma

- Hwa
qamimmmaatmm a1-1wTa1tttrn=1r=r|

mm. mm l7lllf9'E,l=I?llT,6lElTf. n-=I21'r, manna:


Ina? 8-I?-w@I%111I%III1IIIT3Iei=?IT8a1a1'a=I1ifl5=IIz'4s.iI
329

mamrammmiawwreruna aammnmw ' wa


rmra-:aa1=rm=I1za mmzmmwiu EfT'!TEH
1aIiraI'?Tta1n-1311121173: 2

xsxzxzxaxzxxxuxuu =1 =x=x=x

augra
II:--an-ll-It-iii:-3-H?! 'lVl!h'fTi-1=r!rI'_rT
an-rrurrrera}rr12airan1zaa1w:a1=uav;qwa1a=t=utra1zaa1
Unnil

sqr:r.rs-v1 pm my :
aa1av:=raIu=1=u1crIc1r#rrn1tn1am21=rm
Iiiiirtvratrrerila-T1'&$Ii=IH1?3I .=ra1=IdT\1d'rarl'
@11aca1'n1u1.a1u% u1=frmm'a111rdr.trra11
1121?: IF? uarsra3I73Irau'ni=I1=r1%Ir1I'r=I=I1a~'t6Ira1I!tn
a12.=nsrm1=r:na,e1 mam-u-mmaasrmamwgsm
=1=naaarra==ri'I' aTa1a1,atIzurn1'taI1':I1=sttrra=im ram:
aanqaaachmammmnmmumn aa1=r<m=
maadmwmwdg a-rI=ta1I'Tra'tIrrn1m1=iIa1rct?m
aHT3=IalTt5Iu;dTTr11a-*II3as'z=qamftIa1rta-1HT?IIt%R3TnI
C C C $ C C C C Q C Z C C Q Q Q $ C C Q C C C C C 2 C C C C C Q Q Z Q C Q QC

I-E|75'?{T'IiITHTT|'l1'H -q;-561
2- --"-- -II,-570
33

ak1a'q:=Ia~'Il?u11=II=r1' ==1EFrI1"I=htT3TFT1r-='I'r:r9!rt1
.'?11a1}reI'aTa<;?!1=Ia1a-trtrraaI=I1Ta1I=rE'a&Wwl1TI P
ufaaiwmaumutaitfmnmin Wwm :1
FEI=nl3| P'E~?I"lT4TT1=rfl'q13i|1(i'BTEfTG'\Fl1D"=|1Pl
fawn Uawmawmwmqwiam
3f6n'9n1adTntaIEatr'-Til am H1rai'lTi1=$IT&a11a1.P
crTrtrrnrqs*err%1ava={1ta 5!-lf'55|E-'l'|=fI'-I237? trw
tawadwtasnua Litun Tmtalrmamlaarnaati
:mrr=rnwaana=ra1ttzaa1a:a1u-nma-=:a1awi,m~r=wa we
wmmavmwhmmamvawdu 6K'lW?31=i 3
vurfiaetramfau fawmiaiwmmrnfrmn
an=TrItraadT<?n1I<?a=resIa'1?a1fmTdTaIa-'aw1IT8wI1%
WF|l'i[Tvl'_U3T=lTl}1T| :I=m=rrraIrtrrsrr=I1t.tirra
nmmimmtawa =11"! a11u%1%=Ir=1I'r'11r%mta'ru'rdTI
=r em aIt~I1a17:T=Iaetrtnt'ra12;qn3'I%z31a2si",a=aThaHt
itvmtrmmi 3'uIt=I=3I3aa1:I=Iar!%i"aas
t rrnfkmaaa-ruF=IfcmI

=rIa1=s ~=n1'?HErtwa-119'? aamnrma


r-I1=?$arI=:at:$u11'r$tTmxaaI'em'<'1a1in mzsrnft area-1
n=1=rI!1 a11ar-&waEnT=I2si!u=nTmma1aIftaza11%u1m

" A Conprohuuivo History or India. v.1 7. no noun auntmto.


Chapter 1. OJ. Inrn. 1:19.828-829.
2-Iiairvac-a=|'a -aunaf1a1a=1naraa-I;-:59
33;

=r1 sxan Wamwwmaanzmmnmm


qarrmaeravza-1aItim't'=1I1'aa-1dIn't. '4T'-I'E'l'e'If~3'R
I 311633 '|=1I'tfEElr!'a?3IFP3tYl't=I|3'FII?I3171t'
qarrawafe-waaw21={=?UaWdtvd=rH1?Iftnl*h1uTI"

w1~1TTuT=x.'TI'a-1=1fazRaa1a'q1=d.7=I1
aawwra Tmamwrznmmu want-aut=1a1nwF
amainaawmqsunnaawn tmgca
wH:amrn'avIvt%2?arI=rm=na'aftrara1%n=In1?r!!rw:1tfaa3&
'i-fsrcm'nrrrn:rrn"2

in maw
=Irc:titHrTaI=-Ti|=11.=I?1I=Iz:3qaT atzaaravmraa
R1qwtTa1-3u=na11vwuTI'aaTIaum8Ia1.mI.
mm istFra1 Grim-1Tar=n1, dmifgvrdm
wrsaatwwin atauaraqnqnurriuamamqqwti
r=raIrsna=1Ian1=ri=I1aesa:rra?r=11'nrn'rrnwt1a1Ittt1Ia=mnT ma
wmu'rardriu1wM'rztranma=:aii1t1H3arv=s=I1'ifi,
?-K?11iI"!l1$T@'T?|'!1I'I-'T6l'iF1'!Pl'|!ll

znxasramrnlaarrarrartmrrnm
ur't2TIan'dt'3| attirmvammfamaaamin tra

l- t?-:'i'rasa=ia- fnattaa-=[-:59
2- urra aitsunmaa a-Ttrmr-Fa-arr-um-cg-95, aqua :91:
1t=I11=Iq,a=I12 atam'-Marta? ata"I'd-ran-11i*|=h'=If!=u
tmanzrrrn mcmai. =(r=n=1a1aaraaa:n1=rc'1<a1u1
i, mvnmuawumnmananawmmhn
aa1a'q'1=Ia-1aatrn1Tt?rrf5au=T=I1tr1I
1-I!1l11*rtn'auaat=tu1u$aaa aiaizairitaauu IT!
tI%I11fmtmiI(')

mrmntnirrar. aummrmrmtma
narwawwrrlmardtuu mttfatmuatm
it mmmww. =1?! 1'1 mad-Tavrrnua. it-= uzna
mmrqnwamt. Ian! mil itmruwarm
uetaiiwdlr-mt. umuagvaawraravnumaana
=I6man

n1=1rt-hr un1'eI$rt:1'e'raa1z$T1=ua
mmmmmmmqqmamawmwmaaaawn
qmamwaaaicammwmamairarrnnmma a
vaa7a=ra,m-rumaa=n=naamvrammma1raam
=n?a=I1qfa1i| tI=1I'r:rI=r=If=I1a-Tai|1Irl1'1i!-TTIET
Wtumkamwmmgmmmmmmmmz
aureznin murawraarrmnsrcmreamwmmauaqan
cu- - O O Q O O O - o - u . - Q - - - . - . o Q o n - Q u o - c out

'0 D. '02.
p nu D0111 Sultanate. chapter II. no 113131 Dynasty. by

wnmwraatuau-maaruia-1-n71.Ra'1u1$
ma 2o2o ra
33.

aaant. I!'H1&=ll11EITGIIFEIEE|E~1TGITE'TIlI

mmmnmaimwiammutamw
u=rIurr:1a1.eau=1v:1= wet aamrauahtrmnnmanmm
as-hm: ttrauvrracaai anaaajr may
mmamtwwd am =rmlltI1raItf=n1'r&zas1.aIu'-1T
add! 8a1'afTeIn'-11Hft:rI==7I=T aqia iaia
=rr arrc1'rdn=ru1'u=ir'-Wan-38:1 mmmnmaum
2aTm- "wrzmaumnalae aqaf-imrarrarrrn
raITa1@4rra\1'rl1EI1si|=I'l' Etrqfrunar 13%
rara=IiTa"'

rmmrmnmmrmwtaamacarm at
a1ft1sN mhattrrwmmai atau=I1nrqa:n4rfe=u=zr
anaarinliaamtnqqwrniunraaamiu

qqwil eh! mqnr 'ciI'rn1%r=rrnU=!'H


a"rmauaman=rwam1-mu! zcrqagaawmnrtmtmwa
dman atavtrwesarraagtvgtmmqia ssrmrn
marrmfrrmnmn-1mm: uh? =n7H11iI= mm-caawwu
aaiaaa=1= mfmgafnaauwu a'rtrrI1'r91H 14!
i-1Tl'T|'-|'5"l aw: trmt n'r=uft1=IIau'I=Iu'raI1'1
Ccnoucoccnoonc-noco-Occ-Occcnuaccon-O:
n-mm-mud:-umw-$1:
atrwmmmamigammwn mrmnufwrmmwaags
trtItrra=$ra1t%ITari=I1.r3a1=nzu1'ca1n3rua3o1i1au=iT gs
aamanammatatgmtmtmumnaiu '
qmwmzmaantmammwr TPII
FT'l'3'll:IilB'lF muqmamraimaeswnr
mmmwqwraf araoaraummmmmmnm.
ataziru1rr'rn:a'arra'aa-1a!a1aI.m<iFIrr1=warmt:T
gfl aarns1ae=u1&rrrawaa:=1r%uz1%:t1::aagarruu-r
arqwvaarmnanawawnms mwmwi?-'|=I'3t
I1=I%it'a1Eu*1a1.'IrII'

|o Whoa alltun ontorod tho fort on 10 July 1301. ho found


luhonod In lying uonndod. If I hovo your uouhdo trootod
out you rooovor, how I111 you bohovo touordo Io? . tho Salton
ookod. ' If I rooovor'. tho uoundod loghul ropllod. I will
kill you ond ruloo tho son of Hour Dovo to tho throno".
tho Sulton in ongor ordorod Iuhunod Sho to bo trouplod undo:
tho foot of on olophoht. hut oftoruorda on rooolloottug tho
oouroco and loyalty of tho dooduoh. ho ordorod to his to ho
hurlod dooontly". - A Couprohonoivo History of India. Vol.1.
tho Dolhl Sultonoto. Prof. Boharoot Proud loxona. p.347.
2. lunuol ond othor Iojputo. duo hod nod to tho Sultan tron
tho hi. uoro put to doath. boy had boon dioloynl to
tho:l.r on ohiof and nouddih ould thot ho did not oxpoot
_ thou to ho loyol to his." A Gouprohouoivo Hlotory of Iudlo.
Vol. V. Tho Dolhl Snltonoto. Prof. Bonn-ooi Prooad Sozono.
3. 547.
qrwatniawai, 'aata1:r.'1=ra?r=n1ar$r
IatfEFI?I1t1ffiia'tu1I!aTFN1?IT!FId1~i%ErFIU6T3?1T
a1. Ircrdriazavaumawrn. uataurawmr. cw?
gaiauatavmn "

umqmamtmwnmwmatm
iaatrsrtaaarrat-. I|?i'!'I'FT33fG?l?l'-'1Hl?Iv3a|FfM
nmzmmmmmmmawmma anarwMrq1ia
Itrrmsdl

=rrz"8a=a arartaTwrE"zsIEu1'-nsvd
admin wttmtmaumzrdasummtiu =nz-cw-I
I?Ta111u15?:I=Ima?rt#1lr,aIzaTaTtIdTEIBTi1 3
awmqrmtaamimanmmfn 1'ra=[=1 d-Tr-law
aIn=Iv!wr.=rcrn=17vzta=zrai1'nn=11a5I.=rtrrwnatra=m
=m $awun=ra?u-ea?arrraraa1u1a1=Im1|aatrrrrP11 61
uanmmmmummmmmw turr afaaw
ass? at!raETa1av:mntmaar|c1am8favw
crliriitaranwain
fvmanzniqqw eIam:z1=I it
ra=auI21r.ar1'rwIia Tmdrqmrrfms mm
n#iirIIIIiiIuiIIai=i=a"
atGIhraaa1u1a=1a-r=I1?1a<7f1:zsut=I1%u"

PfT1I3iliH-t1-IITHEFIT
IIaa1?:w21.rraRItraaa'rWT#au'R=I1aaaima113IstrasrfzaTsr
z1ifa1%su1iu't1ra"r=traamvnua+a?W.n1*=In1nasrvdttx'drr
i*|I=1IT'a6a1rFI:i|fa1tm%a.tmTta#:17a1T|'
I1r#a=In1t6d1'ra1crafaTia1Ia=IarraralITwr6=:ma
azaammnamaaattrm =rirn

Iirrnmm-Tiaifavaanmaa arr:
t1'7ll1'|1I'EI6?I13IT$ITI{<1J9'FliTTiIl'=l!frE11?P
Iltrvurvttii, a1'8=I=naa:iI m2I3UJltI=IR'=I1TI=11i*I

376131!

I- But: Deva end hie mean. these provieione were eleo exhausted
died fighting at the head of the Peeheb after the input
ladies hed alnitted their bodies to the {lance eeeording
to secret rite of Jenher. It in dtfenlt to aueee et the
eollreee of Hair: etrength but en the but fighting men
end en the 1-eeoareee of the Delhi Empire under ite not
capable ruler were needed for the reduction of Balthubhoz-".
'5 Oenpreheneive History of Indie. Ve1V, chapter I. by
CJ. lharllo PP.820-829.
aT<i1IEET|f3Tt3.d'l'afaT'l3II?:1?F?|'l|Z3I=3!-?-IETrf3 art
=rI27:'a?r:m1-crtin=nTnw1arrauuad'teiaralEi1w':?rrn#nT=1
marktIf=Ia5rndtuTa=I1.a14aaw<.'t=Ia?ra at-ma
ura=:r8=I1itg=r1am%| aantnaaumwaiatanwa
wmtrrcr. Tfdi a?ratrn'f a-tz1Ia=narc&o 3
mtramr a?a1aarra=I'Ri.=n=Itt man an! mama
iarrtmtrnazsaaata, u?ra=rwIa=u1!Iamau1'
asmurmmeaaawlrwma m 11!
aaaa1a<t.'r=I#ureFIa~'Irr=tri?rza1wIru=IPI 3| mana
aqmimvaaanam mmfawrmmr
an=rrs'm|2n=1tr$aafe=ga. aaatmaaa seam? ttr
tqamraau

Trawc maafrmammamaaatf
arritcraqrrzrra dfain amun unit!-t
=n=n. =m=w&nt=irrmna-13:-I1. u1=-'nrrrraa'narar
:a111iTI!n'Ri1'-11, eITl?HEIl=I=IFfd1FI1Ert'l qfd-1cI1
#1

Rh! 1%
$ =x:x=x::x=x:x3

_ 1taaTatr&aEm1= mmam
Iaiawfrvdutfwailanaawqtliatirammamw
Iz=r=ra-m anfaawafqi zirqwa-it aaariu am
W. 11113 aanntaaawammuvmamtaraam
af-'a1I1rar1TI'i, naaaauaanamvzuaurrnain

?m1asuz=rIP'

u-aarqgmwammm
l'I1~.?l=IiiEl.T6I'lTG'{'.'1=lH-'1aIu'33
I1raaI:1I221TmIur.:mcrrquf1:r':!=i1tra-z-323, ah
Ua miatnmn 13-=IIr-iT31=IEItI3-IF
an-aatu-IIaq;ad==trra1t~In t-mm 1nau~1mIrrE-rcniI'

2-aaa1a11.'1=Ia?r:FIIarr1TuTa=I-auawut

6Ia1<!1:1=I=R1'I=I;Ert=I&v=5l?Ta't
rmmmqqrzmmawwmmwu
?|i'lTl'i~3rITCl'('1=l5l7T|'"l'I'IGI=l' Tm U93
eTH1 arTr7l crr\tr=m=Itt n 13613:? vutt
:r=marI13oooo'ltIHT '~l=l.33.1W7J'|'F1fQ,
awi%RrInmuhaurwIa1z1rtr=rif.=;131m Iautcrmia
iamaiamnfs zk1a*1raaIa'm=IaTaaa1T&aT?Iu1=Trnf-1%
Th |Q'Ut|'lt-l1"'3if it tum $~:l7II'50O0
l he Otto:-I History of India - Vincent A. lth. 11.244.
A coup:-ohontvo History of India. Vo1.V. Tho Delhi
Sultanate. (311.17. Jnlaludun K1n1.1:|., P1-ct. Hahibulluh
P0324:

an-cr gfanmuamtum-vuamunf-c992
339

am? It-rI1cr%uf=7t11I"2| altar} mntnammmau


=na1a1ru'n1aII%Iaw#:?r=TIfa11a3aaarrttfaw:1n" _'"'
wmtwu iwftatni itwmuttumuqmanzm
it "2
aawztmmtadw
aawwnsmkwnwdmanmwrr
mqamamw qamardnfavmamzwrramwqm
q,=I:a=Izrru%Iu1q1.m-Ti#ana1t:u1.z1iIvti::&1%z=arTna1ArT
Ra mmahrwfl at:m9u=mI-ta-ra=Iaw
I"lE[E1. w atrtkrmraa ituarrlzzflmsa tn
n&a1'12zra1n1=I121T1a=I11=Ifi1erI1iszss1trIi1u1a1T
n! mmawi E|1'3lT'GWl'Ef-'l'e'TITEI1IE-11%|-T!T|?FWE1
mama tuaarin 3

aauqtnmuanaqrmwrairairnmmmmmarm
x=================================================
|TQT5l'I=l'I

aa I'a12l'l:?.'|? mar :51 131 uava tn" arm!


1'3'Ql%1Tl1'!1IffT11i1=1THFErdI1&Ti'IEaI1'l'21fI W

|- The Oxford History of India. Vincont A. lth. pp.245. 247.


2- inc ltutory and min. of man People. vo1.v1. no mm
hltunto. Ch. 11. S. Roy, p.29.
3_ no noun Sultanate, Gun. Editor. n.c. lnjundu-. Ch. II.
P: '90 360
340

Sea: 1 an-'aTTI=itrc1m1a auawr srvrrtr


Tim uwna mmaiakaenrmwmmatni
srcaaaru --"ua't1atrn??ruTia1a11taIzsra1-=Ia1=Iu
iiiIia11atrGr&n==I't'crrerrrI3am'tI lmml awn
=rI=Ia1 aallt =nI3=ma"l $rI=I1RIiia1=usa=Iaa3I''
uanaamwaarmrwafmrwmwratwn
at-hvitaru mwnwwmqzfrusirawi amt-turn-Ta
'Irm1Iawtavrn=In|ana1,:ra=unnaa?rq1=i'ru1aat{duana
uzrfazm II nwaaa-r, fazaerairanratm. m mums
mmtammi a1311i.:m=ma=tIa aI"?'ri1aIa aqa
rm a=uT9uu11%nwra=1aTa1!'truaa=nfa2:r:aan=1TarnaI
arunwlmttaurufawmaaariaraqnqutvdr
mmmruavammlvuauawmtammwtd.
atT1=tatrrfa3wI=Iu'r:,:,'<Ir{ftr UT-l'F-|1qTsTI'l| ewtitr
'\tma'1-Rasru ark-rra'eTua&itw1'tu11=1tu ah'n1'
aIf:rm1:r{c1=I3rtI=:q=I1:vi'I'a=I1,1GI1'l'I1tIB1I =I1a3tFr In
rth 91-a=nrr<1r;rawwa=I131aa1waara1=3:"2

i=Utf%It11wd-'taa1sI1a1at4t3aiz?rUa{
rzavzsrama r.-119%: :rcI5H%rarsa?ru1?-=I=T2:111=1'a1Tztr
h1?dTdTlTlCI't1%I-*rErlEI=1'=1i'f ffimu rnmawmm
C Q D Q 9 Q C C C C C C Q C Z C Q Q Q Q C Q Q D C C $ Q Q C C C Q I1jQGl

huh! trrqz-:-Tr, nitvrrcirea-crvatqm-q-no


2. A Conprchonsivo History 0! India. Vbl. V. Dllhi nltannto.
chnptot IV. Alunddin Ihnljt. p.334 by Bunarnoi Prnnnd
Banana.
341

*1 ammatazsmmranarmu atqnsz tmrt=rI'u


mm, :3 itanaaamadwmmmmxmad
ma=r&a-cawrzawmin

=nz:ar 11'e"15'll=IIf3I1'-I1'E-|'ldi-lTEFI1=l3.

rm 11arrfTr$au=r8=nH1c $tqf3zaTTr'i',
aftimu mm ma-1ta'3a=rtI' itsaan

unanrtqaraaidtmmn a1a1a1=I1

'c.mar?dr#1aaH%u1.f=I1HIu=riar
uizrawmerrnazzrau aamrmmwrmamr
I'tI=n?n1matIz=ni|

aIa1cm.1=:8r1au1%ra=?rra1t=1?aa'm
11-'1r'=I1=aawswsa1?ra1 E-wirifatm Wauwmwwmm
mau fv3R1IiI"'?drIi?i1T3I1'|=I qta-Hs'r=rc'=I1a1
diam-uuzwt Pusir limit

taatatmuwanuumunawtaaty
1151-2: aanmawuwarwamianqvfiu the
mmmiawaivaaniammwtmmzaak

1. A conprohonsivo history of India - nu mu altunto.


aptor IV. Alauddin X11131. Prof. Bunrnt Pruud BIIOII.
p. 402.
'9' no Dulhi Sultanate. a. Boy. en. 2. ".31-32.
34

amanaa1aau=rraaamwnmam1maa1arawmm'.
wmmwumuzammumm mmmuutaunnio
an arajciumwwmumwvatmmwnw 361:
=n!1I

taatdrvaaanuaatyiawafavruwu

?at-I?aT1iITUtaItasr=rcr_H:rr1Tfi.u1iGI1=
a't11=11a$IrQI?az=I?d?141nad1HIua=!1rI11I11'a&na=i
mqafammmu iaawnrmmmmtgczrwam
d'tfaa=rir Tcaa-'E1ueFa #141 Iawaqa aNwn1'iaT
Ifa-1I?aaau'--Hrv raaarrmmrmn aawarrfewr
afmaiw u'a1a:razwr<a:raTi-"a31trr?
au1.urr|'=st111tH=r=r1a1fwu Ia8crmw3tt-in-13?
U$=l11fUm'3HR1El8:T|'I"4

t?aaI?a'rc+1'IGI'ruizir=Iam1'-rr3tIt 5!
tww it nan:-in
Qn-cn-o--oonaccucucoungnun--out-noccccoo
1. snghuu tho crown prince of Dongle: Ind naked for the had
or Inn: daughter in nu-1:30. but the Vuhola nu. out of
his Injput pride. Ind doellnod it.

2. n. ltlllto. Ch. 2. 3.8. D; o32o


no Coup:-elusive History of India, Vol. V.
1110 Dolht hltnanto. a. 11 Prof. Beau-ad. P1-soul. 11.402.
z-@ra1rrs=r|Eat 1! tfamraa-61-t=h=:-cg-295
4- etc! drq:-I1=rnazs~t,1=rt1mI{-suo, gain; was
341.

9't-a=rn11tsrar!.'u=If'#aI'iarTt'l= tr-1trit=m<3fau11t:ua2zziI
TF1 awwwmammwnqaagvmmil
nI1i=rIu=Ia~'rtra?1%RI

mesa amiwaanitnmaaiwr
ma%I=I1u1%Iuanaarvut;:rrama'tau=1Ta1raararr1JI
Fl?l'I'lFTB'3U=flET|?6Td'GTlT=I351I?lT6!E11U'{'1=I3'EW
qaairhatwaw rm: 1iF'l*-lT1'HR'.TI'-Entt sr
WIna3Ua'3ta1=IaITcn1t'a:~u1I1Evra'rH-?a11T$Irb
=a.qan1vazaa1atIm,artvIa$a1aa1I=:ait' wraiauvli
tircraatraw gaaaaarrmalamtrmn a-1:3?-1
W'4TT$;6117x'=rEl.I1fk'T~T=l*3'l1~au1T1=I'l3!tIFL
fim a'1l=[TaTT1'r211.e";aa:Tvra1a$11tra?fIa?Irr11:ua=rrrIn
mm %In'rTrar=n'4 aaa-' ar.-=1 zstaarwraiz l:vIF'
stfmrn W111 Ir-=11 amrqaaanarvl wwn
vzstfarmWthlrz1RI=+1a1vra'%n arqrazyga :ra:=r
aararnawiu mmmmqrmmwnamamlww
*1T'lEl'I'! awzvaana anam
tamams-nitummmqramvmaaudaiat
i wla-Ia-1a%au3ir:paaa; awmww W
a'$'*':=====::===.-.========::==3::
o|- A Cenprehnelve History of Indie. Delhl Sultanate. Oh. IV.
Aladdin lhelji. Prof. Banned. Pruad sauna, p.419.
t ". . . . but the whole of the reunntte episode of love
between Killer then end Devele Devi. eeele to be a mere poetical
fancy. Delhi Sultanate. cm. 11. 8. by. p.32.
344

*3 cm 21:" ' arhrairqarraaz arvcgrqamc-aw


aarrarr=-'irI1v1'1rrtt9'Fc11Tt1al!'| 3

nrmmcgrzxygat Ua:=IaaI=i[##r t
mmian maaewmin a1%==r=I1za=avrrzar2nu1't2f-I
atnutauyfaqhauwmmiu W731:-1a2:H11-Iiri
2!-'ra=I :Hra1faa"l 31%ru:wa1arraa61=I16Itt[i:&e1rf=II=Ia1fanT
asnaiurf =rraaIu=rra=aata'rtrfaaa1a-I=IIza
a\1aa'rc1'ri|

at-11U?{'F. an e:q=n Ham? Ed a=1tzT=

aIa1a'{e.'I=Iu1ti7aI=;'=rI=In1Pn3I?a3taNI1a'
qa;=rir itrm a'i*r=1rtaIaa1a=Iu1naaa'n~r=rr aaawm I
8 am=trin=rau1&1 trrmwmaa-(33: aa1a'qd1=Ia1am=I1
Chou--0 Q O Q Q ab Q - n u o C O Q 4 O Q Q O o - Q c -QOOc-u
|o lueert thee plundered the rid: pert er ceebag end ebteieed
ee i-eeee beoty. le else eeoured there the hendeeee you;
liede eleve eeeed Item: no wee keen ee Heeerdieeri ee hie
eeeter hee originally beut bin for eee theueeee die.ere"
the Delhi Snltenete. ch. 11. S. by. 3.19.

.2--+%uaitaa1a=za1t1'Iarr1r=Irtr'1Ja1nn1?~na:zrIu'raI GT
fmarut - trm aanmsI=1ai1tfatra-srtnatr-trnf
c;-94-95
34.

naanadmammmzmaammawiu crarlrn 191%


tlmu aaawi|"'
aantamqag
=I1a' fr #mz1IIit=r| amfs
ulqrwanniwtaramaiarmn aa?aat?taI1
113193-?n1riaamq'rmuttanaams'ratauUu'm
aa'<=rI=I~mTa'{tI=IuTra1=rl at. a'cfirn'a1trTaz:Izu1am'.
wmmmmmntawmqmn
antzhrqagiwtvmw *1 na
tkinva-arru1tIfr11=z alcgraantmaifawur
=rrTf?a1a1nzRI?:=IIT-a=ITaTrrIc:.a=IEIs3w}3=afiawI
I9 . . . Kotnr ahod aoro ohovy tooro. brought tho body of hltan
toward: tho and oi tho night out oi tho Siri Palooo and bu-iod
it in his Iaaooloun. ontoido tho Jun looqao. Ihioh had alroady
boon oonotruotod". A conprohonoivo liotory of India. ch. IV.
D. 425.

2--arra afanmmmtmm-mmtunf -cg-uoe


3- Uhilo tho dioclooiono Ioi-o pin; on tho onporor had physically
oollopood and his tonuo had boooao rodoving to illnooo. lo
could not oay a word during tho nootin; owing to no unconsci
ouonooo and Ioaknoaa. . .. Alanddin diod loto at night on
4 January 1316 (6 Shavol 715) - A doaprohonoivo Boitory of India,
Dolhi Saltaaoto. Prof. lanaraai Praoad Saxona.
4, . . . . Rio hoalth tailod. dropoy dovolopod and in January 1316
ho diod'. ho Oxford Hiotory or Indio 9 LA. saith 13.247.
34(

lErI-1'tI1=I'3n

ntumqrmfrr
mrmtmwmmmnmuvwd
lTITIj'rn'F'lT. utc{r<arn~m1a1;=."I=v$qa1 ata=ra=m21a1=I1
am:raa'tan'al amtrtiunaunz IrranI1T-131"

Hui?-11 mt[l'8:FITmrJ?{'=l-1T=lT
aamuwnmmnwaaauauwxaew ammimmn
an&nrEuTu<ft8n1nqirqT&I'3-'t2$raFa=r1=51t{fra1# at
wrrtmruTava1:zrc=r11?nmu=:a#a*'2

lil-F{l'il-TEE!

aawqmatzjraanummawmv
mqrxdmawawmm aiaaaramwtmqr 3
mwammn twin-'|tru'rIa=lIIRIaIl2TI131tra-tta=I 1!
ganfemu mcrrzr aim! tru-1cgrm=ma1=nr1=cmm
Gama! rrram1'crin"
|. " . . . . He imprisoned. blinded. or killed mat of the other
senbers of the Royal. family". he Oxford Eistsry of Indie. p.247.
e. nt of 13111. 'ee Eli. PC2470
3- .... saved by gold snd sentiment they use back. four 01 then
rushed to the epsrhent of Hslik Istu end ale; his Just thirty
five dsys after the dselth of Aladdin". Delhi Su1tsnste'. '1'he
Ihllji Dynasty. 113.40-41. 8. Roy.
34?

aawtmauiamaciraamaw

nmmrammammqzhmrmmnam
rnnzstrfli a1aue1wemat%:ra3<amr1raa1:m:1=I#s1aua
=1=u2qdIa=Ive1:l'ru1a1fcariIaaztt3rra1a=:riIaa1a<t'I=I
dirian a6T11=.aI=Iaa'Ia1=Ifia=iT=tm1a11Tt1T| at
aiTa=rtf,1m=rrdrua1aa1a'e:I=IuT11:u'a-rru1dr2trriitqt
nmru atauwtaiatmamurwmaruirmn zraa
tW$armaaw'{I=Iau=a'mi1m=rrn1haaammm=I
urnllu waawqmafrtmwnvt 31'
Train iii6'|1E1'6'li3TQ'TlFI%ifr1T!T31TFi1?IlT3EI1TfI
mmmmawmwmmmmamawqwm
airman awmmqmmnmmamimwn
m=trutr| atmmmaaatfeanaarufu Wru-Tmattr-7:
anummaaavaantmacnwqanm
w a?lTaEra1=ru[31=I11rr?af*rftqTa11atPrtfruTfC=1IIaI1
wmmmairmahamwrrnmmmnmmaa
&ITndTa-aiIa1uTq'Ttn=Im|iIaaa?r|=1'anTnI1T:raaT=IaT
vatnfu itrw f=ra:=I1'nrayimanrrq=:ur?.a1m

=ne"er Wtnwitimiawat 3
art! Iuaararutrutvxtuiw Us-F|T'Cfle'FElI mamas
aaIa'a3n1iaEn1I?qam'rfmuara|;r:11=I&q1Ftu1'5atIa=I
-II
342

=i1i.a=IraImHaTT'7?a1%I atmadamauw
crarnWttu1faa1I 91m1|

a=EI1afrdr11=11.nT2Ilr1;a,zz=lTIas'I ah
wntdramqufiu timmwmwanmaaawma
dTfBuI1=I2u11?.1%-=I#7tuna1a%1t3a'aaa=1'<aa=I1
&fav:rtaa1u'q7.'1=I-arm wagvmaurdxqraarmawa
dTImaT1m=I1f6u=9I?u1u1%|8t%a-=Iaaw<:1=Ia1ts=Iaa14t k
utatfa -H '3tenq=rrana'|IrIaf| uarrlafarr mttrrau
irF=raru'iTTr6?t"a-'qtI=7r,cmtrit=r111=Tr'-a~?fr\II
6a1a1<:TaaH1iI

aaam :-mawrmhrruwmmrmammaww
E1? #4r=11am3-wrraaera-aanuwnaraunnx mm
m=rrui$r3;aar'fiH%zst1vIf':12ttt:rIf14uaa1u1cI3. a'r1Erm1
nqammvwawamw dwafmfur
Qu-QQouCooQQC ~ - . O . Q Q O o=1a1i1a1i'rm'in"
- Q - Q - Q Q - Q Or
|e Ala-ad-din: unhappy relatione vtth his wife. the daughter of
rua. aleo prompted his ta undertake a profitable. though
perilous. undertaking with a new to taming her he was a
veritable ahrev - the Delhi Sultanate The Khalil Dynasty,
p.15.
2. The Delhi. Sultanate. Ch. II. 8. lay, pp.31-32.
3- Hfc ttqiz-urcnita-{H11 aw--Q 59
4- Ella! it qffa - qmI- =[- (U)
345

wuaaaatafqzumqrmaratm ft
:3 I1TT-T![5G|1-I3 WW1?-l?1T'31II3El!1' a-mt RT
u1Eraa1&a1i1n1t=m141uiratware7r-3,:ramuun1aua
maatnnmmuwwauiatiu nirawmqrva
ummmmwammnwmammmrammi
aanatawniumfmfaamia 332511?
r1.ta='.ra1 qammtmqrawnaawu
aanraamaamammvaaqwmawniztgu
11=1 1=da=1aT:t=(can=YqIcau1 8=nunitaam=IaErrII=1 S
ammvdanawm aimmwmvu
m mt1ra1?rIarMFr=rh truzraranil

=x=x=x=x=x=x=x==x=x=

crrmr
mam mrrafsityawwrvuaw
'a=n=Iraa:'a=1zsra1sa~"rm:I1Tt?-ra1zrn=ata:a1mzwiu

t=#rra~1srrt1i1w?ra=1

qmnmqaarmravmwnuitnkn
Trf EF|'T|-'[fLII?t6l!1'TiI'I3I ataqcgantmaumwrcat
imatmtaamtmmaumemu tlrararsrr wait
ta11anrtmar=trarraa=a1 a1{mHsI'1ra=rara=s-11%
nmammmwrmmmmhwmammintm
35

tmmaamiammqqamtwrmawa
-rr-1a=m '1fam11a-uI{Iaau=:ri1,zgi1Tra~1a'a1u=1it=rrzas
mwamiu Ermvamatimairmmm
rmwaardeammnnrd arq=I=1uv:rrtrT=rf,
atsmr dT~im1n'HRa?tau:reau1#n I-TI1'ra1 a 111
aTa=i"aItI-11nns1RtaH=ma1%I

n1rr4'r9'3tr 1Trf'I3TEPlI'4I'l'3"IQE|'-'l
urrvwhitaanmmrmaatarahtwm -mam
tf=I at:I1='I=1'ti%wrI3u

Iruaiaaxlazarawa

Rawrawumqamrmawatmm
nlaiaairuqmmammammianmmmawa
=mTrPnH&!a1tIII1?IR1I|=I1zcr$cI'Tv;tz1 Iw-I??a'aIlT:m=r
t;a'rawrerIa~'taIafI1win%Ia1afa:a1awra; q:1ta1~1=Ia11a1uat
rarqwin ata1a1mtRa11rr%f:a-ewwmTa1nawm
dhirrrrntrar-11'cTr?IWrwEu1=I5r\1=lTaTa=I1ar$IEa~aTr?
una13twT'amataa1u1if5=1rtaterIiI=ra1w=s6ua=sr
auxin 1=rren?au1faa1*er1Ia?fatrf%mis

n-rsqatuunmtuua-<1-use
2-mqamtrm-azuqrrraxmiurra-cg-41>-4:4
3-it awqamunmtuu-up :57
35

'=l|'?INFI=I!fiFllFl'@i11l'H=I3f3I1iE11

Hmrpitaauzaqaqamzmmaatma qnr
gataiwtummaiaawuuqrammiuta
mtqa aatmu qrmmraimmvaamrfaaarr
mrwwawraqummamaamadamamawnfiu

nufalra-Iafilwita
uirmtaaufitattumrvasadtnfitz
I1maa=;mTw1nu1iu'aau1i#rauzn=:Tea1aarmt5
a1=I1atn1=3aIaItdTnta=r=awa-1#azu=I1=I1=r1TarrcI1nat:ar
arwndrfHaTa&!I&a'ul=I3aiIP#w#aIdTaI1zm
Wmmait wit. almt Iauawit. trail iafft,
tw crmrc. am? *1 3a'l'n=IIar 133313: am
Iylaaamvanmfamtaraa iin mazau
Iruiaaaitmmfsarauiiaraqaaalzwrafiw-Ina?
PTITI2 Iaaufdtmtlnaaiaamaam-rutfuawt
i|'3I1=11TmI3qIII atnaumarrwfnmr a1=n r
TR-11'rHm==Ia3I

waaqufdusmvmamwmw

2- --"-- -1- :55


3- ---"--- -1151
4- ---"---- -cg-:57
aamiwtntrramar-mafaanadawar aznaar
i|qarTI~'na1f'rfl1'IiT Haimiamdu P'<':-'iI"'|E|TWT
wwmnwttvaa mum: uI'1'naTiam'r
amTa'rT!'te1r.:rsrenT=11u'3a'c?r3;I'anra11I7tu Uaarrawr
I3I1!taTI;a'nGI=1UHfsH1=ra=ar1cIaTII?RnIu'&f1i'I6 3
tramraa-aenrmnatiu '

t=fn'r&z;aTraaa'3uu12 Ipvmvrnv Q
mwuwwammuummigamaamwammt
arTT==mrmt#a'a3u11~aFn1ui%R1II1%a=IaI=IfrrTr3ufGIrI=i
8l'Efl~1lT'3R'|'-'I1'JTl aanmwntcmaa um
Iurmmmuwaarauzuwuarawrraaravmwiis tram
taamaaumtat a1am'3ra1a-1n1=fanIr=Ia=Tr.--
ganfnran-maraatnazvrrzvtmmwaatmuz

l'1f'l'll-FEET!

uIaaaru'4'rt;ata=rert3=1aarc6IrEnera1=1t'r
8utaI1aatiuw$1Tvur|ar;auFu1urawn1=Ia'1'arsH:=r
war. mtavlaarctwtavau-tn11=Imm -'-rmamgar a
mmrasnaawm at='f1:iI@f%II1ftIu-iu=I&riaa
0 Q O C Q Q n . Q - C - O o Q Oicoocbcononuu--ouch
I-rlaziatwuartiuu-q~I52-953
2- am - 1- I57
3- air -I- I59-I60
wmaitatmrmiaawnlatarlauawgatwnatgarrmn
truaa :marIsIarrt3nairr3TIaaa112xru'

tqvrdriraaitnaararrtukaawwz-a
it zsrrra-112m1trrn=11iu Wsrdnql qamir arm
Iawatzfranmwraruarrauaawiu

m'r="1'r3a1s1'pz:=IWarl1=fftaaII-ttazx
fliu1na=Iar:mal=I=ni1 i!'fFI'l?1T'li't'.!II?fF!1iIJTfl'I'T
ararnc ararsmtwratanmsmn Iamr
tdmawwamnmamaarazv
a1= aaum armn 3mqatrr:=urEt=nraar
ufraatamuwnzrrin rrtatufrcf-'-1ifat1u1atrIaiaat
utra1dta'1r13aa~1=rtaTr-rriu tmrtmuartutlariri
affT={:1?1aTnrr#3I??EIEIWU'61?1TI=rIa?a:r11&?I=rIE
aiuaiaataiaatmarvarawswvaawnsmr awn
a1=I1aT!?ni|tIR1iHartIiIT8aI1a9qza=rIa1?ad~TurF
auaiTmrmnaa=rmmu1raaw2:%unmzm=umm
taimtmmh
mwmarrermcmanarmmaaam
$Ooo-CoCoQo--Q-n--Cco-ocOOC-c-coco.
|- E13 W IWIFI aw 11r11m- '3[|59-I60
2- air -q;-uso
-3 am --EIGO
trmnmia ma. wrraraanaarawsrmugm-nmvaao
ma. T'-'I'l'U''=|E?5-'li'f"l'. iunvdaaavjriadeuanua
Itrsrtaafaavwiu

wzumzwwta awruuwata F3
afiaivrwi ataitrmuuyfa smnzzH1v:u'arI'uwra
main ii RIE'6I1!|'*fT a1iIa=rI1 an"

UIHIHTW

=na' arerramatmawrnma-aria rm-s-ra=mr


uwnaaernwaar a1tTI%I6n=+=rI=?ea:1a1TaTr1n
mavmia-ra8aua1a1w2<amu1=:tqa=a11%ramH:res1az?:ua1%11it
admaaiwmm, fuidrarfrga-tartrr Q
arrrailtamftnma
:x=x=xax=x=X=x:x=x=x=x=

fw
H'Q'=TlE"!T~3I'lllT=l311'Q3i=1'K3@i?r&1it-I?FWE=|T~'=li

nwmriu Wm ua:TPafa'Taq=I&vJ1II=I
wma&a:Wl tm tntatvnin

I-1'Q=r313111RIui=IIEa1 1? tfa'emaa-T4-raw-={-293
2-31:17-crtmdtr-amgm-t{-25
355

rrcrmtqnnaram
awamm wwwnqnnamaw
Tmmmfawuavarfavmmmurwianfmu 9-trim
iaaaaa1T3u=1'r=r!l maammmmam mi
'6-lI?lE'BIT attamqzwzm Izmnh qnnmswqam
maummmaarnaemn a!.'1d'rfia1&rtaIra1$na
Iaarataf~=aaa1=1a1a1=31Ha1afavu1u"'

a-nznqa;
azrarau-umarzsrvmrasnatwaqwmmd
a-r-11 maven: wamaraainmmtammmamv
aurtarrtm-IH1*mumzvu11ama11%zan,uwmt
m1=I1d1a=rT?JIn"2GI=1&t qmuaanammm
8uaFIh?I1I?u!uIl1wa='I8dTan='!1at=irr{<{ an
arrt=Ia=Irr:'| qwia I3 UFI!'lGTT67HE13161PI'1'\' tn
a1I?mIa3?WTzran=1Tain=11imq'ranaaiTirIat 3
arm crrqsuta-nenartu wmmqqamuammua
at-"1?ar3aIE:mtt?4emaua:n:1e'Ia1=Iu19tarrraa1Tu1
mauantananaanulinatrmfrfanaatamaurmwnm
ah'a'aarwrRII'tmm Intrnaadtrawnnatmwnn
awarmmaw anus: mar mrw mat
I-Tmirr-Iawtitm-2'5-c;-use
2- air "-[l66
35

=Ia11mI"

qnaa1a-=f:~ra1%au'4rqtaa Pa-Um
uT11II1n1i1ta-1a'ra1(a1a:t)m1-3| tafuncrtaztdrmqan
imawmuatrawvawmmqanmml

I-IITTFWTI--'l'=I'n~I1a'l vdqrana as-at

qmnaamaawdmanmnvwm
ua8uta1adnm11,qE!I11aama1au=I?iI=tY aa?I'tTm
F3l'l'G'-'-l|?l"'l?|' aamu atacaw d-'tsrra$wTIm=Ia
8-t awnzaqaaramauwrariu qmmmm
Wu? Tucaruma-1:arrira=I=II=1iT armiu zwrarm at
mmwqmiaamfnmqammmain mawurm
a-T-'-IdTtl'ri"cI'lF?f u'F!1TtIT=f'rBI=1T?=ITE'IF1'T\i1'\l.F5|T|_W
ramtmmmwqihawmawmaimaa
mm: 81%--'inr=If$dr awmqaiai Ta-Iatrfit
lrraaa-1c1rt=n1a1%Ia=crI5Hat1tr9t=ra11=T:c[aatrn1I1=I
=n=namo rrarmrznmtat mqqrrmdhfrzgzrnacn:
mwfawraiavwaivn mumaaazwfaaamm
rrurmnmnaaqzatanrnmzaumqwatammaqrtia
awmdummuwqmu aaarra1snm'famrn gawk
marrqawtiqurrmnavavaradidrm n-a

I-rraqatmunmtutm-r{-I59
357

rrn':e%rana1m IHiI'EHa'IEftaTtrl'l'33I?
nmvqtrmnguwmmmaarmmil dnmfdt
wtqanaqvwarmwtardaarwtn F-ratmarn
nnntcmmravamaaumucmwtm
qmnaawaima a-ti!-7wTm qmnaatrm
'TE{_2TFF|ilG|Wlf3liI!ITIT!13l1i'HaGlP3i=lPlT1Tf
qTaiT''-'tI1:Tl1IE.3TFl1l1'H=Il-T911-n'T=lIUH3?1Td=l
mwmmwmw'
mtmwiflvmgwr an
emf. ummzaqa-mrftraitnqukuaqam aaarr
armr. -1=rwz=naT mamnaqwmwwatmm
rItrervI1iI2

tauatwamtmnfazaa z
a'iTt1raaaa=Itfemina1<s'a1=I=Ir1Ia1%Ia1UIHIm3a'a
a=ra1'=11rrI1%u -aufhatat areraemiarwm
1? ttaIu3?Itmr:ra11fIarfr1u"

ifauiqilitmuftw

no tf11%fr=I - c[- 43-66

3- an q-no
-2- ms qa mum 1tIm- I;-no-nu
358

=rI1 armiu atmazrirsmi-"a;1=raa1zI?rHa'iniT


eamuvawamvummtgamwqamwm
main-IT-a1iu"'Er61f5\T=|1'fTl?I!;|I=IRTv%1'i7"H
at. mwmmwtrmnammwwammww
at-n=n. mI3ra1=I"irtu1?I1u1=I11!sa1a1aa1aqa1=It
aammiaraagrrmnhnaaaamqarmnmqmam,
Tltiqrrrrazmam. mnmuamrrmawrrmmm.
Iawztirarmammaqmmgnrrmwmm .
n=anrTt;:drtu=ita1au61=t&1aaaarrra-Tq=1rnfna?Hm'r
wamenamvktmliln W91:-1'rma'ra1=rtwtra|ut
crnanmqvfuaatrwin 2

mtnmmnamqzmmuwanwa
qamwahwarmtmrsaaam 2=n. qua
mtwmawwqmmavwn t:t=1 -mm!
IFlTEIEl1=I!1P3lZ a?t'-1frva<a1tn'z;cu%=n, Trainer 8
ymaauw =1tqc:1rzrc$1?~Iv1'=Ia ::uma=I1.:r
ariavdtuluurwnuamraaran qzmmwmqmm
u1u1T=rtr-"n. vmmmmmwsakamawww
tm:t3a'-3at'rtr'mvrI'i|"3

I-fem-uiatata-amafrgza-cg-59
-2-ET6'T'TT|Ti'FfEv"ll1?|'l'EI-if I72
3- am 1- I73
359

dnmmtaw frmsawaaraaatrrta
rs1a-=1mItt.arauru1a'rqvfa'1=ItarIa1u1ut1::1n1ata=r
qartre mnamaurwt msrm afwfaun 111m3:118a
rrrma? uavfnmapaaraaaqaia snv awn:-iravnzil
%arri3urzu1zIwsrt1*I=u;1f'III@1%I11fIu%|'

p1'1lTI~:I$fqq:

qId1Tra3a1=fftr!T=Itt1=1UitI%Iw?tsT
Iaq,an=IrTrIarmn mwmawmmamsannin 2

=yd1TIrqg8ar:qra=i=Ia1n1aa&aa
aamamasnawmrawanfnr. mam!
fGI'l'fir-11!!!!-T*?rq,'lTzltI'-IIFTFTIIWINI. aaammnummt
a-1uwrI!=I1. q'ranaaTIm=I1taraaa1T zarrr-11, mnmtm
nmagaanaatawfaangaairttttrra
_q1=maa1Tm1a~ta=tI=II. eI'aaTeT gwr
afrrtrnmrii IlGtT=l1=3I|1'rWa=rI*.='?'ra!1ftw'3I

Q u - u - u . u D Q Q - Q u - o Q o - o Q . - Q Q Q - Q G0

[a Korean Ito undo History. Y.l. lnlknrni. p.3.

3~E13 'TT3H UH THIN


Enron: the nude History. 1.3. xn1knrn1. p.3.
360

W? 91%|"?
3x=x=x:x:X=X=X=X=X=

awmwawatmmu WW1
durum: ammmaaamamnwnetnmamnria
a'rrau;atI1'3auT mdnanmnwwrain

utmatrramu
arraitsrrht unrrcrrnntlimarh-e7r
atutnmaamanammvudadrraiavzamn
qqatanrqyragviuil =r6TrPITt1!II'=I<=ITl'I1'i11Im=I1'-T
4Tcrn=aut!Tw;iatf%ntra1mri|' I-'IRI'uT1=I!TI'Pa'|TF
mnagvatmzmavarmmgsanarqiw
a'1=I1=1tt1%n11<r$aaa1Ti=rI%r:araa:1%u1m1'unah?
tuumwqznuiamfeammmans am
aaw=m'aaTTaa1a1uTzsHru2rir=Iv1fau1a<r=naiumuT
&m1311'1I6|TTV?3U=I?rEi?I=rI!TuTIa?I|1\'#fHI1ftaE
aariaI3It=Izat't<amita1zrM.TI"d!:1n1i1?
wmmmaummwmawnmmwmmw
Hawaii! _ _ _ _ _ _ _ _ _ _ _ _ __
|- L coup:-eheneue mete:-y of tune. Vol V. cm. 10. p.800
by GJ. Sana.
ITS Q?! T UT 'l"|7'l'I'IH - 0.7- I75
2- art r-it: - um I - q- 354
3- am amm=mrra- amnafI.'1t~rIa =mamaa- q-Ia-:9. dim I-'1-I965
4- a1In=Im1- 1ITFaT- FIE? P599397
RTE! 515'? "'lTT - WWW? - I-2!
5. Hour and llughal Emperors. Gel. Sauna. 193.25-26.
ho Oxford intory of India. Vincent A. Smith. p.321.
361

mrmnmtsumwal-'-tmnahmm
awnamsttamrmmmw WI. tatfraxm
wwtmafudrawrdmmqralvaaiwmwnaaa
mtmwlwawramumwwmmvdgeaw ut
u<wi1a1mr1%rm8maua1atuz=rE'is'

mama 1101113711 ratim


uraT=l-Ttrntizxvtialard-13;a::a%ra-1tI=rI:-Iruruztstautvt
ttrmaaaawrliu 2
maraum
maarsvmmamnawama as
Iewrurarg-rntrnmzsanwmrwiswriamwu
tmuz ;1==rdTu i aarmmwmwaama
mrmmmmmidamsaawi aaarr
t-M1 aktmmmmtrnfu tmtfmmtrwtlz-=I1
crmain
|Z13TTHC1HTTN1'H-tI79
-2- Ion: and llughtl hpororo. G.l. an-no. pp.25-26.
3. India oinoo I526. VJ). lohodon. Bovonth Edition. p.9.
Eorou who made history. 7.1). Kulhnt. Sooond Edition. 1965,
oo
conbridu History of India. Vol IV, Ch. I. p.17. by
sir Donioon Ron.

aIa1=Im1- "tr|=a'r- umsnrra1-r- c;-395-391


362

UHaTI{W

uHa12;<!Ra rrurwnrmltuuara
magvnn1m=uas1furaan=zr11%rrmaaaazrtrmnnmin'
mnaafhuwnarnxmrmmtumamvdwn
mmiwmmrtamtmilz
mwwwmmmnmnma
awn. eraq;i'a=I1. miwmwtamarv us
rrtnwumdrrnzutw. zrtg=m'utwa ?*TF'liElT-II, cm
il'=lII7JW'3l'H3l1F|TTlCI5%l'1'3tll?l?iTIrl'Ii'r3t|!1f
qrisu-rua.=a Jamaruazatuwrraunau it
mnwwranmmmganmrmt. tra,&:-nt
mawaumaaantfazaufaai :mrrna1a1aa1
Irrnant -&*~'II1r=ra=rIE't1%m1t:a.1'ra1r=rI=vr3o3

tmrmrumwitqqw. an-afa=nBa
Ira-=rI? aenu aatza: qztwmmmauma it
mqqwdwiw iwnainnawumtqu
|Z'|3'?[Tl5R11'=lTT|'1'H-'{ I79
v2- llour an lucid. hpororu. OJ. Sharla. p.37.
30 R150 and 2:11 of lugul. Elptro. RJ. fripnlyg 13.43.

rsqrumtmum-I:-:79
wrmmmtmr-aamqqln-1-so
COIDrOhOll1VO But." of Ila. '1o '9 Ch. '0' poem.
o'o mrno
363

uu-m1wH<aiI'

=ne*a: ma:1=IaIrz-11311 mmmiurm


##=n11im:au:l ammmmm itwsnwm i
mtsar mwaavswwn

1I'!1R8aITT!=r!1TPI'Il3r!Ir=!1l'trI1aT6-t
1?<ir361=rII=urruTa1i*=nzrr9u31%w1'=I1!1a"a1!=zI:fas=I
Mwmmmiu tainmmamzdwaan
H81 iEI1l?W3'l! a=aa1i11rarRI1!FHrHFT-I!T=IT."t it
an-fraa1=niIT}atmrren"l awrmtanaw artma
guvmarmzaraaiavaatmawaiammmiu
an mwramwcmiamaaamumumaramwmwam
wgqtr =I1'Twin

Tl! UNI?
IXuX=X:X:x=x:x=xa

Wtca I3s1aa;I1z=I12Ia?TaztIqr 3
mhhmmmmqmmcmamimnmmwmm
Frafiu

" The Coup:-ohonatn History of India. Ch. 10. SJ. arla, p.802.
E13" QT! T|'GWlT"-I 3-T ?I'6'|'FI - Q I79

Po.
I130 and P311 of llughal 511130. 3.1. 1':-ipntht. 3211 Edition,
364

asra-c?t=$1:n1=iar1IIra=rt:

uwmammunumawmr
mfdml Transit manxutaa-mn$aea1%w?raa:rr:=1r:s=f
atunrtlairramraumurfatrin uIqaa'r=Ia-mu
crT'srra2x-1i:-n1={mtI'nz=ItmIatFvazIaT'c1ri|arf
aecmsnizta-tnrthI=11ttmmanz=I1iszruwa=n
=I'tazstII$%1H=:?n c16',aI1ma'f'raI4IarEa2,a1'r-dT
fiI'l5T3.6td'BFll!1<i=l.a1R11T-I31l1Fr'tTTHZIT!Fl
trawmmu aaraaamwmazfwna IF|=f1l'?f=Il'Fl
Iaati,arIf1'aw16T#nrrIuaIiTa=rraLauna19na1a=aa1taa
vim-wmuwtu

at-auazfa-arwrnn1z{a71ma#
wwwanavtmwwmiu Him In
#4t&anTzru1rIa1rI=Its'rcraTt:arantrI?=maiu=Ir'rrnt
zrqqaf, :ru21'aa#m11I=H=m iannnammmu
11313:

arhmrmmanwmttnvqmm

I-E|'t">?["IT|'~3IlI|=l3v'!T1(-rI1'El-l83
2-t3rIatrrei1=mrt*c1-al11ar:'ta'ra=1Ia1It-=ru-g- 55
3. u and 1111 of lnuul. lnptro. LP. fripatlu, p.72.
4- India 311100 1526. VJ. Kahuna. pp.21-22.
5-t?fa11Fazs=rre'uT ii tr<nmaa- a1-u=1a2z-t{- 309
365

u=ra18few1%Ia'1tanurm=r.I'am-r11z1aa=r
naki: Wwwwamvmmmmmm
icrrinarInfrafIirIaI*a1azr.'1aIu16Ta'h'=rtsa=I2zlt nu
imxnnrmmmur aTau-1tIrI=Itr'n.=|1#1v'=
I!-'t6T6mF|T!E'I13=-t1l'3 'tdI"lIi11IITII=|1'!{3l|'l1
rttntuhvzs-rgmn3ava=;<waTaan=:a=Ia1arIan-1an=o1
aIII'l'lT'EI1=\llII11!tl13%I!r1T[$IPlIiI{c'II1fI

4f!=l11I$t\{I a1fim=rIarca1'3u=I1z*:
Ramnmiynxqmnaaareutaagr
aammmarmatmstmuataarnnmuwr
tma11lrTu'r&au=1ruBGIa6rairt1aH1?a\Tu:i!tt
a"ts&f-iuzuiat. wmnraamamnmn agaamm
rrqT4r=wc{au=7tau=Ia1aa1=Ia3u uia 2711
111', mwavltrndrmmf aqalmmn

anarmaarrwatruvaumwraa
mmzmiu 3
are! vauwmwtaarwqqw it
rrrrrwuahnd-T$t11=1Taa1rraTI'raw1 tram! 8arn=I1=Ia-1

I-11'l?Frx4FI|lTFl-~3\'Rfl?3f'TIEl331\-l[-55-56
2. India uineo 1526, 7.1). lnhngu, ".2142,
3-asqamummmt-q-I62
366

tnaavipf wrmraagmuaarr ttatma=ca%I '

umlastrlaanvtrazantluniuaeat
wmamwiuamvmin 1ETIa3HFfrliT'lf~3
mmmuwmnmmamwmmmaa
1! aFa1u1a1erira11'$t6rIP11r.1?nFnarIts:&w%arr=I
at aIrT2Iu:it=I1IiHi=f3=rt=1rrT=r$:ra18ar-amt! wm
m'a,uuau17Iin3IiI11mamu%a1aa1iItaI17{mrI=1
F?fqT6rW1tI~11T!JTIli=liiTa%H!itrUlGIfiI8Tl'H!
G'F!I$T(Fl'i'|i3Tl'!1l'|P'Gl1T|1'l'IfII11fiHu'T?lITIIl 2
mwmwagafmmaamqmamfrqrrnmaum
8=13niI-Ia1:#I'atn'azriI
nlzmwaqnmdnaimmmvamunm
2=1F$fI=afI arm-=:'f|' a't,=1'n'aI=ar-ft znuwam it
aearararunmaakmmv, I-"Ffl=6TEl=lv.'-I=Il=IU7~?l'Fl
maatatfw. awasril # aitmwa
m-traniwlw-rrlaituuztrin
UHTIW

aa1az;na=rhna1ta11%maut1azmH
IT-taa:rt=-r uni! avnadrnnmdrairdacttm
R - - - - - - - - - - - - - - - - - - - . - - - - - . - . . - - . . . . . -
u-zwaqanaunmtmw-q;-nez
gmqamtm-maa-um:-=5 224
3-atwwaantaansntzl-Ihrfrwaw-q;-7|
367

mtam mqamtin rrertrnmmtivastn ll


arEtJ1'HI*1I'6Hf3HlI13ITt1TI!IIl=IT\1ra'=1TiIIrIEI=I
'n3a1I'cmfi4tRI'~'72mdu :ra:=IIlaTI1'ra1s8mn1a1
251313-aT=I=1a TETQT i. u"Nh|'l1'Fl1=I%'l'I!'-!lG!8~2iFJ12I
81!-rI'lIlH=T'!11'|3T?iTfl'I!f&?rlfFI!ET'aI'3I

I=x=x=x=x=x=xxxx:x=x

GUT WW

m-nevi 'lI1T3=rT!T1=rrIT3I11f9l'
mhaaaqaammtmmwsmm. uammrafrr
mtvu a1aaaa11\a:m1=1T'h

iItrt1B!f-IIl-TGI'-'I:

dtlqriunamwaqta Trim! it
tatnaramtamfaaa-afatuianman
mwmmmmmh'
'G"l'6'l"lFT3ll7i11{!I:

mmwmmmmum
mm: =uvrawana1vu=rrufaatrcrnr1aur#ranaa1n1ai:
amituirn maafwia ITI'n'=Imd~'riaIr1'dPI=I1I'r

I-El1FlTl35l21-l1iI'|'H-C[o 379
368

ttmarvrfn mamaraaaavrtmmmamuadh
arIv?arrazrra1aI 311:1: am uaaurrmam
i,taIFam=11in1%=amaa1a1=Ra't31tttaa=I19uilu1i,
aazwatmiu e'|=afrtiaTIIaItI'Rt6crTa31iI await
aau a=I1rfI=?-'1t'zFr@=I1ea1u'!i11I=It1-'I:'t=i1 aw
3aI'tatv: 3tnaaaTaa161a1I aaa raamaxanma
11:1: '

aarnadtmin
aI=n'1r.WI11T6't=I11"-'l a11'&rt'frnaI1=n=
fatrrarr maI2=1 aaumamn mwima
mmamfh arrarr 113-T3"3Il'E~311lTdTi
aamttlm EI'E't' cIu1!?=I11fr'11| -atu11"1rIrImrE
iim='1$Ive1<an'tfHa|1=r:r=Ia1T I173 Hatnaqagam
i1lE!I'3tI1IGI1=IT?:'lI!FIII rcjHl'=!i1Tl3aT=i'|'!1l'l'3trlH
q'a=rra.i.=I1a'ti?rrq1aa'aa=maraarrcz1118%rraaa
1='Il1?T1?FGl'T=ll'l'l~3'4?J1'-i1lI' mrrfdrzrtf err:
atrrfrrmnarir crga. awrrmwtmfkuanwtwnanard
wmanwwammwmmn traatrtfatai
1larrn'uarI"rz1taa'atra'-=r8a=Ia1z=1 atnannfutiaifr
mmamtmaammnuarrairnnawaawa
mqmaqmwscamn utmarrammwwernml
369

aI1Ttfc&a1'na'Itfr6I1Pa=! nrwsiwml
aiqcwrunmwalwmaawmfsmmamu
=It~'.!I1'r1=Ir'ln=mazr atI16Ta'l1-.a'?a1=.Tft<'tftan1
qatnmawrn'avaaw1na1amam3aIftsaav1TT
{ms at 6l39lI'-?i6l13?1IIErta'HTfGI1i3l$T3Trli3
iil taa1aTaaartI%1taFcTa'aa[amIalHu1uT
a=nr11Tc=rraaa1Ta=tan'aT1?a1n' '

ummwnavaqauwwnmammt
cmaazamamrmmn wawmmdmmanma
mranmmu mmairqiaiawmwrnan davam qi
TEITI mwmmtrmmu tr-I'P!rrI'araa-taz>1aI.
mamvammamn urmaarswamuaa I
a=i awatliaaaawrmtuuammiazn-wdanntwdtatvrtnn
61113 aN=u'rq=Ii:'I13'11aaaarn'tfIw'1Ienn=1r=maurura31tIT
wwnaffrmmzrrwmmmwru

uq=I'r$#qax Tmqaatmiiwmwt
m=II.tnIawrzra1121a111=rtzsraqunttan1wIran1=1v,
13'I~aTlTGItL?II13lr~'a'e\Y'l'?.1'{1l'l=l!. rI=rra1ufa8muqat
H1511-II. mwtmaaamuwilz

l-'EB?[HTFlIT'I'!'R'-I-|i[- 331
2- am {-332
370

tnaTarrn1atTr6h'.awIrTm. cm
in-Tr. aamilt, aairafr. uwamf, wravtar. airhaamfr
Pmftlacrtaiu

ataamnfummwarwm
mmaamaamkrnaamimuntmmmmamwu
mama uaadamawmwvdmmaaannmw
wmmin mmmmmammmmmm
191151,: amwundzzt hi: vaazxtsu
.qamm1mTr8aazna-qzmmwftaaraarima
rnmntvatmaxaiulta wrraamzrr am
:63. a"tT3 U=ra?r iwm uarrrstm it
,,qeTrIa=a'1n(eItaI1rE.Trwn8att1a"5*1=If mamraraat
M =m*i1 wmnmiummwam qaruau
uarmaamatammnmwm II-Tan warn
antIEIEiIEH =I'Ii1 $33!: altt gin G13
8Iat=25a_a=1#3_WmuT116'haY<wIaI'1 nrurar
taa-Ianiuaria aatrI111=trra'sr&nt=II7'l'$t
aammmmmmminmwaamm
:1-c1Ti:a*sau'3lw1'az1TasT11=ir{#:raq=II;aaTTm1l1t1ti-I
nqftarmdrrwmin wwwwawmmm
1ta1'reT11=ir1wa1!f=Irma1uIEIiIia-innitatiu tanqeran
H11-W33, fhvutagaaatwaiiu i~:F=I11=frWl'e1'M=I
=r uatl
371

=IIa1s-twin ahs Wmmtm


munmawfearuriu raaaau Orr:-cram?--an-r
t[a1smqa'1zznna:aur:11?'=n1taa1an1wu=z=ra"t.1'5-a
mmimntrmmaarwtd its -- ti :r=I
Izun-rra ahmu adaiaa lsH1a1f!Fl"iFl3GT1VI
IIIHSIHI-'?rau%a7ra=IamaTis"'

aanrmttteraaa uranuaarnxauza
i i'1'=|!l1Vf?JIT'6I1=!'l'1"l1l"ll511"?lII'l'W1illT Ta1'rqi-n-it
qa'a=nmI'naTr' I Umsriu. Tmm. =lIF3!I6ITf'
lwittmirtdf atntmirsafmwawmavdwf
ii1t111'1l|=1la*a'd-rqin'1 I1't#=IrciIt5ic'atrRI=ra1 11-I
m=rta:=a=cml mmravraawuamufaum a urra
wmri-'twv'e'i&(=I1*a1()*!ta1a=I=si. FIF|'E
Pimaanmarmwaahn ~=.T'=1ta'(U=ImmfIfans
mnamin mwnaimwawaiumma
GrI=Icre.n Iimmwwmmnmmmamtmw
=rraa-mt, a=e=I't1ta1a='!Isrsu'at=I1a:1 utv&n=mc*-1an1a1
Ina? u-tad! lm. f-r=1r=I}cdw a1-tavawutammt. -Jll=rl1l'
mmiiw animrmmhamw
mam tvgruurammgqwnatiu mmaan
mimamamcmmfwmlmwammw
qzittarrail TGIIE-|I3I!1l3'=l!I13Fl32df$l?'l
372

hen-uratausga n uaafmfaaataanwnr
'mItrr8afaaaaaa=am13rrf'=1wa1qWwz=n
Gunansavfttdn TI?uIFR3=1Q'?I-T'i?lTl?l=Tf~5fIl cm
unatrauaatmai mtu uas atstu
=ha$'n=rEi1 a-Itl111trIi'nI{!=IE=I1aIlaTu1l qiaaaw
wmmmaamiu anmwmmwratmuwrrm
aa1arrzwa=ra=r tmmman -- =am1 -Itmanmarr
mauawwmmlatwwaangsaznwnfariu *3faz1ftws
=rrai1 1! aaaammua @ma"t =ru'1 mm.-am
mwmmmvaimmaam a-'1:n1n=1il muau
a=Ia-1wm1%enm=I=1a'l1| ammtmhm as
1au1t3?ru::a:%awaaua1ri*u<9rarntmrnzr:itasan1rtaw
qwgaanaelwnaiwaaqiawt Smtau b=aa=ma1=I
matfarfltsauvga-t=rI!1' an Wm-1r3d1t Ha
u'aa=IaaIaatiitlrE!raTn=rfaaa~ra% surwlfzsvuait
ua1t:az11IIi1t!atIiakn'trTn1Ir1taratmt-Ia'l=1 31
anwan-at: aaaetmfrnuaazaai mmaiiraa
a1f*n'H1iI'

?l'l?flTIl

atwmrrt imaaatmwil
la2s15I'tar'fr=IvhT8a?ta-vaaIetz4ttraqT-varn#n-tafav
373

qtaz. mush aqsainrratquiaaiu mqa sut


zfv:-mmiwaaarw a-1u1qa1anla-1'rz=dav{retI'fwe;a
arm
xsxaxx=xzx=x:xzx

watt?!
aah Fa;-gmuwznmsqmmtmrc
amnfh aihlaaawmzvddvaawamutrfqq an
arF\%|

mww 1? :FrnfIIaTT3fwz1qva?r9'rh1:
mumwwusin Umnrmun
a1Tu1a-'ru=n'II!7rra%?=I13aTaacrsa1iaa1TrIrIaa?T1a11?
Iaar'~:1iIIIarr3| Tvtl=I6I1't1-3iH'rc&7It''119i<?tI*3<i1i-Tr? Iii

11Ti1ITTT?nU1T,i|'k?rm1~l""TUFIFi3T61trT1T3HPliI
avrrarfnaI3IIrm1=I:a1fl={a1 aw at-t1'fa=11a1r3
i ?TG?ldrFFUlI=iTTtT3ITFIB'l1T3I1=q'+Jf=c'I9ie11F
1'wamnTiI'

:raaTrfiamq{wtFttnarswz:

!rra=ri1TraGI!z311raIlT:=rR5:ca-'3
mmltairaa. 15'urP3ua1arai#r=It3, Fm =1
|. litter: of ahiahu of nun. Inn-at P1-and suns. 99.324. 321.
1't1la'fE-a-I=1-q- I06
3'74

qqwai, as-a=i mwznramawu at


wmmaatwhmuzinni. tnrmw==Iaiu'
:ra=r11Ti1T1r=1{wz?ru1'eTrsItrcr:
urfaa-121:1

tminqatmratnilvun
Ie1I?su1.a1.'a:-cu=aanz1t.fe1sIwTa1=I1a1v'ls$1%wa-tfvxI=r
=Im iianil-aullI1iIu=IattrI'I=?aI17=I1IIIfIfr? TIu;a
=rtaT=II3eIur$T<a11tIa1't.=1at1zi=vIar-:2tfarw1I man
1ra'I;aTtLa1'rv3|a!?ttra13qa3=Il8f=IaaT
=I1=rIzirarIs1$rWII1fa=s'fi=I!uaqTc:zu'|m1IIdt1=
mmrfal 3m=Iv3I1<Ira1%,aaIa1'1nr-:arr?racan1iIrr
uni1=n19cta1f:nn31tatga,a=IIutifIsu1ftnmamwa1
u1aI1a1'3*it=r,aE?_ttw| are? a7!Tl'l'3''W'T|Fl
aq=z1i1z31cr.raf11vmTT.uuwIfzaIa1.ag%rfnarha.an
mmmltqmmqamqgw nrm immat
mnmcrarr. H1 amfqqw aitwn ai-<=rrtIa1
n#aT,111U.nalT.=hfazrImr5tazu=IIam=I1u1n1travuaiI
mm amamtmuaza uam9'nHn%Ia-1'-atwittm
tr-ua=r3a11iI= :r-13uT3'aEta1nnwToUg1lataa
qadtiawn
utkqqwmauqaawtmmacpfwa

2-Eflmwxnaarcratsrtvt-1=f%I<n1a1au1-la'amd-I957
an q-55-so
qo use-:4:
375

guarafaawwaraa ml-ai.:ra
aaamqai drdrt?rIlT1tari4rri|aIHI1&ad-rcIrI5Ia1&t1rI'
dr.a=1miFI1man:;<wasIl1aIa=I%ru1ma1I?3=h
I1rn'1=Iin=rIaa=a1crtcm11I%satu:iaft31r3tnaTatII;T
wiawaamummmmm =1s?=I1.=:tz3a
qawwunnwwmttmamawmdmmvh Ir?
w=rfazmqa1=i'r3tn' m=i=rd'|.snmF1u%u' W
rl3rn3r:a1nI1Tttn'mu=rrft&a=Iat.;:a1.a11a:1In1=1a1'
u'H=II'c'a-rain

mtzmcrtnqqv
zcaaatmmammrnatram
1a=rra1wan uaTm?Grrtfra'bma1ra1a v.'m'-1
uaacamflvumaawmamun
f3=1EIn=I3alT1141Tf3l=|111?1!I|TIT;rT.=I1=iT3El
arrarem aktnaamaraaaaws-nuamm ip
airuwnziinrraaivivtaarwdramuur
arvzrrnzrrwraratiwn mwnafrwmwqm
nrraravtanaul iamarmmatfru
uraara amaamnm. atruaaaqamqaawquramawa
anIf3a1Tm1inttn'I'r.uaarert1z1.-11n1ih'1he.'.:n1tIv
amummnmnmm d?t=R.'I:a-t3i't'IP1'UTII1f
f#a'e11zaTi?%uTaarrI'tI-Ta:?,:raunuu1a1aa1rtufIaT

my-Iamuvaaauahaamrtw-I=zI%I=uIaIaw1%+=u42
376

-3arer1as'z111nrnrra1-.m1rwrarinava=mzrnaw
Bwarwnartfu ma :1-rmum=:wun" mama
iqqtmwvgeuawtmaam 3amrTcrrin'nr
uwrmawamtc auzn'ra1==nq=I1anIa
Hratre1.=11nfl1tvhs.aIf&a'trIaaa1it=rrr35qrwvn ma
wmawaamtmwrrnwwmmta
I31: mtammvdrniaammwmtmmm an
tIa=rrmt,1tI1%I1=atr:r=nisn'rIl1rrT%=11a11%Ia1a'e11u
wmwwmwwinnmmmwa
mrrmin
qwaqquamtrmmmwd
a1a=ra=n=n. mt mmmuatlaanuztmnuar
3'|E"1f|'FI'3I 2

I'If-'-|Tlll|'f6T'I13$IIEl:-

wlfmnuraaamwaithamw
aI1ar:rstarsr1?a1u1:a1asv.u~Ir=a!:waa3T=1uaIda1u
?6rl'th?tlTI?aTa'h1ra afE?=tr11=:'-'r3'3ca'h
ailtitlil-Vita It-$18?-IvTI=tEtTIP| aalaaa
mmmwmmmmatmammwwma
vamwmwwawaiu atza=arra*h1:3aau-1rn1a1
|o 2110 Oxford History of India, Vnoont L. lth. p.394.
afrtnria - rr;=m I1lT - 1- 53-59
20 u Oxford History of India, Vincent A. Butt. p.594.
no Btu and Inn of tho lnghnl hpiro. 1.1. fruatht. p.491.
377

win mnmmwmqhammwwnmhmm
artrrr?aIf15a1u1a11?{t1cIeI=ra%nt?1?=Ia?frI~-uaa=Iurt
azfaaauavaanuammaiwmaamin
tmmmawmiu mummmrsatm
aritniaz-I#8I?~n=f=1rru"s?.a1%=ITriar3uuruaru1zstc1'n&
mmwnwfnaaam qavmnqawn
iart-=ua'tratzvmn' Wt-1Tm=m1aII%aa1
muzuimumamawnarytirmn
mnawmutvmwalam
uzmwmmaalmwzutin
-1=na* Hz-na awaaz-ra-l'3a1aam=ha1u=n%ru1in

uqwziqqwwnananwaw
:n1a?trmI1pna=I mahrrniznmt-1ma=na=Wl'|
Iumr aaaurrztnqqwrnanmwarjr
Itunvaatratmn" 2

I-aimawwaurm-mmafaammzaa-cg see
he Cubrtdgo History of Imus, Vo1.IV. CIIJII. by
Sir Richard Bun. 19.214.
6317131 - HEM HTEHT - I;-7|
310*? 03 alhilhn of mm. Buarui P1-and Suns. pp.332-333.
z-The -Ibridso H1-IM17 of India. cmvn. luau-a Bun. p.214.
aH11=':1a - a=I1u awrr - t;-59
378

ah1<?u3tI3tI=a qe1rr!:T11a1a1
mmihlvufazmjmartm , arhr}aa1z1'n1=1m=cam
1 tmntnmnamsnwmnawnmmnamm. um
$|EfGl'lT'fdTl'3F|'l%15ltl'-TfElB$f$t-!n'f.'f't311T amt
mmumrwsr. 8nirwa=rIs'#I1TIi:tmr:w'5EiF'

m1n1um=n, asa tws1a1=n. =I1f'l'tIl-'f|z!1

dframxmnaaaamtmnmmam
arr-1t1%rraitwuz1nzfa=nmt:a1 ratnaranra
nwu1=I1%aa1qe1n:1n3ttar=1?:v1't:aw1a#
:r9'1T8IiPn~:i'I1'l'IIIl a?a=I:l'3crrHwr&a1=1I'rert
nnuarawzrwaimarrauwaatnwwmuarwn
&TI1a;Erf!I'I:radiI=I13ana&rlT=111:mailf-=rlGI1ITI'fT
8%?-a1%mIr{cr=I=nIa's1a'=IFi mnervaartqg
auer?taa1n1:I.=111aTIuTimfra'trr=1arra-r3ntr
vmaumtauwdttmu avail El'ICl'!FiT11ITlWl'9"T
qvfwllrfazrinz

nnmawnahcratqq
v:1't1a-tvesafrTii."r11tu'-1'rcr1'q.

u and 1:11 of the lnghd. lupin. 1.1. h-ipatht. ).496.


he Oxford History of India, Vincent A. Smith. p.596.
3' u Oxforl nut: or India. v.A. autu. p.596-:97.
Ru and hill of-lughnl hpiro. 1.1. rripnthio PPJ97-98.
379

wI1i1a61u1mu:tI3miaua:Ia1t18a1NTraurHmn
asr&d13=1=rtm'arta1'5Ia<erraa'rin%1a1|a1Iur3?IIe1
a1 ,1%ITqT:kttz1IaTIiz1I1a-3=1GI'r=11u31n11I11=I1rr
tltazamgc azanmu -:52. atqwmrtan HIT
trrr m1=m'ra=1u'n l':aEh=|'F11(5El'~3i;Fl1?IT!1TT3
iudwaaamafsadarnztwwu au==rI=HITr3z=n8
m=I=ma1u=n1'tn':Ia1ail' rm: taavwmwa
vmarwmauvawrnm-qna.anaaaa
wwduaamqsagiaan ataeawmw
I=r"I=1'n$lawTaFla-ra'hrIqE[a8al=.'
~T=rm1d-riagartu 'I3=t~IaTaT::|:,ti8|1=Ia=n.'rTl
u?lt=fzs1!n=ta?rta-Trad-rai1rIIiz=IraTe'maI7:r17w
gn1=itvz3nuai8u1aaizu=I1I?utTm1n"au'qa_u11n131ev
II1t4ua1tIrrrIT1'tsrt=.1?1=vzu1r:2:riu'

'lzit-".TIle't!i3l3ml'FiaII'l'ln't
=ua1ea1rrrrten=1 aaurunanfsu-aaaauawnit am:
nnnflgvmmvmin #rm2ttau=nrav-rarmrax
inn! f&a'ba8=amIau=1'na1eIa?3taracrT
irvwfaaqmmmgagusainus r?
awqaannmi:

WET 3a1'l'aT4I-7-Ixlvitz-3!1f?|r #
O o o o o o - o o . . . . . . . . . . . . - . . . . . . - . . . . - - '- - .
'_ afnvh 2I=rm HTG|"l'- I[. 79-30
Delhi - lltotory and Places of Interest. Dr. P1-chin Chopra pp.26-27
5I1EHIt9I2Ia:rauatTUeIim=irtw-1=i3{nIaIan1%'rq;-u7+n75
380

1fe1mmrqufaa11I1T1eImuurnuta'avau1f=famrr
m1a1G=IwI Wraiu-1=I1m f<'su1i.'arr1mH&
winzmavauandtwuwwmw
Erma-am :=rmaratr:rtru1an1ra1avnFuis

unrn1airzT=II3 3Tl'i'l an
wramsaaweu dwnmmaluiurrauamef
mwnmmamammwmwm
anIt'tLvfwm?fa!11eai'n=I!1=Irn8ai'dtt?tiIIzaI am
tlaiiiwntarpfin 5

I-uI=II111-i-'HtIT1~=l1:-tadfztr. Fltdf gm. q-n1.I2e


2- a'lnv-t'aItrg=11*cr'e'rr=:-11'-=;4o-41
Oxford History of India. Vincent A. Ilith. p.592.

1-EI'k"IHmm3aua'r:rau=r an-WWW amm-cu-103-:04


3-1a|=I\1"II-9EFlEa--:-'H'Tl!!I-|=[

5- an -"- q-H5-us
4-=3r1an1sma:fr:m8a-Tm -?==:taqu1a1au1?I-q-nos. nos

so ller use will ever adorn the pages of hietery an e bright


enenple of tiiiei etteehnent end heroic eelf devotion to the
dictatee of duty. She not only eupperted her {ether in
adversity. but velnnterily resigned her liberty and reeided
with his tiring hie ilprhnnent in the fort of Acre. Beele.
Dictionary of Oriental Biography. p.190.
381

Nrfliaaruaaw mit
WW. t. W1. =l'=|?1|~13TE|!|1'GI1!-'f%1'-'iIllIi1'fIIIlIIl'l'-Q
wmnmadqara ea1'!1m Uvmamtk
mum aarnrrrcn-in
=ITC8I7f'ral13ErI1iBc1anFIa3iI
Hun-ma win

8X3X3X=XSX=X3X=XIX=

WIHHTUWT
mmammmnmaawzvm
Tladrtdlhwiaaawaanawaw-Wwmamf I

Emir 3 1?rr$liF<*.r a=IHL:

iIa1=-1r=1aT1v1.ze1=I1.I1't=wc1c1at=I1.
aTm:.11'anHr.m-tra11?:;rraa3 a-'TIPI?J'lm'I!r
Ia!-la-tqz'Ia=1r|1=1'iII1'I'ra1m1a'5aaTIl:a1I1'r811il
munammamnmammmuarama
I~ETIIe'f|'5IF~*-IEl$l1'IaTU'EI3?-TI!-1:13Il alaufcs-q;-H1
Itarm-|951
382

nadtqnuarizrrlamu traumitatr uretaw


it mmnu nwnt1em1ua==miu'

uktamqq
mtardleaqamtnmamvumwr
$rwn=rma=n, wwmmmwawmd arran
If-Illraau-aIr|'2 maairaeaarawuenwe-n
d-'t#fa'e1ft4=FI warvmmdiqmm newer
:-rrstriii acrlafdznil"

Tfmfmttaqr it man
mmitntifrwnaxdrtntmmtaiaias snv
man Mmm nxtrurnzritdlzta-uent
mmwfmwwmuamiu gm a:n11=u%r}a

1- am -'- qeae-91
I-Il'PEI1=I'W5T a-Itrm-a-3;unawr1%1am-q-9:

3- ferikh-i-ahiveji (Pereien) eeye thet in etter dieguet et


lhiveJi'e eeyuerdneee. Dedeji took poieon then Shivnji Ill
11 yeer'e old - Shivnji end hie tinee'.,Jeduneth Serker, p.31.
4- It ie inpoeeible to exeggorete the influence exeroieed by
JiJehei on young shiveji . . . . le (DedeJi) wee honeet. ehle.
end indnetrione end evinced deep intereet in hie eerd. It
tee of couree inposaihle for thie eetnte lrehnin to guide hie
were deliberately along the peth of revolt egainet the pre
veiling orders. - Heroes the eede Eietory, 1.3. Knlkerni
33.5849.
5. Riee of the Heretha Poser. lehadeo Govinde Benede. pp.28-29.
383

I1'a1mm'| ammimmwwnmdmwwnmw
Inc

mmaaiawmmaqimnhmav
nzmuartzaaqmtwnwtaarm, mam mt.
arama-?wqa:crraa13=n. mdt1nta1&1w='-Int:-rant:
?GiH?57f5!Id'lPJlTlF'l"-11-Fi!-IE? it11%:tmaumt;3tu=I13uiu'
aTa1aIf=1iIa1=1ttFt'm1'9u3iF11FI1?aiIl?Hlata1rrI1
III. Itumtautamawi. manuamaarrama sm
watlriu

anaaufn1zn:
autialmrinrmc. auailiam
I2rdw&=15TiIamu1U??:'aan=n, ilamarnantiauf 3
a'qn1n\&=I1. uI[~lT'ara?iTa1autiau1'a"r1Tla-Ta1=IT
I=rnz=na mrantvuaurzuanwtaamti.
man, at aTaTttrI=I=I'ttw1II#=Tr aura
=neaa acrmanmia 3

.4 - Heron who undo History. VJ. Iulku-:1. p.73.


2-aHn~-ta- agar: crrarr- 1- l9l-I92
India since 1526. L1). llnhnjn. 9.174.
am:~rsIa:=Iwrm-at-annafralmwn-n;-43:
ymmw-(ands-(Gwen-Q 57-so
384

tnmmwnmmm. umwrwmmazwzmm
a2rauraT=I1. mmntqiqmkwttmamm
i: '
mmnumnwamvuwad it
#a=11.:ma1=;=I1$ata'i? aTr=tr.i1ama'ca=udTi1=11ut
arnaawzsru;-n 9-Mauuwwtcrrm err5=mmaw'
TJ."FTH-TFIT, trait qr-Fn.mtaI18v;ad'tqa;.1tm
Wlmqamwgammwwwtfamiaamin 2

mm In qra $11. mm anaumt


atlmacruazn-aztt. 3r|5fW?=|'l. wfatmnmlmw
mrr-mt '-arrzwa-u1e'wurwrai~aa=:1i:uaaanu tn

-1- Ixwaausiaatrrusi n1t1m=r- q- uo9no


2- a'1a1mI=IwrT- atmftli-r 5RTEl?f- cg-433-434
India aiaoa 1526. L1). Ilahajan. p.175.

e'fI1@a- awn HTa1T- qo I9&I96


ha Oxford later: of India. Vincent A. sum. p.-406.
6: India aiaea I526, 1.1). lahajaa. p.175.
afra - awn HT<m'- 1; I97-I98
v3=1ame11=Iwrra- arunaffava =-m:1wn- qo 434-435
4- am I=[- 435-436
aili - FIT?!-IT t[- I99-202
5- at lg 202-203
q=1aa1en'-'uvrr1a- awnafema amen-:9 431-4313
38

tIaFlratavmaa?t=13aua#q=a varn 1=u=ItraTIi:


u~1ia'1 maHv1ar;amars1a'r3*'tauau1i!tn1:tn1
wH1=n.TH'tairiiIa1r1tatcTa1rarnaa1=11~1rx9m
mi:aiu'tr11<u'rasrma1=tzna11u11':rrc1a1=u1m11im
drmlaraasrfazat %u'r:Iv.'rqtmaaI=I1.
afrI3au1TrnfawuT11?tI1=I1.ez:1a'acr:vgurva1'a1.3n1z=u
mwtmwmmmmwtmnwmmm
sTmw:uanan't-ua:19'uI=I,:r:awIaamaa3a-tra'era1
ntaaa1r3a1Ta=Itrsrtrdd1Tn1asrI2IuT=1v.4aIa=m'=tt
11a1mamml aamru-tin mmautsq-u gna
=uIairita1<IrcrrarI:snw.=mdwa-1farIn=ItuTv;<Iu=[1tva
a'i't'wa1a'8ii=uvIan't=m5ita'mn19IITa=I1E||=ILI1%I1I1a
ftamaiftwzldin

I-Him! -2Tif-'-lI2IHT1T- E;-204-206


India since 1526, V.D. lahajua. 9.176.
I1aw11=Hma -Mama-I;-44o-44:
2-mvaswratiarmai mvm-E9123
3-rgrlaarleiwrm-a1taa -cg-443
3'h3-FITIITT-if 209
4- llorooo who nae history, v.3. xuku-:1. 91.31-B5.
'1'I15lE1F-lrt-iffar-t{-444
5- aha -'aTd11'-=[- 2I6-2|!
6 In. In. 7.3. IBIIIJII. Dome
386

Wlfts \3*=TfIaH'Ta?rq=11'HT IT
Rmrtafrrarcgzitazvmmizmwaaa mm
nf Emtivtiin Irnmtmnww mhgarwtrm
qmaammwvavwamwaimwqaa Emu
ta1:tr8rmrr atrra-?qraa!ItTu1T$r1'EIuf wt
weamaaza-amarn am: aamaammtxatig
"-'-TfFI'l'|1'f'l il=:TCIa!TI?rI?1~TIi'i1l'=IIIfTI'xi=Irl'ft1%'t=I'I1!T
awnadtdfn vtsgfiziatitarcfrathu-l'-!a11taTn
Uawmm-memrwummttmm iiF'"l'
aa1Iimn(')I;-Hmt 'zmI=Ianat1Bm'
itlwmmml G1"|El'Hlf&?lW1T'3ITF|3
tail 1?-fitailrrita-1=ni. '1wtawurrzwu;ataa=raI
rnaaramam zilmzr. il|3!11E?ITT'FlEldT.
aTa'tural[w wwtwrmintuam an
cr4't&a~2'3

m aanmwvmmmzm.
mnmatmmmwn marfmnhnh 1cm
ah! mwqqwmvmwwmuaanhw
it uiqama? wmummfu

2- at 1+9
no lHIrl=II-Wt -GIIFTFEIH-[-9-IO
387

'1 far 111' I


8X8XllX=XI=X8X=X|l

teawaaatrriwrnarnhumam,
ti i|~TEl'll'1'=l'\=[lTllI3?J'x=I<!=|1!-1il1=ITlIEI?:F{. ZFl3l1l1W
mrmiiqammawwwmwwum
asrIzaHrraanTT#4|\'. Iamadrrazx. rmwam
trra=Iata==;a=I. a1It:na=I19#ra<u'~i;rtaattrvrI'ia

iaarmiaaaimarnd-Tqag
=ua:es&wrt-Ia mmmsummmem
tiframmrrari -'al'i!l"lfE"di?!l'f3iERFl?
maaaa-"r9311!-'u=7ri*| ?.Fl'd~'Iq1''=1=l''t1IiI'ElH1=l!I!F"'T
i! am lR1@'t't1R'rl'Hf7:'5-3I|iTHEIiF==I|{l?Ia?l
Wwmmn mmacwlalamemimurm art
uararh aaiurersfasrwwmrwlanruiatunur
axmmmmanuwmaaaasawmwanmtn
ut&'tllm@rq'ra11nasT:11IIi?vaw'3mlIa1s=?
B1ii?'lTl17$TI\-'f=1!3i\'flT1'cITli!T6l!!=B"f%'11fU'F
38611 a1=m=n avmzrn ta! araawwwmwr
:ra5ta1T111auT't")

naammm
wzsswuaauaqatqaa affa
Ia)a'f at fil-a Im- Tfcm lurfr-={-:4|. 9911 mini I990
a) lemon the nude History, cluttrunl. VJ. Kulku-n1. p.129.
388

wammadftawawaaaqasmmwma
mmu<5I%n1:a%u''Ire=rtmua1t%-aTu13=rIrt1a1
nwmamfmwmcaaaalhmfurwchmu
=;ardi1i'd?turrl'Ia'1:r3a??rrrr1FIaT'?.tTcIaa1l#
mfrrlfzirdvl Tmmgmmurmfif an
1:: 'TlT!T<iT='-16I=1TA3Ii4I?EllITlTT=1T6T3'Em9RI
Earartafavnckraummratamtrn
rrtrrtarm chwswanwm
wmqtmmmmmmmnwma 3
mdtwvawn *g=&al iwa vamitmiri
r%IIIiI13??tHtUI1?u'I=ii?Tnu1an=1t2?II1.11lrI?l!NI
mam-Iaivwtmatwrmio

|l"l=It%qa;:- f?aI'6l&lff!I1i15uaai1 8
qamaunmdmitwdsnmwrmn EN?
anmiu ylawaauamairawmqramzsaa
maimamatmnrsfawmwatnmiiafai,
mmaray ataaaaiitnautvritawuuva.
ntm1'&d't'erI=i=rtf zrraarrriu atiqamama
-=na=I2-lmwauvazmrrin minuamamfmnmt
mmwmmwwmmmmirnmmw
uaauaadaaatiarumtanlharawwsw at
meN=}HInhrraTnn utir'1=na1s FlIl''EfiI'l1?1

I-\?vI-IWEal!T1'-?I'lTk-I'ET{=f-Tl1El-1ElTft-lg-I45
389

mam mzdsrmuwtmmariu

it-lTRI?ElZlTl'3GTI5ITl'9'?tl3|FI'fa-'f
dliml alz uI'ri1'f:I=itihd'raI'IfrTIT I
mwmraawwmiuamamwatmn n!
nrrama aPfa3|(')'l'katrIn16fi41ra-'tu1a1=iu't
iHav1"rawI. mmmwrmmwiutwmmm
mrrmmmawtaaawain mrermtnianmmuaimw
animaaaarravnrnfmo mwataa an=rt=ma
tma1utaI11I'r?m awumaannaqwdu
naaaatcmnf-1r: aqamwnauaraatarua. mm
:F!avIr3ad-rama1a't=rreiI'crrt1tz:rn&nz=rre mm
l|=I3|(2) 1=ruz=rrafr auwmwnuyramiaz
dtmanwaarrnaana '<1ta'tl3w=1mal1'|Dfiaial
quainam1aa1TIaTrI2sa=ia=1t:lIaH11aa#
iuamunkmitaianwwumaaealdu
slqamariur-mwa-Tram: mammaitma
mmraawatitarmiqmtuawwaawmurfuarr
mmnxn-3 at-a 1rm1m#afrm$I.'tIu=IaI1T
!l3El1=Ie'I&'rfEF6THll?-TaN3Il:I'EIIR6lIFI?rI tr?

1- g=*aII-azndllr-aifatm -Irmafaari'r-c[- use


2. Boron who udo history. Chat:-uni. VJ. Kulku-:1, p.129.

syau-amdnazmr-vfammam-q-ass
390

11-mrasrmxtl (')

mz mmmimiwma
zamzwaituwawnanmwtaiuwauamam
anrrarr93t1a-'te1ri,auPuw1an11*tsIa1#rr|I1arra
mdfdtaw raan at-1*-Ind-'t1mu1'ta'Ia=n
a=1frumaa'cI=utra-naa=1riu'* utwdarumrstr
srit.#rn=Ititq,vr-triiana-m=u1r H1TW'll3.v'T| manna
amamsmmawmawmdmnqafm
zIatqu1i1yf'at1a11ltT=rC| cu-aar:=7ri.usasarpaa
mawmawawmaaimnaawrfgavzitn
aaaaratin wzlwrrmnliam-rnrrlrrawar
wmin aflirrlrr lzutermtlrm
aratr air 3. #91 =rI=I=nnaain 3U'R3lFR'f -an
war?--'m-'1a=rn11i=rit muunnwtavnfaaut an
imdiawraarrwrnatm Smhwi. at
Ra-irnmrahwiaamtar m1dtars1'u'r7"
:rw3!!=.'t1enrmarr2hw=Ti1ar?r'n
I'TWF3iEl$rftiltqq:
atamaamtduam
| Boron who undo history. Chhatx-anal. VJ. Kllkani, p.129.
2- fQ=r3@rau1tw=I1ea-1 atfamau-31-an-q-331
3-9'l'I-|TlElT-1llF-l'51!'.!11-{- 4:
4- Qtauzmiltm-rfammam-C9163
39]

Pda1aart'tn1uaaT f!rl"rt=I1.a=Iz!-Tutsma'1=1tm=ua
$11-=11 rrr1=taI?I1a=I'-11rnv:21a1=s1i.a1fe11'eru:1w;v
IIz=II5in" I1crmr8aaaI'r:'t= an-uauzmr
nrrafn awwd fiamaaawn ark"-Iia1't
mmmmraqmmmmammmwm
crrranarrtrratiu mu? aurr aaa1Ttsarr n
Ursti: Pmuahwrawaaula latarfin

mmqnamhd
matnmdrqaqaqtaalaamwa
u=1q;=r=ner'n mmmwmamfamu W3
mwgzatatmkairarmt larvzwarnazserra
r awmwmaatkn Uilavvai
wn'a1=1e'rn=:f= varnaarrIJaanI=1 qqwnarar
maamwqawau uaauwrnratmzarhrrdiat
wamvn arraitrai qrre 3auI=Im':h mam
mwawwn aiatmqcaa
admdrn r3rIa=rr'turr:raau=1tq{I'-7t1c1raI
ti sharia:-IT: tan-I? 11?-It81B1q1azrl'lt=1tvtTaa'rl'
wtm GI2I3lI1lnTFll?1l.'T-'-IT 112211: 3 mm 3113
am: mam: amtraifraaumrnmwgariam
I-=hi'3Id%I1%rI1n-11a1a r-I-Isa-:62
2- am =[-Is:-I52
3- r1=Iaa=raI=mTta-aI1rafI."ravsI*ta11aa- I;-301
afra-a=mu-tart-q;-394
392

airuigwtwwammmmwaiqnmnurtwfiuam
I-Imaa an u'n;Ta-I?v=i" vairqvml unt
arhaartrdtaawrratgaerrcrrtiarnaqriaart
mm 5116! F? mw IB'!-'T3'1FlU=l33Tf
Ii1a=rTIII$tI"Ia\3fal11a=rIrc=I1aft a'*I=mra'
BIB!-Iaiw mmin
rauraairamz
?El"B'3q'{!3ilEFE|=|T itscmrr
iaarerlrgaamwmgu :r=I&=:=r mrmaaamum
suruwitaqwe em U'F|3m'l':'i!!TFl!1?I"|T
lam-I1 wmmwrwqhummmw
lczairem iE"'lE-I ana11=IIlfaa1aTqa-:11itsm=Il'ra=r
tIa1ri'r=1a=ia=ztawi'uv.IanE a1=?awn11'=m
l$tI'|'l =T.a1tacrs'-uu'rsru1z1a1z?aitu=I=r=111?I1n N8
!i1a'tI=t#aN=Tr?EIfrFIft6'%3dT|?1'I!M9-1I1f%I!r
{Z'E'Ui'l'2
ramervdmva gut
li'REf~T-'-?6lV3 awta=11s-aaan-8
wmammmnmatavuunmat. gtawaaarmdt In
a=mtrnz?=n. aaamatuanmtaivrriaf-<$In1I3an1'

no g=aw&1\11iI2rtn1HT'Ya1afaarn-c[- I69-I70
=[- :71
2. a11a'FI'll'<'Ia1ta1FH-I[- 391
aH'1<}atn;1=IHTailT-c[- 334
393

tIa?raIIn'=Ia1$iat=rnT?xw=far1-5!:tsrt<1 tFI-1!?RIFlE
arvi.'
attaye amaiavlamiut
aqacwnztuufmigqnfcmu 1fI=1wfaaI1311n'nar~i'r
Awrwmmmarvmn mufamaraavmr
Fmtawazaquarunmaawmuvqauwaiur
t1Tii12'Tzr1'IIErIE-trian-Talrslliitll-'0':

UilF|l6THlW! vmwla-'tu'u-r
'tUI5i-a11'htITI=II zrr3:If7I't'FrlTuT111Iet71
aawmxaaftammrrgaa-=I3w#mu1-1:6:
dammawuawamiud a-tumnamn
ii|'l1'lE|U7?TfHl'~iTl'3f1'I air?-Ya! azrtgrtau-3 tn
aaanmlcrayam anamawmmdaawwa
aumamn ataarwrmiarsm rt
tam: mna1"rf?=nIvz9grIa1 mmthratgac
m=I=narti=aaasrI-am tvawftrnwaar avrrsr
arwrnnih maawnmaqmnvwgqwvawaam
wmmtmtumiumdqammnmum
mmimamnnmamrwmcdmw
nnatlmiu

Waaanqn iamammfr
I-=~?i1l'lFl14'li1?I11ll1'G-TTG'IE-{WITH-'1-IBI
EVHGHHWTW-m-q-391
394

a1lW!3'l11'1Tl"3IU'lI'6ld'FlT|TT?ll'TI1'33Fl1illT3T
mam Wmmmtmamwmmnamm ucrcr-'1
auararenummtammauma tamaawnam
avuiumn Ww aafza1'-Itw-Tm
aau=\tsn-I a-T1?dna=aa laa1ag=I?aII-'azrwm=ra1
Rn-tagnamwlai aam=rHa-Icmtmuntfazrrn
Bl1g=3?I$3ls'IF|IH3il=J=I1E-I1 trI=Im'a11u1am=1==1mu

'El'I1"l"T

aIua31?u'HH1'=Fr=;'I &n'=I1a=Ia-1
lawtisrlaaflsat. ummaqhham uaara
aagauu =i11aTH1rwaf In"=raartttn'1i'aa1=n,
zmqqn a1IT=u, muamummmmmm,
a=Id.'ru1a=n=rrzam:rruta1a'tv1 atrmazrr-I FFIHHIBFI
mi:
=xaxsx=x=xsx:x=x=x=

f'.'..'...".....l"2..

munaanawlt-1h11amr$anTan1aT
'IfmiiTlarr8a1aa:&aaaanwa-'ti#r# 'an=Ia1
=n=I1EIa=zniI tr.'3'iatr.nawa'1n1'-'Iaa1?1r.at
:r:r'ra1q"r. nimar aTrsra1=,p11%1auu garwuw.
trawrtrimitftmil
395

mwmfmrwnwraammamat
ummarafrmmngwmrmmam 3
run it tcrrmmo qnfcmeraf aw-:1 aarrftla
aqifrriw w'n1=1a=aTaRIn%1a=t#an=R
m#nW I atasdtvrw
Ina1.a=i ar113ReInltf3iI'1dTim12a12iTIIn=IwraHnu
vrkmaiammmaamiaww
:ra'h1&a3n11Iuta1?=rIa1ftPn aaurarmsraareaan
8a1r=:I?aaa1naa1:r9Iaatd1a1rI',mf ms
3a1=Iu13r31IaTI~*:m mtaatwkmumnhrin
trrra1'dTa1a=1rma=dt=I'd1' imatrmmamafchrad
13335: a1nau1I!naw21=1aar-1w:aY Irruare
!Fl3a1BlW|!T an U=l3HI'I'3lIT1TE'|i_IWl_=l'F{$TFFl
airaxraenu amqtamamratmg-mmatn
mumnqr-waif: cra-gnfmaurrarngawanar
airwmffrarmtmrmu Ikrwmzrlrmaramqk
tnamaufam-aim: um-aauftiartztazgrrfzmiuta
IN! vlkmwmaaaanaamamatnuvmur $91?!
anqzin amaaaamaarazradwuwmnrmqa
d'ra=n=rr3 zrn TI6?r11'IidIrv:maIarT!ru1IatT
1ta={am=I=a1r1aT:sIaaaTa12nu'tq'11aT8uuuTar2h=rft=
wilaviaailtn Wftmamamtwetlmm
naqmrwtwaamnwmnaqaien airq
.d1'Il=lI21I.'1ftHdTa1'8 =rI=3fiw?'3-11'l'#I' unt!
a<'fQIl?T|%TH3q3Wl3'!-'TtIl=lI,'EI3IFUF-3
398

:19? swam-tmmammaawn am
a3%l,ms11a11rId-'t=1l#f eT3.:re7ra:1raf91i1au=rr-Ia
Hrr-gntmmtmtraafinrutmuhltun girl
wnamamwawinaimawrmmu am:-rfemar-um
maawu =:a=n1zardta1mTm'ara1=Is1au=:_ar
we an-=InfemaTsw-1mm=rw-nan sin mtrtzrrfm
atn=matu1a*aaa1Ire1n irgrrfrm-uvaaaanw
a=rf=ta!I13211I=tIz6m?cuzI1=Its=ttrmuT%i1%sI3
IaPu'ai'-a#Ia!1I'GI?ianrriI"'

mmmmaiefraamwaai
tamamramuamwkmmmm mat
:r<u=Ia'ra1in admmzaframvwatmnmmartr
mumauaa 5IT5lT\fI'c'iTl3!'i|'t'fIi"ETQ--11363 1't=I11E1s
artartvIa'<tr=Ian<nu

wlau warm masawatu It


Gt'fa1a1taaa'9oar8thIfa:?Te'hI#aa=<i1a=15n1f1%:
z taaftfin
tatiztaiawaunant
mtaqutnwmlatrmaiu 2
lhfili

t-a:Ttn=}a-u'g=Imtrrarr-r{- 355
1TTaI3.5IE=I!Fl=l?ll1T-l'!1'-P'!6TFT-tltif-|?[o
2-a'?|tnaa-zr:=Iv21<rTarIT-q;-no
B-TH1'l'3 -:ra3rIauiH'1?afIluaT:lz8iuTI61arr:r
muwamrrraaummmm. mgrua gI1a=nt
$317 zasnmrat. zraamzmu-Ian mm. in
tnrcita-1r1aru1?tuieItd-TrIII1a~1zI?ar@Itt1%Iziwe19in(')

wsa1'rurtar:fa?ramiIaa1%a1a=Tr

mtdaimammwi
artmia=sIau=Ii1t'mI=rI=I#I aIa=tr=.'r2:rrf8a=mr
Itanwammmeaauarfnmun
am'Raiaw11=Itfw:1u1|?.atn#ana'aflTc'mrtuI1tI.
-l$fFiT3l3'lI?5$1f=fif an zaetamam
Wa"W*i3'T[4%<1~HiHaIwi| >:I1%'<TTq:H'FI1
man ravasrarrwaaraaazsmau-1r=nuasaamn
Biaarmauaaatin eiwumwiqmmami
taaru=1raau;rranmu-h mtewgasrnmfmgiau-1
aa I5n'r11TT'tI#'I'lI2

ugamuwnslaawal :vuz,isam:'-I1
fwnaaatartmt maria 3 immawmmar
wit, mam srciraaaritahaermsaa uh.-rrrzn
|. The Oxford History of India. Vincent A. hith. p.421.
Wm - Il'EFlTl7[- 2:55
2- ararrn-Mr-t 59-60
3- afnin - FfT?FT1'- q-In
398

I'M

awmamua
ilH'I1I#aIu=4T3T<1t'=IaU=-1m1aI
a1a=mI'aII-ardt vqqatza mtawuad
n-u1i"I11117{I.'I'=uwFIaI1'<;Tzaa:"aa:I=z-1'-atEI=I
vrtr aftf=au1ama1=?a1sI1=2:zrdr:ra=I1trt:tu1nu1ic
Imum="Iwmm1a=1awag=mmzs1T#'v'%rna.n
arh13a=m!9miIafaw:1i|at1~1ta#arrtarEt11 em
amxaa-'la=nI=afa1an'2

anaaawaanrawnzamsramuw
f-=narrrit=1r1a11n1u1=r,t1iuva?TI1rra31%1n=Iv3t1f?
qqwatra1u=:I=1ua1anna7:1'4Tttr.a1a21z$ta=111%I&crIu
trqa-uq1h,#a&a1*n,aurm1=auaaIa,a-at-a1tEra112'aIur
Sawmmwmmawrmmia am
aaeuav a gm--mwmm t{I1t
cntznaewff it mawwaawnaaar men. 113,
:lc.iaa1R'fi=:<msTa=xa1uqutrt"erTtin l'<II1i=I''T
at:-Tacr61a1aa1rmTu#T aag't3T1auBc:&u'3

=ms8smu1a- =Tfra.ms1T. ~I'h1

2- aIHI3a-a',,=rruHTIT-=[- 349-352
3- arr-1a1==rH-g,e3
395

R1u=TrmtII=I'=frat. qrrm, imuiu z l?F|'l


tgamiria tnfemaumascmaarrwmtalt tn-It
=It1sIrITa=I913Ia'r2tzIimm=;t\-Ii! :ramaa1u1I'in

t1%rI1m~.rr':1#rTf1trcf1tl'1l raga}
Rwmiw "l'lil{'dt-ff!-111'GI1TIFF|3?61!['lHiI~!l3?11r
tnwrwwta-rain Irusrdr maniawfemaafu
amwmdmmn :rH=arIIdtT.HmfIr.12I!aH='fm
arm wrfcmmkinlinmmn :I=I&m=I'3t1h1aih'q;a 8
=I1'arirumn==aa1=I1a1zt't -=rI=Iaa1a-1| nfm'-tI'
'cIa1Ifmt=rtf 'T31lIR\JiIl'c'1lvl3 arEm1r=r 18,
l'Ma=?u'atn=m mm: gear! 3-n=n me am
I-Il=liiIh'dFl'?.fl1EFfT!=l12I'-l3E'l1i8l=IT=ItIll mm 3
ll-I33--I111?-115'=lTl'dT6E"ffTFIl6T|dl(?J?1IZff. Ira?
drarr maarra1I~=Iam=tHa1hm'=mnam
nmmnuwaaearirmmuqaqiu Err=r=IFIa1rs1I|aw'a
11==n'iI1=uatrr1a1'-nit"

{'Tf1'GH'<iTt?II6T{8e|'I!iI6'f"l3l t
varaaiu ataautai - Ii mum uamsszmai
rati ymu mmmmwm Va-!|I11'~'-Ir
I'=I'l1"-lT?-IT. h11=nawrraI=aga1, amntaar

u- rnm 5|"I!ITF{T!N1'H.-P'96lTT3Z1TFIf;U}5343'{]
2- ammn-Wt-q-1a
400

tmfemmmnmbdi FlIlEaI}TI-'I6T3I Fat?


dh11I%IfuTIcraaIt1fI'aaI1I' '

QJEJH
mmmmwmiwmgtaw
maww uutaatuaarmfa avmtanmmfr . :I=I=t'r
mm n=qurama=nnaun-uarmammam
er-rmaramawmis
=x=x=x=x=x=x=x=

E31
aitwaaammnswrcaurmarlaamwa
$r1=n=m1 Srarrauw atmaradtiltaratmmu
wmraifniafmmmaawwadl my smart
rqamaiw rmmwn Bra?!
=Ita-' mfl'161?$'~Ti3Tl5FFJTFl-l|'"l in

<iI1=la==I'-h'T'l', G=|$|Iitl,7.dT3EIFfq?13:

iYIET3'l'rll3I'~'il4aI1'1h"l'r6'7TI'MT
errnaaznam a mam afrr&aaTa1a1#qartw
3aItP11= 8&1?! 1"(i'|3I-3'("'|3l'-7f1'w'!TTWUHiIF|1?l3
rnqmqzmtaarnmuhwwnmamnwsn TH
401

t1a1'rIfaz1sT1?mIv3w=rr9 aremmiu' qusrmra


wwtmmwrmnaamafmmvaawmm

mm3mm
hmmtamawnnmttmmnwia 2

=rtrn1an'3tl5ararrafGtu-taIHrr3a8I'mY
a7trv'.'ia~l%urr=IaTI auantlta.-3t'rfmafI1=}n
mnmmmmnmakrmgnndmwmawaama
awn mfranamaml afvu {nft:ma1na
tarmnwal muar mm am-=IrrfraavItaa8
mvwmnramw mua'tn3a#vmnrq=a=3at
umiavmtmmhnwtamvww
:1 mquanmrarammgrmwmreqaiuaaramn
aammawn gnfrmmqnndntmmmrmam
wmwfwahma allrnlfuai rz'tznr'wsT
ruqmmmn gna=It5<6t*rr1'Is rrrm;'-H11
qma1IIrr3a1=RrTa12:=z:zT.trrfrmvz!ntrmna'tt1'n
am 91!. znwia wrwi :r9IirdI'mI?iIl'T5"EI
hmmramimwmn illqm
arr!-reiamy naqavdarm amawmfwzwtm

-1- wrm r3rca:uma=1ur.I1%.ru';tt.-.c:t;a.rr:uinf.-an:-[-53.3 . . . O - . H


-2- afniu -zn;=mtmrn'-t{- I55
3-ana=m=Iwm-aunafdrerrammwn-Q
aft I65-I66 39:
402

mmmfmmwnrruiuaf arr|a"'an
Uadt1w1a1#aiIT*IIa:1=Iai,:a1ara1'1w?if mat I
amfhndana t3rmH1u1'auT auanaa
1%gvItawt|a?f1IaamaFaIuq-fmaaauamuruamala
3fIv*=Tr%utarIa1'rIrrwIiI!N.=IIzIiGa=21mta
.arTfrIuItura=I6uauIa11%d'twu1aaaTasanlII smurf
WW?! la-H1333 R1vi'I'3FI=I!Juaat#$I1
u1'a2:1 z azsara wpmnmawasrmmin
a1"truaazn=7r1a

afhararwmusunw uiranaurnvu
&qaI=Iu-rFu=aa.\3=EImnw anuIIIiiiue?a1I=u'r
a1?-Imanmra1=I1.TIaunarm1rnu1w anamrarqafarm
wrmirmarnaa in andf-mmqasmw
mmnrrgammsnaumrn 9sn=n=I=n1fa-um:
1?rtI:Ii|11%1w8a1=j91Ta't'tn3aiIu11Rit.amamt it
q;$af'aiTlt71T,?w'1Gl!11El'1TI1TI"ii!?If9!tFf'lTTFI
u1'rtaw:rra3,fIm3narwvnu't-I wI.varnrr
1TVI1u1e'II111~11Itnt=1'T?=rI9'I1IruIIa=rI'iI 2

afnaamasqrmvmt
a1EII=I7tFl.trrtaTIIansaT3#qaa:rm
qr. avdamwwmarv cn'a1fm'rarr=11, azu
qravxr,
C . Z C C - C C QUzuwivzaen.
C C C C C C C C C C C C vclt-H6863
Q Q C C C Cii
I rho 0210:! History of India. Vincent A. such, p.411.

2- am to I67
- U?! 9.-TUFIT - '-'[- l64'|65
403

#121! manna. awththammzurit


au1IIfi|'
asgnattrcrrrazx
a1aintn'rnaTrn1TarTarra*m1uaa
=tI'e'tHlta-'otl"i'f*~'t utagvaamaaramawaa
T-cam mqnrrmnmaawuaamnnlwr
muatqnamiud-Ttmwmcruawmawu
TmtT9Ir;?Ia1aIdTazsI'nfan11nI31IaTitaa'aaa:a3f
u11f3ut Stlaarlnvf ms. trratra=Ir.'1= 611'
mm nmaatmmmawminrwa
IITrl'f#a1?tI|fml11tau'4T=lIl'IPl'Cl5f'tuI1311a
=nmn1vf1r8I%m r5I1aiI=I1a-1t{'na'rrcrn1=IaIt=I1u'etu
Twmdtdrratamazapgmqeunwn era!
ancnmaauaammsmazau-aiu 9

ftIII=,11ua=I1I# amen! Vilma? tn'aramn':

air! 31J'o%vHrn'rI3rIa'f itauil


mmmnawmwmmnmmmmumam
tn Immumaatwzhaqammawmnmn
3 L. 332:2 i{.{.{.} '1JaI.I ?:.l...C 3.1:}: 17.21}. ' ' ' ' ' ' '
2- a'lI1~3II- awn rnm'- q-use-:69
3-wmimmmiftw rm-Wtmaw-=24I-242
404

amnaaarguaqrm mtaut-an=m.ar-n
WIEIIITUEII qa=Imrmw,a vdarrd 3I%r:1tu1='ara1c[a'-6
mmnml E:i'm#a1a uiarcqnuwtnaltlrutvrmua
nntmtanm Samlrrrrrin '
afflaamarawrqaz amlm

ah1<iaat1Ila'1'\'at=rI'aIuaT8#qa
it-ac-cn-tarrm1 arm-naimata, mvqumzananafr
1%:-Tw1'8#'qaaTe;il I=IIaf=IgrK-1'1!-III: aagrIa=I11Er
m&"r3a-13ua'IatdrTnc{e:aIaratairi1u1nn'nIar' it
=rta8wta:rarrn'u11%'twI12u1 aT~trIa'f aIa1f=n=1!I|
warmqa ErTfd'i'!I={tlTHd-'I'| 2

aaarwm
afhaamwarafvmmmmfauaru
mumammwimwmh, iamrnrtuarr
ma wlwrtmin muatt ehaarrammt
1'*-I.a'=1rr-3.I--? . . . . . . . . _ . _ . . . . . . . . . . . _ . . _ _ . _ , . ,_
I-aI'fb1m-u':=mtntsrt-cg ISI, :51. use
2- glwru-1m=mn'a-amafltara wa11aa- cg-:92
3- "0! all the alight: that our ehndren had aimed at us. none
hurt Ill more than the conduct of our gifted daughter Zehunieea.
he encouraged her brother Akbar to earry on treaaonoua eonduot
against an and with a heavy heart we were eonetrained to order
her to he detained in Salaagarh fort. . . . Aux-angaseb
nu1r'. (Article published in Illustrated voony of India,
June 3. 1975 p.51 by Inahuant um.)
405
Mrmtaanaaqzmmmw
mi: mma1a-mtamrraaavmiaiwneam
amawm. mmumrmrmwdariu-"1wrad
iurwratr. =::a1=nazn'ta1 aw: artaatavaarmm
iftaaiavutrin--"'
aawwadqamaarm
wnamtamaaaw uam
:211-- "atumamwtcfatruquaanwuum
fm1a=Icrra=1rma1f4rmmT=r um: am: it
awrwmmmzmrawmnmn are, =rrrataa'iTna
unmgrrtuqamm :rt=1rraa1t=Imra'rq1run' 3
am1'al'rm1
alawvfaawrmunaitmmn ama
aaaauututgaaum wmrm'dr1Ir11au;a1 n1
GlJTlTE!T1td-Wifdt =I-3IW'?TU=|?.5t=5'I'=1?l!l-TII1'I
mawmu srmwfmarraamarmmwmmunmn
awawmmnmwmmmmlt
it a wuaswraftttmn aaaaraumtr
auaatufwntazazarriwr aaraaitamr
ma aa1zsTaua-r&umazIa'
n-e!-(911611:-ah1ta21-cg-11
2-wma amutrra=rmt1%rm-era-mtnf-cg-535
auaa-zumtm-1T-t;-I10-I7:
so an ta;-:72
rra 13mnura=ra1u1cri'e'r-c[- 531
406

aunmwam
dfmmwwamwmmm
waammnmqz 8:121? qzrranua 1'6IiH-II-
anTI~'-I=ratt?=11nRI311at=I1I:TarI:r=vI wrafeuvamananu
aanuaaaqs awcraumawmmimarnmtru
wwwwttfe d'tctI'tTiH1au"!TrraTI1a1Ta'ra'rtEm'a1+-'
auarsuirraqaiaar anaua1a:m==rarnr:-Ifcmaaur
IrreFrmu,aa'a178nTu=;a1 a-Ta1"aImara:rua1an=121I.1iFa
tn"
aumra-that

il?ITI'Tf3Ffl!6l1=l'-lT'-'I=|T-f#&T
tr~;lr&q1arr3u a1I1tI'rita:a:a1sre!nf1%r'31:u'1arrr!r1t'rirr1r,
cw! mrq;na=ramun iIa1=1t#11=auza<r&:zzaan%a
ahraaausmrarnmmaaammwaazawmmuuzwm
zraaqdtsxawu an-atdtxr-'rnta=1zsa1Tu~4'srn2zr1!s am
maaamq-gwanavaqa dI=I1v'.a?t1'tpI
Irmtttvv ft aw! amanwqfmdnr
a=iUTftra'T|UR5Inf1H1aa;TfF-gmmazw
1161131 awtmuaanaarmmtm
mwraaiawaawtaiuwmmma
=tl=l6lTriTOuTFl=lFHfE't?a'E'IFaaH-IT71?l1T%fT1TG1
-O O Q n Q Q Q u - Q c c - o Q u Q n - O . Q u Q Q - o OQQQQQC

a-wrrcx lU'FI!l'fEl=lG!I1?l'CI'El-"FF6l1'l'-!l'FIf -q;-533


40.

a1tI1~'-I=Ia:rcaTsrI=r {am UHl1'Fll'l'l'F'-{El'I=l um


Itr=ri1' zrraa-arm: :ra#ftr=I$tatT9?4T=II%uIn1?tz1a'a
umnmamawmw gwhg-rfmu-'tulbr
1?u1ua:=ailam'crn$:ra1iz1IamI' '

tzzs a1rII.aru-'dT.rIf:1I,Hnw1't=t.
as=r=m.1!=I!W<T.I%Twf.Ht6aTu1:r=wI1T#rm.m:ra1=+
umacrvaiu8aa=1u1azmqai.munuta1raamn:1a1
wmmamvtmwmmhuw aransrata
Ir wwammmnuwmimmtmm it
Ina! aalitsqwr mammiim 11
man =nzaaia3favrcI=1an#aIaT 3t1=lT'f'E3IGIT|J
Hnwtmrilmz =IlTunTIu'1i1t.Ii:1?I!1|1,iraI?T
aH11:}u3aFuIyT 3rrmtn'aJR-nu? aTI1'1?n1Tm1iI
In? amaqvrmau? eriarerwqturda am
a=I3araaFn1aia1tI:avI1t*tn=I$a-1aTarIan=au1aT am
II-I=il a1"rtawqaa:rIf?.'211iI

imtl-'tg1aau'-frawrairzrapr
a=rr1?un vnrmawmazamerarmimaamramma
nzwfcwhau mnwamiuwmsmmunwmvmr
til trmsrr-H=I1f an =taIa=a1'3=n1=Ia'<?t=1fIrr
lFm'e1'<=r?.*?| aT6rrmnaH11aT<:'m':ITaaa'tau'5l

,,I:rra ganmuamtvm-an-mt-unf-cg
gsmamhwna-mnammmmwn-re 394. 457, 453
408

tnirgu-aqwawa l17i'\-IT?I6IG1TiIl'c'|lEH9?fl'-
Ernmn 61'-n1'rma"t=x1i==s an. =w3aan1=ur.=Im
tgeil u-1. =ris=rn2 tat. =:m?ten==Ia1R-18!. uaamw
it mm: aalafmmmaammmmm
ilruwaiiraqwar uT=IvfI=a:a-rnmnww, a
whamaan. waiuwdmm. a1Iaua1cratiIs =1
unt

|T'lU'lI

=ma$u-a-Tahaailqwatmtniar
a=1aft=Inm'r sarancriqarrn =Itmrrartra#trra=m1a
trtmavammfamwmu mtatararauzrmmnr
2n%nf&=:aIT wmmaiauiaarmnmm a1
a=?u1'na117tv?=iTua-:rs1ra?T1am:nHa11u12 tagalwu
waunmamaawaawmuamutu wf:d-'raam&=rdf
naafhu lfi1r.uTrn.12'au'dTeI1f!lTn=!1=I'HIu-
an dint :5! FR. ?'v?|!#fw-lF2Icaaa&'l-1a
Iiaifraanmnaznmamaiiaaaamin
uxsxnxsxnxnxsxaxs

int!
dIB?$fTlGIIT('f?l'l-T13IEIl"I1'IllIlvSI
znmuniritmmmcsvramaauwcw in crsatr-tr
401

wajmvwnawammmwlmn RF-11 381315;


nwatmmwmsvmzwaw wihin

mwaqaral vdtrmrz mwnu


wataaat. FIf' El. mtmuaaatmmnmm. mm?
acaiwfaratzuw. a'trRw'4ean='in'

ntmmairvuaurmaamtrnuw
qvnrwlfzmaiiqrmmwawamtimqai I
nataaataiwrunlawavttaatiltmumigm
tatsT1IE',trt=I=rTatEarIar?|=II't=tIt'rmrrms1?1'a
uautrmiutfatmmaatimammumtima
=n.a1II1'r811atmnr$u1w-'ta1nma1mn1fau=5dT
an #1?-Imt$c[a:rawmI't11IuTu 2

wit q-11 aawaurahvtmuw


wmfatamuafematmin tmFl=lIt=i'l'll'|'I at aha
u.aaa1=rirt=It1a1a(:m1'r3ntma'o=rI=rt11tn1ataa1tiT
wauIa1ifdinImatau=1ta=u1zirz1=rr.n1=Ifat8q1sr=c
aurwawaunnmvn ardimmmuam 1 mstrl'l'
aaf=1ta1t11%ImIifsI1aIta1i1aa1=wrsrm!1.u'fu1=t
tmqrmfmtmtimawtmmpttmmn

2- am cg-595
I-?!1:m;T11~?21tI111c1'I'rGr-T11l1T'rTriR'aTiIt-iii?!-2. 1-572
41

wmmaaaanar tR=rI=rtrFIi|"'a1-u=1azz=H'aIr1
ifsittan arr.rrwrua1=f=rnaniu 2 Han an
12:-uvrcprw-aawrcr i. tmaau-aanaaawrrmm
8t=IE'tI1ivarcr'a1=|'=I1%7a1 in wmwmqa
urm::ar=:trmTma1nx:rngirIIadI uni-arm
1?rr\ft:ra3i:Iva%'@Em1a1,:r:r& ap1=n==InrTIa1a'1I
maafszmwmmmwuzac cre srltih an
-tra=1t-rttI'u'Tnm=:I=r.1=uah'adra8Ir1r aar-1!.-In
mgaummnmmnaaznaammiaiamawmiai
uawrhuwnmmvat tII=11Rt?\E'6raT in

nntmfaruqrqiaar. a=r~tterm<-11
GEIFaTI'l&'Ia1=I1. altul talvattlf
(=m=:a=um=a)a1araam m31a?zsTau'-1tarr1'i=EI18=rI=3
Hll1lZ=|'E' qIr'1IIt1IwaI==Ia?I " 3

a'Nq:r8crrmf aqaru rP"w'-Irni


mmuwfamrwwmmtmqamnauqram tit
mamwmatwiummtnamm, arrwfmaiwr
tcrram mmnawwmarrmmai sfanqw H'l'=Tl'f'
mmmmmmmwmmmanm 3Ia1i!nHa1'l'
I-U'W1'fTWn11I1m-1mfaTTI$?aTm-03696
2-1'I=.'T$?1'%ru4a=1rca1 wimaa-n an-r5343
5-atwtnwmwrtm-vnmrazan-c;.s97
41

tatlaarinnnawwsturaat am laatacnm
adrwfmi 9'63?-NI~T-11. maa aarfmt, sa.aa'h'
m'tsrr'.rt't=sIvu'aI1=II. 1a:=naa?T=I1tTta1zh'aa=rt.aarit
&1=I=raw1WIII;a1 -namdt iu marlin"! tn-1!.
ana=i'd-'tfl'tI.' ga1z=umu1maum:a'ra=:auanaaz
'Il#tWI!!T$.11?I?:I'f 6=r?JI'aT?I

Ttagnrvsgnwsvautgrarsvw
qtmawrfcurrdrnmqm-nmwadwnzar mmiu
trt=w=tI?:d12HMf qwmin

auqrasurtvuaaatditrr
trrvnatatz-112m: rrcrnatntmttmr?-mirnmitum
617.312:-1azrt1T3cn'rc111 qawevawmwmmm
11Ua1arra1wtra:1a1=ncr5r umrmnmsmrmami
1'wa#rtIfmIa:taI?maTra1aI=I:1erwr1!'I;t8qIdI
amamwwwmwutaamtinnfirsanawaramnw
mmmmwmin tawmrwnsrmmd
iwatmifnwgnrwrqsqtnairwawnma
1!-T?n'I?I1TETlTV|T'fa't!a1H'ElTF|T3fG!1't3TFl=TI=|I
8-'taflha?atsrIti=1'1:Iai.mTI=a15nrfraT!'I?a1a*r3arr
aiwmirn nmvni:mI.rar=T trtzamwzrrua-H
I2mar3.a=aTah'nrraIz8aIa1 07mm? aqa

1-rtaqamumrruw-q-291
41

avarnuinarumvwwraawruzrwimqqw 8
iFl6T1?'~'~3'FII_1'R|F6lFEll31?|!1'3 mgw
qunawqzqmamurma-1m(u''

aammrrurmnqun aatarraretrmiz
tramurmraw awmrmaawanrttruaatim
mmaaamaerammiumm Ian-vrari--a:1mH
nmm aaautp dma13aaIatH1w'IIdt
a1tmia'-frrt-1t. mnvauvamm $11 nmir 2
ttnra El1"lZ'<l-cG|V|'11'!'FrlRiWE aauwr
FdIF3i|1FI1iII|Tl'I

qwrawtaawaanmnmtzwn
anmnn acvxnaaamaaurqvnwmatnm
a1'ta1a1 wnwmwmwwmmmms at
dtrUa1:Isr8m#eaarT7I1'Iu1atzenmI Iw
qIl1I1TFTa113I1{[a1lilt'36R1'!J1'l711IEWiT=I'8F
=nmu" iralzaaanqzuqvrtanqajmrmtlpf
Radta-tin atamatmmammtaun Taadraracgr
@1116 lm! '-'l3d'c'{a1I'I'lI?Ef'l'Fil"13'I'fiilP"lll

I-larlw-Itatadts-qtcrgm-I;-65
a.:m1t1'r'r1aIa111a1m-ah?-Itm 2-cg-691
a1qa1mI=1mt1a1z11=r;r zoo
3- Hit {-293
a'=I'1'1'Tla-1'rfaI1HI{-591
41

mwaamnaumnf 'e'r-11arrard'n

=m:a 4f?"FIB?f$ll4'l11?f3'lIUI1
zn=1:iraInu1a't'aafta'1 atawzw zrrwanamwnm
is mfamapnarqmavumnzmwvamawmwis an
mnmwmamnmanmmiuncmwr
uruaruaqnrnqnnamkrwmmawswenwzw W
umq-Ittafwmm-ejmtahmmmauwmin
am=1=m3mm-rrqagmanwaau-r
11TH'EEII'-Ii? 11': arzatati.--'n11immd~Ta1aI=rf
I'HIarvI-~au'Puua?'r31ia&i%wmr aamazmr
d|Im2I3traar=rf:-- 'qag2re21rtr1-az-%8.inr at
wart-fm.'nfa8af?a=HrtTT8favaraT,nn'm*a?T
i:ars%aTaT{meat:'3t%im@:9'PITfa1s'.u1rr33rIaTarrraifI"2

tfrtrmzwuutrdutai It
mans? dt1'a~er=rranara=rrca-at zpna?I1%nu1=Iarr-tafw
mumratrat ?tt&tHmItta-Twligtrr
11laa1m't #sn=I3t!I14Tu111=I?nu?a1Tma1RmI

ITl<TtI:- muniwfhunvxcqumitam
wcszmztr. mmwammaapnammmzramazr
arraxaawramaram rqnzasriuzknnnaa-=n1=:
3- ' 1%mr=I ' ' ' 3'-c1Iv{1'a1'a'-via-I1i:2331;-Ia-F ' ' ' ' ' ' ' ' ' ' ' ' ' ' '
2- air-ahrela -srnzaa- I;-92
4]

=3 azranaarmsszasauhgaraaaamqammqaai as
mrmarmmmmgkmmnaaammm an
wmammu
xsx=x=x=x=x=x =x=x=x=x

rms
tNtzwawr=maivusI'Iaa=111'a
damwwmmnartiau
'muHauamt9uua11ru1tiI am-1
u?la1TImaIa1'ta:1-mf an-nu I ?:1mI'=IT=IIFHIEIT11ilIL
tratmatdwrmrntnzztu ahruwrcmzammwdun
amwaamaamzmwmmammm: mama
mn,e1=I.avsafI'rfre=r|1a%a?tc1IlIrr*ai1=H?rrsTT!312!dI
Iild-Iowa-naza1\#tI1!aat1'rtru'da=II3Ifal<3
ma. iI'H=l3t?J"IT?I aT:r==ircf:1t31im1=1u!z1
HTW$r'tltIaIfTt1TII'I6?r','=i1IlTI11I14|'e2'$$i'l crr
vmiitnml

manudu 5I|I|'ll41'(Fi lhl


tsarttwantrrirrmaarwmnmnmv
adv:- mmmanmmmmmugmmamvmmtu
airnnmaamzmraithmaansmc aammamv
arrml nuawrntmazsfzwrusnviit
wrwrnwaua @arn't-'ua'=r:t arrsamrntarahrnwrn
awmwmwummair tmwmaaaaw
6I1W1Ti"T|llIllIElT|'('dTl'3'IB'.?I?'7EI3iTQl13 w
auautuafmn arlnmtavacanw ana-T
nuuaaianaawannrafuwrtamrur 9.
ammuuwuaimaaa 3Irrr=I2Iu" '
wmauwemtahhmwim
Ilf!I2sIl!I't1i1tai.a1nan1i1i$rIyn1I1f11In1t11ma1uT
Tmmraartadwwmmwntmuaanmn
man.-Iwxa vanaimfftaunmunmwm
mntmmvamrmtwtfamftydmimttuin
Hana mnra-ritaariu 2 ammmna
a11xn1i#za1uxIaai.f!u'r1iha=rvw=n1'unft1rsn=a1=1=1t
11 mrrmanfazaauiuwanaai ana1a1u1=1rm
tmt'3w6=I5l$zd-r1%mIalhGIf dhruai
mmmwwawwinmmmnn mmm
aitwiitila-Taatrtu13tITr7I=I1IatlDlT!lra'Nf
aan1=17'-n smmnrmmmmarmmnmwm
&Er+.:a?c1u1rfa1=I1tm| rtwm arr-ftmu1=tr
u1raa1'=lrtrfIIrI=.' wrmmzirntvuvaartaunmxaam
:1?atiT=I1I'3

I-El?I11iIR1Ha-1t-I1W-I:[- sea.
2- am q;-e24
3- am $825-825
416

idrvzmmmwauaumantmiuadaatu
'l'l<lII'lE=llF|IJF|'|'|1iI 'ma1aa~1wnn?u31"ew R
a(a9ra) mmmmmwqvma r-Miran
eI1Iat=75a1I=rn1wma1wrrr?=Ir1ur:I=1'axu ::=Iawumanuf
a=n==sfaazmFatrmu avaa trurrravuwrtruu
8asvI1'rtft1tnqsrc*rrruI-a=ru1Tutl.1%=aa1eIai1 gun
n-1: a3a=r-stnmmresaarmilmramw sewn-*ta=m
mman mmaaaqmamtmmnmtau
I1iITdIhIWtII=rra1iI' 2

*Raf=Ia1I3a'1'Iarca'1'11th1aan1aaa'r
anqanancm aw? tsuu utasraanm zsruatawm
nmuwarmardanmn lures-hfttga
tmizrmto mro1%-t&a=:Ttr=rtt.aruT11t=rTaf=I1aI1
zI't=rIuara=Ia=1l='-1a=IrIur{1a?=rrHite1=IT =I1af|' dwtfaa
Tm |=I'EE7t''T1=,E>%T13fl'B'NIT aiaumtatlddt
=I13u1a:mfernin Iarmqqtmmehaml
ts'1cHHI3t1=aIa1su=aqITu;eifrf9i&aTII?d-rwf%il1Tqa#
iqxaateiat zwa aufazwanvn aarlafrarrua
l'I|_lITtf6'TPI i1'tdraIr8'wI=If' 311211 Ira
rrfu3fnl1=I1aitaraswu't'ua*rp'cha1e1=1=3 air-H lit

1- maa mum !TTEFl- 1-621


2- am 1- 325
3- am cg-ea:
417

amlma arrtm aa mlyzrrqzmmtan


wrmtvdnmmtmardau zftttamtrqa
mlcanfu mnmtvdmwfmtmmmtaumarn
amt-aT WTGHIFIWEG vamnfaammnzwmrm
mi.
nxsxgxuxxxsxaxsxaxs

m tr 3! =1

EH Ie573aaaa1dmnarzIt?lf%I31ftmuI1t1'!w'3t1?aIH
Q3-qa. am. aim. urWatTd-Mi? mH=n=I1f1mIa't
hlmnwialvmmmrnfanv vrrmmrl'aa1
Em. mmavtaw idrwuaarurfn

11'EI7lP3I'|1I?1=l

aim;-rsa=mar qaz-:tarrraI=m\ #
aaarwautrfatgal uTamI1'l t11I1'Rafriaa
a=uHdaT Swmt wattrrreznu uaqamvtraa
I=Iw Gr!-:$t6l'lm=I: qqmmnwmuwmmi.
zrwcitrartragawmmrtwairaurnwrm
was "
mmcmraaituwu
3l?lTII1ITT1#.'iT?7l!IEFI1[lIluil't'-tlil
D C Q Q Q O o Q Q - Q Q C o Q - Q O Q O C Q Q . Q Q Q . Q - . Q O O 1u

Io I851 mm'c'c-II a=rr- 1EFI1ua= !:'r=ffrrma'rn'- q;- ea-39


41.8

ama=n, await vaua1I'?t4'rmI=uua=n, atanaavfrra


P?!i5lTIl=lT-EI?GIE~?f?=lI. afraimfl mmmmm
II1aTt;Ia'I'arwa=I1'truHa=aaiI' '

uqfr mirmvm rfwdtn


Iltdralvivltl mmwwrmammwm
mamas ma wrma armaooonnrmnru-rma*u
witdwravmartrwnfu ara1=Iiar3.a'rI'-ramrnr, arr

taaaammwwmqamwaswwgrmunma
%f=m1 mam knraaaa-8%: a'1I3a;$I3taaw,s=i"
wra'=fta=I=I1=rr1ruB=IitTI21rII nI,8aa*rana1'n1
a&'~"It.1Ha=ii1=lII=I3l| mmvutkalvmam
lflfi-1'TTCTGTGl"T!'3aW6T6l'Hl1QI?I a~ttI%"tII=rIaiT
amen mmmmamm tm1'=I'l'a1n
mrauumrmwtadi aaaanawarna
t:ra1tr3.a=I'<uu'm:a'd~''M mini! starwnrrr
ganwran

"T!.'~I$l6Tc~'1l-3lT

daridtanlaaaairaaanm
rfanaHaTuI=II11'3a1aT miaimaua
6136!? mtgrtlnmmaf a1irsrm'am=1r=I1 gnarin

no sopoy nanny, n.c. Ilajumdar (2nd man.) 1963 p.250.


419

3FI'$6l|'l'l2TGI'1TFl:!|V?lTT gacra uTrlrma1=raa


?lIT3l'|UT'|T'l'l '11'f'IT'c1f.'?FRTIl aw? iama M
ninawawnmnmn Raf muiakwamwmmmt
tIai[aa*IuI3!nusa1=Fcrar:n1nuarI=1IruT'8u1111 31
tmimra marqmaarnq warm: 114%
miaazanqfqfwwrrmwmatlwm
anmqmmwnnmmqaama matrra1&a1if-mat? .
=u=i=,==fr a1afaa?an1tuf. uma1a1a1aranamar.y'a1w
ararrfu ukaau a%;at=rrIuItn=rm-cnattcm
1-NH"! WTEWFT mmwmmwl Warrtazi iaqt
Elwn"
mnwnd wjvmwt
=Imarn-Tani! uzanaw a1a1=n1'r
wmmawwm aura?! a-titan aaaaaaaiw
wwaraf 5! aarraFrra?a==a'Ha1 . mam

I0 General leill who proceeded from celeutte in Key 1851. with


e regiment tonrde Verulaei (nmru) end nlehabed had
earned undying notoriety for the inhulen erueitiee which
lurked the pregreee of hie erly e11 elong the we: . . . lhe
eyeten of Burning Village". Iritee Eelnee ' tee in nan:
ineteneee feetfully ehueed. 01 hen the hed done ue In
her: end helpleee velen with eneking intents at their
breast. felt the weight or our vengeance. - 'sepoy Hntiny'
1.0. Hajunder. pp.194-198.
42(

Hz! WT1I1"l'siT~=IT armzmgfmu atnfta 1?:-lazta


1-'!f~i=I$v:'uaIf' a?&lIGil 31'h4=I6m56T=8dal it-3I1'qrdl
a-1tarruIlrv.'tzm 2|-13-T'{J9'l!TTI*=l*1GT!IITI aittr
6'fRi=IIdf' 3186-T=I'I3 $11 5=I113'=nHaaiEiIW
=n.'tiI zwu'reztta'tTaam#DGarIIt3aI1auah'
vtsar r1s1raa1=n9TMfawrII 313-'-'n=Ir'ta'taTI1
waenrmana d'tm=IaTIa1mI-T-Iarttro 'nnf1rt=1tm!'
83117 kmvfaan mm" ama7rrI'rvI1'31arm-a
qr-:.a1.n-=aw1ma q.'trI stat 13-waatrt
6IfTi1'-?IIITilI=RIill'6l1I'TlF2 d-'tara=3am=,u=1d
&'l!!IITHl'l nfH3=r.=r2I%I'r,e?aK~I,a3tIu&r,
a'hq~1?nl"ahz411't=1=1IarraaI1rI'n'

aalainwzwatawaafewatdia
aw? ?l=IHIHIwa}Ta1a:1z'tdu-1:m'rc1=iT=rI=II3|' 3%
=1 1=I#au=IaTf=I11w1Tmfiaa'r-uvatuE'fbn:1%1t an
u1uz=IIwTa<a=:1=Irarcavata1euIz\1z*a1uaq1'23tt=rfI
Uld-=It<!=3'TI'Td'Qi'-11%-=|'if FEM

tanuramarrrrma-am=u=nmiaa-1
II7fT@$taII9iT. velakitdtlrif tITH1Tll'3HB'$I
a-'r=11Ir11atra'eII==rai|'
I- I 2 - 30: nutm. n.c. Iumuu. p.39.
3- so far as tho rupouibility of Inn in oonoornod 1t 1: to
be rcnonborod that ho III not pruat at the Chat and u
soon as not: of the suture ruched hin, ho "gt .3 91-4.;
Drohibiting the destruction or when and ohildrcn. - 3.3.,
mun. 11.201.
421

Wa arna=I=It=mP'&trtam1#f
anuwgwmetinmwlasrimftaaararmumwragv
maraaz=n%-ar.I=s=va?a1xHa1uzsg:gazneti,rtau1:ra1
mu:-rarmanhrerarin mawmaamawmm =11
mi: tfa1r:Ia=r'=n=ni*sa'r mumwtamm.
atqqt it Ift%u1'1=ra1'rt"l*~'r1=In1 itmimm
mmwaxramnezraatsrgutnmn anatrm ilfi-H
in wmaavr rnaau=I1=trIw1i.tattt
1=usrr=r man"
?lti|'!Tlw=IlliF

ttmrr arhd'rn1'ta1a 'ca='raI=I1=n'


mwnmu amacuumamaarmn :ra#a=maw
tmmrn amt a'tqua11uz1n-ravugd zramvm
ahrwrmuqawttrnfn imrr wammmums
in 2 wamawmtmmamviawtgv
E'|=|1Wfl6IQ'4l'llEFll"3l

_ =n=nww#mq;rn:rananau-ham
aiama mmrwg em:-.'n vuafm mm:
a!F!T!lT'TtI-'l!J'T,Il'=l3v'fllv=l1T.=ll=lIITl'li. namwauraur
rm: aqua. =uar$arcrr =r'ra"t=I1=nma'-1=rLarr

|- IMEFI-ital!-|=[Ib': (1)
an Sopoy lmttny. R.C. lajundu-, 3.203.
422

mm: wrtcwftmnrzntru traacr-Taaw=aaela


tf=ItTnI'| |TITBTElEItFlTf&lP|15?Fl!ilI'=|Ti'!lTI

uqrarutmmmtiairmararndw
=nn'Har=au1aaan':mmu ara1sraw.z'ra=rtt4't,ar1m1I'f .
auazrau-rramzuraaranmua aarm E;1'1tr#a1 3
m mvfun mmqaanmmmawaavmam
3aI!uII1h'I=II=ITaTiatz11I atiatamtrati. '-I
iI=I1.=n=1nawIiI;rwtmaa1n=:ra3tra'uat1'ratrr
d'I'fd'lT tPr~'-t=11Te7m=IIur.:raul:Im fmartrit
an-rm-rm:rqraa::mar.a1a=r1ur:rau'mwa1ua1rauau7
a-'tamt#:I=Im mmavazrvwu mtmmawm
tuamrrnnmaamnnawqmaiw
FI3=IFlII awrnrawrrd-'tarrnarc= navrarrrmm
r aaaaamzamivnqaarramqrr
mafavair ma. tatturaawrwuaaaruavzn
mancmammmmu arusm1'=a:r1'az.=sIdtrr'l3
aawm wm In=It1Taq=n remawwmmmai
3:121? maarsarun vrasnagaaqrra aaaraama
ammnmnmwhaaulwrrmaamuhmmmw
urtdn am: rrr z:1=rII;'rzf-'rmTc1'ItI=:'IaI'f B-7D1F\"ITlI
"!leIh4Ian1'-1tarmr6n?m1ru mtrsgurmtanaara
=1ra='ar2#ara&m1qT'r=rwT u-13.qad-nan aha
mwwmwmmmmmmwmw
Hit-$Yr=I1aaf u=rn11J1tu=:arrarI22'c1q1v1=:1s manamnvrm
garmmraimmmmww mum aramitir
423

nmnaarmiadhiunwruaawamaa mm dram
awarawarmaaramn mwmwawnvmaaa
ahwmatu a1Te11=fI' a1're?tc-um:

am1=?an=nITrrn~m'1nIr. mm.
Ql?i14'f~iHTitdT{TErTl17I:aIfiE?IT1311!I ra1=1a"tTaa=raa=I
rmftraarlrfcmn mamaaammqrmdtmd
umar=riI wmitaaarmu amgfm EISTRTII at
anammmziuiamwwiahwwmiu
mmwrnmwwmmn amIzIi=riaam'-13321:!
TcfiI~'da=TlTl?|T|T|U'Fl3Cl!i1ll'?1=1=l|1'TClT~3TTEPT
H-'T-1111311!-Tf3FItruTl3TFI!'l11il"T!lTTllE|111'fI
=rm1m,aIr5ataIm1trrana=n
mm: nimwwmmdmahmmzh
wf1,a1tnaaar<c:ralGI=1n'ru1'ita1Efla1iaT=.cI=H1ii=
armmaftarrwmmn a=i'm:-1cn1nfa=un arm
?f=I13E?$&'Ti33?I1T=l13lE'6TE'PlIlEI'q'T1F'lPJII
==l'Mt=rIwTm-araurrmli- ararrcravirtutmlalarl
amwwmardnmiuawmfmqtna
urrzn'I=m '
mgqt 1'Tl mmaiwhawn
rwnutr mrrcxa. ufasdqi atagamqgwnnmm
mm:
|- um N-lWl'!m a1'di.zran1'- 1a=rm:1n1rrmm1rr- I;-354-360
424

Illzgr alt:-I1 ail-asgzrnrarqr


tmuwartwarrm wmanmmmmmmh
maatgarvnwuaaawrmarttmn lF'!Til'3!lElTt?f
trmramarmfamramfraaatrfzawo
anasrrawnhtrqar arnmummwwaur arm
mnfanwmrnkramnmawmaarrm
rm mmmmmmmam azrcrdwtm
rrrartlrmaiuzt aaugv cazntran mm
aoawwd-'Hh1?a3aI1'FttmIwi|'

7?l'l?ITq'T'lH

aRUI*arIiE-I7-1TaRtaTIaa'r3liFrul~i'=II

varaamfmiawunmnxfizvlagawaimmu
Hlfa?-Il'*ll'TFfIFiF'l-'TfTr H538: aT?.'1iIIwrI
El |ffFlFlErBR5FFi!1'I'T~iGT'$I?lv=1=11HTz='UiQ=i
573%: vartm armmmmnwwmmmmm
tanfu mtaaiwwaaiauaaaaimwnswm
60634? rtwmawmmmmfn wlarluatant
Hlll a-'t=m'h1uTI'eun R'='u'rErtgq III?In =1W"TH
1|=l'lC11=Hl1TI'<llE1T'IH3=FI'=l!fl=I1I'iII'TllliI
H ett mtwatanawmwuamnum

so :35: mmaau a=n'- mm 1=T!:T mm - cg-352


425

~nmanmm=Ins1Immwahak18=awmtma
a:narr1'I=ft=rIIa1Ia21Ttaara:I=satu1,:rtaa-'rarazt
aatr?-.11 ~-Ihtvdalattqr arDalt&rqquan| Iw
dumwmw a1a=Ptwr.HIfaauT1a'aa1'1'm
naat<1ta1nuIava?Tuna=:zT airlaarnzvaraqr
mttran

Tiw ma-r dimmwauzf


mrm1a-fIra!11-Ia'c1=truI rmtauwssooo
t?-wa Wqqwauzaramarmwnrvtwwi
Emamnnatu mvaran=naT=r'tu=II=I1t 3
uma1sma3&wam:n'

mmtmmmmmmwmqtn z1'cn=I
I1%rrm:a"rr?m=a1=r%% faran'c?&a?a=<=."r=r1' iF%'RIlIF|1
m.EfasFa'I1tt#an'?uaNa3a1?n1a7I?a1aT<iFTa=ia1I?m
anrdrmnwamawwrraanu fa=aaIa11'm=na1m'afT
wrarmttau-Rmfta?au=travwuruTaaa1n arr
anhraarai: mm? 2 ffl'i'rl'FlI3fliTi'II3VdT|1
qawqwmmtimammmmnu
lXaXuXuxax=x:X:X=X=

Io I851 In '11"l'\'-TR: main m=rr- lEI'(diT- tg 475


Sopoy Runny. pp. 299-305.
a :35? an n-am amen mun tnarnrr- cc-476-479. am 11-I965
426

IWTIWHWI
H=J|a573a'liI=ITI4'5I1=I5:-*eI=ITrdm1a#
Iii iluznaatrfeazviln maumftamm
aammm I=I1-'taauudrIt.araIITtwH11tIm1aa=a11I(
inwmnmaauanrammrmtwnmrmm It
crumqmarnwwaawnmassgcuawatntaamxaaarcavaw
&'tnrau=I111a'a:at%m=ra-r=4z&1nra?fw:1=ra'1-c1t1:uTwI!3
aInTafm=ImIt1Iwlfffda1I=I1zrai ail?-ail

araamawuawmqura
i=It6'aI?!1\1rlcTlIITl~i1aIT avvui
wnmmmznnmmtaaaw
ill!-ll ' wmsaamrvhawtmtmmmw
aluazuutycammmwaivaamdmml 3
tcmqf aa1=n=Iw=r tn almII1$arcIaqa=v=Trrua
mmwmmwamnmma tn-III erafsazt
qq'q1rgq|gq'pa(Dootor1nootLupu )u.1q'IaT5'tU[|3q=|
nes4iwtanwunrr1iwti---~-q-amawnanm
m niaanaiaieataannzmrum
u-11'r=rir n1=na1H=n"

aadrufsanzxaazwuivn at
|- no Cnbridgo auto:-y or man. Vol 1. British India,
Chapter nu. pp.58I-82.
.2. Indian Constitutional Doeulontn, Vol. 1. pp.342-343.
427

mu mmrmmwamnw gem avrqra-ea!


11wuTm=rtrnmm'tarwfaaaq;a=rir an a=mrqag3
qtaawrnrqavclml idmqmvmmaqa
a'tTran=I1'l n1=I1atT==f|i&11aIuTa:u=IIatzsITu'r1au1u"

as1nm1'd-r91'-l%mf'm'l

aaamdumartwammfawuanamwai
a-Twtdfl 3'F=?lW''l6=l'lfl'!J7 a13Hr.t-EI'd1T
I-ve:Idq;6aaI=lr.:ra1al3alI? iE1'l'aT'Ill'l?.'TI W13-Tf3P'G
=rI1=IaI=II%I17zaarHrnuw3=rr1vn{1%:uan1mfaf:sTI'3
11=rrtr11an1=1uat3aH= agaaatmataawixzrwaaar
mam a13.Ilu1rra3atrz1lt-fIraitarII1I1Ht=rd'r win"

auel1.'t~!rawn'i1a?a1'11r:n:rIFd-'r
vsvmwmumatewmmmawrsaawnmr
Tl1a~l3!tt6ualHIrNa~'rn'r|~.'uaT61*l1=IT1TB=IaT~iT
maanoamnummmmwwammn
i|TPfra=I1-'tTl1d'r-wt 11=1T'11a'i atnta I-13??
itmrn #i~i'??$t\1'rfIIl=I1UI1'5HD'l'f*-1!5Tl?IIn mam
uugfrm amzsarmiiamarruu aiaama azm
mummwawwmammtmrdtrarmn

1- India -Mm 1526. Ln. lnhnju. cnpto: nu. Lord Dolhouaio.


p.201.
2

3- *n=1r ax=:ta11- a1I1=Iama1a1cl'rIfaT- q;-es, wmansee


428

8:i1=I&f1Hra111=1t2sIrI1=Ia1'cTti| mvaaaimwl
itaurendwraao EII1frEITTilT1liT1=1f1Tl1?a
?F|?IIRI?1TFU=l?l7IN=1I'HTa?lTq,'TEEFT1TI "|''=l aft?
mat:6r:t1I'a'rI'qTatl'u'eh1=l9\1Iar=Ie1EIa%I Fl f=I'lIu1=I1
I161: a=ET%aq-frat-ai-=11 atmamadrauafmai
afisqtammn'
ma anwamaaaatum
ifdtsla ma:-[=IattrwI:mws Fm
ttrramni H-1l'l"lf=liI'I3d'R3E|l'tTi1'il!I"|T'TV3el.lT\vE~nT
=z;aa.ewa1v3traaa1=ha3w1za'cIrrIt'w1tn=ruru=7t1a:=IekDa
if-I53! H-i Til1a171Gr~'i1--lltt'1'f~'-I=II1=IardiT1'#Cv1t21r:I=I?
Ina-n=Il=u:T aaarrv 2

iI1r$er<u1anTaTta:1arPaT aravamns
arimaaii TI=1raH't=Nr=I1=u'iu" 33mm:
1T4tn?tf=IEFo1iIHi%=IIiu%1%Iu1'#a1a-'rzfw:r3un=tta1'I
wan Wvata? an-cat=;?-=rwvd'tH'.'tI#na~1ara'
zrwrt stnuat-rntw-11ln1aws'rf0sTI mrazrl
W. I1T{1I?|'
waaaimtrrawlr
aTmavlTqfau1d't-a1a'?usI1'dr3I%Ia-5
in aTDa7Ia=frat313=ra1Ttaa?:ramm1a?Tvm3trfdrqT
":7 ' ' ' ' ' 7-u-uI~mrr"ai%'r''qIe'a ' ' ' ' ' ' ' ' ' '
2 LC. lajundur. o9.
i History of Indian Mutiny. vo1. III p.126. nyo & nnuu-.
429

arIamarr=%$t%zrrt'rr: a?m=rttr$z.'ra1=I=w3If maa?


3urr1tn=1raaIv-m aImh'a=rafr!I1=IIti#aTRa1aft=r| er: I
U'\"TCW'|'313Il"I Gtmamhfemvam
mmwdmmmmnm rpir uea1I.'rdfI:ri
Ha-aa1arWTa-umamth tngaranaanafmuzua
madrmwac 3tl_T<NTIiaraair1'aftI1aWm'
TI=Tr31aTmutaa'r?Iarwaad-t?nT aTITFa'w2n'th
u1=Itt1-awzne aammiumn amzngan
umm-irmwmrmwmammnm
=rtf aTUtUwTj:LUfut3aa1nn'rnuazFri1=I1a'1aafeu1I
a1Tqaa'ctrzriaarrw1a1 aawamummaam
am-war-1!: taTt1i'lnmT araIfu'aTua3aIma1a1
l3?nfaruImtnTPn'l1aTTDmT3=1aw<3fwniaa
=Isl'G'faI|1'-fI?I?a'IT!1ETGif6TI1F1=IIITII "11'-Tl?iI1x~m=I
anwmiua aI\1lW!Wrd't, ' mmm W?
ntmmiqqqqtmmaiazfemiu atwmaawmaaa
11'1T1Iia aaftml

uamwmamaawf
nmmvatazwmmmwufnmn
trqnawraliurrtrrrmn Uaamuwmwmnww
Iaqganmaawannmwmu rrrrtr-frmnzrrqqw
zrasfr-r=1r1?m=rua1n atwma-T=n'aT1raI.FaTI=tr
3'-16lI1iT'R21IHETlElTl331111=rI6?l!rWll<1J1,@1G
Iuttmmazmnnnmarmtu tmTI=fr'11=rwrr
430

1Iau8tIur&a:1Ia'rIaata='raFrI=:rI|" '

=Ia1aaa1rm1;r(11=7r:iwI%r8at111'=rr
a&wv5I)arr9tr:'titaa=d1TaItr&ma1awravP:1IInarr1%:aa
ntrfa13=ra'r1tmI t11Tat-frz$T&1n,a!1'u1'rGI1=Ia1!n'r
TI=tr&rita1arI:3atI"luTTa161atT:rav3awa'cu1=1
mmwmatmmwcrathaawgawmn tmf-L
mn gamut mmwnnmmmmmmai
aart3aatTrar6u1ar&a1a'I*7ta3T{z;'ttad-T*a=I1qTerItvI
Qua-33$! Iain azamutwzatrraa
ham man? Rurftaaanwtwtfiviisatwsum
W3: Uaunurrtfraltnaf FTatv?rrrh1roaauatrr
naumwaaarmmauumamaqqt Hrnmuuwanmmn
rmvsamnthwnmumxrs

areztraraunutzaku emu!
<51 ammmaaiammwtafmawawdwdtatn
awwrattmairagzszuamawitnmnmwtaraaar
mm m. Iii-a?a1=mI' gem aran1'rza=nrund'rn't
in:

ml: 31:?! a-Jamarr


u=mHa=ta'fra1a1'BG1 #11Te111!IT=IBTb1
mu did! mfkatmrmrffaarmvu mm it

I-Tl4t6IlI4'l'411I'-*IFI?:1'r'.=l|E'I1<IT1'n3d~T-!{- as-as
431

tharmwnnmaawfunrurwfamn at
6m=r mmarmtwen arlutmuas #911
rvdimartalawaamu First-uaiew
wmnmzvwnmarammmw
I11=ftd'ra" anfuadutmwmfan
mu aauiatueacrrnqaaaiuirvirmfamtganmn
mmuwn waauraqmextuwairurzraaauwva
tmutialn ahdmhamamamnmn
d~1Ta' ae'tIt11fI1iIITI'6I!:=Iazr-e? tr'r\1=1a~'raF=I
at1fn1m'aTramramI2 aqzqurmtrwmu mt
awdtaraaamwai wamn F51 tamzrr
Sntmmtmtadrnhdtml Ema 1'?-1dma~ItIi
am =I=rr8areci'1Ta?rnarrrtrrvau11117ITtfmalT
zmahmmm aTdtm| mnaanuimwni
!Ta:saaa1t?r.terIarq%a7Tw1Ta1i'&c[a'narr&tt[a'
aaa=n1I?II1Iaft1rd-Ta1~:qaarr2mfH-tut$9aE!t-u$Iz?
frv.-=n=|ar='rrna1Tui=ni1 uauwwmxfufmn

amsa nnaifrhattfwrlaaatmaw
am q'tI=11rHI1=Ja111=1'ri1ta&aFcTiHf'#u1-tt
az wrtratamnrvawrraamwn uzmaarammmwt
mm tn errata 3Tttw|-amad-1cu'r\IrI
mtaansmaat msmvmamu mum
atammrannanfu rrtrtr auwam
aTc1iImwc"a$??rnI=1T awmrndr tr21'rt11a'tr1'1ir~IFcII
nmmfmn arnm traT-!uad7araT a-#651
432

arrfzzn. aaam%=Itn1=trwTa8n

wl1Tr=trd't'ri'f?I1.IlH.n'al'rTnE=r&
aruzraizfaiatn mwaauaaaaaarwrraraw
mm: aamawmwna urm1"tzsqaa'r<8Iraau==I
HT-=m tqamftaavuaatmtruhsktr gr
itI=1ftaTa1n=7t4'tt=n gammmu wmnms
=m8vuau=rra1ciatamn:ra8rtru1uarat1va'arI:34
6rrcrT1a1Irrrh awaqaarIa'r11=ttaa1'rmrrr=1r
vnarnmnnaanwraarneuwarwamauaaramemaraw
1~iI2-I1 d'rrI11tn=1g wwmmmwm :1 Ira-13%
mwhmrl immcrfrm-r Itwme
3ul=IurT1ttII'rII1=r1?su1I--=rIrn=frt'3 anfeaawr
nfzm =Iurn#r#rUcrm1a1tn1ltuT marmaamaitat
aTq{rmTt3| fdaa mmmmammm
emqamd Stavdlaftan
aftaimfmwu
mrummafmwwqtaandn
'I'H'3'Ta?'l'3'lE|! mwmaqgamnwmu murrulp
=l'l'HI3I, =1nTcT11aiI116i1ag'3iH$rr.'IarrtrT
I1d'ru'ra;zq:Y rrmrraniiwzakrrmrrp;
ht-ImtIarrarcrt4I=11?rIvne11t#zaa'ra't,a3U=Iarrd1I1aT
Tua1.T1=1T'3tvanTrta1undtaTR'm|rrIftdGHar
#a=mI1'm=m an afmammaumtmawmum
tt=rata_2:uTncra1u mmaufiwmraamu
433

wwumaamgirmfuigafa 11-T
(man mmmcazrammumaahairmmaa
VJFIT nuaatuaumvuwmarrmmunwdm
arar-I 'rra-ragga? aiarrai 3FIT=lGlc'T'l'f!1fIhI11'f
nmamtaammamgfattaauaaurmm
ra1u%IzrTu'i1Ts114Ta?Ta1?a1=T=IT'arIIiuTE7:1'ctu'ra1iatn
ritacm il'g?IEI&3IT3'*'l'l?5'ElTl'8l5rf11T?l'%1TF"d|lF
=:T:?i'tarurrv;1ftrTazT=.1?1=I1amamrrrasTq'Is'?Iu'a1
era-raanamamw aeusrwmmitmn aT3=u'm8
mmuawaumtluragwfwrmmurramiswuvmn
ianaarwaaaauan 'lW1?=l'tT"l'fT! aaau
ummmurmmmwmwm. aw=na!1=a=ru-?5ut=n
mvqamim aft-Inn
aI1ra1\a7rIrIazr-1

triTl'I'-1T1aIfazIT8q'{tr GIWECTTTFI
Itu1u1nerrauacrTaa-t13:i!arn=Iuar~?,=T=ITI122' aaarr
i|T!",'l'f~:I'1TB3!16T?Tf.UWTiE1'EFI1$'faTCUEl'1
an t?sna111=rI= vrfmrwaawmfain aaaam
wiziw Ilraaaam ma=aHaTirc-Ia1naa'a-1?
rmm T1='lT3alI13I'lT37f[?3|?lTT*.'T1'ilTIt3'=ld'l'l:'
=In1a1a'r=rIrt1=rrtI'fatI121ua%:'# c-nffru mnaawr
mmwimrnmmmgzwammnamtmmamlrt
Smmmrtmmimammaanmn mmqwatt
1? an 11=Iwuaa=tu1a1=r=rcrm mmmqzw air-*1
434

airInura1au=irmzrrt=I1a1a"rsuImn"'

wrai Wtaumarfaaiiaw
mhmn ddmwmmmmummmmm
aItn'arlata14aa1-wIm2:1=Ii!T=I1ra:rI3a:aiuI'3nau1ta11'
mmrnumatqaiumamaat
=rrrn=tras=nan'amam1n=n aamaariamnrwmaawm
=n| ll aII1iarl5t:31a=I3aFa=IHIla=5uiza6H11rr
!11!11.:I'GI9uaItDPi'fEFtRITft=r| an tm'3FITlIi'Fl
=ra :irm avdmwmamntm d-Tai
gwmrmmunamaazvnmmtattu
anzaa I'lTTI1T3xT3If<"l?|'-'I3'1s=|3'I'G'al1=l'l"l3"'|'ll

wmgwfuavaiuwmta H:
uahi. zrsvu qa'wzz1f&aufc'5dIa=I-traaawfana
tavurdwr maa11=narftvnzrtrwm1=fran1rarrI6ranT
a1aznv{urrrq,-arrrasrunitartrn in
Mmmumrimimm
crrau'-:amnTa?w#dTI=rarttanf&twr13wr,waa1ut
wuivaal
zrtrartgqtatrltvaazwiutat
tutmawaiaramarru wt! amwmmiu

v- I857 an tzrram main a=rr- mm =1n"rrrmarrcn'- q-43o-436


43:,

T H ET H

nasviwnenuuiuumgsmanw
uIr{mrt'a=st'aHrm=na<uma:1a1Tiu1aaamu1'm
n7r'rat1%Iaari11aItltr~siIf!Ft"tua=:1ai\ Itraa"rfI

nawam mawmawz
imr aiadtai-1n'nua=rrdr.at1a''lr
&T3H1?3!3f3l1J611'l3!WlDll?$f33=|U1E'PI
2| aaunuaaawutdraraeiiutn tmmawr
=1rtm1?Iwa1%|"

mwptmnw
|as5rrI3ua-tail? rwuavsm
auwaimrmmulwwarwrzzaa
203 acariraraawdrifl didtau n-I tmh
[3E|'51?3l?l?E1'l3TU=i6I1'i|TT=l3i'dfEI'5?[GT
~"t'fa'1 a-12I sr ailTiIl74rHI1T#6I15I1lU'ah=I
faan maiarartrurwmzvsfamrmntwmn
=1mi1=:i=h%mT wwumarnmawavmurraaaw
O Q . - C . C O O o u o . n . - . . O Q . Q 0 O - . - c cc
4 0 . . . (ho) was nt guilty of any over not of hostility
against tho British till the morning of lay, 11. 1857 Ihtl at
8'0Oo1oek Intinoore tron nirut arrived at Dblhia They undo
l*?l1ht for the palace . . . ' Sopoy Mutiny. n.c. naaundar.
D.229.
436

atamtrahnlzzn anauaamrr in-ra*r#wat


#urznn1ia1aT 5Ia=8arI2v3;a=IuwI%a:raraau-Iq1t
wnfmwautalavwmitasu zwwaad
a1Ha~1rn' ahwrrenan T-'l3llTIEiI it armI11IrI3t-wI=I1
fsa-rmTa1=znT a?=3iaaT.'maTtruT anzam-tun
113: fl'F.=i'r qiaarqrf-Ial awamma RT
3 tataamzmnmn zuvh am? Sfara
ttliaaua armaTn=.'r|zItwt1ntfa111Iw==aa%|"

masnlaaguxvtmitawurctzeiw
fluas zr{a1ir3u'taiirI=azirlcuT mma
3'33. It-rirlw aiqaavaguawn
k FlF-I:
Itarr em? $t1'=mna'TrwrreTra
aan= $3133. 54. an'14=1aTz!'ri#=rI'df,3Ifr91F
wftr 83t8=n%~a1nf|a=!1#d1 avairmais
qzrmu aw am atravrrrcrranwrsmra =4?
EH1!-'I'l?[EI,'l'!~iTTI3~1'l'13'?iF'l'l?1T tnnwriarr
an mmraaawamammnmnuwwr
wt nT,afa=rm1'aurTm1Iua1mTrmaraTI'
mahnmmmwmumuwmr atmam
itmawu 3'-'-lEN'c"l amaratmradma
aaa-'rmaI't1IP,I%Fata1ztit25111T??tzI3|1*-It vaem1=I1ut

rvri Rat-it-(na57) 61- araarratadr-t1;-4o-4|


f{a?fmw1vI- I966
1-Tanmnfueataumaare qmnaaarwn Irwka
crtatr, maamuatwwrtamfawmnmawamm
F-mo I
atlqmwqamtian iwqefl an
aI211a1=I111%n1Hunrc1tIEH13u' 3

1?I7J1'41T5'3'kl?5'I'l'$tt11-I

arawaaazmmmwmwnauamnrar
wraaaurdtnilm m,1%=Iu3ma1aI==I1arsita=i
crivwrgurmnmn aiamwehnmwamai arm
wrrwmmatwnmrsaaafaaqaamawnmw
aritmwmtavwaraammmmwn man
13 4721. 24. 21'v1aTa-'rI1rra1=t#I1a'f tuamlvw.
ail rd=iI1'r=n=1rrc7tuTard1 anudrarrfrmt
urrmua=na1aau=uatrariam:- 3

rrrctm
rrrm 55=1a'rzIitI1rt?ltzI=I1=rIa'@~=1T
arIw1t=riI' mmmcwwawmw. mama
u=aaa=rimT wif =rI=1T. diammrumnars

2- an I;-I23-I34
1. I335 sf ?uE.r;a' I =;..'o1s.'.o'a' ' '
3- an I;-I35-I37
1tarzrarrwI=I1I'u dmmwaamwftml
a1'a1wa1aT mm. urrcirexui am. 1%, HT,
tan azau ['ff|IE~IZ=I1?ITl1-T1?I3TqTa3TI'l'I"

ardrrzrmiiur
arI1TdT23=1aT$tuaz=II?r1r1i-mu
Wimma? a't*frtt=I131ftaiIStarrIr=I'5ttr3nl=3 1&7
mmmsmvwmagvu a?'rTm=u.'ru1'raT-Rats
waau diaI\1wIm'u=naf!av3rmr*Ru1aTm=T
am caurmmmustnawwwairsowmantf
1-I amwu aauawaiwrawfaawlmmnmn
mt armaizmnmn ssaltinaaa
aaz dzarrmrwn DWI!!!-IEIF-T mnmamhwa
"TE-1T13f3E12l1?i'l5iiTlI.i?l?FlGIII1JiIE' azww
Fl!FIE1TGIa"Il'r'lIHH a-1l'|'IE|T11l=T|.i!fffl?Il=I
fl-Ia#3I:1:~uir=rr32}Iq111&vari252au1 318
an! ahatrtzaaurmnmn aammwqrzamm
aaait=uqa'1'tv:ra1ufz=q12-1r maria 2
mam, =I1u1aTaft=a31ra1afr saw
awutlrmrtiafefr 3mrra.1a=n. U=l'lT5|'B|T avian-T
mt z'artm=resaaa1=I1.tra1qr=I$11a1a1cII1I3I1aHI:I16=I

.. I851 31 man m=rr- t'm1n'- cg-uo I35-I31


2- 15-2111?! 'ft,'f6I1w12'u;.re=i'r' 1- 353
(Ie57n%rIua1'<4ilaHnT-uwwr-cg-n3sgn4o tuna)
3- I857 mwrrmumaumr-Hwwr-I;-Ina
lilEF1iI=TTl=|T,"7!l'3|'l1TFE3F2T1'3TFi1BlT arr=1'reliIi|
itaktart. 2 Fi? mm? airy?-Ila? mam? mam
an-1!. aims. =II1't't. =mmaw rI*efr.trrun1=rI'm. amn
am-.'. amt, 5arIa=mcr,fraq;r. a=I1Ta-aFIq;T.1a1I1uw.aw
=13, '-1rnaatI1tntu1= wrelif Stawnianaamam
mmm. H-trul crrmmurrrui atareurazttilataat
amemamqvrwaammawwi.
Iuzurcavrqrmaa-trm1aaI. erneT &sn'ah=I1-ua

wrm-n-czar: ummaia? am
a1T.I=maa'rI;IE?I1tef=I=It[a1 a~1tI!m'i%'ifa1u1Iat-!a?I1
t1IITn11a1a?I1a'-TdtaarruTaaIai'*LwF=I1iaaaIa=i
awmrtmnimiiviwdvawwmitm
lwmmamunanmaamaqtuiwnam
aaawnawmmmma oznaan" 7

3- rm 1- 242
2- ms? at urrara E11-I'r-II m=rr- marm't- 1- 242-243

4 ertr I} 141-152
5- am q;- :60
5- an '1; I62-I89
1- H143 fE'c'<1t- 61'-3m' stain -mm-iers-tees-es
44

I1TWRI|3OlUH'd-'l={'1?31'l=IlE&:-TT3q'ia13{H"(7{!1I3
;r1aI3wIri6f?:~'t1c"rH8-3'-;;'sI1TtriI'

arcurrutvnaum
mmmauwamfmw
it=m1ata=I2t-'r=rr=t='tttr'f|' E! #319111. =I11'rf=Ia1ra1
n, 6TE-i'ra-I11ldT ma-rawrmrmmfm
wrrad-Terr11=IHI-1In=I1tfra'ca19TuIam: aunzama
Smuiwmiammamaamndrfnmaua
zrr:mr.a1*mmruqwarcra1-rr; aaII813va1wr\%11?m
Grimm----rawh&rI7wrIa-1a1a1afaa1vr=rrrH i,
art'ri1a=Ia1a'&1%Ia1waaa1TttTII7Iz21iu'

mafaqanatquvaamnummmt
3cmsrm91ruaan1h'aarr9Iara1srth%arr:::sv'(z,1uaa11ufr
mmmr)aaa-mtrin"
I1aul'a1arctntd-'ra1 UtlfN'lT=l'l
~nL
aawfa1atana11'%n-aaz-3. mash
a!Hrl'l1'rTII!5,U:3zI?."t?IT<?.'<1l=IiITFiI aharatraaurr
arI=11.aI:tnrasru=Ia~1r3v1=i1wI%r?n1f2ana1av:twauFr4Ia

-9 WGHREIT-eiazaawmmvdt-goszss. 14, 31-32


2- am F{-lllili
3-{ma -cg-uzem =5-I54:m[a
4 I851 mmmumdiamr-mm-@275
44;

u1=m'urraT:14afa11avz&u2t|twn11Iaawfatunurr?:FItau
afar! manavummwwmamnwhacwm.
IuwfuIa'cw~zuI=I1Ia=:raa=Im'eHuiTnTm,u.'uraa12tq'fP
#t1T=rmftn1'i1aau-11%n=u=rrItaa-'t11d-Tazrd-1a1a=nTtrr
rrra=ra=-e.'a&rrr,:mutIua1eurtra? 3'-'IW'l6I'iI'=|'ll=l=lUEE'
u't=I1a11!1=-aqua-=I113rzMz'119i Zwatawi a1
Icrr=It'-I wmamlwmmmmmmmwmr
u'riImTaFrI?.ut;rth=1ttl%n1H8aratrrTin'
lE1f3|%'1F:lfH7ElITIP!llF\1'Ilfl'IHFllT

=m11ra-1 T|=l13l?!'llGTI1?l-?f'l'Il'!E|'~'3

rtarwtat avmaazuuaimumma
memtmawrmmawiatuwu ntnaa-Iwf
marmamwwittaqawnm tqcllmgtr
srn1laa1=rrnmn<a'narcrma-aaamgarx?'raa
qa'esu=Ivaafaa:rratra11aaYq await farm"
vmailwfmtasnmamwvamat
rP%ataw=IerI=I1&t&a1a*t'a1tI1a111I1l11i|"
1- mm =q1'e=!t- arr-m-=xq=nrrr- 1-235

3- at
2- ma 'a17- mm mm - l{-I55-I55

4-{ma -=[-u-(waa'aarq- ussznna)


5- 1a'-1a1i&1r- '{-I56-I57
45- air t[-I62
44.

u1FautI"cuTzru'n=a=t

dimarawwumahmoua
ucaa an1?sI1rIaf!Ia1u1lisa'-tru'1a=11=]=a=rif unwa
Ifuriarnlaaimlitamuiavuirratgara
a'rI=u=m=t:1arraurturcau'?:awxaahwtuR15rIzt|(n)
i-11?:=ra1=urr=11tu=af1arlTuIIaa1un=rf=rI=unTa'ma1'au=n
maaanqiwreaaaauaraarmmu '1
ma Irma, u1=urtuta=naFn=I1. !lTlGl1''I"=t-IGTW-11

lI?II'f?l-l'l'T3(GI'Y1'72=l1=Il&'l'<f|'=|?|'l1-ii,
mrmmnnmamahwmnsmwfwum
gnrqanmf aawc 'l1'lE!l|'E=I'tIil'1qT'l'!3FTE'I1=I
dleH?r%=I13m2za=i a='ra=Iam1n mzau-3-srrc1iI=:1 a
an-ti-!:HTT8azIler it gmmairawtanrm
maawmamwwanmaeuanzauan
amt agqanmmmuammmwrmam at
TITEI-T<i'|P7TfITb"FFIl1?1l=l?FlIEI3q1F!3l1'GT:5&'l1F
awmwaammrmamwgvamtamramawmu
tn1trrc.=I1?~ra:taTTazrtaaaa-t=m1?m1 2? mtarrdmawu
aI1tat:'tlT.z1a=I1azarcrwvar:?raairTauaana1a-T1511 fa
wammnuaf 11win1%rafavEI.mafaqau'r.a1r
mwmaamawmwrmmummmwr
l- I857 at mam a=n'- |''l'3-T- q-I;-320-32:
2- waa12afr- 1- I77 vqa
443

mmmmai dmnnmaiamwu
2I'=l$fl~rIB'lTTfl'I trlwre? aumraaraunum
'-1:ramTmIU=I3maarrI%I=3wI tara=1a=ia1=
muawhavftarmmrrnmu aaatailmuamum
wlarifilatsaunlrc mmgag aarmuraaa
B1%Iri'tId'taI7=Iur~?I=r wfuva ftrGIfana.af
aqua-rahmafwaaetmwaagvarwnurgmwaw
irw =rl"'3~.'8II?.t=l15-I!-T1f'5RlI7|Tl1l!TI!I1'.dl'
u1::nttrta%--"%i1{r=Ftaa1z1'rru7s~TraIIta-ra1tr
aarraratzrradn anammtiI=Ita1=H.'H=_a1=ru=rrarn
zrwru-1=rtr ,1laiIa1tr=uu%-za'r'taazF1a1zfm!t r-wan"

llif

1ItqIIIdr1'r$z31en11tm'=rra-=1 ihfaimaa
maarmmuwmiwtmqaa an
awirauuammuaa mwmmammamamm
l3I11TT'IFfBlT alum? ahmaatvdani uamatsm-'Hn
mam ar-uaru=t=Irza1 it emad-'ra=iI' we-ua, a1'tIn1a1
ahazemw a1anx&11=am1%.1=r1twrn-cvrunmraa ma
mwwnxmtiuahweam nTnfBu1i|a=I&<3$
'l'|=II-TIT 1iI1'aI!F-IIHIIF-l13li|E?IBlT uaadratiamin

?l<=I'nRIIi=It-:1-I Sqaaalva afana


QOO-OCCCQOOQQQQOOOCu-QQQo.-QQQI
4441

?;1Tl=lEl1T-I'li'-'I.lllIq1iT atawrarflaitavin ##r8=11z1i1


1=Iz41-ft a-Iatrauin tuamw atam=I1wI1=Ia1u i
atI1%Itm3amaa*rmurrI1nu1iuaa:t1uu11aitax1
nlawmar tIatr3'ati|=1'aH=m'a-I a1Ilau'rahT-iii
f3't'-I1?.<i an ta1=IuFaaaiu=nmwum=rcr gawiumw
at-saauaumi. "a1T=Iw'd'&%IInFIaa=ra'I:i'a=I mm
rvraaa:1=:1rtnfi,x9fewu3arwIa=raru1rra1i.=I1zd-1ua
H1I:1=IULvf1t=1u'i,trrH=I1I'rI%Iartatu'rurr:h an
aiwFIuaana1iu'iI1t#,1-n1trmt1IeItIfta-:a'r8=IIz1:s
u-111 wrliwa-'1-av'n1%lw'd't:{m raw?-zrxrrnar
(faHI%I!1I=s'-1Iza~|' ~atT:rn=um? a Ifria-'la"Ia=re=sT
u=mri,IaFi1III=r.=rIa.=Ir=atruz=11aT =rTI?I=TrIt'RYtEIT
aII==1iI'2rn1f1FvI11'aIFr:I=Ia=I'fraI1i5tftHIfu=Iaa:=It
5PlFl!1l=lW=I1.Gl1T11T-Il1T{?iiI1?I21l'lTsaR!l'TW6TI'
mam
?1?I'!14FPI vduzwa zsumamwrm
|B'4rItr1lzaur$=Irazs$azrma1uT3FzaIWtztrn a=n':-am-kt
lm vmwmmzmmawtiaaammw
twcvmmmarammiu aasnma mmatmununrm
TlrdTIa1traErR1azr1Er:=;ata=IdTz3qvfarm1uftq!fdrI1'l=I:aT
trr am? aarganirqtmm. tzfvzlaxm, a'a1Tf3a1Im'
wqanmltgmwamm aisrtaavmi. znmr
I-fl=-tmtflaavza-f T1rl'!1fF1's!I-31-$13!!-C[-374
2-Ult-#4! -='tt.'-q-7. 3, raTH4taI- I956
at-n. a=mi1nrarr. mm, mm. FlI'ClT.!1'=|1i6l117."1T3Tl?I

Inrin
in mmqmmmwwnmaam trrrnm din

NHl't1?a:r=In1a|rai't'r=1'rTrI'ztr1':i=ul-'t
trI1'aI!u1rurwI:rI?u1tfztt,aquItr&aintaa=ntiu'5I>
!I't*{IEl acataaaqawt-agvimfslwitiawe
H-1m=rrPl6'dI31qa1?ra;IdHITtt3uUHt1%1IIeIa?9!l
aazavaummvatamaatatasaraaafaaafaa lam
7ll11iI'T5lE1' tfrtt-wmrfl qarutrmin-1n1aT an
1&t?ITr'I&W%Iu'aIiuafTI~iuaI!r1f?46aa'e1?s'r5z~sr1<*I in-'6
ammmmmawrnamgam-ama%raa=1ma mu
iTfE'I'I?1'Q1' crt-Imml araacrrmaaataiz
Svwaqnrqwnaamzmmmmwmwairma
mutate:-3.117 a1In1=ra11zn2m ':IwI=rI=I'zrr1a=nq2rruB=1r
m~anm&rcu%fd-wahrqvniahwavaameaafarmn

i=?r='#\3f?mI6IE1l13T award! am
1=rI'Ian1=IdTawm1a1vett1.'-I1:aT rttrammariutama
ninm? a1auman1=:aaw aa-riwncrarif an
wn1z=r-mintnuuurraantaammaamazmarmaa
$u=a=It?I=H:: --am? trqsz-irmacraau-nan-rguna
f5m3I

Hmnarlf uanmtm
Ina? 3Ml|6F?JlTI=i'l"l' fa-1Tl3IU=ld-Tii-'tF{Tl'T1F;Tl?{F
zIa1=r am a=u'Ig11auraaFl' tlp arrrnvtmin
446

Huaawarmamaaarnnmuwnaw arrcrftaurzn
in am-mqa aa=a1-air vaaaimayn aanam :r=I%
tr-1:11-il t7e.aTTIt113a17a?JIa11Ea'na*n11ta1aTqTaaa1'T
It-ttaI'eTrdf.a=I m1aavaa1atau1um.uTm'aI%uf.
qarrztrrratatitm

namasrmmdriraaanmqkmma
qawttrmnqznmrtrmitaahrmimmm
=rHrq1nI#ra1?1aI1ItIzt=a=It11r1aTa1q1I" muting
mwmwii--' mrvrmm
mtawn tfelamauuautad-1I2.we=I1a1.a1TTtavI
8=n=Tamrna=um'=ruI1i-Iuwatua uatarimt
mitt-11iniv.mr=r-Iaavrwm q'aa-3.I31n'a
:I'IT=I-6I'fn'tr%.rs11aTta=n" 2

m$=rraa1 it mawmmrmmm
a=Iua1%uI3=1a9drtatwuIe1I=ITIa=I11a. mm wm.
vdatqmqum an1:raasra3trra=I9dF1. 11a1&aIfm1l.
?I<l1lFIT. ma! atI1?v1=:u1vr'I'aia=n3=na'aT vmaiu
a=+3=m:-ca? mmamnaammumamin

59?-|1=fI'=I?.71l|ll15. wrdrmawm. aw
tn-zPrm'rr, amm am-, arafdwirrr srazra. ah
a-1!'t&t?fcm=Ia=rIza1 Iunaa-31-Wan
2-mu-n -c[-6Ramt1=nrIa54
447

ammtmavhuatrqwagtnwvmmanm tlmutzrr
7l'?1i',IFF11'EfiIf'fl31T~3l?YI?I3=I$lElU6'1 at
an-1=nz*a1 it maamvammmmnamuww cmaf
3138?: rfatmawravwa-Iw'au=nnRuecIH ma-ava
rmmagmmaaia ahamavmimqnm-nmmn
m%|
448

3 ll 6 It 1'

mam auramq-ramaammarauws
mantra-tiaewvaazrmmasnmaanmiaiw H-wmm
d't\1'rusw1ttTzITiu
mnmwmmmsimiwmth il
ui'm1-tmmunmrivaatwtamie an-18=uru1:tt
cuamfmmi?
Il'iE@l?II'l1'il!5'-'I1E'EElllml'=I11II=I1|3lIi=!!<.II Mm

Ilwuteft-Ii: Nttjlrq awstrtiirivawl IITBH


H=I&IPtTiIIT&aI'I1e8t?lTdT'I?=lli1I'3I3I
umva=I=m=:a1 it qnmmtmawmnmimv
mwwmmvrin
IW|lT9I'!TE'-'i1Z6tIl%aIIe'l<il'll"l. 11%|
mmarwwawntnnm imawwanmagsan
If. mHsrarI=w:I=rwII'taI'1'r?aI mnrqnmmmt ml
utmlutztfrarxiaimrqznauin mam
Mw wvanillvzwnit
t1atrwawaT=n<11m1= mm WW3
wtuunmwlin tuummrwmrrsvtm
uatr-nurcrcnitninmiu mtmaawwtuwaiavr-Ii
a'tInaI.at1i=v.'t$1'Rt*I1raa-T naminn
11?ItIr3=r!T1'tBTrI1u1=Yf|?6nTl1I1 aqui
449

PIEIEIETFECIT-1tlT3=IGiPl$lTfFl1ilE'?1llUI'RWIfGTPlF
mmmrmamaammmmmm:
imtzmidat uuwtaamarraw
l'I?l1|1=lif'&'GT1?11T|fBm'WUIU'{I1Fl=fli'l'1GllY
IIIIIWCI mnanmwmnaumatnmmaavrmvamn
aaumzaa a uqraaraammmmmmnuvaurqtaumaa
d7sraa17m8munanum12rua1mxftm'nrnInIrnwfqa'
amrina=ai=:n:=1a'a'ra3v;a1-narr~1d'tuIB=III11 aria
man-rain aa:t31%ru11aun.1<amuefn1=IanmI1ann-x-R
I-1mm1'taa8=rIz1-t &1=Im=1':rq?zaTni| ward a-f
vgcfrua=na1 sawaanmmmailmuiimnwz
wttmurTa=Intaqz1=I1ttaI=1twwu1a'1amar
inst-unI%n=fr?fua1u=If2Irr=IIa:qufiu3aI'c?ri'4r
hmawwnmmrmmmmmmmm
ma! wgnvnwadimnarnmtwnwan" '
mmaqn rm! 8=Innw11(tawa1d-'t
tluaaar-ItrIaurli'nm1 mwuntrmqufiu a=Im-r
tnuqmitwuaav a$1'!IlN'l'*l'-IIl'l(WatlI-I can
ah-avaawauwz-an with wlaammairnira
amataaqi dfrwmw a?aa'nr=tqnr=;-znaramrr
mqnzntmuarlanmaqumvu immmmtm
ammratavmrsrmuavamrwmwm
C C C C C Z C C K C C C C C . C C Q C Q Q Q Q Q 3 C Q C Z I C C C C C C I QC
450

8arrraf'caY mnarrarm-Imecrlaqaaamnwmt. am!


mwiwvdawt 3ImI;=I:auaa?n
mum-ms1 mmwmttw-amnmqm
vmmmrw uummtmn =1m=ira1-5:211-rut
iW?.|'1'RlP?'-?'I1=l_'!T?!l3tI|75lTl"lIlJ'e'| mail Iaat
namimrnfmmrmfrmatmlm-srwawama
a=I3=nEa-|' 1? II: eta: utmimmmrtfw
ans? wegmnmimvwmmmiwrw
qefitmin naamaawemumamwwmamw
-rzmara-'!-1,am!q:awfauTar%wi1vnta
Mimi itgarlwawwa-1nI1aa1=u'v$r
Flaiua=!=!u=uIu:%vaI=fa1rv=s11I::a=ra1:!fsraa
Ita1aha'M'f n'f#dtra1nIamu1av,vuqzII.au#
Q(IIIt3=1HRR!l19'arl5ld'titnh'tI=tFI!I'a1a?tti!:1
tr3a1airu=1:a1u-1t!a1uTn1T=I1=i1Iaitu=I1ttM'1H.avr'
amamvmzmsmmnmmmaa-mmn
mane-muutrnutl ammnwmww
warmth aatmwazvmuauwnwnaiamgrm aa
afutnmmiu
wmitmwnwrtwtwrimimu
Fran amid ammtma trcnun-ai ti
I-at mmmmmmmmvwaramswa
mmwr-tn? aznmwimmamwmv
U=TM'z-.l3d1<'3Hl1'tRlEl' wrwumuqfinmian.
amumn. mmaammimsaaa niantwr ea
tmwaim ur=rruaniuIanu1iuaa:a=ut=I1r1=t
auawfmwmutn
452

mutt"-W
anal: t!-qit
war-Ir alaatmaazu

=nzu aramrr 9'9-rs . ma-1!


namqrmz mawaaw ma mum. man
qmuam I962
2-am1'Ti'rmI=m1I a11a=I111u=I!rn1' qmnmmw
391.3131. I895
3-a1'=I1im Trqmanf nauwewwqfrear
mtrwm I91!
4-carat azuturrsmv: =r1'rc?ra1'r.tamaw
a=maI'- I962
5-er-fat daaamuwmm mwatma, uamaw
mnawtvr I959
ca-anrra-t-it =mamnaaz1e'r ammratam-nnwt
mtvnr
7- amram tqirtdr fF4'.f*=liFI. EFT!
Buttdta-tut I964
e-a=rrI1a=1=I " ai1=d'rwm.1a1m1w
Bmdmw |9se
9-a=mi#crmr rmmvmrtr =9TTfPl3H
Io-333$? tqvldt 3l'Fl*1Tl'x'-ft, air
wmamvr 1912
nu-um i=."',FI13'{!1'l1'd-Fl mmamzemnar
I963
I2--mfhi il67flI3=u1 FFF?EP36$l7-Tf,R'Tf
I8-3'R=P1

I9-WRIT

2o-'6! I'l'l'Hfl.El1'I"|'|''-71

2|-6a1a'l'q=rWl Truantnala
warmazrr
R11"T.{G'l'l uses
22- uiitniz; fF."HF=|1T
a1-w'r1t. 1955 '
23-I!-'l!11TiFIG1ZT afar
non
24-rlrflanx 'lTl'I'P''BFFH

25-ma aw-r:~:-2
26-=I'a1
.u+.3f"."9s"?
27- aina-' 1'lT?l1l'W1, 1811131?
28- vrasa R11 WWW P93 FR,
GWTITI. I948
mum, $6
=1rrc?r=1a1T.

751 we sFI,1&'ur
I958
_fnEu _ _ _ _ _ . __=|TtEEil'l: srdnms. dfafw _ _ _ _ _ E
3|-avmrs all?!-Irwin! M
:2-azztrurm :r=z=m '6!!!-" =nsn-I Iamaw
72:! :95:
33-autT=I=rI2z rt-I-lra111=raa't a1i'a'=rTe11=r1EI;a6trft=r

34-atfntrrc aiemamanf 13:63


35-am Irrwawana arrrmraiu. um
36-sI'kTd~'tn-I 7lT?1"I&'TIE|=If 't'!;l1;r2
31-m=Iumn=n'- ImI=I'mrs1't
?I1TI61TE

39' M I958
38-I1I1.'I'l lrfw it Tl"=FfP'TEElFEl1T. amm

4o-zrrrauarlvwm wmmza arI'nITrnwe 1226?!


{H11 It I962
4|-rznfaar ar(1=IveIw<";E whim; mm
42-:aw:1'I%r-17 azn1a1'm=m.' mm. 61m-$1962
'36; .
43-=I21TIrt Ilqrr W ammwegszfnr
amcIB=Id'ra
am mum. u9e2
Tn=I=Irl' TI"=I=I1"t'rIPIErIatI1mw
45-Iznmn ammmrmau aaitarma. rm
4sqa'eraT a;=~:1a=naatn ggrugm. sr|I'x91t62
41-wslum Ifrql W 1!=I.'r=t={, Iarulw
4a-srltr-irt avwwwmw ft='r Imuaw
mm I1|'l34f rm
3-%T=':ta*5-7";1.''s
. 31!?!
I960
imam"
't1- I960 toss
n1=Ia=a=zgav1%|r:;,aw'1=1

a'da'a61%I=rI'R'a1't

T'FFllTFPE-H?-I, Iamaw
{Em I1-I95:
an11'aIa#H.*Ia1
mrara mfta: 11127. war
I957
993 FR, mar
11- 19529940
W 3
1a111'a?;n- #1313
-Irrara
awn. I959
mftmn. nan?-It
=u'vrtrsmrft'rtm.=mr

3lTFlTl'WPB'FFFI,1?T
9
I973 llllal
Giamhil '|' F1 RTFM!
113918 we aw. tfr
I962

C C C Q Q C Z C C O C C Q Q Q C C C Q C Q Q C G Q O C D Q C Q C C C Q C O C C Q8
C C Q G O O Q Q Q O Q O Q C Q O O O C C O O O C O O O O O C O O Q O O C Q C O -0
mm 11::-wt
O C O C O O C C Q O 9 Q C O O Q O Q Q D O C O O C O Q O Q O C O Q Q Q D . O O C 99
fI=<.'r
@133 I962

t1=I?da'rI'IEI.=:=ItfI

tllggw $96!

%I$""" "35,
'l|~sifFH'IW3?R.1R~<1'f

9%? I959
fi=r \I"a=I. TGITTWW
1561 I963
UFI.Tl'
I962
I=et=Ia=I.tamIrI.'
I958

3:-l'u1I$Tr. I956
'l|"FlPV8'I-P-Fl,T
In 195 I959
atmmvaa cI=H,I?a-1'!
nm IrauI=I.=I1'12'ar
am: 11 I955
amrrrm we tI'-cI.:E1'r
I955
1'75?!
W 11-P?9;T['
3%?-33" ."9"2.
C C C C Q Q Q Q C C C C Q Z C C C C $ C C C C C Q Q Q C C C C C C C C C Q Gjil
"W . . . "W _ " _ .. W . . "' ' ...... -
313- 111111: smlwzra wrt-amlaawmm. at:
09- mam n=r=n'rarn1
9om=mI=n trap! W ydtan =m=trrtm'
9:. auammw TFIITl'?l'FIf Tratrras-uass:'g9f,a';tr
ea. 11zf*Ia1ada'r matazw mrammuawert
93- ms ITTIFI M TTT'|'E1.'ET11.1:T,B1?<i4T
94- QEEEWEFI 1111-1 M nnwaw qarggsgsa
as. arut mrmn ramr naun tam. mm
96-Hrtrqw I1'lTT5H Gas:-vam=ft.'1;'-29!
91. ftmrr KW %_=ImaYg'v;,va ztsramru
9e-mrllf tTI'arrrn==I'a'.'r l?_.HTqF_ggTg|gl_;1'l"{
99- amqwma " zfe=!fmalaa.l1am|95s

'0'. I W I964
|oo- lama 1'rmawrr{a1a arrzaqanima-fr

102- warn Iqvl Wt PII'6l:F9g21'v.w-IT


103- iatuqr az1a=1a1aanf nzztmmsamist I1
no4- mama}? tq-I Wt m 19E.l.91'1;'l'<'-Tl
no! if a61i'mw.'v:1H it I960
gays-we tIu=tt,1?<1=1r
459

____.""':'

EFIT an =n=r Wm 9'6-IRE, darn


loo {sauna mam mmmwmwau

'08. II It
|O7- mfarw " "
:09 wfm -- wmtumwmt-L mm
no- dhrmrrnam ammneuetra
I960

Iir. I960

mat

Ill at it nqirft maimwvuaqsq.


mHr.arrtn1I9sa
ua- ETC! " 3T!'5T1'lE"%H=H.
trait. Burr 6:962
Ins wm amrntwus can
air. :95:
46(

artaawnan

-.-E. . - . . . . . . . . . . - .33; . . - I - - . - U - - I-5-.- g!"

n- aramnaawa-awn-arsrawuaa am. urlrnwrcnznsvz


mac
2. arrsmumrtaxa-rwwr
mmarr Tmwum m'ra=:ua=I. iawnsss
3- a\'I3Fra==t=rre*a FI"F maaqmmmm
RE-ff, I910
4. m-31'-nn=erar-as
<iIrr=n:2IsrT 6l'l1'=II11"',F1 amnqaaaamrqn.
aunt I913
5-anRI!i=%t=ITc"dT Ii
crrarvz=I=rIza-1u19%11=ta1-:t!=z=1ru-ax-11141 ='rmrta:raarr.fza1t
I970
smattwuwtarhttm amrrua-1rI=t.1t&'rr :91:
llt=l'l'1'll?.'|rRI

1-mmlwrmwmatmww mamwmmmiisa
=rHaa1aT'ert{=mc' iI1'6- nsu
it (man was Bllti ms
e-arql=ns1'I==:'r=n-ail 61-a11=I11aznmIu qraadu1=I.a1aq'r

we[I'av31a1r amt I970


9-zmmauwmz 11-1|I1aw~1r Hl'<~'-1a'PT|'.WI1I1'&'l1'E

aauwrarear mm: I959


no-@1cn1ftusau=rrIa1 mwmm ahwtimwammwnm

In-znauiw uainw
nzaaananfma aIaIra1=rfcr=rm1 iilTf311l'Id=l,a1"l'lTI1f
I962
#1 an wmma-1=-I
Ii==.t,q'15" I973
1:-nftrwurn El a1-arrlvzalfr amwqasmmnqm

Iwraarravl I912
noaaraasauwrt G!-1H17J1|fP111n1HI6II1'-I-1!'lB1%B1=i.1'r6

ns.=a1nP1crua1t1nmn'11na==:u=za
as-nu-ammqgirerr auirarlrravifa mmwawaa
ft=e.rm1rraa=r11%1tra awn: I973
n.=Iaac=I at-11=wrnaa3'I.'r a1-rmzrwrm. am
92196. I960
Ia-=Bufl=T=Ira: at-miterw am=Iaimtr=I I967
|9- =nza-arrraw an:'m=r1=rraT E-Ijw#wm=L lIT:1;_.1:
2o-we-mniwznlrnhw asntmrtat arrrtru==111'mcm.arIrt
mind I968
2:-=1'|z*-aurrtutfaruzznnmunf mmmnvvawqmar
aramm um :91:
zzmnasaaa: mqtsawqnrrfaum tqfauama. Ianww
29- maa 6F!|'W6lTilI rlaawmmmmm
sum: 1912
2|-=rmad-raw Fa-dim m1m=1a=1.tamm'
qara I959
zsazwawihvzzm nnaarw auaamalazratnssa
as-rcaasrrtf'ltrI4r :awa=uH'ma'anm1u*ez=I. wait
mmaafrqa Burns I960
21- srla1=tmrzrl'eII'arr G1-Tl'|=I'l rm: mm: rm. tnrgmses
2&WW3 61-animawamr m'aarq;taaaz=t,arI1rn
29-wwaammaakrmw
mqw a-1
HM!
30-D'ET'TIT?-'T=l1E'E 31-ivfiwu

3|-war1rrft=~*.'r=uzu
32-141T'c11=r=I1<=Hrrfm 1161-=I"F=: area: as at-=II'1?1t. I968
33--1rram11'I(a1'r 3 61-aIt=n=rrrru-I rl=v."tmm11urr.n'a1I7
tawmtrlwrutw
ama
34-Tl'3-'3'lFTH|'|EG mcn=m1=.;am I=:a=1t=1rf=1.=trua=I.
Hlm WIHGW

as-WF~:=z'TI=IIW whmm =F1&ITwacFq,a11Irt-Ir


=m.~mrm
36-t1n?F$=rIEav " mu in-1tI=I.m=nrr :9-:2
:':-11=rnrrarn'i?v- ui'Ian1% tartar mm. ava=I:I
t1m==m'1a1amn mu I972
q'=|T37WI'6ITQ

as-11-iraa1aT1'i='r=I1a*a1-a!,11nftrar

39-allmmmmvra 6'!-l1IWD'Hl
?I111tI=s=trrm
40-El|1TlPlF.F5l3 wmwm
an
4:-ammumnra 31-!|'i"I9'F|1'f-'
#mR4=I1as
42.9-*YtI1R=1?rIP! av-I=\=rE
m an
43-amaurra amwain
wmnaunsu 'na=n'utr=n'
45-H1Iia1aTl'a13FI=rqI1I?8=r1tIT
ah
4sm11a1a1atrtazITaraIu-mrturrftal
nmmarmum
41-aviavm-a:=rI:a 11=ra1=r=rh.'
uatmtqmf
43-I'n=I1'atn-Tr Whmfe

49-1I=ta'tTur-n1'a'r at-1vm'ran1u:rIu
=Iv:ummna1aa=n
znuamuw
so-It=raTaa11&aT'aa'a avaam BTIR1 5m!n.uhn 11-1970
qa'#1%m1f%m:rn=Irem aianru
aa=rrc=aau:zr=I
5:-I't=<.'raTrnTm3?Ia-31-an=Imm (IN Wlk, |914
muma at -rrrqzm
aa=na=usamu=I
52-=~."ra#r=m$r8 sriq-_uzaT
@f'l1=rlC6: a11i'l'nlt, I970
vruvquaunnlaaw
53-wraiuratmu 3'!-'|l|iI'-'IT!'R'l'l"ll"'f ma Iirrcft WIN
mm Iarmw. u914
54.=~."r8t9-1111tI6au=u1wnaru'Ia!l
s..1't=r &x?I'em11mau=urua1-r-rrnmmt
TNT
56- =?.'r8t9111fI=$ Utr Tl-WT
mrmmmwmrr
51-fa=er$t9ta-rravrrza-1 61-r-tau
tnmaar
58- =~."T3aF?-I1TT 61-urtzrmt
'-'llEdi

59-1'a=d'rm1arrar=Irc-a-1 at-1'=rI=r?v
waanrecnmt
so-II=r=I1c1s as-a=Ifl1t

5|-t-'-z't=Itanirr .=Ira1u=IrI

62-f!=~:'r=rI'aafh' amfattm 382.115 I31 mrtr,


aII1t=n'l'I=PI1im a_r'tUIT'c1T.uII=I1Maa2o25
I3-"?5T=|Tf: nun ztrmaln 'rraI:1'<=I we 1I,12E1t
aiu
TI=m"rtri=r nrwarqasmaawm
aunt I955
11-=I'FFW ararmamamm
ERIN? I967
1"r0!ITlf1t 11u=Ism1=I. a-'I=1T
Wilt I967
m'1ua'ta1 %1=sacr1Ia1i1=1IWH.12e-:11
Hutu? I975
COO . Q Q Q - - C Q c - Q Q Q o Q Q - Q - Q Q Q - Q - Q Q C C C O Q Q - Ca

se-=v.'t=I1zts:q=It$=:h=I 3'!-E5FF<iI'l m"=:.a1=1I1'r :91:


as-fwrazaau II-T11'?lIIHT-l'f=I=|ll|J =rIra=I. 1313137:
in!!! 1% I958
1o-fI=r=na"mfmn1 a'ccnaw=11 mwnurratw-Ia
viI'|'c'.7flT5=|6i'?-W! rm REIT. I958
amr Irrf I964
1:-n=et=Ita1n1I?urm1a=.=rurFatnu1a ur1'maz=:.?m=c

mm-m :91:
1a.fl=er=rrc1Immm1i 31-mar=n=m ammmimrm
13- Iwrmzmm mwm arawrratcru=m=I.1a111w.'

mar: :95: mo
7+1I=.'r=I1z1s1uTuna1a1a1-famunf =?:r;wIwtm'r.arrrrn

aTIr(tn1 Burn. uses


75- that am: Rnzw-a iaunfa aan rarftar cm, trrrqw
15 r IITEII =na-cs atnltarr mm? ti anffems
l, I914
um mutt I912
17- timarasnzaruz at a1=I==: =nzI1awd1?r,a11m

re-fH'rai'eqva<sr|1?ns aaz1=1I.'a1au1a=I rr1rqIr1srau1=I. man


WW
79.f!=~=."rtna1a1qIa amirnt =I1"rt'ru=Itmn,arI!7r
wfatw-Va-mum a1mma1sn uunaaaa 2029
61-auinrrrmarla
eo- =r:tmma-1tIc*nw #61-=I?F: trausrnmiafem

Mfr arms mtrdt .


en- fwtmmmmm 31-Tn-ca-'-mar~I =IFTff9?Tf'tYfm,EFlfl'
ez-mu 6llliF=r'l'il mqqmwaggs
46!

Q C - Q . - - . u u . . - c - a - . . - - . - . . . - - . . - . . . Q ouwqn

I965
nan nmra.qa=n ram
cram Er?! Rama mesa
ruwrtz WEE!-T,fEETf
mo
ah-Irreitsra-1tH,rarmrrz
:91:
13:5! ncra in-EL
1m'ruw,qan:H1- I969
aamrnw tiimwuntmf.
Ian-11 I965
a9.~=1'-i.'r.m=?m'eztTa=Ia=r at-mu 1551:1345-Tsff IWIIEIEI Srdm=I.=
=I2Ir air, u9s2
so-wrnwmauw awnamaxm ctailla Tchl auq,'n915
9|. <.Ts' qa 11av;n=Ic"u1 aanwrvur area 1a=d1 qaalulsss
F-T519

92-f?6.Tl'E=I' aIna1"e."ta1a maamarI1'ra1aw%*,


'a'E"a amrn.*~man1- 1974
93-=1rI=Hqm=I=1rra daatrrar =1maaa=I1111'rm.
31-'-NW. I969
C

94-9'I'-=n=It-111?: TIE? SW Tram-:~I mam


Bzm #3 I96!
95-u1==fI=H11Ta-rm at-at-taa FlIllrGli'|"'llUH.31H
airrci
96- 9'H'l=l*1Tl'1!I'|'11'Gl fa-an I=I'c.'~I,1t~Ir!m1.'
mitlm (aunties:
91~BTiTl=H1l'lcl?!!nT!'Q1H rftatc-11a a=I1'u1relH
46

sayau-amvtnnvnfamam =mm9a1-nm1,a=mr
1933
99-*lTl?rH-l"H'!1'T mrwwmtwtrwwqmm
am-I1.arnraI
uoonm-araI1%nrramu'au e-".1-tIlI'eftEI131I ==a=1Ir<mwa=t.a=I1m
{m1tM963
Iol-Wrrlutltmrail ivn-Crna-T vmnmmuaaf
qmznt I951
Ioz*1TlRIl-rl'liff'lI'TIT Tfa-nam=Irn anwmnmmnww
l96|
uoywmwmmnmmvaqw fruwwqamau
:04--Irraawfa-1tw't1a'cm Maua amnrwm.
(Ina1afh'crnwm) Iawwmivfn

|97|
nos-urrdarfarrquatatm dirnawea tnrrarsltaa,
lT!ETl|11"1 =n'I?arr.r;aTr
:95:
Ioomrasfauwnntarra ?J'|;=lIlTl'diIT wuulwrmwm
man
I01-tmadtumaeuut uqrnrar anzrffl=tI1aaa1an.1an1ar:
mitt-M961

am mm
toe ue51a1m-mmaau Ia-1rzrsz1=Trr 11a'uI=1't11u111n',=I112a=I'r,

Io9.:311aaR1t=Hma % Ia=.=rIaarrrrerIas~a
mama amm
no-a=1amsmurwa:ra1'r 1=rI3<ma1aur1i=etranTam'aa,aaf
N3
(u'xsrrani"'F{srnu1n)
uh - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
an an cram. mam
nun-qfanurmmmm vesarrrmf '91'
uuatutmataamttatm muwmua 13!lal6l1Tl?lEIP||3$
ma I962
113- Ef?iI<.'I'-l'[ azranmmaammmzma
V-Fa-RQET

II4-fr-l''I=rlR'.1:ElB?lTf=l 61-rraaarruq au=nta<una=I,a-=rrm


I959
nus-Iazatfatmmsau aarnmrnl FIl?|1HlflW113H,=I'l'f"w
(trm'ra?rTI11tm1) qralssz
H6-a=1aa=Iaa=Id'tiFIF 61-(T|=|13'l1"I!l'=l|'13'=!1lFI$111'?.'l'.I957
l|7- a?1a<~.=ir(nes1) 31-rwanatr fI=z.r amrauna
aiamuzfr (H11 M969
no-art=rwrmwma 53ll,=1iH awmhrvuaictaww
I96!
n9-mmTIE.T9a'ma=I 61-11m=warua1ac'nm=rgst-Itar
mtimra qmu I968
:20 ={1Tl' 1fam3fr=I1'IT I'3v?tlU=ll9'Ul!'l=l.
rcmwrc
:2:-=;maa1 macaw! mmara1tFI.1%'&1'r
aamaamur aaf uses
amata
dfifl

lLI.1l_L0.QE (3393133)

122. An Introduction to tho Hillion Esntry ludson Goo:-gs G. Enrrsp


study of Litsratun I co. Ltd. Sydnoy.
1910.
125. British Drssn Allsrdyoo liooll Gsorgo G. Hsrrop
5thCO0. Iatdos
Edn. 1962.
124. nksspssi-' s History
Plays
3.H. '0
125. no Art of Duns Ronald Posoook Boutlodgo 5 local:
Psnl. London 1957
125. Ihst is Art Loo Tolstoy
127. Horld Drnss
00.. 3
Allsrdyos liooll Goorgo G. Ksrrsp &
1949.

HLQIOR! 300 igll


128. L snrvoy of Indisn K.l. Pnniokor Asia Publishing
History Houso. Bonboy.
4th Ed. 1964.
129. A Study of History Arnold Toynbos Oxford Univorsity
Abridgnsnt Pross . London.
1960.
150. Anoiont listoriosl
frsdi tion
1.3. Psrgittsr
III. ht.
Hotilnl Bsnnrnsi

131. Bihsr ihrough Acos R. 3. mi 1003"...


303501. 1959.
132. Chsndrsgupthn lsuryn Dr. l.K. Hooksrji lotilsl Bsnnrssi
snd His Tinss Dss. Patns,
133.

134.
Glispsss of World
History
History and Oulturo of
Indian Psoplo - Ago of
Isporisl Unity.
y
Jssshu-lsl lohn Asis Publishing
Gan. Bdito r.
Hones. Bonbsy.
Bhnrsthiyo Vidys
Bhavsn. Bonbsy.
I5. Iietory of shehjehen Benereei Preeed
1 Delhi. Sexene
Idie einoe Independence V.D. lehejen 3. Chend . coop
B0-bl.
I95
idle
157 .
gun - Ihet it Teaehee In luller
153.
01:1-4 lietory of Indie Vincent A. aeith
Oxford Univereity
Linn. 3111..
I59.
2-reed
10 Fell of llughel 3.1. Irlpethl cut:-e1 leeks
Depot. mum:
3111 Ban. 1965.
10.
1\'\- Eeeede
3-181' the lerethe Iehedee Govind Publteetloe Dlvieiee.
l:I.n.1.et1-7 or Infor
eetlon O lreedeeetng
1961.
1-1.
30PIt1ny R. C. lea dulder
12.
&1"IId his lines Juluneth Berke: OPIOIC Ltdo.
lIdr..e
130 Tl" czleel Ace
H1-In cumu-o of lheretlye Vldye
Bheven. 101.111.
14
TM Cam lietory or 3.3. Dedvell
Indit '. v - nun-n chend & co, llev
Delhi. 1968.
1341"
hpire II. he Indien
15
'1' D! or Indie Jeweherlel lehru Isle Pnbitehlng
House. Imp e
t6.n1e EiI*
Pculture
or 11.0. Iejnnder
1351
aaltenet- The Delhi Bhetetiye V1 dye
Bhavell
17o 1'50 't III
Indie A.L. Beehel
Orient Longnene Ltd..
Poole. 1963.