Vous êtes sur la page 1sur 144

Rewriting the rules for the digital age

2017 Deloitte Global Human Capital Trends


Start exploring with an
augmented reality journey
Get a new perspective on the 10 Global Human
Capital Trends for 2017 by downloading the free
Aurasma app from your preferred app store.
Once you have downloaded the app, launch
your AR journey by holding your tablet or phone
over the report cover.

COVER AND CHAPTER ILLUSTRATIONS BY LUCIE RICE


Deloittes Human Capital professionals leverage research,
analytics, and industry insights to help design and
execute the HR, talent, leadership, organization, and
change programs that enable business performance
through people performance. Visit the Human
Capital area of www.deloitte.com to learn more.
Rewriting the rules for the digital age

PREFACE

W
ELCOME to Deloittes fifth annual Global Human Capital Trends report and survey. This years
report takes stock of the challenges ahead for business and HR leaders in a dramatically changing
digital, economic, demographic, and social landscape. In an age of disruption, business and HR
leaders are being pressed to rewrite the rules for how they organize, recruit, develop, manage, and engage the
21st-century workforce.

This workforce is changing. Its more digital, more global, diverse, automation-savvy, and social media-
proficient. At the same time, business expectations, needs, and demands are evolving faster than ever before.
While some view this as a challenge, we see it as an opportunity. An opportunity to reimagine HR, talent, and
organizational practices. An opportunity to create platforms, processes, and tools that will continue to evolve
and sustain their value over time. An opportunity to take the lead in what will likely be among the most signifi-
cant changes to the workforce that we have seen.

Hence, our call for new rules for HR in the digital age.

The 2017 report began last summer with us reaching out to hundreds of organizations, academics, and practi-
tioners around the world. This year, it includes a survey of more than 10,000 HR and business leaders across
140 countries. The report reveals how leaders are turning to new organizational models that highlight the
networked nature of todays world of work; innovation-based HR platforms; learning and career programs
driven by social and cognitive technologies; and employee experience strategies that put the workforce at the
center. The report closes with a discussion of the future of work amid the changes being driven by advances in
automation and an expanded definition of the workforce.

We are pleased to present this years Global Human Capital Trends report and survey and look forward to
your comments. 2017 is positioned to be a year of change as we all manage new levels of transformation and
disruption. The only question now is: Are you ready?

Brett Walsh Erica Volini


Global leader, Human Capital US leader, Human Capital
Deloitte LLP Deloitte Consulting LLP
2017 Deloitte Global Human Capital Trends

CONTENTS

Introduction: 5HZULWLQJWKHUXOHVIRUWKHGLJLWDODJH_

7KHRUJDQL]DWLRQRIWKHIXWXUH$UULYLQJQRZ_

&DUHHUVDQGOHDUQLQJ5HDOWLPHDOOWKHWLPH_

7DOHQWDFTXLVLWLRQ(QWHUWKHFRJQLWLYHUHFUXLWHU_

7KHHPSOR\HHH[SHULHQFH&XOWXUHHQJDJHPHQWDQGEH\RQG_

3HUIRUPDQFHPDQDJHPHQW3OD\DZLQQLQJKDQG_

/HDGHUVKLSGLVUXSWHG3XVKLQJWKHERXQGDULHV_

'LJLWDO+53ODWIRUPVSHRSOHDQGZRUN_

3HRSOHDQDO\WLFV5HFDOFXODWLQJWKHURXWH_

'LYHUVLW\DQGLQFOXVLRQ7KHUHDOLW\JDS_

7KHIXWXUHRIZRUN7KHDXJPHQWHGZRUNIRUFH_


Rewriting the rules for the digital age

Introduction
Rewriting the rules for the digital age

The 2017 Deloitte Global Human Capital Trends


UHSRUWUHHFWVVHLVPLFFKDQJHVLQWKHZRUOG
of business. This new era, often called
the Fourth Industrial Revolution1or, as
we have earlier labeled it, the Big Shift2
has fundamentally transformed busi-
ness, the broader economy, and society.

W
E WLWOH WKLV \HDUV UHSRUW Rewriting the KDUGWRSUHGLFWZKLFKHPHUJLQJEXVLQHVVSUDFWLFHV
rules for the digital age EHFDXVH D SULQ- ZLOOHQGXUHLWLVLPSRVVLEOHWRLJQRUHWKHQHHGIRU
FLSDOFKDUDFWHULVWLFRIWKHQHZHUDLVQRW FKDQJH 7KLV UHSRUW LV D FDOO WR DFWLRQ IRU +5 DQG
PHUHO\ FKDQJH EXW FKDQJH DW DQ DFFHOHUDWLQJ UDWH EXVLQHVVOHDGHUVZKRPXVWXQGHUVWDQGWKHLPSDFW
ZKLFK FUHDWHV QHZ UXOHV IRU EXVLQHVV DQG IRU +5 RI FKDQJH DQG GHYHORS QHZ UXOHV IRU SHRSOH ZRUN
2UJDQL]DWLRQV IDFH D UDGLFDOO\ VKLIWLQJ FRQWH[W IRU DQGRUJDQL]DWLRQV
WKHZRUNIRUFHWKHZRUNSODFHDQGWKHZRUOGRIZRUN
7KLV UHSRUW PDUNV WKH IWK DQQLYHUVDU\ RI RXU DQ-
7KHVH VKLIWV KDYH FKDQJHG WKH UXOHV IRU QHDUO\ HY-
QXDOGHHSGLYHLQWRKXPDQFDSLWDOWUHQGV7KLV\HDU
HU\RUJDQL]DWLRQDOSHRSOHSUDFWLFHIURPOHDUQLQJWR
RXUVXUYH\LQFOXGHGPRUHWKDQUHVSRQGHQWV
PDQDJHPHQWWRWKHGHQLWLRQRIZRUNLWVHOI
IURP  FRXQWULHV IXHOLQJ RXU DQDO\VLV RI WKH VR-
$OO EXVLQHVV OHDGHUV KDYH H[SHULHQFHG WKHVH VKLIWV FLDOHFRQRPLFSROLWLFDOWHFKQRORJLFDODQGFXOWXUDO
IRU JRRG RU IRU LOO LQ ERWK WKHLU EXVLQHVV DQG SHU- LVVXHVIDFLQJEXVLQHVVDQG+5OHDGHUVDQGHPSOR\-
VRQDOOLYHV5DSLGFKDQJHLVQRWOLPLWHGWRWHFKQRO- HHVZRUOGZLGH
RJ\EXWHQFRPSDVVHVVRFLHW\DQGGHPRJUDSKLFVDV
ZHOO %XVLQHVV DQG +5 OHDGHUV FDQ QR ORQJHU FRQ-
WLQXH WR RSHUDWH DFFRUGLQJ WR ROG SDUDGLJPV 7KH\ Forces for change driven
PXVWQRZHPEUDFHQHZZD\VRIWKLQNLQJDERXWWKHLU by the digital revolution
FRPSDQLHVWKHLUWDOHQWDQGWKHLUUROHLQJOREDOVR-
FLDOLVVXHV :H IRXQG D IDVFLQDWLQJ WDSHVWU\ RI LVVXHV DV ZH
ORRNHG DW WKH VXUYH\ GDWD VSRNH ZLWK FOLHQWV DQG
:H KDYH GHYHORSHG D QHZ VHW RI UXOHV WR PDNH LQWHUYLHZHGEXVLQHVVOHDGHUVDURXQGWKHZRUOG
VHQVHRIWKLVFKDQJLQJODQGVFDSH7KHVHUXOHVUHHFW
WKHVKLIWVLQPLQGVHWDQGEHKDYLRUWKDWZHEHOLHYH ,WLVDEXQGDQWO\FOHDUWKDWWHFKQRORJ\LVDGYDQFLQJ
DUH UHTXLUHG WR OHDG RUJDQL]H PRWLYDWH PDQDJH DWDQXQSUHFHGHQWHGUDWH7HFKQRORJLHVVXFKDVDU-
DQGHQJDJHWKHVWFHQWXU\ZRUNIRUFH:KLOHLWLV WLFLDO LQWHOOLJHQFH $,  PRELOH SODWIRUPV VHQVRUV


2017 Deloitte Global Human Capital Trends

DQG VRFLDO FROODERUDWLRQ V\VWHPV KDYH UHYROXWLRQ-


L]HGWKHZD\ZHOLYHZRUNDQGFRPPXQLFDWHDQG
WKH SDFH LV RQO\ DFFHOHUDWLQJ 7KLV FDXVHV VWUHVV
IRULQGLYLGXDOVDVZHOODVVRFLHWLHVUHVHDUFKVKRZV
Organizations face a
WKDW HPSOR\HHV DQG RUJDQL]DWLRQV DUH PRUH RYHU- radically shifting context
for the workforce,
ZKHOPHGWKDQHYHU3

%XVLQHVVSURGXFWLYLW\KDVQRWNHSWSDFHZLWKWHFK-
QRORJLFDOSURJUHVV'DWDIURPWKH86%XUHDXRI/D- the workplace, and
ERU6WDWLVWLFVDQGRWKHUVRXUFHVVKRZWKDWSURGXF-
WLYLW\JURZWKUHPDLQVORZGHVSLWHWKHLQWURGXFWLRQ
the world of work.
RI QHZ WHFKQRORJ\ LQWR WKH EXVLQHVV HQYLURQPHQW
,Q IDFW VLQFH WKH  UHFHVVLRQ JURZWK LQ EXVL-
QHVVSURGXFWLYLW\ JURVVGRPHVWLFSURGXFWSHUKRXU
ZRUNHG  VWDQGV DW LWV ORZHVW UDWH VLQFH WKH HDUO\ GULYHQE\,3DQGVHUYLFHVQRWE\SK\VLFDORUFDSLWDO
V  SHUFHQW 4 $W WKH VDPH WLPH FRPSDQLHV JRRGV
WKHPVHOYHV DUH EHLQJ GLVUXSWHG PRUH TXLFNO\ )RU
:KDW FDXVHV WKLV JDS" :H EHOLHYH WKH SUREOHP
H[DPSOH RQO\  SHUFHQW RI WKH Fortune  FRP-
FRPHVGRZQWRKXPDQFDSLWDOVWUDWHJLHVKRZEXVL-
SDQLHVIURPDUHVWLOOLQEXVLQHVVDQGODVW\HDU
QHVVHVRUJDQL]HPDQDJHGHYHORSDQGDOLJQSHRSOH
DORQHSHUFHQWIHOORWKHOLVW
DWZRUN
7KH SUREOHP LOOXVWUDWHG LQ JXUH  LV WKH HYHULQ-
,QKLVERRNThank You for Being Late7KRP-
FUHDVLQJ JDS EHWZHHQ WHFKQRORJLFDO VRSKLVWLFDWLRQ
DV)ULHGPDQUHIHUVWRDJUDSKFUHDWHGE\(ULF$VWUR
DQG WKH DPRXQW RI ZRUN DFWXDOO\ SHUIRUPHG 7KH
7HOOHU&(2RI$OSKDEHWV*RRJOH;GLYLVLRQZKLFK
UHVXOW LV LQFRPH LQHTXDOLW\ ZDJH VWDJQDWLRQ DQG
VXJJHVWV WKDW WHFKQRORJ\ LV LQFUHDVLQJ DW DQ HYHU
VRFLDO DQG SROLWLFDO XQUHVW DURXQG WKH ZRUOG &RP-
IDVWHUUDWHZKLOHKXPDQDGDSWDELOLW\ULVHVRQO\DWD
SDQLHV ZLWK ORZ SURGXFWLYLW\ QRZ ORVH TXLFNO\ WR
VORZHU OLQHDU UDWH5 :KLOH ZH SDUWLDOO\ DJUHH ZLWK
FRPSHWLWRUV DV PRVW VWRFN PDUNHW YDOXDWLRQV DUH

Figure 1. What appears to be happening


Technology change

Mobile, sensors, AI, cognitive computing


Access to technology by consumers globally
7HFKQRORJ\LQOWUDWHVKRPHDQGSROLWLFDOOLIH
Rate of change

Gap in business
performance potential

Business productivity

Time

Deloitte University Press | dupress.deloitte.com


Rewriting the rules for the digital age

Figure 2. What is really happening


Technology

Individuals

HRs opportunity is to help close


the gaps among technology,
individuals, businesses, and society Businesses
and governments.
Rate of change

Curve 1

Curve 2
Public policy
Curve 3

Curve 4

1970s 1980s 1990s 2000s 2010s Today

Deloitte University Press | dupress.deloitte.com

KLV FRQFOXVLRQ ZH EHOLHYH LQGLYLGXDOV GR DQG ZLOO DJHDQGFRPSDQLHVPXVWFRQVWDQWO\UHYLVHWKHPWR


DGDSWWRWHFKQRORJ\YHU\TXLFNO\ ZHWKLQNWKDWLWLV NHHSXS7KHJDSVEHWZHHQFXUYHVDQGVKRZ
DOVR FULWLFDO WR XQGHUVWDQG WKH UHODWLRQVKLS DPRQJ WKH QHHG IRU RUJDQL]DWLRQV WR DGDSW WR WHFKQRORJ\
WKHIRXULQWHUORFNLQJLVVXHVVKRZQLQJXUH DQGOLIHVW\OHFKDQJHV7KH\DUHDPDMRUIRFXVRIWKH
WUHQGVGLVFXVVHGLQWKLV\HDUVUHSRUW
,QJXUHFXUYHLOOXVWUDWHVWKHH[SRQHQWLDOUDWHRI
WHFKQRORJLFDOFKDQJH0RUHWKDQ\HDUVDIWHUWKH )LQDOO\ FXUYH  UHSUHVHQWV SXEOLF SROLF\ LQFOXG-
IRUPXODWLRQRI0RRUHVODZZKLFKKROGVWKDWFRP- LQJ SROLFLHV DURXQG LQFRPH LQHTXDOLW\ XQHPSOR\-
SXWLQJ SRZHU GRXEOHV LQ FDSDELOLW\ HYHU\  WR  PHQWLPPLJUDWLRQDQGWUDGH7KHVHLVVXHVZKLFK
PRQWKVPRELOH GHYLFHV VHQVRUV $, DQG URERWLFV GLUHFWO\DHFWEXVLQHVVHVWKURXJKUHJXODWLRQWD[HV
DHFWRXUOLYHVPRUHTXLFNO\DQGPRUHSHUYDVLYHO\ DQGOHJLVODWLRQDGDSWDWDQHYHQVORZHUSDFH/DZV
WKDQHYHUEHIRUH DQGSROLFLHVRQWRSLFVVXFKDVPLQLPXPZDJHWUDGH
WDULV LPPLJUDWLRQ DQG HGXFDWLRQ RQO\ VKLIW DI-
&XUYHSRVLWVWKDWLQGLYLGXDOVDUHUHODWLYHO\TXLFN
WHU\HDUVRISXEOLFGHEDWH7KHJDSEHWZHHQSXEOLF
DQGDGHSWDWDGRSWLQJQHZLQQRYDWLRQV'HORLWWHUH-
SROLF\DQGWKHRWKHUWKUHHGRPDLQVUHVXOWVLQLPEDO-
VHDUFKIRUH[DPSOHQGVWKDW86FLWL]HQVQRZORRN
DQFHVDQGFKDOOHQJHVIRUEXVLQHVVDQG+5OHDGHUV
DW WKHLU PRELOH SKRQHV  ELOOLRQ WLPHV D GD\ IRUF-
LQJLQGXVWULHVVXFKDVPHGLDUHWDLOWUDQVSRUWDWLRQ 8QGHUVWDQGLQJ WKHVH IRXU FXUYHV DQG WKH JURZLQJ
DQGHYHQUHVWDXUDQWVWREXLOGGLJLWDOSURGXFWVDQG JDSV DPRQJ WHFKQRORJ\ LQGLYLGXDOV EXVLQHVVHV
VHUYLFHVWRFDSWXUHLQGLYLGXDOVWLPHDQGDWWHQWLRQ DQGSXEOLFSROLF\LVQRZHVVHQWLDOWRHHFWLYHO\QDY-
LJDWLQJWKHZRUOGRIKXPDQFDSLWDO+5KDVDXQLTXH
$V VKRZQ LQ FXUYH  KRZHYHU ZKLOH LQGLYLGXDOV
UROH WR SOD\ ,W FDQ KHOS OHDGHUV DQG RUJDQL]DWLRQV
DGDSW WR WHFKQRORJ\ UHODWLYHO\ UDSLGO\ EXVLQHVVHV
DGDSWWRWHFKQRORJ\KHOSSHRSOHDGDSWWRQHZPRG-
DQGRUJDQL]DWLRQVPRYHDWDVORZHUSDFH7KHEXVL-
HOV RI ZRUN DQG FDUHHUV DQG KHOS WKH FRPSDQ\ DV
QHVVSUDFWLFHVRIFRUSRUDWHSODQQLQJRUJDQL]DWLRQDO
DZKROHDGDSWWRDQGHQFRXUDJHFKDQJHVLQVRFLHW\
VWUXFWXUH MRE GHVLJQ JRDOVHWWLQJ DQG PDQDJH-
UHJXODWLRQDQGSXEOLFSROLF\
PHQWZHUHODUJHO\GHYHORSHGLQWKH UVW LQGXVWULDO

4
2017 Deloitte Global Human Capital Trends

OUR GLOBAL RESEARCH


The 2017 survey is our largest and most extensive to date, with input from more
than 10,400 business and HR leaders across 140 countries. Twenty-two percent of
respondents were from large companies (more than 10,000 employees), 29 percent
from medium-sized companies (1,00010,000 employees), and 49 percent from
small companies (fewer than 1,000 employees). Respondents from the Americas
accounted for 31 percent of the total; Europe, Middle East, and Africa contributed 51
SHUFHQWDQG$VLD3DFLFSHUFHQW5HVSRQGHQWVUHSUHVHQWHGDEURDGFURVVVHFWLRQ
RILQGXVWULHVLQFOXGLQJQDQFLDOVHUYLFHVFRQVXPHUEXVLQHVVWHFKQRORJ\PHGLDDQG
telecommunications; and manufacturing. Sixty-three percent of the respondents
were HR professionals, with other business executives comprising 37 percent. C-level
executives accounted for 30 percent (more than 3,100) of the respondents.
The appendix contains additional details on respondent demographics.

RAPID AND DISRUPTIVE The 10 human capital trends


CHANGE IS NOT NEW
7KHWUHQGVLQWKLV\HDUVUHSRUWLGHQWLI\DUHDVLQ
7KHFXUUHQWXQHDVLQHVVZLWKWKHSDFHRIWHFKQRORJL- ZKLFK RUJDQL]DWLRQV ZLOO QHHG WR FORVH WKH JDS EH-
FDOFKDQJHLVQRWQHZ7KHVIRULQVWDQFHVDZ WZHHQWKHSDFHRIFKDQJHDQGWKHFKDOOHQJHVRIZRUN
DUDSLGULVHLQFRPSXWLQJSRZHUWKDWUHVXOWHGLQDX- DQGWDOHQWPDQDJHPHQW JXUH 
WRPDWHGWHOOHUPDFKLQHVRQOLQHV\VWHPVDQGWKH,7
LQGXVWU\VUDSLGJURZWK7KHZRUOGDGDSWHGZHOODV
TREND 1. THE ORGANIZATION OF
SHRSOHJDLQHGQHZVNLOOVDQGQHZMREV
THE FUTURE: ARRIVING NOW
7RGD\ D QHZ VHW RI GLJLWDO EXVLQHVV DQG ZRUNLQJ
*LYHQWKHSDFHRIFKDQJHDQGWKHFRQVWDQWSUHVVXUH
VNLOOVLVQHHGHG$VZHGLVFXVVLQWKLVUHSRUWFRPSD-
WRDGDSWLWLVQRWVXUSULVLQJWKDWH[HFXWLYHVLGHQWL-
QLHVVKRXOGIRFXVPRUHKHDYLO\RQFDUHHUVWUDWHJLHV
HG EXLOGLQJ WKH RUJDQL]DWLRQ RI WKH IXWXUH DV WKH
WDOHQWPRELOLW\DQGRUJDQL]DWLRQDOHFRV\VWHPVDQG
PRVW LPSRUWDQW FKDOOHQJH IRU  ,Q WKLV \HDUV
QHWZRUNVWRIDFLOLWDWHERWKLQGLYLGXDODQGRUJDQL]D-
VXUYH\QHDUO\SHUFHQWRIUHVSRQGHQWVUDWHGWKLV
WLRQDOUHLQYHQWLRQ7KHSUREOHPLVQRWVLPSO\RQHRI
SUREOHPDVYHU\LPSRUWDQWDQGSHUFHQWUDWHGLW
UHVNLOOLQJ RU SODQQLQJ QHZ DQG EHWWHU FDUHHUV ,Q-
DVLPSRUWDQWRUYHU\LPSRUWDQW7KLVOHYHORILQWHU-
VWHDGRUJDQL]DWLRQVPXVWORRNDWOHDGHUVKLSVWUXF-
HVWVLJQDOVDVKLIWIURPGHVLJQLQJWKHQHZRUJDQL]D-
WXUHVGLYHUVLW\WHFKQRORJ\DQGWKHRYHUDOOHPSOR\-
WLRQWRactively buildingRUJDQL]DWLRQDOHFRV\VWHPV
HHH[SHULHQFHLQQHZDQGH[FLWLQJZD\V
DQG QHWZRUNV $JLOLW\ SOD\V D FHQWUDO UROH LQ WKH
RUJDQL]DWLRQRIWKHIXWXUHDVFRPSDQLHVUDFHWRUH-
SODFHVWUXFWXUDOKLHUDUFKLHVZLWKQHWZRUNVRIWHDPV
HPSRZHUHGWRWDNHDFWLRQ


Rewriting the rules for the digital age

Figure 3. The 2017 trends by importance


Percentage of total responses

Organization of the future 12% 88%

Careers and learning 17% 83%

Talent acquisition 19% 81%

Employee experience 21% 79%

Performance management 22% 78%

Leadership 22% 78%

Digital HR 27% 73%

People analytics 29% 71%

Diversity and inclusion 31% 69%

The augmented workforce 37% 63%

Robotics, cognitive computing, and AI 60% 40%

Not/somewhat important Important/very important

Note: Ratings for The augmented workforce and Robotics, cognitive computing, and AI both relate to the broader trend
on The future of work discussed in this report.
Deloitte University Press | dupress.deloitte.com

TREND 2. CAREERS AND LEARNING: TREND 3. TALENT ACQUISITION:


REAL TIME, ALL THE TIME ENTER THE COGNITIVE RECRUITER
7KH FRQFHSW RI D FDUHHU LV EHLQJ VKDNHQ WR LWV $V MREV DQG VNLOOV FKDQJH QGLQJ DQG UHFUXLWLQJ
FRUH GULYLQJ FRPSDQLHV WRZDUG DOZD\VRQ OHDUQ- WKHULJKWSHRSOHEHFRPHPRUHLPSRUWDQWWKDQHYHU
LQJH[SHULHQFHVWKDWDOORZHPSOR\HHVWREXLOGVNLOOV 7DOHQWDFTXLVLWLRQLVQRZWKHWKLUGPRVWLPSRUWDQW
TXLFNO\ HDVLO\ DQG RQ WKHLU RZQ WHUPV 7KLV \HDU FKDOOHQJH FRPSDQLHV IDFH ZLWK  SHUFHQW RI UH-
FDUHHUV DQG OHDUQLQJ URVH WR VHFRQG SODFH LQ UDWHG VSRQGHQWV FDOOLQJ LW LPSRUWDQW RU YHU\ LPSRUWDQW
LPSRUWDQFHZLWKSHUFHQWRIH[HFXWLYHVLGHQWLI\- 2XU FKDSWHU RQ WDOHQW DFTXLVLWLRQ KLJKOLJKWV KRZ
LQJWKHVHLVVXHVDVLPSRUWDQWRUYHU\LPSRUWDQW$W OHDGLQJRUJDQL]DWLRQVXVHVRFLDOQHWZRUNLQJDQDO\W-
OHDGLQJ FRPSDQLHV +5 RUJDQL]DWLRQV DUH KHOSLQJ LFVDQGFRJQLWLYHWRROVWRQGSHRSOHLQQHZZD\V
HPSOR\HHV JURZ DQG WKULYH DV WKH\ DGRSW WKH UDGL- DWWUDFWWKHPWKURXJKDJOREDOEUDQGDQGGHWHUPLQH
FDO FRQFHSW RI D FDUHHU GHVFULEHG LQ The 100-Year ZKRZLOOEHVWWWKHMREWHDPDQGFRPSDQ\$QHZ
Life1HZOHDUQLQJPRGHOVERWKFKDOOHQJHWKHLGHD EUHHG RI FRJQLWLYH WHFKQRORJLHV LV UDGLFDOO\ WUDQV-
RIDVWDWLFFDUHHUDQGUHHFWWKHGHFOLQLQJKDOIOLIHRI IRUPLQJUHFUXLWLQJZKLFKVWDQGVDWWKHHDUO\VWDJHV
VNLOOVFULWLFDOWRWKHVWFHQWXU\RUJDQL]DWLRQ RIDUHYROXWLRQ


2017 Deloitte Global Human Capital Trends

TREND 4. THE EMPLOYEE EXPERIENCE: TREND 7. DIGITAL HR: PLATFORMS,


CULTURE, ENGAGEMENT, AND BEYOND PEOPLE, AND WORK
&XOWXUH DQG HQJDJHPHQW DUH YLWDO SDUWV RI WKH HP- $V WKH HQWHUSULVH DV D ZKROH EHFRPHV GLJLWDO +5
SOR\HH H[SHULHQFH DQG OHDGLQJ RUJDQL]DWLRQV DUH PXVW EHFRPH D OHDGHU LQ WKH GLJLWDO RUJDQL]DWLRQ
EURDGHQLQJ WKHLU IRFXV WR LQFOXGH D SHUVRQV UVW 7KLV PHDQV JRLQJ EH\RQG GLJLWL]LQJ +5 SODWIRUPV
FRQWDFW ZLWK D SRWHQWLDO HPSOR\HU WKURXJK UHWLUH- WR GHYHORSLQJ GLJLWDO ZRUNSODFHV DQG GLJLWDO ZRUN-
PHQW DQG EH\RQG 7RGD\ FRPSDQLHV DUH ORRNLQJ IRUFHV DQG WR GHSOR\LQJ WHFKQRORJ\ WKDW FKDQJHV
DW HPSOR\HH MRXUQH\V VWXG\LQJ WKH QHHGV RI WKHLU KRZ SHRSOH ZRUN DQG WKH ZD\ WKH\ UHODWH WR HDFK
ZRUNIRUFHDQGXVLQJQHWSURPRWHUVFRUHVWRXQGHU- RWKHU DW ZRUN )RUWXQDWHO\ WKH SDWK WR GLJLWDO +5
VWDQGWKHHPSOR\HHH[SHULHQFH:RUNSODFHUHGHVLJQ LV EHFRPLQJ FOHDUHU ZLWK H[SDQGHG RSWLRQV QHZ
ZHOOEHLQJ DQG ZRUN SURGXFWLYLW\ V\VWHPV DUH DOO SODWIRUPV DQG D ZLGH YDULHW\ RI WRROV WR EXLOG WKH
EHFRPLQJSDUWRIWKHPDQGDWHIRU+5 VWFHQWXU\ GLJLWDO RUJDQL]DWLRQ ZRUNIRUFH DQG
ZRUNSODFH
TREND 5. PERFORMANCE
MANAGEMENT: PLAY A WINNING HAND 75(1'3(23/($1$/<7&6
RECALCULATING THE ROUTE
)RUWKHODVWYH\HDUVFRPSDQLHVKDYHEHHQH[SHUL-
PHQWLQJ ZLWK QHZ SHUIRUPDQFH PDQDJHPHQW DS- 'DWDDERXWSHRSOHDWZRUNKDVEHFRPHPRUHLPSRU-
SURDFKHVWKDWHPSKDVL]HFRQWLQXRXVIHHGEDFNDQG WDQWWKDQHYHUEXWWKHIRFXVRISHRSOHDQDO\WLFVKDV
FRDFKLQJUHGXFLQJWKHIRFXVRQDSSUDLVDO7KLV\HDU FKDQJHG)RUPHUO\DWHFKQLFDOGLVFLSOLQHRZQHGE\
FRPSDQLHV DUH PRYLQJ EH\RQG H[SHULPHQWDWLRQ WR GDWDVSHFLDOLVWVSHRSOHDQDO\WLFVLVQRZDEXVLQHVV
GHSOR\ QHZ PRGHOV RQ D ZLGH VFDOH (YHQ WKRXJK GLVFLSOLQH VXSSRUWLQJ HYHU\WKLQJ IURP RSHUDWLRQV
+5WHFKQRORJ\WRROVKDYHQRWTXLWHFDXJKWXSQHZ DQGPDQDJHPHQWWRWDOHQWDFTXLVLWLRQDQGQDQFLDO
DSSURDFKHVWRSHUIRUPDQFHPDQDJHPHQWDUHZRUN- SHUIRUPDQFH5HDGLQHVVWRFDSLWDOL]HRQSHRSOHDQD-
LQJDQGWKH\DUHLQFUHDVLQJSURGXFWLYLW\DQGFKDQJ- O\WLFVUHPDLQVDFKDOOHQJHKRZHYHU2QO\SHUFHQW
LQJFRUSRUDWHFXOWXUH RIRUJDQL]DWLRQVUHSRUWWKH\KDYHXVDEOHGDWDZKLOH
RQO\SHUFHQWEHOLHYHWKH\KDYHDJRRGXQGHUVWDQG-
TREND 6. LEADERSHIP DISRUPTED: LQJRIWKHWDOHQWIDFWRUVWKDWGULYHSHUIRUPDQFH
PUSHING THE BOUNDARIES
TREND 9. DIVERSITY AND
$VFRPSDQLHVWUDQVIRUPDQGGLJLWDORUJDQL]DWLRQDO INCLUSION: THE REALITY GAP
PRGHOV HPHUJH OHDGHUVKLS QHHGV FKDQJH DV ZHOO
(LJKW\ SHUFHQW RI RXU UHVSRQGHQWV VD\ WKDW OHDGHU- )DLUQHVV HTXLW\ DQG LQFOXVLRQ DUH QRZ &(2OHYHO
VKLSLVDQLPSRUWDQWLVVXHDQGSHUFHQWFDOOLWYHU\ LVVXHV DURXQGWKH ZRUOG([HFXWLYHV FDQQRORQJHU
LPSRUWDQW 2UJDQL]DWLRQV DUH FODPRULQJ IRU PRUH DEGLFDWH GLYHUVLW\ VWUDWHJLHV WR WKH &+52 RU FKLHI
DJLOHGLYHUVHDQG\RXQJHUOHDGHUVDVZHOODVQHZ GLYHUVLW\ RFHU $ QHZ IRFXV RQ DFFRXQWDELOLW\
OHDGHUVKLSPRGHOVWKDWFDSWXUHWKHGLJLWDOZD\WR GDWDWUDQVSDUHQF\DQGGLYHUVLW\WKURXJKSURFHVV
UXQ EXVLQHVVHV :KLOH WKH OHDGHUVKLS GHYHORSPHQW LVGULYLQJHRUWVDURXQGXQFRQVFLRXVELDVWUDLQLQJ
LQGXVWU\FRQWLQXHVWRVWUXJJOHFRPSDQLHVDUHSXVK- DQGHGXFDWLRQWKURXJKRXWWKHEXVLQHVVFRPPXQLW\
LQJWKHERXQGDULHVRIWKHLUWUDGLWLRQDOOHDGHUVKLSKL- 'HVSLWHWKHVHHRUWVKRZHYHUZHVHHDUHDOLW\JDS
HUDUFKLHVHPSRZHULQJDQHZEUHHGRIOHDGHUVZKR ,VVXHVDURXQGGLYHUVLW\DQGLQFOXVLRQFRQWLQXHWREH
FDQWKULYHLQDUDSLGO\FKDQJLQJQHWZRUN IUXVWUDWLQJDQGFKDOOHQJLQJIRUPDQ\RUJDQL]DWLRQV


Rewriting the rules for the digital age

Figure 4. Rewriting the rules for the digital age

2017 Deloitte Human Capital Trends

How we redesign the organization and


its leadership for the future

How we build a new management


TREND 1 system to empower and engage the
The organization
n
teams
ms
of the future:
Arriving now
TREND
T 5
Pe
Performance
management: Play a
m
TREND 6 winning hand
w
Leadership
disrupted: Pushing
the boundaries
TREND 9
Diversity and
inclusion: The reality
How we design the employee gap
experience for engagement,
productivity, and growth
How we build a culture of continuous
TREND 4 learning, adaptability, growth, and
The employee
personal development
experience: Culture,
engagement, and
beyond TREND 2
Careers and
learning: Real time,
How we leverage digital technology to all the time
design and improve work, the workplace,
and the workforce
rce
How we leverage data, cognitive
technologies, and AI to improve the
TREND 7 organization and its teams
Digital HR:
Platforms, people,
e,
and work TREND
T 3
Talent acquisition:
T
Enter the cognitive
E
rrecruiter
TREND 10
The future of work:
The augmented
workforce TREND 8
T
People analytics:
P
Recalculating the
R
route
ro

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

TREND 10. THE FUTURE OF WORK: New game, new rules


THE AUGMENTED WORKFORCE
7KH JDPH KDV FKDQJHG DQG VR KDYH WKH UXOHV ,Q
5RERWLFV $, VHQVRUV DQG FRJQLWLYH FRPSXWLQJ WKLV \HDUV Global Human Capital Trends UHSRUW
KDYHJRQHPDLQVWUHDPDORQJZLWKWKHRSHQWDOHQW ZHVXSSOHPHQWHDFKFKDSWHUZLWKDWDEOHKLJKOLJKW-
HFRQRP\ &RPSDQLHV FDQ QR ORQJHU FRQVLGHU WKHLU LQJWKHVKLIWIURPROGUXOHVZKLFKGRPLQDWHGSDVW
ZRUNIRUFHWREHRQO\WKHHPSOR\HHVRQWKHLUEDODQFH WKLQNLQJDERXWKRZWRUXQDQRUJDQL]DWLRQWRDVHW
VKHHW EXW PXVW LQFOXGH IUHHODQFHUV JLJ HFRQRP\ RIQHZUXOHVZKLFKGHQHKRZOHDGLQJFRPSDQLHV
ZRUNHUV DQG FURZGV 7KHVH RQ DQG REDODQFH QRZWKLQNDQGRSHUDWH7KHVHQHZUXOHVUHHFWQRW
VKHHWZRUNHUVDUHEHLQJDXJPHQWHGZLWKPDFKLQHV RQO\ LQVLJKWV IURP RXU VXUYH\ EXW DOVR RXU ZRUN
DQG VRIWZDUH 7RJHWKHU WKHVH WUHQGV ZLOO UHVXOW LQ ZLWK FRPSDQLHV DURXQG WKH ZRUOG WKDW DUH VHWWLQJ
WKH UHGHVLJQ RI DOPRVW HYHU\ MRE DV ZHOO DV D QHZ WKHEDUIRUSHUIRUPDQFHLQWRGD\VJOREDOHFRQRP\
ZD\RIWKLQNLQJDERXWZRUNIRUFHSODQQLQJDQGWKH 7KH\DUHWKHUHVXOWRI\HDUVRIWKRXJKWDQGSUDFWLFH
QDWXUH RI ZRUN &KDQJH LV DOUHDG\ WDNLQJ SODFH ,Q DVZHOODVRXUREVHUYDWLRQVRIOHDGLQJFRPSDQLHVLQ
WKLV \HDUV VXUYH\  SHUFHQW RI RXU UHVSRQGHQWV HYHU\LQGXVWU\JHRJUDSK\DQGVL]H
KDYH HLWKHU IXOO\ LPSOHPHQWHG RU PDGH VLJQLFDQW
SURFHVV LQ DGRSWLQJ FRJQLWLYH DQG $, WHFKQRORJLHV
DQGDQRWKHUSHUFHQWUHSRUWSLORWSURJUDPV

Figure 5. HR performance scorecard, 20152017

2015 2016 2017

GPA (grade) 2.0 (C) 2.1 (C+) 2.0 (C)

40%

35% 34% 33%


32% 32% 31% 30%
30%

25%
22% 21% 21%
20%

15%
10% 9% 9%
10%
5% 6% 5%
5%

0%
Underperforming Getting by Adequate Good Excellent

2015 2016 2017

The proportion of respondents rating their HR capabilities as Getting


by and Adequate has marginally increased, and that rating their
capabilities as Good has marginally decreased, since 2016

Scale used: Excellent (4), Good (3), Adequate (2), Getting by (1), Underperforming (0)

Deloitte University Press | dupress.deloitte.com


Rewriting the rules for the digital age

Figure 6. 2017 HR scorecard by job function

Non-HR (GPA: 1.8) HR (GPA: 2.1)

5% Excellent 5%

25% Good 33%

33% Adequate 35%

23% Getting by 20%

14% Underperforming 7%

Deloitte University Press | dupress.deloitte.com

3XWGLUHFWO\$Q\RUJDQL]DWLRQWKDWLVQRWSOD\LQJE\ ULHQFHHPSOR\HHSURGXFWLYLW\DQGWKHHQWLUHUHDOP
WKHQHZUXOHVZLOOOLNHO\IDOOEHKLQG:HKRSHWKHVH RI ZRUN MRE DQG VWUXFWXUDO GHVLJQ 7KH QHZ UXOHV
LQVLJKWVFDQVHUYHDVDVWUDWHJLFURDGPDSWRKHOSRU- SURYLGH D PDQGDWH IRU PDQ\ +5 RUJDQL]DWLRQV WR
JDQL]DWLRQVWRQRWVLPSO\DGDSWEXWWRWKULYHLQWKH UHRULHQW WKHPVHOYHV DQG IRFXV WKHLU SHRSOH RQ WKH
HPHUJLQJEXVLQHVVHQYLURQPHQW FKDQJLQJKXPDQFDSLWDOLVVXHVWKHLUFRPSDQLHVIDFH

+5OHDGHUVDUHFOHDUO\EHLQJDVNHGWRVWHSXSWRWKH
HR scorecard: How well FKDOOHQJH 7KH SURIHVVLRQ LV OLJKWLQJ XS ZLWK QHZ

is HR keeping up? LGHDVDQG+5WHDPVDUHUDSLGO\XVLQJWKHQHZUXOHV


LQVRPHRIWKHPRVWLQQRYDWLYHZD\VZHKDYHVHHQ
(DFKRIWKHWUHQGVZHGLVFXVVDHFWVWKHUROHRI LQ\HDUV
+5ZKLFKLQWXUQVOHDGVWRDVHULRXVTXHVWLRQ+RZ
ZHOOLV+5NHHSLQJXS"
Join us: Riding the
2YHU WKH SDVW YH \HDUV ZH KDYH WUDFNHG ZKDW ZH wave to its crest
WHUPWKH+5VFRUHFDUGZKLFKPHDVXUHVKRZZHOO
+5H[HFXWLYHVEHOLHYHWKHLUWHDPVFDQDGGUHVVWKH +XPDQVDUHPDUYHORXVO\DGDSWDEOH:HKDYHHYHU\
WDOHQW LVVXHV DURXQG WKHP 7KLV \HDU +5 LV VWUXJ- FRQGHQFHWKDWHYHQLQWKHVHGD\VRIUDSLGFKDQJH
JOLQJ /DVW \HDU  SHUFHQW RI +5 WHDPV IHOW WKHLU OHDGHUVDQGZRUNHUVZLOODGDSWDVWKH\KDYHLQWKH
FDSDELOLWLHV ZHUH JRRG RU H[FHOOHQW EXW WKLV \HDU SDVW 7KH TXHVWLRQ LV :LOO RUJDQL]DWLRQV ULGH WKLV
WKDW SURSRUWLRQ KDV GURSSHG WR  SHUFHQW EHORZ ZDYHRUZDWFKLWFUDVKRYHUWKHPVHOYHV"
WKHFDSDELOLW\ZHPHDVXUHGLQ JXUH 
7KH RSSRUWXQLW\ IRU OHDGLQJ RUJDQL]DWLRQV LV QRW
:K\WKHVOLSEDFNZDUGV" RQO\ WR XVH WKHVH WUHQGV WR JXLGH EXVLQHVV VXFFHVV
EXWWRKHOSSXOOVRFLHW\WRZDUGWKHFUHVWRIWKHWHFK-
:HEHOLHYHWKDWWKH+5IXQFWLRQLVLQWKHPLGGOHRID
QRORJLFDO ZDYHDQ LPSRUWDQW FRQVLGHUDWLRQ ZKHQ
VLJQLFDQWLGHQWLW\FKDQJH1RWRQO\GR+5RUJDQL-
EXVLQHVV LV LQFUHDVLQJO\ LQYLWHG WR SOD\ D VRFLDO DV
]DWLRQVQHHGWRVWUXFWXUHWKHPVHOYHVIRUVHUYLFHGH-
ZHOO DV DQ HFRQRPLF UROH :H LQYLWH \RX WR MRLQ XV
OLYHU\ HFLHQF\ DQG H[FHOOHQFH LQ WDOHQW SURJUDPV
RQWKLVMRXUQH\
EXWWKH\PXVWQRZDOVRIRFXVRQWKHHPSOR\HHH[SH-


2017 Deloitte Global Human Capital Trends

Appendix

)LJXUH7UHQGLPSRUWDQFHUDWLQJVE\UHJLRQ
AMERICAS EUROPE, MIDDLE EAST, & AFRICA ASIA PACIFIC
Central
Latin &
North and Middle Nordic Western
Region Global South Africa Asia Oceania
America Eastern East countries Europe
America
Europe

Organization
of the future          

Careers and
learning          

Talent acquisition          

Employee
experience          

Performance
management          

Leadership          

Digital HR          

People analytics          

Diversity and
inclusion          

The augmented
workforce          

Robotics, cognitive
computing, and AI          

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP
Higher % Lower %

Note: Figures represent the percentage of respondents rating each trend important or very important. Ratings for
The augmented workforce and Robotics, cognitive computing, and AI both relate to the broader trend on The future
of work discussed in this report.


Rewriting the rules for the digital age

)LJXUH7UHQGLPSRUWDQFHUDWLQJVE\LQGXVWU\

Trend in order Life Pro- Technology,


Consumer Energy & Financial Manu- Public Real media, &
of global Global sciences & fessional
business resources services facturing sector estate telecommuni-
importance health care services cations

Organization
of the future  88 85 92 87 83 90 85 81 94

Careers and
learning  81 80 83 82 82 86 73 81 84

Talent
acquisition  82 76 82 82 82 84 76 83 84

Employee
experience  79 77 79 80 76 83 72 79 83

Performance
management  81 80 80 77 81 77 68 83 80

Leadership  75 74 82 74 75 80 73 74 85

Digital HR  74 75 74 75 72 75 72 68 76

People
analytics  72 69 71 75 68 72 67 67 74

Diversity and
inclusion  69 70 71 69 68 70 68 65 67

The
augmented  59 63 61 63 59 73 63 62 62
workforce
Robotics,
cognitive
computing,  34 37 41 38 44 45 34 28 46
and AI

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP
Higher % Lower %

Note: Figures represent the percentage of respondents rating each trend important or very important. Ratings for
The augmented workforce and Robotics, cognitive computing, and AI both relate to the broader trend on The future
of work discussed in this report.


2017 Deloitte Global Human Capital Trends

)LJXUH7UHQGLPSRUWDQFHUDQNLQJVE\RUJDQL]DWLRQVL]H

Large Medium (1,001 Small


Trend in order of global importance Global
(10,000+) to 10,000) (1 to 1,000)

Organization of the future    

Careers and learning    

Talent acquisition    

Employee experience    

Performance management    

Leadership    

Digital HR    

People analytics    

Diversity and inclusion    

The augmented workforce    

Robotics, cognitive
computing, and AI
   

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP
Higher % Lower %

Note: Figures represent the percentage of respondents rating each trend important or very important. Ratings for
The augmented workforce and Robotics, cognitive computing, and AI both relate to the broader trend on The future
of work discussed in this report.


Rewriting the rules for the digital age

Figure 10. Survey demographics

Our survey includes data from 10,447 business and HR leaders


Region Industry

Western Europe 25% Professional services 16%

Latin & South America 17% Financial services 13%

Asia 15% Consumer business 13%


Technology, media,
North America 14% 12%
& telecommunications
Africa 10% Manufacturing 11%

Central & Eastern Europe 8% Public sector 8%

Nordic countries 7% Energy & resources 7%

Oceania 3% Life sciences & health care 6%

Middle East 2% Real estate 1%

Other 12%
Country
United States 1,115 Singapore 94
Belgium 779 Nigeria 89 Organization size (employees)
India 616 Guatemala 88 Large
Norway 379 Argentina 78 (10,001+) 22%
China 351 Serbia 78 49%
Small
Canada 318 United Arab Emirates 77 (1 to 1,000)
France 299 New Zealand 76 Medium
29%

South Africa 295 Ukraine 74 (1,001 to 10,000)


Mexico 281 El Salvador 72
Costa Rica 262 Italy 72
Colombia 245 Tunisia 72
Spain 235 Chile 68 Respondent job function
Germany 229 Romania 68
United Kingdom 215 Cyprus 58 Non-HR
Japan 205 Luxembourg 53 37%
Australia 197 Malaysia 53 63% HR
Ireland 196 Indonesia 52
Poland 188 Angola 48
Finland 182 Senegal 48
Kenya 181 Namibia 47
Brazil 159 Ivory Coast 46
Russia 156 Zimbabwe 46
Netherlands 142 Czech Republic 45 Respondent job level
Greece 136 Ethiopia 45 Individual
Peru 136 Hong Kong 42 contributor 20%
Uruguay 134 Thailand 42 51% Mid-level
Switzerland 126 Dutch Caribbean 34
Portugal 123 Panama 33 C-suite
30%
Denmark 111 Venezuela 31
Ecuador 101 Korea 30
Austria 98 Sweden 30
Turkey 97 All others 371
Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. Klaus Schwab, The Fourth Industrial Revolution (World Economic Forum, 2016).

2. John Hagel, John Seely Brown, and Lang Davison, The Big Shift: Measuring the forces of change, Harvard Busi-
ness Review, JulyAugust 2009.

3. -H6FKZDUW]HWDOThe overwhelmed employee: Simplify the work environment, Deloitte University Press, March 7,
2014, https://dupress.deloitte.com/dup-us-en/focus/human-capital-trends/2014/hc-trends-2014-overwhelmed-
HPSOR\HHKWPO"LG J[HOGFGXSFRQVDZDKFWDFFHVVHG-DQXDU\

4. Bureau of Labor Statistics, Labor productivity and costs, https://www.bls.gov/lpc/prodybar.htm, accessed Janu-
ary 13, 2017.

5. Thomas L. Friedman, Thank You for Being Late (Farrar, Straus & Gioux, 2016), pp. 213219.

6. 'HORLWWH'HORLWWHVXUYH\$PHULFDQVORRNDWWKHLUVPDUWSKRQHVLQWKHDJJUHJDWHPRUHWKDQELOOLRQWLPHVGDLO\
PRNewswire, December 9, 2015, http://www.prnewswire.com/news-releases/deloitte-survey-americans-look-
DWWKHLUVPDUWSKRQHVLQWKHDJJUHJDWHPRUHWKDQELOOLRQWLPHVGDLO\KWPO DFFHVVHG -DQXDU\ 
2017.

7. Lynda Gratton and Andrew Scott, The 100-Year Life (Bloomsbury, 2016).


Rewriting the rules for the digital age

AUTHORS

Josh Bersin, Bersin by Deloitte, Deloitte Consulting LLP | jbersin@deloitte.com

Josh Bersin founded Bersin & Associates, now Bersin by Deloitte, in 2001 to provide research
and advisory services focused on corporate learning. He is a frequent speaker at industry
events and a popular blogger. Bersin spent 25 years in product development, product
management, marketing, and sales of e-learning and other enterprise technologies. He has
a BS in engineering from Cornell, an MS in engineering from Stanford, and an MBA from the
Haas School of Business at the University of California, Berkeley.

Bill Pelster, Deloitte Consulting LLP | bpelster@deloitte.com

Bill Pelster has more than 25 years of industry and consulting experience. In his current role,
Pelster is responsible for leading the Bersin by Deloitte Research and Products practice and
is a senior advisor to the Integrated Talent Management practice. A well-respected speaker
and author, he has recently led, supported, or authored key research pieces including Talent
2020, Global Human Capital Trends, and The Leadership Premium. In his previous role as
'HORLWWHVFKLHIOHDUQLQJRFHU3HOVWHUZDVUHVSRQVLEOHIRUWKHWRWDOGHYHORSPHQWH[SHULHQFH
of Deloitte professionals, and was one of the key architects of Deloitte University, Deloittes
$300 million learning facility outside Dallas. Pelster is a former US board member for Deloitte
Consulting LLP.

-H6FKZDUW]'HORLWWH&RQVXOWLQJ//3_MHVFKZDUW]#GHORLWWHFRP

-H6FKZDUW]LVWKHJOREDOOHDGHUIRU+XPDQ&DSLWDO0DUNHWLQJ(PLQHQFHDQG%UDQG+H
is an advisor to senior business leaders in global companies, focusing on organization, HR,
WDOHQWDQGOHDGHUVKLS6FKZDUW]LVWKHVHQLRUDGYLVRUIRUWKHUPV+XPDQ&DSLWDOFRQVXOWLQJ
SUDFWLFHLQQGLDDQGDOVRWKHIRXQGLQJDQG86PDQDJLQJSULQFLSDOIRUWKHUPVQQRYDWLRQ
Tech Terminal (ITT) connecting US and global companies with the Israeli start-up ecosystem.
He is a frequent speaker and writer on issues at the nexus of talent, human resources, global
business challenges, and the future of work. In 2011, Schwartz led the launch of Deloittes
Global Human Capital Trends survey and report series and continues to serve as one of the
executive editors.

Bernard van der Vyver, Deloitte Consulting BV | bevandervyver@deloitte.com

Bernard van der Vyver is a leading advisor on human capital matters, focusing on learning
DQGGHYHORSPHQW%\PHUJLQJKLVEDFNJURXQGLQWHFKQRORJ\DQGLWVHHFWLYHXVHZLWK
the development of people, van der Vyver brings a unique strength to the HR domain. As
Deloittes global Learning Solutions leader, he aspires to grow and strengthen the global
learning community by leveraging the organizations knowledge and expertise to deliver
learning solutions that create unique value for clients.

CONTRIBUTORS
David Mallon, Julie May, Jen Stempel
Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

The organization of the future


Arriving now

High-performing organizations operate as empowered networks, coordinated


through culture, information systems, and talent mobility. Companies are focused on
redesigning the organization itself, with nearly half actively studying and developing
new models. And many organizations are not only designing but also building this
new organization. As networks and ecosystems replace organizational hierarchies,
the traditional question For whom do you work? has been replaced by With whom
do you work?

)XOO\SHUFHQWRIWKLV\HDUVVXUYH\UHVSRQGHQWVEHOLHYHWKDWEXLOGLQJWKHRUJDQL-
zation of the future is an important or very important issue.

0RUHWKDQWKUHHLQYH SHUFHQW VD\WKHLVVXHLVYHU\LPSRUWDQWDSHUFHQW


increase from last year.

Yet challenges remain: Only 11 percent of survey respondents believe they under-
stand how to build the organization of the future.

W
HY KDV RUJDQL]DWLRQDO GHVLJQ ]RRPHG SDVWWKHGHVLJQSKDVHDQGDFWLYHO\EXLOGLQJWKLVQHZ
WR WKH WRS RI WKH OLVW DV WKH PRVW LPSRU- RUJDQL]DWLRQ 6WLOO PDQ\ EXVLQHVV OHDGHUV VHHP WR
WDQWWUHQGLQWKHGlobal Human Capital KDYHOLWWOHFRQGHQFHWKH\ZLOOJHWWKHSURFHVVULJKW
Trends VXUYH\ IRU WZR \HDUV LQ D URZ" 7KH DQVZHU
7KLV FRQFHUQ LV ZDUUDQWHG 2UJDQL]DWLRQDO GHVLJQ
LV VLPSOH 7KH ZD\ KLJKSHUIRUPLQJ RUJDQL]DWLRQV
DQG FKDQJH DUH FRPSOH[ 0DQ\ RUJDQL]DWLRQDO UH-
RSHUDWH WRGD\ LV UDGLFDOO\ GLHUHQW IURP KRZ WKH\
GHVLJQVIDLOEHFDXVHWKH\DUHUHGXFHGWRDQH[HUFLVH
RSHUDWHG  \HDUV DJR <HW PDQ\ RWKHU RUJDQL]D-
WR FXW FRVWV 2WKHUV IDFH UHVLVWDQFH IURP FRPSDQ\
WLRQV FRQWLQXH WR RSHUDWH DFFRUGLQJ WR LQGXVWULDO
OHDGHUVKLS,QIDFWPDQ\FRQVXOWLQJUPVDQHFGRW-
DJHPRGHOVWKDWDUH\HDUVROGRUPRUHZHLJKHG
DOO\UHSRUWWKDWXSWRSHUFHQWRIUHRUJDQL]DWLRQV
GRZQ E\ OHJDF\ SUDFWLFHV V\VWHPV DQG EHKDYLRUV
IDOO VKRUW EHFDXVH RI FUHDWLYH GLVREHGLHQFH IURP
WKDWPXVWEHFRQIURQWHGDQGGLVFDUGHGEHIRUHWUXH
WKHH[HFXWLYHWHDP
FKDQJHFDQWDNHKROG
)UXVWUDWLRQ LV DOVR FRPPRQ 'HVLJQLQJ WKH RUJDQL-
$V RUJDQL]DWLRQV EHFRPH PRUH GLJLWDO WKH\ IDFH D
]DWLRQRIWKHIXWXUHLVDGLFXOWVRPHWLPHVPHVV\
JURZLQJLPSHUDWLYHWRUHGHVLJQWKHPVHOYHVWRPRYH
SURMHFWRIWULDODQGHUURUQRWDQH[HUFLVHRQSDSHU
IDVWHUDGDSWPRUHTXLFNO\IDFLOLWDWHUDSLGOHDUQLQJ
,WLVDFRQWLQXRXVG\QDPLFDQGLQDVHQVHQHYHU
DQGHPEUDFHWKHG\QDPLFFDUHHUGHPDQGVRIWKHLU
HQGLQJ SURFHVV <HW IRU FRPSDQLHV WKDW ULVH WR WKH
SHRSOH7KLV\HDUOHDGLQJRUJDQL]DWLRQVDUHPRYLQJ


Rewriting the rules for the digital age

Figure 1. Organization of the future: Percentage of respondents rating this trend important
or very important

Percentages in
selected countries:
Higher % Lower %
Canada 87
India 96
85 Netherlands Brazil 94
Spain 91
Germany 90
Belgium 82
Mexico 89
UK 88
Italy 89
USA 87 Germany 90
70 Japan China 89
France 88
89 China France 88
Spain 91
United Kingdom 88
Mexico 89
Italy 89 United States 87
96 India
Canada 87

95 Brazil Netherlands 85
84 Australia Australia 84
74 South Africa
Belgium 82
South Africa 74
Percentages by region: Japan 70
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


92 87 87 83 83 90 87 89 85
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

FKDOOHQJH WKH SD\R FDQ EH LPPHQVH LQ WHUPV RI THE POWER OF NETWORKS OF TEAMS
QDQFLDO SHUIRUPDQFH SURGXFWLYLW\ HPSOR\HH HQ-
JDJHPHQWDQGDKRVWRIRWKHUEHQHWV $QLPSRUWDQWSDUWRIGHVLJQLQJIRUDGDSWDELOLW\LVD
VKLIW DZD\ IURP KLHUDUFKLFDO RUJDQL]DWLRQDO VWUXF-
ORGANIZING FOR SPEED, WXUHVWRZDUGPRGHOVZKHUHZRUNLVDFFRPSOLVKHGLQ
WHDPV,QGHHGRQO\SHUFHQWRIH[HFXWLYHVEHOLHYH
AGILITY, AND ADAPTABILITY
WKDW WKH WUDGLWLRQDO RUJDQL]DWLRQDO PRGHOZLWK
,Q WKH SDVW PRVW RUJDQL]DWLRQV ZHUH GHVLJQHG IRU KLHUDUFKLFDO MRE OHYHOV EDVHG RQ H[SHUWLVH LQ D VSH-
HFLHQF\DQGHHFWLYHQHVVOHDGLQJWRFRPSOLFDWHG FLFDUHDPDNHVWKHLURUJDQL]DWLRQKLJKO\HHFWLYH
DQG VLORHG RUJDQL]DWLRQV 7KH UHVXOWLQJ EXVLQHVV ,QVWHDG OHDGLQJ FRPSDQLHV DUH SXVKLQJ WRZDUG D
PRGHOV ZKLFK ZHUH EDVHG RQ SUHGLFWDEOH FRPPHU- PRUHH[LEOHWHDPFHQWULFPRGHO
FLDO SDWWHUQV DUH XQVXLWHG WR DQ HUD RI XQSUHGLFW-
$VRUJDQL]DWLRQVPDNHWKLVWUDQVLWLRQWKH\QGWKDW
DELOLW\ DQG GLVUXSWLRQ ,QVWHDG RI PHUH HFLHQF\
VPDOOHUWHDPVDUHDQDWXUDOZD\IRUKXPDQVWRZRUN
VXFFHVVIXORUJDQL]DWLRQVPXVWEHGHVLJQHGIRUVSHHG
5HVHDUFKVKRZVWKDWZHVSHQGWZRRUGHUVRIPDJQL-
DJLOLW\DQGDGDSWDELOLW\WRHQDEOHWKHPWRFRPSHWH
WXGHPRUHWLPHZLWKSHRSOHQHDURXUGHVNWKDQZLWK
DQGZLQLQWRGD\VJOREDOEXVLQHVVHQYLURQPHQW
WKRVH PRUH WKDQ  PHWHUV DZD\1 :KDWHYHU D KL-


2017 Deloitte Global Human Capital Trends

HUDUFKLFDORUJDQL]DWLRQFKDUWVD\VUHDOGD\WRGD\ 5HFHQWO\DOHDGLQJ1RUWK$PHULFDQEDQNXQGHUWRRN
ZRUN JHWV GRQH LQ QHWZRUNV 7KLV LV ZK\ WKH RUJD- DQLQLWLDWLYHWRGHVLJQDQHZZD\RIZRUNLQJWRGH-
QL]DWLRQ RI WKH IXWXUH LV D QHWZRUN RI WHDPV VHH OLYHUVROXWLRQVIDVWHUZKLOHFRPSHWLQJZLWKQWHFKV
JXUH  DQG RWKHU XQFRQYHQWLRQDO SOD\HUV WKDW FRPSHWH
EDVHG RQ FXVWRPHU H[SHULHQFH GLJLWDO LQWHUIDFHV
7RS FRPSDQLHV DUH EXLOW DURXQG V\VWHPV WKDW HQ-
DQG UDSLG WLPH WR PDUNHW LQ SURGXFW GHOLYHU\ 7KH
FRXUDJH WHDPV DQG LQGLYLGXDOV WR PHHW HDFK RWKHU
SURSRVHG RSHUDWLQJ PRGHO IRFXVHG RQ HPEHGGLQJ
VKDUH LQIRUPDWLRQ WUDQVSDUHQWO\ DQG PRYH IURP
DJLOHSUDFWLFHVDQGXVLQJQHWZRUNHGFURVVIXQFWLRQ-
WHDP WR WHDP GHSHQGLQJ RQ WKH LVVXH WR EH DG-
DO WHDPV RI GHYHORSHUV FRGHUV EXVLQHVV DQDO\VWV
GUHVVHG 'LHUHQW QHWZRUNV FDQ KDYH GLHUHQW
DQGXVHUGHVLJQH[SHUWVIRFXVHGRQDVSHFLFSURG-
VSHFLDOWLHVVXFKDVLQQRYDWLRQRUJHWWLQJWRPDUNHW
XFWRXWFRPH$IWHUQLVKLQJZRUNLQRQHDUHDWHDPV
TXLFNO\EXWWKHSULQFLSOHLVWKHVDPH
ZRXOGEHUHGLVWULEXWHGDQGWKHQH[WSURMHFWEHJXQ
)RUDFRPSDQ\WRVWD\DJLOHWHDPVPXVWEHIRUPHG ,QLQLWLDOSLORWVWKHEDQNSURYHGWKDWWKLVW\SHRIRU-
DQG GLVEDQGHG TXLFNO\ +LJKSHUIRUPLQJ FRPSD- JDQL]DWLRQDO DSSURDFK FRXOG UDGLFDOO\ LQFUHDVH WKH
QLHVWRGD\PD\EXLOGDGLJLWDOFXVWRPHUH[SHULHQFH VSHHGRIWKHGHYHORSPHQWF\FOHLWSODQVWRVFDOHWKH
JURXSVHOHFWLQGLYLGXDOVIRUWKHWHDPDQGDVNWKHP PRGHODFURVVWKHRUJDQL]DWLRQRYHUWLPH
WR GHVLJQ DQG EXLOG D QHZ SURGXFW RU VHUYLFH LQ D
\HDURUWZR$IWHUZDUGWKHWHDPGLVSHUVHVDVWHDP STARTING AT THE EDGE
PHPEHUV PRYH RQ WR QHZ SURMHFWV 7KLV DELOLW\ WR
PRYHEHWZHHQWHDPVZLWKRXWULVNLVDFULWLFDODWWUL- 1HDUO\DOOVXUYH\HGFRPSDQLHV SHUFHQW UHSRUW
EXWHRIWRGD\VKLJKSHUIRUPLQJFRPSDQLHV WKDW DJLOLW\ DQG FROODERUDWLRQ DUH FULWLFDO WR WKHLU
RUJDQL]DWLRQV VXFFHVV \HW RQO\  SHUFHQW VD\ WKDW

Figure 2. A network of teams

How things were How things are

A B
A
B
F C D

C D E G
E

How things work

Shared values and culture


Transparent goals and projects
)UHHRZRILQIRUPDWLRQDQGIHHGEDFN
3HRSOHUHZDUGHGIRUWKHLUVNLOOVDQGDELOLWLHV
QRWSRVLWLRQ

Deloitte University Press | dupress.deloitte.com


Rewriting the rules for the digital age

WKH\ DUH KLJKO\ DJLOH WRGD\  SHUFHQW GHVFULEH

Among this years


WKHPVHOYHV DVQRWDJLOH)RUWXQDWHO\WKHUH LVWUH-
PHQGRXV SURJUHVV LQ WKLV DUHD $PRQJ WKLV \HDUV
VXUYH\ UHVSRQGHQWV  SHUFHQW VD\ WKDW WKH\ DUH
QRZGHVLJQLQJWKHLURUJDQL]DWLRQWREHPRUHDGDSW-
survey respondents,
DEOHDQGWHDPFHQWULF 32 percent say that
+LJKSHUIRUPLQJ FRPSDQLHV RIWHQ UVW GHYHORS they are now designing
WKHVHH[LEOHPRGHOVDWWKHHGJHRIWKHFRPSDQ\
7RPDNHIXUWKHUSURJUHVVWKH\IRFXVRQEXLOGLQJD their organization to
QHZ OHDGHUVKLS PLQGVHW WKDW UHZDUGV LQQRYDWLRQ
H[SHULPHQWDWLRQ OHDUQLQJ DQG FXVWRPHUFHQWULF be more adaptable
GHVLJQWKLQNLQJ2,QVKRUWLIZKDWDFRPSDQ\QHHGV
WRNQRZDQGGRLVFRQVWDQWO\FKDQJLQJWKHQWKHRU-
and team-centric.
JDQL]DWLRQVVWUXFWXUHPXVWFKDQJHDVZHOO

NEXT STEP: BUILDING THE 2QO\  SHUFHQW RI FRPSDQLHV LQ WKLV \HDUV Global
ORGANIZATION OF THE FUTURE Human Capital TrendsVXUYH\DUHXVLQJ21$WRGD\
EXWXVDJHLVJURZLQJUDSLGO\ZLWKDQDGGLWLRQDO
0DQ\QHZWRROVDQGWHFKQLTXHVRHUYDOXDEOHFRQ- SHUFHQW RI FRPSDQLHV H[SHULPHQWLQJ ZLWK WKHVH
WULEXWLRQVWREXLOGLQJWKHRUJDQL]DWLRQRIWKHIXWXUH WRROV2QHFRPSDQ\XVHGWKLVWHFKQLTXHWRUHGHVLJQ
LWVVDOHVRUJDQL]DWLRQDQGIRXQGWKDWPDQ\H[SHUWV
2QHSURPLVLQJWHFKQLTXHLVRUJDQL]DWLRQDOQHWZRUN
ZHUHXQGHUXWLOL]HG$IWHUDGRSWLQJDQHZWHDPFHQ-
DQDO\VLV 21$  ZKLFK XVHV VSHFLDOL]HG VRIWZDUH
WULF PRGHO WRWDO UHYHQXH JHQHUDWLRQ URVH E\ PRUH
DQG PHWKRGRORJLHV WR KHOS FRPSDQLHV VWXG\ ZKR
WKDQSHUFHQW3
LV WDONLQJ WR ZKRP 7KLV W\SH RI DQDO\VLV ZKLFK
FDQXVHSDWWHUQVLQHPDLOVLQVWDQWPHVVDJHVSK\VL- 6LPSOLFDWLRQRIZRUNSUDFWLFHVDQGQHZZRUNWRROV
FDOSUR[LPLW\DQGRWKHUGDWDDOORZVOHDGHUVWRVHH DUHFULWLFDODVZHOO:KLOHDQHWZRUNHGRUJDQL]DWLRQ
TXLFNO\ZKDWQHWZRUNVDUHLQSODFHDQGLGHQWLI\WKH PDNHV VHQVH IRU DJLOLW\ DQG UHVSRQVLYHQHVV LW DOVR
FRQQHFWRUVDQGH[SHUWV LQFUHDVHV WKH QHHG WR FRRUGLQDWH WHDPV DQG FDQ
OHDG WR DQ RYHUZKHOPLQJ QXPEHU RI PHHW-
LQJV HPDLOV DQG FRPPXQLFDWLRQV FKDQQHOV
&RJQLWLYH RYHUORDG FDQ GUDPDWLFDOO\ UHGXFH
SURGXFWLYLW\

1HZ RUJDQL]DWLRQDO PRGHOV DOVR UHTXLUH D


QHZ DSSURDFK WR OHDGHUVKLS /HDGHUV RI QHW-
ZRUNHG WHDPV LQ DJLOH RUJDQL]DWLRQV UHTXLUH
VNLOOVVXFKDVQHJRWLDWLRQUHVLOLHQFHDQGV\V-
WHPVWKLQNLQJ,QVRPHFDVHVWKHPRVWH[SH-
ULHQFHGOHDGHUVDQGEXVLQHVVXQLWKHDGVPD\
EHWKHZURQJSHRSOHWRWDNHFKDUJHRIGLJLWDO
DJLOHQHWZRUNHGWHDPV$VZHGLVFXVVLQRXU
FKDSWHU RQ OHDGHUVKLS HHFWLYH OHDGHUV LQ D
QHWZRUNHGHQYLURQPHQWPXVWKDYHDKLJKGH-
JUHHRIQHWZRUNLQWHOOLJHQFHJHWWLQJWRNQRZ
ZKDWV JRLQJ RQ WKURXJKRXW WKHLU FRPSDQ\
WKURXJKRXW WKHLU LQGXVWU\ DQG WKURXJKRXW
WKHFXVWRPHUPDUNHWSODFH


2017 Deloitte Global Human Capital Trends

$V QHWZRUNHG RUJDQL]DWLRQV FRQWLQXH WR HPHUJH LQJ VHUYLFHV DQG D QHZ PDUNHW IRU ,QWHUQHWEDVHG
QHZWRROVDUHVWDUWLQJWRPDNHFROODERUDWLRQHDVLHU ODPLQDWLRQ
)DFHERRNV:RUNSODFH6ODFN*RRJOH 7HDP'ULYHV
$WODVVLDQ &RQXHQFH 0LFURVRIW 6N\SH DQG KXQ-
GUHGV RI RWKHUV DUH KHOSLQJ WR IDFLOLWDWH WKH WUDQVL- Lessons from the front lines
WLRQWRQHWZRUNVRIWHDPV1HDUO\WKUHHTXDUWHUVRI
2QHNH\FDSDELOLW\RIWKHRUJDQL]DWLRQRIWKHIXWXUH
FRPSDQLHV SHUFHQW DUHQRZH[SHULPHQWLQJZLWK
LVWKHDELOLW\WRIRUPWHDPVUDSLGO\7KLVUHTXLUHVD
WKHVHWRROVDQGEHQHWLQJLQXQLTXHZD\V4)RULQ-
FOHDUXQGHUVWDQGLQJRIHDFKHPSOR\HHVVNLOOV2QH
VWDQFH D SXEOLF PXVHXP LQ 6\GQH\ QRZ XVHV -LUD
KXJHRUJDQL]DWLRQWKDWKDVPDVWHUHGWKLVFDSDELOLW\
DQDJLOHPDQDJHPHQWWRROWRNHHSWUDFNRIEXUQHG
LVWKH86'HSDUWPHQWRI'HIHQVH '2' 9
RXW OLJKW EXOEV $Q DXWR GLVWULEXWRU LQ 0DLQH XVHV
+LS&KDWWRPRQLWRUWLUHSUHVVXUHVDQGUHSDLULWHPV '2'V PLOLWDU\ SRSXODWLRQ LQFOXGHV RYHU  PLOOLRQ
LQLWVZDUHKRXVHV5 SHUVRQQHO RQ DFWLYH JXDUG DQG UHVHUYH GXW\ LQ-
FOXGLQJ 5HWLUHG5HDG\ 5HVHUYH SHUVRQQHO VXEMHFW
BUILDING IN ACCOUNTABILITY WR FDOOEDFNDQG GHVSLWH LWV PDVVLYH VL]H KDV FUH-
DWHGRQHRIWKHPRVWFRPSOHWHGHWDLOHGYLHZVRILWV
(PSRZHULQJ SHRSOH WR PDNH GHFLVLRQV DQG UHO\- ZRUNIRUFH WKDW DQ\ RUJDQL]DWLRQ KDV DFKLHYHG )RU
LQJRQQHWZRUNVRILQWHUDFWLRQVGRHVQRWPHDQWKDW HYHU\VROGLHU'2'JUDGHVKLVRUKHUOHDGHUVKLSH[-
SHRSOHDUHQRORQJHUDFFRXQWDEOHIRUUHVXOWV,QIDFW SHULHQFH DQG VNLOOV FDSWXUHV RFFXSDWLRQDO VSHFLDO-
RQHREMHFWLYHRIDQDJLOHQHWZRUNLVWRXVHJRDOVHW- WLHV ZLWK GHWDLOV RQ OHYHOV RI H[SHULHQFH DQG FRP-
WLQJWRVXSSRUWVXFFHVV SLOHV D FRPSOHWH VHUYLFH KLVWRU\ WKDW HQFRPSDVVHV
ERWK '2' DQG QRQ'2' VNLOOV LQFOXGLQJ GHJUHHV
,Q WHDPV DFFRXQWDELOLW\ EHFRPHV PRUH WUDQVSDU-
DQGFHUWLFDWLRQV
HQW,QGLYLGXDODQGWHDPJRDOVDQGPHWULFVVKRXOG
EHVKDUHGIRUHYHU\RQHWRVHH7KHVHQVHRIDFFRXQW- :LWKWKLVLQIRUPDWLRQ'2'FDQPDNHDJLOHKLJKO\
DELOLW\WKLVFDQFUHDWHLVFULWLFDOWRWHDPDQGFRUSR- WDUJHWHG GHSOR\PHQWVLQ HVVHQFH WHDPV RU QHW-
UDWHHHFWLYHQHVV,QGHHGDPRQJWRSSUDFWLFHVLQ ZRUNV RI WHDPVIURP LWV SRSXODWLRQ RI  PLOOLRQ
KLJKLPSDFWOHDGHUVKLSDQRUJDQL]DWLRQVDELOLW\WR 2YHUWKHODVWGHFDGH'2'KDVGHYHORSHGWKHFDSD-
FOHDUO\GHQHGHFLVLRQPDNLQJSUDFWLFHVDQGFODULI\ ELOLW\ WR GHSOR\ HLWKHU D VLQJOH LQGLYLGXDO RU D VSH-
DFFRXQWDELOLW\ IHDWXUHG DPRQJ WKH WRS GULYHUV RI FLFDOO\ FKRVHQ JURXS DQ\ZKHUH LQ WKH ZRUOG ZLWK
RXWVWDQGLQJQDQFLDORXWFRPHV UHODWLYHHDVH

)RULQVWDQFHDODUJHWHOHFRPPXQLFDWLRQVFRPSDQ\ )RU EXVLQHVV '2'V H[DPSOH RHUV FOHDU OHVVRQV


LQ $VLD KDV HPEUDFHG UHDOWLPH GDVKERDUGV WKDW 2UJDQL]DWLRQVVKRXOGFUHDWHDEDVLFIUDPHZRUNIRU
PHDVXUH FXVWRPHU DFTXLVLWLRQ FXVWRPHU VDWLVIDF- XQGHUVWDQGLQJ DQG PHDVXULQJ LWV FRPSOHPHQW RI
WLRQ KLULQJ HPSOR\HH VDWLVIDFWLRQ DQG QDQFLDO VNLOOV DFURVV WKH HQWHUSULVH 0RVW RUJDQL]DWLRQV
SURWDELOLW\ DFURVV DOO  RI LWV VPDOO EXVLQHVV KDYH QRW LQYHVWHG LQ D FRPPRQ IUDPHZRUN ZLWK-
WHDPV 7KLV LQIUDVWUXFWXUH EXLOW RQ WRS RI LWV 6$3 RXW LW D FOHDU XQGHUVWDQGLQJ RI FDSDELOLWLHV LV LP-
EDFNERQH JLYHV WKH HQWLUH FRPSDQ\ WUDQVSDUHQF\ SRVVLEOH%XWDIUDPHZRUNDORQHLVQWHQRXJK7KH
DFFRXQWDELOLW\DQGWKHDELOLW\WRDGDSWTXLFNO\ V\VWHPRQO\ZRUNVLIWKHGDWDDUHFXUUHQWDQGHDVLO\
DFFHVVLEOH
3KLOLSV /LJKWLQJ FRQGXFWHG D VHULHV RI ZRUNVKRSV
DURXQG WKH ZRUOG WR KHOS WKH FRPSDQ\ LGHQWLI\ LWV $QRWKHUH[DPSOHRIRUJDQL]DWLRQDODJLOLW\LVDOHDG-
WUDGLWLRQDO FXUUHQW DQG IXWXUH YDOXHV LQ RUGHU WR LQJ 1RUWK $PHULFDQ LQVXUDQFH SURYLGHUV FUHDWLRQ
EXLOG DOLJQPHQW DURXQG D QHZ PRUH LQQRYDWLYH RIDGLJLWDOLQVXUDQFHSODWIRUPWKDWDOORZVFRQVXP-
FXOWXUH7KHFRPSDQ\FUHDWHGDFRPPRQPDQLIHVWR HUVWREX\SROLFLHVRQOLQHLQDIHZVLPSOHVWHSV
DURXQGIRXUQHZFXOWXUDOYDOXHV 3LRQHHULQJ&DULQJ
)DVWDQG([WHUQDO)RFXV WRKHOSWKHFRPSDQ\HP- $VLGH IURP WKH OHJDO DQG UHJXODWRU\ FKDOOHQJHV WR
SRZHUWHDPVUDSLGO\LQQRYDWHDQGPRYHLQWROLJKW- GHSOR\LQJVXFKDSODWIRUPWKHFRPSDQ\KDGQRH[-
SHULHQFH ZLWK DJLOH SURJUDPV ,W KDG WR WUDQVIRUP


Rewriting the rules for the digital age

LWVHOI DQG OHDUQ QHZ ZD\V RI ZRUNLQJ DW WKH VDPH
Start here
WLPH 0RVW IXQGDPHQWDOO\ WKH RUJDQL]DWLRQ KDG
WRUHVWUXFWXUHLWVHOIWRHQDEOHJUHDWHUFROODERUDWLRQ Embrace the speed of change: 7KLQN FDUH-
FRPPXQLFDWLRQ HPSOR\HH HPSRZHUPHQW DQG LQ- IXOO\DERXWWKHZD\VLQZKLFKGLJLWDOGHPDQGVWKH
IRUPDWLRQRZ FRQVLGHUDEO\VORZHUWUDGLWLRQDORSHUDWLQJPRGHO
WREHVSHHGHGXS8QGHUVWDQGKRZVWUDWHJ\FRQ-
7KHVWUXFWXUHRIWKHOHJDF\RUJDQL]DWLRQFRPSRVHG
QHFWHGQHVV FXVWRPHUV DQG WDOHQW SRROV DUH DOO
RI RYHU  HPSOR\HHV XQGHU D WUDGLWLRQDO FRP-
FKDQJLQJDVSDUWRIWKHGLJLWDOWUDQVIRUPDWLRQ
PDQGDQGFRQWUROPRGHOZDVQRWULJKWIRUWKHQHZ
YHQWXUH 7KH FRPSDQ\ VHW XS D VHSDUDWH HQWLW\ RI Make talent mobility a core value:5HTXLUH
DERXWHPSOR\HHVDQGFRQWUDFWRUVWKDWUHSRUWHG H[HFXWLYHVWRPRYHIURPIXQFWLRQWRIXQFWLRQVR
GLUHFWO\WRWKHVHQLRUYLFHSUHVLGHQWOHDGHUVKLSWHDP WKDWWKH\XQGHUVWDQGWKHQHZPRUHDJLOHFDUHHU
DQGWKH&(27KHHQWLW\ERWKKLUHGQHZWDOHQWDQG PRGHO %XLOG LQ SURFHVVHV WR VXSSRUW WHDP X-
DVVLJQHG FXUUHQW HPSOR\HHV WR WKH SURJUDP HP- LGLW\ VR WKDW WHDP PHPEHUV FDQ TXLFNO\ UHWXUQ
SRZHULQJWKHPWRPDNHGHFLVLRQVLQWKHEHVWLQWHU- WRWKHLUKRPHEDVHRUPRYHWRDGLHUHQWWHDP
HVWRIWKHSURJUDPZLWKOLWWOHRUQRLQXHQFHIURP RQFHDSURMHFWLVGRQH
WKH OHJDF\ RUJDQL]DWLRQ ,W DOVR HVWDEOLVKHG D H[-
Form an organizational performance
LEOH RUJDQL]DWLRQDO DQG JRYHUQDQFH VWUXFWXUH FHQ-
group: $VN WKH JURXS WR LQWHUYLHZ DQDO\]H
WHUHG DURXQG WKH $JLOH PHWKRGRORJ\ D QHWZRUN RI
DQGVWXG\KRZKLJKSHUIRUPLQJWHDPVSURMHFWV
WHDPV JURXSHG E\ SURGXFW IXQFWLRQDOLW\ WHFKQLFDO
DQG SURJUDPV DFWXDOO\ ZRUN %\ H[DPLQLQJ WKH
GRPDLQV DQG RSHUDWLRQDO UHDGLQHVV UHSRUWLQJ WR
FRPSDQ\VMREWLWOHVUHZDUGV\VWHPVDQGFDUHHU
SURJUDPOHDGHUVZLWKWKHDXWKRULW\WRDSSURYHQDO
SDWKV WKLV JURXS FDQ KHOS FKDUW WKH ZD\ WR D
GHFLVLRQV
PRUHDJLOHERWWRPXSPRGHOIRUEXVLQHVVXQLWV
7KHSURJUDPHQWLW\VHWXSDYDULHW\RIZD\VWRHQDEOH
Examine new communication tools: &RQ-
DQ\RQHWRUDLVHDQGYLHZLVVXHVHVFDODWHGHFLVLRQV
VLGHU WHFKQRORJLHV OLNH :RUNSODFH 6ODFN %DVH-
ZKHQUHTXLUHGDQGXOWLPDWHO\IDFLOLWDWHDFROODERUD-
FDPS $VDQD 7UHOOR :RUNERDUG DQG RWKHUV
WLYH HQYLURQPHQW )URP D WDOHQW SHUVSHFWLYH FRQ-
7KHQ VWDQGDUGL]H DQG LPSOHPHQW WKHP DV D
WLQXRXVFRDFKLQJOHDUQLQJDQGWHDPLQJHPSOR\HHV
FRPSOHPHQW WR WKH RUJDQL]DWLRQV FRUH (53
ZLWK RWKHU W\SHV RI ZRUNHUV VXFK DV FRQWUDFWRUV 
+506LQIUDVWUXFWXUH
DOORZHGIRUDGLYHUVHDQGFROOHJLDOHQYLURQPHQWLQ-
FUHDVLQJDJLOLW\DQGUHPRYLQJGHFLVLRQURDGEORFNV Adopt continuous, feedback-based per-
formance management: 5HJXODU IHHGEDFN
7KH OHJDF\ RUJDQL]DWLRQ ZDV HQJDJHG ZLWK WKH SUR-
HPSRZHUV SHRSOH WR UHVHW JRDOV FRQWLQXRXVO\
JUDPWHDPWRVXSSRUWWKHGHVLJQDQGGHOLYHU\RIWKH
FKDQJH SURMHFWV DQG IHHO UHZDUGHG IRU WKHLU
SURJUDP7KHLQWHUDFWLRQVEHWZHHQWKHOHJDF\RUJD-
ZRUN QRW MXVW WKHLU MRE (PSOR\HH VXUYH\
QL]DWLRQDQGWKHQHZHQWLW\ZHUHGHQHGLQDGYDQFH
WRROV JLYH PDQDJHUV LPPHGLDWH LQSXW RQ WKHLU
DQGZKLOHLWWRRNHRUWDQGWLPHWRUHDFKWKHSRLQW
RZQSHUIRUPDQFHERRVWLQJWUDQVSDUHQF\
ZKHUHWKHPRGHOZRUNHGHHFWLYHO\WKLVZDVFULWLFDO
WRWKHVXFFHVVRIWKHSURJUDP

7KH GLJLWDO SODWIRUP WKDW JUHZ RXW RI WKLV ZRUN


WUDQVIRUPHGKRZSHRSOHSXUFKDVHLQVXUDQFHDQGLV
VHWWLQJDQHZSUHFHGHQWIRUKRZLQVXUHUVVKRXOGGR
EXVLQHVV1RZWKHFRPSDQ\LVZRUNLQJWREULQJNH\
FRPSRQHQWVRIWKLVH[LEOHRUJDQL]DWLRQDOVWUXFWXUH
LQWR WKH HQWLUH HQWHUSULVH WR FKDQJH KRZ LW GRHV
EXVLQHVVGDLO\


2017 Deloitte Global Human Capital Trends

FAST FORWARD
As this new type of organization takes hold, working in teams will likely become the
norm in business, and dynamism will become an organizational hallmark. Building and
VXSSRUWLQJWHDPVZLOOEHOHDGHUVSULQFLSDOWDVNV6RIWZDUHWRKHOSFRPSDQLHVEHQHW
from teaming may also become standard.

/HDGLQJRUJDQL]DWLRQVZLOORHUG\QDPLFGHYHORSPHQWDORSSRUWXQLWLHVIRUHPSOR\HHV
to build their careers, while companies that continue to operate in the old manner
will likely struggle to keep up. In this new world, more nimble organizations will have
certain advantages, but successful large organizations will keep pace by building
stronger ecosystems and partnerships that broaden their workforces and capabilities.

)LJXUH7KHRUJDQL]DWLRQRIWKHIXWXUH2OGUXOHVYVQHZUXOHV

Old rules New rules

Organized for learning, innovation, and customer


2UJDQL]HGIRUHFLHQF\DQGHHFWLYHQHVV
impact

Company viewed as an agile network, empowered


Company viewed as a hierarchy, with hierarchical
by team leaders and fueled by collaboration and
decision rights, structure, and leadership progression
knowledge-sharing

Structure based on business function with functional Structure based on work and projects, with teams
leaders and global functional groups focused on products, customers, and services

Advancement through many assignments, diverse


Advancement through promotion upward with many
experiences, and multifunctional leadership
levels to progress through
assignments

3HRSOHFUHDWHIROORZHUVWRJURZLQLQXHQFHDQG
People become leaders through promotion
authority

Lead by direction Lead by orchestration

Culture ruled by fear of failure and perceptions of Culture of safety, abundance, and importance of risk-
others taking and innovation

Rules-based Playbook-based

7HDPVDQGUHVSRQVLELOLWLHVFOHDUO\GHQHGEXWUROHV
5ROHVDQGMREWLWOHVFOHDUO\GHQHG
and job titles change regularly

Process-based Project-based

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


Rewriting the rules for the digital age

ENDNOTES

1. 7LDQ\0F'RZHOO'LPSOH$JDUZDO'RQ0LOOHU7VXWRPX2NDPRWRDQG7UHYRU3DJH2UJDQL]DWLRQDOGHVLJQ7KH
rise of teams, Deloitte Global Human Capital Trends 2016, February 29, 2016, https://dupress.deloitte.com/dup-
us-en/focus/human-capital-trends/2016/organizational-models-network-of-teams.html, accessed December 21,
2016.

2. 7UHYRU3DJH$PLU5DKQHPD7DUD0XUSK\DQG7LDQ\0F'RZHOO8QORFNLQJWKHH[LEOHRUJDQL]DWLRQ2UJDQL]D-
tional design for an uncertain future, Deloitte, 2016, https://www2.deloitte.com/content/dam/Deloitte/global/
'RFXPHQWV+XPDQ&DSLWDOJ[KFXQORFNLQJH[LEOHRUJDQL]DWLRQSGIDFFHVVHG'HFHPEHU

3. Report by Rob Cross, http://www.robcross.org/consortia.htm.

4. Josh Bersin, HR technology disruptions for 2017: Nine trends reinventing the HR software market, Bersin by Deloitte,
2016.

5. Quentin Hardy, The new workplace is agile, and nonstop. Can you keep up? New York Times, November 25,
2016, http://www.nytimes.com/2016/11/25/technology/the-new-workplace-is-agile-and-nonstop-can-you-keep-
up.html, accessed December 21, 2016.

6. Andrea Derler, High-impact leadership: The new leadership maturity model, Bersin by Deloitte, 2016.

7. Conversation with the CEO of the Asian telecommunications company, August 2016.

 Deloitte, A new global HR software solution supports HR transformation and drives innovation at Philips, https://
www2.deloitte.com/content/dam/Deloitte/uk/Documents/consultancy/deloitte-uk-consulting-philips-hr-digital.
pdf, accessed February 12, 2017.

9. /7&:LOOLDP73HOVWHU 86$)UHWLUHG LQFRQYHUVDWLRQZLWKWKHDXWKRUV-DQXDU\


2017 Deloitte Global Human Capital Trends

AUTHORS

Josh Bersin, Bersin by Deloitte, Deloitte Consulting LLP | jbersin@deloitte.com

Josh Bersin founded Bersin & Associates, now Bersin by Deloitte, in 2001 to provide research
and advisory services focused on corporate learning. He is a frequent speaker at industry
events and a popular blogger. Bersin spent 25 years in product development, product
management, marketing, and sales of e-learning and other enterprise technologies. He has
a BS in engineering from Cornell, an MS in engineering from Stanford, and an MBA from the
Haas School of Business at the University of California, Berkeley.

7LDQ\0F'RZHOO'HORLWWH&RQVXOWLQJ//3_tmcdowell@deloitte.com

7LDQ\0F'RZHOOLVWKH86OHDGHUIRU'HORLWWHV2UJDQL]DWLRQ6WUDWHJLHVSUDFWLFH6KHKDV
years of business and consulting experience, delivering operating model, organization design,
talent strategy, decision optimization, and change management solutions. Her focus is on
KHOSLQJH[HFXWLYHVLQKHDOWKFDUHHHFWLYHO\OHDGWKHLURUJDQL]DWLRQVWKURXJKWUDQVIRUPDWLRQ
McDowell holds an MBA and a doctorate in industrial/organizational psychology.

Amir Rahnema, Deloitte Canada | arahnema@deloitte.com

Amir Rahnema is Deloittes global leader for Organization Design services. He focuses
on working with both private- and public-sector clients to drive large-scale organizational
UHVWUXFWXULQJHRUWVW\SLFDOO\WLHGWRPHUJHUVDQGDFTXLVLWLRQVVKLIWVLQVWUDWHJ\QHZ
technology implementations, and complex workforce transitions. His work has spanned
reorganizations in numerous industries, including banks, regulatory agencies, consumer
EXVLQHVVFRPSDQLHVPHGLDFRPSDQLHVDQGHQHUJ\UPV

Yves van Durme, Deloitte Consulting | yvandurme@deloitte.com

Yves van Durme is a partner with Deloittes Belgian consulting practice and the global leader
of Deloittes Strategic Change practice. He specializes in leadership and organizational
development and talent and HR strategy in business transformation contexts. Van Durme
has nearly 20 years of experience as a consultant, project manager, and program developer
RQKXPDQFDSLWDOSURMHFWVIRUPXOWLSOH(XURSHDQ-DSDQHVH$PHULFDQDQG%HOJLDQ
multinationals, family businesses, and small and medium enterprises. His experience
ZLWKKLJKSHUIRUPDQFHFRDFKLQJLQVSRUWVJLYHVKLPDVSHFLDODQLW\IRUOHDGHUVKLSDQG
organizational development work, focusing on the balance between processes, structures,
and systems on the one hand and cultural and people-related elements on the other.

CONTRIBUTORS
Garth Andrus, David Mallon, Phil Neal


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Careers and learning


Real time, all the time

The concept of career is being shaken to its core. Employees now enjoy the prospect
of 60-year careers. Yet at the same time, the half-life of skills is rapidly falling. These
new realities are forcing companies to rethink the way they manage careers and
deliver always-on learning and development (L&D) opportunities. Leading companies
are moving to overhaul their career models and L&D infrastructure for the digital age,
though most organizations are still in the early stages of this transformation.

This year, the issue of improving employee careers and transforming corporate
OHDUQLQJHPHUJHGDVWKHVHFRQGPRVWLPSRUWDQWWUHQGLQRXUVXUYH\XSIURPIWK
last year.

Learning technology is changing rapidly. Traditional learning management systems


are being complemented with and replaced by a wide range of new technologies
for content curation, delivery, video distribution, and mobile use.

This upheaval in learning and careers has become a catalyst for radical change.
Nearly half of our surveyed executives (45 percent) cite this problem as urgent or
YHU\LPSRUWDQW DQLQFUHDVHRYHUODVW\HDU $VFDSDELOLWLHVIDOOEHKLQGFRPSDQLHV
DELOLW\ WR NHHS XS ZLWK HPSOR\HHV GHPDQGV IRU OHDUQLQJ DQG FDUHHU JURZWK KDV
dropped by 5 percent.

W
HAT GRHV LW PHDQ WR KDYH D FDUHHU WR- WHAT EMPLOYEES EXPECT
GD\"0RUHVSHFLFDOO\ZKDWGRHVLWPHDQ FROM THE 100-YEAR LIFE1
LQ D ZRUOG ZKHUH FDUHHUV VSDQ  \HDUV
HYHQ DV WKH KDOIOLIH RI OHDUQHG VNLOOV FRQWLQXHV WR ,QPDQ\LQVWDQFHVHPSOR\HHVWKHPVHOYHVDUHSXVK-
IDOOWRRQO\DERXWYH\HDUV",QWKHSDVWHPSOR\HHV LQJIRUFRQWLQXRXVVNLOOGHYHORSPHQWDQGG\QDPLF
OHDUQHG WR JDLQ VNLOOV IRU D FDUHHU QRZ WKH FDUHHU FDUHHUV *ODVVGRRU GDWD UHYHDO WKDW DPRQJ 0LOOHQ-
LWVHOILVDMRXUQH\RIOHDUQLQJ QLDOVWKHDELOLW\WROHDUQDQGSURJUHVVLVQRZWKH
SULQFLSDOGULYHURIDFRPSDQ\VHPSOR\PHQWEUDQG2
$V FRPSDQLHV EXLOG WKH RUJDQL]DWLRQ RI WKH IXWXUH <HWRQO\RQHWKLUGRI0LOOHQQLDOVEHOLHYHWKHLURUJD-
FRQWLQXRXVOHDUQLQJLVFULWLFDOIRUEXVLQHVVVXFFHVV QL]DWLRQVDUHXVLQJWKHLUVNLOOVZHOODQGSHUFHQW
)RUWRGD\VGLJLWDORUJDQL]DWLRQVWKHQHZUXOHVFDOO VD\ WKH\ DUH OLNHO\ WR OHDYH EHFDXVH WKH\ DUH QRW
IRU D OHDUQLQJ DQG GHYHORSPHQW RUJDQL]DWLRQ WKDW OHDUQLQJIDVWHQRXJK3
FDQ GHOLYHU OHDUQLQJ WKDW LV DOZD\V RQ DQG DOZD\V
DYDLODEOHRYHUDUDQJHRIPRELOHSODWIRUPV


Rewriting the rules for the digital age

Figure 1. The changing nature of a career

Length of career Average tenure in a job Half-life of a learned skill

60 to 70 years 4.5 years 5 years


Sources: Lynda Gratton and Andrew Scott, The 100-Year Life: Living and Working in an Age of Longevity (Bloomsbury, 2016); Douglas
Thomas and John Seely Brown, A New Culture of Learning: Cultivating the Imagination for a World of Constant Change (CreateSpace,
January 4, 2011).
Deloitte University Press | dupress.deloitte.com

/HDGLQJRUJDQL]DWLRQVDUHSD\LQJDWWHQWLRQ&RPSD- WLRQ GRHV QRW KDYH WKH VNLOOV WR DGDSW 7KLV GRXEW
QLHVZLWKG\QDPLFFDUHHUPRGHOVRXWSHUIRUPWKHLU UHHFWVWKHIDFWWKDWVNLOOVDUHEHFRPLQJREVROHWHDW
SHHUV E\ SURYLGLQJ FRQWLQXRXV OHDUQLQJ RSSRUWX- DQDFFHOHUDWLQJUDWH6RIWZDUHHQJLQHHUVPXVWQRZ
QLWLHV DQG D GHHSO\ HPEHGGHG FXOWXUH RI GHYHORS- UHGHYHORSVNLOOVHYHU\PRQWKV3URIHVVLRQDOV
PHQW4 $V WKH DXWKRUV RI The 100-Year Life SRLQW LQPDUNHWLQJVDOHVPDQXIDFWXULQJODZDFFRXQWLQJ
RXW HPSOR\HHV IDFLQJ FDUHHUV VSDQQLQJ  WR  DQGQDQFHUHSRUWVLPLODUGHPDQGV
\HDUVH[SHFWHPSOR\HUVWRKHOSWKHPFRQWLQXDOO\UH-
7KHJRRGQHZVLVWKDWDQH[SORVLRQRIKLJKTXDOLW\
LQYHQWWKHPVHOYHVPRYHIURPUROHWRUROHDQGQG
IUHH RU ORZFRVW FRQWHQW RHUV RUJDQL]DWLRQV DQG
WKHLUFDOOLQJRYHUWLPH5
HPSOR\HHV UHDG\ DFFHVV WR FRQWLQXRXV OHDUQLQJ
&RPSDQLHV ZRUOGZLGH DUH VFUDPEOLQJ WR FDWFK XS 7KDQNV WR WRROV VXFK DV <RX7XEH DQG LQQRYDWRUV
ZLWK HPSOR\HHV GHVLUHV )XOO\  SHUFHQW RI WKH VXFK DV .KDQ $FDGHP\ 8GDFLW\ 8GHP\ &RXUV-
UHVSRQGHQWV ZH VXUYH\HG WKLV \HDU VD\ WKHLU RUJD- HUD 1RYR(G HG; DQG RWKHUV D QHZ VNLOO LV RIWHQ
QL]DWLRQV DUH VKLIWLQJ WR H[LEOH RSHQ FDUHHU PRG- RQO\DPRXVHFOLFNDZD\/HDGLQJXQLYHUVLWLHVRHU
HOV WKDW RHU HQULFKLQJ DVVLJQPHQWV SURMHFWV DQG JUDGXDWHOHYHO FRXUVHV RQOLQH WKURXJK HG; 0LFUR-
H[SHULHQFHVUDWKHUWKDQDVWDWLFFDUHHUSURJUHVVLRQ 0DVWHUVSURJUDPVIRUDIUDFWLRQRIWKHFRVWRIDIXOO
$QG  SHUFHQW RI VXUYH\HG UHVSRQGHQWV QRZ EH- PDVWHUV GHJUHH &RPSOHWLRQ RI D VHULHV RI RQOLQH
OLHYH WKHLU RUJDQL]DWLRQV HPSOR\HHV ZLOO KDYH FD- FRXUVHV RSHQV WKH GRRU IRU OHDUQHUV WR WKHQ DSSO\
UHHUVWKDWVSDQYH\HDUVRUOHVV IRUDGPLVVLRQWRDIRUPDOPDVWHUVSURJUDPDWRQH
RIWKHPDQ\WRSLQVWLWXWLRQVSDUWLFLSDWLQJ
THE NEED FOR RAPID SKILL
7KH RQJRLQJ FRPPRGLWL]DWLRQ RI FRQWHQW FDQ EH
DEVELOPMENT AND THE KLJKO\ GLVUXSWLYH WR FRUSRUDWH / ' GHSDUWPHQWV
COMMODITIZATION OF CONTENT 7KH\IDFHDVWDUNFKRLFHKDUQHVVWKLVWUHQGWRWKHLU
9LUWXDOO\ DOO &(2V  SHUFHQW  EHOLHYH WKHLU FRP- FRPSDQ\V EHQHW RU ULVN ZDWFKLQJ WKHLU OHDUQLQJ
SDQ\ LV IDFLQJ GLVUXSWLYH FKDQJH GULYHQ E\ GLJLWDO SURJUDPVEHFRPHREVROHWH
WHFKQRORJLHV DQG  SHUFHQW VD\ WKHLU RUJDQL]D-

Companies worldwide are scrambling to


catch up with employees desires.


2017 Deloitte Global Human Capital Trends

Figure 2. Careers and learning: Percentage of respondents rating this trend important
or very important

Percentages in
selected countries:
Canada 78 Higher % Lower %

China 91
86 Netherlands India 88
Brazil 87
Netherlands 86
Belgium 68
Japan 86
UK 84
United Kingdom 84
USA 80 Germany 83
86 Japan Germany 83
France 82
91 China Mexico 82
Spain 81
France 82
Mexico 82
Italy 76 Spain 81
88 India
South Africa 81
87 Brazil United States 80
78 Australia Canada 78
81 South Africa
Australia 78
Italy 76
Percentages by region: Belgium 68
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


86 80 86 84 78 81 78 88 79
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

/HDGLQJ FRPSDQLHV DUH HPEUDFLQJ FRQWLQXRXV RIH[WHUQDO022&VDQGYLGHROHDUQLQJDYDLODEOHRQ


OHDUQLQJ GHOLYHUHG GLJLWDOO\ *( FUHDWHG %ULOOLDQW WKH,QWHUQHW
8DQRQOLQHOHDUQLQJSODWIRUPWKDWIHDWXUHVYLGHR
7KH IDVWHVWJURZLQJ VHJPHQW LQ +5 WHFKQRORJ\
VKDULQJDQGRHUVHPSOR\HHGULYHQOHDUQLQJDFURVV
VSHQGLQJ LV QRZ WKH DGRSWLRQ RI QHZ HPSOR\HH
WKHHQWHUSULVH,Q\HDURQHPRUHWKDQSHUFHQWRI
OHDUQLQJV\VWHPV9&RPSDQLHVDUHVHULRXVO\ORRNLQJ
*(HPSOR\HHVGHYHORSHGFRQWHQWDQGVKDUHGLWZLWK
DWUHSODFLQJWKHLUHPSOR\HHOHDUQLQJLQIUDVWUXFWXUH
WKHLUSHHUV
DQGVKRSSLQJIRUQHZWRROVDWDOOOHYHOVRIWKHOHDUQ-
LQJWHFKQRORJ\VWDFN
NEW TOOLS ARE LEAVING
BEHIND TRADITIONAL LMS

$W PRVW FRPSDQLHV WKH OHDUQLQJ PDQDJHPHQW V\V-


WHP /06 LVDPRQJWKHROGHVWDQGPRVWFKDOOHQJ-
LQJ WR XVH 7RGD\ D QHZ VHW RI OHDUQLQJ WRROV KDV
HQWHUHG WKH PDUNHW SLRQHHUHG E\ YHQGRUV VXFK DV
'HJUHHG 3DWKJDWKHU (G&DVW *URYR DQG $[RQLI\
7KHVHWRROVSURYLGHFXUDWHGFRQWHQWYLGHRDQGPR-
ELOH OHDUQLQJ VROXWLRQV PLFUROHDUQLQJ DQG QHZ
ZD\VWRLQWHJUDWHDQGKDUQHVVWKHH[SORGLQJOLEUDU\


Rewriting the rules for the digital age

THE NEW LOOK OF L&D

$VDUHVXOWRIWKHVHIRUFHVWKHVWUXFWXUHRSHUDWLRQV
DQG PLVVLRQ RI FRUSRUDWH / ' DUH IDFLQJ UDGLFDO
FKDQJH 2QO\ D GHFDGH DJR FRPSDQLHV ZHUH FRQ-
WHQWWREXLOGYLUWXDOXQLYHUVLWLHVDQGRQOLQHFRXUVH
FDWDORJXHV7RGD\ZHVHHWKHOHDUQLQJIXQFWLRQDVD
KLJKO\VWUDWHJLFEXVLQHVVDUHDWKDWIRFXVHVRQLQQR-
YDWLRQDQGOHDGHUVKLSGHYHORSPHQWE\GHOLYHULQJD
ZRUOGFODVVOHDUQLQJH[SHULHQFHSURPRWLQJOLIHWLPH
OHDUQLQJIRUORQJHUFDUHHUVDQGEULQJLQJPXOWLIXQF-
WLRQDOWHDPVWRJHWKHUWRFRQQHFWDQGFROODERUDWH

7KHUHLVDOVRDQHZIRFXVRQFRQYHUJHQFHEULQJLQJ
WRJHWKHU GLVFLSOLQHV VXFK DV VDOHV PDUNHWLQJ GH-
VLJQQDQFHDQG,7RQWRFURVVIXQFWLRQDOWHDPVWR
EXLOGSURGXFWVDQGVROXWLRQVIDVWHU)RUZDUGWKLQN-
LQJ/ 'GHSDUWPHQWVDUHIDFLOLWDWLQJWKLVJURZWKLQ
LQWHUGLVFLSOLQDU\WKLQNLQJE\YLHZLQJWKHFRUSRUDWH
XQLYHUVLW\DVDFRPPRQVLQVWHDGRIDWUDLQLQJFHQWHU 6LQFH  $7 7 KDV LQYHVWHG  PLOOLRQ LQ
HGXFDWLRQDQGGHYHORSPHQWSURJUDPVIRU
)RUEXVLQHVVDQG+5OHDGHUVWKHQHZPRGHOVDUHD HPSOR\HHVZLWKDIRFXVRQFRQWLQXRXVFDUHHUGHYHO-
ZDNHXSFDOOWRDGDSWRUULVNIDOOLQJEHKLQGLQKLULQJ RSPHQW
HPSOR\HH HQJDJHPHQW SURGXFWLYLW\ DQG SURGXFW
LQQRYDWLRQ $V-RKQ'RQRYDQ$7 7VFKLHIVWUDWHJ\RFHUVDLG
:H IHOW D IXQGDPHQWDO REOLJDWLRQ WR UHVNLOO RXU
THE CHANGING ROLE OF ZRUNIRUFH11 7KH FRPSDQ\ H[SHFWV WKDW WKHVH LQGL-
L&D LEADERSHIP YLGXDOVZLOOFKDQJHUROHVHYHU\IRXU\HDUV12

7RIDFLOLWDWHWKLVPRELOLW\$7 7QRZRHUVDZLGH
7RNHHSSDFHZLWKWKHVHFKDQJHVFKLHIOHDUQLQJRI-
UDQJH RI RQOLQH OHDUQLQJ RSSRUWXQLWLHV DQG HQFRXU-
FHUV &/2V  PXVW QRZ EHFRPH WKH FDWDO\VWV IRU
DJHVHPSOR\HHVWRQGQHZMREVVHHNRXWPHQWRUV
QH[WJHQHUDWLRQ FDUHHUV ZKLOH DOVR WKLQNLQJ DERXW
DQG OHDUQ QHZ WHFKQRORJLHV 7R PDNH WKH WUDQVL-
KRZ WR VXSSRUW WKH RYHUDOO JURZWK RI WKH EXVLQHVV
WLRQ DV HDV\ DV SRVVLEOH $7 7 KDV SDUWQHUHG ZLWK
7KH\VKRXOGEHFRPHSDUWRIWKHHQWLUHHPSOR\HHH[-
XQLYHUVLWLHVWRSLRQHHUDRUGDEOHRQOLQHFRXUVHVLQ
SHULHQFHGHOLYHULQJOHDUQLQJVROXWLRQVWKDWLQVSLUH
WKHVNLOOVLWQHHGV$V%LOO%ODVHKHDGRI+5H[SODLQV
SHRSOH WR UHLQYHQW WKHPVHOYHV GHYHORS GHHS VNLOOV
,WV D QHZ EDUJDLQRQH WKDW GRQH ZHOO EHQHWV
DQGFRQWULEXWHWRWKHOHDUQLQJRIRWKHUV
ERWKWKHRUJDQL]DWLRQDQGWKHHPSOR\HHVZKROHDUQ
7KH JRDO LV D OHDUQLQJ HQYLURQPHQW DGDSWHG WR D QHZVNLOOVWRDGYDQFHWKHLUFDUHHUV13
ZRUOG RI LQFUHDVHG HPSOR\HH PRELOLW\ ,QWHUGLVFL-
,URQLFDOO\ DV OHJDF\ / ' UHVSRQVLELOLWLHV EHFRPH
SOLQDU\VNLOOVGHYHORSPHQWLVFULWLFDOEHFDXVHWKHVH
OHVV UHOHYDQW WKH RSSRUWXQLWLHV IRU / ' WR EH
FDSDELOLWLHV DOLJQ ZLWK WKH RUJDQL]DWLRQDO VKLIW WR
PRUH UHOHYDQW KDYH QHYHU EHHQ JUHDWHU / ' RUJD-
QHWZRUNVRIWHDPV/HDUQLQJVKRXOGHQFRXUDJHDQG
QL]DWLRQV WKDW UHFRJQL]H WKH QHZ IXWXUH RI FDUHHUV
HYHQSXVKSHRSOHWRPRYHDFURVVMREV
HPEUDFH H[SRQHQWLDO FKDQJHV LQ WHFKQRORJ\ DQG
/HDGLQJ RUJDQL]DWLRQV DUH DGRSWLQJ WKHVH W\SHV RI EHFRPH H[LEOH FRQWHQW FXUDWRUV UDWKHU WKDQ ULJLG
OHDUQLQJ VWUDWHJLHV WR KHOS HPSOR\HHV DGDSWZKDW FRQWHQWFUHDWRUVKDYHWKHSRWHQWLDOWREHFRPHKLJK-
7RP )ULHGPDQ WHUPV LQWHOOLJHQW DVVLVWDQFH O\YDOXHGEXVLQHVVSDUWQHUV


2017 Deloitte Global Human Capital Trends

DOOWKHDVVHWVRIDQRUJDQL]DWLRQWRDWWDFNLW,QWKH
(OLDQG(G\WKH%URDG&HQWHUIRU5HJHQHUDWLYH0HGL-
For business and FLQHDQG6WHP&HOO5HVHDUFKWKHXQLYHUVLW\EURXJKW

HR leaders, the new


WRJHWKHU OHDGLQJ PLQGV LQ VFLHQFH DQG WRS WDOHQW
IURP WKH FLQHPDWRJUDSK\ VFKRRO :K\ WKH FLQHPD

models are a wake- VFKRRO"%HFDXVHLWRHUHGDGYDQFHGVNLOOVLQGLJLWDO


LPDJLQJDQGYLUWXDOUHDOLW\DFFHOHUDWLQJWKHZRUNRI
up call to adapt or risk WKHVFLHQFHWHDPWRVROYHFRPSOH[VFLHQWLFLVVXHV

falling behind in hiring,


7KLVQRWRQO\EURXJKWQHZWKLQNLQJWRWKHSUREOHP
LW UHIUDPHG WKH FDUHHUV RI WKH FLQHPD VFKRRO HP-

employee engagement, SOR\HHV DV ZHOOD SULPH H[DPSOH RI OHDUQLQJ DQG
FRQYHUJHQFH15
productivity, and $QRWKHUH[DPSOHLVWKH,RYLQHDQG<RXQJ$FDGHP\
product innovation. IRU$UWV7HFKQRORJ\DQGWKH%XVLQHVVRI,QQRYDWLRQ
HVWDEOLVKHGZLWKDJLIWIURPWKHIRXQGHUVRI%HDWV,Q
DQHDUO\H[DPSOHRIFRQYHUJHQFH%HDWVEURXJKWGH-
VLJQWKLQNLQJHQJLQHHULQJDQGWKHORYHRIPXVLFWR
DEUHDNWKURXJKGHVLJQIRUKHDGVHWV$VWKHFRPSD-
Lessons from the front lines Q\JUHZQGLQJWKHULJKWWDOHQWSURYHGDFRQVWDQW
FKDOOHQJH7RVROYHLW%HDWVZRUNHGZLWK'U(ULFD
7RSWLHU UHVHDUFK XQLYHUVLWLHV RHU LQVLJKWV LQWR
0XKO GHDQ RI WKH 5RVNL 6FKRRO RI $UW DQG 'HVLJQ
QHZDSSURDFKHVIRU&/2VVWUXJJOLQJWRDGMXVWWRGH-
WRIRXQGWKHDFDGHP\DW86&IRFXVLQJRQQHZOLW-
PDQGVIRUFRQYHUJHQFH7KH8QLYHUVLW\RI6RXWKHUQ
HUDFLHVLQFOXGLQJYLVXDOGHVLJQFROODERUDWLRQDQG
&DOLIRUQLD 86& LVOHDGLQJWKHFKDUJHRQKRZOHDUQ-
LWHUDWLYH GHVLJQ WHFKQLFDO VNLOOV DQG EXVLQHVV DFX-
LQJFDQGULYHLQQRYDWLRQDQGHPSRZHULQGLYLGXDOV
PHQ7KLVDSSURDFKKDVOHGWREUHDNWKURXJKGHVLJQ
WRUHDFKWKHLUSHDNSHUIRUPDQFH
WKLQNLQJ WKDW LV EHLQJ DSSOLHG WR DGYDQFHG FDQFHU
/LNH PDQ\ RUJDQL]DWLRQV 86& UHDOL]HG LW QHHGHG UHVHDUFK DQG JOREDO VDWHOOLWHEDVHG :L)L IRU WKH
WR UHWKLQN LWV XQGHUO\LQJ DSSURDFK WR PDNH D UHDO ZRUOG
LPSDFW8QGHUWKHJXLGDQFHRIWKHSURYRVW0LFKDHO
:KDWOHVVRQVVKRXOGFRUSRUDWH&/2VDSSO\"7KLQN
4XLFN DQG SUHVLGHQW &/ 0D[ 1LNLDV 86& FKDO-
EH\RQGLQWHUGLVFLSOLQDU\DQGPRYHWRFRQYHUJHQFH
OHQJHGLWVHOIWRUHLPDJLQHKRZOHDUQLQJFDQEHXVHG
)RFXV RQ GHQLQJ DQG DGGUHVVLQJ WRXJK SUREOHPV
DVDVWUDWHJLFDVVHWIRUWKHVWXGHQWXQLYHUVLW\DQG
ZKLFK LI VROYHG ZRXOG PDNH D UHDO LPSDFW &KDO-
VRFLHW\DWODUJH
OHQJHWHDPVWRJRDIWHUYH[LQJSUREOHPVE\VWDUWLQJ
86&KDVGLVWLQFWEXVLQHVVXQLWVHDFKZLWKLWV IURP WKH JURXQG XS %ULQJ WRJHWKHU SHRSOH ZLWK
RZQSURWDQGORVVVWDWHPHQW/LNHPDQ\FRUSRUDWH QRQWUDGLWLRQDOVNLOOV
&/2V86&IDFHGWKHFKDOOHQJHRIEUHDNLQJWKURXJK
&RPSDQLHV VXFK DV 1HVWOp 'HOO DQG 9LVD DUH IRO-
WKHVLORV7KHSURFHVVVWDUWHGZLWKLQWHUGLVFLSOLQDU\
ORZLQJ WKLV SDWK WR EXLOG QHZ FRUSRUDWH OHDUQLQJ
WKLQNLQJ EULQJLQJ WRJHWKHU OHDUQHUV DQG UHVHDUFK-
IXQFWLRQV XVLQJ WKHLU FRUSRUDWH XQLYHUVLW\ DV D
HUVIURPGLVWLQFWEXVLQHVVXQLWV7KLV\LHOGHGLQFUH-
FRUQHUVWRQH IRU FROODERUDWLRQ OHDGHUVKLS GHYHORS-
PHQWDOEHQHWVEXWQRWUHDOFKDQJH14
PHQWDQGFURVVIXQFWLRQDOLQQRYDWLRQ$VSHRSOH
7KH QH[W VWHS LQ WKH HYROXWLRQ ZDV FRQYHUJHQFH EHFRPHPRUHG\QDPLFLQWKHLUFDUHHUVWKHQHHGWR
IRUPLQJ LQWHUGLVFLSOLQDU\ WHDPV IURP WKH JURXQG EXLOGUHODWLRQVKLSVDQGFRPPXQLW\FRQQHFWLRQVEH-
XSIRFXVLQJRQDVSHFLFSUREOHPDQGWKHQXVLQJ FRPHVLQWHJUDOWRSHUIRUPDQFHDQGLQQRYDWLRQ


Rewriting the rules for the digital age

Start here Refocus the L&D team: 0RYH DZD\ IURP


WUDLQLQJ WRZDUG FXUDWLRQ FXOWXUH DQG EULQJLQJ
Evaluate internal mobility: $V WKH GHPDQG SHRSOHWRJHWKHU
IRUFURVVIXQFWLRQDOWHDPVFRQWLQXHVWRULVHPR-
Rethink the entire L&D technology infra-
ELOLW\ZLOORQO\JURZLQLPSRUWDQFH6WXG\H[LVW-
structure:)RUPDQ\FRPSDQLHVWKLVZLOOPHDQ
LQJSDWWHUQVRIFDUHHUPRELOLW\DQGEHJLQPRUH
PRYLQJ DZD\ IURP /06 WRZDUG D OHDUQLQJFHQ-
DJJUHVVLYH SURJUDPV LQFOXGLQJ GHYHORSPHQWDO
WULF PRGHO ZKLFK PD\ LQYROYH UHSODFLQJ FRUH
DQG URWDWLRQDO DVVLJQPHQWV DQG SURIHVVLRQDO
/06ZLWKQHZOHDUQLQJH[SHULHQFHVRIWZDUH
GHYHORSPHQWSURJUDPV
Rethink the corporate university:,QYHVWLQ
Review the organizations job architec-
D SODFH WR EULQJ SHRSOH WRJHWKHU IRU FURVVIXQF-
ture: %H VXUH LW LV DV QLPEOH DQG VWUHDPOLQHG
WLRQDO DQG LQWHUGLVFLSOLQDU\ SURJUDPV LQ DGGL-
DVSRVVLEOHWRVXSSRUWWKHQHZFDUHHUPRGHOVRI
WLRQWRJUHDWOHDUQLQJ
WKHIXWXUH
Manage the employment brand:7RROVVXFK
Build a culture of hiring from within:+ROG
DV*ODVVGRRUNHHSPHWULFVRQZKHWKHUDFRPSD-
PDQDJHUVDFFRXQWDEOHIRUWUDLQLQJDQGVXSSRUW-
Q\SURYLGHVRSSRUWXQLWLHVIRUFDUHHUJURZWK3R-
LQJLQWHUQDOFDQGLGDWHVLQQHZUROHV
WHQWLDOFDQGLGDWHVFDQHYDOXDWHWKHVHUDWLQJVDQG
Track learning metrics:(PHUJLQJWHFKQROR- PD\DYRLGRUJDQL]DWLRQVWKDWGRQRWFRQVLVWHQWO\
JLHVRHUQHZPHDVXUHVRIGHYHORSPHQWVXFKDV RHURSSRUWXQLWLHV
WKHQXPEHURIKRXUVHPSOR\HHVVSHQGRQOHDUQ-
LQJ SODWIRUPV )RUZDUGORRNLQJ FRPSDQLHV DUH
FROOHFWLQJDQGOHYHUDJLQJWKLVGDWD

FAST FORWARD
The impact of the fourth industrial revolution is fundamentally changing the nature
of work and the meaning of career, and making it imperative to constantly refresh
RQHVVNLOOV8QOLNHVRPHRIWKLV\HDUVWUHQGVZKHUHWKHRUJDQL]DWLRQFDQKHOSGULYH
ZKDWQHHGVWREHGRQHZKHQLWFRPHVWROHDUQLQJWKHRUJDQL]DWLRQVUROHLVWR
create the environment and systems to allow employees to constantly learn and
relearn. The explosion of free content means that the learning organization should
seamlessly integrate internal and external content into its platforms.


2017 Deloitte Global Human Capital Trends

)LJXUH&DUHHUVDQGOHDUQLQJ2OGUXOHVYVQHZUXOHV

Old rules New rules

Employees are told what to learn by their managers Employees decide what to learn based on their
or the career model WHDPVQHHGVDQGLQGLYLGXDOFDUHHUJRDOV

Careers go up or out Careers go in every direction

3HRSOHQGWKHLUFDUHHUGLUHFWLRQZLWKKHOSIURP
Managers direct careers for people
leaders and others

Corporate L&D curates development and creates a


Corporate L&D owns development and training
useful learning experience

People learn in the classroom and, sometimes, People learn all the time, in micro-learning, courses,
online classrooms, and groups

The corporate university is a corporate commons,


The corporate university is a training center bringing leaders and cross-functional groups
together

Learning technology focuses on compliance and Learning technology creates an always-on,


course catalog collaborative, curated learning experience

Learning content is provided by everyone in the


Learning content is provided by L&D and experts organization, and curated by employees as well as
HR

Credentials are provided by universities and Credentials come in the form of unbundled
DFFUHGLWHGLQVWLWXWLRQVVNLOOVDUHRQO\FHUWLHG FUHGHQWLDOVZKHUHSHRSOHREWDLQFHUWLFDWHVLQ
through credentials many ways

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


Rewriting the rules for the digital age

ENDNOTES

1. Lynda Gratton and Andrew Scott, The 100-Year Life: Living and Working in an Age of Longevity (Bloomsbury, 2016).

2. Bersin by Deloitte proprietary research with Glassdoor.

3. Christie Smith and Stephanie Turner, The Millennial majority is transforming your culture, Deloitte, 2016, pp. 115,
https://www2.deloitte.com/content/dam/Deloitte/us/Documents/about-deloitte/us-millennial-majority-will-
transform-your-culture.pdf, accessed December 21, 2016.

4. Dani Johnson, The career management framework, Bersin by Deloitte, 2016; Dani Johnson, Applying the career
management framework, Bersin by Deloitte, 2016.

5. Gratton and Scott, The 100-Year Life.

6. Gerald C. Kane, Doug Palmer, Anh Nguyen Phillips, David Kiron, and Natasha Buckley, $OLJQLQJWKHRUJDQL]DWLRQ
for its digital future, MIT Sloan Management Review and Deloitte University Press, July 25, 2016, https://dupress.
deloitte.com/dup-us-en/topics/emerging-technologies/mit-smr-deloitte-digital-transformation-strategy.html.

7. GitHub, https://github.com/.

 0DQL*RSDODNULVKQDQ FKLHIOHDUQLQJRFHU*( LQGLVFXVVLRQZLWKWKHDXWKRUVVSULQJ

9. Stacey Harris and Erin Spencer, Sierra-Cedar 20162017 HR systems survey, 19th annual edition, Sierra-Cedar, 2016.

10. Thomas L. Friedman, Thank You for Being Late (Farrar, Straus & Giroux, 2016), pp. 213219.

11. -RKQ'RQRYDQDQG&DWK\%HQNR$7 7VWDOHQWRYHUKDXOHarvard Business Review, October, 2016, https://hbr.


org/2016/10/atts-talent-overhaul, accessed October 3, 2016.

12. Ibid.

13. Ibid.

14. Michael Quirk (provost, University of Southern California), in discussion with the authors, October 2016.

15. Ibid.

16. Dr. Erica Muhl (dean of the Roski School of Art and Design, University of Southern California), in discussion with
the authors, fall 2016.

17. Executive conversations with the authors.


2017 Deloitte Global Human Capital Trends

AUTHORS

Bill Pelster, Deloitte Consulting LLP | bpelster@deloitte.com

Bill Pelster has more than 25 years of industry and consulting experience. In his current role,
Pelster is responsible for leading the Bersin by Deloitte Research and Products practice and
is a senior advisor to the Integrated Talent Management practice. A well-respected speaker
and author, he has recently led, supported, or authored key research pieces including Talent
2020, Global Human Capital Trends, and The Leadership Premium. In his previous role as
'HORLWWHVFKLHIOHDUQLQJRFHU3HOVWHUZDVUHVSRQVLEOHIRUWKHWRWDOGHYHORSPHQWH[SHULHQFH
of Deloitte professionals, and was one of the key architects of Deloitte University, Deloittes
$300 million learning facility outside Dallas. Pelster is a former US board member for Deloitte
Consulting LLP.

Dani Johnson, Bersin by Deloitte, Deloitte Consulting LLP


danjohnson@deloitte.com

Dani Johnson has spent the majority of her career writing about, conducting research in,
designing, and consulting on human capital practices. Johnson led the Human Resource
Competency Study with the University of Michigan and six other professional organizations
around the world, and co-authored the resulting book, HR Competencies: Mastery at the
Intersection of People and Business (Society for Human Resource Management, 2008).

Jen Stempel, Deloitte Consulting LLP | jstempel@deloitte.com

Jen Stempel has more than 20 years of experience in corporate learning. She leads Deloittes
Americas Learning Solutions practice and the US Learning Advisory practice, working with
large, complex, global companies to help them optimize their learning functions and realize
YDOXHIURPWKHLUOHDUQLQJVSHQGE\LPSURYLQJSURJUDPHHFWLYHQHVVRSHUDWLRQDOHFLHQF\
and business strategy alignment. Stempel is a frequent writer and speaker on learning and
talent topics.

Bernard van der Vyver, Deloitte Consulting BV | bevandervyver@deloitte.com

Bernard van der Vyver is a leading advisor on human capital matters, focusing on learning
DQGGHYHORSPHQW%\PHUJLQJKLVEDFNJURXQGLQWHFKQRORJ\DQGLWVHHFWLYHXVHZLWK
the development of people, van der Vyver brings a unique strength to the HR domain. As
Deloittes global Learning Solutions leader, he aspires to grow and strengthen the global
learning community by leveraging the organizations knowledge and expertise to deliver
learning solutions that create unique value for clients.

CONTRIBUTORS
Jason Galea, Greg Stoskopf


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Talent acquisition
(QWHUWKHFRJQLWLYHUHFUXLWHU

Talent sourcing and recruitment face tremendous pressure. Talent and skill short-
ages are widespread. Employees are demanding new careers and career models. And
WHFKQRORJLHV DQG LQQRYDWLRQVLQFOXGLQJ FRJQLWLYH DUWLFLDO LQWHOOLJHQFH VRFLDO FRO-
laboration, crowds, and the sharing economyare reshaping the workforce. Leading
companies are turning the open talent economy into an opportunity by embracing
WHFKQRORJLHVDQGGHYHORSLQJQHZPRGHOVWKDWPDNHLQQRYDWLYHXVHRIRQDQGR
balance-sheet talent sources.

Attracting skilled resources is no longer simply the responsibility of HR. It now


stands as a top concern of business leaders, ranking third in our survey this year.

0RUH WKDQ  LQ   SHUFHQW  H[HFXWLYHV VD\ WDOHQW DFTXLVLWLRQ LV LPSRUWDQW RU
very important.

F
INDING WDOHQWERWKRQDQGREDODQFHVKHHW HPSOR\PHQW EUDQG ZKLFK FDQ SXOO FDQGLGDWHV
KDVPRYHGIDUEH\RQGWUDGLWLRQDOUHFUXLWLQJWR WRZDUGWKHP
HQFRPSDVV WKH EURDGHU VFRSH RI WDOHQW DFTXL-
&UHDWLQJDQDWWUDFWLYHHPSOR\PHQWEUDQGLQYROYHVD
VLWLRQ 7$  2QFH WKH VROH GRPDLQ RI +5 7$ QRZ
FRPSOH[PL[RIIRUFHV2QHPDMRUIDFWRULVWKHRYHU-
LQYROYHV PXOWLSOH WHDPV DFURVV WKH RUJDQL]DWLRQ
DOO ZRUNIRUFH H[SHULHQFH ZKLFK UHTXLUHV KLJK OHY-
$GGLQJ WR WKH FRPSOH[LW\ WKH DFFHOHUDWLQJ SDFH RI
HOVRIHQJDJHPHQWDQGVWURQJFDUHHURSSRUWXQLWLHV
WHFKQRORJ\RHUVDGL]]\LQJDUUD\RIQHZVROXWLRQV
,QIDFWRXWUHDFKFDPSDLJQVWRHGXFDWHDQGDWWUDFW
HYHQ DV WKH QDWXUH DQG VRXUFHV RI WDOHQW PDUNHWV
FDQGLGDWHV PD\ EH MXVW DV LPSRUWDQW DV FXVWRPHU
FRQWLQXH WR VKLIW &XUUHQW SODWIRUPV VWUXJJOH WR
IRFXVHG DGYHUWLVLQJ +HLQHNHQ IRU H[DPSOH GHYHO-
DGDSWEHFDXVHPDQ\DUHWRRROGWRLQWHJUDWHHPHUJ-
RSHGDVHULHVRIXQFRQYHQWLRQDOYLGHRVDQGZHELQ-
LQJWHFKQRORJLHVFDSDELOLWLHVDQGQHHGV
WHUYLHZV WR KLJKOLJKW WKH HPSOR\HH H[SHULHQFH DQG
VHWWKHFRPSDQ\DSDUW1
BUILDING A STRATEGIC AND
DIGITAL EMPLOYMENT BRAND (PSOR\HUV PXVW DOVR UHFRQVLGHU KRZ WKH\ FRP-
PXQLFDWH WKHLU YDOXH SURSRVLWLRQ WR WKH ZRUNIRUFH
,Q WRGD\V WUDQVSDUHQW GLJLWDO ZRUOG D FRPSDQ\V 'HOOV *OREDO 7DOHQW %UDQG DQG 7RROV WHDP FRP-
HPSOR\PHQWEUDQGPXVWEHERWKKLJKO\YLVLEOHDQG SOHWHO\ UHGHVLJQHG WKH FRPSDQ\V JOREDO FDUHHU
KLJKO\DWWUDFWLYHEHFDXVHFDQGLGDWHVQRZRIWHQQG ZHEVLWHV WR LQFOXGH FRQVLVWHQW PHVVDJLQJ DQG LP-
WKH HPSOR\HU QRW WKH UHYHUVH 7R OHYHUDJH WKLV LQ- DJHV7KHWHDPDOVRODXQFKHGDMREVHDUFKRSWLPL]D-
WHUHVW FRPSDQLHV DUH LQWHQVLYHO\ PDQDJLQJ WKHLU WLRQ VLWH DQG DQ DJJUHVVLYH FDPSDLJQ RI FDQGLGDWH


Rewriting the rules for the digital age

Figure 1. Talent acquisition: Percentage of respondents rating this trend important


or very important

Percentages in
selected countries:
Higher % Lower %
Canada 79
India 89

81 Netherlands United Kingdom 87


China 84
Japan 83
Belgium 70 Spain 83
UK 87 United States 82
USA 82 Germany 77 South Africa 81
France 75 83 Japan Netherlands 81
Spain 83 84 China Mexico 80
Mexico 80 Italy 79
Italy 79
89 India
Brazil 79
Canada 79
79 Brazil
70 Australia Germany 77
81 South Africa
France 75
Australia 70
Percentages by region: Belgium 70
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


83 81 84 81 82 75 78 87 70
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

IRFXVHG FRQWHQW IHDWXULQJ EORJ SRVWV DQG D ZLGH ODUJHU +5 V\VWHPV VXFK DV :RUNGD\ DQG 2UDFOH
UDQJH RI YLGHRV 7KHVH ZHUH SRVWHG RQ WKH FRP- DUHEXLOGLQJVROXWLRQVWKDWIHHGLQWRHYHQELJJHUV\V-
SDQ\VFDUHHUVLWHVLWV<RX7XEHFKDQQHODQGRWKHU WHPV
HPSOR\HH DQG FDQGLGDWHIRFXVHG VLWHV VXFK DV
7KH PRUH LQQRYDWLYH LGHDV DQG VROXWLRQV DUH FHQ-
*ODVVGRRU 7KH YLGHRV ZKLFK LQFOXGHG HPSOR\HHV
WHUHGDURXQGFRJQLWLYHWHFKQRORJLHVVXFKDVDUWLFLDO
WDONLQJ DERXW WKHLU H[SHULHQFHV DW 'HOO UHDFKHG D
LQWHOOLJHQFH $, PDFKLQHWRPDFKLQHOHDUQLQJUR-
ZLGHDUUD\RIVRFLDOQHWZRUNV2
ERWLFSURFHVVDXWRPDWLRQQDWXUDOODQJXDJHSURFHVV-
LQJ SUHGLFWLYH DOJRULWKPV DQG VHOIOHDUQLQJ &KDW-
LEVERAGING NEW TECHNOLOGIES
ERWV DUH EHFRPLQJ SRSXODU LQFOXGLQJ WKH UHFHQWO\
FROM SOCIAL TO COGNITIVE ODXQFKHG 2OLYLD ZKLFK JXLGHV FDQGLGDWHV WKURXJK
7KHELJJHVWGLVUXSWRULQWDOHQWDFTXLVLWLRQWRGD\LV DQDSSOLFDWLRQSURFHVVZLWKVHTXHQFHGTXHVWLRQV4
H[SHULPHQWDWLRQ ZLWK WHFK VROXWLRQV DQG VHUYLFHV :KLOHFRJQLWLYH7$LVFXUUHQWO\WKHGRPDLQRIPRVW-
:LWK RYHU  SHUFHQW RI 7$ V\VWHPV FRPLQJ IURP O\VPDOOVLQJOHVROXWLRQVWDUWXSV,%0V$,SLRQHHU
WKLUGSDUW\ SURYLGHUV YHQGRUV DUH DFWLYHO\ VHHN- :DWVRQ LV QRZ PRYLQJ LQWR WKH VSDFH ZLWK WKUHH
LQJWRFDSLWDOL]HRQWKHVHQHZWHFKQRORJLHV30DQ\ QHZWHFKQRORJLHVDPDFKLQHOHDUQLQJSODWIRUPWKDW
RI WKHVH DUH HYROYLQJ WRZDUG FRJQLWLYH FDSDELOLWLHV UDQNVWKHSULRULW\RIRSHQUHTXLVLWLRQVVRFLDOOLVWHQ-
WKDWEXLOGRQPRELOHDQGFORXGWHFKQRORJLHVDVZHOO LQJIRUDQRUJDQL]DWLRQVDQGFRPSHWLWRUVSXEOLFO\
DV VRFLDO QHWZRUNV VXFK DV /LQNHG,Q 6RPH RI WKH DYDLODEOH UHYLHZV RQ *ODVVGRRU 7ZLWWHU DQG QHZV-


2017 Deloitte Global Human Capital Trends

IHHGV DQG D WRRO WKDW PDWFKHV FDQGLGDWHV WR MREV )RUZDUGORRNLQJ RUJDQL]DWLRQV DUH DOVR EHJLQQLQJ
WKURXJK D W VFRUH EDVHG RQ FDUHHU H[SHULHQFHV WRHPSOR\VLPXODWLRQVDQGJDPLQJWRFRQQHFWZLWK
DQG VNLOOV 7KHVH WHFKQRORJLHV WDNH SUHH[LVWLQJ VR- WDOHQWSDUWLFXODUO\0LOOHQQLDOVDQGDQDO\]HZKHWK-
FLDOGDWDDQGLQIRUPDWLRQDQGWKHQDSSO\DGYDQFHG HUFDQGLGDWHVDUHSULPHGWRVXFFHHGLQDJLYHQUROH
FRJQLWLYHFDSDELOLWLHVWRGHOLYHUDFWLRQDEOHDQDO\VLV +RZHYHU IHZ DUH IXOO\ XWLOL]LQJ WKHVH FDSDELOLWLHV
-XVW  SHUFHQW RI VXUYH\HG JOREDO EXVLQHVV OHDGHUV
3UHGLFWLYHDQDO\WLFVLVLQFUHDVLQJO\LPSRUWDQWWR7$
VD\WKHLUFRPSDQ\LVH[FHOOHQWDWXVLQJJDPLQJDQG
DVVRSKLVWLFDWHGDQDO\WLFVWHDPVEHJLQWRSULRULWL]H
VLPXODWLRQV WR DWWUDFW DQG DVVHVV SRWHQWLDO FDQGL-
UHFUXLWLQJ ZRUNRZV FRQGXFW ZRUNIRUFH SODQQLQJ
GDWHVDQGSHUFHQWRIUHVSRQGHQWVUDWHWKHLUFRP-
HYDOXDWHGLHUHQWUHFUXLWLQJVRXUFHVDVVHVVTXDOLW\
SDQ\DVZHDN 6HHJXUH
RI KLUH DQG XVH SUHKLUH DVVHVVPHQWV &RPSDQLHV
WKDWDUHQRWSULRULWL]LQJDQDO\WLFVGRVRDWWKHLURZQ
USING VIDEO AS A TOOL FOR A
ULVN
COMPELLING CANDIDATE EXPERIENCE
3UHGLFWLYH+LUH D FORXGEDVHG 6DD6 DQDO\WLFV VROX-
WLRQ SURYLGHU IRXQG WKDW RQH RI LWV $XVWUDOLDQ FOL- 7KH FDQGLGDWH H[SHULHQFH LV WKH UVW SKDVH RI WKH
HQWVFRXOGKDYHVDYHGPLOOLRQ$XVWUDOLDQGROODUV EURDGHU HPSOR\HH H[SHULHQFH <HW RQO\  SHUFHQW
E\ XVLQJ D SUHKLUH DVVHVVPHQW WRRO :LWKRXW WKH RIJOREDOEXVLQHVVOHDGHUVVXUYH\HGWKLV\HDUEHOLHYH
WRROWKHFOLHQWKLUHGSHRSOHRYHUPRQWKVEXW WKHLUFRPSDQLHVGRDQH[FHOOHQWMREFXOWLYDWLQJDQG
ORVW  $XVWUDOLDQ GROODUV RQ WKRVH DSSRLQW- PRQLWRULQJ ORQJWHUP UHODWLRQVKLSV ZLWK SRWHQWLDO
PHQWVDVPHDVXUHGLQSHRSOHFRVWVRVHWE\WKHUHY- IXWXUHWDOHQW
HQXHVWKH\JHQHUDWHG5 9LGHRLVHPHUJLQJDVDWRROWRDGGUHVVWKLVFKDOOHQJH
7KH DSSOLFDQW WUDFNLQJ V\VWHP $76 ZKLFK KDV E\ HQDEOLQJ D PRUH FRPSHOOLQJ FDQGLGDWH H[SHUL-
WUDGLWLRQDOO\EHHQDQLPPHQVH7$OLQJFDELQHWLV HQFH 6$3 IRU H[DPSOH XVHV FDUWRRQV DQG YLGHR
EHLQJ UHLQYHQWHG E\ LQQRYDWLYH VROXWLRQ SURYLGHUV JDPHVWRLOOXVWUDWHOLIHDWWKHFRPSDQ\LQDQHQJDJ-
7KHVHSURYLGHUVDUHDXJPHQWLQJWKH$76ZLWKRWKHU LQJ ZD\ 2WKHU RUJDQL]DWLRQV DUH UHLPDJLQLQJ WKH
7$ WHFKQRORJLHV LQFOXGLQJ FDQGLGDWH UHODWLRQVKLS DJHROGMREGHVFULSWLRQLQDYLGHRIRUPDW-RESRVW-
PDQDJHPHQWYLGHRLQWHUYLHZLQJDQGDQDO\WLFV)RU LQJVRQ)DFHERRNWKDWIHDWXUHYLGHRVUHFHLYHSHU-
H[DPSOH +5 VRIWZDUH FRPSDQ\ /HYHU KDV UHLPDJ- FHQWPRUHDSSOLFDWLRQV
LQHGWKH$76WRSLYRWDURXQGFDQGLGDWHUHODWLRQVKLS 9LGHRLVDOVRWUDQVIRUPLQJLQWHUYLHZV$,DQGDYLG-
PDQDJHPHQWRHULQJEXLOWLQUHDOWLPHUHSRUWLQJ HRLQWHUYLHZPD\EHEHWWHUDEOHWRLGHQWLI\SURPLV-
DFURVVDOOSLSHOLQHVDQGUHFUXLWLQJIXQFWLRQV LQJ FDQGLGDWHV WKDQ D WUDGLWLRQDO LQWHUYLHZ VDYLQJ
PRQH\ DQG UHGXFLQJ WLPHWRKLUH )RU H[DPSOH

Figure 2. Respondents ratings of their ability to use games and simulations to attract
and assess potential candidates

Percentage of total responses


Using games and simulations to attract
71% 23% 6%
and assess potential candidates

Weak Adequate Excellent

Deloitte University Press | dupress.deloitte.com


Rewriting the rules for the digital age

+LOWRQXVHGDYLGHRLQWHUYLHZLQJSODWIRUPWRFXWLWV FROM CREDENTIALS TO SKILLS


UHFUXLWLQJ F\FOH IURP VL[ ZHHNV WR MXVW YH GD\V
9LGHRLQWHUYLHZLQJFDQUHGXFHSUHKLUHDVVHVVPHQW 7R MXGJH ZKHWKHU FDQGLGDWHV ZLOO EH HHFWLYH HP-
TXHVWLRQVIURPWRMXVWDQGUDLVHVWKHSRVVLELO- SOR\HUV DUH VKLIWLQJ WKHLU IRFXV IURP FKHFNLQJ FUH-
LW\RIRQHLQWHUYLHZKLUHV GHQWLDOV WR FRQUPLQJ VNLOOV 0RUH WKDQ D TXDUWHU
RIJOREDOEXVLQHVVOHDGHUVZHVXUYH\HG SHUFHQW 
,QGHHG D FRQVHQVXV LV HPHUJLQJ WKDW WUDGLWLRQDO DUH XVLQJ JDPHV DQG VLPXODWLRQV WR DWWUDFW DQG DV-
LQWHUYLHZLQJVXEMHFWLYHDQGXQVWDQGDUGL]HGPD\ VHVVSRWHQWLDOFDQGLGDWHVEXWRQO\SHUFHQWWKLQN
EHDQXQUHOLDEOHPHWKRGIRUSUHGLFWLQJDSRWHQWLDO WKH\ DUH SHUIRUPLQJ H[FHOOHQWO\ 0DQ\ RUJDQL]D-
HPSOR\HHVVXFFHVV-XVWDVEOLQGPXVLFDODXGLWLRQV WLRQVDUHWXUQLQJWRMREVLPXODWLRQVRIWZDUHZKLFK
LQFUHDVHG WKH QXPEHU RI ZRPHQ LQ $PHULFDQ RU- FDQLPSURYHKLULQJE\JLYLQJFDQGLGDWHVWDVNVWKH\
FKHVWUDVHRUWVWRFRQWUROXQFRQVFLRXVELDVDUHRQ ZRXOGGRRQWKHMRE6WLOORWKHUVDUHXVLQJYLGHRWR
WKHULVHLQEXVLQHVV9 GHPRQVWUDWHVNLOOV6NLOO6FRXWSURGXFHVDVKRUWMRE
YLGHRWKDWVHUYHVDVDMRESRVWLQPRWLRQDOORZLQJ
FDQGLGDWHV WR SUHYLHZ ZKDW WKH MRE LV OLNH DQG WKH
VNLOOVUHTXLUHG

In the open talent 9HWHUDQV DUH D SULPH H[DPSOH RI KRZ WHFKQRORJ\

economy, technology FDQ LGHQWLI\ YDOXDEOH VNLOOV LQ RYHUORRNHG WDOHQW


SRROV7KLVJURXSKDVPDQ\RIWKHVNLOOVHPSOR\HUV
allows talent to move QHHGEXWPD\ODFNWKHFHUWLFDWLRQFUHGHQWLDOVWKDW
PDQ\ EXVLQHVVHV UHTXLUH 0DQ\ RUJDQL]DWLRQV DUH
more freely than QRZXVLQJPLOLWDU\WUDQVODWRUVLQZKLFKYHWHUDQV

beforefrom role to FDQHQWHUWKHLUPLOLWDU\MREFRGHDQGWLWOHDQGWUDQV-


ODWHWKHLUPLOLWDU\VNLOOVLQWRFLYLOLDQWHUPV11
role, within and outside )LQDOO\ FRQVXPHUIDFLQJ EUDQGV DUH QGLQJ ZD\V

the enterprise, and WR UHMHFW FDQGLGDWHV ZLWKRXW GDPDJLQJ WKHLU UHSX-
WDWLRQ 7R NHHS UHMHFWHG FDQGLGDWHV SRVLWLYHO\ HQ-
across organizational JDJHG (ULFVVRQ SDUWQHUHG ZLWK WKLUGSDUW\ YHQGRU

and geographic
&DUHHU$UF WR FUHDWH D FRPSDQ\EUDQGHG MRE SODFH-
PHQW SRUWDO ODXQFKHG LQ  FDOOHG &DQGLGDWH

boundaries. &DUH 5HMHFWHG FDQGLGDWHV UHFHLYH D OHWWHU LQYLWLQJ


WKHP WR WDNH DGYDQWDJH RI WKH MRE SODFHPHQW SRU-
WDORQFHUHJLVWHUHGSDUWLFLSDQWVFDQOHDUQVNLOOVWR
LPSURYHWKHLUUpVXPpVERRVWWKHLULQWHUYLHZVNLOOV
OHDUQ KRZ WR OHYHUDJH SHUVRQDO QHWZRUNV DQG LP-
SURYHWKHLUMREVHDUFKLQJVNLOOV7KH&DQGLGDWH&DUH
SODFHPHQWSRUWDOKDVEHHQDKXJHVXFFHVVZLWK
SHUFHQW RI HOLJLEOH SDUWLFLSDQWV HOHFWLQJ WR VLJQ XS
IRUWKHSODWIRUP12

OPTIMIZING SOURCING CHANNELS

2UJDQL]DWLRQV HPSOR\ PDQ\ VRXUFLQJ VWUDWHJLHV WR


DWWUDFWDQGHQJDJHWRSWDOHQW$FRPSDQ\VRZQHP-
SOR\HHVGHOLYHUWKHKLJKHVWTXDOLW\FDQGLGDWHVZLWK
RYHU KDOI RI VXUYH\HG RUJDQL]DWLRQV  SHUFHQW 
FLWLQJ HPSOR\HH UHIHUUDOV DV RQH RI WKHLU WRS WKUHH
FKDQQHOVIROORZHGE\SURIHVVLRQDOQHWZRUNLQJVLWHV


2017 Deloitte Global Human Capital Trends

Figure 3. Respondent ratings of sub-capabilities related to talent acquisition

Percentage of total responses


Managing contingent, outsourced, 25% 57% 19%
contracted, and part-time sources of labor

Understanding emerging skills and


24% 62% 14%
critical capability gaps

Managing gig and talent-sharing


53% 39% 9%
economy resources

Managing crowdsourcing as part of the


59% 33% 8%
organizations workforce and talent
programs

Weak Adequate Excellent

Deloitte University Press | dupress.deloitte.com

 SHUFHQW  DQG LQWHUQDO FDQGLGDWHV  SHUFHQW  OPTIMIZING THE TALENT
,QRQO\SHUFHQWRIVXUYH\HGJOREDOEXVLQHVV ACQUISITION OPERATING MODEL
OHDGHUVWKRXJKWWKHLUXVDJHRIVRFLDOWRROVIRUVRXUF-
LQJ DQG DGYHUWLVLQJ SRVLWLRQV ZDV H[FHOOHQW WKLV 0DQ\ELJRUJDQL]DWLRQVKDYHHPEUDFHGVKDUHGVHU-
QXPEHUKDVPRUHWKDQGRXEOHGWRSHUFHQW YLFHVIRU+5\HWZKHQLWFRPHVWRUHFUXLWLQJORFDO
KLULQJPDQDJHUVWHQGWRZRUNODUJHO\DORQHZLWKWKH
,Q WKH RSHQ WDOHQW HFRQRP\ WHFKQRORJ\ DOORZV WDO- KHOSRIORFDOUHFUXLWHUVRU+5SURIHVVLRQDOV*LYHQ
HQWWRPRYHPRUHIUHHO\ WKDQEHIRUHIURPUROHWR WKHH[SHQVHFRUSRUDWH+5LVWKHPRVWOLNHO\FKRLFH
UROHZLWKLQDQGRXWVLGHWKHHQWHUSULVHDQGDFURVV WRLQYHVWLQWKHWDOHQWDFTXLVLWLRQSURGXFWVWKDWFDQ
RUJDQL]DWLRQDO DQG JHRJUDSKLF ERXQGDULHV 2UJDQL- PDNHWKHFRPSDQ\VWDQGRXW$QGWKDWVOLNHO\WREH
]DWLRQVWKDWDUHOHYHUDJLQJRSHQWDOHQWDUHSDUWQHU- PRQH\ZHOOVSHQW&RPSDQLHVFDQVXSSRUWWKLVQHZ
LQJ ZLWK WHPSRUDU\ ODERU PDUNHWSODFH FRPSDQLHV DSSURDFKWRWDOHQWDFTXLVLWLRQE\VWDUWLQJZLWKDGH-
VXFK DV 6KLIW*LJ DQG %RXQW\-REV HVWDQJ DJHQ- JUHHRIFHQWUDOL]DWLRQWRJDLQWKHEHQHWRIVFDOHDQG
FLHV VXFK DV +,5(' DQG &ORVHU,4 IUHHODQFH PDQ- HFLHQF\ DQG PRUH LPSRUWDQWO\ FUHDWH D VWURQJ
DJHPHQW V\VWHPV VXFK DV 2Q)RUFH DQG -RE%OLVV DQG FRPSHWLWLYHO\ GLHUHQWLDWHG FDQGLGDWH H[SHUL-
DQG FURZGVRXUFHG UHFUXLWPHQW V\VWHPV VXFK DV HQFH
$PD]RQV0HFKDQLFDO7XUNDQG*LJZDON14

2XU JOREDO VXUYH\ WKLV \HDU IRXQG FDSDELOLWLHV UHOD-


Lessons from the front lines
WLYHWRQHZVRXUFLQJDQGWDOHQWSRROVWREHDPRQJ
WKH ZHDNHVW UHSRUWHG 0RUH WKDQ KDOI RI VXUYH\HG *OREDO FRQVXPHU SURGXFWV JLDQW 8QLOHYHU LV FRP-
JOREDO EXVLQHVV OHDGHUV  SHUFHQW  UHSRUW ZHDN ELQLQJJDPLFDWLRQDQGYLGHRLQWHUYLHZLQJWRFUHDWH
FDSDELOLWLHV LQ UHODWLRQ WR JLJ DQG WDOHQW HFRQRP\ DQDOOGLJLWDOJUDGXDWHUHFUXLWLQJSURFHVVVLPSOLHG
UHVRXUFHVDQGRQO\SHUFHQWUDWHWKHLUFRPSDQLHV LQWRIRXUHDV\VWHSV15
DELOLW\WRPDQDJHFURZGVRXUFLQJDVH[FHOOHQW 6HH
JXUH   ,PSURYLQJ WKHVH FDSDELOLWLHV ZLOO GHWHU- )LUVWFDQGLGDWHVFRPSOHWHDVKRUWRQOLQHIRUPWLHG
PLQH ZKLFK EXVLQHVVHV FDQ DWWUDFW QHHGHG WDOHQW WRWKHLU/LQNHG,QSUROHVQRUpVXPpVQHHGHG6HF-
DQG ZKLFK VWUXJJOH WR LGHQWLI\ DQG LQFRUSRUDWH LQ RQG FDQGLGDWHV VSHQG  PLQXWHV RQ D VHULHV RI
GHPDQGVNLOOV JDPHV WKDW DUH DYDLODEOH RQ FRPSXWHUV WDEOHWV RU
VPDUWSKRQHV :RUNLQJ ZLWK JDPLFDWLRQ VROXWLRQ


Rewriting the rules for the digital age

SURYLGHU 3\PHWULFV WKH 8QLOHYHU 7$ WHDP GHYHO-


RSHGJDPHVWKDWSURYLGHLQVLJKWLQWRYDULRXVFD-
SDELOLWLHVVXFKDVSUREOHPVROYLQJSHUVRQDOLW\DQG Given the expense,
FRPPXQLFDWLRQ VW\OH $IWHU FRPSOHWLQJ WKH JDPHV
DOO FDQGLGDWHV UHFHLYH D SHUVRQDOL]HG IHHGEDFN UH- corporate HR is the
SRUW
most likely choice to
2QO\FDQGLGDWHVVHOHFWHGE\WKH3\PHWULFVSURJUDP
PRYH RQ WR WKH WKLUG VWHS UHFRUGLQJ D YLGHR LQWHU- invest in the talent
YLHZ8QLOHYHUXVHV+LUH9XHIRULWVYLGHRLQWHUYLHZ-
LQJSODWIRUPZKLFKGLJLWDOO\DVVHVVHVDQGUDQNVWKH
acquisition products
YLGHR LQWHUYLHZV WR GHWHUPLQH FDQGLGDWH W 7KH that can make the
company stand out.
VWURQJHVW FDQGLGDWHV WKHQ PRYH RQ WR WKH IRXUWK
VWHSZKHQWKH\DUHLQYLWHGWRD'LVFRYHU\&HQWUHIRU
DQLQSHUVRQGD\LQWKHOLIHDW8QLOHYHUVLPXODWLRQ

8QLOHYHU SURXGO\ DQQRXQFHG WKH WUDQVIRUPDWLRQ


RI LWV JUDGXDWH UHFUXLWPHQW SURFHVV RQ LWV ZHEVLWH GLYLGXDO VWRUHV ,W DOVR HVWDEOLVKHG D VHULHV RI VWDQ-
*RRGQHZVIRUQHZJUDGVWKDWWLPH\RXVSHQWRQ GDUGL]HG SURFHVVHV WR PDNH VXUH FDQGLGDWHV GLGQW
0LQHFUDIWDQG:RUOGRI:DUFUDIWPD\KDYHDFWXDOO\ IDOOWKURXJKWKHFUDFNVDQGZRXOGHQMR\DEHWWHUDQG
EHHQ WLPH ZHOO VSHQW 8QLOHYHU KDV GLJLWL]HG LWV UH- PRUH FRQVLVWHQW H[SHULHQFH 1HZ HPSOR\HHV ZHUH
FUXLWPHQWSURFHVVDQGPLQXWHVRIJDPLQJLVQRZ VHWXSZLWKOHDUQLQJSODQVDVSDUWRIWKHLURQERDUG-
SDUWRIWKHPL[ LQJ DQG +5 WRRN QRWH RI WKHLU FRPSHWHQFLHV DQG
FDUHHULQWHUHVWV
:KLOHWKHSURFHVVLVLQLWVHDUO\VWDJHV8QLOHYHUUH-
FUXLWHUV DUH UHSRUWLQJ VLJQLFDQW LPSURYHPHQWV LQ %\FHQWUDOL]LQJWKHHPSOR\HHGDWD+5ZDVDEOHWR
WKHKLULQJSURFHVV8QGHUWKHROGV\VWHPUHFUXLWHUV PRYHWKHRUJDQL]DWLRQWRZDUGDQRSHQPDUNHWDS-
VFUHHQHGVL[FDQGLGDWHVWRSXWRQHWKURXJKWKHSUR- SURDFKWRWDOHQWDQGPRELOLW\7KLVKHOSHGQRWMXVW
FHVVQRZUHFUXLWHUVDUHVFUHHQLQJWZRFDQGLGDWHVWR ZLWK UHWDLQLQJ FXUUHQW HPSOR\HHV EXW ZLWK DWWUDFW-
SXWRQHWKURXJKDOOWKHIRXUVWHSV LQJ RXWVLGH FDQGLGDWHV GULYLQJ D FRQVLVWHQW FDQGL-
GDWH H[SHULHQFH DFURVV WKH HQWHUSULVH WKDW EHWWHU
$QRWKHU ODUJH HPSOR\HU LQ WKH UHWDLO LQGXVWU\ ZDV
DOLJQHG ZLWK WKH FRPSDQ\V WDOHQW VWUDWHJ\ DQG GH-
VWUXJJOLQJ ZLWK KLJK HPSOR\HH WXUQRYHU D ODFN
VLUHGUHSXWDWLRQLQWKHPDUNHWSODFH
RI IRFXV RQ WKH FDQGLGDWH H[SHULHQFH DQG RYHUDOO
EUDQGVRFLDOSUHVHQFHDVLWWULHGWRUDLVHWKHOHYHORI $V WKLV ODUJH HPSOR\HU IRXQG WHFKQRORJ\ LVQW
WDOHQWLQWKHRUJDQL]DWLRQ0RVWRILWVZRUNHUVZHUH HQRXJK WR HOHYDWH D FRPSDQ\V UHFUXLWLQJ H[SHUL-
QRQH[HPSW KRXUO\ VWD +LULQJ PDQDJHUV RQ WKH HQFH7RKHOSHQVXUHDVWHDG\RZRIWDOHQWLQWRWKH
OLQHZHUHEXUGHQHGZLWKKLJKYROXPHVHVSHFLDOO\DW RUJDQL]DWLRQ DQG FUHDWH DQ DSSURDFK WKDW GHOLJKWV
VHDVRQDOSHDNVWRDYRLGJHWWLQJRYHUZKHOPHGWKH\ FDQGLGDWHV HVSHFLDOO\ ZLWK WKH MRE PDUNHW WLJKWHQ-
ZHUHWDNLQJSHRSOHRQZLWKOLWWOHUHJDUGWRWDOHQWGH- LQJFRPSDQLHVVKRXOGVWDUWZLWKDEURDGHUSHUVSHF-
YHORSPHQW3RWHQWLDOQHZVRXUFHVRIWDOHQWZHUHOHIW WLYH RQ KLULQJ WKURXJK WKH OHQV RI WKH FDQGLGDWH
XQWDSSHG 7KH\FDQQRORQJHUDRUGWRUHO\RQORFDOPDQDJHUV
WRUHSUHVHQWWKHFRPSDQ\
7KH FRPSDQ\ GHFLGHG WR LPSOHPHQW D QHZ KXPDQ
FDSLWDO PDQDJHPHQW VRIWZDUH SDFNDJH WR UHSODFH
LWVKRGJHSRGJH RIPDQXDODQGDXWRPDWHGV\VWHPV Start here
%XWWKHVRIWZDUHZDVQWHQRXJK+5QHHGHGWRJHW
LQYROYHG WR VKRZ OLQH VXSHUYLVRUV WKH LPSRUWDQFH Leverage new technologies: 7KH ZRUOG RI
RIPDQDJLQJWDOHQWRYHUWLPHIURPKLULQJWKURXJK UHFUXLWLQJ LV EHFRPLQJ D GLJLWDO H[SHULHQFH
RULHQWDWLRQ DQG EH\RQG +5 VHW XS D FHQWUDOL]HG SHUKDSVOHDGLQJWKHSDFNDPRQJWKHUHVWRI+5
UHFUXLWLQJ FHQWHU WR SUHVFUHHQ FDQGLGDWHV IRU LQ- SURFHVVHVDV FDQGLGDWHV FRPH WR H[SHFW FRQ-

44
2017 Deloitte Global Human Capital Trends

YHQLHQFH DQG PRELOH H[SHULHQFHV ([SORUH WKH Broaden and expand sourcing channels:
YDOXH RI FRJQLWLYH WRROV YLGHR DQG JDPLQJ HV- 2SHQ XS WDOHQW SLSHOLQHV WR QRQWUDGLWLRQDO
SHFLDOO\ZKHQWKH\EXLOGRQVRFLDOQHWZRUNVDQG VRXUFHV7KLQNDERXWKRZEHVWWRVRXUFHDQGUH-
WKHFORXG FUXLWIRUWKHPDQ\W\SHVRIWDOHQWQHHGHGERWK
RQDQGRWKHEDODQFHVKHHWLQFOXGLQJIXOODQG
Build a digital employment brand: (YHU\-
SDUWWLPH HPSOR\HHV IUHHODQFHUV JLJ ZRUNHUV
WKLQJDQRUJDQL]DWLRQGRHVLQWKHGLJLWDODQGVR-
DQGFURZGV
FLDOO\ QHWZRUNHG ZRUOG DHFWV FDQGLGDWHV GHFL-
VLRQWRZRUNWKHUH%HVXUHWRPRQLWRUDQGDOLJQ Integrate sourcing:7DOHQWDFTXLVLWLRQVRXUF-
PHVVDJLQJDFURVVVLWHVDQGH[SHULHQFHV LQJ VKRXOG EH FRQQHFWHG DFURVV +5 EXVLQHVV
SURFXUHPHQW ,7 DQG RWKHU IXQFWLRQV 0RYH
Create a compelling candidate experi-
EH\RQGVLORVWRZDUGFRRUGLQDWHGWDOHQWVRXUFLQJ
ence: 3XW \RXUVHOI LQWR WKH FDQGLGDWHV VKRHV
FKDQQHOV
:KDWLVXQLTXHDERXW\RXURUJDQL]DWLRQWKDWFDQ
DGGULFKQHVVWRWKHFDQGLGDWHH[SHULHQFH":KDW
TXDOLWLHVERWKVHW\RXUFRPSDQ\DSDUWDQGPDNH
LWPRUHDWWUDFWLYHWRFDQGLGDWHV"


Rewriting the rules for the digital age

FAST FORWARD
Accelerating digital, video, and cognitive technologies and ever-increasing transparency
DUHTXLFNO\FKDQJLQJKRZUHFUXLWHUVQGDQGFRXUWVNLOOHGHPSOR\HHV5DWKHUWKDQ
continuing to focus on sourcing and selection, recruiters are now relationship builders
and managers. They are looking to enable a positive candidate experience for new
employeesa task that requires both new responsibilities and new skills.

Savvy recruiters will continue to embrace new TA technologies and hone their
relationship-building skills. Indeed, this is the promise of cognitive recruiting. As
AI and other technologies take over the basic, time-consuming tasks of sourcing
candidates, human jobs will shift. A recruiter in this new world can add value by
building psychological and emotional connections with candidates and constantly
strengthening the employment brand.

Figure 4. Talent acquisition: Old rules vs. new rules

Old rules New rules

Recruiters continuously expand their use of social


media sites for sourcing, including Twitter, Facebook,
5HFUXLWHUVXVHGQWHUQHWWRROVWRQGFDQGLGDWHV
Glassdoor, Pinterest, and Quora, in addition to
LinkedIn

Employment brand has a complete strategy, reaching


Employment brand is viewed as a marketing strategy
into all possible candidate pools and channels

Recruiters partner with hiring managers throughout


Recruiters run the recruiting process the search process, leveraging their networks,
cultural needs, and success criteria

Job descriptions focus on the needs of the


Job descriptions communicate what the organization
candidatesa tactic that yields three times as many
demands from the potential employee
highly rated applicants*

Companies have talent acquisition technology


An applicant tracking system is the only required platforms that manage sourcing, video interviewing,
talent acquisition technology interview management, candidate relationship
management, and onboarding

The candidate and hiring manager are front and


7DOHQWDFTXLVLWLRQSURFHVVHVDUHEXLOWRQHFLHQF\ center in talent acquisition processes, tailoring the
HHFWLYHQHVVDQGVSHHGRIKLUHLQDZD\WKDWZRUNV candidate experience around the moments that
for the enterprise matter in the talent acquisition journey with the
organization

* Andre Lavoie, How to attract the best talent with your job descriptions, Aberdeen Essentials, September 25,
2015, www.aberdeenessentials.com/hcm-essentials/how-to-attract-the-best-talent-with-your-job-descriptions/.

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. $QJHOD1DWLYLGDG+HLQHNHQMXVWPDGHDQ+5FDPSDLJQWKDWVDVFRRODVDQ\FRQVXPHUDGVLWVGRQHAdWeek,
6HSWHPEHUKWWSDGZHHNLWF\J4

2. Robin Erickson and Denise Moulton, Reimagining talent attraction: Dell transforms its employment brand by going
social, Bersin by Deloitte, November 9, 2016, http://bersinone.bersin.com/resources/research/?docid=20355.

3. Katherine Jones, Buyers guide to talent acquisition management and onboarding solutions 2013, Bersin by Deloitte,
July 2013, www.bersin.com/Practice/Detail.aspx?docid=16724.

4. ATC Events and Media, Chat bot interviews recruiter, recruiter gets smitten, November 25, 2016, http://atchub.
net/news/chat-bot-interviews-recruiter-recruiter-gets-smitten/.

5. Jonathan Nicholson (cofounder and managing director, PredictiveHire), in discussion with Robin Erickson, De-
cember 5, 2016.

6. Richard George, Interview: How SAP is using cartoons, video games and more to change recruiting standards,
LinkedIn, September 19, 2016, https://business.linkedin.com/talent-solutions/blog/recruiting-strategy/2016/
interview-how-sap-is-using-cartoons-video-games-and-more-to-change-recruiting-standards.

7. PeopleScout, Innovative sourcing strategies for mastering the talent landscape: Its a marathon, not a sprint, 2015,
http://www.peoplescout.com/innovative-sourcing-strategies-for-mastering-the-talent-landscape/, accessed Feb-
ruary 12, 2017.

 PR Newswire, HireVue honors IBM, Hilton Worldwide, Vodafone, and ten other customers with 3rd annual Digi-
WDO'LVUXSWRUDZDUGVSUHVVUHOHDVHIURP+LUH9XH-XQHKWWSZZZSUQHZVZLUHFRPQHZVUHOHDVHV
hirevue-honors-ibm-hilton-worldwide-vodafone-and-ten-other-customers-with-3rd-annual-digital-disruptor-
DZDUGVKWPO

9. Curt Rice, How blind auditions help orchestras to eliminate gender bias, Guardian, October 14, 2013, www.
theguardian.com/women-in-leadership/2013/oct/14/blind-auditions-orchestras-gender-bias.

10. 6NLOO6FRXW6R\RXUHVWDUULQJLQDMREYLGHRKWWSZZZVNLOOVFRXWFRPMREYLGHRIDTKWPODFFHVVHG-DQXDU\
31, 2017.

11. Robin Erickson, From the armed forces to the workforce: Why veteran hiring is both the right thing to do & a smart
move to make, Bersin by Deloitte, May 2015, http://marketing.bersin.com/veteran-hiring.html.

12. Lisa Smith-Strother, The role of social advocacy in diversity & inclusion recruiting, presented at Glassdoor Sum-
mit, September 13, 2016, https://youtu.be/IdsqQMV4V_0.

13. Robin Erickson, Strategic talent sourcing: Improve blend of high-quality channels (part I), Bersin by Deloitte, 2017.

14. Talent Tech Labs, Talent acquisition ecosystem #5, https://talenttechlabs.com/ecosystem/, accessed December
16, 2016.

15. 8QLOHYHU *DPH RQ 2XU JUDGXDWH UHFUXLWPHQW GULYHV JRQH GLJLWDO 6HSWHPEHU   ZZZXQLOHYHUFRP
news/news-and-features/2016/game-on-our-graduate-recruitment-drives-gone-digital.html.

16. Ibid.

17. Erickson, Strategic talent sourcing8QLOHYHU*DPHRQ2XUJUDGXDWHUHFUXLWPHQWGULYHVJRQHGLJLWDO


Rewriting the rules for the digital age

AUTHORS

Michael Stephan, Deloitte Consulting LLP | mstephan@deloitte.com

Michael Stephan is the global leader for Deloittes HR Transformation practice. He develops
and integrates HR service delivery models across the operations and technology spectrum,
with a focus on optimizing HR service delivery around the world. His global consulting
experience includes HR strategy, HR operating model design and implementation, HR
business process outsourcing (BPO), global technology deployment, and enterprise
transition management.

David Brown, Deloitte Touche Tohmatsu | davidbrown@deloitte.com.au

David Brown leads the Human Capital practice in Australia. He has over 30 years experience
in the human capital space in both corporate HR and advisory roles, including considerable
LQWHUQDWLRQDOH[SHULHQFHLQ+5PDQDJHPHQWDFURVV1RUWK$PHULFD(XURSHDQG$VLD%URZQ
specializes in HR strategy and execution, strategic change, workforce productivity and
engagement, and talent management and development.

Robin Erickson, Bersin by Deloitte, Deloitte Consulting LLP | rerickson@deloitte.com

5RELQ(ULFNVRQIRFXVHVRQWDOHQWDFTXLVLWLRQHQJDJHPHQWDQGUHWHQWLRQUHVHDUFKZKHUH
she draws on her deep experience in talent strategies consulting and related research for
'HORLWWHV+XPDQ&DSLWDOSUDFWLFH(ULFNVRQKROGVDGRFWRUDWHIURP1RUWKZHVWHUQ8QLYHUVLW\
in organizational communication and change, a masters degree in communication from
Northwestern University, a masters degree in theology from Northern Seminary, and a
bachelor of arts degree from the University of Chicago.


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

The employee experience


Culture, engagement, and beyond

Q D GLJLWDO ZRUOG ZLWK LQFUHDVLQJ WUDQVSDUHQF\ DQG WKH JURZLQJ LQXHQFH RI
Millennials, employees expect a productive, engaging, enjoyable work experience.
Rather than focus narrowly on employee engagement and culture, organizations are
developing an integrated focus on the entire employee experience, bringing together
all the workplace, HR, and management practices that impact people on the job. A
QHZPDUNHWSODFHRISXOVHIHHGEDFNWRROVZHOOQHVVDQGWQHVVDSSVDQGLQWHJUDWHG
employee self-service tools is helping HR departments understand and improve this
experience. Through new approaches such as design thinking and employee journey
maps, HR departments are now focusing on understanding and improving this com-
plete experience and using tools such as employee net promoter scores to measure
employee satisfaction.1

Organizational culture, engagement, and employee brand proposition remain top


priorities in 2017; employee experience ranks as a major trend again this year.

1HDUO\  SHUFHQW RI H[HFXWLYHV UDWHG HPSOR\HH H[SHULHQFH YHU\ LPSRUWDQW 
SHUFHQW RULPSRUWDQW SHUFHQW EXWRQO\SHUFHQWUHSRUWHGWKDWWKHLUFRPSD-
QLHVZHUHH[FHOOHQWDWEXLOGLQJDGLHUHQWLDWHGHPSOR\HHH[SHULHQFH

Fifty-nine percent of survey respondents reported they were not ready or only
somewhat ready to address the employee experience challenge.

A
PRODUCTIVE, SRVLWLYHHPSOR\HHH[SHULHQFH 7KH SUREOHPV RI HPSOR\HH HQJDJHPHQW DQG SUR-
KDV HPHUJHG DV WKH QHZ FRQWUDFW EHWZHHQ GXFWLYLW\ FRQWLQXH WR JURZ 2YHUDOO HPSOR\HH HQ-
HPSOR\HU DQG HPSOR\HH -XVW DV PDUNHWLQJ JDJHPHQW PHDVXUHG E\ *ODVVGRRU GDWD DFURVV
DQG SURGXFW WHDPV KDYH PRYHG EH\RQG FXVWRPHU WKRXVDQGVRIFRPSDQLHVLVDW\HDURYHU\HDU37KLV
VDWLVIDFWLRQWRORRNDWWRWDOFXVWRPHUH[SHULHQFHVR 7KLV\HDUVGlobal Human Capital TrendsUHVHDUFK
LV +5 UHIRFXVLQJ LWV HRUWV RQ EXLOGLQJ SURJUDPV VKRZV WKDW RUJDQL]DWLRQV DELOLW\ WR DGGUHVV WKHVH
VWUDWHJLHVDQGWHDPVWKDWXQGHUVWDQGDQGFRQWLQX- LVVXHV RI HQJDJHPHQW DQG FXOWXUH KDV GURSSHG E\
RXVO\LPSURYHWKHHQWLUHHPSOR\HHH[SHULHQFH2XU SHUFHQWVLQFHODVW\HDULOOXVWUDWLQJKRZFRPSOH[
UHVHDUFKKDVLGHQWLHGHOHPHQWVWKDWEULQJWKLV WKH ZRUN HQYLURQPHQW KDV EHFRPH ,Q VHYHUDO LP-
WRJHWKHUHDFKRIZKLFKUHTXLUHVIRFXVDQGDWWHQWLRQ SRUWDQW DUHDV WKHUH LV OLWWOH RU QR LPSURYHPHQW DW
IURP+5DQGPDQDJHPHQW2 DOO 6HHJXUH


Rewriting the rules for the digital age

)LJXUH3HUFHQWDJHRIFRPSDQLHVWKDWIHHOWKH\DUHH[FHOOHQWLQHDFKDUHD

  Change

Helping employees balance personal


23% 19% 21% better
and professional life/work demands

Aligning employees and personal


24% 23% 4% better
goals with corporate purpose

Providing programs for younger,


older, and a multi-generational 11% 11% Flat
workforce

Understanding and using design


thinking as part of the employee 10% 13% 23% worse
experience

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP

Figure 2. Employee experience: Percentage of respondents rating this trend important


or very important

Percentages in
selected countries:
Canada 80 Higher % Lower %

Brazil 93
76 Netherlands
India 89
China 88
Belgium 63 United States 85
UK 84 Australia 85

USA 85 Germany 70 United Kingdom 84


France 64 75 Japan Mexico 83
Spain 77 88 China South Africa 83
Mexico 83 Canada 80
Italy 79
89 India Italy 79
Spain 77
93 Brazil
Netherlands 76
85 Australia
83 South Africa Japan 75
Germany 70
France 64
Percentages by region: Belgium 63
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


85 84 82 77 77 69 71 85 85
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

7KLV\HDUVVXUYH\IRXQGERWKFKDOOHQJHVDQGRSSRU- )RXUWK FRPSDQLHV QHHG WR XSGDWH WKHLU WRROV


WXQLWLHV IRU LPSURYHPHQW DFURVV PXOWLSOH GLPHQ- WRHQJDJHHPSOR\HHVRQDQRQJRLQJEDVLV ZLWK
VLRQVRIWKHHPSOR\HHH[SHULHQFH JXUH  SXOVHVXUYH\VDWOHDVW WRKHOS+5WHDPVDQGOLQH
OHDGHUV XQGHUVWDQG PRUH IXOO\ ZKDW WKH WDOHQW
6HYHUDO IDFWRUV PDNH HPSOR\HH H[SHULHQFH D FKDO-
WKH\ HPSOR\ H[SHFWV DQG YDOXHV $Q HPSOR\HH
OHQJHWRGD\
QHWSURPRWHUVFRUHLVDQRWKHULPSRUWDQWWRROLQ
)LUVW PDQ\ FRPSDQLHV KDYH QRW \HW PDGH WKLVHRUW
HPSOR\HH H[SHULHQFH D SULRULW\ IRU +5 OHDG-
)LIWK PDQ\ FRPSDQLHV UHPDLQ IRFXVHG RQ
HUVRIWHQGHOHJDWLQJWKLVSUREOHPWRDQDQQXDO
SRLQWLQWLPH HQJDJHPHQW DQG KDYH QRW \HW
HQJDJHPHQWVXUYH\
SXOOHG WRJHWKHU WKH GLVFLSOLQHV RI SHUIRUPDQFH
6HFRQGZKLOHVRPHFRPSDQLHVKDYHFUHDWHGWKH PDQDJHPHQW JRDO VHWWLQJ GLYHUVLW\ LQFOXVLRQ
&VXLWHUROHRIHPSOR\HHH[SHULHQFHRFHUPRVW ZHOOQHVVZRUNSODFHGHVLJQDQGOHDGHUVKLSLQWR
FRPSDQLHVKDYHQRWDVVLJQHGUHVSRQVLELOLW\WRD DQLQWHJUDWHGIUDPHZRUN
VHQLRU H[HFXWLYH RU WHDP WR GHVLJQ DQG GHOLYHU
WKHHPSOR\HHH[SHULHQFH A GROWING CHALLENGE
7KLUG VLORHG +5 GHSDUWPHQWV RIWHQ QG LW GLI- 8QGHUVWDQGLQJDQGLPSURYLQJWKHHPSOR\HHH[SHUL-
FXOWWRREWDLQWKHUHVRXUFHVQHHGHGWRDGGUHVV HQFHLVFULWLFDOIRUFRPSDQLHVRSHUDWLQJLQDKLJKO\
DQLQWHJUDWHGVHWRISULRULWLHVZKLFKUDQJHIURP FRPSHWLWLYH JOREDO HFRQRP\ 3URYLGLQJ DQ HQJDJ-
PDQDJHPHQWSUDFWLFHVWRWKHZRUNSODFHWREHQ- LQJ H[SHULHQFH ZLOO KHOS FRPSDQLHV VXFFHHG LQ DW-
HWVDQGRIWHQWKHZRUNFXOWXUHLWVHOI

Figure 3. Respondent ratings of sub-capabilities related to employee experience

Percentage of total responses


Understanding and using design thinking 48% 42% 10%
as part of the employee experience

Using design thinking in developing HR 46% 43% 11%


and talent programs

Providing programs for younger, older, 39% 49% 12%


and a multi-generational workforce

Considering diverse employee preferences 38% 49% 13%


when designing work

%XLOGLQJDVWURQJDQGGLHUHQWLDWHG 22% 57% 22%


employee experience brand

Aligning employees and personal goals 22% 55% 23%


with corporate purpose

Helping employees balance personal and 23% 54% 23%


professional life/work demands

Integrating social, community, and 25% 52% 23%


corporate programs

Weak Adequate Excellent

Deloitte University Press | dupress.deloitte.com


Rewriting the rules for the digital age

Companies need a new approachone that builds


on the foundation of culture and engagement to
focus on the employee experience holistically,
considering all the contributors to worker
satisfaction, engagement, wellness, and alignment.

WUDFWLQJ DQG UHWDLQLQJ VNLOOHG HPSOR\HHV $ VWURQJ THE GROWING NEED FOR A
HPSOR\HHH[SHULHQFHDOVRGULYHVDVWURQJFXVWRPHU HOLISTIC SOLUTION
H[SHULHQFH4
7UDGLWLRQDOO\+5KDVDGGUHVVHGLVVXHVVXFKDVHP-
$V RUJDQL]DWLRQV VKLIW WR D QHWZRUNHG WHDPEDVHG SOR\HHHQJDJHPHQWFXOWXUHUHZDUGVDQGOHDUQLQJ
VWUXFWXUH WKH HPSOR\HH H[SHULHQFH EHFRPHV ERWK DQG FDUHHU GHYHORSPHQW DV VHSDUDWH LQGHSHQGHQW
PRUH LPSRUWDQW DQG PRUH FRPSOH[ 3HRSOH WRGD\ SURJUDPV LQ LQGLYLGXDO VLORV (DFK SURJUDP KDV D
RIWHQ KDYH PXOWLSOH UROHV ZLWK PXOWLSOH PDQDJHUV VHQLRU+5OHDGHUDVHWRIWRROVDQGGLDJQRVWLFVDQG
$UHFHQWVWXG\'HORLWWHFRPSOHWHG VROXWLRQVWRGULYHDQGPHDVXUH
ZLWK )DFHERRN IRXQG WKDW RQO\ FKDQJH
 SHUFHQW RI FRPSDQLHV EHOLHYH
WKHLU LQWHUQDO SURFHVVHV IRU FRO- 7KH HPSOR\HH VHHV WKH SLFWXUH
ODERUDWLRQ DQG GHFLVLRQ PDNLQJ GLHUHQWO\6WDUWLQJDVSRWHQWLDO
DUH ZRUNLQJ ZHOO DQG  SHUFHQW KLUHV DQG UHFUXLWV HPSOR\HHV
EHOLHYHHPDLOLVQRORQJHUDYLDEOH ORRNDWHYHU\WKLQJWKDWKDSSHQV
WRROIRUHHFWLYHFRPPXQLFDWLRQ5 DW ZRUN DV DQ LQWHJUDWHG H[SH-
ULHQFH WKDW LPSDFWV GDLO\ OLIH
7KH FKDOOHQJH LV QRW JHWWLQJ DQ\ LQ DQG RXWVLGH WKH ZRUNSODFH
HDVLHU3URGXFWLYLW\LQWKH8QLWHG LQFOXGLQJRYHUDOOSK\VLFDOHPR-
6WDWHV LV ULVLQJ E\ RQO\ DERXW  WLRQDO SURIHVVLRQDO DQG QDQ-
SHUFHQW DQQXDOO\ HYHQ DV HP- FLDO ZHOOEHLQJ &DQGLGDWHV DV-
SOR\HHVDUHZRUNLQJPRUHKRXUV VHVVIXWXUHHPSOR\HUVIURPWKH
5HVHDUFK VKRZV WKDW WKH DYHUDJH YHU\ VWDUW RI WKH WDOHQW DFTXLVL-
YDFDWLRQWLPHWDNHQLVGRZQWRGD\VLQIURP WLRQ H[SHULHQFH DQG PDNH TXLFN MXGJPHQWV DERXW
LQSXWWLQJHYHQPRUHSUHVVXUHRQHPSOR\- ZKDW OLIH ZLOO EH OLNH IRU WKHP LQ WKH RUJDQL]DWLRQ
HHVVHHNLQJDKHDOWK\ZRUNOLIHEDODQFH EDVHGRQKRZWKH\LQWHUDFWZLWKWKHHQWHUSULVHGXU-
&RPSDQLHV QHHG D QHZ DSSURDFKRQH WKDW EXLOGV LQJWKHUHFUXLWLQJF\FOH
RQ WKH IRXQGDWLRQ RI FXOWXUH DQG HQJDJHPHQW WR 7KLV LQWHJUDWHG YLHZ LQFUHDVLQJO\ OHDGV WR HPSOR\-
IRFXV RQ WKH HPSOR\HH H[SHULHQFH KROLVWLFDOO\ FRQ- HHVGHPDQGLQJDKROLVWLFHQGWRHQGUHFUXLWPHQW
VLGHULQJDOOWKHFRQWULEXWRUVWRZRUNHUVDWLVIDFWLRQ WRUHWLUHPHQWH[SHULHQFH IURP WKHLU HPSOR\HUV
HQJDJHPHQWZHOOQHVVDQGDOLJQPHQW ZKHWKHU WKH\ DUH IXOOWLPH HPSOR\HHV FRQWLQJHQW
ZRUNHUVRUHYHQFURZGVRXUFHGWDOHQW7KLVDOVRUH-
TXLUHVDUDGLFDOFKDQJHLQHPSKDVLVRQWKHSDUWRI
HPSOR\HUV


2017 Deloitte Global Human Capital Trends

Figure 4. Factors that contribute to a positive employee experience

Simply Irresistible OrganizationTM model

Supportive Positive work Growth Trust in


Meaningful work
management environment opportunity leadership

Clear and Flexible work Training and Mission and


Autonomy
transparent goals environment support on the job purpose

Continuous
Humanistic Facilitated talent
6HOHFWWRW Coaching investment in
workplace mobility
people

Investment in
Small, empowered Culture of Self-directed, Transparency and
development of
teams recognition dynamic learning honesty
managers

Fair, inclusive,
Agile performance High-impact
Time for slack diverse work Inspiration
management learning culture
environment

Cross-organization collaboration and communication

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP

+5DQGEXVLQHVVOHDGHUVIDFHERWKWKHGHPDQGDQG GHYHORSPHQWDQGVDOHVH[HFXWLYHVZKRDUHZRUNLQJ
WKHRSSRUWXQLW\WRUHWKLQNWKHUROHVVWUXFWXUHWRROV DORQJ VLPLODU OLQHV WR GHVLJQ LQWHJUDWHG FXVWRPHU
DQG VWUDWHJ\ WKH\ XVH WR GHVLJQ DQG GHOLYHU DQ LQ- H[SHULHQFHV
WHJUDWHG HPSOR\HH H[SHULHQFH 0RGHOV VXFK DV WKH
(PSOR\HHV H[SHFW QRW RQO\ D EHWWHUGHVLJQHG H[SH-
RQHLQJXUHUHSUHVHQWDVWDUWLQJSRLQWWRDGGUHVV
ULHQFHEXWQHZPRGHOVRIGHOLYHU\,QDZRUOGZKHUH
D YDULHW\ RI LVVXHV PHDQLQJIXO ZRUN WKH SXUSRVH
HPSOR\HHV FDQ PDQDJH PXFK RI WKHLU OLYHV RQ D
RI WKH RUJDQL]DWLRQ HPSOR\HH WDOHQW GHYHORSPHQW
KDQGIXO RI VPDUWSKRQH DSSV WKH\ H[SHFW HYHU\ HO-
DQG JURZWK UHZDUGV DQG ZHOOQHVV WKH ZRUN HQYL-
HPHQW RI WKHLU HPSOR\HH H[SHULHQFH IURP ZRUN WR
URQPHQW IDLUQHVV DQG LQFOXVLRQ DQG DXWKHQWLFLW\
GHYHORSPHQWWRUHZDUGVWREHDFFHVVLEOHDQGHDV\
DPRQJPDQDJHPHQWDQGOHDGHUVKLS
WRXVHRQWKHLUPRELOHGHYLFHV

GETTING THE DESIGN AND


FOCUS ON EMPLOYEE FEEDBACK IS
DELIVERY RIGHT
IMPROVING, BUT NOT FAST ENOUGH
,Q UHFHQW \HDUV ZH KLJKOLJKWHG WUHQGV UHODWLQJ WR
&UHDWLQJ D KROLVWLF DSSURDFK WR WKH HPSOR\HH H[SH-
WKHRYHUZKHOPHGHPSOR\HHVLPSOLFDWLRQRIZRUN
ULHQFH GHPDQGV EHWWHU WRROV DQG SURJUDPV WR FDS-
DQGGHVLJQWKLQNLQJ'HYHORSLQJDQLQWHJUDWHGHP-
WXUHHPSOR\HHIHHGEDFNFRQWLQXRXVO\$QHZEUHHG
SOR\HH H[SHULHQFH DFURVV PXOWLSOH GLPHQVLRQV ZLOO
RI SXOVH VXUYH\ WRROV SHUIRUPDQFH PDQDJHPHQW
UHTXLUH +5 DQG EXVLQHVV OHDGHUV WR FRPELQH LQ-
WRROVDQGRSHQVXUYH\WRROVLVPDNLQJWKLVSRVVLEOH
VLJKWVLQDOORIWKHVHDUHDV%XVLQHVVDQG+5OHDGHUV
7RGD\  SHUFHQW RI FRPSDQLHV VXUYH\ HPSOR\HHV
FDQ OHYHUDJH WKH H[SHULHQFH RI PDUNHWLQJ SURGXFW


Rewriting the rules for the digital age

TXDUWHUO\RUPRUHRIWHQSHUFHQWVXUYH\HPSOR\-
HHV DQQXDOO\ RU OHVV DQG  SHUFHQW QHYHU VXUYH\
HPSOR\HHVDWDOO
High-performing
7KH QHJOHFW RI UHJXODU HPSOR\HH IHHGEDFN KHOSV
H[SODLQ RWKHU FKDOOHQJHV FRPSDQLHV IDFH WRGD\ LQ- companies have
FOXGLQJ VKRUWFRPLQJV LQ GULYLQJ FXOWXUH DQG SXU-
SRVHDQGSURYLGLQJDKHDOWK\ZRUNOLIHEDODQFH7KLV
found ways to
\HDURQO\SHUFHQWRIFRPSDQLHVEHOLHYHWKHLUHP- enrich the employee
experience, leading to
SOR\HHVDUHIXOO\DOLJQHGZLWKWKHFRUSRUDWHSXUSRVH
$QGZKLOHSHUFHQWKDYHVRPHSURJUDPWRPHD-
VXUH ZRUNOLIH EDODQFH MXVW  SHUFHQW FODLP WKHLU
VROXWLRQVDUHH[FHOOHQW
purposeful, productive,
&RPSDQLHVLQ1RUGLFFRXQWULHVWKH$PHULFDVDQG
meaningful work.
&HQWUDO(XURSHOHDGWKHZD\ZLWKWKRVHLQ$VLDWKH
0LGGOH(DVWDQG$IULFDVWLOOVLJQLFDQWO\EHKLQG

$VRQHIRUZDUGWKLQNLQJUHWDLOH[HFXWLYHQRWHG:H Well-being apps: $ QHZ PDUNHW RI ZHOO-


XVHGWRSULRULWL]HRXUVWDNHKROGHUVDVVKDUHKROGHUV QHVV DSSV EULQJV WRJHWKHU FRPSHWLWLRQV W-
UVW FXVWRPHUV VHFRQG DQG HPSOR\HHV WKLUG :H QHVV JURXSV ZHDUDEOHV LQWHJUDWLRQ DQG PL-
QRZUHDOL]HZHKDGLWEDFNZDUG,IZHSXWHPSOR\- FUROHDUQLQJ IURP YHQGRUV VXFK DV /LPHDLG
HHVUVWWKH\LQWXUQWDNHFDUHRIRXUFXVWRPHUVDQG DQG9LUJLQ3XOVH
WKH\LQWXUQWDNHFDUHRIRXUVKDUHKROGHUV
Employee service platforms:7KHVHWRROVRI-
IHUDQLQWHJUDWHGHPSOR\HHH[SHULHQFHIRUWUDQV-
7+(5(6$1$33)257+$7 DFWLRQDODQGVHUYLFHQHHGVLQWHJUDWLQJFKDWERWV
$QH[SORVLRQRIGLJLWDODQGPRELOHWRROVKDVHPHUJHG DQGQDWXUDOODQJXDJHSURFHVVLQJZLWKFDVHPDQ-
WRKHOS+5GHVLJQDQGGHOLYHUDJUHDWHPSOR\HHH[- DJHPHQWFRQWHQWPDQDJHPHQWDQGHDV\WRXVH
SHULHQFH PRELOHDQGZHESRUWDOV

Productivity and collaboration apps:1HZ :KLOHDOOWKHVHWRROVDUHYDOXDEOHWKHIDFWWKDWHDFK


WRROV DUH PRYLQJ ZHOO EH\RQG WUDGLWLRQDO HPDLO RI WKHVH PDUNHWV LV VHSDUDWH LOOXVWUDWHV WKDW WKH IR-
WRLPSURYHSURGXFWLYLW\DQGHQJDJHPHQW3URG- FXVRQHQGWRHQGHPSOR\HHH[SHULHQFHLVVWLOOQHZ
XFWV VXFK DV )DFHERRNV :RUNSODFH 6ODFN 0L- :LWKIHZLQWHJUDWHGWRROVHWVRQWKHPDUNHWRUJDQL-
FURVRIW 6N\SH IRU 7HDPV *RRJOH *VXLWH DQG ]DWLRQVKDYHWREULQJWRJHWKHULQGHSHQGHQW+5DQG
VROXWLRQV IURP FRPSDQLHV VXFK DV %DVHFDPS WHFKQRORJ\ PDQDJHUV WR EXLOG DQ HPSOR\HH H[SHUL-
7UHOOR$VDQDDQG)LYHFDQVXSSRUWFROODERUD- HQFHVWUDWHJ\DQGSURJUDP
WLYH WHDPFHQWULF ZRUN DQG RHU HQJDJLQJ SODW-
IRUPVIRUOHDUQLQJJRDODOLJQPHQWSHUIRUPDQFH THE CENTRALITY OF THE
PDQDJHPHQWDQGWUDGLWLRQDO+5SURFHVVHV EMPLOYEE EXPERIENCE

Engagement and feedback apps:1HZSXOVH /RRNLQJ DFURVV DOO  WUHQGV ZH GLVFXVV WKLV \HDU
VXUYH\ WRROV DUH RRGLQJ WKH PDUNHW UHSODFLQJ LWV FOHDU WKDW HPSOR\HH H[SHULHQFH LV D FHQWUDO
WUDGLWLRQDODQQXDOHQJDJHPHQWVXUYH\V WKHPH LQ  /HDGHUVKLS RUJDQL]DWLRQ VWUXFWXUH
DQG WHDPV FDUHHU PRELOLW\ OHDUQLQJ GLYHUVLW\
Performance management apps: $ QHZ
HPSOR\PHQW EUDQG DQG +5 VHUYLFHV DOO DHFW DQ
EUHHG RI FRQWLQXRXV SHUIRUPDQFH PDQDJH-
HPSOR\HHVH[SHULHQFH
PHQW SURGXFWV WKDW LQFOXGH IHHGEDFN WRROV KDV
HPHUJHG IURP YHQGRUV VXFK DV 5HHNWLY %HW-
WHU:RUNV =XJDWD +LJKJURXQG :RUNERDUG
DQG6XFFHVV)DFWRUV


2017 Deloitte Global Human Capital Trends

+LJKSHUIRUPLQJFRPSDQLHVKDYHIRXQGZD\VWRHQ- IDVWHUURXWHV19DQGH[SHULHQFHFHQWHUVWRKHOSFXV-
ULFKWKHHPSOR\HHH[SHULHQFHOHDGLQJWRSXUSRVHIXO WRPHUVH[SHULHQFHDOOWKHGLJLWDOVROXWLRQVDYDLODEOH
SURGXFWLYHPHDQLQJIXOZRUN WKURXJK)RUGDXWRPRELOHVDQGFRQQHFWHGHOHFWURQ-
LFV
,QQRYDWLYH FRPSDQLHV ORRN WR HPSOR\HHV WKHP-
VHOYHV IRU LQVSLUDWLRQ &LVFR ,%0 *(9 $LUEQE 7KHVH FKDQJHV GULYHQ E\ &(2 0DUN )LHOGV DOVR
DQG PDQ\ RWKHU FRPSDQLHV KDYH XVHG KDFNDWKRQV UHTXLUHDFKDQJHLQWKHZD\H[HFXWLYHVWKLQNDERXW
WRFROOHFWHPSOR\HHLGHDVDQGGHVLJQQHZDSSURDFK- WKHLUSHRSOH$VWKHFRPSDQ\PRYHVIURPDSURGXFW
HV WR SHUIRUPDQFH PDQDJHPHQW ZRUNSODFH GHVLJQ WR FRQVXPHU IRFXV LQ LWV SURGXFWV DQG VHUYLFHV LW
EHQHWVDQGUHZDUGV7KHVHRSHQFROODERUDWLYHDS- LV DOVR PRYLQJ IURP D SURGXFW WR HPSOR\HH H[SHUL-
SURDFKHVHQJDJHHPSOR\HHVGLUHFWO\LQGHVLJQLQJD HQFHIRFXVLQLWVZRUNIRUFHVROXWLRQV:KLOH)RUGLV
SHUIHFWHPSOR\HHH[SHULHQFH WDFNOLQJ WKLV DFURVV DOO LWV FRUH EXVLQHVV SURFHVVHV
WKH+5WHDPLVOHDGLQJWKHZD\ORRNLQJWRGHOLYHU
0DQ\OHDGLQJUPVDUHLQFRUSRUDWLQJGHVLJQWKLQN-
KLJKLPSDFW LQQRYDWLYH ZRUNIRUFH VROXWLRQV DQG
LQJ WR LPSURYH WKH RYHUDOO HPSOR\HH H[SHULHQFH
H[SHULHQFHV WKDW LPSURYH ZRUNHUV OLYHV $V )HOL-
1LNH &RPPRQZHDOWK %DQN RI $XVWUDOLD 7HOVWUD
FLD)LHOGVJURXSYLFHSUHVLGHQW+5DQGFRUSRUDWH
'HXWVFKH 7HOHNRP DQG VHYHUDO RWKHU FRPSDQLHV
VHUYLFHV SXWV LW 2XU PLVVLRQ LV WR PDNH HPSOR\-
KDYHUHGHVLJQHGWKHLURQERDUGLQJUHFUXLWPHQWDQG
HHVOLYHVEHWWHUE\FKDQJLQJWKHZD\ZHWKLQNDERXW
HPSOR\HHVHOIVHUYLFHDSSOLFDWLRQV,QHDFKFDVHWKH
ZRUNIHHODERXWZRUNDQGWKHZD\ZHGRRXUZRUN
FRPSDQ\GHYHORSHGDQHZVHWRIPRELOHDSSVQHZ
GLHUHQWO\
XVHUH[SHULHQFHVRUQHZVHUYLFHGHOLYHU\VROXWLRQV
WR LPSURYH DQG VLPSOLI\ OLIH DW ZRUN11 +5 VKRXOG )RUDFRPSDQ\VRHVWDEOLVKHGJOREDODQGFRPSOH[
OHDGWKHVHFRQYHUVDWLRQV WKLV LV QRW HDV\ DQG WKH RQO\ ZD\ WR UHYROXWLRQL]H
WKHHPSOR\HHH[SHULHQFHLVWRSUDFWLFHGHVLJQWKLQN-
&RPSDQLHV DUH QRZ FDUHIXOO\ VWXG\LQJ WKH ZRUN-
LQJDWVFDOH$VSDUWRI)RUGVEURDG+5WUDQVIRUPD-
SODFH LWVHOI VHHNLQJ D H[LEOH FROODERUDWLYH KX-
WLRQLQLWLDWLYH ZKLFKLQFOXGHVLPSOHPHQWLQJDQHZ
PDQLVWLF HQYLURQPHQW )DFHERRNV QHZ FDPSXV LV
JOREDO +5 RSHUDWLQJ PRGHO DQG WHFKQRORJ\ SODW-
EHDXWLIXO SHUVRQDOL]HG DQG OOHG ZLWK SODFHV WR
IRUPDQGIRFXVLQJRQGLJLWDO+5DSSV WKHFRPSDQ\
HDW FROODERUDWH H[HUFLVH DQG ZRUN WRJHWKHU12 $S-
HPEDUNHGRQDJOREDOOLVWHQLQJWRXUWRXQGHUVWDQG
SOH,QF*RRJOH/LQNHG,Q13DQGZRUNSODFHGHVLJQ
FRPSDQLHV VXFK DV *HQVOHU14 6WHHOFDVH15 DQG /HHV-
PDQKDYHLQWURGXFHGLQQRYDWLYHQHZZRUNVSDFHV
WKDW EULQJ WRJHWKHU UHFUHDWLRQ FROODERUDWLRQ DQG
LQGLYLGXDOZRUNLQQRYHOZD\V

Lessons from the front lines


)RUG0RWRU&RZLWKQHDUO\HPSOR\HHVLV
JRLQJ WKURXJK DWUDQVIRUPDWLRQZLWK DPLVVLRQWR
PDNHSHRSOHVOLYHVEHWWHUE\FKDQJLQJWKHZD\WKH
ZRUOGPRYHV

:LWK D IRFXV RQ LQQRYDWLRQ )RUG LV H[SDQGLQJ LWV


EXVLQHVV PRGHO WR IRUWLI\ DQG WUDQVIRUP LWV FRUH
DXWRPRWLYH EXVLQHVV ZKLOH JURZLQJ LQ WKH DUHDV RI
HOHFWULFDWLRQDXWRQRP\DQGPRELOLW\7KHVHLQQR-
YDWLRQVDUHEURDGDQGGHHSLQFOXGLQJLQYHVWPHQWV
LQ DXWRQRPRXV YHKLFOHV PRELOH DSSV WR IDFLOLWDWH
FDUVKDULQJDQGSDUNLQJ )RUG3DVV ELJGDWDVROX-
WLRQV WR KHOS SHRSOH QG RSHQ SDUNLQJ VSDFHV DQG


Rewriting the rules for the digital age

ZKDWLVHHFWLYHDQGZKDWLVSUREOHPDWLFLQLWVHP- LQWR WKUHH FXVWRPHU JURXSV HPSOR\HHV SHRSOH


SOR\HHH[SHULHQFH OHDGHUV DQG EXVLQHVVXQLRQZRUNV FRXQFLO OHDG-
HUV DQGGHYHORSHGDVHWRIPRUHWKDQFXVWRPHU
2YHUWKHODVW\HDUVWDUWLQJZLWKDWKUHHZHHNJORE-
RULHQWHG PRPHQWV WKDW PDWWHU IRU HDFK RI WKHVH
DO SHRSOH VWUDWHJ\ ODE LQ ZKLFK +5 OHDGHUV IURP
WKUHH VHJPHQWV 7KHVH PRPHQWV ZHUH GHYHORSHG
DURXQG WKH JOREH SDUWLFLSDWHGDQG WKDW LQFOXGHG
DVSHUVRQDOVWDWHPHQWVVXFKDVHQDEOLQJPHWREH
UHYLHZV ZLWK )LHOGV DQG WKH H[HFXWLYH WHDP)RUG
VXFFHVVIXO LQ D QHZ UROH UHLQIRUFLQJ P\ LPSDFW
GHYHORSHG D QHZ SHRSOH VWUDWHJ\ +5 YLVLRQ LQWH-
WKURXJKIHHGEDFNDQGGHYHORSPHQWDQGNQRZLQJ
JUDWHGSODQDQGEXVLQHVVFDVH$VSDUWRILWVHRUWV
ZKHUH,VWDQGDQGWKDWP\SHUVSHFWLYHVDUHYDOXHG
WRGHQHLWVYLVLRQWKH+5WHDPGHSOR\HGDFRPSD-
7KURXJK WKHVH PRPHQWV WKH +5 WHDP LV QRZ
Q\ZLGH SROOLQJ SURFHVV WKDW OHW HPSOR\HHV FRQWULE-
ZRUNLQJ WR FUHDWH VLPSOHU LQWHJUDWHG FXVWRPHU
XWHLGHDVVKDUHWKHLUH[SHULHQFHVDQGUDWHDQGUDQN
IRFXVHGSURFHVVHVDQGWRROV
ZKLFK+5SURGXFWVDQGVHUYLFHVWKH\IHOWZHUHPRVW
LPSRUWDQW7KHFRPSDQ\DOVRFRQGXFWHGZRUNVKRSV )RUG IRXQG WKDW PDQ\ HPSOR\HHV IHOW WKDW SHRSOH
DURXQGWKHZRUOGDWWHQGHGE\PRUHWKDQ+5 SURFHVVHVZHUHRYHUO\DGPLQLVWUDWLYHFRPSOH[DQG
OHDGHUV DQG OHYHUDJHG UHJLRQDO IRFXV JURXSV ZLWK QRWDOZD\VXVHIXOLQJHWWLQJWKHLUZRUNGRQH3HRSOH
HPSOR\HHV DQG SHRSOH OHDGHUV DFURVV DOO DUHDV RI OHDGHUV IHOW WKDW +5 EXVLQHVV SDUWQHUV ZHUH RYHU-
)RUGVEXVLQHVV ZKHOPHGE\RSHUDWLRQDOWDVNVQHJDWLYHO\LPSDFWLQJ
WKHWLPHWKH\FRXOGVSHQGHQJDJLQJDQGGHYHORSLQJ
$VDUHVXOWRIWKLVEURDGDQGRSHQIHHGEDFNSURFHVV
WKHLUWHDPV7RDGGUHVVWKHVHLVVXHVWKH+5WHDPLV
WKLVZDVWKHUVWWLPH)RUGKDGGRQHWKLVRQVXFKD
QRZGHYHORSLQJSURGXFWVDQGVHUYLFHVWKDWDUHPRUH
ZLGHVFDOH WKH+5WHDPLVOHDUQLQJDERXWZKDWHP-
LQWHJUDWHGDQGIRFXVHGRQWKHHPSOR\HHH[SHULHQFH
SOR\HHVUHDOO\ZDQWZKDWSUREOHPVDQGFKDOOHQJHV
WRROV WKDW DUH PRUH LQWXLWLYH DQG XVHUIULHQGO\ DQ
WKH\ IDFH DW ZRUN DQG KRZ +5 FDQ EHWWHU HQDEOH
LQWHUDFWLRQ PRGHO WKDW DOORZV WKH ZRUNIRUFH WR LQ-
DQGHPSRZHUWKHPLQWKHLUGD\WRGD\ZRUN
WHUDFW ZLWK +5 WKURXJK PXOWLSOH FKDQQHOV DQG
7RWXUQWKLVGHVLJQWKLQNLQJSURFHVVLQWRDFWLRQDEOH SURJUDPVWKDWDUHWIRUSXUSRVH,WLVZRUNLQJWR
UHVXOWV WKH WHDP WKHQ VHJPHQWHG WKH ZRUNIRUFH VLPSOLI\HYHU\WKLQJ+5GRHV$OORIWKLVLVDLPHGDW
LPSURYLQJWKHHPSOR\HHH[SHULHQFHDQGIUHHLQJ+5
SURIHVVLRQDOVWRVXSSRUWVWUDWHJLFEXVLQHVVQHHGV

7KLV GHVLJQ WKLQNLQJ LV IROGLQJ LQWR WKH FRPSDQ\V

By focusing on the
IRXU\HDU +5 WUDQVIRUPDWLRQ SURJUDP ZKLFK ZDV
DSSURYHG EHFDXVH RI LWV VWURQJ DOLJQPHQW ZLWK

employee experience, )RUGV EXVLQHVV WUDQVIRUPDWLRQ DJHQGD )RUGV


SHRSOHVWUDWHJ\DQGWKH+5WUDQVIRUPDWLRQDUHQRZ
HR leaders can FRQVLGHUHGLQWHJUDOWRWKHFRPSDQ\VIRFXVRQLQQR-
YDWLRQDQGDQHZZD\RIGRLQJEXVLQHVV
improve employee
0DQ\ FRPSOH[LWLHV UHPDLQRI FRXUVH )RUGVZRUN-
engagement, empower IRUFH LV ORFDWHG LQ PRUH WKDQ  FRXQWULHV HDFK

teams and leaders, ZLWK XQLTXH ORFDO UHJXODWRU\ QHHGV 6LQFH PDQX-
IDFWXULQJSODQWVDQGODERUUHODWLRQVYDU\IURPORFD-
and develop workforce WLRQWRORFDWLRQGHVLJQHGVROXWLRQVPXVWEHH[LEOH
DQG ORFDOL]HG LQ PDQ\ ZD\V 7KH FRPSDQ\ LV VKLIW-
solutions that will be LQJ LWV RUJDQL]DWLRQDO IRFXV IURP WKH PDWUL[ WR D

useful and compelling


QHWZRUN RI WHDPV FRPSHOOLQJ +5 WR ORRN DW QHZ
ZD\VWRIDFLOLWDWHQHWZRUNVFROODERUDWLRQFRDFKLQJ

to employees. DQGFDUHHUPRELOLW\WRDOORZIDVWHULQQRYDWLRQ$QG
RIFRXUVHPDNLQJSURFHVVHVVLPSOHLVKDUGLQLWVHOI
ZKHQWKHFRPSDQ\RSHUDWHVRQPXOWLSOHFRQWLQHQWV


2017 Deloitte Global Human Capital Trends

DQG GHYHORSV D ZLGH UDQJH RI SURGXFWV VXEDVVHP- Consider experiences for the entire work-
EOLHVDQGHOHFWURQLFRHULQJV force: $OO VHJPHQWV RI WKH ZRUNIRUFHFDQGL-
GDWHV IXOOWLPH SDUWWLPH IUHHODQFHUV JLJ HP-
7KHOHVVRQIURPWKH)RUGH[SHULHQFHLVVLPSOH%\
SOR\HHV DQG HYHQ RIWHQ DOXPQLZLOO H[SHFW
IRFXVLQJ RQ WKH HPSOR\HH H[SHULHQFH +5 OHDG-
HOHPHQWV RI WKH HPSOR\HH H[SHULHQFH WR EH GH-
HUV FDQ LPSURYH HPSOR\HH HQJDJHPHQW HPSRZHU
VLJQHGWRDWWUDFWDQGHQJDJHWKHP
WHDPVDQGOHDGHUVDQGGHYHORSZRUNIRUFHVROXWLRQV
WKDWZLOOEHXVHIXODQGFRPSHOOLQJWRHPSOR\HHV$V Look outside: 8VH LQIRUPDWLRQ IURP *ODVV-
)RUGFRQWLQXHVWRDFFHOHUDWHLWVWUDQVIRUPDWLRQLQWR GRRU /LQNHG,Q DQG RWKHUV WR VSRW DUHDV RI
D GLJLWDO HQWHUSULVH IRFXVHG RQ LPSURYLQJ PRELOLW\ RSSRUWXQLW\ DQG ZHDNQHVV 9LVLW SHHU FRPSD-
VROXWLRQV DURXQG WKH ZRUOG WKH WUDQVIRUPDWLRQ RI QLHV DQG ORRN IRU IUHVK LGHDV DERXW KRZ WR UH-
WKHFRPSDQ\VHPSOR\HHH[SHULHQFHZLOOEHFULWLFDO GHVLJQ WKH HPSOR\HH H[SHULHQFH ,QYHVWPHQWV
WRWKHFRPSDQ\VVXFFHVV LQ EHQFKPDUNLQJ JHQHUDOO\ SD\ IRU WKHPVHOYHV
PDQ\WLPHVRYHULQSURGXFWLYLW\DQGDUHGXFWLRQ
LQWXUQRYHU
Start here
Enlist C-suite and team leader support:
Elevate the employee experience and 7KHLQYROYHPHQWRIVHQLRUH[HFXWLYHVDQGWHDP
make it a priority: 5HFRJQL]H WKDW WKH LQWH- OHDGHUVLVFULWLFDODVGDLO\PDQDJHPHQWDQGHQ-
JUDWHG HPSOR\HH H[SHULHQFH LV DV YDOXDEOH DQG JDJHPHQWLPSDFWWKHRYHUDOOHPSOR\PHQWEUDQG
FDQKDYHDVPXFK RUPRUH RIDQLPSDFWDVWKH 6HQLRU OHDGHUV FDQ EH DFFRXQWDEOH IRU WKH HP-
FXVWRPHU H[SHULHQFH VWUDWHJ\ $UWLFXODWH D GLI- SOR\HH H[SHULHQFH WKURXJK JRDOV UHZDUGV DQG
IHUHQWLDWHG HPSOR\HH H[SHULHQFH DQG HQVXUH LW RWKHUSHUIRUPDQFHSURJUDPV
FRRUGLQDWHV DOO DVSHFWV RI WKH ZRUN ZRUNSODFH
DQGZRUNIRUFHH[SHULHQFH,QFOXGHWKHFRQFHSWV Consider the impact of geography: (YHQ
RIZHOOQHVVDQGZHOOEHLQJLQ\RXUVWUDWHJ\ WKRXJKWKHWUHQGLVJOREDOVXFFHVVIXODSSURDFK-
HVZLOOYDU\E\JHRJUDSK\,QWHUQDWLRQDOFRPSD-
Designate a senior leader or team to QLHV VKRXOG XQGHUVWDQG FXOWXUDO GLHUHQFHV LQ
own it: $VVLJQ D VHQLRU OHDGHU IRU HPSOR\HH KRZ HPSOR\HHV SHUFHLYH WKH ZRUN H[SHULHQFH
H[SHULHQFH DQG RUFKHVWUDWH WKH IXQFWLRQV RI &XOWXUHV WKDW DUH PRUH FROOHFWLYH RU JURXSIR-
HQJDJHPHQW OHDUQLQJ FDUHHU GHYHORSPHQW FXVHG UHTXLUH GLHUHQW HQJDJHPHQW SURJUDPV
RUJDQL]DWLRQDO GHVLJQ DQDO\WLFV DQG FXOWXUH WKDQWKRVHWKDWDUHPRUHLQGLYLGXDOIRFXVHG
LQWR D FRRUGLQDWHG WHDP VR WKDW +5 FDQ IRFXV
RQ WKH HQWLUH HPSOR\HH H[SHULHQFH 3URJUDPV Measure it:0RYHEH\RQGDQQXDORUELDQQXDO
VXFK DV OHDGHUVKLS GHYHORSPHQW SHUIRUPDQFH HQJDJHPHQW VXUYH\V WR UHJXODU SXOVH VXUYH\V
PDQDJHPHQW ZRUNSODFH GHVLJQ DQG UHZDUGV DQG RSHQ IHHGEDFN V\VWHPV 8VH FDQGLGDWH LQ-
QRZ IDOO LQWR WKH GRPDLQ RI WKH LQWHJUDWHG WHUYLHZVVWD\LQWHUYLHZVRQJRLQJSHUIRUPDQFH
HPSOR\HHH[SHULHQFH FRQYHUVDWLRQV DQG H[LW LQWHUYLHZV DV ZD\V WR
EXLOGDFRPSOHWHUHDOWLPHXQGHUVWDQGLQJRIWKH
Embrace design thinking: 6WXG\ OLVWHQ WR LVVXHV\RXUHPSOR\HHVIDFH&RQVLGHULQVWLWXWLQJ
DQG OHDUQ ZKDW HPSOR\HHV DUH GRLQJ HYHU\ GD\ DQ HPSOR\HH QHW SURPRWHU VFRUH ZKLFK \LHOGV
DQGGLVFRYHUQHZZD\VWRVLPSOLI\ZRUNDQGLP- RQHQXPEHURQWKHYDOXHRIWKHHPSOR\HHH[SHUL-
SURYH SURGXFWLYLW\ SHUIRUPDQFH DQG HQJDJH- HQFHWKDWFDQEHUHJXODUO\PHDVXUHGDQGWUDFNHG
PHQW'HYHORSHPSOR\HHSHUVRQDVDQGXVHWKHP
WRGHYHORSMRXUQH\PDSV


Rewriting the rules for the digital age

FAST FORWARD
QDZRUOGEHLQJWUDQVIRUPHGE\GLJLWDOWHFKQRORJLHV 7KHUHVDQDSSIRUWKDW 
increasing transparency (What does Glassdoor say about us?), and the rising demand
for talented professionals and workers with fast-changing skills, employee experience
will become an increasingly important dimension of competing for and engaging
your workforce. Employee brand and reputationthe story that employees in the
H[WHUQDOZRUOGWHOODERXW\RXUFRPSDQ\VHPSOR\HHH[SHULHQFHZLOOEHDFULWLFDO
FRPSHWLWLYHGLHUHQWLDWRU-XVWDVFRPSDQLHVQRZPHDVXUHFXVWRPHUH[SHULHQFH
through net promoter tools, social media monitoring, and customer segmentation,
so will HR rigorously monitor the health and productivity of its employees. Real-time
feedback tools will explode as pulse surveys and always-on feedback systems become
FRPPRQSODFHDQGWKHGHQLWLRQRIHPSOR\HHH[SDQGV:HZLOOGHVLJQDQGPRQLWRU
the experience of contractors, contingent, and gig workers too.

)LJXUH(PSOR\HHH[SHULHQFH2OGUXOHVYVQHZUXOHV

Old rules New rules

(PSOR\HHH[SHULHQFHGHQHGDVDKROLVWLFYLHZRI
(PSOR\HHH[SHULHQFHGHQHGE\DQQXDOHQJDJHPHQW
life at work, requiring constant feedback, action, and
surveys
monitoring

Culture is a topic on the company website and Company uses tools and behaviors to measure, align,
SHUKDSVRQWKHZDOOEXWQRWPHDVXUHGRUGHQHG and improve culture during change, M&A, and other
through behavior major initiatives

Companies have someone responsible for the


Companies have a series of HR leaders across
complete employee experience, focused on
recruiting, learning, rewards, engagement, and other
employee journeys, experiences, engagement, and
HR services
culture

&RPSHQVDWLRQEHQHWVUHZDUGVDQGUHFRJQLWLRQ
&RPSHQVDWLRQEHQHWVDQGUHZDUGVDUHPDQDJHG
GHVLJQHGWRPDNHSHRSOHVOLIHEHWWHUDQGEDODQFH
with a focus on benchmarking and fairness
QDQFLDODQGQRQQDQFLDOEHQHWV

Companies have an integrated program for


Wellness and health programs are focused on safety
employee well-being focused on the employee, her
and managing insurance costs
family, and her entire experience at life and work

5HZDUGVDOVRLQFOXGHQRQQDQFLDOUHZDUGVPHDOV
Rewards are designed to cover salary, overtime,
OHDYHVYDFDWLRQSROLF\WQHVVDQGZHOOQHVV
ERQXVEHQHWVDQGVWRFNRSWLRQV
programs

The employee experience platform is designed,


Employee self-service is viewed as a technology
mobile, and includes digital apps, prescriptive
platform that makes it easy to complete HR
solutions based on employee journeys, and ongoing
transactions and reports
communications that support and inspire employees

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. Wikipedia, NetPromoter, https://en.wikipedia.org/wiki/Net_Promoter. NetPromoter asks a simple question:


On a scale of zero to ten, how likely is it you would recommend this company as a place to work? Using this
question, organizations can sort employees into promoters, passives, and detractors, similar to the identical
question used widely with customers.

2. Josh Bersin, Becoming irresistible: A new model for employee engagement, Deloitte Review 16, January 26, 2015,
https://dupress.deloitte.com/dup-us-en/deloitte-review/issue-16/employee-engagement-strategies.html.

3. Bersin by Deloitte proprietary research with Glassdoor.

4. .DWH7D\ORU&KLFNO$LVEHDWLQJHYHU\FRPSHWLWRUE\WUDLQLQJZRUNHUVWRVD\SOHDVHDQGWKDQN\RXBusiness
Insider2FWREHUZZZEXVLQHVVLQVLGHUFRPFKLFNODLVWKHPRVWSROLWHFKDLQ

5. Deloitte and Facebook, Transitioning to the future of work and the workplace, November 2016.

6. Bureau of Labor Statistics, Overview of BLS productivity stats, www.bls.gov/bls/productivity.htm, accessed


December 21, 2016.

7. 3URMHFW7LPH2The state of American vacation 2016: How vacation became a casualty of our work culture, p. 6,
ZZZSURMHFWWLPHRFRPVLWHVGHIDXOWOHV372B6R$9SHUFHQW5HSRUWB)1$/SGIDFFHVVHG2FWREHU

 Jeanne Meister, Cisco HR breakathon: Reimagining the employee experience, Forbes, March 10, 2016, www.
forbes.com/sites/jeannemeister/2016/03/10/the-cisco-hr-breakathon/.

9. Executive conversations with authors.

10. Ben Whitter, Bye, bye, human resources, LinkedIn, July 27, 2015, www.linkedin.com/pulse/bye-human-
UHVRXUFHVEHQZKLWWHU(&$&(%%%(%

11. Executive conversations with authors.

12. 7RGG&)UDQNHO:KDWWKHVHSKRWRVRI)DFHERRNVQHZKHDGTXDUWHUVVD\DERXWWKHIXWXUHRIZRUNWashington
Post, November 30, 2015, http://wpo.st/93cX2.

13. Executive conversations with authors.

14. Gensler, 86ZRUNSODFHVXUYH\.H\QGLQJVZZZJHQVOHUFRPXSORDGVGRFXPHQWOHB86B


Workplace_Survey_07_15_2013.pdf, accessed December 21, 2016.

15. Steelcase, Boosting employee engagement, November 12, 2014, www.steelcase.com/insights/articles/boosting-


employee-engagement-place-matters/.

16. Leesman, Leesman_review  KWWSRULJLQPLVFSDJHVXLWHFRPSGIGRZQORDGGDDDEH


HHDDGSGIDFFHVVHG'HFHPEHU

17. .HUUL+XJKHVVWLPXODWLQJGHVLJQRFHVWRVWLUWKHVHQVHVCreative Bloq, February 19, 2016, www.creative-


EORTFRPGHVLJQGHVLJQRFHVVHHDOVR-RKQ+DJHO-RKQ6HHO\%URZQDQG7DPDUD6DPR\ORYDWork en-
vironment redesign: Accelerate performance through talent, Deloitte University Press, June 3, 2013, https://dupress.
deloitte.com/dup-us-en/topics/talent/work-environment-redesign.html.

 Fordpass, Home, www.fordpass.com/, accessed January 30, 2017.

19. .LUVWHQ.RURVHN)RUGVSODQVWRGRPRUHWKDQMXVWVHOOFDUVFortune, January 12, 2016, http://for.tn/1mStuQp.

20. Conversations with Ford senior management, November 2016.


Rewriting the rules for the digital age

AUTHORS

Josh Bersin, Bersin by Deloitte, Deloitte Consulting LLP | jbersin@deloitte.com

Josh Bersin founded Bersin & Associates, now Bersin by Deloitte, in 2001 to provide research
and advisory services focused on corporate learning. He is a frequent speaker at industry
events and a popular blogger. Bersin spent 25 years in product development, product
management, marketing, and sales of e-learning and other enterprise technologies. He has
a BS in engineering from Cornell, an MS in engineering from Stanford, and an MBA from the
Haas School of Business at the University of California, Berkeley.

Jason Flynn, Deloitte Consulting LLP | MDV\QQ#GHORLWWHFRP

Jason Flynn leads Deloittes global Rewards practice. He has more than 20 years of consulting
experience, helping multinational organizations design, deliver, communicate, and manage
total rewards programs to support their business and talent strategies. Flynns broader HR
consulting experience includes supporting talent management, HR transformation, and other
human capital initiatives.

Art Mazor, Deloitte Consulting LLP | amazor@deloitte.com

Art Mazor is Deloittes global leader for HR Service Delivery and a thought leader in HR
transformation strategy. He collaborates with global clients to achieve business impact with
a focus on transforming human capital strategies, programs, and services. With a balance
of strategic planning, operating model and organization design, process transformation,
technology deployment, governance, and change management, Mazor helps generate
tangible results through innovative and pragmatic solutions.

Vernica Melin, Deloitte SC | vmelian@deloitte.com

Vernica Melin is the Human Capital practice leader for Deloitte LATCO and the global
leader of Deloittes Culture practice. She has more than 20 years of consulting experience,
specializing in large-scale global transformation projects. Melins work focuses primarily on
culture change, leadership alignment, communication, HR, and talent strategies.

CONTRIBUTORS
David Brown, Alyson Daichendt, Robin Erickson, David Mallon, Yves van Durme


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Performance management
Play a winning hand

2YHUWKHODVWYH\HDUVRUJDQL]DWLRQVKDYHUDGLFDOO\FKDQJHGWKHZD\WKH\PHDVXUH
evaluate, and recognize employee performance. Today, with much initial experimen-
tation, continuous performance management practices are being deployed on a wide
scale. While not all the tools are in place at every organization, the new practices are
EHFRPLQJFOHDUHUDQGPRUHVWDQGDUGL]HGDQGWKH\DUHGHQLWHO\ZRUNLQJ$JLOHJRDO
management, check-ins, and continuous feedback are becoming common, and new
models of evaluation and rewards are being adopted next.

The redesign of performance management is picking up speed: 79 percent of ex-


HFXWLYHVUDWHLWDKLJKSULRULW\XSIURPSHUFHQWWKUHH\HDUVDJRZLWKSHUFHQW
calling the problem very important.

Company capabilities to implement performance management have improved.


Our research shows organizations are 10 percent more capable than they were
in 2015, and most are heavily focused on retraining leaders to implement agile,
developmental management approaches.

The impact of these new performance practices is high: 90 percent of companies


that have redesigned performance management see direct improvements in en-
JDJHPHQWSHUFHQWVD\WKHSURFHVVHVDUHVLPSOHUDQGSHUFHQWVD\WKH\VHH
the quality of conversations between employees and managers going up.1

T
HE SHUIRUPDQFH PDQDJHPHQW 30  UHYROX- AS WORK SHIFTS, SO DOES PM
WLRQLVLQIXOOLJKW$FURVVDOOLQGXVWULHVDQG
JHRJUDSKLHV FRPSDQLHV DUH UHHYDOXDWLQJ HY- :K\ LV WKH UHLQYHQWLRQ RI SHUIRUPDQFH PDQDJH-
HU\DVSHFWRIWKHLUSURJUDPVIURPJRDOVHWWLQJDQG PHQWVRLPSRUWDQW"4XLWHVLPSO\EHFDXVHWKHZD\
HYDOXDWLRQWRLQFHQWLYHVDQGUHZDUGV2UJDQL]DWLRQV ZHZRUNKDVFKDQJHG
DUHDOLJQLQJWKHVHFKDQJHVWRERWKEXVLQHVVVWUDWHJ\
7KH WUDGLWLRQDO HQGRI\HDU DSSUDLVDO GHVLJQHG
DQGWKHRQJRLQJWUDQVIRUPDWLRQRIZRUN:KLOHDOO
LQ WKH V LV FOHDUO\ QRW HHFWLYH DQ\PRUH ,Q
WKHVRIWZDUHWRROVDUHQRWKHUH\HWWKHUHLVHYLGHQFH
 RXU Global Human Capital Trends UHVHDUFK
WKDWWKHQHZUXOHVRISHUIRUPDQFHPDQDJHPHQWDUH
VKRZHGWKDWSHUFHQWRIFRPSDQLHVUHSRUWHGWKDW
XQGHUVWRRGDQGZRUNLQJZHOO
SHUIRUPDQFHHYDOXDWLRQVZHUHQRWZRUWKWKHWLPH$


Rewriting the rules for the digital age

Figure 1. Performance management: Percentage of respondents rating this trend important


or very important

Percentages in
selected countries:
Higher % Lower %
Canada 71
India 91
Brazil 87
79 Netherlands
Mexico 86
China 85
Belgium 61 Spain 82
UK 77 Japan 80

USA 75 Germany 73 South Africa 80


France 64 80 Japan Netherlands 79
Spain 82 85 China Italy 78
Mexico 86 United Kingdom 77
Italy 78
91 India United States 75
Germany 73
87 Brazil
Canada 71
71 Australia
80 South Africa Australia 71
France 64
Percentages by region: Belgium 61
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


86 74 85 80 85 67 71 86 73
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

VHSDUDWH VWXG\ UHSRUWHG WKDW  SHUFHQW RI FRPSD- Capital Trends 2016  KDV GUDPDWLFDOO\ LP-
QLHV IRXQG ZLGHVSUHDG PDQDJHU ELDV DQG  SHU- SURYHGFRPPXQLFDWLRQVDQGIHHGEDFNHQDEOLQJ
FHQWEHOLHYHGSHUIRUPDQFHHYDOXDWLRQVGLGQRWPR- PDQDJHUV WR WRXFK EDVH ZLWK HPSOR\HHV RQ D
WLYDWHHPSOR\HHV2 FRQWLQXRXVEDVLVXVLQJQHZWRROVDQGFKHFNLQV
WKDWWDNHYHU\OLWWOHWLPH
7RGD\DVFRPSDQLHVRSHUDWHDVDQHWZRUNRIWHDPV3
FDUHHUVDQGOHDUQLQJDUHVWUDWHJLF4DQGFRPSDQLHV (PSOR\HHVDQGRUJDQL]DWLRQVH[SHFWFRQWLQXRXV
DUHVKLIWLQJIURPMREVWRZRUNLQWKHLURSHUDWLRQV5 OHDUQLQJ 1HZ SHUIRUPDQFH PDQDJHPHQW SUDF-
WKHQHHGWRDOLJQJRDOVSURYLGHIHHGEDFNDQGFRDFK WLFHV DQG WRROV  IDFLOLWDWH UHJXODU GLVFXVVLRQV
IRUSHUIRUPDQFHLVUHDOWLPHFRQWLQXRXVDQGPXO- DERXWFDSDELOLWLHVDQGVNLOOVKHOSLQJHPSOR\HHV
WLGLUHFWLRQDO OHDUQZKHUHWRIRFXVDQGZKDWOHDUQLQJWRDGRSW
1HZOHDUQLQJVROXWLRQVDUHFUHDWLQJDQDOZD\V
,Q DGGLWLRQ VHYHUDO RUJDQL]DWLRQDO FKDQJHV KDYH
RQOHDUQLQJHQYLURQPHQWWRVXSSRUWWKLVQHHG
PDGHGHYHORSLQJDPRUHDJLOHSURFHVVLPSRUWDQW
,PSRUWDQW GHFLVLRQV DERXW ZKRP WR SURPRWH
(PSOR\HHV ZDQW PRUH UHJXODU IHHGEDFN ,Q-
KRZPXFKRIDUDLVHWRJLYHDQGZKRPWRPRYH
IRUPHG E\ WKHLU H[SHULHQFHV LQ VRFLDO PHGLD
LQWR D QHZ UROH DUH JHWWLQJ HDVLHU DQG EHWWHU
SHRSOH ZDQW WR JHW DQG JLYH IHHGEDFN UHJXODUO\
WKURXJK GDWD 1LQHW\RQH SHUFHQW RI FRPSD-
&LVFRV QHZ SHUIRUPDQFH PDQDJHPHQW SURFHVV
QLHVWKDWKDYHDGRSWHGFRQWLQXRXVSHUIRUPDQFH
ZKLFKZHGHVFULEHGODVW\HDULQGlobal Human
PDQDJHPHQWVD\WKDWWKH\QRZKDYHEHWWHUGDWD


2017 Deloitte Global Human Capital Trends

IRU SHRSOH GHFLVLRQV PDNLQJ PDMRU SURJUHVV LQJ KHU FRQWULEXWLRQ WR D WHDP DQG WKH WHDPV LP-
LQ UHPRYLQJ ELDV DQG GLVFUHWLRQ LQ SURPRWLRQ SDFWRQGULYLQJRYHUDOOEXVLQHVVJRDOV
DQGDGYDQFHPHQW
&LVFR*(DQG*RRJOHKDYHDOOSLRQHHUHGWKLVPRGHO
&RPSDQLHV RSHUDWH LQ WHDPV VR SHUIRUPDQFH 7KHVHFRPSDQLHVKDYHEXLOWRUERXJKWVRSKLVWLFDWHG
PDQDJHPHQW PXVW EH ORFDO $OO RI RXU GLVFXV- VRIWZDUH WR XQGHUVWDQG WHDP G\QDPLFV HYDOXDWH
VLRQVZLWKFRPSDQLHVOLNH&LVFR*(,%0DQG JURXS JRDO V\VWHPV DQG JDXJH KRZ HHFWLYHO\ HP-
3DWDJRQLD VKRZ WKDW WKH QHZ FRQWLQXRXV SUDF- SOR\HHVFRQWULEXWHWRWKHLUWHDPV127KHJRDORI30
WLFHV HPSRZHU ORFDO OHDGHUV FUHDWH EHWWHU UHOD- LVWKHUHE\WUDQVIRUPHGIURPERRVWLQJDQLQGLYLGXDO
WLRQVKLSV DPRQJ WHDPV DQG KHOS WHDPV ZRUN HPSOR\HHVSHUIRUPDQFHWRLPSURYLQJWKHUHVXOWVRI
PRUH FORVHO\ WRJHWKHU &RPSDQLHV OLNH *RRJOH WKHWHDP,IWKHWHDPZLQVWKHHPSOR\HHZLQV,IWKH
*0$WODVVLDQDQG&LVFRKDYHQRZVWXGLHGWKH WHDPZLQVWKHFRPSDQ\ZLQV
EHKDYLRURIKLJKSHUIRUPLQJWHDPVDQGXVHFRQ-
:KHQ RUJDQL]DWLRQV IRFXV RQ WHDP SHUIRUPDQFH
WLQXRXV SHUIRUPDQFH PDQDJHPHQW WR GLUHFWO\
WKH\HYDOXDWHVXFFHVVE\GLHUHQWPHWULFV7UXVWLQ-
KHOSWHDPVOHDUQIURPKLJKSHUIRUPHUV9
FOXVLRQGLYHUVLW\DQGFODULW\RIUROHVDUHFULWLFDOWR
+XQGUHGV RI FRPSDQLHVLQFOXGLQJ $GREH ,%0 WHDPVXFFHVV7HDPOHDGHUVPXVWEHKDQGVRQDQG
*( *ROGPDQ 6DFKV 1HZ <RUN /LIH -XQLSHU 1HW- DFWLYHO\HQJDJHG$QGWHDPVPXVWEHFRQQHFWHGWR
ZRUNV DQG &LVFRFRQWLQXH H[SHULPHQWLQJ ZLWK RWKHU WHDPV WR VXFFHHG 0HDVXULQJ WKHVH QHZ PHW-
QHZ SURFHVVHV DQG PRVW DUH QGLQJ JUHDW YDOXH ULFVUHTXLUHVQHZWRROVDQGDSSURDFKHVWKRXJKWIXO
7KHIRFXVKDVVKLIWHGIURPWDONLQJabout people to H[SHULPHQWDWLRQ DQG D ZLOOLQJQHVV WR DGRSW QHZ
WDONLQJ with SHRSOH LQ RSHQ FRQYHUVDWLRQV 2XU PRGHOV
QHZSHUIRUPDQFHDSSURDFKLVIRFXVHGRQLPSURYLQJ
'HYHORSLQJJUHDWHUFODULW\DERXWKRZSHUIRUPDQFH
GLVFXVVLRQVFUHDWLQJIUHTXHQWFKHFNLQVDQGFUHDW-
LV PHDVXUHG KDV VXUIDFHG DV D FRUH YDOXH DW PDQ\
LQJDGHYHORSPHQWDOIRFXVVDLG$P\%HUJGLUHFWRU
RUJDQL]DWLRQV SDUWLFXODUO\ DURXQG FKHFNLQV ZLWK
RIWDOHQWDW$GLGDV*URXS11
PDQDJHUV DQG JRDOVHWWLQJ IRU HPSOR\HHV 6RPH
VPDOOHU FRPSDQLHV KDYH JUHDWHU H[LELOLW\ WR VHW
JRDOVZLGHO\DWWKHLQGLYLGXDODQGWHDPOHYHOVZKLOH

The focus has shifted ODUJHUFRPSDQLHVPD\IRFXVRQGHSDUWPHQWDOJRDOV


(LWKHUZD\WKHROGV\VWHPRIFDVFDGLQJJRDOVIURP
from talking about WKH&(2DOOWKHZD\GRZQWRWKHLQGLYLGXDOFRQWULE-
XWRULVQRWSDUWRIWKHQHZGHVLJQ
people to talking 2QH VLJQ RI SRVLWLYH FKDQJH LV D ULVH LQ HPSOR\HH
with people in open GULYHQ FRPPXQLFDWLRQ UDWKHU WKDQ RQHZD\ IHHG-
EDFN (YDOXDWLQJ PDQDJHUV RQ WKH TXDQWLW\ DQG
conversations. TXDOLW\RIFRQYHUVDWLRQVLVEHFRPLQJDNH\WRERWK
WHDPDQGPDQDJHUVXFFHVV

:KLOHWKHXVHRIDIRUFHGGLVWULEXWLRQFXUYHPD\EH
IDGLQJPDQ\RUJDQL]DWLRQVDUHXQZLOOLQJWRJLYHXS
TEAM EFFECTIVENESS, DEVELOPMENT, WKH FRQFHSW HQWLUHO\ 5DWLQJV DUH VWLOO ZLGHO\ XVHG
COLLABORATION, AND WKRXJK RIWHQ ZLWK TXDOLWDWLYH PHDVXUHV LQVWHDG RI
INDIVIDUAL PERFORMANCE QXPEHUV +RZHYHU WRGD\V QHZ SUDFWLFHV ORRN DW
$ FULWLFDO JRDO LQ 30 H[SHULPHQWDWLRQ LV WR GHYLVH SHUIRUPDQFH FXUYHV DQG UDWLQJV EDVHG RQ ULFKHU
ZD\V WR DOLJQ LW PRUH FORVHO\ ZLWK EXVLQHVV RXW- GDWD XVLQJ LQSXW IURP PDQ\ VRXUFHV DQG LQ WKH
FRPHV$VRUJDQL]DWLRQVEHFRPHPRUHWHDPFHQWULF FRQWH[WRIDFRQWLQXRXVGLVFXVVLRQDERXWWKLQJVWKDW
30LVDOVREHJLQQLQJWRVKLIWIURPIRFXVLQJMXVWRQ KDSSHQHGDOO\HDUUDWKHUWKDQGHOLYHULQJDVLPSOH
DQ HPSOR\HHV LQGLYLGXDO DFKLHYHPHQWV WR HYDOXDW- HQGRI\HDUUHSRUWWKDWRIWHQORVHVVLJKWRIDOOWKH
WKLQJVWKDWKDSSHQRYHUWKDWPRQWKWLPHSHULRG


Rewriting the rules for the digital age

YHUWLFDOIHHGEDFNWKHFRPSDQ\KDVFRPSOHWHO\UHLQ-
YHQWHGLWVSURFHVVDQGEXLOWDSHUIRUPDQFHPDQDJH-
PHQWV\VWHPVKDSHGE\DQGIRULWVHPSOR\HHV

*(V QHZ SURFHVV DVNV HPSOR\HHV WR IRFXV RQ SHU-


IRUPDQFHGHYHORSPHQWUDWKHUWKDQDSSUDLVDOWHDFK-
HV3HRSOH/HDGHUVWRLQVSLUHDQGHPSRZHUWKHLU
WHDPV KHOSV HPSOR\HHV VHW UHDOWLPH SULRULWLHV
EDVHGRQFXVWRPHULQSXWDQGXOWLPDWHO\LQFUHDVHV
VSHHG DQG FROODERUDWLRQ 7KH UHVXOW *( LV VHHLQJ
GUDPDWLF LPSURYHPHQWV LQ HPSOR\HH HQJDJHPHQW
WLPHWRPDUNHWDQGVSHHGRILQQRYDWLRQ13

THE PROMISE AND USES


OF BETTER DATA

$VSDUWRI30H[SHULPHQWDWLRQFRPSDQLHVDUHVHHN-
LQJZD\VWRDSSO\GDWDWRSHUIRUPDQFHPHDVXUHPHQW
)RUH[DPSOH*(GHYHORSHGDQLQKRXVHDSSWRJDLQ
LQVLJKWV IURP HPSOR\HHV DQG PDQDJHUV DW DOO OHY-
HOV LQFOXGLQJ XSZDUG IHHGEDFN RQ PDQDJHUV 7KLV
PRGHOUHVWVRQWKHSUHPLVHWKDWPRUHLQIRUPDWLRQ
\LHOGVEHWWHUGDWDZKLFKLQWXUQEULQJVEHWWHUFODULW\
DQGLQVLJKWOHDGLQJWRFRQWLQXRXVLPSURYHPHQW14

%XW KRZ LV DOO WKLV GDWD OHYHUDJHG WR PDNH DFWXDO

Finding the right GHFLVLRQV DERXW SD\ DQG SURPRWLRQ" 0RUH SUHFLVH-
O\ KRZ FDQ DQ RUJDQL]DWLRQV V\VWHPV WDNH JDLQIXO
solution takes time DGYDQWDJH RI WKHVH QHZ VRXUFHV RI SHUIRUPDQFH
UHODWHGGDWD"7KHVHDUHRSHQTXHVWLRQVWKDWDUHVWLOO
and commitment. EHLQJWHVWHG

7KHJRRGQHZVLVWKDWWKHLQFUHDVHLQWKHTXDQWLW\
DQG TXDOLW\ RI GDWD JLYHV RUJDQL]DWLRQV PRUH LQIRU-
PDWLRQRQSHUIRUPDQFHDQGEHWWHUTXDOLW\GDWDZLWK
*LYHQ WKH SDFH RI FKDQJH LW LV XQFOHDU ZKHUH WKLV ZKLFKWRLGHQWLI\KLJKSHUIRUPHUVDQGPDNHDSSUR-
UHYROXWLRQZLOOHQGZKDWWKHQHZ30JROGVWDQGDUG SULDWHSD\SURPRWLRQDQGRWKHUUHZDUGVGHFLVLRQV
ZLOO EHFRPH RU LI D VLQJOH VWDQGDUG ZLOORU HYHQ %HWWHUTXDOLW\ GDWD DOVR PDNHV FRXUVH FRUUHFWLRQV
VKRXOGHPHUJH1HZSUDFWLFHVDUHEHLQJWHVWHGLQ HDVLHUIRUERWKLQGLYLGXDOVDQGWKH30V\VWHPLWVHOI
UHDO WLPH WKURXJK D SURFHVV RI WULDO DQG HUURU 'LI- %XW WKH ZRUN FRQWLQXHV DQG PDQ\ RUJDQL]DWLRQV
IHUHQW FRPSDQLHV LQGXVWULHV DQG JHRJUDSKLHV ZLOO QGWKLVWKHKDUGHVWDVSHFWRI30WRWUDQVIRUP
OLNHO\ UHDFK GLHUHQW FRQFOXVLRQV DERXW ZKDW FRQ-
VWLWXWHVDQRSWLPDO30V\VWHP THE CHALLENGES OF NEW PM MODELS

*(DFRPSDQ\ZHOONQRZQIRULWVSLRQHHULQJZRUN :KLOHPRVWFRPSDQLHVPD\ZLVKWRFUHDWHDVLQJOH
LQFDVFDGLQJJRDOVDQGIRUFHGUDQNLQJLQWKHV VLPSOH 30 V\VWHP DFURVV WKH RUJDQL]DWLRQ PDQ\
KDVEHHQUHLQYHQWLQJLWVSHUIRUPDQFHPDQDJHPHQW DUH QGLQJ WKDW GRLQJ WKLV LV FKDOOHQJLQJ LQ SUDF-
RYHUWKHODVWWZR\HDUV1RZDIWHUUHPRYLQJUDWLQJV WLFH $W PDQ\ JOREDO FRPSDQLHV UHJXODWRU\ RU FXO-
DGRSWLQJ RQJRLQJ WRXFKSRLQWV DQG LPSOHPHQWLQJ WXUDO IDFWRUV UHVWULFW PDQ\ 30 LQQRYDWLRQV DQG
SURFHGXUHV WR GHOLYHU LPPHGLDWH KRUL]RQWDO DQG FDQHYHQUHTXLUHRUJDQL]DWLRQVWRPDLQWDLQUDWLQJV


2017 Deloitte Global Human Capital Trends

$GLGDV *URXS IRU LQVWDQFH IRXQG WKDW LWV HPSOR\- JRDOVHWWLQJ DQG SHUIRUPDQFH DSSOLFDWLRQV WKDW
HHV LQ $VLD ZDQWHG D PRUH WUDGLWLRQDO VWUXFWXUHG OHW WHDPPDWHV VHW VKDUH DQG FROODERUDWH RQ
DSSURDFK ZKLOH 86 ZRUNHUV ZDQWHG D PRUH DJLOH JRDOVRQOLQH
SURFHVV15
Enabling easy progress tracking: 7RROV
)LQGLQJ WKH ULJKW VROXWLRQ WDNHV WLPH DQG FRPPLW- WR OLQN JRDOV RIWHQ XVLQJ WKH 2EMHFWLYHV DQG
PHQW ,Q LWV UHVHDUFK WKH 1HXUR/HDGHUVKLS ,QVWL- .H\ 5HVXOWV 2.5  PRGHO DOORZ SHRSOH WR XS-
WXWH IRXQG WKDW  SHUFHQW RI FRPSDQLHV WRRN WZR GDWH WKHLU JRDOV HDVLO\ DQG VHH KRZ RWKHUV DUH
\HDUVWRJDLQVLJQLFDQWWUDFWLRQZLWKDQHZ30V\V- PDNLQJSURJUHVV
WHP7UDLQLQJDQGFKDQJHPDQDJHPHQWDUHWKHPRVW
Providing continuous feedback: 7RROV
LPSRUWDQWHOHPHQWVRIVXFFHVVLQWKLVHQGHDYRU$V
WKDW KHOS HPSOR\HHV GHOLYHU RU UHTXHVW IHHG-
RQHH[HFXWLYHSXWLW,WVDMRXUQH\QHHGLQJVXVWDLQ-
EDFN RIWHQ LQWHJUDWHG ZLWK HPDLO V\VWHPV DQG
PHQWDQGFRQWLQXRXVLPSURYHPHQW+DELWVDQGFXO-
RWKHU SURGXFWLYLW\ WRROV HQDEOH FRQWLQXRXV
WXUHFKDQJHVORZO\DQGWKURXJKSHUVLVWHQFH
LPSURYHPHQWORRSV

SOFTWARE LEADING IN Providing instant information: 3HULRGLF


A NEW DIRECTION WHDP VXUYH\V KHOS PDQDJHUV HYDOXDWH WHDP HQ-
JDJHPHQWDQGHHFWLYHQHVVZKLFKDUHWKHQXVHG
*LYHQWKLVIHUPHQWRIH[SHULPHQWDWLRQLWLVQRWVXU- WR HYDOXDWH PDQDJHUV 5HJXODU HQJDJHPHQW RU
SULVLQJWKDWWKH+5VRIWZDUHLQGXVWU\LVQGLQJLWVHOI SXOVHVXUYH\VRIHPSOR\HHVRHULQVLJKWVDERXW
LQX[,QPDQ\ZD\V+5GHSDUWPHQWVDUHDKHDGRI ZKHQDQGZK\FHUWDLQWHDPVDUHXQGHUSHUIRUP-
+5WHFKQRORJ\SURYLGHUV7KHYDVWPDMRULW\RI30 LQJRUPLJKWEHXQKDSS\RUIUXVWUDWHG
VRIWZDUH WRROV LQFOXGLQJ WKRVH GHYHORSHG E\ PDU-
NHWOHDGHUVDQGPDMRUKXPDQFDSLWDOPDQDJHPHQW Deploying data/analytics: %LJ GDWD WRROV
+&0  FORXG YHQGRUV ZHUH GHYHORSHG DURXQG WKH ORRN DW SHUIRUPDQFH RQOLQH DQG VHQG VXJJHV-
ROGRQFHD\HDUPRGHO6WLOODVPDOOEXWJURZLQJ WLRQVWRPDQDJHUVEDVHGRQDUWLFLDOLQWHOOLJHQFH
VHJPHQWRIWKH30WRROVPDUNHWLVOHDGLQJWKHZRUOG WRHQFRXUDJHFRDFKLQJ
RI+5VRIWZDUHLQDFRPSOHWHO\QHZGLUHFWLRQ7KH
Supporting career development:7RROVFDQ
GRPLQDQWFKDUDFWHULVWLFVRIQHZHUWRROVLQFOXGH
UHFRPPHQG QHZ MREV DQG FDUHHUV EDVHG RQ DQ
Enabling goal making to be more so- LQGLYLGXDOVLQWHUQDOH[SHULHQFHVZLWKMREPRELO-
cial and transparent, mobile, and digi- LW\DQGKLVSULRUVXFFHVVLQWKHFRPSDQ\
tal: 0DQ\ QHZ YHQGRUV QRZ RHU PRELOH
2HULQJ HDV\ LQWHJUDWLRQ 7KH LQWHJUDWLRQ
RI 30 WRROV ZLWK SURGXFWV OLNH 6ODFN 2XWORRN
*PDLO DQG RWKHU SURGXFWLYLW\ WRROV ZKHUH SHR-
SOH VSHQG PRVW RI WKHLU WLPH LQFRUSRUDWHV 30
LQWRHYHU\GD\ZRUN

$VWKH30UHYROXWLRQJDWKHUVVSHHGWKHQDOFKDS-
WHUKDV\HWWREHZULWWHQ0RVWEXVLQHVVHVWRGD\EH-
OLHYHWKH\KDYHSHUPLVVLRQWRUHLQYHQWH[SHULPHQW
DQG LQQRYDWH ZLWK 30 V\VWHPV $ IHZ VKRUW \HDUV
DJR WKLV ZDV QRW WUXH 1RZ WKH ZHLJKW RI H[SHUL-
HQFH DQG WKH FOHDU EHQHWV IRU ERWK RUJDQL]DWLRQV
DQGHPSOR\HHVKDYHSXVKHGWKLVWUHQGGUDPDWLFDOO\
IRUZDUG&RPSDQLHVDUHH[SORULQJDQGQGLQJZKDW
ZRUNV IRU WKHLU KLJKO\ LQGLYLGXDOL]HG VLWXDWLRQV ,W
LVDQH[FLWLQJHYROXWLRQSLRQHHUHGE\WKHIRUHVLJKW
DQG FRXUDJH RI D IHZ LQQRYDWLYH RUJDQL]DWLRQV VHY-
HUDO\HDUVDJR


Rewriting the rules for the digital age

Lessons from the front lines 1RZ WKDW HRUW KDV SDLG R 7KH QHZ 30 SURFHVV
KDV JHQHUDWHG EHWWHU QDQFLDO SHUIRUPDQFH LP-
3DWDJRQLDDGHVLJQHUDQGPDQXIDFWXUHURIRXWGRRU SURYHG LQGLYLGXDO SHUIRUPDQFH DQG VWUHQJWKHQHG
DSSDUHODQGDFFHVVRULHVHPEDUNHGRQDQHZWHDP HQJDJHPHQW3DWDJRQLDKDVVKRZQWKDWSHRSOHDQG
FHQWULFSHUIRUPDQFHSURJUDPWZR\HDUVDJR7RGD\ WHDPVZKRSDUWLFLSDWHPRUHUHJXODUO\LQFKHFNLQV
3DWDJRQLD HQFRXUDJHV LQGLYLGXDOV WR VHW QDQFLDO DQG IHHGEDFN RXWSHUIRUP WKHLU SHHUV RQ D ZLGH
DQGVWUHWFKJRDOV XVLQJWKH2.5PHWKRGRORJ\ DQG UDQJHRIQDQFLDODQGWDOHQWPHDVXUHV
WR FKHFN LQ DW OHDVW TXDUWHUO\ ZLWK WKHLU PDQDJHUV
2WKHU RUJDQL]DWLRQV WKDW UHYROXWLRQL]HG SHUIRU-
7KH FRPSDQ\ KDV HOLPLQDWHG \HDUHQG UDWLQJV %R-
PDQFH PDQDJHPHQW VHYHUDO \HDUV DJR DUH VWLOO
QXVHV DUH EDVHG RQ JRDO DWWDLQPHQW DQG EDVH SD\
UHDSLQJ VLJQLFDQW UHZDUGV $GREH FKDQJHG LWV
LV DOORFDWHG DFFRUGLQJ WR VNLOOV DQG UHODWLYH SHUIRU-
SHUIRUPDQFH PDQDJHPHQW DSSURDFK LQ  DERO-
PDQFH 7KH HQWLUH SURFHVV KDV EHHQ LPSOHPHQWHG
LVKLQJDQQXDOSHUIRUPDQFHDSSUDLVDOVUDWLQJVDQG
WKURXJKDPRELOHDSSFDOOHG+LJK*URXQG
D IRUFHG GLVWULEXWLRQ FXUYH DQG PRYLQJ WR DQ DS-
7KHVHGHYHORSPHQWVGLGQRWKDSSHQRYHUQLJKW)RU SURDFK WKH\ FDOOHG &KHFNLQV :KLOH $GREH XS-
3DWDJRQLD WUDQVIRUPLQJ 30 WRRN \HDUV RI UHWKLQN- GDWHGLWV&KHFNLQEUDQGLQWRNHHSLWIHHOLQJ
LQJ UHWUDLQLQJ DQG UHHGXFDWLQJ HPSOR\HHV 7KH FXUUHQWWKHFRUHFRQFHSWVKDYHKHOGVWHDG\DFURVV
FRPSDQ\ QRWHG WKDW LQ WKH SURJUDPV UVW \HDU WKH ODVW IRXU \HDUV D IRFXV RQ PDQDJHUV VHWWLQJ
IHHGEDFNZDVYHU\SRVLWLYHDVSHRSOHZHUHDIUDLGWR FOHDUH[SHFWDWLRQVPDQDJHUVDQGGLUHFWUHSRUWVFRO-
JLYHVKDUSVXJJHVWLRQV%XWE\WKHHQGRIWKHVHFRQG ODERUDWLQJRQHPSOR\HHIHHGEDFNDQGGLUHFWUHSRUWV
\HDU PDQDJHUV EXLOW D PXVFOH DERXW KDYLQJ FDQ- EHLQJUHVSRQVLEOHIRUGHYHORSPHQW ZLWKPDQDJHUV
GLG GHYHORSPHQWDO FRQYHUVDWLRQV DQG SHRSOH IHOW DOVRVKDULQJUHVSRQVLELOLW\ 6LQFHWKHQHZDSSURDFK
FRPIRUWDEOHWKDWFKHFNLQVDQGIHHGEDFNZRXOGEH LVDFRQWLQXRXVSHUIRUPDQFHSURFHVVHLWKHUPDQDJ-
XVHIXOSRVLWLYHDQGQRWSXQLWLYH HUV RU GLUHFW UHSRUWV FDQ UHTXHVW D FKHFNLQ DW DQ\
SRLQWGXULQJWKH\HDU

8VLQJ LWV HQJDJHPHQW VXUYH\ IURP  DV


WKH EDVHOLQH $GREH FRQWLQXHV WR PRQLWRU
WKH SURJUHVV DQG HHFWLYHQHVV RI LWV &KHFN
LQ SURJUDP )RU H[DPSOH WKHUH KDV EHHQ D
 SHUFHQW LQFUHDVH LQ DUPDWLYH UHSOLHV WR
WKH TXHVWLRQ , ZRXOG UHFRPPHQG $GREH DV
D JUHDW SODFH WR ZRUN DQG D  SHUFHQW LQ-
FUHDVHLQDUPDWLYHUHSOLHVWRWKHTXHVWLRQ,
UHFHLYH RQJRLQJ IHHGEDFN WKDW KHOSV P\ SHU-
IRUPDQFH

$V RQH RI $GREHV +5 OHDGHUV QRWHG )RXU


\HDUV LV D ORQJ WLPH IRU D SURFHVV WR UHPDLQ
WKH VDPHHVSHFLDOO\ LQ WKH G\QDPLF WHFK
LQGXVWU\ +RZHYHU WKLV DSSURDFK LV VLJ-
QLFDQWO\ EHWWHU WKDQ WKH SULRU DSSURDFK VR
ZH KDYHQW QHHGHG WR PDNH VXEVWDQWLDO
FKDQJHV19


2017 Deloitte Global Human Capital Trends

Start here Tailor PM to strategic and organizational


needs: 7KH FRUH SULQFLSOHV RI FKHFNLQV DJLOH
Identify a strategy and philosophy for JRDOVHWWLQJDQGIUHTXHQWIHHGEDFNDUHEHFRPLQJ
PM::KDWLVWKHRUJDQL]DWLRQWU\LQJWRDFKLHYH FRPPRQDURXQGWKHZRUOG%XWVRPHFRPSDQLHV
WKURXJKDQHZ30V\VWHP"+RZFDQLWEHVWEH VWLOO ZDQW IRUPDO UHYLHZV QXPHULF UDWLQJV DQG
DOLJQHGZLWKEXVLQHVVVWUDWHJ\":KDWDSSURDFK GHYHORSPHQWSODQV2UJDQL]DWLRQDOFXOWXUHWDNHV
ZLOOGHYHORSOHDGHUVPRVWHHFWLYHO\",QVWHDGRI \HDUVWRFKDQJHVRFRPSDQLHVVKRXOGDGRSWQHZ
FDVFDGHGJRDOVWKDWORFNHPSOR\HHVLQWRDVHWRI SUDFWLFHVDWDVSHHGWKDWZRUNVIRUWKHEXVLQHVV
DFWLYLWLHV FRQVLGHU D PRUH H[LEOH DJLOH WUDQV-
Upskill managers in coaching skills: &RQ-
SDUHQWDSSURDFKWRJRDOVHWWLQJ
WLQXRXVIHHGEDFNIRUHPSOR\HHVLVDFULWLFDOIHD-
Look to peers: ,GHQWLI\ FRPSDQLHV LQ WKH LQ- WXUHRIWKHQHZ30SDUDGLJP\HWPDQDJHUVRIWHQ
GXVWU\ RU UHJLRQ WKDW DUH OHDGLQJ WKH 30 UHYR- QHHGKHOSOHDUQLQJKRZWREHIXOOWLPHFRDFKHV
OXWLRQ DQG WKDW IDFH FRPSDUDEOH FKDOOHQJHV G\- UDWKHU WKDQ SDUWWLPH HYDOXDWRUV &RPSDQLHV
QDPLFVDQGRSSRUWXQLWLHV DGRSWLQJDQHZ30DSSURDFKVKRXOGIRFXVKHDY-
LO\ RQ OHDGHUVKLS GHYHORSPHQW EXLOGLQJ QHZ
See what is working: $PRQJ SHHUV WKDW DUH
PXVFOHV LQ PDQDJHUV DQG FUHDWLQJ GLVFLSOLQH
H[SHULPHQWLQJZLWK30LGHQWLI\WKHGHVLJQHOH-
DURXQGIHHGEDFNFRDFKLQJDQGFROODERUDWLRQ
PHQWVWRROVDQGSURFHVVHVWKDWDUHPRVWHHF-
WLYHIRUWKHP,QWHUQDOO\VWXG\KLJKSHUIRUPLQJ Put it all together: 'HWHUPLQH KRZ FKDQJHV
LQGLYLGXDOV WHDPV DQG OHDGHUV WR QG ZD\V WR WR 30 ZLOO LQIRUP WKH RUJDQL]DWLRQV UHZDUGV
LQFRUSRUDWH WKHLU SUDFWLFHV WKURXJKRXW WKH UHVW SURPRWLRQDQGVXFFHVVLRQSURFHVVHV$SSURDFK
RIWKHRUJDQL]DWLRQ WKLVIURPWKHHPSOR\HHH[SHULHQFHSHUVSHFWLYH

FAST FORWARD
In the future, leading companies will create a continuous, highly agile process
among employees and teams, as well as among employees and leaders. Many will
take advantage of new software tools that integrate PM into daily work and use the
greater quantity and richer quality of data now available. The dreaded end-of-year
HYDOXDWLRQZLOOEHJRQHUHSODFHGE\FRQWLQXRXVIHHGEDFNRZLQJEHWZHHQHPSOR\HHV
and managers.

These changes are not merely new processes, but rather new organizational muscles.
As such, they will take time to develop and need constant exercise to maintain. But
RYHUWLPHWKH\ZLOOEHFRPHVWURQJHU30FKDQJHVWKDWVHHPGLFXOWLQWKHHDUO\
stages of transformation become more natural over time. As trust grows, feedback
becomes more direct and constructive, and changes are accepted.


Rewriting the rules for the digital age

)LJXUH3HUIRUPDQFHPDQDJHPHQW2OGUXOHVYVQHZUXOHV

Old rules New rules

Check-ins conducted quarterly or more frequently;


Performance appraisals and goal-setting conducted
regular goal-setting occurs in an open, collaborative
once per year
process

Feedback collected continuously and easily reviewed


Feedback collected by manager at end of year
at end of year (often through apps and mobile tools)

*RDOVNHSWFRQGHQWLDOZLWKIRFXVRQLQGLYLGXDO Goals made public and transparent with increased


achievement focus on team achievement

Employees evaluated by their manager Managers also evaluated by their employees

Employees rated on a qualitative scale; rankings


Employees force-ranked on a quantitative scale
considered, not forced

Compensation levels more transparent, more


&RPSHQVDWLRQNHSWFRQGHQWLDODQGIRFXVHGRQ
frequently discussed, and focused more on pay for
equity; bands based on performance ratings
performance than on equity

Managers focused on coaching and developing


Managers focused on evaluating performance
people

One leader evaluates each individual in a qualitative, 0DQ\FRQWULEXWHWRDQLQGLYLGXDOVSHUIRUPDQFH


opinion-based process evaluation; evaluation draws heavily on data

Process considered to be a burden and waste of time Process is agile, faster, continuous, and lighter

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. David Rock, Beth Jones, and Camille Inge, Reengineering performance management: How companies are evolving PM
beyond ratings, NeuroLeadership Institute, 2015.

2. %ULDQ+RPDQ&KDUOHV(/DQFH%HWKDQ\%\QXPDQG:LOOLDP$*HQWU\5DWHUVRXUFHHHFWVDUHDOLYHDQGZHOO
after all, Personnel Psychology 63, no. 1 (spring 2010): pp. 119151.

3. -RVK %HUVLQ 7LDQ\ 0F'RZHOO $PLU 5DKQHPD DQG <YHV YDQ 'XUPH 7KH RUJDQL]DWLRQ RI WKH IXWXUH $UULYLQJ
now, 2017 Deloitte Global Human Capital Trends: Rewriting the rules for the digital age, Deloitte University Press,
February 27, 2017.

4. Bill Pelster, Dani Johnson, Jen Stempel, and Bernard van der Vyver, Careers and learning: Real time, all the time,
2017 Deloitte Global Human Capital Trends: Rewriting the rules for the digital age, Deloitte University Press, February
27, 2017.

5. -H 6FKZDUW] /DXUHQFH &ROOLQV +HDWKHU 6WRFNWRQ 'DUU\O :DJQHU DQG %UHWW :DOVK 7KH IXWXUH RI ZRUN 7KH
augmented workforce, 2017 Deloitte Global Human Capital Trends: Rewriting the rules for the digital age, Deloitte
University Press, February 27, 2017.

6. 7LDQ\0F'RZHOO'LPSOH$JDUZDO'RQ0LOOHU7VXWRPX2NDPRWRDQG7UHYRU3DJH2UJDQL]DWLRQDOGHVLJQ7KH
rise of teams, in *OREDO+XPDQ&DSLWDO7UHQGV7KHQHZRUJDQL]DWLRQ'LHUHQWE\GHVLJQ, Deloitte University
Press, February 29, 2016.

7. Schwartz et al., Careers and learning: Real time, all the time.

 Rock et al., Is transforming performance management worth it?

9. Executive conversations with the authors.

10. Executive conversations with the authors.

11. Amy Berg (Adidas), in discussion with the authors, November 2016.

12. Executive conversations with the authors.

13. GE executives, in discussion with the authors, January 2017.

14. Janice Semper (GE), in discussion with the authors, August 2016.

15. Amy Berg (Adidas), in discussion with the authors, November 2016.

16. Rock et al., Is transforming performance management worth it?

17. Josh Bersin, HR technology in 2017: Disruption ahead, Bersin by Deloitte, October 4, 2016, http://joshbersin.
com/2016/10/hr-technology-in-2017-disruption-ahead/. OKR (Objective and Key Results) is a goal-setting ap-
proach originally developed at Intel. Also see Josh Bersin, Becoming irresistible: A new model for employee
engagement, Deloitte Review 16, Deloitte University Press, January 26, 2015, https://dupress.deloitte.com/dup-
us-en/deloitte-review/issue-16/employee-engagement-strategies.html.

 Patagonia senior management, in discussion with the authors, November 2016.

19. Angela Szymusiak (senior talent development partner, Adobe), in discussion with the authors, December 2016.


Rewriting the rules for the digital age

AUTHORS

Nathan Sloan, Deloitte Consulting LLP | nsloan@deloitte.com

1DWKDQ6ORDQOHDGV'HORLWWHV3HUIRUPDQFH0DQDJHPHQWVHUYLFHRHULQJLQWKH8QLWHG
States, and oversees the US Organization Strategies, Talent Strategies, Strategic Change,
and Functional Transformation practice areas. He works with global companies to
determine the organizational structures, talent programs, and HR priorities required to
implement their business strategies. He is also the US Human Capital leader for Retail and
Wholesale Distribution.

Dimple Agarwal, Deloitte MCS Limited | dagarwal@deloitte.co.uk

Dimple Agarwal is the global leader of Organization Transformation and Talent for
the Human Capital practice. She consults at the C-suite level on operating model and
organizational design, HR and talent strategies, leadership strategies and development,
merger integration, and major transformation programs. Her 20-plus years of consulting
experience includes work in the United Kingdom, Netherlands, France, Switzerland, India,
0DOD\VLD1LJHULDDQGWKH8$(

Stacia Sherman Garr, Bersin by Deloitte, Deloitte Consulting LLP


sgarr@deloitte.com

Stacia Sherman Garr is responsible for research on human resources, talent strategy,
integrated talent management, performance management, career management, diversity
and inclusion, employee recognition, competencies, and workforce planning. Garr holds an
MBA from the University of California, Berkeley, a masters degree from the London School
RI(FRQRPLFVDQGEDFKHORUVGHJUHHVLQKLVWRU\DQGSROLWLFDOVFLHQFHIURP5DQGROSK0DFRQ
Womans College.

Karen Pastakia, Deloitte Canada | kapastakia@deloitte.ca

Karen Pastakia has more than 20 years experience in HR and talent consulting. Currently,
she leads Deloittes Human Capital practice in Toronto. She works with clients to ensure
alignment between their HR and talent objectives and investments and the overall business
strategy. Pastakia is also one of Deloitte Canadas marketplace inclusion leaders and has
been intimately involved in the evolution of Deloitte University globally.

CONTRIBUTORS
Maren Hauptmann


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Leadership disrupted
Pushing the boundaries

/HDGHUVKLS GHYHORSPHQW FRQWLQXHV WR EH D VLJQLFDQW FKDOOHQJH IRU FRPSDQLHV


around the world, as the transition to the new digital organization creates even larger
OHDGHUVKLS JDSV +LJKSHUIRUPLQJ OHDGHUV WRGD\ QHHG GLHUHQW VNLOOV DQG H[SHUWLVH
than in generations past, yet most organizations have not moved rapidly enough to
develop digital leaders, promote young leaders, and build new leadership models.

The leadership gap has become larger; organizational capabilities to address lead-
ership dropped by 2 percent.

Forty-two percent of companies cite leadership development as very important.

The percentage of companies with strong or adequate experiential programs for


leaders rose by 2 percent this year.

A
S GLJLWDOGLVUXSWLRQVZHHSVDFURVVHYHU\PD- FDSLWDOYVWHFKQRORJ\PD\EHLQGHEDWHVRPHH[HF-
MRU LQGXVWU\ OHDGHUVKLS FDSDELOLWLHV DUH QRW XWLYHVVWLOOFRQWLQXHWRIRFXVRQWKHWHFKQRORJ\VLGH
NHHSLQJSDFH,QZHWHUPHGOHDGHUVKLS RIWKHEXVLQHVVDWWKHH[SHQVHRIGHYHORSLQJOHDGHUV
WKHSHUHQQLDOLVVXHLQEXVLQHVVDFKDOOHQJHWKDW
2IFRXUVHWHFKQRORJ\LVFULWLFDOO\LPSRUWDQWEXWKX-
QHYHUVHHPVWRJRDZD\7KLV\HDUZHVHHDUDGLFDO
PDQFDSLWDOUHPDLQVLQGLVSHQVDEOH
VKLIW7RGD\DVQHYHUEHIRUHRUJDQL]DWLRQVGRQRW
MXVW QHHG PRUH VWURQJ OHDGHUV WKH\ QHHG D FRP- +RZHYHUWKHFRQFHSWRIOHDGHUDVKHURQRORQJHU
SOHWHO\ GLHUHQW NLQG RI OHDGHU ,Q VKRUW RUJDQL]D- VFDOHV +LJKO\ HHFWLYH FRPSDQLHV VXFK DV *RRJOH
WLRQV QHHG WR EXLOG D QHZ EUHHG RI \RXQJHU PRUH /\IW :/ *RUH 0DVWHUFDUG DQG $WODVVLDQ ORRN DW
DJLOHGLJLWDOUHDG\OHDGHUV OHDGHUVKLSDVDWHDPHRUWDQGUHFUXLWOHDGHUVZKR
FDQ ZRUN WRJHWKHU FRPSOHPHQW HDFK RWKHU DQG
/HDGHUVKLS WRGD\ LV OHVV DERXW WKH DUW RI OHDGHU-
IXQFWLRQDVDWHDP2
VKLSDQGPRUHDERXWWKHFKDOOHQJHVOHDGHUVDUHIDF-
LQJ$ERYHDOOWKHGUDPDWLFWUDQVIRUPDWLRQRIEXVL- :KHQROGHUEXVLQHVVPRGHOVDUHQRORQJHUZRUNLQJ
QHVVLVGULYHQODUJHO\E\WKHVZLWFKWRGLJLWDO OHDGHUVQHHGQHZFDSDELOLWLHV<HWPRVWFRPSDQLHV
DUHGLJLWDOLPPLJUDQWVQHZWRWKLVZRUOGDQGEXLOW
8QIRUWXQDWHO\ PDQ\ &(2V GR QRW XQGHUVWDQG WKH
RQROGHUPRGHOVVXFKDVFRQWUROPHFKDQLVPVDQG-
JUDYLW\ RI WKLV LVVXH ,Q D UHFHQW LQGXVWU\ VWXG\ RI
QDQFLDOUHWXUQV1RZFRPSDQLHVDUHVFDOLQJIRUGLI-
 WRS EXVLQHVV H[HFXWLYHV  SHUFHQW EHOLHYHG
IHUHQWJRDOVVXFKDVLQQRYDWLRQDQGPRYLQJDWKLJK
WKDWWHFKQRORJ\ZLOOGULYHJUHDWHUYDOXHWKDQKXPDQ
VSHHG1LQHW\SHUFHQWRIFRPSDQLHVDUHUHGHVLJQLQJ
FDSLWDO DQG  SHUFHQW EHOLHYHG SHRSOH DUH D FRVW
WKHLU RUJDQL]DWLRQV WR EH PRUH G\QDPLF WHDPFHQ-
QRW D GULYHU RI YDOXH 1 :KLOH WKH WRSLF RI KXPDQ


Rewriting the rules for the digital age

Figure 1. Leadership: Percentage of respondents rating this trend important or


very important

Percentages in
selected countries:
Canada 79 Higher % Lower %

Germany 86
83 Netherlands China 86
India 86
Netherlands 83
Belgium 64
Brazil 82
UK 78
Germany 86 Canada 79
USA 72 78 Japan
Italy 79
France 65
86 China Japan 78
Spain 78
Spain 78
Mexico 78
Italy 79 United Kingdom 78
86 India
Mexico 78
95 Brazil South Africa 76
73 Australia Australia 73
76 South Africa
United States 72
France 65
Percentages by region: Belgium 64
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


81 74 78 73 78 79 74 85 76
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

WULFDQGFRQQHFWHG7KHVHFKDQJHVUHTXLUHQRWMXVW JLHV FRPH WRJHWKHU WR IRUP VROXWLRQV 7KH GD\V RI
QHZRSHUDWLQJPRGHOVEXWDGLHUHQWW\SHRIOHDG- D OLQH OHDGHU UHDFKLQJ WKH H[HFXWLYH OHYHO LQ D VROH
HUVKLSWRPRELOL]HDQGH[HFXWHWKHVHPRGHOV IXQFWLRQKDYHHQGHG3

%HFDXVH RI WKHVH VKLIWV RUJDQL]DWLRQV QHHG SHRSOH 3HUKDSV PRVW LPSRUWDQW LQQRYDWLRQ DQG ULVN
ZKR FDQ OHDG WHDPV DQG SDUWQHU ZLWK WKH EURDGHU WDNLQJ QRZ GHQH KLJKLPSDFW OHDGHUVKLS ,Q WKH
HFRV\VWHPV 7KLV QHZ W\SH RI OHDGHU PXVW XQGHU- ZRUGVRI0DUN=XFNHUEHUJ&(2RI)DFHERRN7KH
VWDQG KRZ WR EXLOG DQG OHDG WHDPV NHHS SHRSOH ELJJHVW ULVN LV QRW WDNLQJ DQ\ ULVN ,Q D ZRUOG WKDW
FRQQHFWHG DQG HQJDJHG DQG GULYH D FXOWXUH RI LQ- LVFKDQJLQJUHDOO\TXLFNO\WKHRQO\VWUDWHJ\WKDWLV
QRYDWLRQ OHDUQLQJ DQG FRQWLQXRXV LPSURYHPHQW JXDUDQWHHGWRIDLOLVQRWWDNLQJULVNV45LVNWDNLQJ
7KH\PXVWDOVREHDEOHWROHDGDZRUNIRUFHWKDWQRZ KDVEHFRPHRQHRIWKHPRVWLPSRUWDQWGULYHUVRID
LQFOXGHVFRQWUDFWRUVWKHFRQWLQJHQWZRUNIRUFHDQG KLJKSHUIRUPLQJOHDGHUVKLSFXOWXUH
FURZGWDOHQW
DEMOGRAPHICS AND
$ QDWXUDO FRUROODU\ RI WKLV LV WKDW OHDGHUV QHHG LQ-
WHUGLVFLSOLQDU\ VNLOOV &RPSDQLHV VXFK DV *( ,%0
LEADERSHIP DESTINY
1HVWOp;HUR[DQG0DVWHUFDUGQRZEULQJOHDGHUVWR- 'HPRJUDSKLF FKDQJHV DUH DOVR LQXHQFLQJ ZKDW LV
JHWKHUIRUFROODERUDWLYHGHVLJQDQGSUREOHPVROYLQJ UHTXLUHG IRU D OHDGHU WR EH VXFFHVVIXO 0LOOHQQLDOV
H[HUFLVHVFKDOOHQJLQJWKHPWRXQGHUVWDQGKRZGLI- H[SHFW WR EH GHYHORSHG WKURXJKRXW WKHLU ZRUN OLIH
IHUHQWEXVLQHVVIXQFWLRQVLQGXVWULHVDQGWHFKQROR-


2017 Deloitte Global Human Capital Trends

)LJXUH/HDGHUVKLSFDSDELOLWLHVQHHGHGWRVXFFHHGLQDGLJLWDOZRUOG

/HDGHUVQHHGWRWKLQNDFWDQGUHDFWGLHUHQWO\WRPDNH
their organizations succeed in a digital world

Cognitive transformation Behavioral transformation Emotional transformation


7+1.GLHUHQWO\ $&7GLHUHQWO\ 5($&7GLHUHQWO\

Conceptualizing possibilities in a Adapting to constantly shifting Tolerating an environment of risk


virtual world SRZHUDQGLQXHQFH and ambiguity

Handling ever-increasing Collaborating with ease across Showing resilience in the face of
cognitive complexity PDQ\GLHUHQWWHDPV constant change

Valuing the contribution of new


Thinking divergently about new Being brave in challenging how
ZRUNSDUWQHUVDQGGLHUHQW
ways of doing things things are being done
interest groups

Investing huge amounts of energy


Making decisions quickly without +DYLQJWKHFRQGHQFHWRWDNHWKH
into getting things right; try, fail,
all of the information lead in driving change
try again

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP

YLD RSSRUWXQLWLHV PHQWRULQJ DQG VWUHWFK DVVLJQ- 7KH SHUFHQWDJH RI FRPSDQLHV ZLWK VWURQJ H[SH-
PHQWV /LNHZLVH WKH PRVW VRSKLVWLFDWHG RUJDQL]D- ULHQWLDO SURJUDPV URVH IURP  SHUFHQW LQ  WR
WLRQV YLHZ OHDGHUVKLS GHYHORSPHQW DV PRUH WKDQ  SHUFHQW LQ  2XU QHZHVW UHVHDUFK VKRZV
WUDLQLQJ 7KH\ FRPELQH RUJDQL]DWLRQDO GHVLJQ MRE WKDW IRUPDO WUDLQLQJ LV DPRQJ WKH OHDVW YDOXHG LQ-
GHVLJQ PHQWRULQJ and GHYHORSPHQW SURJUDPV WR YHVWPHQWV WR GHYHORS OHDGHUV ,QVWHDG FRPSDQLHV
FUHDWHWKHOHDGHUVWKH\QHHG5 VKRXOG IRFXV RQ HVWDEOLVKLQJ D OHDGHUVKLS FXOWXUH
ULVNWDNLQJ NQRZOHGJH VKDULQJ DQG PDWUL[ PDQ-
+RZHYHUDWPDQ\FRPSDQLHVWRGD\WKHOHDGHUVKLS
DJHPHQWWREXLOGWKHOHDGHUVRIWKHIXWXUH
SLSHOLQH UHPDLQV WRR WRSKHDY\ SUHYHQWLQJ 0LO-
OHQQLDOV IURP JHWWLQJ WKH RQWKHMRE OHDUQLQJ DQG
THE DIGITAL LEADER
GHYHORSPHQW WKH\ QHHG DQG OHDYLQJ RUJDQL]DWLRQV
VWUXJJOLQJ WR EXLOG WKHLU OHDGHUVKLS SLSHOLQHV HDU- 7KHPRVWFULWLFDOQHHGIRUPRVWRUJDQL]DWLRQVLVIRU
OLHU 0RUH WKDQ  SHUFHQW RI 0LOOHQQLDOV DUH QRZ OHDGHUV WR GHYHORS GLJLWDO FDSDELOLWLHV 7RGD\ RQO\
LQ OHDGHUVKLS SRVLWLRQV EXW PRVW EHOLHYH WKH\ DUH SHUFHQWRIFRPSDQLHV
UHFHLYLQJ OLWWOH WR QR GHYHORSPHQW LQ WKHLU UROHV IHHO WKH\ KDYH VWURQJ
,Q WKLV \HDUV VXUYH\  SHUFHQW RI FRPSDQLHV UH- GLJLWDO OHDGHUV LQ SODFH
SRUW WKH\ KDYH H[FHOOHQW RU DGHTXDWH SURJUDPV IRU DFFRUGLQJ WR RXU 
0LOOHQQLDOVXSIURPRQO\SHUFHQWWZR\HDUVDJR Global Human Capital
'HVSLWHWKLVVKLIW0LOOHQQLDOVVWLOOIHHOOHIWRXWRQO\ Trends VXUYH\ UHVSRQ-
SHUFHQWEHOLHYHWKHLURUJDQL]DWLRQLVIXOO\WDNLQJ GHQWV,QDVLJQRISRVL-
DGYDQWDJHRIWKHLUVNLOOV WLYH FKDQJH KRZHYHU
7RDGGUHVVEXVLQHVVQHHGVDQGVDWLVI\WKHGHVLUHIRU  SHUFHQW RI UHVSRQ-
OLIHORQJGHYHORSPHQWDQGPRUHUDSLGDGYDQFHPHQW GHQWVDUHGHYHORSLQJRU
PDQ\IRUPDOOHDGHUVKLSSURJUDPVDUHEHLQJVXSSOH- VWDUWLQJWRGHYHORSQHZ
PHQWHG ZLWK GHYHORSPHQWDO DVVLJQPHQWV H[WHUQDO OHDGHUVKLS SURJUDPV
H[SHULHQFHVVWUHWFKSURMHFWVDQGH[SRVXUHWRLQWHU- IRFXVHGRQGLJLWDOPDQ-
QDODQGH[WHUQDOOHDGHUV DJHPHQW


Rewriting the rules for the digital age

Getting there is hard. Our research on digital


leadership, based on studies done with MIT,
shows a shift in leadership capabilities in three
areas: how leaders must think, how leaders
must act, and how leaders must react.

*HWWLQJWKHUHLVKDUG2XUUHVHDUFKRQGLJLWDOOHDG- RIGLJLWDOOHDGHUVDQGPRVWRUJDQL]DWLRQVZLOOQHHG
HUVKLS EDVHG RQ VWXGLHV GRQH ZLWK 0,7 VKRZV D VRPHFRPELQDWLRQRIDOOWKUHH
VKLIW LQ OHDGHUVKLS FDSDELOLWLHV LQ WKUHH DUHDV KRZ
Digital investors: 6HQLRU H[HFXWLYHV ZKR HP-
OHDGHUVPXVWWKLQNKRZOHDGHUVPXVWDFWDQGKRZ
EUDFH WKH 9& PLQGVHW XQFRYHU RSSRUWXQLWLHV
OHDGHUVPXVWUHDFW9
LQYHVW LQ WDOHQW DQG LGHDV IRUJH SDUWQHUVKLSV
DQGEXLOGDQHFRV\VWHPIRULQQRYDWLRQWRWKULYH
DIGITAL LEADERS: A FIELD GUIDE
Digital pioneers:%XVLQHVVDQGIXQFWLRQOHDG-
/HDGHUVKLSLVFULWLFDOLQPDNLQJWKHWUDQVIRUPDWLRQ HUVZKRFDQUHLPDJLQHWKHIXWXUHVKDSHQHZDQG
IURP DQ RUJDQL]DWLRQ GRLQJ GLJLWDO WKLQJV WR RQH GLHUHQW EXVLQHVV PRGHOV DQG OHDG D ZLQQLQJ
WKDWLVEHFRPLQJGLJLWDO)RUERWKWKHRUJDQL]DWLRQ GLJLWDOVWUDWHJ\
DQGLWVOHDGHUVWKLVLQYROYHVWKUHHGLHUHQWW\SHVRI
WUDQVIRUPDWLRQV JXUH  Digital transformers:/HDGHUVZKRFDQPDQ-
DJH SHRSOH WKURXJK UDGLFDO FKDQJH DQG WUDQV-
Cognitive transformation: /HDGHUV QHHG WR IRUPWKHEXVLQHVV
thinkGLHUHQWO\
)RU GLJLWDO LQYHVWRUV D SULQFLSDO WDVN LV HGXFDWLRQ
Behavioral transformation: /HDGHUV QHHG 7KLVLQFOXGHVHGXFDWLQJWKHERDUGDQGRWKHUVHQLRU
to actGLHUHQWO\ OHDGHUV ZKR PD\ QRW IXOO\ XQGHUVWDQG WKH QDWXUH
Emotional transformation: /HDGHUV QHHG
to reactGLHUHQWO\

7DNHQ WRJHWKHU WKHVH WUDQVIRUPDWLRQV VKRZ KRZ


UDGLFDO WKH GLJLWDO WUDQVIRUPDWLRQ ZLOO EH $QG RU-
JDQL]DWLRQV VKRXOG KDYH FHUWDLQ FRUH H[SHFWDWLRQV
RIGLJLWDOOHDGHUV7KH\QHHGWRPDNHVHQVHRIYDJXH
H[WHUQDOWUHQGVKHOSWKHRUJDQL]DWLRQLPDJLQHWKH
GLJLWDOIXWXUHEOXUWKHLQWHUQDODQGH[WHUQDOERXQG-
DULHV LQ ZD\V WKDW DVVLVW WKH WUDQVIRUPDWLRQ HGX-
FDWHRWKHUVUHSXUSRVHWHFKQLFDOH[SHUWLVHDQGXVH
GHVLJQWKLQNLQJPHWKRGVWRIRVWHULQQRYDWLRQ

7KDWLVDEURDGOLVWRIOHDGHUVKLSFKDUDFWHULVWLFVEXW
LWLVLPSRUWDQWWRUHFDOOWKDWQRWHYHU\GLJLWDOOHDGHU
GRHV WKH VDPH WKLQJ :H VHH WKUHH GLHUHQW W\SHV


2017 Deloitte Global Human Capital Trends

RIWKHVKLIW$QRWKHUFKDOOHQJHLVJHWWLQJWKHLQYHVW- WR RQH RI LWV EXVLQHVV IXQFWLRQV RQ D ZRUOGZLGH


PHQWGHFLVLRQVULJKWVXFKDVFKRRVLQJEHWZHHQLQ- EDVLV ,Q WZR ZHHNV  UDWHUV DVVHVVHG PRUH WKDQ
WHUQDO LQYHVWPHQW LQ V\VWHPV RU SXUFKDVLQJ IURP  PLGOHYHO OHDGHUV DFURVV WKH JOREH HQDEOLQJ D
H[WHUQDO YHQGRUV DW OHVV FRVW EXW DOVR ZLWK OHVV GH- UDSLG GDWDEDVHG DSSURDFK $Q DJJUHJDWH UHSRUW
VLJQFRQWURO'LJLWDOLQYHVWRUVPXVWDOVRGHWHUPLQH RI DOO OHDGHUV ZDV FRPSLOHG DQGUHYLHZHG ZLWK +5
KRZWREDODQFHWKHFXUUHQWEXVLQHVVPRGHOZLWKWKH OHDGHUVKLS 5DWHUV EHOLHYHG WKH QHZ WRRO ZDV ERWK
GLJLWDOWUDQVIRUPDWLRQDQGWKHQLQWHJUDWHLWLQWRWKH HDV\WRXVHDQGRHUHGDFWLRQDEOHUHVXOWVWKHVHUH-
QHZHUGLJLWDOPRGHOV VXOWV SURYLGHG LQIRUPDWLYH DQG DFWLRQDEOH LQVLJKWV
WRWKHH[HFXWLYHFRPPLWWHHZKLFKKHOSHGLQPDNLQJ
'LJLWDOSLRQHHUVDUHLQPDQ\ZD\VWKHKHDUWRILQ-
IXWXUHWDOHQWGHFLVLRQV
QRYDWLRQ 7KH\ VHW WKH YLVLRQ IRU WKH ZKROH RUJDQL-
]DWLRQIXWXUHSURRIWKHEXVLQHVVGHQHWKHURDG- 7KHRUJDQL]DWLRQLVQRZH[SDQGLQJWKHWRRODFURVV
PDSIRUWKHQH[WWZRWRWKUHH\HDUVDQGGULYHERWK WKHHQWLUHJOREDORUJDQL]DWLRQDOORZLQJLWWRTXLFNO\
WKHSDFHRIFKDQJHDQGWKHRUJDQL]DWLRQVQHZGLJL- FRPSDUH UDWLQJV RI SRWHQWLDO OHDGHUV E\ SODFLQJ DOO
WDOFDSDELOLWLHV7KH\HQVXUHDFRQVLVWHQWYLVLRQDQG OHDGHUV RQ D OHYHO SOD\LQJ HOG UHJDUGOHVV RI IXQF-
SODQIRUGLJLWDOWKURXJKRXWWKHRUJDQL]DWLRQ WLRQRUUHJLRQ7KLVDSSURDFKHVWDEOLVKHVDVWDQGDUG
FRQVLVWHQWODQJXDJHIRULGHQWLI\LQJSRWHQWLDODFURVV
'LJLWDO WUDQVIRUPHUV DUH DW WKH IXOFUXP SRLQW RI
WKH JOREDO RUJDQL]DWLRQ ,W DOVR KHOSV WKH RUJDQL]D-
OHDGLQJUDGLFDOFKDQJH%XVLQHVVHVIDFHDSDUWLFXODU
WLRQWRXQFRYHUKLGGHQJHPVLQXQH[SHFWHGSODFHV
FKDOOHQJHLQQGLQJOHDGHUVZKRFDQFDUU\RQEXVL-
WKDQNV WR ULFK FRQVLVWHQW GDWD IURP JOREDO DQG UH-
QHVVDVXVXDOZKLOHPRYLQJWKHGLJLWDODJHQGDIRU-
JLRQDOWDOHQWUHYLHZV,QGHHGSHUFHQWRIWKHKLJK-
ZDUG
HVWSRWHQWLDOOHDGHUVLGHQWLHGLQWKHLQLWLDOSURMHFW
ZHUH PHHWV H[SHFWDWLRQV SHUIRUPHUVLQGLFDWLQJ
Lessons from the front lines HLWKHUSRRUUROHWRUXQWDSSHGSRWHQWLDO

$V WKH SDFH RI WHFKQRORJ\ GLVUXSWLRQ FRQWLQXHV WR


DFFHOHUDWH WKH KLJKWHFK PDQXIDFWXULQJ LQGXVWU\ Start here
LV H[SHULHQFLQJ EURDGEDVHG WDOHQW VKRUWDJHV DQG
Rethink the organizations leadership
VNLOOV JDSV 2QH JOREDO KLJKWHFK PDQXIDFWXUHU
model: 7KH QHZ PRGHO VKRXOG LQFOXGH WKH
VHHNLQJ WR H[SORUH QHZ RSHUDWLQJ PRGHOV WR VSXU
FRQFHSWVRILQQRYDWLRQJURZWKLQFOXVLRQWHDP-
UDSLG JURZWK IDFHG VHULRXV OHDGHUVKLS FKDOOHQJHV
ZRUNDQGFROODERUDWLRQ
DVLWDWWHPSWHGWRVKLIWLWVEXVLQHVVVWUDWHJ\$VLWV
EXVLQHVV FKDQJHG VR GLG LWV WDOHQW QHHGV SDUWLFX- Identify the likely digital leaders in the
ODUO\ZKHQLWFDPHWRGHYHORSLQJWKHOHDGHUVRIWKH organization: 'HWHUPLQH ZKR FDQ EH WKH LQ-
IXWXUHLWQHHGHGWRLPSOHPHQWWKHQHZVWUDWHJ\ YHVWRUVSLRQHHUVDQGWUDQVIRUPHUV7KHQWUDLQ
WKHPWRXQGHUVWDQGWKHVHRSSRUWXQLWLHV
7KHFRPSDQ\IRFXVHGUVWRQJURZLQJLWVRZQSLSH-
OLQHRIOHDGHUV%XWWKHRUJDQL]DWLRQTXLFNO\UHDOL]HG Ensure accountability: ,GHQWLI\ WKH SHUVRQ
LWQHHGHGJUHDWHUSUHFLVLRQLQLGHQWLI\LQJOHDGHUVKLS RUJURXSUHVSRQVLEOHWRWKH&VXLWHDQGERDUGIRU
SRWHQWLDODFURVVLWVZRUNIRUFH6SHFLFDOO\WKHFRP- EXLOGLQJOHDGHUVDVSDUWRIWKHEXVLQHVVVWUDWHJ\
SDQ\]HURHGLQRQWZRJRDOVWRLPSURYHLWVDELOLW\WR
Promote younger people into leadership
VSRW OHDGHUVKLS WDOHQW DFURVV DOO RI LWV WDOHQW SRROV
much faster: *LYH WKHP WKH RSSRUWXQLW\ WR
HVSHFLDOO\DWWKHPLGGOHPDQDJHUOHYHODQGWRLGHQ-
OHDUQRQWKHMREDQGWKHH[LELOLW\WROHDGWHDPV
WLI\SRWHQWLDOOHDGHUVIDVWHUDQGDWORZHUFRVW
DQG SURMHFWV ZLWK VXSSRUW IURP VHQLRU OHDGHUV
7R DFKLHYH WKHVH JRDOV WKH FRPSDQ\ GHYHORSHG D 8VH WKHP DV UHYHUVH PHQWRUV WR KHOS VHQLRU H[-
IUDPHZRUN IRU OHDGHUVKLS SRWHQWLDO WKDW RXWOLQHG HFXWLYHVOHDUQDERXWWHFKQRORJ\ZRUNSUDFWLFHV
WKH VSHFLF DWWULEXWHV PRVW SUHGLFWLYH RI OHDGHU- DQGWKHFXOWXUHRI\RXQJHUHPSOR\HHV
VKLS VXFFHVV 7KH RUJDQL]DWLRQ UROOHG RXW WKH WRRO


Rewriting the rules for the digital age

Foster risk-taking and experimentation Move beyond traditional leadership


through leadership strategy: /HDGHUVKLS training: ,QVWHDG IRFXV RQ OHDGHUVKLS VWUDW-
SURJUDPVPXVWEHLQWHUGLVFLSOLQDU\DQGIRFXVRQ HJ\ZLWKDQHPSKDVLVRQFXOWXUHHPSRZHUPHQW
QHZSURGXFWDQGVHUYLFHLQQRYDWLRQVHQFRXUDJ- ULVNWDNLQJ NQRZOHGJH VKDULQJ H[SRVXUH PD-
LQJ ULVNWDNLQJ DQG H[SHULPHQWDWLRQ DV SHRSOH WUL[PDQDJHPHQWDQGEXLOGLQJWDOHQWDVJXLGHV
GHYHORSQHZVNLOOV %ULQJLQH[WHUQDOOHDGHUVDQGUHWKLQN\RXUOHDG-
HUVKLSYHQGRUVPDQ\DUHVWHHSHGLQROGPRGHOV
DQGWUDGLWLRQDOOHDGHUVKLSWKLQNLQJ

FAST FORWARD
Great leaders have always been expected to succeed in the context of ambiguity. Now,
they face even greater pressures as the speed of technology accelerates. The role that
leaders play will continue to change, becoming even more digital-focused and team-
centric. A focus on organizational practice, including culture and organizational design,
will become an ever-more important part of leadership development. Despite this
more challenging environment, leaders will be asked to execute at a higher leveland
ensure that their organizations do not lag behind in the digital transformation.


2017 Deloitte Global Human Capital Trends

)LJXUH/HDGHUVKLS2OGUXOHVYVQHZUXOHV

Old rules New rules

/HDGHUVDUHLGHQWLHGDQGDVVHVVHGEDVHGRQ Leaders are assessed early in their careers for agility,


experience, tenure, and business performance creativity, and ability to lead and connect teams

/HDGHUVDUHLGHQWLHGHDUO\DQGJLYHQHDUO\RXWVL]HG
Leaders must pay their dues to work their way up
responsibility to test and develop their leadership
the leadership pipeline
skills

Leaders are expected to innovate, collaborate, and


Leaders are expected to know what to do and bring
use client teams, crowdsourcing, and hackathons to
judgment and experience to new business challenges
QGQHZVROXWLRQV

Leadership development focuses on assessments, Leadership development focuses on culture, context,


training, coaching, and 360-degree development knowledge-sharing, risk-taking, and exposure to
programs others

Leaders are assessed and developed based on Leaders are assessed and developed based on
behavior and style thinking patterns and problem-solving ability

Leaders are developed through training and Leaders are developed through simulation, problem
professional development programs solving, and real-world projects

Diversity of leadership is considered a goal and Leaders are assessed and trained to understand
important benchmark to measure unconscious bias, inclusion, and diversity in their role

/HDGHUVKLSLVFRQVLGHUHGDGLFXOWUROHDQGRQHWKDW Leadership is considered a role that all play;


is sacrosanct in the organization everyone has opportunities to become a leader

Leaders lead organizations and functions Leaders lead teams, projects, and networks of teams

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


Rewriting the rules for the digital age

ENDNOTES

1. Korn Ferry, Korn Ferry global study: Majority of CEOs see more value in technology than their workforce,
BusinessWire, September 17, 2016, http://www.businesswire.com/news/home/20161117006293/en/Korn-Ferry-
Global-Study-Majority-CEOs-Technology, accessed December 21, 2016.

2. Executive conversations with authors.

3. Executive conversations with authors.

4. BrainyQuote, Mark Zuckerberg Quotes, https://www.brainyquote.com/quotes/quotes/m/markzucker453450.


html, January 17, 2017.

5. Andrea Derler, High-impact leadership: The new leadership maturity model, Bersin by Deloitte, 2016, http://www.
EHUVLQFRP3UDFWLFH'HWDLODVS["GRFLG  PRGH VHDUFK S /HDGHUVKLS'HYHORSPHQW

6. Deloitte, 7KH'HORLWWH0LOOHQQLDO6XUYH\:LQQLQJRYHUWKHQH[WJHQHUDWLRQRIOHDGHUV, 2016.

7. Deloitte, The 2016 Deloitte Millennial Survey, p. 6.

 Derler, High-impact leadership.

9. Gerald Kane et al., Strategy, not technology, drives digital transformation, MIT Sloan Management Review and
Deloitte University Press, 2015, https://dupress.deloitte.com/content/dam/dup-us-en/articles/digital-transfor-
mation-strategy-digitally-mature/15-MIT-DD-Strategy_small.pdf, accessed December 21, 2016.


2017 Deloitte Global Human Capital Trends

AUTHORS

Anthony Abbatiello, Deloitte Consulting LLP | aabbatiello@deloitte.com

Anthony Abbatiello is the global leader of Deloittes Leadership practice. He specializes in


leadership strategy and development, succession management, and HR/talent strategy.
Abbatiello has led industry and functional human capital practices and is a respected global
thought leader as a SHRM Trendsetter and a resident talent blogger for +XQJWRQ3RVW.
He advises senior global clients on executive readiness, transformational leadership, and
building future leadership pipelines.

Margorie Knight, Deloitte MCS Limited | marjknight@deloitte.co.uk

Marjorie Knight was the co-founder and chairman of Kaisen Consulting, a boutique global
leadership consultancy acquired by Deloitte in 2015. As a seasoned business psychologist,
she specializes in the assessment, coaching, and development of C-suite leaders and high
potentials and in supporting organizations with succession planning. Based in the United
Kingdom, Knight has over 25 years experience working with leaders in more than 25
countries across a wide range of sectors.

Stacey Philpot, Deloitte Consulting LLP | sphilpot@deloitte.com

Stacey Philpot is a principal with Deloittes Leadership practice. She specializes in


implementing cutting-edge programs and processes that help senior executives lead,
innovate, and adapt to volatile markets and changing industries. As an organizational
psychologist, her areas of expertise are leadership development, succession planning, and
talent strategy implementation. Philpot is the author of several book chapters and articles
and a frequent speaker on womens leadership topics.

Indranil Roy, Deloitte Consulting Pte Ltd | indroy@deloitte.com

QGUDQLO5R\OHDGVWKH'HORLWWH/HDGHUVKLSSUDFWLFHIRUWKH$VLD3DFLFUHJLRQDQGVHUYHVDV
FKLHIVWUDWHJ\RFHUIRUWKHJOREDO/HDGHUVKLSSUDFWLFH5R\LVDJOREDOO\UHQRZQHGVWUDWHJLF
advisor on innovation and digital, leadership, strategy, organization, and culture. He has
H[WHQVLYHH[SHULHQFHDGYLVLQJFOLHQWVIURPWKH$6($1PHPEHUVWDWHV%UD]LO-DSDQ&KLQD
India, Korea, the United Kingdom, and the United States across a wide range of sectors,
LQFOXGLQJQDQFLDOVHUYLFHV7JRYHUQPHQWFRQVXPHUEXVLQHVVDQGKHDOWKFDUH

CONTRIBUTORS
John Crump, Andrea Derler, Karen Pastakia, Mohinish Sinha


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Digital HR
Platforms, people, and work

HR is undergoing rapid and profound change. Once viewed as a support function


that delivered employee services, HR is now being asked to help lead the digital
transformation sweeping organizations worldwide. We see this change taking place
in three areas:

Digital workforce: How can organizations drive new management practices


(which we call digital DNA1), a culture of innovation and sharing, and a set of tal-
ent practices that facilitate a new network-based organization?2

Digital workplace: How can organizations design a working environment that


enables productivity; uses modern communication tools (such as Slack, Work-
place by Facebook, Microsoft Teams, and many others); and promotes engage-
ment, wellness, and a sense of purpose?

Digital HR: How can organizations change the HR function itself to operate in a
digital way, use digital tools and apps to deliver solutions, and continuously ex-
periment and innovate?

This shift is happening rapidly, as HR leaders are being pushed to take on a larger
role in helping to drive the organization to be digital, not just do digital.

Fifty-six percent of companies we surveyed this year are redesigning their HR


programs to leverage digital and mobile tools.

Fifty-one percent of companies are currently in the process of redesigning their


organizations for digital business models.

7KLUW\WKUHHSHUFHQWRIVXUYH\HG+5WHDPVDUHXVLQJVRPHIRUPRIDUWLFLDOLQWHOOL-
gence (AI) technology to deliver HR solutions, and 41 percent are actively building
mobile apps to deliver HR services.


Rewriting the rules for the digital age

O
VER WKH ODVW YH \HDUV WKH +5 GLVFLSOLQH UHGHVLJQHG DV D VHUYLFH RUJDQL]DWLRQ FHQWHUV RI
KDV XQGHUJRQH D UDSLG HYROXWLRQ 7KUHH H[SHUWLVH EHJDQ WR PDQDJH FRUH WDOHQW SUDFWLFHV
\HDUVDJRZHZURWHDERXW+5VUDFHWRWKH VHUYLFH FHQWHUV KDQGOHG LQGLYLGXDO QHHGV DQG +5
FORXGDVFRPSDQLHVUXVKHGWRUHSODFHOHJDF\WDOHQW EXVLQHVV SDUWQHUV EHJDQ WR EH HPEHGGHG LQ WKH
V\VWHPV ZLWK LQWHJUDWHG +5 SODWIRUPV 7ZR \HDUV EXVLQHVV ,Q WKH V DQG HDUO\ V +5 ZDV
DJRZHFKDUDFWHUL]HG+5DVDIXQFWLRQLQQHHGRI UHGHVLJQHGDJDLQDURXQGLQWHJUDWHGWDOHQWPDQDJH-
D PDNHRYHU DV FRPSDQLHV IRFXVHG RQ UHVNLOOLQJ PHQWRIWHQDFFRPSDQLHGE\WKHLPSOHPHQWDWLRQRI
+5SURIHVVLRQDOVLQWHJUDWLQJWKHRUJDQL]DWLRQDQG QHZ V\VWHPV IRU UHFUXLWLQJ OHDUQLQJ SHUIRUPDQFH
LPSOHPHQWLQJ DQDO\WLFV 7KLV \HDU DV GLJLWDO PDQ- PDQDJHPHQWDQGFRPSHQVDWLRQ
DJHPHQWSUDFWLFHVDQGDJLOHRUJDQL]DWLRQGHVLJQEH-
7RGD\ +5V IRFXV KDV VKLIWHG WRZDUG EXLOGLQJ WKH
FRPHFHQWUDOWREXVLQHVVWKLQNLQJ+5LVFKDQJLQJ
RUJDQL]DWLRQ RI WKH IXWXUH &RPSDQLHV DUH KLULQJ
DJDLQIRFXVLQJRQSHRSOHZRUNDQGSODWIRUPV:H
\RXQJGLJLWDOO\VDYY\ZRUNHUVZKRDUHFRPIRUWDEOH
FDOOWKHUHVXOWLQJVHWRI+5SUDFWLFHVGLJLWDO+5
GRLQJWKLQJVWKHPVHOYHVDQGVKDULQJLQIRUPDWLRQLQ
'LJLWDO+5EXLOGVXSRQ\HDUVRIHRUW,QWKHV DWUDQVSDUHQWZD\7KH\ZDQWDQLQWHJUDWHGGLJLWDO
DQG V +5 IRFXVHG RQ SHUVRQQHO RSHUDWLRQV H[SHULHQFH DW ZRUNRQH GHVLJQHG DURXQG WHDPV
DXWRPDWLQJWUDQVDFWLRQVDQGPDLQWDLQLQJDVRXQG SURGXFWLYLW\ DQG HPSRZHUPHQWDQG +5 LV H[-
HPSOR\HH V\VWHP RI UHFRUG ,Q WKH V +5 ZDV SHFWHGWRGHOLYHULW

Figure 1. Digital HR: Percentage of respondents rating this trend important or very
important

Percentages in
selected countries:
Canada 63 Higher % Lower %

India 87
75 Netherlands
Brazil 82
Mexico 79
Belgium 61 Germany 75
UK 67 Netherlands 75

USA 65 Germany 75 South Africa 74


France 63 64 Japan Italy 74
Spain 73 73 China China 73
Mexico 79 Spain 73
Italy 74
87 India Australia 68
United Kingdom 67
82 Brazil
United States 65
68 Australia
74 South Africa Japan 64
Canada 63
France 63
Percentages by region: Belgium 61
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


81 65 79 69 76 72 67 79 67
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

REWRITING THE RULES FOR DIGITAL HR 'LJLWDO +5 UHTXLUHV GLJLWDO WHFKQRORJ\ H[SHUWLVH
:KLOH FORXGEDVHG +5 V\VWHPV EURXJKW WUHPHQ-
:KLOHQRQHRI+5VSULRUUHVSRQVLELOLWLHVKDVJRQH GRXV YDOXH WR RUJDQL]DWLRQV WKH\ DUH QR ORQJHU
DZD\ +5 GHSDUWPHQWV WRGD\ DUH XQGHU SUHVVXUH HQRXJK 7RGD\ +5 WHDPV DUH UHWKLQNLQJ WKHLU VR-
WRUHZULWHWKHUXOHVE\UHGHVLJQLQJWDOHQWSUDFWLFHV OXWLRQVLQWKHFRQWH[WRIZRUNRZHPEHGGHGDSSV
IURPUHFUXLWLQJWROHDGHUVKLSWRSHUIRUPDQFHPDQ- 5R\DO %DQN RI &DQDGD 'HXWVFKH 7HOHNRP )RUG
DJHPHQW E\ H[SHULPHQWLQJ ZLWK GLJLWDO DSSV DQG DQGRWKHUVQRZKDYHGLJLWDOGHVLJQWHDPVZLWKLQWKH
E\EXLOGLQJDFRPSHOOLQJHPSOR\HHH[SHULHQFH$OO +5 GHSDUWPHQW3 7KLV PHDQV XVLQJ WKH FORXG DV D
WKLVPXVWEHGRQHZLWKDIRFXVRQUHGHVLJQLQJWKH SODWIRUP DQG EXLOGLQJ RQ LW IRU FRPSDQ\VSHFLF
RUJDQL]DWLRQDURXQGWHDPVLPSOHPHQWLQJDQDO\WLFV QHHGV
DQG RUJDQL]DWLRQDO QHW-
ZRUNDQDO\VLVDQGGULYLQJ 7KHYHQGRUPDUNHWLVUHLQ-
DJOREDOIRFXVRQGLYHUVLW\ YHQWLQJLWVHOI$QHZEUHHG
FXOWXUH OHDUQLQJ DQG FD- As companies RI +5 SURGXFWV DQG VROX-
WLRQVLVFRPLQJWRPDUNHW
UHHUV
become networks PDQ\EXLOWDURXQGPRELOH

and the employee


'LJLWDO +5 LV EXLOW RQ DSSV $, DQG FRQVXPHU
LQQRYDWLRQ DQG H[SHUL- OLNH H[SHULHQFHV4 7KHVH
PHQWDWLRQ $V FRPSD-
QLHV EHFRPH QHWZRUNV
base becomes both WRROV DUH HQDEOLQJ +5 WR
EHFRPH QHDUUHDO WLPH
DQG WKH HPSOR\HH EDVH older and younger, &RPSDQLHV VXFK DV 6$3
EHFRPHV ERWK ROGHU DQG
\RXQJHU QHZ DSSURDFKHV new approaches are DQG 5HOLDQFH -LR QRZ
PRQLWRUUHDOWLPHPHWULFV
DUH QHHGHG LQ DOPRVW HY-
HU\ +5 GRPDLQ &RP-
needed in almost RQ HQJDJHPHQW UHFUXLW-
LQJ WXUQRYHU DQG RWKHU
SDQLHV RIWHQ QRZ XVH every HR domain. PHDVXUHVWRKHOSEXVLQHVV
KDFNDWKRQV UDSLG GHVLJQ OHDGHUV PDNH GHFLVLRQV
JURXSV DQG ERWK SUR- PRUH TXLFNO\5 ,%0 KDV
WRW\SHV DQG PLQLPDOO\ EHJXQ WR XVH $, WRROV WR
YLDEOHSURGXFWVWRUROORXWSLORW+5SURJUDPV JLYHOHDGHUVUHJXODUSXOVHVRQKRZWKHLUWHDPVDUH
GRLQJKHOSLQJWKHPVHHSDWWHUQVWKDWFDQJHWLQWKH
'HVLJQ WKLQNLQJ KDV JRQH PDLQ-
ZD\ RI SHUIRUPDQFH RU UHWHQWLRQ DQG SURPSWLQJ
VWUHDP 5DWKHU WKDQ GHOLYHU
WKHPWRSURDFWLYHO\DGGUHVVWKHPWKURXJKFRDFKLQJ
+5 SURJUDPV GHVLJQHG DURXQG
UHFRJQLWLRQRUFRPPXQLW\EXLOGLQJ
OHJDF\ EXVLQHVV SURFHVVHV +5
WHDPV QRZ VWXG\ HPSOR\HH $V GLJLWDO +5 WDNHV KROG DQG +5 RUJDQL]DWLRQV EH-
QHHGV DFURVV DOO VHJPHQWV KRXU- FRPH PRUH SODWIRUP EDVHG EXVLQHVV SDUWQHUV DUH
O\ ZRUNHUV VDODULHG HPSOR\HHV EHFRPLQJ PRUH GLJLWDOO\ HPSRZHUHG DQG DEOH WR
PDQDJHUV H[HFXWLYHV ,QVWHDG VSHQGPRUHWLPHLQWKHEXVLQHVV2XUODWHVWUHVHDUFK
RIWUDGLWLRQDOFDUHHUPRGHOV+5 VKRZV WKDW KLJKSHUIRUPLQJ +5 WHDPV KDYH IHZHU
LV RHULQJ MRXUQH\ PDSV DQG UH- JHQHUDOLVWV DQG PRUH VHQLRU +5 EXVLQHVV SDUWQHUV
SODFLQJ FRPSOH[ SURFHVVHV ZLWK IRUFLQJ PDQ\ +5 GHSDUWPHQWV WR UHVNLOO WKHLU +5
ORFDO SUDFWLFHV EDVHG RQ DQ LQWH- VWDDQGJLYHWKHPQHZUROHVDVVHQLRUFRQVXOWDQWV
JUDWHG SODWIRUP 6HH WKH )RUG OHYHUDJLQJWKHGLJLWDOWRROVLQSODFH
FDVH VWXG\ LQ WKH (PSOR\HH H[-
SHULHQFHFKDSWHURIWKLVUHSRUW 


Rewriting the rules for the digital age

)DFWRUVZKLFKQRZSURYLGHVVLPLODUWRROVLQLWV
HQWHUSULVHWDOHQWPDQDJHPHQWDSSOLFDWLRQ

7UDQVSDUHQF\LVEHFRPLQJDVWDQGDUGLQWKHZRUOGRI
+5DQGWDOHQW,QFRPSHQVDWLRQ*ODVVGRRUV.QRZ
<RXU:RUWK13DQG/LQNHG,QV6DODU\ZHUHODXQFKHG
WKLV \HDU MRLQLQJ YHQGRUV VXFK DV 6DODU\FRP DQG
3D\VFDOH ZKLFK FURZGVRXUFH FRPSHQVDWLRQ GDWD
IRU DQ\RQH WR VHH %\ FROOHFWLQJ DQRQ\PRXV GDWD
RQ WHQV RI WKRXVDQGV WR PLOOLRQV RI VDODULHV WKHVH
WRROVOHWZRUNHUVFRPSDUHWKHLUVDODU\DJDLQVWWKRVH
IRUVLPLODUMREVE\FLW\WHQXUHLQGXVWU\DQGHYHQ
FRPSDQ\

Lessons from the front lines


,%0 D JOREDO FRPSDQ\ ZLWK RYHU  SHRSOH
LVOHDGLQJWKHWUDQVLWLRQWRGLJLWDO+5XVLQJDZLGH
YDULHW\RIH[SHULPHQWVWRGULYHQHZGLJLWDO+5VROX-
WLRQV14

$IWHU DQ HPSOR\HH KDFNDWKRQ WKH FRPSDQ\ UHLQ-


YHQWHG LWV SHUIRUPDQFH PDQDJHPHQW SURFHVV E\
NEWS TOOLS AND EXPANDED EXLOGLQJ &KHFNSRLQW D QHZ IHHGEDFN SURFHVV WKDW
TRANSPARENCY FACILITATE DIGITAL HR LV GUDPDWLFDOO\ LQFUHDVLQJ HQJDJHPHQW DOLJQPHQW
DQGJRDOPDQDJHPHQW15
7KHUROHRI$,FRJQLWLYHSURFHVVLQJHPEHGGHGDQD-
O\WLFV DQG PRELOH WHFKQRORJ\ LV FKDQJLQJ WKH ZD\ 7R GULYH FRQWLQXRXV OHDUQLQJ ,%0 VKXW GRZQ LWV
SHRSOHSURJUDPVZRUN WUDGLWLRQDOJOREDOOHDUQLQJPDQDJHPHQWV\VWHPDQG
UHSODFHGLWZLWKDQHZGLJLWDOOHDUQLQJSODWIRUP7KH
:DGH DQG :HQG\ D FKDWERW VHUYLFH EULQJV $,
QHZV\VWHPHQDEOHVHPSOR\HHVWRSXEOLVKDQ\FRQ-
DQG FKDWERWV WR UHFUXLWPHQW DQG FDUHHU SODQ-
WHQWWKH\IHHOLVLPSRUWDQWFXUDWHVDQGUHFRPPHQGV
QLQJ9 :DGH KHOSV HPSOR\HHV ZLWK WKHLU FDUHHU
WUDLQLQJ EDVHG RQ UROH DQG H[SHULHQFH DQG LQWH-
VWUDWHJLHVDQGVKRZVWKHPFDUHHURSSRUWXQLWLHV
JUDWHVH[WHUQDOOHDUQLQJIURPDFURVVWKH,QWHUQHW
LQ WKH FRPSDQ\ :HQG\ WDONV ZLWK FDQGLGDWHV
DQG KHOSV WKHP XQGHUVWDQG WKH FRPSDQ\V FXO- 7R HPSRZHU HPSOR\HHV WR WDNH JUHDWHU FRQWURO RI
WXUHMRERSSRUWXQLWLHVDQGKLULQJSURFHVV WKHLUFDUHHUPDQDJHPHQW,%0GHYHORSHGDSURSUL-
HWDU\FDUHHUPDQDJHPHQWV\VWHPWKDWKHOSVSHRSOH
)LUVWMREV FKDWERW 0\D FDQ HOLPLQDWH XS WR 
QGQHZMREVDQGUHFRPPHQGVQHZDVVLJQPHQWVE\
SHUFHQWRIWKHTXHVWLRQVSHRSOHKDYHGXULQJWKH
ORRNLQJDWWKHSDWWHUQVRIWKHLUSHHUV
UHFUXLWLQJSURFHVV
:LWKLQ+5,%0OHYHUDJHGWKHFRPSDQ\V$,LQYHVW-
6ZLWFK D QHZ DSS IRU UHFUXLWLQJ KHOSV FDQGL-
PHQWV LQ :DWVRQ WR SLORW WKH XVH RI &+,3 &RJQL-
GDWHVQGMREVE\JLYLQJWKHPD7LQGHUOLNHH[-
WLYH +XPDQ ,QWHUIDFH 3HUVRQDOLW\  D FRJQLWLYH DV-
SHULHQFHIRUMREVHDUFKDQGUHFUXLWPHQW11
VLVWDQWWKDWFDQKDQGOHDZLGHUDQJHRI+5UHODWHG
6RIWZDUH YHQGRU 8QLWLYH XVHV $, WR ZULWH MRE TXHVWLRQV&+,3LVDQLQWHOOLJHQWFKDWERW DYDLODEOH
GHVFULSWLRQV EDVHG RQ DFWXDO GLVFXVVLRQV DERXW WKURXJK FRPSXWHU WH[W PHVVDJHV DQG VRRQ YRLFH 
WKHMREDQGFDQDOJRULWKPLFDOO\LGHQWLI\JHQGHU WKDW UHFRJQL]HV WKH  PRVW IUHTXHQWO\ DVNHG
UDFHRUJHQHUDWLRQDOELDVWRUHGXFHXQFRQVFLRXV HPSOR\HH TXHVWLRQV VXFK DV 7HOO PH DERXW P\
ELDVLQUHFUXLWLQJ12$QRWKHUH[DPSOHLV6XFFHVV- YDFDWLRQEHQHWVRU)LQGPHDQH[SHUWLQGLJLWDO


2017 Deloitte Global Human Capital Trends

PDUNHWLQJ DQGEHFRPHVVPDUWHUDOOWKHWLPH7KH Build a digital HR team:'HGLFDWHWHDPVWR


V\VWHPKDVDOUHDG\UHGXFHGFDOOFHQWHUWLPHDQGLV H[SORUH QHZ YHQGRU VROXWLRQV DQG EXLOG RWKHUV
SURYLQJSRSXODUZLWKHPSOR\HHV DQGFRQVLGHU$,VROXWLRQVWRLPSURYHVHUYLFHGH-
OLYHU\UHFUXLWLQJDQGOHDUQLQJ&RPSDQLHVVXFK
5R\DO%DQNRI&DQDGD 5%& LVUHLQYHQWLQJLWVHP-
DV5%&DQG'HXWVFKH7HOHNRPQRZKDYHGLJLWDO
SOR\HHH[SHULHQFHWKURXJKDFRPSOHWHGLJLWDOIRFXV
GHVLJQWHDPVLQ+5WKDWZRUNZLWK,7WRGHVLJQ
7KHFRPSDQ\VHWXSDGLJLWDO+5GHYHORSPHQWWHDP
SURWRW\SHDQGUROORXWGLJLWDODSSV
SDUWQHULQJ ZLWK ,7 IRU LQIUDVWUXFWXUH DQG VHFXULW\
WRGHSOR\DQHZSUHERDUGLQJDSSOLFDWLRQ7KHDSS Organize HR into networks of expertise
FDOOHG (PEDUN KHOSV HPSOR\HHV OHDUQ DERXW WKHLU with strong business partners: 5HWKLQN
QHZMREVHPEUDFHWKHFRPSDQ\FXOWXUHDQGPHHW \RXU +5 RUJDQL]DWLRQ PRGHO WR IRFXV HRUWV
WKHLU WHDPV RQOLQH 7R EXLOG RQ WKLV VXFFHVV 5%& RQ WKH HPSOR\HH H[SHULHQFH DQDO\WLFV FXOWXUH
SODQVWRGHYHORS&RPSHOOLQJ&DUHHUVDQHQGWRHQG DQGWKHQHZZRUOGRIOHDUQLQJ0DNHVXUHWKHVH
VHWRIDSSVDQGWRROVWKDWIRUPVDGLJLWDOVROXWLRQIRU WHDPVFRPPXQLFDWHZHOO+LJKSHUIRUPLQJ+5
FDUHHUGHYHORSPHQWMREWUDQVLWLRQDQGFRQWLQXRXV WHDPV VKDUH OHDGLQJ SUDFWLFHV DQG NQRZ ZKDW
OHDUQLQJ WKHRWKHUWHDPVDUHGRLQJ

Make innovation a core strategy within


Start here HR: 3XVK \RXUVHOI WR UHLQYHQW DQG LQQRYDWH
LQ HYHU\ SHRSOH SUDFWLFH 0DQ\ RUJDQL]DWLRQV
5HGHQH \RXU PLVVLRQ +5 WRGD\ PXVW GH- DUH QRZ XVLQJ QHZ SHUIRUPDQFH PDQDJHPHQW
QHLWVUROHDVWKHWHDPWKDWKHOSVPDQDJHPHQW SUDFWLFHV EXLOW DURXQG GHVLJQ VHVVLRQV DQG
DQG HPSOR\HHV UDSLGO\ WUDQVIRUP DQG DGDSW WR KDFNDWKRQV ,QYHVWLJDWH QHZ LQQRYDWLRQV LQ
WKH GLJLWDO ZD\ RI WKLQNLQJ )DPLOLDUL]H \RXU- UHFUXLWLQJ LQFOXGLQJ XVLQJ GDWD WR QG SHRSOH
VHOI ZLWK QHWZRUNHG RUJDQL]DWLRQ VWUXFWXUHV ZKRUHVHPEOHKLJKSHUIRUPHUVLQWKHFRPSDQ\
RUJDQL]DWLRQDO QHWZRUN DQDO\VLV DQG GLJLWDO
OHDGHUVKLSPRGHOV Rotate younger people into the HR pro-
fession:5HJXODUO\URWDWHSHRSOHIURPWKHEXVL-
Upgrade core technology: 5HSODFH OHJDF\ QHVVLQWRDQGRXWRI+5XVHLQQRYDWLRQWHDPVWR
V\VWHPVZLWKDQLQWHJUDWHGFORXGSODWIRUPIRUD UHYHUVHPHQWRU VHQLRU OHDGHUV DQG UHFUXLW QHZ
VRXQG GLJLWDO LQIUDVWUXFWXUH 8SJUDGH ROG WRROV 0%$V WR EULQJ SHRSOH ZLWK DQDO\WLFV VNLOOV LQWR
IRU OHDUQLQJ UHFUXLWLQJ DQG SHUIRUPDQFH PDQ- WKHSURIHVVLRQ
DJHPHQWDQGEULQJLQV\VWHPVWKDWDUHHDV\IRU
HPSOR\HHVWRXVH Benchmark:9LVLWRWKHUFRPSDQLHVWRVHHZKDW
WKH\ DUH GRLQJ +5 WHDPV FDQ EULQJ LQ RXWVLGH
Develop a multiyear HR technology strat- VSHDNHUV MRLQ UHVHDUFK PHPEHUVKLS SURJUDPV
egy: ,Q WRGD\V UDSLGO\ FKDQJLQJ +5 WHFKQRO- DQG FRQWLQXDOO\ ORRN IRU QHZ LGHDV WR IRVWHU LQ-
RJ\ ZRUOG LWV LPSRUWDQW WR EXLOG D PXOWL\HDU QRYDWLRQ 7RGD\V OHDGLQJ SUDFWLFHV FRPH IURP
VWUDWHJ\WKDWLQFOXGHVFORXGHQWHUSULVHUHVRXUFH LQQRYDWLYHLGHDVGHYHORSHGDURXQGDQRUJDQL]D-
SODQQLQJ (53  SODWIRUPV DSSV DQDO\WLFV DQG WLRQVFXOWXUHDQGEXVLQHVVQHHGVQRWDERRN
D UDQJH RI WRROV IRU $, FDVH PDQDJHPHQW DQG
RWKHUVROXWLRQV


Rewriting the rules for the digital age

FAST FORWARD
HR has a critical opportunity to help lead the transformation to a digital enterprise.
In the next several years, HR teams that embrace digital platforms to take up the
dual challenge of transforming HR operations on the one hand, and transforming
the workforce and the way work is done on the other, will be game changers. HR
leaders who lean into new technologies, platforms, and ways of working, and who
explore and invest in enabling agility through constant reinvention, will be strongly
positioned to have an impact on business results and employee experience.

)LJXUH'LJLWDO+52OGUXOHVYVQHZUXOHV

Old rules New rules

HR departments focus on optimizing employee


HR departments focus on process design and
productivity, engagement, teamwork, and career
harmonization to create standard HR practices
growth

HR selects a cloud vendor and implements out-of- +5EXLOGVLQQRYDWLYHFRPSDQ\VSHFLFSURJUDPV


the-box practices to create scale develops apps, and leverages the platform for scale

HR technology team moves beyond ERP to develop


HR technology teams focus on ERP implementation
digital capabilities and mobile apps with a focus on
and integrated analytics, with a focus on ease of use
productivity at work

HR centers of excellence leverage AI, chat, apps, and


HR centers of excellence focus on process design and
other advanced technologies to scale and empower
process excellence
employees

HR programs target employee segments, personae,


HR programs are designed for scale and consistency
DQGVSHFLFJURXSVSURYLGLQJWKHPZLWKMRXUQH\
around the world
maps relevant to their jobs and careers

HR focuses on self-service as a way to scale services HR focuses on enablement to help people get work
and support GRQHLQPRUHHHFWLYHDQGSURGXFWLYHZD\V

HR builds an employee self-service portal as a HR builds an integrated employee experience


WHFKQRORJ\SODWIRUPWKDWPDNHVLWHDV\WRQG platform using digital apps, case management, AI,
transactional needs and programs and bots to support ongoing employee needs

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. Deloitte LLP, Building your digital DNA, 2014, https://www2.deloitte.com/bh/en/pages/technology/articles/build-


ing-your-digital-dna.html.

2. -RVK %HUVLQ 7LDQ\ 0F'RZHOO $PLU 5DKQHPD DQG <YHV YDQ 'XUPH 7KH RUJDQL]DWLRQ RI WKH IXWXUH $UULYLQJ
now, Global Human Capital Trends 2017: Rewriting the rules for the digital age, Deloitte University Press, 2017,
https://dupress.deloitte.com/dup-us-en/focus/human-capital-trends.html.

3. Executive conversations with the authors.

4. Josh Bersin, The HR software market reinvents itself, Forbes -XO\   KWWSZZZIRUEHVFRPVLWHV
MRVKEHUVLQWKHKUVRIWZDUHPDUNHWUHLQYHQWVLWVHOIE

5. Executive conversations with the authors.

6. Executive conversations with the authors.

7. David Mallon et al., +LJKLPSDFW+5%XLOGLQJRUJDQL]DWLRQDOSHUIRUPDQFHIURPWKHJURXQGXS, Bersin by Deloitte,


July 24, 2014.

 Michael Stephan, David Brown, and Robin Erickson, Talent acquisition: Enter the cognitive recruiter, Global
Human Capital Trends 2017: Rewriting the rules for the digital age, Deloitte University Press, 2017, https://dupress.
deloitte.com/dup-us-en/focus/human-capital-trends.html.

9. Wade and Wendy, http://wadeandwendy.ai/, accessed January 17, 2017.

10. BI Intelligence, Chatbots increase recruitment opportunities, Business Insider, July 12, 2016, http://www.
businessinsider.com/chatbots-increase-recruitment-opportunities-2016-7; Khari Johnson, Recruitment chat-
bot Mya automates 75% of hiring process, Venture Beat, July 11, 2016, http://venturebeat.com/2016/07/11/
recruitment-chatbot-mya-automates-75-of-hiring-process/.

11. Switch, http://www.switchapp.com/, accessed January 17, 2017.

12. Executive conversations with the authors.

13. 6DUD $VKOH\ 2%ULHQ *ODVVGRRUV QHZ WRRO WHOOV \RX LI \RXUH XQGHUSDLG CNN Tech, October 19, 2016, http://
money.cnn.com/2016/10/19/technology/glassdoor-know-your-worth-tool/.

14. Diane Gherson (senior vice president, Human Resources, IBM), interview with the authors, December 2016.

15. Claire Zillman, IBM is blowing up its annual performance review, Fortune, February 1, 2016, http://fortune.
com/2016/02/01/ibm-employee-performance-reviews/.

16. Alison DeNisco, Three guiding principles for ethical AI, from IBM CEO Ginni Rometty, Tech Republic, January 17,
2017, http://www.techrepublic.com/article/3-guiding-principles-for-ethical-ai-from-ibm-ceo-ginni-rometty/.

17. Per Scott (vice president, Human Resources, Royal Bank of Canada), interview with Josh Bersin, December 2016.

 Executive conversations with the authors.


Rewriting the rules for the digital age

AUTHORS

Erica Volini, Deloitte Consulting LLP | evolini@deloitte.com

(ULFD9ROLQLLVWKH+XPDQ&DSLWDOFRXQWU\OHDGHUIRUWKH86DQGWKHOHDGHURIWKH86+5
7UDQVIRUPDWLRQSUDFWLFH6KHUPO\EHOLHYHVWKDW+5VKRXOGEHDWWKHKHOPRIKHOSLQJ
businesses optimize their performance. Throughout her 20-year consulting career, Volini
has worked with organizations to determine how best to deliver HR services, which enable
JOREDOJURZWKDQGGULYHHQKDQFHGSURWDELOLW\DQGKDVKHOSHGPDQ\RIWKHZRUOGVOHDGLQJ
RUJDQL]DWLRQVDFURVVPXOWLSOHLQGXVWULHVGHQHWKHLUKXPDQFDSLWDOVWUDWHJ\

Pascal Occean, Deloitte Canada | poccean@deloitte.ca

Pascal Occean leads Deloittes Canadian HR Transformation practice. With more than
18 years of experience serving domestic and global clients, Occean specializes in all
aspects of HR transformation, including strategy, service delivery, process reengineering,
outsourcing, service center transitions, implementations, and support. Occean also has
in-depth knowledge of HR technology implementations for solutions such as SAP, Oracle,
and Workday.

Michael Stephan, Deloitte Consulting LLP | mstephan@deloitte.com

Michael Stephan is the global leader for Deloittes HR Transformation practice. He develops
and integrates HR service delivery models across the operations and technology spectrum,
with a focus on optimizing HR service delivery around the world. His global consulting
experience includes HR strategy, HR operating model design and implementation, HR
business process outsourcing (BPO), global technology deployment, and enterprise
transition management.

Brett Walsh, Deloitte MCS Limited | bcwalsh@deloitte.co.uk

Brett Walsh is Deloittes global Human Capital leader and a global lead client service
partner. He has over 25 years of international experience consulting with executives on
HR transformation, HR technologies, and the future of work. A frequent speaker and
author, Walsh has an MBA from Warwick University and is a fellow of the Institute of
Business Consultants.

CONTRIBUTORS
-DVRQ)O\QQ'DYLG0DOORQ-H0LNH


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

People analytics
Recalculating the route

People analytics in HR is undergoing a seismic shift. Driven by the widespread adop-


tion of cloud HR systems, companies are investing heavily in programs to use data
for all aspects of workforce planning, talent management, and operational improve-
ment. People analytics, a discipline that started as a small technical group that ana-
lyzed engagement and retention, has now gone mainstream. Organizations are
redesigning their technical analytics groups to build out digitally powered enterprise
analytics solutions. These new solutions, whether developed internally or embedded
in new digital solutions, are enabling organizations to conduct real-time analytics at
the point of need in the business process. This allows for a deeper understanding of
issues and actionable insights for the business.

While 71 percent of companies see people analytics as a high priority in their orga-
nizations (31 percent rate it very important), progress has been slow. The percent-
age of companies correlating HR data to business outcomes, performing predic-
tive analytics, and deploying enterprise scorecards barely changed from last year.

Analytics is being applied to a wide range of business challenges: Recruiting remains


the No. 1 area of focus, followed by performance measurement, compensation,
workforce planning, and retention. We see an explosive growth in the use of orga-
nizational network analysis (ONA) and the use of interaction analytics (studying
employee behavior) to better understand opportunities for business improvement.

5HDGLQHVVUHPDLQVDVHULRXVLVVXH$IWHU\HDUVRIGLVFXVVLQJWKLVLVVXHRQO\SHU-
cent report they have usable data; only 9 percent believe they have a good under-
standing of which talent dimensions drive performance in their organizations; and
only 15 percent have broadly deployed HR and talent scorecards for line managers.


Rewriting the rules for the digital age

T
HE IXQFWLRQ RI SHRSOH DQDO\WLFV ZKLFK LQ- LPSDWLHQW ZLWK +5 WHDPV WKDW FDQW GHOLYHU DFWLRQ-
YROYHVXVLQJGLJLWDOWRROV1DQGGDWDWRPHDVXUH DEOH LQIRUPDWLRQ DQG LQVLJKWV WKHUHIRUH DQDO\WLFV
UHSRUW DQG XQGHUVWDQG HPSOR\HH SHUIRU- LVVKLIWLQJIURPDIRFXVRQ+5WRDIRFXVRQWKHEXVL-
PDQFH LV JRLQJ WKURXJK D PDMRU VKLIW $IWHU \HDUV QHVVLWVHOI)RUH[DPSOH
RI LQYHVWLQJ LQ FORXG +5 SODWIRUPV DQG VSHFLDOLVW
/HDGLQJ (53 YHQGRUV DUH LPSOHPHQWLQJ D VHW
WHDPV&+52VDQGEXVLQHVVOHDGHUVDUHQRWJHWWLQJ
RI SHRSOH DQDO\WLFV GDVKERDUGV DYDLODEOH WR WKH
WKHUHVXOWVWKH\ZDQW1RORQJHULVDQDO\WLFVDERXW
&(2 WR KHOS VHQLRU OHDGHUV XQGHUVWDQG DWWUL-
QGLQJ LQWHUHVWLQJ LQIRUPDWLRQ DQG DJJLQJ LW IRU
WLRQ KLULQJ PHWULFV HPSOR\HH FRVW DQG HP-
PDQDJHUV,WLVQRZ EHFRPLQJ DEXVLQHVV IXQFWLRQ
SOR\HHHQJDJHPHQWE\JHRJUDSK\EXVLQHVVXQLW
IRFXVHG RQ XVLQJ GDWD WR XQGHUVWDQG HYHU\ SDUW RI
DQGPDQDJHU
DEXVLQHVVRSHUDWLRQDQGHPEHGGLQJDQDO\WLFVLQWR
UHDOWLPHDSSVDQGWKHZD\ZHZRUN,QWKHFRQWH[W 7KH FKLHI RSHUDWLQJ RFHU DW D ODUJH FKDLQ RI
RIPRELOHPDSVLWLVWLPHWRUHFDOFXODWHWKHURXWH KRVSLWDOVXVHVDQDO\WLFVWRXQGHUVWDQGSDWWHUQV
RISDWLHQWRXWFRPHVDQGKRZPDQDJHPHQWDQG
NEW TOOLS PROVIDE DEEP NEW SHRSOHLVVXHVFRQWULEXWHWRUHVXOWV2
INSIGHTS TO DRIVE PERFORMANCE
7KH VDOHV RUJDQL]DWLRQ DW D PDMRU FRQVXPHU
6WDNHKROGHUVHVSHFLDOO\ ERDUG PHPEHUV DQG SURGXFWV FRPSDQ\ KDV SDUWQHUHG ZLWK +5 WR
&(2VDUH GULYLQJ WKLV FKDQJH 6HQLRU OHDGHUV DUH GHYHORS D FRPSOHWH PRGHO IRU VDOHV SURGXFWLY-

Figure 1. People analytics: Percentage of respondents rating this trend important or


very important

Percentages in
selected countries:
Higher % Lower %
Canada 72
Brazil 85
75 Netherlands India 83
China 81
UK 78
Belgium 55
Japan 77
UK 78
Italy 76
USA 76 Germany 66
77 Japan USA 76
France 48
Netherlands 75
Spain 61 81 China
Australia 73
Mexico 71
Italy 76 Canada 72
83 India
South Africa 71

85 Brazil Mexico 71
73 Australia Germany 66
71 South Africa
Spain 61
Belgium 55
Percentages by region: France 48
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


75 75 75 75 78 83 85 85 81
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

LW\ZKLFKKHOSVSUHGLFWDQGGLDJQRVHSUREOHPV
SLQSRLQWWUDLQLQJVROXWLRQVDQGLPSURYHTXDOLW\
RIKLULQJ3 Predictive analytics
$ UHWDLO KHDG RI RSHUDWLRQV QRZ XVHV EXVLQHVV tools from many HR
DQGSHRSOHDQDO\WLFVWRORRNDWFXVWRPHUDQGHP-
SOR\HHWUDFSDWWHUQVLGHQWLI\LQJQHZORFDWLRQV technology vendors
ZKHUHVDOHVSHRSOHVKRXOGEHSRVLWLRQHGWRKHOS
LPSURYHWRWDOFXVWRPHUSXUFKDVH4 have arrived, making it
)RUFRPSDQLHVWKDWKDYHEHHQLQYHVWLQJLQWKLVDUHD possible to analyze data
IRU\HDUVLWLVQRZHDVLHUWRJHWWKHVHDQVZHUVWKDQ
HYHU EHIRUH 3UHGLFWLYH DQDO\WLFV WRROV IURP PDQ\
regarding recruitment,
+5 WHFKQRORJ\ YHQGRUV KDYH DUULYHG PDNLQJ LW performance,
employee mobility,
SRVVLEOH WR DQDO\]H GDWD UHJDUGLQJ UHFUXLWPHQW
SHUIRUPDQFHHPSOR\HHPRELOLW\DQGRWKHUIDFWRUV
([HFXWLYHVQRZKDYHDFFHVVWRDVHHPLQJO\HQGOHVV
FRPELQDWLRQRIPHWULFVWRKHOSWKHPXQGHUVWDQGDW
and other factors.
DIDUGHHSHUOHYHOZKDWGULYHVUHVXOWV5

0RYLQJ EH\RQG WKH DQDO\VLV RI HPSOR\HH HQJDJH-


PHQW DQG UHWHQWLRQ DQDO\WLFV DQG $, KDYH FRPH KXPDQ SHUIRUPDQFH GDWD WR KHOS HPSOR\HHV
WRJHWKHU JLYLQJ FRPSDQLHV D PXFK PRUH GHWDLOHG LPSURYH WKHLU OHYHOV RI HQHUJ\ ZHOOQHVV DQG
YLHZ RI PDQDJHPHQW DQG RSHUDWLRQDO LVVXHV WR LP- EXVLQHVVSHUIRUPDQFH
SURYHRSHUDWLRQDOSHUIRUPDQFH)RUH[DPSOH 7KHELJWUHQGLQLVWKDWWKHVHQHZVROXWLRQVDUH
'DWDGULYHQWRROVFDQQRZKHOSSUHGLFWSDWWHUQV EXVLQHVV GULYHQ QRW LQWHUQDOO\ +5 IRFXVHG FKDO-
RI IUDXG VKRZ WUXVW QHWZRUNV FRQGXFW 21$ OHQJLQJ+5GHSDUWPHQWVWRPRYHEH\RQGWKHLURZQ
VKRZ UHDOWLPH FRUUHODWLRQV EHWZHHQ FRDFKLQJ LQWHUQDOYLHZRIGDWDDQGOHYHUDJLQJSHRSOHGDWDIRU
DQG HQJDJHPHQW DQG HYHQ DQDO\]H HPSOR\HH DEURDGUDQJHRIEXVLQHVVSUREOHPV
SDWWHUQV IRU WLPH PDQDJHPHQW GULYHQ E\ HPDLO
DQGFDOHQGDUGDWD IMAGINING NEW USES FOR DATA
TO DRIVE BUSINESS RESULTS
$UWLFLDO LQWHOOLJHQFH VRIWZDUH FDQ QRZ DQDO\]H
YLGHRLQWHUYLHZVDQGKHOSDVVHVVFDQGLGDWHKRQ- 7UDGLWLRQDO +5 RUJDQL]DWLRQV VHW XS DQ DQDO\WLFV
HVW\DQGSHUVRQDOLW\WKURXJKVRIWZDUH WHDPDVDVHSDUDWHJURXSRIVSHFLDOLVWV7RGD\FRP-
SDQLHVDUHUHWKLQNLQJ+5DVDQLQWHOOLJHQWSODWIRUP
7RROVFDQQRZDQDO\]HKRXUO\ODERUDQGLPPH-
DQGHPEHGGLQJDQDO\WLFVLQWRWKHLUHQWLUHZRUNIRUFH
GLDWHO\ LGHQWLI\ SDWWHUQV RI RYHUWLPH DQG RWKHU
PDQDJHPHQW SURFHVV DQG RSHUDWLRQV $ ODUJH WHOH-
IRUPV RI SD\UROO OHDNDJH HQDEOLQJ LPSURYH-
FRPPXQLFDWLRQV FRPSDQ\ LQ ,QGLD DQDO\]HV WKH
PHQWV RI PLOOLRQV RI GROODUV WKURXJK LPSURYHG
WLPH WR SURGXFWLYLW\ RI HYHU\ QHZ KLUH DFURVV WKH
SUDFWLFHVLQZRUNIRUFHPDQDJHPHQW
FRPSDQ\JLYLQJOLQHPDQDJHUVDQGFRUSRUDWHOHDG-
2WKHVKHOIUHWHQWLRQPRGHOV RQFHRQO\XVHIXO HUVDGDVKERDUGWRQRWHZKHQSHRSOHDUHEHKLQGLQ
LIEHVSRNH DUHQRZDYDLODEOHIURP6$32UDFOH WKHLU RQERDUGLQJ SURFHVV9 8EHUV RSHUDWLRQV WHDP
:RUNGD\ $'3 8OWLPDWH 6RIWZDUH DQG RWKHUV FROOHFWV GDWD RQ KRZ TXLFNO\ GULYHUV FDQ SLFN XS
PDNLQJLWHDVLHUWKDQHYHUWRXQGHUVWDQGGULYHUV IRRG LQ UHVSRQVH WR UHTXHVWV WR LPSURYH FXVWRPHU
IRUDWWULWLRQ VHUYLFH DQG HQKDQFH SURGXFWLYLW\ 6HYHUDO RI RXU
ODUJHFOLHQWVKDYHQRZXVHG21$WRDQDO\]HWKHEH-
'HORLWWH DQG RWKHU FRPSDQLHV DUH QRZ ORRN- KDYLRURIKLJKSHUIRUPLQJWHDPVWRXQGHUVWDQGKRZ
LQJ DW WUDYHO GDWD ELOOLQJ KRXUV DQG RWKHU ZRUNLVGRQHKHOSLQJWHDPVEHFRPHVPDUWHU


Rewriting the rules for the digital age

$V ZH GLVFXVV LQ WKH WDOHQW DFTXLVLWLRQ FKDSWHU11 XQGHUVWDQGKLULQJPDQDJHPHQWDQGSHUIRUPDQFH


DQDO\WLFV LV QRZ EHFRPLQJ D FULWLFDO SDUW RI KLJK LVVXHVDURXQGWKHFRPSDQ\LQUHDOWLPH14
SHUIRUPDQFHKLULQJ&RPSDQLHVXVHLQWHUYLHZGDWD
7KHTXDOLW\RIGDWDLQ+5FRQWLQXHVWREHDFKDOOHQJH
FDUHIXO SDUVLQJRIMRESRVWLQJ ODQJXDJH DQGFDQGL-
1HZFORXG+5WHFKQRORJ\KHOSVWUHPHQGRXVO\EXW
GDWH VFUHHQLQJ GDWD WR UHGXFH XQFRQVFLRXV ELDV LQ
FOLHQWVWHOOXVWKHSUREOHPUHTXLUHVDV\VWHPLFVROX-
UHFUXLWLQJ 1HZ WRROV WKDW ORRN DW VRFLDO DQG ORFDO
WLRQ&RPSDQLHVPXVWQRZZRUU\DERXWGDWDTXDOLW\
KLULQJGDWDKHOSFRPSDQLHVLGHQWLI\SHRSOHZKRDUH
DWDOOOHYHOVSXWLQSODFHSULYDF\DQGDQRQ\PLW\SRO-
OLNHO\ WR ORRN IRU QHZ MREV PXFK EHIRUH WKH\ DUH
LFLHV DQG FDUHIXOO\ LPSOHPHQW SUDFWLFHV WR SURWHFW
HYHQDSSURDFKHGE\FRPSHWLWRUV127KHXVHRIH[WHU-
HPSOR\HHGDWDIURPWKHIWDQGDEXVH$QGDGYDQFHG
QDOGDWDIRUSHRSOHDQDO\WLFVKDVJURZQVLJQLFDQWO\
FRPSDQLHV QRZ KDYH JRYHUQDQFH WHDPV WKDW PDNH
DVPRUHWKDQSHUFHQWRIFRPSDQLHVQRZDFWLYHO\
VXUHDOOSHRSOHUHODWHGGDWDDUHFRRUGLQDWHGDVWKH
XVHVRFLDOQHWZRUNDQGH[WHUQDOGDWDWRXQGHUVWDQG
FRPSDQ\ UHRUJDQL]HV DFTXLUHV RWKHUV DQG LPSOH-
DWWULWLRQUHWHQWLRQDQGRWKHUSHUIRUPDQFHPHWULFV
PHQWVQHZV\VWHPV

+5652/(66+)71* -XVW DV VSUHDGVKHHWV ZHUH RQFH D WRRO RI QDQFH


DORQHEXWDUHQRZXVHGWKURXJKRXWEXVLQHVVSHRSOH
:KLOH ZLGHVSUHDG DGRSWLRQ PLJKW EH OLPLWHG SHR- DQDO\WLFV LV PDNLQJ D VLPLODU OHDS %XVLQHVVHV DQG
SOH DQDO\WLFV KDV JURZQ IURP D WHFKQLFDO VSHFLDO- RUJDQL]DWLRQVWKDWDUHDGRSWLQJDQDO\WLFVDUHEULQJ-
LVW JURXS WR D VHULRXV EXVLQHVV IXQFWLRQ WKDW PXVW LQJLWLQWRWKHFRUHRIWKHLUEXVLQHVVDQGXVLQJLWWR
PHHW WKH QHHGV RI PDQ\ VWDNHKROGHUV WKURXJKRXW LQIRUP EXVLQHVV VWUDWHJ\ 6XFFHVV LQ DQDO\WLFV ZLOO
WKH FRPSDQ\ ,Q VKRUW WKH DELOLW\ WR DQDO\]H KXJH UHTXLUH D SURORQJHG WLPH FRPPLWPHQW DQG FRQWLQ-
DPRXQWVRIGDWDVKRXOGEHPRUHRIDEXVLQHVVZLGH XHGLQYHVWPHQW
IXQFWLRQQRWOLPLWHGWR+5

*LYHQWKLVVKLIWWKHUHLVDJURZLQJFRQVHQVXV
WKDWWKHEHVWDQDO\WLFVSURJUDPVDUHRZQHGE\
DGHGLFDWHGPXOWLGLVFLSOLQDU\JURXS3HUKDSV
WKLVIXQFWLRQZLOOHYHQWXDOO\EHGHFHQWUDOL]HG
EXW IRU QRZ FHQWUDOL]DWLRQ \LHOGV D VWURQJHU
DQDO\WLFV UHVXOW 6RPH RUJDQL]DWLRQV SODFH
WKLVLQ+5ZKLOHRWKHUVEXLOGDFHQWHURIH[-
SHUWLVH RXWVLGH +5 )RU LQVWDQFH )RUG DQG
RWKHUV KDYH H[SDQGHG WKH SHRSOH DQDO\WLFV
IXQFWLRQ WR ZRUN DFURVV DOO VHJPHQWV RI WKH
EXVLQHVV LQFOXGLQJ QDQFH +5 DQG RSHUD-
WLRQV13

0RUHDQGPRUHDQDO\WLFVLVVKLIWLQJIURPSXOO
WRSXVKZKHUHWKHDQDO\WLFVWHDPQRORQJHU
VLPSO\ EXLOGV PRGHOV DQG GRHV SURMHFWV EXW
QRZGHYHORSVGDVKERDUGVDQGWRROVWKDWKHOS
PDQDJHUV DQG HPSOR\HHV VHH UHOHYDQW GDWD
LQ UHDO WLPH 2QH RI RXU FOLHQWV EXLOW D WDO-
HQW PDQDJHPHQW GDVKERDUG WKDW DQDO\]HV
 GLHUHQW PHDVXUHV RI WHDP HQJDJHPHQW
DQG SHUIRUPDQFH DQG GHOLYHUV WKLV LQIRUPD-
WLRQWRDOOWHDPOHDGHUVDQGVHQLRUPDQDJHUV
WKURXJKRXWWKHFRPSDQ\9HUVLRQVRIWKLVDUH
DYDLODEOH WR VHQLRU H[HFXWLYHV KHOSLQJ WKHP


2017 Deloitte Global Human Capital Trends

Lessons from the front lines FDOO\UHGXFHGWLPHWRFRPSOHWHDQDQDO\WLFVSURMHFW


DQGLQFUHDVHGUHOLDELOLW\IRUDOOSHRSOHUHODWHGGHFL-
$JRRGH[DPSOHRIWKHQHZUROHRISHRSOHDQDO\WLFV VLRQVWKHFRPSDQ\QRZKDVVWDQGDUGUHSRUWVDFURVV
LVWKHMRXUQH\&KHYURQKDVWDNHQWREXLOGDJOREDO WKHEXVLQHVVIRUDOOWDOHQWPHWULFVDQGWKHWHDPLV
ZRUOGFODVVDQDO\WLFVIXQFWLRQ15)DOOLQJRLOSULFHVLQ ZLGHO\ FRQVXOWHG IRU GHFLVLRQV RQ UHRUJDQL]DWLRQ
UHFHQW\HDUVKDVUHTXLUHG&KHYURQWRQGQHZZD\V UHVWUXFWXULQJ DQG RWKHU VWUDWHJLF EXVLQHVV GHFL-
WRPDLQWDLQLWVDERYHDYHUDJHSURWDELOLW\DQGUHY- VLRQV&RPSDUHGZLWKWKHSULRUGHFHQWUDOL]HGPRGHO
HQXH SHU HPSOR\HH 7R DFKLHYH WKLV JRDO WKH FRP- WKH QHZ PRGHO RSHUDWHV DW VLJQLFDQWO\ ORZHU FRVW
SDQ\XVHGDQDO\WLFVWRIRFXVPRUHGHHSO\RQXQGHU- \HW DFKLHYHV  SHUFHQW KLJKHU SURGXFWLYLW\ GR-
VWDQGLQJZRUNIRUFHSURGXFWLYLW\ LQJPRUHZRUNZLWKVLJQLFDQWO\IHZHUSHRSOHDQG
LQ VLJQLFDQWO\ OHVV WLPH 2QH EXVLQHVV XQLW DORQH
&KHYURQEHJDQZLWKDVPDOOFHQWUDOL]HG+5DQDO\W-
HOLPLQDWHGQHDUO\KRXUVRIUHGXQGDQWUHSRUWLQJ
LFV JURXS WKDW SURYLGHG UHSRUWV DQG VWDQGDUGL]HG
ZRUNLQ
SHRSOH PHWULFV DW KHDGTXDUWHUV 3UHYLRXVO\ WKHUH
ZDV OLWWOH VHQVH RI FRPPXQLW\ DPRQJ WKH YDULRXV
+5 VSHFLDOW\ DUHDV DQG EXVLQHVV XQLWV OHDGLQJ WR Start here
JUHDWYDULDELOLW\LQWKHLUSUDFWLFHVRSHUDWLQJSURFH-
GXUHV DQG FDSDELOLWLHV 'LHUHQW DUHDV RI WKH EXVL- 2XU UHVHDUFK DQG FRQVXOWLQJ ZRUN KDYH LGHQWLHG
QHVV ZHUH GXSOLFDWLQJ GDWD FROOHFWLRQ DQG DQDO\VLV WKHIROORZLQJHLJKWIDFWRUVDVLPSRUWDQWWRFUHDWLQJ
PHWKRGVWRJHQHUDWHWKHVDPHUHSRUWV DVXFFHVVIXOSHRSOHDQDO\WLFVSURJUDP

7R VROYH WKHVH SUREOHPV WKH WHDP UHGHQHG LWV Invest at a senior level in people analyt-
PLVVLRQWR VXSSRUW &KHYURQVEXVLQHVV VWUDWHJLHV ics:7KHIXQFWLRQVKRXOGSURYLGHJOREDOVXSSRUW
ZLWKEHWWHUIDVWHUZRUNIRUFHGHFLVLRQVLQIRUPHGE\ QRWMXVWWHFKQLFDODQDO\VLVDQGUHTXLUHV&+52
GDWD7KLVH[SDQGHGYLVLRQOHG&KHYURQWRUHLQYHQW DQGVHQLRUH[HFXWLYHVXSSRUWWHFKQLFDOUHVRXUF-
LWVDQDO\WLFVWHDPDVDFRPSDQ\ZLGHFRPPXQLW\RI HVIURP,7DQGDVWURQJEXVLQHVVIRFXVHGOHDGHU
SUDFWLFHDQGHVWDEOLVKDJOREDOSURFHVVWRSULRULWL]H
Establish clear leadership: $ VLQJOH WHDP
DOOSHRSOHDQDO\WLFVSURMHFWVLQWKHFRPSDQ\
DQG OHDGHU VKRXOG RZQ WKH LQLWLDO VWDJHV RI DQ
7KH FRPPXQLW\ RI SUDFWLFH WRWDOHG  PHPEHUV DQDO\WLFVHRUWHYHQLIWKDWFDSDELOLW\HYHQWXDOO\
DFURVV DOO LPSRUWDQW GLYLVLRQV RI WKH FRPSDQ\ LQ- EHFRPHVGHFHQWUDOL]HG
FOXGLQJ +5 EXVLQHVV SDUWQHUV VSHFLDOLVWV DQG DQ-
Prioritize clean and reliable data across
DO\VWV IURP DURXQG WKH ZRUOG ,W SURYLGHV D IRUXP
HR and the organization:$QDO\VHVDUHRQO\
IRU LQWHUHVWHG DQDO\WLFV SURIHVVLRQDOV LQ WKH RUJD-
DVJRRGDVWKHGDWDIHGLQWRWRROVDQGVRIWZDUH
QL]DWLRQ WR JDWKHU YLUWXDOO\ DQG GLVFXVV GDWD PRG-
:RUNLQJ ZLWK FRQVLVWHQW WLPHO\ DQG DFFXUDWH
HOV VKDUH GDWD VKRZFDVH QHZ WHFKQLTXHV GHVLJQ
GDWD LV IRXQGDWLRQDO WR DOO DQDO\WLFV SUDFWLFHV
VWDQGDUGL]HG PHWULFV DQG GHYHORS DQDO\WLFV SUR-
7DNH FRQFUHWH VWHSV WR HQVXUH WKDW GDWD TXDOLW\
JUDPV 7KH FRUH WHDP DOVR GHYHORSHG DQ LQKRXVH
LV D SDUW RI HYHU\ DQDO\WLFV GLVFXVVLRQ (GXFDWH
ZRUNIRUFHDQDO\WLFVFXUULFXOXPDLPHGDWGHYHORSLQJ
+5V VWDNHKROGHUV DQG LPSOHPHQW GDWD JRY-
FULWLFDODQDO\WLFVFRPSHWHQFLHVLQERWK+5DQGQRQ
HUQDQFH SURJUDPV WR FOHDQ DQG PDLQWDLQ GDWD
+5VWDNHKROGHUV%HFDXVHDQDO\WLFVLQYROYHVDUDQJH
DFFXUDF\DQGFRQVLVWHQF\DFURVV+5DQGRSHUD-
RIVNLOOVIURPSUREOHPVROYLQJDQGGDWDDQDO\VLVWR
WLRQDOGDWDVWRUHV
YLVXDOL]DWLRQ DQG VWDWLVWLFVWKLV FXUULFXOXP KHOSV
WHDPPHPEHUVJDLQDFRPPRQOHYHORIXQGHUVWDQG- Understand that analytics is multidis-
LQJDQGFDSDELOLW\ ciplinary: %ULQJ WRJHWKHU D PXOWLGLVFLSOLQDU\
JURXS IURP DFURVV WKH RUJDQL]DWLRQ QRW MXVW
7KH UHVXOWV KDYH EHHQ VLJQLFDQW 2QO\ WZR \HDUV
3K'VDQGVWDWLVWLFLDQV7HFKQLFDODQDO\VLVLVRQO\
DIWHU WKH UHLQYHQWLRQ RI SHRSOH DQDO\WLFV WKH WHDP
DVPDOOSDUWRIWKHIXQFWLRQ'DWDIXQFWLRQGDWD
LV QRZ SHUIRUPLQJ GR]HQV RI DQDO\WLFV SURMHFWV
TXDOLW\ EXVLQHVV NQRZOHGJH GDWD YLVXDOL]DWLRQ
&KHYURQV SHRSOH DQDO\WLFV SUDFWLFH KDV GUDPDWL-
DQGFRQVXOWLQJVNLOOVDUHDOOFULWLFDOWRVXFFHVV


Rewriting the rules for the digital age

,QFUHDVH DQDO\WLFV XHQF\ WKURXJKRXW )RFXVRQDFWLRQVQRWMXVWQGLQJV7RSUR-


the organization: 5HJDUGOHVV RI ZKHWKHU WKH YLGHYDOXHWKHDQDO\WLFVWHDPPXVWWUDQVODWHLQ-
DQDO\WLFV FXVWRPHUV GR WKH DQDO\VLV WKHPVHOYHV IRUPDWLRQLQWRVROXWLRQVDQGVWDNHKROGHUVPXVW
RU KDYH VSHFLDOLVWV VXSSRUWLQJ WKHP WUDLQLQJ WDNHDFWLRQ
IRU ERWK +5 DQG RWKHU EXVLQHVV IXQFWLRQV ZLOO
Integrate HR, organizational, and exter-
EH FULWLFDO WR RSHUDWLQJ DW VFDOH ,GHQWLI\ D FXU-
nal data:$GYDQFHGSHRSOHDQDO\WLFVSURJUDPV
ULFXOXPRURWKHUSDUWQHUWRKHOSZLWKHGXFDWLRQ
LQFUHDVLQJO\UHO\RQWKHLQWHUVHFWLRQRIGDWDIURP
LPSOHPHQWDWLRQ RI VWDQGDUG WRROV DQG VWDQ-
+5RSHUDWLRQVDQGH[WHUQDOVRXUFHV2UJDQL]D-
GDUGL]DWLRQRIUHSRUWVDQGGDVKERDUGV
WLRQVUHTXLUHDGDWDVWUDWHJ\WKDWHQFRXUDJHVWKH
Develop a two- to three-year roadmap for LQWHJUDWLRQ DQG XVH RI VWUXFWXUHG DQG XQVWUXF-
investment in analytics programs: 7KLV WXUHGGDWDIURPLQWHUQDODQGH[WHUQDOVRXUFHV
LQYHVWPHQWLVDLPHGDWEXLOGLQJDQHZEXVLQHVV
IXQFWLRQ IRU WKH FRPSDQ\ QRW MXVW D WHFKQLFDO
WHDPZLWKLQ+5

FAST FORWARD
Over the next few years, the number of data sources will continue to rise, leading
to a fusion of external and internal data in predicting employee behavior. At leading
companies, analytics will become even more interdisciplinary, along the lines of ONA.
Eventually, people analytics will be fully integrated into systems and always in the
background, rather than a separate source of information.

Going forward, analytics technology will have the capability to deliver increasingly
personalized recommendations. Due to the sensitive nature of some people analytics
programs, organizations will likely need to become far more serious about data
FRQGHQWLDOLW\ORFDOUHJXODWLRQUHJDUGLQJWKHXVHRIHPSOR\HHGDWDDQGWKHULVNRI
public disclosure of private information on the organization and its employees.


2017 Deloitte Global Human Capital Trends

)LJXUH3HRSOHDQDO\WLFV2OGUXOHVYVQHZUXOHV

Old rules New rules

People analytics is viewed as a business analytics


People analytics is viewed as an HR team focused on
team that works across the business to drive
advanced analytics within HR
business results

Analytics focuses on business problems such as sales


Analytics focuses on HR topics such as retention, SURGXFWLYLW\ZRUNIRUFHHHFWLYHQHVVKLJKSRWHQWLDO
engagement, learning, and recruitment metrics retention, fraud, accident patterns, and other
operational needs

The organization has already committed to accurate


The organization makes a business case for better
and integrated data, and has tools and processes to
data integration, quality, and tools
ensure quality and ease of analysis

The people analytics team understands HR data,


The people analytics team has a strong QDQFLDOGDWDDQGFXVWRPHUGDWDDQGLWKDV
understanding of HR data relationships with all the other analytics groups in
the company

The people analytics team operates at a senior level,


The people analytics team lives in HR operations and
reports to the CHRO, and serves business leaders
reports to HR technology, or in functional areas
across the company

The people analytics team is a multidisciplinary


The people analytics team is a small set of technical
team, with a focus on business consulting, visual
experts with data management and statistical skills
communications, and problem solving

3HRSOHDQDO\WLFVLVVWDHGE\3K'VWDWLVWLFLDQVZKRVH
People analytics is a consulting function that helps
primary focus is the development of models and
business leaders solve problems
data warehouses

People analytics focuses on the entire workforce,


People analytics focuses on employees
including employees and contingent labor

The people analytics team moves beyond


The people analytics team focuses heavily on
engagement to understand the detailed drivers
engagement survey data and employee happiness
of engagement and builds culture models to
and culture
understand what drives the workforce

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


Rewriting the rules for the digital age

ENDNOTES

1. Erica Volini, Pascal Occean, Michael Stephan, and Brett Walsh, Digital HR: Platforms, people, and work, Global
Human Capital Trends 2017: Rewriting the rules for the digital age, Deloitte University Press, 2017, https://dupress.
deloitte.com/dup-us-en/focus/human-capital-trends.html.

2. Executive conversations with the authors.

3. Ibid.

4. Ibid.

5. Josh Bersin, Workday acquires Platfora: Analytics race accelerates, Forbes, July 25, 2016, http://www.forbes.
FRPVLWHVMRVKEHUVLQZRUNGD\DFTXLUHVSODWIRUDDQDO\WLFVUDFHDFFHOHUDWHVHEGGIH

6. Peter A. Gloor, What email reveals about your organization, MIT Sloan Management Review, November 17, 2015,
http://sloanreview.mit.edu/article/what-email-reveals-about-your-organization/.

7. 2OLYLD2UDQ:DOO6WUHHWKRSHVDUWLFLDOLQWHOOLJHQFHVRIWZDUHKHOSVLWKLUHOR\DOEDQNHUVReuters, June 7, 2016,


http://www.reuters.com/article/us-banks-hiring-ai-idUSKCN0YT163, accessed December 2016.

 'HORLWWH 'HORLWWH DQDO\VLV +LGGHQ ODERU H[SHQVHV DQG LQHHFWLYH ODERU XWLOL]DWLRQ FRVWLQJ FRPSDQLHV WHQV RI
millions of dollars, press release, June 16, 2016, https://www2.deloitte.com/us/en/pages/about-deloitte/articles/
press-releases/laborwise-solution-pinpoints-overages-in-labor-spending.html.

9. Executive conversations with the authors.

10. 6DUDK 2&RQQRU :KHQ \RXU ERVV LV DQ DOJRULWKP Financial Times 6HSWHPEHU   KWWSVZZZIWFRP
FRQWHQWIGFHIHEDGHGHD

11. Michael Stephan, David Brown, and Robin Erickson, Talent acquisition: Enter the cognitive recruiter, Global
Human Capital Trends 2017: Rewriting the rules for the digital age, Deloitte University Press, 2017, https://dupress.
deloitte.com/dup-us-en/focus/human-capital-trends.html.

12. hiQ, Enterprise solutions, https://www.hiqlabs.com/solutions/, accessed January 31, 2017.

13. Executive conversations with the authors.

14. Ibid.

15. Madhura Chakrabarti, Scaling people analytics globally: Chevron takes a multipronged approach to building organi-
]DWLRQZLGHDQDO\WLFVFDSDELOLWLHV SDUW , Bersin by Deloitte, November 2, 2016, https://www.bersin.com/Practice/
Detail.aspx?id=20290, accessed December 21, 2016.


2017 Deloitte Global Human Capital Trends

AUTHORS

Laurence Collins, Deloitte MCS Limited | lcollins@deloitte.co.uk

Laurence Collins leads the United Kingdoms HR Digital, Workforce Planning and Analytics
practices, helping clients drive productivity and performance in the context of the future
of work. He focuses on applying a variety of approaches such as predictive analytics,
robotics, and strategic workforce planning for improved business impact. His work includes
reimagining the role of HR and linking the resulting outcomes of new capabilities back to the
economic contribution of human capital.

Dave Fineman, Deloitte Consulting LLP | GQHPDQ#GHORLWWHFRP

Dave Fineman leads the HR Transformation People Analytics and Workforce Planning
program in the United States. In this role, he collaborates with Deloitte colleagues from
DFURVVPHPEHUUPVIXQFWLRQVWHFKQRORJ\HQYLURQPHQWVDQGLQGXVWU\SURJUDPVGHVLJQLQJ
and delivering solutions that build capability, deploy technology, and advance people
analytics and workforce planning capabilities within client organizations. In addition to his
client work, Fineman has presented people analytics and workforce planning topics at
LQGXVWU\DQGIXQFWLRQDOFRQIHUHQFHVDQGOHGFOLHQWVSHFLFVHPLQDUVDQG*UHHQKRXVH/DE
sessions. He has an MBA from the Amos Tuck School of Business at Dartmouth College and a
BA from Clark University.

Akio Tsuchida, Deloitte Tohmatsu Consulting Co., Ltd | akitsuchida@tohmatsu.co.jp

Akio Tsuchida is Deloittes Human Capital leader for Japan. With more than 20 years of
human capital consulting experience, Tsuchida has rich expertise in total rewards and
performance management, executive compensation, workforce planning, and talent
management. He has led large-scale business transformation projects related to cross-
border M&A, post-merger integration, corporate restructuring, and globalization. He has a
masters degree in labor relations and human resources from Michigan State University.

CONTRIBUTORS
Madhura Chakrabarti, Stavros Demetriou, Jim Guszcza, John Houston, Luk Smeyers


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

Diversity and inclusion


The reality gap

Diversity and inclusion has become a CEO-level issue around the world. The digital
organization of today, which operates as a network of teams, thrives on empower-
ment, open dialogue, and inclusive working styles. Leading organizations now see
diversity and inclusion as a comprehensive strategy woven into every aspect of the
talent life cycle to enhance employee engagement, improve brand, and drive perfor-
mance. The era of diversity as a check the box initiative owned by HR is over. CEOs
must take ownership and drive accountability among leaders at all levels to close the
gap between what is said and actual impact.

QWKLV\HDUVVXUYH\WKHSURSRUWLRQRIH[HFXWLYHVZKRFLWHGLQFOXVLRQDVDWRSSUL-
ority has risen by 32 percent compared with our 2014 survey.

Over two-thirds (69 percent) of executives rate diversity and inclusion an impor-
tant issue (up from 59 percent in 2014).

Thirty-eight percent of executives report that the primary sponsor of the compa-
Q\VGLYHUVLW\DQGLQFOXVLRQHRUWVLVWKH&(2

I
N WRGD\VSROLWLFDOHFRQRPLFDQGJOREDOEXVLQHVV YLHZ 'LYHUVLW\ DQG LQFOXVLRQ QRZ LPSDFWV EUDQG
HQYLURQPHQW GLYHUVLW\ KDV EHFRPH LQFUHDVLQJO\ FRUSRUDWH SXUSRVH DQG SHUIRUPDQFH 1RW RQO\ LV
LPSRUWDQW 7KH QXPEHU RI H[HFXWLYHV ZKR FLWHG WKHSXEOLFLQFUHDVLQJO\DZDUHRIWKHLVVXH ZLWQHVV
LQFOXVLRQDVDWRSSULRULW\KDVULVHQSHUFHQWIURP WKH VFUXWLQ\ RI JHQGHU DQG UDFLDO GLYHUVLW\ LQ WKH
WKH+XPDQ&DSLWDO7UHQGVVXUYH\DQGLQWKH WHFKQRORJ\ LQGXVWU\ 1 EXW HPSOR\HHV DUH DOVR H[-
ODVW WKUHH \HDUV WKH SHUFHQWDJH RI FRPSDQLHV WKDW SUHVVLQJVWURQJHUYLHZVRQGLYHUVLW\DQGLQFOXVLRQ
UDWH WKHPVHOYHV H[FHOOHQW DW JHQGHU GLYHUVLW\ ZHQW 0LOOHQQLDOV IRU H[DPSOH VHH LQFOXVLRQ DV D PDQ-
XS E\  SHUFHQW %DVHG RQ WKLV \HDUV VXUYH\  GDWRU\ SDUW RI FRUSRUDWH FXOWXUH GHQLQJ KRZ WKH
SHUFHQWRIFRPSDQLHVFRQVLGHUWKHPVHOYHVDGHTXDWH FRPSDQ\ OLVWHQV WR WKHP DW ZRUN2 6KDUHKROGHUV
DWIRFXVLQJRQJOREDOFXOWXUDOGLYHUVLW\DQGSHU- FXVWRPHUVDQGVXSSOLHUVDUHDOOWDNLQJDFORVHUORRN
FHQWRIFRPSDQLHVFRQVLGHUWKHPVHOYHVDGHTXDWHRU DWWKLVLVVXH
H[FHOOHQWDWVXSSRUWLQJDYDULHW\RIIDPLO\PRGHOVLQ
$VDZDUHQHVVDURXQGGLYHUVLW\DQGLQFOXVLRQJURZV
WKHZRUNIRUFH
GLYHUVLW\ DQG LQFOXVLRQ KDYH EHFRPH PRUH LPSRU-
7KLV \HDU WKH LVVXH LV EURDGHU WKDQ WKH VWDQGDUG WDQWIRUWDOHQWDFTXLVLWLRQDQGDFRPSDQ\VHPSOR\-
EXVLQHVV FDVH DQG UHTXLUHV D PRUH FRPSUHKHQVLYH PHQW EUDQG 0DQ\ RUJDQL]DWLRQV RSHUDWH LQ DQ HQ-


Rewriting the rules for the digital age

YLURQPHQW RI KLJK WUDQVSDUHQF\ ZKLFK HPSOR\HHV 'HVSLWHWKLVLQFUHDVHGHPSKDVLVDQGVFUXWLQ\KRZ-


GHPDQG)RU\RXQJHUZRUNHUVLQFOXVLRQLVQRWMXVW HYHU ZH EHOLHYH EXVLQHVVHV IDFH D UHDOLW\ JDS 5H-
DERXWDVVHPEOLQJGLYHUVHWHDPVEXWDOVRDERXWFRQ- VXOWV DSSHDU WR EH WRR VORZ &(2V ZKR KDYH DEGL-
QHFWLQJ WHDP PHPEHUV VR WKDW HYHU\RQH LV KHDUG FDWHG UHVSRQVLELOLW\ IRU WKLV LVVXH WR WKH &+52 RU
DQG UHVSHFWHG3 &RPSDQLHV VKRXOG DOLJQ WKHLU DS- FKLHIGLYHUVLW\RFHUPXVWQRZWDNHRZQHUVKLSDQG
SURDFKZLWKWKHH[SHFWDWLRQVRI0LOOHQQLDOVDQGRWK- KROGEXVLQHVVOHDGHUVDFFRXQWDEOHDWDOOOHYHOV3HR-
HUVRUWKH\ZLOOOLNHO\ORVHWDOHQW SOHWRGD\DUHVORZO\EHFRPLQJDZDUHRIERWKXQFRQ-
VFLRXVDQGH[SOLFLWELDVDQGVRPHRUJDQL]DWLRQVDUH
,I RQH FRQVLGHUV WKH IDFW WKDW RUJDQL]DWLRQV QRZ
VWDUWLQJWRWDNHDFWLRQWRH[SRVHWKHLVVXHDQGPDNH
RSHUDWH DV QHWZRUNV4 LW EHFRPHV HYHQ FOHDUHU WKDW
LQVWLWXWLRQDOFKDQJHVWRGHDOZLWKLW
GLYHUVLW\DQGLQFOXVLRQFDQUHLQIRUFHRUJDQL]DWLRQDO
SHUIRUPDQFH 1HZ UHVHDUFK E\ 'HORLWWH DQG RWKHU 7KH PRVW SRSXODU VROXWLRQ WRGD\ LV WUDLQLQJ %XW
DFDGHPLF LQVWLWXWLRQV GHPRQVWUDWHV WKDW GLYHUVH ZKLOHVXFKLQWHUYHQWLRQVDUHKHOSIXOLWDSSHDUVWKDW
DQG LQFOXVLYH WHDPV DUH PRUH LQQRYDWLYH HQJDJHG PDNLQJSHRSOHDZDUHLVQRWHQRXJK2UJDQL]DWLRQV
DQGFUHDWLYHLQWKHLUZRUN52XUUHVHDUFKFRPSDULQJ VKRXOG FRQVLGHU PDNLQJ VWUXFWXUDO FKDQJHV LPSOH-
KLJKSHUIRUPLQJ WHDPV DJDLQVW ORZHUSHUIRUPLQJ PHQWLQJ WUDQVSDUHQW GDWDGULYHQ VROXWLRQV DQG
WHDPV VXSSRUWV WKH YLHZ WKDW SHRSOH PXVW IHHO LQ- LPPHUVLQJ H[HFXWLYHV LQ WKH ZRUOG RI ELDV WR JLYH
FOXGHGLQRUGHUWRVSHDNXSDQGIXOO\FRQWULEXWH WKHPDYLVFHUDOXQGHUVWDQGLQJRIKRZELDVLPSDFWV

Figure 1. Diversity and inclusion: Percentage of respondents rating this trend important
or very important

Percentages in
selected countries:
Higher % Lower %
Canada 68
Japan 86

65 Netherlands China 81
South Africa 80
Mexico 79
Belgium 56 India 78
UK 74 Australia 77
USA 66 Germany 61 United Kingdom 74
France 59 86 Japan Brazil 69
Spain 66 81 China Canada 68
Mexico 79 United States 66
Italy 61
78 India
Spain 66
Netherlands 65
69 Brazil
77 Australia Italy 61
80 South Africa
Germany 61
France 59
Percentages by region: Belgium 56
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


73 67 79 60 67 62 62 78 75
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

GHFLVLRQPDNLQJWDOHQWGHFLVLRQVDQGEXVLQHVVRXW- 7KLUGDJURZLQJERG\RIUHVHDUFKLQGLFDWHVWKDWGL-
FRPHV YHUVHDQGLQFOXVLYHWHDPVRXWSHUIRUPWKHLUSHHUV9
&RPSDQLHV ZLWK LQFOXVLYH WDOHQW SUDFWLFHV LQ KLU-
:H KLJKOLJKW WKLV WUHQG EHFDXVH WKLV LVVXH KDV EH-
LQJSURPRWLRQGHYHORSPHQWOHDGHUVKLSDQGWHDP
FRPHLQFUHDVLQJO\LPSRUWDQW(PSOR\HHVDQGVWDNH-
PDQDJHPHQWJHQHUDWHXSWRSHUFHQWKLJKHUUHY-
KROGHUVDUHVWDUWLQJWRYRLFHFRQFHUQVEXWVROXWLRQV
HQXH SHU HPSOR\HH DQG JUHDWHU SURWDELOLW\ WKDQ
EXLOWDURXQGWUDLQLQJDQGHGXFDWLRQDUHQRWZRUNLQJ
WKHLU FRPSHWLWRUV :LWKRXW D VWURQJ FXOWXUH RI LQ-
ZHOO HQRXJK $ VHW RI QHZ UXOHV LV EHLQJ ZULWWHQ
FOXVLRQDQGH[LELOLW\WKHWHDPFHQWULFPRGHOFRP-
WKDWZLOOGHPDQGDQHZIRFXVRQH[SHULHQWLDOOHDUQ-
SULVLQJGLYHUVHLQGLYLGXDOVPD\QRWSHUIRUPZHOO
LQJ SURFHVV FKDQJH GDWDGULYHQ WRROV WUDQVSDUHQ-
F\DQGDFFRXQWDELOLW\ )RXUWKWKHWRSLFRIHTXDOLW\DQGJHQGHUSD\HTXLW\
KDV UHFHLYHG PRXQWLQJ SXEOLF DWWHQWLRQ &DQDGLDQ
WHAT IS DRIVING THE RISE 3ULPH 0LQLVWHU -XVWLQ 7UXGHDX PDGH KHDGOLQHV LQ
IN CONCERN? E\DSSRLQWLQJDJHQGHUHTXDOFDELQHW117KHUH
LV D QHZ HPSKDVLV RQ WUDQVSDUHQF\ RI
:K\ KDV GLYHUVLW\ DQG LQFOXVLRQ EHFRPH H[HFXWLYH SD\12 &RPSDQLHV VXFK DV
VR LPSRUWDQW" $ VHULHV RI EXVLQHVV DQG )DFHERRN 6DOHVIRUFH DQG RWKHUV DUH
FXOWXUDO FKDQJHV KDV FRPH WRJHWKHU WR SXEOLFO\ KLJKOLJKWLQJ JHQGHU HTXDOLW\
VSRWOLJKWWKHLPSRUWDQFHRIWKLVLVVXH DQG VHWWLQJ D VWURQJ H[DPSOH $V DQ
H[DPSOH DIWHU 6DOHVIRUFH SHUIRUPHG D
)LUVW WKH JOREDO SROLWLFDO HQYLURQPHQW
FRPSUHKHQVLYH DQDO\VLV RI  HP-
KDV KHLJKWHQHG HPSOR\HH VHQVLWLYLW\ WR
SOR\HHVDQGLGHQWLHGDJHQGHUSD\JDS
GLYHUVLW\ DQG LQFOXVLRQ ,PPLJUDWLRQ
WKHFRPSDQ\VSHQWURXJKO\PLOOLRQ
FKDOOHQJHV QDWLRQDOLVP DQG IHDU RI WHU-
WRHYHQRXWWKHGLVSDULW\13
URULVP DSSHDU ZLWK JUHDWHU IUHTXHQF\ LQ WKH SUHVV
2UJDQL]DWLRQV UHSRUW WKDW HPSOR\HHV DUH SHUVRQ- )LIWKDVFDUHHUWUDMHFWRULHVFKDQJHLVVXHVRIDJHDQG
DOO\FRQFHUQHGDERXWZKDWWKH\UHDGDQGKHDUDQG OLIHWUDQVLWLRQDUHEHFRPLQJPRUHLPSRUWDQW$QHF-
WKH\ZDQWWKHLUHPSOR\HUVWRRHUSHUVSHFWLYH7KH GRWDOHYLGHQFHVXJJHVWVWKDWPLOOLRQVRI%DE\%RRP-
EXVLQHVVLVVXHRIGLYHUVLW\DQGLQFOXVLRQQRZWRXFK- HUVDUHGHOD\LQJUHWLUHPHQWZKLOHPDQ\0LOOHQQLDOV
HVLVVXHVRIHPSOR\HHHQJDJHPHQWIDLUQHVVKXPDQ DUH DSSURDFKLQJ WKH DJH ZKHQ ERWK VSRXVHV RIWHQ
ULJKWVDQGHYHQVRFLDOMXVWLFH ZRUNDQGWKH\H[SHFWDQGGHPDQGHTXDOWUHDWPHQW
$QG WKH SURVSHFW RI ORQJHU FDUHHUV PHDQV D ZLGHU
6HFRQGWKHQHHGIRUGLYHUVLW\DQGLQFOXVLRQLVQRZ
JHQHUDWLRQDO VSDQ LQ WKH ZRUNIRUFH (RUWV WR DG-
DQLPSRUWDQWFRPSRQHQWDWZRUN0DQ\ODUJHRUJD-
GUHVV VXFK LVVXHV DUH JDLQLQJ JURXQG 2QH UHWDLOHU
QL]DWLRQV QRZ GHQH WKHPVHOYHV DV JOREDO HQWLWLHV
IRUH[DPSOHGHYHORSHGDSURJUDPFDOOHG6QRZELUG
PDNLQJ UHOLJLRXV JHQGHU JHQHUDWLRQDO DQG RWKHU
WRKHOSROGHUZRUNHUVWUDQVIHUWRZDUPHUFOLPDWHVWR
W\SHV RI GLYHUVLW\ D EXVLQHVV UHDOLW\ 3URJUDPV WR
VWD\ ZLWK WKH FRPSDQ\ 0LFKHOLQ OHWV VHQLRU ZKLWH
UDLVH DZDUHQHVV RI XQFRQVFLRXV ELDV DUH LQFUHDV-
FROODU ZRUNHUV VWUHWFK RXW WKHLU FDUHHUV WR UHGXFH
LQJO\SRSXODU
VWUHVV ODWHU LQ OLIH 7KH 86 1DWLRQDO ,QVWLWXWHV RI

A set of new rules is being written that


will demand a new focus on experiential
learning, process change, data-driven tools,
transparency, and accountability.


Rewriting the rules for the digital age

+HDOWK RHUV HPHUJHQF\ HOGHU FDUH DOORZLQJ HP- DOO SHUVRQDO GHWDLOV IURP MRE DSSOLFDWLRQV 6RPH
SOR\HHVWRPRGLI\WKHLUZRUNSDWWHUQVZKHQSDUHQWV FRPSDQLHV ORRN DW SDWWHUQV RI MRE RHUV DQG FRP-
EHFRPHLOO14 SDUHPDQDJHUVDJDLQVWWKHLUSHHUVIRUVLJQVRIJHQ-
GHUUDFLDORUDJHGLVFULPLQDWLRQ
MANY COMPANIES ARE STILL
:HDUHQRWVD\LQJWKDWWUDLQLQJLVQRWLPSRUWDQWLW
NOT SEIZING OPPORTUNITIES SOD\VDYLWDOUROHLQHGXFDWLRQDQGDZDUHQHVVRIWKH
'HVSLWHWKHRYHUDOOLQFUHDVHLQIRFXVRQDQGLQYHVW- LVVXH%XWWKLV\HDUDQGPRYLQJIRUZDUGZHVHHDQ
PHQW LQ GLYHUVLW\ DQG LQFOXVLRQ PDQ\ EXVLQHVVHV DGGLWLRQDOHPSKDVLVRQUHPRYLQJELDVIURPV\VWHPV
PD\EHLQGHQLDODERXWWKHUHDOLW\LQWKHLURZQFRP- DQG SURFHVVHV 7KLV LV ZKDW LW PHDQV WR HPEHG GL-
SDQLHV2XUUHVHDUFKLQWR+5SUDFWLFHVIRXQGWKDW YHUVLW\ LQWR DQ RUJDQL]DWLRQV FXOWXUH UDWKHU WKDQ
ZKLOH DQ RYHUZKHOPLQJ PDMRULW\ RI RUJDQL]DWLRQV PRXQWLQJ D PHUHO\ SURJUDPPDWLF HRUW %\ PHD-
 SHUFHQW  DVSLUH WR KDYH DQ LQFOXVLYH FXOWXUH VXULQJHDFKRILWVWDOHQWSURFHVVHVUHPRYLQJIDFWRUV
LQ WKH IXWXUH WKHLU DFWXDO PDWXULW\ OHYHOV DUH YHU\ WKDWOHDGWRELDVJLYLQJPDQDJHUVDODQJXDJHWRGLV-
ORZ152QO\SHUFHQWKDYHUHDFKHGOHYHOWKHPRVW FXVVELDVDQGKROGLQJWKHPDFFRXQWDEOHRUJDQL]D-
PDWXUHOHYHOLQRXUPRGHO WLRQVFDQPRYHWRZDUGWUXHLQFOXVLYHQHVV19

,Q VRPH FRXQWULHV WKH SUREOHPV DUH HYHQ PRUH 2QHDUHDRIFKDQJHRYHUWKH


SUHVVLQJ,Q-DSDQVXUYH\VVKRZWKDWSHUFHQW SDVW\HDULVWKHLQFUHDVHGIR-
RIZRPHQEHWZHHQWKHDJHVRIDQGZRXOG FXVRQELDVLQUHFUXLWLQJDQG
OLNHWRZRUNEXWDUHXQDEOHWRREWDLQMREV WKH XVH RI QHZ WRROV WR KHOS
FRPSDQLHVUHGXFHELDV7KLV
\HDU  SHUFHQW RI RXU VXU-
COMPANIES MUST UNDERSTAND THE
YH\UHVSRQGHQWVEHOLHYHWKHLU
COMPLEXITY OF THEIR WORKFORCE
RUJDQL]DWLRQV SURYLGH H[FHO-
7KLV \HDUV Global Human Capital Trends re- OHQW WUDLQLQJ DJDLQVW XQFRQ-
VHDUFK VKRZV WKDW  SHUFHQW RI UHVSRQGHQWV VFLRXV ELDV DQG  SHUFHQW
QRZ EHOLHYH GLYHUVLW\ DQG LQFOXVLRQ LV D FRP- PHDVXUH DQG PRQLWRU GLYHU-
SHWLWLYH DGYDQWDJH  SHUFHQW VD\ LW LV D VLJ- VLW\ DQG LQFOXVLRQ LQ UHFUXLW-
QLFDQW FRPSHWLWLYH DGYDQWDJH  <HW GHVSLWH LQJ1HZWRROVIURPYHQGRUV
WKLVLQFUHDVHGOHYHORILQWHUHVWRQO\SHUFHQWRI VXFK DV +LUH9XH 6XFFHVV-
FRPSDQLHVDFWXDOO\WLHFRPSHQVDWLRQWRGLYHUVLW\ )DFWRUV DQG (QWHOR FDQ GL-
RXWFRPHV:K\" UHFWO\ PRQLWRU PDQDJHU KLU-
LQJ SUDFWLFHV LQFOXGLQJ MRE
7KH DQVZHU LV VLPSOH 6ROYLQJ GLYHUVLW\ FKDO- GHVFULSWLRQV DQG LQWHUYLHZ
OHQJHV LV GDXQWLQJO\ GLFXOW 2XU UHVHDUFK DQG VFRULQJ SDWWHUQV WR LGHQWLI\
FRPSDQ\LQWHUYLHZVVKRZWKDWRUJDQL]DWLRQVDUH UDFLDODQGFXOWXUDOELDV
QRZ FRQVLGHULQJ PRYLQJ EH\RQG WUDLQLQJ WR IR-
FXVRQPHDVXUHPHQWWUDQVSDUHQF\DQGSHUVRQDO 2UJDQL]DWLRQV DUH DOVR SD\-
DFFRXQWDELOLW\ $OVR WUHQGLQJ XSZDUG LV D IRFXV LQJ PRUH DWWHQWLRQ WR GLYHU-
RQ HOLPLQDWLQJ PHDVXUDEOH ELDV IURP WDOHQW SUR- VLW\ LQ VXFFHVVLRQ DQG OHDG-
FHVVHVLQFOXGLQJKLULQJSURPRWLRQSHUIRUPDQFH HUVKLS 7RGD\  SHUFHQW RI
PDQDJHPHQW OHDGHUVKLS GHYHORSPHQW VXFFHV- VXUYH\ UHVSRQGHQWV EHOLHYH
VLRQDQGFRPSHQVDWLRQ WKHLU RUJDQL]DWLRQV DUH DGHTXDWH RU H[FHOOHQW DW
LGHQWLI\LQJDQGSURPRWLQJGLYHUVHOHDGHUVWKURXJK-
)RULQVWDQFHRUJDQL]DWLRQVDUHH[SHULPHQWLQJZLWK RXW WKH RUJDQL]DWLRQ ,QYHVWPHQW LQ WKLV DUHD LV LQ-
HOLPLQDWLQJQDPHVRQUHVXPHVEHFDXVHFDQGLGDWHV FUHDVLQJ EXW PRUH ZRUN UHPDLQV WR EH GRQH 7KH
ZLWKHWKQLFVRXQGLQJQDPHVPD\H[SHULHQFHORZHU SHRSOHRUJDQL]DWLRQVGHVLUHDUHRXWWKHUHLIDQRUJD-
KLULQJUDWHV$XVWUDOLDKDVEHHQDOHDGHULQWKLVDUHD QL]DWLRQGRHVQRWKDYHGLYHUVHOHDGHUVLWUDLVHVWKH
WKHVWDWHRI9LFWRULDLVH[SHULPHQWLQJZLWKUHPRYLQJ TXHVWLRQRIZK\


2017 Deloitte Global Human Capital Trends

WLYHDLPHGDWUDLVLQJDZDUHQHVVDQGGLVUXSWLQJELDV
GXULQJWKHUHFUXLWPHQWDQGSHUIRUPDQFHSURFHVVHV
We identify LQ DQ HRUW WR HQDEOH PRUH REMHFWLYH WDOHQW GHFL-

commitment, courage,
VLRQVDQGEHWWHUGLYHUVLW\RXWFRPHV7KHFRPSDQ\
KDGODXQFKHGSUHYLRXVHRUWVWRUDLVHDZDUHQHVVRI

cognizance of bias, ELDVEXWLWZDQWHGWRGHHSHQLWVFRPPLWPHQWE\DF-


WLYHO\DGGUHVVLQJSUDFWLFHVVXFKDVUHFUXLWLQJ
curiosity, cultural 7KHLQLWLDWLYHLQYROYHGIRXUNH\DFWLYLWLHV,WEHJDQ
intelligence, and ZLWK D UHYLHZ WKDW PDSSHG WKH PDMRU VWHSV LQ WKH
UHFUXLWPHQW DQG SURPRWLRQ SURFHVVHV HVSHFLDOO\
collaboration as DUHDVRIKLJKPDQDJHULDOGLVFUHWLRQ7KHUHYLHZDOVR

the six traits of an LGHQWLHGWKHVSHFLFSURFHGXUHVDQGV\VWHPVWKDW


FRXOGLQXHQFHWKHLPSDFWRIELDV)RULQVWDQFHLI
inclusive leader. LQWHUYLHZLQJGHFLVLRQVZHUHPDGHDWWKHHQGRIWKH
GD\ZKHQPDQDJHUVZHUHWLUHGDQGUXVKHGWKHSR-
WHQWLDOIRUVLPLODULW\DWWUDFWLRQELDVFRXOGEHDPSOL-
HGEHFDXVHELDVHVDUHPDJQLHGZLWKWLUHGQHVV
THE ROLE OF LEADERSHIP 6HFRQGWKHLQLWLDWLYHUHGHVLJQHGQHZWLSVDQGSUDF-
WLFHV WR QXGJH PDQDJHUV WRZDUG PHULWRFUDWLF GHFL-
:H EHOLHYH LVVXHV DURXQG GLYHUVLW\ DQG LQFOXVLRQ
VLRQVWRHOLPLQDWHDUHDVZKHUHELDVFRXOGEHSUHVHQW
DUH FKDOOHQJHV WKDW DOO OHDGHUV VKRXOG DGGUHVV :H
ZKLOH WDNLQJ FDUH WR PDNH WKH QHZ SUDFWLFHV ERWK
LGHQWLI\ FRPPLWPHQW FRXUDJH FRJQL]DQFH RI ELDV
SUDFWLFDODQGUHOHYDQWWRWKHEXVLQHVV
FXULRVLW\ FXOWXUDO LQWHOOLJHQFH DQG FROODERUDWLRQ
DVWKHVL[WUDLWVRIDQLQFOXVLYHOHDGHU:HHQFRXU- 7KHQHZSUDFWLFHVZHUHFRPPXQLFDWHGWRPDQDJHUV
DJHFRPSDQLHVWRLQFOXGHWKHVHFDSDELOLWLHVLQWKHLU DQG WHDPV ZHUH HQFRXUDJHG WR GLVFXVV ZD\V WR UH-
OHDGHUVKLSDVVHVVPHQWDQGOHDGHUVKLSGHYHORSPHQW GXFHELDVLQUHFUXLWPHQWDQGSHUIRUPDQFHUHYLHZV
SURFHGXUHV )LQDOO\ WKH HRUW GHYHORSHG PXOWLSOH PHDVXUHV RI
VXFFHVVDQGZD\VWRWUDFNSURJUHVVIRUODWHUUHYLHZ
)RUGLYHUVLW\DQGLQFOXVLRQWREHFRPHHPEHGGHGLQ
2QHNH\PHDVXUHRIVXFFHVVZDVWKHLPSDFWRQHP-
WKHRUJDQL]DWLRQOHDGHUVVKRXOGSXUVXHFKDQJHVLQ
SOR\HHVSHUFHSWLRQVRILQFOXVLRQDQGWKHLUYRLFHDW
SURFHVVHVDQGV\VWHPV2UJDQL]DWLRQVVKRXOGWUDQV-
ZRUN%RWKRIWKHVHPHDVXUHVVDZDQXQSUHFHGHQW-
SDUHQWO\ PHDVXUH GLYHUVLW\ DQG PDQDJHUV VKRXOG
HG \HDURYHU\HDU LQFUHDVH ZLWK D  SHUFHQWDJH
EH KHOG DFFRXQWDEOH IRU RXWFRPHV DV ZHOO DV WKHLU
SRLQWLQFUHDVHRQSHUFHSWLRQVRILQFOXVLRQDQGD
RZQ EHKDYLRU 2UJDQL]DWLRQV ZRXOG DOVR EHQHW
SHUFHQWDJHSRLQWLQFUHDVHRQHPSOR\HHVSHUFHSWLRQ
IURP H[SDQGLQJ WKH GHQLWLRQ RI GLYHUVLW\ EH\RQG
RIWKHLUYRLFHDWZRUN
GHPRJUDSKLFDQGVRFLDOLGHQWLWLHV5HVHDUFKVKRZV
WKDWRQHRIWKHELJJHVWVRXUFHVRIELDVDWFRPSDQLHV 7UDLQLQJ IRFXVHG QRW RQO\ RQ LGHQWLI\LQJ SRWHQWLDO
LV D ODFN RI GLYHUVLW\ RI WKRXJKW /HDGHUV DQG PDQ- DUHDVIRUELDVEXWDOVRRQWHDFKLQJPDQDJHUVWROHDG
DJHUV FDQ EHQHW E\ OLVWHQLQJ WR SHRSOH ZKR WKLQN FRQYHUVDWLRQV WR FRGHYHORS VROXWLRQV ZLWK VWD
GLHUHQWO\ EHFDXVH WKH\ RIWHQ EULQJ VRPH RI WKH 0DQDJHUV OHDUQHG DERXW GLHUHQW W\SHV RI ELDVHV
WHDPVPRVWLQQRYDWLYHLGHDV DQGZKHUHWKH\FRXOGVKRZXS7UDLQLQJPDWHULDOV
DQG WRROV LQFOXGHG HOHDUQLQJ PRGXOHV DQ RQOLQH

Lessons from the front lines KXE DQG RQHSDJH KDQGRXWV FRQFLVHO\ FRQYH\LQJ
NH\SRLQWV7KHWUDLQLQJDQGVXSSRUWPDWHULDOVDUH
5HFRJQL]LQJ WKH PDQ\ EXVLQHVV LPSDFWV RI XQFRQ- KDYLQJ D SRVLWLYH LPSDFW JHQHUDWLQJ KLJK OHYHOV RI
VFLRXV ELDV %02 )LQDQFLDO *URXS D WRS 1RUWK DGRSWLRQIRUWKHQHZSURFHVVHVDQGSUDFWLFHVZLWK
$PHULFDQEDQNKDVSLRQHHUHGDQHZDSSURDFKWRGL-  SHUFHQW RI SHRSOH PDQDJHUV DQG RQHWKLUG RI
YHUVLW\DQGLQFOXVLRQ,WKDVLPSOHPHQWHGDQLQLWLD- DOOHPSOR\HHVYROXQWDULO\FRPSOHWLQJWKHHOHDUQLQJ


Rewriting the rules for the digital age

PRGXOHZLWKLQWKHUVWPRQWKVRIODXQFKLQJWKHLQL- DQG  ZRPHQV UHSUHVHQWDWLRQ DPRQJ 3 *


WLDWLYH7KHRUJDQL]DWLRQKDVDOVRVHHQDPHDVXUDEOH PDQDJHUVJUHZIURPWRSHUFHQWLQFOXGLQJ
LPSDFWRQKLULQJUDWHVRIGLYHUVHFDQGLGDWHVZKLFK SHUFHQWDWDQGDERYHDWWKH93OHYHO
KDVLQFUHDVHGRYHUSHUFHQWLQWKHSDVW\HDU21
%H\RQGJHQGHUGLYHUVLW\WKHFRPSDQ\KDVWDNHQD
/OR\GV%DQNLQJ*URXSDOHDGLQJ8.EDVHGEDQNLV OHDGHUVKLS SRVLWLRQ LQ VXSSRUWLQJ HPSOR\HHV ZLWK
DQRWKHU H[DPSOH RI D FRPSDQ\ WKDW WDNHV DQ LQQR- GLVDELOLWLHV $ UHYHUVH PHQWRULQJ SURJUDP HQDEOHV
YDWLYHDSSURDFKWRGLYHUVLW\DQGLQFOXVLRQHPEDUN- VHQLRUVWDWRXQGHUVWDQGWKHGDLO\FKDOOHQJHVVRPH
LQJRQDPXOWLIDFHWHGHRUWWRHPEHGGLYHUVLW\DQG RIWKHLUFROOHDJXHVIDFHDQGKRZWRFUHDWHDQLQFOX-
LQFOXVLRQ ZLWKLQ LWV FXOWXUH 7KH JURXS UHFRJQL]HG VLYHZRUNSODFHZKHUHDOOKDYHWKHDELOLW\WRFRQWULE-
WKDW SXWWLQJ LQFOXVLYH EHKDYLRUV DW WKH FRUH RI LWV XWH)XQGLQJIRUDFFRPPRGDWLRQVLVQRZDOORFDWHG
RSHUDWLRQV DQG PDNLQJ JHQGHU HTXDOLW\ D SULRULW\ WRDFHQWUDOEXGJHWWRHQVXUHWKDWDOO3 *IDFLOLWLHV
EHQHWHGQRWRQO\WKHZRPHQWKH\HPSOR\EXWDOVR ZRUOGZLGHKDYHWKHUHVRXUFHVQHHGHGWRDFFRPPR-
WKHRUJDQL]DWLRQDVDZKROHDQGWKHFOLHQWVFXVWRP- GDWHDOOZRUNHUV29
HUVDQGFRPPXQLWLHVWKH\VHUYH/HDGHUVVHWDFOHDU
7R LQFUHDVH DFFRXQWDELOLW\ DW DOO OHYHOV 3 * LQVWL-
WUDQVSDUHQW WDUJHW %\   SHUFHQW RI VHQLRU
WXWHG D QHZ FRPSHQVDWLRQ V\VWHP WKDW UHLQIRUFHV
UROHV ZHUH WR EH RFFXSLHG E\ ZRPHQ22 5HFUXLWLQJ
LWVFRPPLWPHQWWRGLYHUVLW\DQGLQFOXVLRQ7HQSHU-
SURJUDPV ZHUH FKDQJHG WR DOLJQ ZLWK WKLV JRDO LQ-
FHQWRIH[HFXWLYHFRPSHQVDWLRQLVOLQNHGWRGLYHUVLW\
FOXGLQJ D UHTXLUHPHQW WKDW WKH VKRUWOLVW IRU HYHU\
JRDOV ZKLFK DUH HYDOXDWHG DV SDUW RI SHUIRUPDQFH
VHQLRU UROH PXVW LQFOXGH D TXDOLHG IHPDOH FDQGL-
UHYLHZV&ULWHULDLQFOXGHEHLQJDQH[HFXWLYHVSRQ-
GDWHRUDFRQYLQFLQJH[SODQDWLRQIRUWKHDEVHQFH
VRU RI DQ HPSOR\HH UHVRXUFH JURXS EHLQJ D FURVV
7KLV FRPPLWPHQW WR GLYHUVLW\ LV GHOLYHULQJ UHVXOWV FXOWXUDO PHQWRU DQG UHFUXLWPHQW DQG SURPRWLRQV
,Q   SHUFHQW RI H[WHUQDO KLUHV LQWR VHQLRU LQ WKH H[HFXWLYHV DUHD RI UHVSRQVLELOLW\ $GGLWLRQ-
PDQDJHPHQW ZHUH ZRPHQ FRPSDUHG ZLWK  SHU- DOO\WKHVWRFNRSWLRQDZDUGVIRUWKHFRPSDQ\VWRS
FHQWLQ237KHSURSRUWLRQRIZRPHQSURPRWHG RFHUVDUHOLQNHGWRGLYHUVLW\UHVXOWV31
LQWR VHQLRU UROHV LQFUHDVHG IURP  SHUFHQW WR 
)RU WKHVH DQG RWKHU LQLWLDWLYHV LQ  'LYHUVLW\-
SHUFHQW24HDUQLQJWKHJURXSUHFRJQLWLRQDPRQJWKH
,QF UDQNHG 3 * VHFRQG DPRQJ WKH WRS  FRPSD-
TimesWRSHPSOR\HUVIRUZRPHQ25
QLHVIRUSHRSOHZLWKGLVDELOLWLHVVHYHQWKDPRQJLWV
7R SXVK GLYHUVLW\ DQG LQFOXVLRQ GHHSHU LQWR WKH WRS  FRPSDQLHV IRU GLYHUVLW\ RYHUDOO DQG HLJKWK
FRPSDQ\V FXOWXUH DOO OLQH PDQDJHUV UHFHLYHG VSH- IRUJOREDOGLYHUVLW\32'LYHUVLW\,QFFUHGLWHG3 *IRU
FLDOL]HG WUDLQLQJ LQ  7R DVVLVW ZLWK WKHVH DQG KLJKO\ YDOXLQJ HDFK HPSOR\HHV XQLTXH FRQWULEX-
RWKHU LQLWLDWLYHV D PHPEHU RI WKH JURXS H[HFXWLYH WLRQVDQGIRUWKHUHSUHVHQWDWLRQRIZRPHQ$IULFDQ
FRPPLWWHHDFWVDVERWKH[HFXWLYHVSRQVRUIRUGLYHU- $PHULFDQV /DWLQRV DQG $VLDQ$PHULFDQV DPRQJ
VLW\ DQG LQFOXVLRQ DQG H[HFXWLYH VSRQVRU IRU JHQ- PDQDJHPHQWDWUDWHVKLJKHUWKDQWKH86DYHUDJH
GHU

3 *KDVDOVREHFRPHDOHDGHULQWKLVDUHDE\LQFRU- Start here


SRUDWLQJ D FRPPLWPHQW WR GLYHUVLW\ DQG LQFOXVLRQ
GHHSO\ZLWKLQLWVFXOWXUH2YHUWKHSDVWVHYHQ\HDUV Ensure that top leadership understands
WKH FRPSDQ\ KDV VSHQW  ELOOLRQ DQQXDOO\ WR VXS- the importance of diversity:6KDUHUHVHDUFK
SRUWLWVVXSSOLHUGLYHUVLW\SURJUDPEXLOGLQJDEURDG RQ WKH YDOXH RI LQFOXVLRQ WR EXLOG FRQVHQVXV DW
DQG GLYHUVH VXSSOLHU EDVH WKDW LQFOXGHV RYHU  WKHRUJDQL]DWLRQVKLJKHVWOHYHOV7KHQKROGWRS
ZRPHQDQGPLQRULW\RZQHGVXSSOLHUV OHDGHUV DFFRXQWDEOH WKURXJK PHWULFV DQG WUDQV-
SDUHQWUHSRUWVRQGLYHUVLW\LQSURPRWLRQKLULQJ
7KH FRPSDQ\ DOVR IRFXVHV RQ DGYDQFLQJ ZRPHQ DQGFRPSHQVDWLRQ
OHDGHUV WKURXJK D FRPSUHKHQVLYH OHDGHUVKLS GH-
YHORSPHQW VWUDWHJ\ IHDWXULQJ VWURQJ PHQWRUVKLS Use technology and data to identify prob-
DQGVSRQVRUVKLSDVZHOODVVLWHDQGUHJLRQVSHFLF lems and measure progress: $QDO\WLFV FDQ
SURJUDPV$VDUHVXOWRIWKHVHHRUWVEHWZHHQ QRZ KHOS LQ LGHQWLI\LQJ SDWWHUQV RI JHQGHU DQG


2017 Deloitte Global Human Capital Trends

UDFLDO ELDV GLVSDULWLHV LQ FRPSHQVDWLRQ DQG UH- &RQVLGHU JOREDO GLHUHQFHV *HRJUDSKLF
ZDUGVDQGELDVLQKLULQJDQGSURPRWLRQ7RROV GLYHUVLW\LVLQFUHDVLQJO\LPSRUWDQWDVPRUHRUJD-
WR DQRQ\PL]H UHVXPHV DQG KHOS WUDLQLQJ PDQ- QL]DWLRQVEHFRPHJOREDO7KHVSHFLFFKDOOHQJHV
DJHUV UHPRYH ELDV VKRXOG EHFRPH SDUW RI WKH IRUGLYHUVLW\DQGLQFOXVLRQZLOOOLNHO\YDU\ZLGHO\
GLYHUVLW\HRUW IURPUHJLRQWRUHJLRQDQGHPSOR\HHVLQWHUHVWV
DQGFRQFHUQVLQGLHUHQWUHJLRQVZLOOOLNHO\GLI-
Move beyond HR: &RQVLGHU GLYHUVLW\ DQG LQ-
IHUDVZHOO
FOXVLRQ DV SDUW RI WKH FRUSRUDWH LQIUDVWUXFWXUH
MXVW OLNH FRPSOLDQFH ,7 DQG VHFXULW\ LW PXVW
EHSUDFWLFHGE\HYHU\RQHDQGRZQHGE\DOOOLQH
OHDGHUV'LYHUVLW\DQGLQFOXVLRQLVDEXVLQHVVUH-
VSRQVLELOLW\QRWDQ+5UHVSRQVLELOLW\

FAST FORWARD
Old models of diversity and inclusion are undergoing change, and this trend is
expected to accelerate. As employee demands shift and diversity receives greater
DWWHQWLRQJOREDOO\WKHSULYDWHVHFWRUVUHVSRQVLELOLWLHVZLOOFRQWLQXHWRJURZ$VWKH
large Baby Boomer population ages, the need to broaden the focus on diversity
and inclusion to account for the elderly in the workplace will increase. In inclusive
organizations, the way people operate will shift, and the everyday language of the
business will change.


Rewriting the rules for the digital age

)LJXUH'LYHUVLW\DQGLQFOXVLRQ2OGUXOHVYVQHZUXOHV

Old rules New rules

Diversity and inclusion is a CEO-level priority and


Diversity is considered a reporting goal driven by
considered important throughout all levels of
compliance and brand priorities
management

Work-life balance is considered a challenge for


Work-life balance, family, and individual wellness are
employees to manage, with some support from the
all considered part of the total employee experience
organization

Companies measure diversity through the Companies measure inclusion, diversity, and lack of
GHPRJUDSKLFSUROHRIGHVLJQDWHGJURXSVGHQHGE\ bias in all recruitment, promotion, pay, and other
attributes such as gender, race, nationality, or age talent practices

'LYHUVLW\LVGHQHGLQDEURDGHUFRQWH[WLQFOXGLQJ
'LYHUVLW\LVGHQHGE\JHQGHUUDFHDQG
concepts of diversity of thought, also addressing
GHPRJUDSKLFGLHUHQFHV
SHRSOHZLWKDXWLVPDQGRWKHUFRJQLWLYHGLHUHQFHV

Merit is unpacked to identify built-in biases; leaders


Leaders are promoted on merit and experience
are promoted on their ability to lead inclusively

Diversity and inclusion goes beyond education to


Diversity and inclusion is a program of education,
focus on debiasing business processes and holding
training, and discussion
leaders accountable for inclusive behavior

Companies hold managers accountable for creating


Companies regularly report progress on diversity
an inclusive culture, using metrics to compare them
measures
against each other

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


2017 Deloitte Global Human Capital Trends

ENDNOTES

1. Bonnie Marcus, The lack of diversity in tech is a cultural issue, Forbes, August 12, 2015, http://www.forbes.com/
VLWHVERQQLHPDUFXVWKHODFNRIGLYHUVLW\LQWHFKLVDFXOWXUDOLVVXHF

2. Deloitte Touche Tohmatsu Limited, %LJ GHPDQGV DQG KLJK H[SHFWDWLRQV 7KH 'HORLWWH 0LOOHQQLDO 6XUYH\ ([HFXWLYH
summary, January 2014, http://www2.deloitte.com/content/dam/Deloitte/global/Documents/About-Deloitte/gx-
dttl-2014-millennial-survey-report.pdf.

3. M. Christie Smith and Stephanie Turner, 7KHUDGLFDOWUDQVIRUPDWLRQRIGLYHUVLW\DQGLQFOXVLRQ7KH0LOOHQQLDOLQX-


ence, Deloitte, 2015, http://www2.deloitte.com/us/en/pages/about-deloitte/articles/radical-transformation-of-
diversity-and-inclusion.html, accessed October 12, 2016.

4. -RVK %HUVLQ 7LDQ\ 0F'RZHOO $PLU 5DKQHPD DQG <YHV YDQ 'XUPH 7KH RUJDQL]DWLRQ RI WKH IXWXUH $UULYLQJ
now, Global Human Capital Trends 2017: Rewriting the rules for the digital age, Deloitte University Press, 2017,
https://dupress.deloitte.com/dup-us-en/focus/human-capital-trends.html.

5. Juliet Bourke, :KLFK7ZR+HDGV$UH%HWWHUWKDQ2QH"+RZ'LYHUVH7HDPV&UHDWH%UHDNWKURXJKGHDVDQG0DNH6PDUWHU


Decisions (Australian Institute of Company Directors, 2016); David Rock and Heidi Grant, Why diverse teams are
smarter, Harvard Business Review, November 4, 2015, https://hbr.org/2016/11/why-diverse-teams-are-smarter,
accessed December 21, 2016; Stacia Sherman Garr, Candace Atamanik, and David Mallon, High-impact talent
management: The new talent management maturity model, Bersin by Deloitte, 2015, http://marketing.bersin.com/
high-impact-talent-management.html, accessed December 21, 2016.

6. Bernadette Dillon and Juliet Bourke, Waiter, is that inclusion in my soup? A new recipe to improve business perfor-
mance, Deloitte, May 2013, https://www2.deloitte.com/content/dam/Deloitte/au/Documents/human-capital/de-
loitte-au-hc-diversity-inclusion-soup-0513.pdf, accessed December 21, 2016; Natasha Doherty and Juliet Bourke,
Toward gender parity: Women on Boards Initiative, Deloitte Access Economics, 2016, https://www2.deloitte.com/
content/dam/Deloitte/au/Documents/Economics/deloitte-au-toward-gender-parity-women-on-boards-initia-
tive-041016.pdf, accessed December 21, 2016.

7. -DQH 3RUWHU <RXUH PRUH ELDVHG WKDQ \RX WKLQN Fast Company, October 6, 2014, https://www.fastcompany.
com/3036627/strong-female-lead/youre-more-biased-than-you-think, accessed December 21, 2016.

 Stacia Sherman Garr, The diversity and inclusion primer: An introduction, Bersin by Deloitte, 2014.

9. Bourke, :KLFK7ZR+HDGV$UH%HWWHUWKDQ2QH"; Garr, Atamanik, and Mallon, High-impact talent management.

10. Garr, Atamanik, and Mallon, High-impact talent management.

11. $GDP)ULVN%HFDXVHLWV7UXGHDXVJHQGHUHTXDOFDELQHWPDNHVKHDGOLQHVDURXQGZRUOGVRFLDOPHGLD
Global News, November 5, 2015, http://globalnews.ca/news/2320795/because-its-2015-trudeaus-gender-equal-
cabinet-makes-headlines-around-world-social-media/, accessed December 21, 2016.

12. Alexander K. Song, Dodd-Frank and executive compensationpart 1: Status update, National Law Review, April
KWWSZZZQDWODZUHYLHZFRPDUWLFOHGRGGIUDQNDQGH[HFXWLYHFRPSHQVDWLRQSDUWVWDWXVXSGDWH

13. Cindy Robbins, Equality at Salesforce: The equal pay assessment update, Salesforce Blog0D\KWWSV
www.salesforce.com/blog/2016/03/equality-at-salesforce-equal-pay.html, accessed December 21, 2016.

14. Steven Greenhouse, The age premium: Retaining older workers, New York Times, May 14, 2014, http://www.
nytimes.com/2014/05/15/business/retirementspecial/the-age-premium-retaining-older-workers.html, accessed
December 21, 2016.


Rewriting the rules for the digital age

15. Stacia Sherman Garr, The diversity and inclusion benchmarking report, Bersin by Deloitte, March 2014.

16. Stacia Sherman Garr and Candace Atamanik, High-impact diversity and inclusion, Bersin by Deloitte, forthcoming,
April 2017.

17. Catalyst, Statistical overview of women in the workforce, April 6, 2016, http://www.catalyst.org/knowledge/
statistical-overview-women-workforce.

 Miki Perkins, Victorian government trials blind job applications to overcome hiring bias, Age, May 20, 2016,
http://www.theage.com.au/victoria/victorian-government-trials-blind-job-applications-to-overcome-hiring-bias-
JR]SIKWPODFFHVVHG2FWREHU

19. Matthew Lieberman et al., Breaking bias: The SEEDS model, NeuroLeadership Journal, November 2015, https://
neuroleadership.com/portfolio-items/breaking-bias-updated-the-seeds-model-2/, accessed December 21, 2016.

20. Bernadette Dillon and Juliet Bourke, 7KHVL[VLJQDWXUHWUDLWVRILQFOXVLYHOHDGHUVKLS7KULYLQJLQDGLYHUVHQHZZRUOG,


Deloitte University Press, April 14, 2016, https://dupress.deloitte.com/dup-us-en/topics/talent/six-signature-
traits-of-inclusive-leadership.html, accessed December 21, 2016.

21. 6RQ\D.XQNHO LQFOXVLRQRFHUYLFHSUHVLGHQWSHRSOHVWUDWHJLHVDQGLQVLJKWV%02)LQDQFLDO*URXS LQFRQYHUVD-


tion with Juliet Bourke, January 2017.

22. *RYHUQPHQW(TXDOLWLHV2FH7KLQNDFWUHSRUW/OR\GV%DQNLQJ*URXSKWWSVZZZJRYXNJRYHUQPHQWFDVH
studies/think-act-report-lloyds-banking-group, November 4, 2014.

23. Virgin Money, (PSRZHULQJSURGXFWLYLW\+DUQHVVLQJWKHWDOHQWVRIZRPHQLQQDQFLDOVHUYLFHV, March 2016, http://


uk.virginmoney.com/virgin/assets/pdf/Virgin-Money-Empowering-Productivity-Report.pdf.

24. Ibid.

25. *RYHUQPHQW(TXDOLWLHV2FH7KLQNDFWUHSRUW

26. Virgin Money, Empowering productivity.

27. P&G, 2015 diversity & inclusion annual report: Enabling a culture of innovation & productivity, http://cdn.pg.com/-/
media/PGCOMUS/Documents/PDF/Who_We_Are/DiversityandInclusion/PG_DiversityInclusion_AR_2012%20pdf.
pdf?la=en-US&v=1-201506230605.

 Catalyst, Disrupt the default: Catalyst Awards Conference, March 26, 2015, https://www.google.co.uk/url?sa=t&r-
FW M T HVUF V VRXUFH ZHE FG  FDG UMD XDFW  YHG DK8.(ZMQV+TOF5$K:/.V$.+6G[%=<4)JJK
MAE&url=http%3A%2F%2Fwww.catalyst.org%2Fuploads%2F2015_catalyst_awards_conference_program-1.
pdf&usg=AFQjCNEcPhISCHjaihIvkWo_zbpeZN2DSQ&bvm=bv.144224172,d.bGs.

29. P&G, 2015 diversity & inclusion annual report.

30. %DUUHWW-%UXQVPDQ+HUHVZKHUH3 *UDQNVIRUZRUNSODFHGLYHUVLW\Cincinnati Business Courier$SULO


KWWSZZZEL]MRXUQDOVFRPFLQFLQQDWLQHZVKHUHVZKHUHSJUDQNVIRUZRUNSODFHGLYHUVLW\KWPO

31. P&G, 2010 global sustainability report, June 30, 2010, http://cdn.pgcom.pgsitecore.com/en-gb/-/media/PG-
COMUK/Documents/PDF/Sustanability_PDF/sustainability_reports/PG2010SustainabilityReport%20pdf.
pdf?la=en-GB&v=1-201601061549.

32. P&G, 2015 diversity & inclusion annual report.


2017 Deloitte Global Human Capital Trends

AUTHORS

Juliet Bourke, Deloitte Touche Tohmatsu | julietbourke@deloitte.com.au

Juliet Bourke leads Deloitte Australias Diversity and Inclusion consulting practice and co-leads
its Leadership practice. She has over 25 years experience in human capital, management,
and law. Her latest book, Which Two Heads Are Better than One?, focuses on diversity of
WKLQNLQJDQGFROOHFWLYHLQWHOOLJHQFH6KHLVDPHPEHURIWKH$XVWUDOLDQUPVGLYHUVLW\FRXQFLO
and sits on a number of boards and award panels. Bourke has also keynoted at hundreds of
JOREDOFRQIHUHQFHVLQFOXGLQJ7('[

Stacia Sherman Garr, Bersin by Deloitte, Deloitte Consulting LLP


sgarr@deloitte.com

Stacia Sherman Garr is responsible for research on human resources, talent strategy,
integrated talent management, performance management, career management, diversity
and inclusion, employee recognition, competencies, and workforce planning. Garr holds an
MBA from the University of California, Berkeley, a masters degree from the London School
RI(FRQRPLFVDQGEDFKHORUVGHJUHHVLQKLVWRU\DQGSROLWLFDOVFLHQFHIURP5DQGROSK0DFRQ
Womans College.

Ardie van Berkel, Deloitte Consulting BV | avanberkel@deloitte.nl

$UGLHYDQ%HUNHOLVWKH+XPDQ&DSLWDOSUDFWLFHOHDGHUIRUWKH(XURSH0LGGOH(DVWDQG
$IULFD (0($ UHJLRQ6KHKDVOHGPDQ\LQLWLDWLYHVWRVWUHQJWKHQ'HORLWWHVSRVLWLRQDVWKH
leading human capital practice in the market, and her team has contributed to numerous
(0($DQGJOREDOLQLWLDWLYHV9DQ%HUNHOLVDPHPEHURIWKHVXSHUYLVRU\ERDUGRI'HORLWWH
1RUWK:HVW(XURSHDQGDQDFWLYHPDUNHWIDFLQJFOLHQWSDUWQHU6KHFRQVXOWVRQPHUJHU
integrations, organizational design, HR strategies, and change management to support major
transformation programs, primarily in the public sector.

Jungle Wong, Deloitte Consulting (Shanghai) Co. Ltd, Beijing Branch


junglewong@deloitte.com.cn

-XQJOH:RQJOHDGV'HORLWWHV+XPDQ&DSLWDOSUDFWLFHLQ*UHDWHU&KLQDDQGWKH$VLD3DFLF
region. He has extensive experience working with multinational enterprises located in China,
as well as state-owned enterprises, on solving talent and HR issues. He is a frequent speaker
at HR conferences and an assessor for the Chinese Business Leaders Awards. Wong is a
regular writer for HR magazines in China.

CONTRIBUTORS
Candace Atamanik, Carolyn Lawrence


Rewriting the rules for the digital age
2017 Deloitte Global Human Capital Trends

The future of work


The augmented workforce

Driven by the acceleration of connectivity and cognitive technology, the nature of


work is changing. As AI systems, robotics, and cognitive tools grow in sophistication,
almost every job is being reinvented, creating what many call the augmented work-
force. As this trend gathers speed, organizations must reconsider how they design
jobs, organize work, and plan for future growth.

This year, 41 percent of companies reported they have fully implemented or


KDYHPDGHVLJQLFDQWSURJUHVVLQDGRSWLQJFRJQLWLYHDQG$WHFKQRORJLHVZLWKLQ
their workforce.

Another 34 percent of survey respondents are in the midst of pilot programs.

But only 17 percent of global executives report they are ready to manage a work-
force with people, robots, and AI working side by sidethe lowest readiness level
IRUDWUHQGLQWKHYH\HDUVRIWKH*OREDO+XPDQ&DSLWDO7UHQGVVXUYH\

F
OR WKH SDVW VHYHUDO \HDUV ZH KDYH FKURQLFOHG WKHQHDUIXWXUH2UJDQL]DWLRQVDUHUHGHVLJQLQJMREV
WKHDUULYDORIZKDWLVQRZFDOOHGWKHIXWXUHRI WR WDNH DGYDQWDJH RI FRJQLWLYH V\VWHPV DQG URERWV
ZRUN ,Q  ZH LGHQWLHG 7KH RSHQ WDO- DQGZHVHHDQRSSRUWXQLW\WRUHWKLQNZRUNDURXQG
HQWHFRQRP\DVDWUHQGDQGGLVFXVVHGWKHJURZWK VRPHWKLQJZHFDOOHVVHQWLDOKXPDQVNLOOV4,Q
RI REDODQFH VKHHW HPSOR\PHQW WDOHQW SODWIRUPV DQG EH\RQG RUJDQL]DWLRQV VKRXOG H[SHULPHQW DQG
DQG FURZGVRXUFLQJ1 ,Q  ZH KLJKOLJKWHG WKH LPSOHPHQWFRJQLWLYHWRROVIRFXVKHDYLO\RQUHWUDLQ-
WUHQG RI 0DFKLQHV DV WDOHQW &ROODERUDWLRQ QRW LQJSHRSOHWRXVHWKHVHWRROVDQGUHWKLQNWKHUROHRI
FRPSHWLWLRQ DQG WKH LQFUHDVLQJ SRZHU RI URERW- SHRSOHDVPRUHDQGPRUHZRUNEHFRPHVDXWRPDWHG
LFV DQG FRJQLWLYH FRPSXWLQJ WR UHVWUXFWXUH MREV2
)LQDOO\ ODVW \HDU ZH SXEOLVKHG 7KH JLJ HFRQRP\ RETHINKING WORK FOR THE
'LVWUDFWLRQ RU GLVUXSWLRQ" ZKLFK GLVFXVVHG WKH AUGMENTED WORKFORCE
EHQHWV DQG FKDOOHQJHV RI PDQDJLQJ WDOHQW LQ WKH
VKDULQJDQGFROODERUDWLYHHFRQRP\3 7KHTXHVWLRQRIKRZHDFKMREZLOOFKDQJHDGDSWRU
GLVDSSHDU KDV EHFRPH D GHVLJQ GHFLVLRQ :KDW DV-
,QWKHVHFKDQJHVKDYHFRPHLQWRIRFXVDQGWKH SHFWV RI ZRUN GR \RX UHSODFH ZLWK DXWRPDWHG PD-
LVVXHKDVEHFRPHPRUHXUJHQW$XWRPDWLRQFRJQL- FKLQHV" 'R \RX ZDQW WR DXJPHQW ZRUNHUV ZLWK
WLYH FRPSXWLQJ DQG FURZGV DUH SDUDGLJPVKLIWLQJ PDFKLQHVWKDWPDNHZRUNHDVLHUDQGPRUHVFDODEOH"
IRUFHV WKDW ZLOO UHVKDSH WKH ZRUNIRUFH QRZ DQG LQ :KDW ZLOO EH WKH LPSDFW RI $, DQG URERWLFV RQ WKH


Rewriting the rules for the digital age

FXVWRPHU H[SHULHQFH VHUYLFH TXDOLW\ DQG EUDQG" ORQJWHUPFRQVHTXHQFHVRIWKHVHGHFLVLRQVIRUWKHLU


6KRXOG \RXU RUJDQL]DWLRQ ZDLW IRU FRPSHWLWRUV WR RUJDQL]DWLRQZRUNDQGZRUNIRUFH"
IXOO\YDOLGDWH$,DQGURERWLFV"
2XUUHVHDUFKDQGGLVFXVVLRQZLWKFOLHQWVVKRZWKDW
7RGD\WKHUHLVDQHZIRFXVRQWKHSHRSOHDVSHFWVRI ZKHQ GRQH FDUHIXOO\ DXWRPDWLRQ DQG WKH XVH RI
ZRUN2XUUHVHDUFKEDVHGRQVWXGLHVIURP2[IRUG FURZGVRXUFLQJ  FDQ KDYH D WUHPHQGRXV SRVLWLYH
8QLYHUVLW\DQGWKH2 1HWMREGDWDEDVHVKRZVWKDW LPSDFWRQSURGXFWLYLW\HPSOR\HHHQJDJHPHQWDQG
ZKLOHWDVNVDUHEHLQJDXWRPDWHGWKHHVVHQWLDOO\KX- FXVWRPHU YDOXH $PD]RQFRP IRU H[DPSOH KDV HI-
PDQSDUWVRIZRUNDUHEHFRPLQJmoreLPSRUWDQW5 IHFWLYHO\XVHGDXWRPDWLRQWRVFDOHZDUHKRXVLQJDQG
6NLOOVVXFKDVHPSDWK\FRPPXQLFDWLRQSHUVXDVLRQ VKLSSLQJ UDSLGO\ GXULQJ KROLGD\ VHDVRQV ZKLOH UH-
SHUVRQDOVHUYLFHSUREOHPVROYLQJDQGVWUDWHJLFGH- GXFLQJWLPHWRWUDLQLQJIRUHPSOR\HHVDQGPDLQWDLQ-
FLVLRQ PDNLQJ DUH PRUH YDOXDEOH WKDQ HYHU :KLOH LQJLWVUHSXWDWLRQDVRQHRIWKHWRSHPSOR\HUEUDQGV
VRPH ZLOO GUDPDWL]H WKH QHJDWLYH LPSDFWV RI $, LQLWVLQGXVWU\
FRJQLWLYH FRPSXWLQJ DQG URERWLFV WKHVH SRZHUIXO
WRROV ZLOO DOVR KHOS FUHDWH QHZ MREV ERRVW SURGXF- WHERE DO COMPANIES STAND TODAY?
WLYLW\DQGDOORZZRUNHUVWRIRFXVRQWKHKXPDQDV-
SHFWVRIZRUN7KLVRSHQVDQRWKHUGHVLJQTXHVWLRQ 2XU UHVHDUFK VKRZV WKDW PRVW FRPSDQLHV DUH LQ
+RZFDQFRPSDQLHVDFKLHYHWKHJUHDWHVWWRWDOYDOXH WKH PLGGOH RI WKLV IXQGDPHQWDO VKLIW 7KLUW\RQH
WKURXJKDXWRPDWLRQZKLOHEDODQFLQJWKHVKRUWDQG SHUFHQWRIFRPSDQLHVLQWKLV\HDUVGlobal Human

Figure 1. Robotics, cognitive computing, and AI: Percentage of respondents rating this
trend important or very important

Percentages in
selected countries:
Higher % Lower %

Canada 33 India 54
China 51
37 Netherlands Japan 48
Mexico 44
United Kingdom 43
Belgium 39
Brazil 42
UK 43
Germany 40
USA 31 Germany 40
48 Japan Spain 40
France 32
51 China Belgium 39
Spain 40
Netherlands 37
Mexico 44
Italy 36 Italy 36
54 India
Australia 36
42 Brazil South Africa 34
36 Australia Canada 33
34 South Africa
France 32
Percentages by region: United States 31
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


45 32 33 34 38 48 38 50 37
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

Figure 2. Augmented workforce: Percentage of respondents rating this trend important


or very important

Percentages in
selected countries:
Higher % Lower %

Canada 56 India 76
China 73
70 Netherlands Netherlands 70
Japan 68
Belgium 67
Belgium 67
Mexico 66
UK 63
Australia 65
USA 59 Germany 61
68 Japan Italy 64
France 49
73 China South Africa 64
Spain 63
United Kingdom 63
Mexico 66
Italy 64 Spain 63
76 India
Brazil 63
63 Brazil Germany 61
65 Australia United States 59
64 South Africa
Canada 56
Percentages by region: France 49
Higher % Lower %

Americas Europe, Middle East, and Africa $VLD3DFLF


62 58 66 61 64 56 62 72 61
Latin & South North Africa Central & Middle East Nordic Western Asia Oceania
America America Eastern Europe countries Europe

Deloitte University Press | dupress.deloitte.com

Capital TrendsVXUYH\WHOOXVWKH\DUHLQWKHSURFHVV SDQLHV EHOLHYH WKHLU XVH RI REDODQFH VKHHW WDOHQW
RI LPSOHPHQWLQJ $, DQG URERWLFV DQG  SHUFHQW ZLOOJURZVLJQLFDQWO\LQWKHQH[W\HDUVRQO\
DUHSLORWLQJVHOHFWHGDUHDV$QGSHUFHQWVD\WKH\ SHUFHQWVD\WKH\DUHQRWDEOHWRPDQDJHFRQWLQJHQW
DUHHLWKHUIXOO\DXWRPDWHGRUKLJKO\DGYDQFHGLQWKLV ODERUZHOODQGSHUFHQWVD\WKH\KDYHQHYHUXVHG
DUHD RU GR QRW XQGHUVWDQG KRZ WR OHYHUDJH FURZGVRXUF-
LQJ 6R ZKLOH VRPH HOHPHQWV RI WKH IXWXUH RI ZRUN
,QWHUHVWLQJO\ZKHQZHDVNHGFRPSDQLHVDERXWWKH
DUHZHOOXQGHUVWRRGE\EXVLQHVVOHDGHUVRWKHUVDUH
LPSDFW RI WKHVH IXWXUHRIZRUN VFHQDULRV RQO\ 
VWLOOLQDQHPHUJLQJVWDJHRIXQGHUVWDQGLQJ
SHUFHQWVDLGWKH\ZRXOGUHGXFHWKHQXPEHURIMREV
0RVWFRPSDQLHV SHUFHQW WROGXVWKH\ZLOOHLWKHU :KDW LV FOHDU LV WKDW LQWHUHVW LQ WKLV WRSLF LV JURZ-
UHWUDLQ SHRSOH WR XVH WHFKQRORJ\ RU ZLOO UHGHVLJQ LQJ H[SRQHQWLDOO\ :KLOH RQO\  SHUFHQW RI &VXLWH
MREVWREHWWHUWDNHDGYDQWDJHRIKXPDQVNLOOV UHVSRQGHQWVUDWHWKLVWUHQGDVDSULRULW\IRUWKLV\HDU
ZKLFKZHEHOLHYHUHSUHVHQWVWKHOHYHORIFRQIXVLRQ
:KHQ ZH DVNHG FRPSDQLHV DERXW WKHLU SODQV WR OH-
LQWKHPDUNHW SHUFHQWEHOLHYHLWZLOOEHLPSRU-
YHUDJHFURZGVFRQWUDFWODERUDQGQHZPRGHOVIRU
WDQW LQ WKH QH[W WKUHH WR YH \HDUVDQ LQFUHDVH RI
KXPDQWDOHQWWKHVWRU\ZDVTXLWHGLHUHQW,QWKHVH
SHUFHQWRQHRIWKHODUJHVWPRYHPHQWVZHKDYH
QHZKXPDQPRGHOVIRUWKHIXWXUHRIZRUNFRPSD-
VHHQ
QLHVDUHIDUOHVVSUHSDUHG:KLOHSHUFHQWRIFRP-


Rewriting the rules for the digital age

UNEVEN PROGRESS TOWARD RETHINKING TALENT, TECHNOLOGY,


THE FUTURE WORKFORCE AND THE WORKPLACE
7KH VKLIW IURP IXOOWLPH HPSOR\HHV WR DQ DXJPHQW- 2XUUHVHDUFKFOHDUO\VKRZVWKDWRQHRIWKHQHZUXOHV
HG ZRUNIRUFH DXJPHQWHG E\ ERWK WHFKQRORJ\ DQG IRU WKH GLJLWDO DJH LV WR H[SDQG RXU YLVLRQ RI WKH
FURZGV  LV RQH RI WKH PRUH FKDOOHQJLQJ RI WKH KX- ZRUNIRUFHWKLQNDERXWMREVLQWKHFRQWH[WRIWDVNV
PDQ FDSLWDO WUHQGV RQ WKH KRUL]RQ ,W XSHQGV WKH WKDWFDQEHDXWRPDWHG RURXWVRXUFHG DQGWKHQHZ
IDPLOLDUFRQFHSWVRIZKDWDMRELV DORQJZLWKDOOWKH UROH RI KXPDQ VNLOOV DQG IRFXV HYHQ PRUH KHDYLO\
LPSOLFDWLRQV IRU FDUHHUV  ZKDW ZRUN UHDOO\ PHDQV RQ WKH FXVWRPHU H[SHULHQFH HPSOR\HH H[SHULHQFH
KRZWKHZRUNIRUFHLVWUDLQHGDQGVHOHFWHGDQGKRZ DQG HPSOR\PHQW YDOXH SURSRVLWLRQ IRU SHRSOH 2U-
WKHZRUNSODFHLVGHVLJQHG,WVWUHWFKHVFRQYHQWLRQDO JDQL]DWLRQV WKDW DXWRPDWH PDQXIDFWXULQJ SODQWV
QRWLRQVRIZKDWW\SHVRIZRUNFDQEHGRQHE\SHRSOH IRUH[DPSOHDQGWKDWGRQRWFOHDUO\JLYHSHRSOHRS-
DQGE\PDFKLQHVDQGLWUHGHQHVWKHKXPDQZRUN- SRUWXQLWLHVIRUUHVNLOOLQJDQGQHZSRVLWLRQVPD\VHH
IRUFHVHJPHQWVWKDWDUHLQYROYHG WKHLUEUDQGVXHUDQGWRVRPHH[WHQWPD\DOVRIHHO
SUHVVXUHIURPWKHVRFLDODQGSROLWLFDOHQYLURQPHQW
:KLOHWKHDGRSWLRQRIURERWLFVLVKDSSHQLQJTXLFN-
$7 7V WDOHQW PDQLIHVWR ZKLFK HQFRXUDJHV DQG
O\ FRPSDQLHV DELOLWLHV WR UHVNLOO DQG UHRUJDQL]H
HPSRZHUV HPSOR\HHV WR FRQWLQXRXVO\ UHVNLOO WKHP-
DURXQG DXWRPDWLRQ DUH VWLOO EHKLQG 5RXJKO\ KDOI
VHOYHVLVDQHHFWLYHH[DPSOHRIDFRPSDQ\WKDWDX-
RI WKH OHDGHUV VXUYH\HG UDWH WKHLU FRPSDQ\ ZHDN
WRPDWHVLQDQLQWHJUDWHGKXPDQFHQWULFZD\
DW DOLJQLQJ FRPSHWHQF\ IUDPHZRUNV WR DFFRXQW IRU
QHZ URERWLFV FRJQLWLYH DQG $, UHTXLUHPHQWV GH- :H HQYLVLRQ UHWKLQNLQJ WKH FRPELQDWLRQV RI WDO-
SOR\LQJ HPSOR\HHV UHSODFHG E\ WKHVH WHFKQRORJLHV HQWWHFKQRORJ\DQGWKHZRUNSODFHDFURVVPXOWLSOH
DQGUHVNLOOLQJHPSOR\HHVWRFRPSOHPHQWWKHVHQHZ GLPHQVLRQV
WRROV

Figure 3. Respondent ratings of sub-capabilities related to the augmented workforce

Percentage of total responses


Managing contingent, outsourced, 25% 57% 19%
contracted, and part-time sources of labor
Understanding emerging skills and
24% 62% 14%
critical capability gaps

Managing gig and talent-sharing


53% 39% 9%
economy resources

Managing crowdsourcing as part of the


organizations workforce and talent 59% 33% 8%
programs

Weak Adequate Excellent

Deloitte University Press | dupress.deloitte.com


2017 Deloitte Global Human Capital Trends

Figure 4. Respondent ratings of sub-capabilities related to robotics, cognitive


computing, and AI
Percentage of total responses
Understanding the future impact of
34% 45% 21%
robotics/cognitive computing/AI on talent

Identifying external sources of


43% 47% 11%
robotics/cognitive computing/AI talent
Redeploying employees replaced by
robotics/cognitive computing/AI resources 51% 40% 10%
elsewhere in the organization
Reskilling employees to complement 51% 40% 9%
robotics/cognitive computing/AI
Aligning competency models/frameworks to
account for new robotics/cognitive computing/ 56% 38% 6%
AI requirements

Weak Adequate Excellent

Deloitte University Press | dupress.deloitte.com

:KDWSDUWVRIDMREFDQEHDXWRPDWHGDQGZKDW WKRVH WKDW DUH WKH EHVW FRQQHFWHG ZLWKLQ DQG


LV WKH KXPDQ YDOXH DGG DURXQG WKHVH VNLOOV" DFURVVWKHFRPSDQ\'RHVRXURUJDQL]DWLRQKDYH
)RU H[DPSOH EDQN WHOOHUV QRZ DGYLVH DQG VHOO HQRXJKRSHQFROODERUDWLYHSK\VLFDODQGGLJLWDO
UDWKHU WKDQ VLPSO\ WUDQVDFW JLYLQJ JUHDWHU FXV- VSDFHV WR IDFLOLWDWH SHRSOHWRSHRSOH PHHWLQJV
WRPHUYDOXHWRFOLHQWV DQGFROODERUDWLRQ"

+RZ FDQ ZH UHVNLOO DQG UHWUDLQ SHRSOH WR OHDUQ +RZ FDQ ZH HYROYH DQG SHUKDSV VHSDUDWH WKH
WHFKQRORJ\DQGWRROVIDVWHUDQGKRZFDQZHGH- IXQFWLRQV RI PXOWL\HDU  \HDUV  VWUDWHJLF
VLJQWKHWHFKQRORJ\VRLWWDNHVDOPRVWQRWUDLQLQJ ZRUNZRUNIRUFHDQGZRUNSODFHSODQQLQJRQWKH
WRXVH" RQH KDQG DQG DQQXDO ZRUNIRUFH SODQQLQJ DQ-
QXDOKHDGFRXQW RQWKHRWKHUWRPRUHGHHSO\H[-
:KHUHGRHVWKHZRUNDQGPRUHVSHFLFDOO\HDFK
SORUH VFHQDULRV WKDW LQFOXGH PRUH FURZGVRXUF-
LQGLYLGXDOWDVNQHHGWREHGRQH":KDWSK\VLFDO
LQJ JUHDWHU DXWRPDWLRQ RU WKH LQFUHDVHG XVH
SUR[LPLW\LVUHTXLUHGWRVHUYHFXVWRPHUVDQGWR
RIURERWLFV"
GHVLJQDQGGHYHORSSURGXFWVDQGVHUYLFHV"
:KDW LV RXU RUJDQL]DWLRQDO DQG ZRUN GHVLJQ
+RZ FDQ ZH FURZGVRXUFH DFWLYLWLHVDQG XVH
FDSDELOLW\  DQG KDYH ZH H[SORUHG WKH ZD\ PD-
FRQWLQJHQW IUHHODQFH DQG JLJ HFRQRP\ WDOHQW
FKLQHVFDQFURVVIXQFWLRQDOERXQGDULHVWRPRYH
WR VDYH WLPH DQG PRQH\ LQFUHDVH TXDOLW\ DQG
SHRSOH IURP MREV WR ZRUN DQG IURP H[HFX-
LPSURYHRSHUDWLRQDOH[LELOLW\DQGVFDODELOLW\"
WLRQZRUNWRHPSDWK\ZRUN"$VZHH[SORUHLQ
+RZFDQZHUHGHVLJQWKHZRUNSODFHWREHPRUH ERWK WKH 3HRSOH DQDO\WLFV DQG WKH 2UJDQL]D-
GLJLWDO LQ QDWXUH RSHQ DQG FROODERUDWLYH \HW WLRQ RI WKH IXWXUH FKDSWHUV RI WKLV UHSRUW QHZ
SURYLGHRSSRUWXQLWLHVIRUGHYHORSPHQWJURZWK WRROVWRSHUIRUPRUJDQL]DWLRQDOQHWZRUNDQDO\VLV
DQGIRFXVWLPH"0XFKUHVHDUFKQRZSURYHVWKDW DQGHYHQWUXVWHGQHWZRUNDQDO\VLVFDQKHOSLGHQ-
WKHKLJKHVWSHUIRUPLQJWHDPV DQGOHDGHUV DUH WLI\RZVRIZRUNWKDWFDQIDFLOLWDWHSURGXFWLYLW\
DPRQJWHDPVDVPRUHWDVNVDUHDXWRPDWHG


Rewriting the rules for the digital age

RETHINKING THE BOUNDARIES LQIRUPDWLRQ LQYROYHG LQ D MRE 7KLV NLQG RI DQDO\-
OF WORK BETWEEN HUMANS VLVKHOSVGHVLJQHUVXQGHUVWDQGZKHUHWDVNVFDQEH
AND MACHINES RXWVRXUFHG DQG ZKHUH KXPDQ HPSDWK\ FDQ EH HQ-
KDQFHGDQGIXUWKHUOHYHUDJHG
7KH UDSLG DGYDQFHV LQ PDFKLQH LQWHOOLJHQFH KDYH
EHHQ ZHOOGRFXPHQWHG9 5RERWV DQG FRJQLWLYH $V 7RP 'DYHQSRUW DQG -XOLD .LUE\ HPSKDVL]H LQ
WHFKQRORJLHV DUH PDNLQJ VWHDG\ DGYDQFHV SDUWLFX- Only Humans Need Apply WKLV UHTXLUHV UHFRJQL]-
ODUO\LQMREVDQGWDVNVWKDWIROORZVHWVWDQGDUGL]HG LQJ WKDW DXJPHQWDWLRQ PHDQV VWDUWLQJ ZLWK ZKDW
UXOHVDQGORJLF7KLVUHLQIRUFHVDFULWLFDOFKDOOHQJH PLQGVDQGPDFKLQHVGRLQGLYLGXDOO\WRGD\DQGJ-
IRU EXVLQHVV DQG +5 OHDGHUVQDPHO\ WKH QHHG XULQJKRZWKDWZRUNFRXOGEHGHHSHQHGUDWKHUWKDQ
WR GHVLJQ VRXUFH DQG PDQDJH WKH IXWXUH RI ZRUN GLPLQLVKHGE\DFROODERUDWLRQEHWZHHQWKHWZR11
ZRUNIRUFHVDQGZRUNSODFHVWRLQFRUSRUDWHDUREXVW 7KH IXWXUH RI ZRUN KDV DUULYHG DQG FRPSDQLHV
XQGHUVWDQGLQJRIZKLFKVNLOOVDUHHVVHQWLDOO\KXPDQ VKRXOG HPEUDFH WKLV GLVUXSWLYH RSSRUWXQLW\ :H
+5OHDGHUVVKRXOGIRFXVRQGHQLQJWKHGLHUHQFH EHOLHYHWKHIDFWRUVGULYLQJWKHVHFKDQJHVZLOODFFHO-
EHWZHHQ HVVHQWLDO KXPDQ skills VXFK DV FUHDWLYH HUDWHOHDYLQJVORZDGRSWHUVEHKLQGDVUVWPRYHUV
DQGHWKLFDOWKLQNLQJDQGQRQHVVHQWLDOtasksZKLFK EHFRPH H[SHUWV DW RSWLPL]LQJ WKH XVH RI PDFKLQHV
FDQEHPDQDJHGE\PDFKLQHV7KLVUHTXLUHVUHIUDP- DQG FURZGV WR GULYH SURGXFWLYLW\ LQQRYDWLYH SURG-
LQJFDUHHUVDQGGHVLJQLQJQHZZD\VRIZRUNLQJDQG XFWVDQGVHUYLFHVDQGFXVWRPHUUHODWLRQVKLSV
QHZ ZD\V RI OHDUQLQJERWK LQ RUJDQL]DWLRQV DQG
DV LQGLYLGXDOV 5HVHDUFK E\ 'HORLWWH LQ WKH 8QLWHG
.LQJGRP QGV WKDW WKH IXWXUH ZRUNIRUFH ZLOO UH-
TXLUHDEDODQFHRIWHFKQLFDOVNLOOVDQGPRUHJHQHUDO
SXUSRVH VNLOOV VXFK DV SUREOHP VROYLQJ VNLOOV FUH-
DWLYLW\VRFLDOVNLOOVDQGHPRWLRQDOLQWHOOLJHQFH

2QH RI WKH WHFKQLTXHV ZH DGYLVH IRU WKLV ZRUN LV
GHVLJQ WKLQNLQJ DQG WKH GHYHORSPHQW RI MRXUQH\
PDSV-RXUQH\PDSVRXWOLQHDQGGRFXPHQWWKHDF-
WXDO ZRUN WDNLQJ SODFH DQG WKH WRROV SHRSOH DQG

Robots and cognitive


technologies are
making steady
advances, particularly
in jobs and tasks that
follow set, standardized
rules and logic.


2017 Deloitte Global Human Capital Trends

Lessons from the front lines


$PD]RQVXVHRIDGYDQFHGZDUHKRXVHWHFKQRORJLHV The future of work has
LOOXVWUDWHV KRZ URERWLFV FRJQLWLYH FRPSXWLQJ DQG
H[LEOHKXPDQZRUNIRUFHVWUDWHJLHVFDQFRPELQHWR
arrived, and companies
PD[LPL]HHFLHQFLHVDQGSURGXFWLYLW\ZKLOHFUHDW-
LQJQHZWHPSRUDU\DQGSHUPDQHQWMREV
should embrace this
7RPHHWLQFUHDVHGGHPDQGGXULQJWKHKROLGD\VHD-
disruptive opportunity.
VRQ $PD]RQ H[SDQGV LWV ZRUNIRUFH E\ URXJKO\ 
SHUFHQW ZLWK DURXQG 
WHPSRUDU\ KLUHV ZKR FDQ EH 6WDWHVWKHQXPEHURIWHOOHUVKDVFRQWLQXHGWRULVH
WUDLQHG TXLFNO\ EHFDXVH RI WR PRUH WKDQ 15  6LPLODU WUDQVIRUPDWLRQV
URERWLF DQG FRJQLWLYH WHFK- KDYH RFFXUUHG DFURVV D UDQJH RI WHFKQRORJLHV DQG
QRORJLHV 7KHVH WRROV VXFK DV SURIHVVLRQVVXFKDVEDUFRGHVFDQQHUVDQGFDVKLHUV
DXWRPDWHG WUDLQLQJ VFUHHQV RUHOHFWURQLFGRFXPHQWGLVFRYHU\DQGSDUDOHJDOV
VPDUW WDSH GLVSHQVHUV DQG
URERWLF SDOOHWV UHGXFH QHZ
KLUHWUDLQLQJIURPVL[ZHHNVWR Start here
DVOLWWOHDVWZRGD\V127KHWHFK-
QRORJLHVDXWRPDWHWDVNVVXFKDVURWHPHPRUL]DWLRQ Consider how the core work actually gets
DQGKHDY\OLIWLQJDOORZLQJWHPSRUDU\HPSOR\HHVWR done:&KDOOHQJHWKHRUJDQL]DWLRQWRUHWKLQNQRW
TXLFNO\PDVWHUWKHZRUNWKDWUHTXLUHVKXPDQVNLOOV RQO\ZKDWZRUNQHHGVWREHGRQHEXWWRFRQVLGHU
WKH UDQJH RI WDOHQW VHJPHQWV DQG WHFKQRORJLHV
)XUWKHU WKHVH ZRUNIRUFH LQQRYDWLRQV QRW RQO\ HQ- WKDW FDQ EH XVHG LQ FRPELQDWLRQ WR EHVW FRP-
DEOH H[LELOLW\ IRU VKRUWWHUP ZRUNHUVWKH\ DOVR SOHWHWKDWZRUN
FUHDWHSHUPDQHQWMREV/DVW\HDU$PD]RQUHWDLQHG
SHUFHQWRILWVVHDVRQDOKLUHVLQSDUWEHFDXVHDXJ- Identify all human workforce segments:
PHQWHGZDUHKRXVHVDFWXDOO\UHTXLUHDJUHDWHUQXP- 7KLVLQFOXGHVWKRVHERWKLQVLGHDQGRXWVLGHWKH
EHURIKXPDQZRUNHUV137KHVHFHQWHUVFDQSURFHVV FRPSDQ\ GLHUHQW PRGHOV RI FRQWUDFWRUV WKH
PRUHWRWDORUGHUVDQGWKHUHIRUHUHTXLUHPRUHWRWDO FURZG DQG FRPSHWLWLRQV 7DOHQW SODWIRUPV DUH
KXPDQHPSOR\HHV JURZLQJ UDSLGO\ LQ VFDOH XQGHUVWDQGLQJ KRZ
WKH\ FDQDXJPHQWIXOOWLPH ZRUNIRUFHVLVDNH\
)LQDOO\ DOO RI WKHVH MREV DUH SRVVLEOH EHFDXVH RI H FDSDELOLW\IRUPDQDJHUVLQERWK+5DQGEXVLQHVV
FRPPHUFH ZKLFK LV LWVHOI D UHVXOW RI UHFHQW WHFK-
QRORJLFDO DGYDQFHV 7KRXJK VRPH VSHFXODWHG WKDW Examine all types of nonhuman work-
HFRPPHUFH ZRXOG UHSODFH ZRUNHUV LQ FHUWDLQ forces: 7KLV LQFOXGHV WKH HQWLUH DUUD\ RI UR-
LQGXVWULHV WKH HOG KDV OHG WR UREXVW MRE FUHDWLRQ ERWLFV FRJQLWLYH DQG $, WHFKQRORJLHV WR DXJ-
VXFKDV$PD]RQVFRQVWUXFWLRQRIQHZZDUHKRXV- PHQW KXPDQ ZRUNHUV OHYHUDJLQJ WKH SRZHU RI
HVLQDORQH14 PDFKLQHV WR DFFRPSOLVK DQ LQFUHDVHG QXPEHU
RI WDVNV 3DUWQHULQJ ZLWK WKH EXVLQHVV +5 FDQ
7KLV RSWLPLVWLF YLHZ RI FRPSOHPHQWDU\ PDFKLQH KHOSOHDGWKHUHGHVLJQRIZRUNDULVLQJIURPUDSLG
DQG KXPDQ ZRUN LV DOVR HYLGHQW LQ D UDQJH RI KLV- FKDQJHVLQURERWLFVDQG$,
WRULFDO FDVHV )RU H[DPSOH  \HDUV DIWHU WKH UVW
$70V EHJDQ WR SHUIRUP WDVNV IRUPHUO\ GRQH E\ Redesign multiyear strategic and annual
WHOOHUV WKHUH DUH PRUH EDQNHUV ZRUNLQJ DW PRUH operational workforce planning:&RQVLGHU
EUDQFKHV DQG WKHLU ZRUN LV PRUH YDULHGHYHQ VHSDUDWLQJ PXOWL\HDU VWUDWHJLF ZRUN ZRUNIRUFH
DV LW OHYHUDJHV PRUH DQG PRUH WHFKQRORJ\ :KLOH DQGZRUNSODFHSODQQLQJZKLFKFRPEVQHZWDO-
WKHUHDUHQRZURXJKO\$70VLQWKH8QLWHG HQW VHJPHQWV DQG WHFKQRORJLHV WR GHYHORS VSH-


Rewriting the rules for the digital age

FLF IXWXUH VFHQDULRV IRU WKH ZRUNIRUFHIURP HWKLFDO GHFLVLRQ PDNLQJ DUH DOO HVVHQWLDOO\ KX-
DQQXDORSHUDWLRQDOZRUNIRUFHSODQQLQJ PDQ VNLOOV WKDW HYHU\ RUJDQL]DWLRQ QHHGVQRZ
DQGLQWKHIXWXUH:KHQSODQQLQJWKHIXWXUHRI
Collaborate across functions to plan and
WKHZRUNIRUFHFRQVLGHUWKHVHORQJWHUPKXPDQ
implement new work and workforce so-
VNLOOQHHGV
lutions:(QVXUHWKDWWKHQHZVFRSHRIWKHDXJ-
PHQWHGZRUNIRUFHDOLJQVZLWKEXVLQHVVVWUDWHJ\ Plan and manage the workforce transfor-
DQG LQYROYHV IXOO SDUWLFLSDWLRQ RI EXVLQHVV +5 mation: *LYHQ WKH VFRSH DQG VFDOH RI FRPLQJ
DQG RWKHU FRUSRUDWH IXQFWLRQV 7KLV ZLOO OLNHO\ FKDQJHVWRZRUNZRUNIRUFHVDQGZRUNSODFHVLW
UHTXLUH H[SHULPHQWLQJ ZLWK QHZ ZD\V RI ZRUN- LVFULWLFDOWRKDYHDQHQWHUSULVHIXWXUHRIZRUN
LQJDQGFRRUGLQDWLQJDFURVVRUJDQL]DWLRQDOVLORV RU DXJPHQWHG ZRUNIRUFH URDGPDS FRPELQ-
LQJEXVLQHVV+5,7SURFXUHPHQWDQGQDQFH
Invest in critical human skills for the fu-
7KLV SODQ VKRXOG LQFOXGH DQ DFWLRQDEOH YLHZ RI
ture workforce: 3UREOHP VROYLQJ FUHDWLYLW\
WDOHQWWUDLQLQJFRPPXQLFDWLRQOHDGHUVKLSFXO-
SURMHFW PDQDJHPHQW OLVWHQLQJ DQG PRUDO DQG
WXUHDQGRUJDQL]DWLRQDOLPSDFWV

FAST FORWARD
2IWKHWUHQGVLQWKLV\HDUVUHSRUWWKHIXWXUHRIZRUNZLOOOLNHO\DFFHOHUDWHWKHIDVWHVW
LQWKHQH[WYH\HDUV7KLVLVVLPSO\DIXQFWLRQRIZKHUHZHDUHLQWKHHYROXWLRQRI
WHFKQRORJ\)LIW\\HDUVDIWHUWKHIRUPXODWLRQRI0RRUHVODZSURFHVVLQJDQGFRPSXWLQJ
power continue to grow exponentially, driving advances in robotics and machine
learning. Cognitive tools to augment, and in some cases replace, knowledge work will
continue to accelerate and become widely deployed and adopted. We would not be
surprised if the future of work, workforce, and workplace issues come to dominate the
concerns and agenda of HR and business leaders in the near future. This challenge
UHTXLUHVPDMRUFURVVIXQFWLRQDODWWHQWLRQHRUWDQGFROODERUDWLRQ


2017 Deloitte Global Human Capital Trends

)LJXUH7KHIXWXUHRIZRUN2OGUXOHVYVQHZUXOHV

Old rules New rules

Jobs and tasks are being redesigned to use more


0DFKLQHVDQGDUWLFLDOLQWHOOLJHQFHDUHWDNLQJRYHU
essential human skills, and are augmented by
jobs (replacement)
technology (augmentation)

A continuum of talent is available, including


Full-time employees are the main source of talent contractors, gig employees, crowds, and
competitions

The focus in workforce planning shifts to start


Workforce planning focuses on full-time workforce
with work and analyzing options across multiple
and skill requirements
workforces and technologies

The half-life of skills continues to decrease rapidly,


-REVDUHUHODWLYHO\VWDWLFZLWK[HGVNLOOUHTXLUHPHQWV
and work is being constantly reinvented

Projects, assignments, and tours of duty are building


Jobs and career ladders are the foundation of work
blocks for work; careers are portfolios of projects
and the workforce
and experiences

Integrating people and technology is a


Robotics and cognitive technologies are IT projects
multidisciplinary task

HR has a strategic role to facilitate and orchestrate


+5VMRELQDXWRPDWLRQLVWRIRFXVRQFKDQJH
the redesign of jobs and train the augmented
management and workforce transition
workforce

The fundamental elements of work are jobs, with The fundamental elements of work are tasks, which
formally developed job descriptions are aggregated into jobs and roles

'HORLWWH8QLYHUVLW\3UHVV_GXSUHVVGHORLWWHFRP


Rewriting the rules for the digital age

ENDNOTES

1. -H6FKZDUW]$QGUHZ/LDNRSRXORVDQG/LVD%DUU\The open talent economy: Beyond corporate borders to talent


ecosystems, Deloitte University Press, July 24, 2013, https://dupress.deloitte.com/dup-us-en/deloitte-review/is-
sue-13/the-open-talent-economy.html, accessed December 13, 2016.

2. 'DYLG6FKDWVN\DQG-H6FKZDUW]Machines as talent: Collaboration, not competition, Deloitte University Press, Feb-


ruary 27, 2015, https://dupress.deloitte.com/dup-us-en/focus/human-capital-trends/2015/cognitive-technology-
in-hr-human-capital-trends-2015.html, accessed December 13, 2016.

3. -H 6FKZDUW] HW DO The gig economy: Distraction or disruption?, Deloitte University Press, February 29, 2016,
https://dupress.deloitte.com/dup-us-en/focus/human-capital-trends/2016/gig-economy-freelance-workforce.
html, accessed December 13, 2016.

4. Angus Knowles-Cutler and Harvey Lewis, Essential skills for working in the machine age, Deloitte, https://www2.
deloitte.com/uk/en/pages/growth/articles/essential-skills-for-working-in-machine-age.html; Bersin by Deloitte
Glassdoor research.

5. Angus Knowles-Cutler and Harvey Lewis, Talent for survival: Essential skills for humans working in the machine age,
Deloitte, 2016, p. 1, https://www2.deloitte.com/content/dam/Deloitte/uk/Documents/Growth/deloitte-uk-talent-
for-survival-report.pdf, accessed December 13, 2016.

6. Laura Stevens, How Amazon gets its holiday hires up to speed in two days, Wall Street Journal1RYHPEHU
KWWSZZZZVMFRPDUWLFOHVDPD]RQOHDQVRQWHFKQRORJ\WRVSHHGWUDLQLQJRIKROLGD\ZRUNHUV
accessed December 13, 2016.

7. -RKQ'RQRYDQDQG&DWK\%HQNR$7 7VWDOHQWRYHUKDXOHarvard Business Review, October 2016, https://hbr.


org/2016/10/atts-talent-overhaul, accessed October 3, 2016.

 7UHYRU 3DJH $PLU 5DKQHPD 7DUD 0XUSK\ DQG 7LDQ\ 0FGRZHOO 8QORFNLQJ WKH H[LEOH RUJDQL]DWLRQ, Deloitte,
KWWSVZZZGHORLWWHFRPJOREDOHQSDJHVKXPDQFDSLWDODUWLFOHVJ[XQORFNLQJWKHH[LEOHRUJDQL]DWLRQKWPO

9. Erik Brynjolfsson and Andrew McAfee, Race against the Machine: How the Digital Revolution is Accelerating Innova-
tion, Driving Productivity, and Irreversibly Transforming Employment and the Economy (Digital Frontier Press, 2011);
Erik Brynjolfsson and Andrew McAfee, The Second Machine Age: Work Progress, and Prosperity in a Time of Brilliant
Technologies (W.W. Norton & Company, 2016); Thomas H. Davenport and Julia Kirby, 2QO\+XPDQV1HHG$SSO\
Winners and Losers in the Age of Smart Machines (HarperBusiness, 2016).

10. Knowles-Cutler and Lewis, Talent for survival.

11. Davenport and Kirby, 2QO\+XPDQV1HHG$SSO\.

12. Stevens, How Amazon gets its holiday hires up to speed in two days.

13. Ibid.

14. Ibid.

15. James Bessen, Toil and technology, Finance and Development 52, no. 1 (March 2015), http://www.imf.org/exter-
nal/pubs/ft/fandd/2015/03/bessen.htm, accessed December 13, 2016.

16. James Bessen, +RZFRPSXWHUDXWRPDWLRQDHFWVRFFXSDWLRQV7HFKQRORJ\MREVDQGVNLOOV, Boston University School


RI/DZ1RYHPEHUKWWSZZZEXHGXODZOHV1HZ7HFKSGIDFFHVVHG'HFHPEHU


2017 Deloitte Global Human Capital Trends

AUTHORS
-H6FKZDUW]'HORLWWH&RQVXOWLQJ//3_MHVFKZDUW]#GHORLWWHFRP

-H6FKZDUW]LVWKHJOREDOOHDGHUIRU+XPDQ&DSLWDO0DUNHWLQJ(PLQHQFHDQG%UDQG+H
is an advisor to senior business leaders in global companies, focusing on organization, HR,
WDOHQWDQGOHDGHUVKLS6FKZDUW]LVWKHVHQLRUDGYLVRUIRUWKHUPV+XPDQ&DSLWDOFRQVXOWLQJ
SUDFWLFHLQQGLDDQGDOVRWKHIRXQGLQJDQG86PDQDJLQJSULQFLSDOIRUWKHUPVQQRYDWLRQ
Tech Terminal (ITT) connecting US and global companies with the Israeli start-up ecosystem.
He is a frequent speaker and writer on issues at the nexus of talent, human resources, global
business challenges, and the future of work. In 2011, Schwartz led the launch of Deloittes
Global Human Capital Trends survey and report series and continues to serve as one of the
executive editors.

Laurence Collins, Deloitte MCS Limited | lcollins@deloitte.co.uk

Laurence Collins leads the United Kingdoms HR Digital, Workforce Planning and Analytics
practices, helping clients drive productivity and performance in the context of the future
of work. He focuses on applying a variety of approaches such as predictive analytics,
robotics, and strategic workforce planning for improved business impact. His work includes
reimagining the role of HR and linking the resulting outcomes of new capabilities back to the
economic contribution of human capital.

Heather Stockton, Deloitte Canada | hstockton@deloitte.ca

Heather Stockton serves the banking sector, advising clients on governance and
management practices, leadership, operating models, and business transformation. She
leads Deloittes Americas Human Capital business and is also the organizations global
Financial Services Industry leader for human capital. She is also a global leader of Deloittes
future of work research and client solution development. Stockton is a director on the
Deloitte Canada board and chairs its governance committee.

Darryl Wagner, Deloitte Consulting LLP | dawagner@deloitte.com

Darryl Wagner is the global leader for Deloittes Actuarial, Rewards, and Analytics practice.
+LVDUHDVRIVSHFLDOW\LQFOXGHOLIHLQVXUHUQDQFLDOUHSRUWLQJDQGSHUIRUPDQFHYDOXH
measurement and management. He has worked with clients around the world on many
accounting and valuation frameworks, helping them with technical, process-oriented, and
organizational aspects of implementation, execution, and evaluation. Wagner is a fellow of
the Society of Actuaries and a member of the American Academy of Actuaries.

Brett Walsh, Deloitte MCS Limited | bcwalsh@deloitte.co.uk

Brett Walsh is Deloittes global Human Capital leader and a global lead client service
partner. He has over 25 years of international experience consulting with executives on
HR transformation, HR technologies, and the future of work. A frequent speaker and
author, Walsh has an MBA from Warwick University and is a fellow of the Institute of
Business Consultants.

CONTRIBUTORS
Raj Attra, Stacia Garr, Bob Kaunert, Peter Lowes, Christa Manning, Sarah Rogers, David
Schatsky, Nathan Sloan


Rewriting the rules for the digital age

EXECUTIVE EDITORS

Bill Pelster, Deloitte Consulting LLP | bpelster@deloitte.com

Bill Pelster has more than 25 years of industry and consulting experience. In his current role,
Pelster is responsible for leading the Bersin by Deloitte Research and Products practice and
is a senior advisor to the Integrated Talent Management practice. A well-respected speaker
and author, he has recently led, supported, or authored key research pieces including Talent
2020, Global Human Capital Trends, and The Leadership Premium. In his previous role as
'HORLWWHVFKLHIOHDUQLQJRFHU3HOVWHUZDVUHVSRQVLEOHIRUWKHWRWDOGHYHORSPHQWH[SHULHQFH
of Deloitte professionals, and was one of the key architects of Deloitte University, Deloittes
$300 million learning facility outside Dallas. Pelster is a former US board member for Deloitte
Consulting LLP.

-H6FKZDUW]'HORLWWH&RQVXOWLQJ//3_MHVFKZDUW]#GHORLWWHFRP

-H6FKZDUW]LVWKHJOREDOOHDGHUIRU+XPDQ&DSLWDO0DUNHWLQJ(PLQHQFHDQG%UDQG+H
is an advisor to senior business leaders in global companies, focusing on organization, HR,
WDOHQWDQGOHDGHUVKLS6FKZDUW]LVWKHVHQLRUDGYLVRUIRUWKHUPV+XPDQ&DSLWDOFRQVXOWLQJ
SUDFWLFHLQQGLDDQGDOVRWKHIRXQGLQJDQG86PDQDJLQJSULQFLSDOIRUWKHUPVQQRYDWLRQ
Tech Terminal (ITT) connecting US and global companies with the Israeli start-up ecosystem.
He is a frequent speaker and writer on issues at the nexus of talent, human resources, global
business challenges, and the future of work. In 2011, Schwartz led the launch of Deloittes
Global Human Capital Trends survey and report series and continues to serve as one of the
executive editors.

LEAD RESEARCHER

Josh Bersin, Bersin by Deloitte, Deloitte Consulting LLP | jbersin@deloitte.com

Josh Bersin founded Bersin & Associates, now Bersin by Deloitte, in 2001 to provide research
and advisory services focused on corporate learning. He is a frequent speaker at industry
events and a popular blogger. Bersin spent 25 years in product development, product
management, marketing, and sales of e-learning and other enterprise technologies. He has
a BS in engineering from Cornell, an MS in engineering from Stanford, and an MBA from the
Haas School of Business at the University of California, Berkeley.


2017 Deloitte Global Human Capital Trends

ACKNOWLEDGEMENTS
7KHGlobal Human Capital Trends UHSRUWLVWKHUHVXOWRID\HDUORQJHRUWE\DJOREDO'HORLWWHWHDPWKDW
LQFOXGHVDXWKRUVDQGUHVHDUFKHUVIURPFRXQWULHVUHSUHVHQWLQJHYHU\UHJLRQRIWKHZRUOG7KHUHSRUWKDV
EHHQVKDSHGE\WKHGDLO\H[SHULHQFHVRIRXUPDQ\FRQVXOWLQJSUDFWLWLRQHUVZRUNLQJZLWKRXUYDOXHGFOLHQWV
WRDGGUHVVWKHLUPRVWVWUDWHJLFSHRSOHLVVXHVLQQXPHUDEOHLQWHUYLHZVZLWKEXVLQHVVDQG+5OHDGHUVDQGWKH
YRLFHVRIPRUHWKDQVXUYH\SDUWLFLSDQWVIURPFRXQWULHV

2UFKHVWUDWLQJWKHVHPDQ\VWUDQGVLQWRDVLQJOHUHSRUWLVQRWDQHDV\XQGHUWDNLQJ3OHDVHMRLQXVLQWKDQNLQJWKH
LQVSLUHGDQGWLUHOHVVWHDPZKRKDVGULYHQWKHGHYHORSPHQWDQGSURGXFWLRQRIWKLV\HDUVUHSRUWDQGVXUYH\

Julie MayIRURYHUDOOPDQDJHPHQWRIWKHGlobal Human Capital TrendsSURJUDP:HDSSUHFLDWHWKHIRFXV


HRUWDQGFKDOOHQJLQJSHUVSHFWLYHV\RXEULQJWRWKHWHDPDVZHOODVWKHZD\\RXNHHSXVPRYLQJIRUZDUG
WKURXJKRXUPDQ\ORQJGLVFXVVLRQVWRJHWWRDQLVKHGSURGXFW:HDUHDOVRJUDWHIXOIRU\RXUDELOLW\WRZHDYH
WRJHWKHU WKH HRUWV DQG SHUVSHFWLYHV RI WKH PDQ\ FRXQWU\ FKDPSLRQV DXWKRUV DQG VXEMHFWPDWWHU H[SHUWV
LQYROYHGLQSURGXFLQJWKLVJOREDOUHSRUW

Jen StempelBernard van der VyverDavid MallonDQGLuke MonckIRUVKDULQJ\RXUH[SHULHQFH


DQGLQVLJKW<RXUZLOOLQJQHVVWRHQJDJHLQGHEDWHKHOSHGXVVKDSHWKHWKHPHVRIWKHUHSRUW

Elizabeth ChodaczekAlejandra ArrueMia FarnhamAnna MartinDQGLauren ShevlinIRUPDQ-


DJLQJDOOWKHPDQ\GHWDLOVRIVXFKDFRPSOH[XQGHUWDNLQJ

Junko KajiRXUHGLWRUH[WUDRUGLQDLUH6RQ\D9DVLOLHDQGTroy BishopRQWKH'HORLWWH8QLYHUVLW\3UHVV


GHVLJQDQGPHGLDWHDPVDQGWKHUHVWRIWKRVHDW'HORLWWH8QLYHUVLW\3UHVVZKRKHOSHGWRFUHDWHWKLVLQVLJKWIXO
DQGEHDXWLIXOSXEOLFDWLRQ

Katrina Drake HudsonChristy HodgsonDQGLaura EliasIRUOHDGLQJRXULQQRYDWLYHPDUNHWLQJSUR-


JUDPDQGKHOSLQJXVDGRSWWKHQHZUXOHVRIWKHGLJLWDOZRUOGLQRXURZQZRUN7KDQNVDVZHOOWRMelissa
DoyleSusan OstaszewskiStephen SoylandDQGLesley StephenIRUPDQDJLQJWKHJOREDOSXEOLFUHOD-
WLRQVSURJUDP

Ankita JainUdita AroraMukta GoyalShivank GuptaDQGMaansi PandeyIRUOHDGLQJRXUUHVHDUFK


HRUWVDQGPDQDJLQJDJOREDOVXUYH\ZLWKPRUHWKDQUHVSRQGHQWVLQPXOWLSOHODQJXDJHV0DQ\WKDQNV
DQGPXFKDSSUHFLDWLRQWRWKHUHVHDUFKWHDPSaylee BhorkarDiptarka ChakrabortySrishti Dayal
Garima Tyagi Dubey Karan Gurung Rachit Jain Swati Jain Ashish Kumar Kainth Harsh
KhandelwalNavti NarangSangeet SabharwalSonia Sharma*RUDO6KURDQGManan Vij

$QGQDOO\DVSHFLDOWKDQN\RXWRBrett WalshOHDGHURIRXUJOREDO+XPDQ&DSLWDOSUDFWLFHDQGJason
GellerDQGErica VoliniWKHOHDGHUVRIRXU86+XPDQ&DSLWDOSUDFWLFH:HDUHJUDWHIXOIRU\RXUVXSSRUWDQG
JXLGDQFHHYHU\VWHSRIWKHZD\LQSURGXFLQJWKLVUHSRUW


Rewriting the rules for the digital age

BERSIN BY DELOITTE RESEARCH TEAM


%HUVLQE\'HORLWWHGHOLYHUVUHVHDUFKEDVHGSHRSOHVWUDWHJLHVGHVLJQHGWRKHOSOHDGHUVDQGWKHLURUJDQL]DWLRQVGHOLYHU
H[FHSWLRQDOEXVLQHVVSHUIRUPDQFH$%HUVLQE\'HORLWWHPHPEHUVKLSJLYHV+5SURIHVVLRQDOVWKHLQIRUPDWLRQDQG
WRROVWKH\QHHGWRGHVLJQDQGLPSOHPHQWOHDGLQJSUDFWLFHVROXWLRQVEHQFKPDUNWKHPVHOYHVDJDLQVWRWKHUVGHYHORS
WKHLUVWDDQGVHOHFWDQGLPSOHPHQWV\VWHPV$SLHFHRI%HUVLQE\'HORLWWHUHVHDUFKLVGRZQORDGHGRQDYHUDJHHYHU\
PLQXWHGXULQJWKHEXVLQHVVGD\

David Mallon, head of research, Bersin by Deloitte, Deloitte Consulting LLP


$VKHDGRIUHVHDUFKIRU%HUVLQE\'HORLWWH'DYLG0DOORQVHWVVWUDWHJ\HQVXUHVKLJKTXDOLW\HRUWV
and drives continuous innovation among Bersin by Deloittes research team. He is the former steward
for Bersin by Deloittes learning and development research practice and has been the primary force
behind its work in continuous learning, learning cultures, high-impact learning organization maturity,
and learning management systems. He is also central to developing thought leadership related to HRs
operating models, governance, and the evolution of key roles such as the HR business partner.

Candace Atamanik, talent management research leader, Bersin by Deloitte,


Deloitte Consulting LLP
Candace Atamaniks research focuses on talent strategy, talent management, performance management,
and competencies. Atamanik has a BS in psychology from Pepperdine University and an MS in industrial
and organizational psychology from Florida International University. She was also a PhD candidate in
industrial and organizational psychology at Florida International University.

Madhura Chakrabarti, people analytics research leader, Bersin by Deloitte,


Deloitte Consulting LLP
Madhura Chakrabarti has a bachelors degree in psychology from the University of Delhi and an MA
and PhD in industrial/organizational psychology from Wayne State University, Michigan. Previously,
Chakrabarti worked at Dell and Ford Motor Company in various roles spanning people analytics,
employee engagement, and pre-employment assessments

Vikram Datta Choudhury, India leader, Bersin by Deloitte, Deloitte Consulting LLP
9LNUDP'DWWD&KRXGKXU\OHDGV'HORLWWHVHRUWVLQQGLDWRFUHDWHUHVHDUFKFRQWHQWIRU%HUVLQE\'HORLWWH
member organizations. Before his current role, he headed research initiatives at People Matters, a leading
KXPDQFDSLWDOPDJD]LQHLQQGLDDQGVSHQWPRUHWKDQVL[\HDUVDWWKH&RUSRUDWH([HFXWLYH%RDUG
UVWDVDUHVHDUFKHUDQGWKHQDVDQDFFRXQWPDQDJHU&KRXGKXU\KROGVDSRVWJUDGXDWHGHJUHHLQ
LQWHUQDWLRQDOEXVLQHVVIURP'HOKL8QLYHUVLW\DQGLVDOVRDTXDOLHGFLYLOHQJLQHHU

Janet Clarey, learning and development research leader, Bersin by Deloitte, Deloitte
Janet Clarey focuses on the areas of learning culture, high-impact learning, organization maturity,
and learning technology. She holds a BA in communications from the State University of New York at
Oswego and a masters degree in instructional design for online learning from Capella University. She
has also completed coursework toward a doctorate from Syracuse University in instructional design,
development, and evaluation.

Andrea Derler, leadership and succession research leader, Bersin by Deloitte,


Deloitte Consulting LLP
Andrea Derler holds a doctoral degree in economics (leadership and organization) and a masters degree
in philosophy. Prior to joining Bersin by Deloitte, she collaborated closely with organizations in the
8QLWHG6WDWHVDVZHOODV(XURSHWRFRQGXFWSUDFWLFHRULHQWHGOHDGHUVKLSUHVHDUFKIDFLOLWDWLQJOHDGHUVKLS
GHYHORSPHQWHRUWVLQDYDULHW\RILQGXVWULHV


2017 Deloitte Global Human Capital Trends

BERSIN BY DELOITTE RESEARCH TEAM, CONT.


Robin Erickson, vice president, talent acquisition research,
Bersin by Deloitte, Deloitte Consulting LLP
5RELQ(ULFNVRQIRFXVHVRQWDOHQWDFTXLVLWLRQHQJDJHPHQWDQGUHWHQWLRQUHVHDUFKZKHUHVKHGUDZVRQ
her deep experience in talent strategies consulting and related research for Deloittes Human Capital
SUDFWLFH(ULFNVRQKROGVDGRFWRUDWHIURP1RUWKZHVWHUQ8QLYHUVLW\LQRUJDQL]DWLRQDOFRPPXQLFDWLRQ
and change, a masters degree in communication from Northwestern University, a masters degree in
theology from Northern Seminary, and a bachelor of arts degree from the University of Chicago.

Stacia Sherman Garr, vice president, talent management


research, Bersin by Deloitte, Deloitte Consulting LLP
Stacia Sherman Garr is responsible for research on human resources, talent strategy, integrated talent
management, performance management, career management, diversity and inclusion, employee
recognition, competencies, and workforce planning. Garr holds an MBA from the University of
&DOLIRUQLD%HUNHOH\DPDVWHUVGHJUHHIURPWKH/RQGRQ6FKRRORI(FRQRPLFVDQGEDFKHORUVGHJUHHV
in history and political science from Randolph-Macon Womans College.

Dani Johnson, vice president, learning and development


research, Bersin by Deloitte, Deloitte Consulting LLP
Dani Johnson has spent the majority of her career writing about, conducting research in, designing, and
consulting on human capital practices. Johnson led the Human Resource Competency Study with the
University of Michigan and six other professional organizations around the world, and co-authored the
resulting book, HR Competencies: Mastery at the Intersection of People and Business (Society for Human
Resource Management, 2008).

Christa Manning, vice president, HR solution provider


research, Bersin by Deloitte, Deloitte Consulting LLP
Christa Manning helps businesses align their workforce support strategies with the right third-party
software, service partners, and governance models. She also helps solution providers map their
capabilities and go-to-market activities to solution users needs. Manning holds a bachelors degree
LQ(QJOLVKIURP%DUQDUG&ROOHJH&ROXPELD8QLYHUVLW\LQFRUSRUDWLQJVWXGLHVDW8QLYHUVLW\&ROOHJH
8QLYHUVLW\RI/RQGRQVKHDOVRKROGVDPDVWHUVGHJUHHLQ(QJOLVKIURPWKH8QLYHUVLW\RI0DVVDFKXVHWWV

-H0LNHYLFHSUHVLGHQWKXPDQUHVRXUFHVUHVHDUFK
Bersin by Deloitte, Deloitte Consulting LLP
-H0LNHFDPHWR%HUVLQE\'HORLWWHIURP03$4QWHUQDWLRQDOZKHUHKHZDVKHDGRIKXPDQFDSLWDO
He has also been a faculty member in human resources development at Al Akhawayn University,
0RURFFR0LNHKROGVDEDFKHORUVGHJUHHLQ(QJOLVKOLWHUDWXUHIURPWKH8QLYHUVLW\RI:DVKLQJWRQ
and a masters degree in organizational development and strategic human resources from Johns
Hopkins University.

Denise Moulton, mid-market HR and talent research leader,


Bersin by Deloitte, Deloitte Consulting LLP
Denise Moulton has several years of practitioner experience focusing on talent acquisition, talent
management, and human resources operations. Previously, she was a talent acquisition leader at
Hasbro, Inc., where she provided recruitment management for global and commercial business
XQLWV0RXOWRQKROGVDEDFKHORURIDUWVGHJUHHIURPWKH8QLYHUVLW\RI5KRGHVODQGDQGLVDFHUWLHG
Internet recruiter.


Rewriting the rules for the digital age

GLOBAL HUMAN CAPITAL LEADERS

Global Human Capital leader Global Actuarial, Rewards, and Analytics


Brett Walsh leader
Deloitte MCS Limited Darryl Wagner
bcwalsh@deloitte.co.uk Deloitte Consulting LLP
dawagner@deloitte.com
Global Organization Transformation
and Talent leader Global Employment Services leader
Dimple Agarwal Nichola Holt
Deloitte MCS Limited Deloitte Tax LLP
dagarwal@deloitte.co.uk nicholt@deloitte.com

Global HR Transformation leader Global Human Capital leader, Marketing,


Michael Stephan Eminence, and Brand
Deloitte Consulting LLP -H6FKZDUW]
mstephan@deloitte.com Deloitte Consulting LLP
MHVFKZDUW]#GHORLWWHFRP

HUMAN CAPITAL COUNTRY LEADERS

AMERICAS
Americas Argentina
Heather Stockton Leonardo Pena
Deloitte Canada Deloitte & Co. S.A.
hstockton@deloitte.ca lepena@deloitte.com

United States Brazil


Erica Volini Roberta Yoshida
Deloitte Consulting LLP Deloitte Consultores
evolini@deloitte.com royoshida@deloitte.com

Canada Colombia and Peru


-H0RLU Alejandra DAgostino
Deloitte Canada Deloitte & Touche SRL
jmoir@deloitte.ca aldagostino@deloitte.com

Chile Costa Rica


Jaime Valenzuela Paula Lenero
Deloitte Audit y Consult. Deloitte & Touche S.A.
jvalenzuela@deloitte.com plenero@deloitte.com

Mexico
Tomas Fernandez
Deloitte Consulting Mexico
tofernandez@deloittemx.com


2017 Deloitte Global Human Capital Trends

AMERICAS (CONT.)

Dutch Caribbean Panama


Maghalie van der Bunt Jessika Malek
Deloitte Dutch Caribbean Deloitte Consultores
mvanderbunt@deloitte.com jmalek@deloitte.com

Ecuador Uruguay, LATCO


Roberto Estrada Vernica Melin
Andeanecuador Consultores Deloitte SC
restrada@deloitte.com vmelian@deloitte.com

ASIA PACIFIC

$VLD3DFLF &KLQD Korea


Jungle Wong Eric Seok Hoon Yang
Deloitte Consulting (Shanghai) Co. Ltd, Deloitte Consulting
Beijing Branch seoyang@deloitte.com
junglewong@deloitte.com.cn
New Zealand
Australia Hamish Wilson
David Brown Deloitte
Deloitte Touche Tohmatsu hawilson@deloitte.co.nz
davidbrown@deloitte.com.au
Southeast Asia
India Mark Maclean
Gaurav Lahiri Deloitte Consulting Pte Ltd
Deloitte India mmaclean@deloitte.com
gauravlahiri@deloitte.com

Japan
Akio Tsuchida
Deloitte Tohmatsu Consulting Co. Ltd
akitsuchida@tohmatsu.co.jp


Rewriting the rules for the digital age

EUROPE, MIDDLE EAST, AND AFRICA

EMEA France
Ardie Van Berkel Philippe Burger
Deloitte Consulting BV Deloitte Conseil
avanberkel@deloitte.nl phburger@deloitte.fr

United Kingdom Germany


Anne-Marie Malley 8GR%RKGDO6SLHJHOKR
Deloitte MCS Limited Deloitte Consulting GmbH
amalley@deloitte.co.uk ubohdal@deloitte.de

Africa Ireland
Abrie Olivier Valarie Daunt
Deloitte Consulting Pty Deloitte & Touche
aolivier@deloitte.co.za vdaunt@deloitte.ie

Austria Israel
Christian Havranek Zohar Yami
Deloitte Austria Brightman Almagor Zohar & Co.
chavranek@deloitte.at zyami@deloitte.co.il

Belgium Italy
Yves van Durme Lorenzo Manganini
Deloitte Consulting Deloitte Consulting SRL
yvandurme@deloitte.com lmanganini@deloitte.it

Central Europe Kenya


Evzen Kordenko George Hapisu
Deloitte Advisory s.r.o. Deloitte Consulting Ltd
ekordenko@deloittece.com ghapisu@deloitte.co.ke

CIS Luxembourg
*XOD$\XSRYD Basil Sommerfeld
CJSC Deloitte & Touche CIS Deloitte Tax & Consulting
gayupova@deloitte.ru bsommerfeld@deloitte.lu

Cyprus Middle East


George Pantelides Ghassan Turqieh
Deloitte Ltd Deloitte & Touche (M.E.)
gpantelides@deloitte.com gturqieh@deloitte.com

Denmark and Nordics Netherlands


Filip Gilbert Petra Tito
Deloitte Denmark Deloitte Consulting BV
fgilbert@deloitte.dk ptito@deloitte.nl

Finland Norway
Eva Tuominen Eva Gjovikli
Deloitte Oy Deloitte AS
HYDWXRPLQHQ#GHORLWWH egjovikli@deloitte.no


2017 Deloitte Global Human Capital Trends

EUROPE, MIDDLE EAST, AND AFRICA

Poland
0LFKD2OEU\FKRZVNL
Deloitte Business Consulting S.A.
molbrychowski@deloittece.com

Portugal
Jos Subtil
Deloitte Consultores, S.A.
jsubtil@deloitte.pt

Spain
Enrique de la Villa
Deloitte Advisory, S.L.
edelavilla@deloitte.es

Sweden
Jonas Malmlund
Deloitte Sweden
jmalmlund@deloitte.se

Switzerland
Myriam Denk
Deloitte Consulting Switzerland
mydenk@deloitte.ch

Turkey
Tolga Yaveroglu
Deloitte Turkey
tyaveroglu@deloitte.com


Follow @DU_Press
Sign up for Deloitte University Press updates at www.dupress.deloitte.com.

About Deloitte University Press


Deloitte University Press publishes original articles, reports and periodicals that provide insights for businesses, the public
sector and NGOs. Our goal is to draw upon research and experience from throughout our professional services organization,
and that of coauthors in academia and business, to advance the conversation on a broad spectrum of topics of interest to
executives and government leaders.
Deloitte University Press is an imprint of Deloitte Development LLC.

About this publication


7KLVSXEOLFDWLRQFRQWDLQVJHQHUDOLQIRUPDWLRQRQO\DQGQRQHRI'HORLWWH7RXFKH7RKPDWVX/LPLWHGLWVPHPEHUUPVRULWV
DQGWKHLUDOLDWHVDUHE\PHDQVRIWKLVSXEOLFDWLRQUHQGHULQJDFFRXQWLQJEXVLQHVVQDQFLDOLQYHVWPHQWOHJDOWD[RURWKHU
professional advice or services. This publication is not a substitute for such professional advice or services, nor should it be
XVHGDVDEDVLVIRUDQ\GHFLVLRQRUDFWLRQWKDWPD\DHFW\RXUQDQFHVRU\RXUEXVLQHVV%HIRUHPDNLQJDQ\GHFLVLRQRUWDNLQJ
DQ\DFWLRQWKDWPD\DHFW\RXUQDQFHVRU\RXUEXVLQHVV\RXVKRXOGFRQVXOWDTXDOLHGSURIHVVLRQDODGYLVHU
1RQHRI'HORLWWH7RXFKH7RKPDWVX/LPLWHGLWVPHPEHUUPVRULWVDQGWKHLUUHVSHFWLYHDOLDWHVVKDOOEHUHVSRQVLEOHIRUDQ\
loss whatsoever sustained by any person who relies on this publication.

About Deloitte
Deloitte refers to one or more of Deloitte Touche Tohmatsu Limited, a UK private company limited by guarantee (DTTL), its
QHWZRUNRIPHPEHUUPVDQGWKHLUUHODWHGHQWLWLHV'77/DQGHDFKRILWVPHPEHUUPVDUHOHJDOO\VHSDUDWHDQGLQGHSHQGHQW
entities. DTTL (also referred to as Deloitte Global) does not provide services to clients. In the United States, Deloitte refers to
RQHRUPRUHRIWKH86PHPEHUUPVRI'77/WKHLUUHODWHGHQWLWLHVWKDWRSHUDWHXVLQJWKH'HORLWWHQDPHLQWKH8QLWHG6WDWHV
DQGWKHLUUHVSHFWLYHDOLDWHV&HUWDLQVHUYLFHVPD\QRWEHDYDLODEOHWRDWWHVWFOLHQWVXQGHUWKHUXOHVDQGUHJXODWLRQVRISXEOLF
accounting. Please see www.deloitte.com/aboutWROHDUQPRUHDERXWRXUJOREDOQHWZRUNRIPHPEHUUPV
Copyright 2017 Deloitte Development LLC. All rights reserved.
Member of Deloitte Touche Tohmatsu Limited