Vous êtes sur la page 1sur 462

Table Of Contents

TableOfContents..................................1 DecipherScript(Int;TrainedOnly) BrewPotion[ItemCreation]..........93


TheBasics.............................................2 ......................................................64 Cleave[General]............................94
TheCoreMechanic..........................2 Diplomacy(Cha)............................64 CombatCasting[General]..............94
Dice..................................................2 DisableDevice(Int;TrainedOnly).65 CombatExpertise[General]...........94
RoundingFractions..........................2 Disguise(Cha)...............................66 CombatReflexes[General]............94
Multiplying.......................................3 EscapeArtist(Dex;ArmorCheck CraftMagicArmsAndArmor[Item
CharacterCreation................................3 Penalty).........................................67 Creation]........................................94
StepbyStep.....................................3 Forgery(Int)..................................68 CraftRod[ItemCreation]..............95
RecordKeeping................................4 GatherInformation(Cha)..............69 CraftStaff[ItemCreation].............95
CharacterAdvancement........................5 HandleAnimal(Cha;TrainedOnly) CraftWand[ItemCreation]...........95
EarningExperience..........................5 ......................................................69 CraftWondrousItem[ItemCreation]
ExperienceRequiredbyCharacter Heal(Wis).....................................71 ......................................................95
Level................................................6 Hide(Dex;ArmorCheckPenalty). .72 Deceitful[General]........................96
ApplyingtheEffectsofExperience. ..6 Intimidate(Cha)............................73 DeflectArrows[General]...............96
AbilityScores........................................8 Jump(Str;ArmorCheckPenalty). .73 DeftHands[General].....................96
AbilityModifiers...............................8 Knowledge(Int;TrainedOnly)......75 Diehard[General]..........................96
AbilitiesandSpellcasters..................9 Listen(Wis)...................................76 Diligent[General]..........................96
TheAbilities.....................................9 MoveSilently(Dex;ArmorCheck Dodge[General]............................96
ChangingAbilityScores..................11 Penalty).........................................77 EmpowerSpell[Metamagic]..........97
Races...................................................11 OpenLock(Dex;TrainedOnly).....77 Endurance[General]......................97
FavoredClass.................................11 Perform(Cha)................................77 EnlargeSpell[Metamagic].............97
RaceandLanguages.......................11 Profession(Wis;TrainedOnly)......78 EschewMaterials[General]...........97
SmallCharacters............................11 Ride(Dex).....................................79 ExoticWeaponProficiency[General]
Humans..........................................11 Search(Int)...................................80 ......................................................97
Dwarves.........................................12 SenseMotive(Wis)........................81 ExtendSpell[Metamagic]..............98
Elves..............................................12 SleightOfHand(Dex;TrainedOnly; ExtraTurning[General].................98
Gnomes..........................................13 ArmorCheckPenalty)....................81 FarShot[General].........................98
HalfElves.......................................13 SpeakLanguage(None;Trained ForgeRing[ItemCreation]............98
HalfOrcs........................................14 Only).............................................82 GreatCleave[General]..................99
Halflings.........................................14 Spellcraft(Int;TrainedOnly).........83 GreatFortitude[General]..............99
Classes................................................14 Spot(Wis).....................................84 GreaterSpellFocus[General]........99
Barbarian.......................................14 Survival(Wis)................................85 GreaterSpellPenetration[General]
Bard...............................................17 Swim(Str;ArmorCheckPenalty). .85 ......................................................99
Cleric..............................................21 Tumble(Dex;TrainedOnly;Armor GreaterTwoWeaponFighting
Druid..............................................24 CheckPenalty)...............................86 [General].......................................99
Fighter...........................................29 UseMagicDevice(Cha;Trained GreaterWeaponFocus[General]. . .99
Monk..............................................30 Only).............................................87 GreaterWeaponSpecialization
Paladin...........................................34 UseRope(Dex)..............................89 [General].....................................100
Ranger...........................................38 Feats...................................................89 HeightenSpell[Metamagic].........100
Rogue.............................................41 Prerequisites..................................89 ImprovedBullRush[General]......100
Sorcerer.........................................43 TypesOfFeats................................89 ImprovedCounterspell[General].100
Wizard...........................................45 FeatDescriptions...........................91 ImprovedCritical[General].........100
Description..........................................50 Acrobatic[General].......................92 ImprovedDisarm[General].........101
Alignment......................................50 Agile[General]..............................92 ImprovedFamiliar[General]........101
VitalStatistics.................................53 Alertness[General]........................92 ImprovedFeint[General].............102
Skills...................................................54 AnimalAffinity[General]..............92 ImprovedGrapple[General]........102
SkillsSummary..............................54 ArmorProficiency(Heavy)[General] ImprovedInitiative[General].......102
SkillDescriptions............................56 ......................................................92 ImprovedOverrun[General].......102
Appraise(Int).................................57 ArmorProficiency(Light)[General] ImprovedPreciseShot[General] .103
Balance(Dex;ArmorCheckPenalty) ......................................................92 ImprovedShieldBash[General]. .103
......................................................58 ArmorProficiency(Medium) ImprovedSunder[General].........103
Bluff(Cha).....................................59 [General].......................................92 ImprovedTrip[General]..............103
Climb(Str;ArmorCheckPenalty). .60 Athletic[General]..........................93 ImprovedTurning[General]........104
Concentration(Con)......................61 AugmentSummoning[General]....93 ImprovedTwoWeaponFighting
Craft(Int)......................................62 BlindFight[General].....................93 [General].....................................104

Page1of462
ImprovedUnarmedStrike[General] SelfSufficient[General]..............111 Equipment.........................................117
....................................................104 ShieldProficiency[General]........111 WealthandMoney.......................117
Investigator[General]..................105 ShotOnTheRun[General].........111 Weapons.......................................118
IronWill[General].......................105 SilentSpell[Metamagic]..............111 Armor...........................................123
Leadership[General]...................105 SimpleWeaponProficiency[General] GoodsandServices......................125
LightningReflexes[General]........106 ....................................................112 Combat.............................................133
MagicalAptitude[General]..........106 SkillFocus[General]....................112 HowCombatWorks.....................133
Manyshot[General].....................106 SnatchArrows[General].............112 CombatStatistics..........................133
MartialWeaponProficiency SpellFocus[General]...................112 ActionsinCombat........................137
[General].....................................107 SpellMastery[Special]................112 InjuryAndDeath..........................145
MaximizeSpell[Metamagic]........107 SpellPenetration[General].........113 Movement,Position,AndDistance
Mobility[General].......................107 SpiritedCharge[General]............113 ....................................................147
MountedArchery[General].........108 SpringAttack[General]...............113 CombatModifiers.........................150
MountedCombat[General].........108 Stealthy[General].......................113 Cover...........................................150
NaturalSpell[General]................108 StillSpell[Metamagic]................113 Concealment................................151
Negotiator[General]....................108 StunningFist[General]...............113 Flanking.......................................152
NimbleFingers[General].............108 Toughness[General]....................114 HelplessDefenders.......................152
Persuasive[General]....................108 TowerShieldProficiency[General] SpecialAttacks.............................152
PointBlankShot[General]..........108 ....................................................114 SpecialInitiativeActions..............162
PowerAttack[General]................109 Track[General]...........................114 SpecialAbilitiesandConditions........163
PreciseShot[General].................109 Trample[General].......................115 SpecialAbilityTypes.....................163
QuickDraw[General]..................109 TwoWeaponDefense[General]...115 SpecialAbilities............................163
QuickenSpell[Metamagic]..........109 TwoWeaponFighting[General]. .116 Conditions....................................176
RapidReload[General]................110 WeaponFinesse[General]...........116 SpellCasting.....................................180
RapidShot[General]...................110 WeaponFocus[General]..............116 SpellList......................................180
RideByAttack[General].............110 WeaponSpecialization[General].116 Spells...........................................218
Run[General]..............................110 WhirlwindAttack[General].........117
ScribeScroll[ItemCreation]........111 WidenSpell[Metamagic]............117

The Basics
TheCoreMechanic
Wheneveryouattemptanactionthathassomechanceoffailure,yourollatwentysideddie(d20).Todetermineifyour
charactersucceedsatataskyoudothis:
Rollad20.
Addanyrelevantmodifiers.
Comparetheresulttoatargetnumber.
Iftheresultequalsorexceedsthetargetnumber,yourcharactersucceeds.Iftheresultislowerthanthetargetnumber,you
fail.

Dice
Dicerollsaredescribedwithexpressionssuchas3d4+3,whichmeansrollthreefoursideddiceandadd3(resultingin
anumberbetween6and15).Thefirstnumbertellsyouhowmanydicetoroll(addingtheresultstogether).Thenumber
immediatelyafterthedtellsyouthetypeofdietouse.Anynumberafterthatindicatesaquantitythatisaddedor
subtractedfromtheresult.
d%:Percentilediceworkalittledifferently.Yougenerateanumberbetween1and100byrollingtwodifferenttensided
dice.One(designatedbeforeyouroll)isthetensdigit.Theotheristheonesdigit.Two0srepresent100.

RoundingFractions
Ingeneral,ifyouwindupwithafraction,rounddown,evenifthefractionisonehalforlarger.
Exception:Certainrolls,suchasdamageandhitpoints,haveaminimumof1.

Page2of462
Multiplying
Sometimesarulemakesyoumultiplyanumberoradieroll.Aslongasyoureapplyingasinglemultiplier,multiplythe
numbernormally.Whentwoormoremultipliersapplytoanyabstractvalue(suchasamodifieroradieroll),however,
combinethemintoasinglemultiple,witheachextramultipleadding1lessthanitsvaluetothefirstmultiple.Thus,a
double(2)andadouble(2)appliedtothesamenumberresultsinatriple(3,because2+1=3).
Whenapplyingmultiplierstorealworldvalues(suchasweightordistance),normalrulesofmathapplyinstead.Acreature
whosesizedoubles(thusmultiplyingitsweightby8)andthenisturnedtostone(whichwouldmultiplyitsweightbya
factorofroughly3)nowweighsabout24timesnormal,not10timesnormal.Similarly,ablindedcreatureattemptingto
negotiatedifficultterrainwouldcounteachsquareas4squares(doublingthecosttwice,foratotalmultiplierof4),
ratherthanas3squares(adding100%twice).

Character Creation
StepbyStep
Thereareseveralstepstocreatinganewcharacter.ThemostimportantistodiscussyourcharacterwiththeGameMaster
beforeyoubegin.Theymayhavespecialrulesorrestrictionsyouwillneedtofollowinadditiontothestepsoutlinedhere.
TheGMalwayshasthefinalwordonhowcharactersarecreatedwithinaparticulargame.Charactercreationmeansthe
processofassigninginitialscorestoabilities,selectingarace,selectingastartingclass,assigninginitialskillpoints,
selectinginitialfeats,andpickinganinitialalignment.Ifthecharacterisaspellcaster,theyshouldchoosetheirSpellsat
thispoint.ThenbuysomeEquipmentandfleshoutyourcharacterabitwithanameandafewdetailsabouttheirpersonal
appearanceheight,weight,hairandeyecolor,andperhapsabriefdescriptionoftheirpersonalityandbackground.More
detailedguidelinesforeachofthesetasksareoutlinedbelow.

AssigningAbilityScores
Thereareseveralmethodsforassigningabilityscores.Thesimplistmethodistoroll3d6foreachofthesixstats,inorder.
Whilethiscreatesabilityscoresintheproperhumanrange,itoftenresultsinacharacterthatispoorlysuitedfora
particularClass,orpoorlysuitedtoadventuringingeneral.Severalothermethodsexistwhichwillresultincharactersthat
aremuchmorelikelytosucceedinthegame.Twoofthemostpopularmethodsarelistedbelow:
Roll3d6twelvetimes,keepingthebest6rollsandassigningtheminanyordertheplayerwishes.
Roll4d6sixtimes,discardingthelowestdiefromeachrollandassigningtheminanyordertheplayerwishes.
BothofthesemethodswillcreatesacharacterwellsuitedtowhicheverClassyouchoose,who'sabilityscoresareslightly
aboveaverageperfectforaheroorheroine.Othermethodsarecertainlypossible,andplayersareencouragedto
experimentwiththeirownmethods.Playersshouldagreeonthemethodtheywilluseaheadoftime,andallplayersina
particulargameshouldcreatetheircharactersusingthesamemethod.
OnceeachAbilityScorehasbeenassignedyoushouldnotethemodifierassociatedwitheachscoreandkeepthesehandy
throughoutthecharactercreationprocess.SeetheAbilityScoressectionformoreinformationaboutAbilityScore
modifiers.

SelectingaRace
LookoverthevariousracesacceptableforplayercharactersintheRacessectionandchooseone,keepinginmindthesort
ofthingsyou'dlikeyourcharactertoplay.Certainraceshaveanaturalaffinityforcertainclasses,knowasthatrace's
FavoredClass.Thoughitisnotrequiredthatacharacterofagivenracechoosetheirrace'sFavoredClassatthebeginning
oftheircareer,mostcharacterswillchoosetopickupalevelortwooftheirrace'sFavoredClassatsomepointintheir
career.Payattentiontotherace'sspecialabilities,makingsurethattheyareconsistentwiththesortofcharacteryouwould
liketoplay.
Onceyouhaveexaminedallyouroptions,choosearaceforyourcharacter.NotetheRace'sPreferredClassandanyspecial
abilitiestheymighthave.AlsoapplyanyRacialadjustmentsthatneedtobemadetothecharacter'sabilityscores.

SelectingaClass
Nowit'stimetochooseastartingClassforyourcharacter.Aclassisakindofpackageofskillsandspecialtalentsavailable
tothecharacter.Overtimeacharactermaychoosetoadvanceinmoreoneormoreadditionalclasses,butinthebeginning
theymayonlystartwithone.LookoverthelistofBasicCharacterClassesandchooseonethatseemstofitthekindsof
skillsandabilitiesyou'dlikeyourcharactertohave.Certainclassesmayhavespecialrequirements,besureyoumeetthose

Page3of462
requirementsbeforechoosingoneofthoseclasses.
OnceyouhavechosenyourinitialClass,notetheClass'srestrictions,hitdice,skills,andanyspecialabilitiesitmighthave.
CharactersbeginthegamewiththemaximumnumberofhitpointspossiblefortheirClassasadjustedbytheirConsitution
modifier.

SelectingSkills
OnceaClassischosenitistimetopickthecharacter'sskills.ConsulttheStartingSkillPointstableintheSkillssectionto
seehowmanyskillpointsthecharacterreceivesatfirstlevel.Besuretoincludeanybonusesorpenaltiesforthecharacter's
Intelligencescore.Skillpointsarespentbuyingskillranks.Dependingonacharacters'raceandclass,someskillsare
considered"class"skills,someskillsareconsidered"crossclass"skills,andsomeareconsidered"restricted"skills.Classskills
cost1skillpointperrank,crossclassskillsrequire2skillpointsperrank,andrestrictedskillsareunavailabletothe
character.Regardlessofwhetheraskillisaclassskilloracrossclassskill,acharactermayonlyspendanumberofskill
pointsonagivenskillisequaltotheircharacterlevel+3.Besuretospendallofyourskillpointsanyskillpointsnot
spentarelost.Itispossibletospendanoddnumberofskillpointsonacrossclassskills,resultinginanextra"halfrank"in
thatskill.These"halfranks"shouldbenotedforrecordkeepingandskilladvancementpurposes,buthavenoothereffect
ongameplay.Treatthemasiftheydidnotexistforpurposesofallskillchecks.

SelectingFeats
EverycharacterbeginsthegamewithatleastoneFeat.Dependingonthecharacter'sRaceandClass,theymaybeentitled
tomore.SomeFeatshaveprerequisites,whichmustbemetbeforethatFeatcanbechosen.CertainClasseshavespecial
abilitiesthatduplicatetheeffectsofFeatsthesespecialabilitiescanbeusedtosatisfytheseprerequisitesifnecessary.Look
overthelistoffeatsintheFeatssection,andchoosetheonesthatseemtofityourideaofthecharacter.Ifyoudonotmeet
theprerequisitesforaparticularfeatrightnow,workbackwardstodeterminewhichfeatorfeatsyouwillneedtotakenow
sothatyoumightbeabletotakethatfeatatsomepointinthefuture.Beawarethatmostcharactersneverearnmorethan
6featsbeforetheyretire(thoughsomeclassesmayearnconsiderablymore).
Onceyouhavechosenyourfeats,noteanyeffectstheymighthaveongameplaysuchasskillmodifiers,combatmodifiers,
orspecialabilitiestheygrant.

PickinganAlignment
Acharacter'sethosandmoralsarerepresentedingametermsbytheirAlignment.SeethesectiononAlignmentfora
discussionofGoodvs.Evil,andLawvs.Chaos.CertainClasseshavealignmentrestrictionsplacedonthem,whichmustbe
observed.Everycharactermustchooseoneoftheninealignments.

BuyingEquipment
CharactersbeginthegamewithanamountofgoldindicatedbytheirClass.Playersmayeitherrollrandomlytodetermine
theamountofgoldtheystartwithortheymaypickthedefaultamountfortheirClass.Playerscanthenbuyclothing,
weapons,armor,andotherequipmentfromthetablesintheEquipmentsection.CheckwiththeGameMastertoseeifany
oftheequipmentlistedonthosetablesareprohibitedtofirstlevelcharacters.Notethatcharactersdonotactuallybegin
thegamewithapileofgold,butrathertheybeginwithgoodstheyhaveacquiredofequivalentvalue.Charactersmaynot
keepmorethan10%oftheirstartinggoldanyleftunspentoverthisamountislost.

BackgroundInformation
Nowthatthegamestatisticsareoutoftheway,it'stimetofleshoutthecharacter.Chooseanameforyourcharacter,as
wellasgender,heightandweight,skin,eye,andhaircolor,andanyotherinformationthatmighthelptodefinethe
personalityofthecharacter.Someplayersliketodevelopdetailedbackgroundsfortheircharacters,whileotherspaylittle
attentiontothepastandfocusinsteadonthecharacter'sfuture.

RecordKeeping
Nowitistimetorecordallofthisinformationonacharacterrecordsheet.Makeanoteofallofthecharacter'scombat
modifiers,feats,specialabilities,gear,weightcarried,armorclass,hitpoints,skillmodifiers,andanyotherinformationyou
mightneedduringplay.AstandardCharacterRecordSheetisquiteusefulinhelpingyoudeterminewhichvalueswillbe
usefultoknowtokeepthegamerunningsmoothly.

Page4of462
Character Advancement
EarningExperience
AscharactersembarkonadventuresandovercomethechallengesplacedintheirpathbytheGameMaster,theywilllearn
fromtheirsuccesses(andsometimesfromtheirmistakes).ThisisreflectedingametermsthroughtheawardofExperience
Points.Thenumberofexperiencepointsthecharactersearndependsonthedifficultyofthesituationstheyface.Ingame
terms,thisdifficultyfactoriscalledtheChallengeRatingoftheencounter.TheGMassignstheChallengeRatingofa
situationbasedonseveralfactorsincludingrisktothecharactersandtheoddsofovercomingthechallenge.Asageneral
guide,apartyof4charactersshouldbeabletoovercomeachallengeofaratingequaltotheiraveragelevelbyexpending
approximately20%oftheirresources.
Certainsituationsmayhaveoneormorespecialcircumstancesthatwilltransformarelativelydifficultencounterintoa
relativelyeasyone.Ifthesecircumstancesarecharacterdriven,meaningthatifthecharactersplaytheencounteracertain
way,thenthecharactersshouldearnexperiencebasedonthefullChallengeRatingoftheencounterregardlessofwhether
itwasovercometheeasywayorthehardway.Ifthecircumstancesareessentiallybeyondthecharacter'scontrolthenthey
shouldonlyearnexperiencebasedonthedifficultyofthechallengetheyactuallyfaced.
Todeterminethenumberofexperiencepointsthatshouldbeawardedtoacharacterafterovercomingachallenge,theGM
mustfirstdeterminetheaveragelevelofthepartythatfacedthechallenge.Thisisdonebysimplyaddingupthetotalparty
levelsanddividingbythenumberofcharacters,roundingtowardsthenearestlevel.Theaveragepartylevelisthencross
indexedtotheChallengeRatingusingtheChallengeRatingvsCharacterLevelTable.Theresultingnumberistheamount
ofexperiencepointsawardedtotheentirepartyforthatparticularencounter.Generallytheplayerswillsplitthese
experiencepointsevenlybetweentheircharacters,butinextraordinarycircumstancestheGMmaychoosetodistributethe
pointsinanunevenfashion.
Thetableisdesignedsothatapartyoffourcharactersshouldearnanewexperiencelevelroughlyonceevery131/3
encounters.IftheGMfeelsthatthecharactersareadvancingtooslowlyortooquickly,hemaychoosetoincreaseor
decreasetheamountofexperiencepointsawardedforeachchallenge.Bewarnedthatthiscanhaveatremendouseffecton
theoverallqualityofthegame,andtheGMshouldbewaryofbeingtoogenerousortoostingy.Bothwillresultin
unsatisfyinggameplay.
Thetablewascalculatedusingoneofthreedifferentformulas:
WhereCR=CL,xp=CR*300
WhereCR>CL,xp=CR*300*(1.25^abs(CRCL))
WhereCR<CL,xp=CR*300*(.75^abs(CRCL))
Theresultsofthoseformulaewereroundedtothenearest25.Noexperiencepointsareawardedifthedifferencebetween
theCRandtheCLisgreaterthan7.
Table:ChallengeRatingvs.CharacterLevel(CR1CR10)
CL CR1 CR2 CR3 CR4 CR5 CR6 CR7 CR8 CR9 CR10
1 300 750 1400 2350 3650 5500 8000 11450 0 0
2 225 600 1125 1875 2925 4400 6400 9150 12875 0
3 175 450 900 1500 2350 3525 5125 7325 10300 14300
4 125 350 675 1200 1875 2825 4100 5850 8250 11450
5 100 250 500 900 1500 2250 3275 4700 6600 9150
6 75 200 375 675 1125 1800 2625 3750 5275 7325
7 50 150 275 500 850 1350 2100 3000 4225 5850
8 50 100 225 375 625 1025 1575 2400 3375 4700
9 0 75 150 275 475 750 1175 1800 2700 3750
10 0 0 125 225 350 575 875 1350 2025 3000
11 0 0 0 150 275 425 675 1025 1525 2250
12 0 0 0 0 200 325 500 750 1150 1700
13 0 0 0 0 0 250 375 575 850 1275
14 0 0 0 0 0 0 275 425 650 950
15 0 0 0 0 0 0 0 325 475 700
16 0 0 0 0 0 0 0 0 350 525
17 0 0 0 0 0 0 0 0 0 400
18 0 0 0 0 0 0 0 0 0 0
19 0 0 0 0 0 0 0 0 0 0
20 0 0 0 0 0 0 0 0 0 0
Page5of462
Table:ChallengeRatingvs.CharacterLevel(CR11CR20)
CL CR11 CR12 CR13 CR14 CR15 CR16 CR17 CR18 CR19 CR20
1 0 0 0 0 0 0 0 0 0 0
2 0 0 0 0 0 0 0 0 0 0
3 0 0 0 0 0 0 0 0 0 0
4 15725 0 0 0 0 0 0 0 0 0
5 12600 17175 0 0 0 0 0 0 0 0
6 10075 13725 18600 0 0 0 0 0 0 0
7 8050 10975 14875 20025 0 0 0 0 0 0
8 6450 8800 11900 16025 21450 0 0 0 0 0
9 5150 7025 9525 12825 17175 22900 0 0 0 0
10 4125 5625 7625 10250 13725 18300 24325 0 0 0
11 3300 4500 6100 8200 10975 14650 19450 25750 0 0
12 2475 3600 4875 6575 8800 11725 15575 20600 27175 0
13 1850 2700 3900 5250 7025 9375 12450 16475 21750 28600
14 1400 2025 2925 4200 5625 7500 9950 13175 17400 22900
15 1050 1525 2200 3150 4500 6000 7975 10550 13925 18300
16 775 1150 1650 2375 3375 4800 6375 8450 11125 14650
17 575 850 1225 1775 2525 3600 5100 6750 8900 11725
18 450 650 925 1325 1900 2700 3825 5400 7125 9375
19 0 475 700 1000 1425 2025 2875 4050 5700 7500
20 0 0 525 750 1075 1525 2150 3050 4275 6000

ExperienceRequiredbyCharacterLevel
Toearnanewexperiencelevel,acharactermustearnanumberofexperiencepointsequalto1000timestheircurrent
level.Thiscanalsobeexpressedthroughthefollowingformula:xp=(500*CL^2)(500*CL).
TheExperienceRequiredbyCharacterLevelTabledeterminestheexperiencepointsrequiredtoearnanewcharacterlevel.
Table:ExperienceRequiredbyCharacterLevel
CHARACTERLEVEL REQUIREDEXPERIENCE
1 0
2 1000
3 3000
4 6000
5 10000
6 15000
7 21000
8 28000
9 36000
10 45000
11 55000
12 66000
13 78000
14 91000
15 105000
16 120000
17 136000
18 153000
19 171000
20 190000

ApplyingtheEffectsofExperience
EachtimeacharacterearnsadditionalexperiencepointstheyshouldcomparetheirnewexperiencepointtotaltotheLevel
Advancementchartbelow.Iftheirpointtotalexceedstheminimumrequiredforthenextlevelthenthecharacterhas
earnedanewlevel.Thisisdonebyeitherincrementingthecharacterlevelofacharacterbyincrementingaclasslevelby
onerankorbyaddinganewclassatfirstlevel.Theprocessofeitherincrementinganexistingclassoraddinganew1st
levelclassiscollectivelycalled'takingalevel'inthatclass.

TakingaLevelinanExistingClass
Whenaplayertakesalevelinanexistingclass,thatcharacterisentitledtoallocatenewskillpoints,andmayalsobeable
toselectnewfeatsorgainnewclasslevellinkedabilities.Thenumberofskillpointsacharacterearnsisbasedontheclass

Page6of462
taken;seethesectiononcharacterclassestodeterminehowmanynewskillpointsyoumayallocate.Skillpointsmaybe
allocatedtoneworexistingskills,buttheplayermayneverspendanumberofskillpointsmorethan3plustheirCharacter
Levelinanygivenskill.Consultthechartofleveldependentabilitiesfortheirnewclassleveltodetermineifthecharacter
earnsanynewfeatsorgainsanynewspecialabilities.

TakingaLevelinaNewClass
Whenaplayertakesalevelinanewclassisverysimilartotakingalevelinanexistingclass.Thecharactergainsanumber
ofskillpointsbasedontheirnewclass,andmaygainanadditionalfeatorcertainclassleveldependentspecialabilities.
ThecharacterdoesNOTgainthebonusfeatorbonusskillpointsnormallyawardedtocharacterswhentheytaketheirfirst
levelintheirinitialclass,nordoesthecharacterautomaticallygainthemaximumnumberofhitpointspossibleforthat
class.AcharacterwithmorethanoneclassiscalledaMultiClasscharacter,andusespecialrulesforcombiningtheabilities
ofthecharacter'svariousclasses.SeethesectiononMulticlassCharactersfordetailsontheserules.

GeneralRulesforTakingaLevel
Regardlessofwhethertheplayerchoosestotakealevelinanexistingclassorinanewclass,thecharactermayalsoearn
additionalfeatsortheopportunitytoincrementoneofthecharacter'sabilityscores.Acharacterearnsanewfeatevery
threelevelsat3rd,6th,9th,12th,15th,and18thlevel.Thiscanbeanyfeatforwhichthecharactermeetsthe
prerequisites.Acharactermayincrementoneabilityscorebyonepointeveryfourlevels,at4th,8th,12th,16th,and20th
level.Abilityscoresraisedinthismannermayexceedthenormalmaximumvaluesfortheirrace.Notethatacharacter
earnsthesenewabilitiesbasedontheirCharacterLevelandnottheirClassLevel.SeethesectiononMulticlasscharacters
formoreinformationaboutCharacterLevel.

MulticlassCharacters
Acharactermayaddnewclassesasheorsheprogressesinlevel,thusbecomingamulticlasscharacter.Theclassabilities
fromacharactersdifferentclassescombinetodetermineamulticlasscharactersoverallabilities.Multiclassingimprovesa
charactersversatilityattheexpenseoffocus.

MulticlassFeaturesException
Acharacterthatacquiresthebarbarianclassdoesnotbecomeilliterate.
Theabilitiesofamulticlasscharacterarethesumoftheabilitiesofeachofthecharacter'sclasses.

Level
Characterlevelisacharacterstotalnumberoflevels.Itisusedtodeterminewhenfeatsandabilityscoreboostsare
gained.
Classlevelisacharacterslevelinaparticularclass.Foracharacterwhoselevelsareallinthesameclass,characterlevel
andclasslevelarethesame.

HitDice
Acharactergainshitdicefromeachclassashisorherclasslevelincreases,addingthenewhitpointsgainedtothe
previoustotal.

BaseAttackBonus
Addthebaseattackbonusesforeachclasstogetthecharacter'sbaseattackbonus.Ifthecharacter'sBaseAttackBonusis
+6orhigher,thecharactergetsmultipleattacks.Findthebaseattackvaluetoseehowmanyadditionalattacksthe
charactergetsandatwhatbonuses.

SavingThrows
Addthebasesavebonusesforeachclasstogether.

Skills
Thecharacterretainsandcanaccessskillsfromallhisorherclasses.Ifacharacterhasspentskillpointsonaparticularskill
inmorethanoneclass,thoseranksareaddedtogether.Thisisirrespectiveofwhetherthoserankswereearnedasclassor
crossclassskills.Forexample,acharacterwith3levelsinRogueand2levelsinFighterhasspent6skillpointsinHideasa
Rogue,givinghim6ranks,and2skillpointsinHideasaFighter,givinghimonemorerank(becauseHideisacrossclass
skillforFighters).Thismeansthatalthoughthecharacterhasspentatotalof8skillpointsontheirHideskill,theyhave
onlyearned7ranksinthatskill.
Ifaskillisaclassskillforanyofamulticlasscharactersclasses,thencharacterleveldeterminesaskillsmaximumrank.
(Themaximumrankforaclassskillis3+characterlevel.)

Page7of462
Ifaskillisnotaclassskillforanyofamulticlasscharactersclasses,themaximumrankforthatskillisonehalfthe
maximumforaclassskill.

ClassFeatures
Amulticlasscharactergetsalltheclassfeaturesofallhisorherclassesbutmustalsosuffertheconsequencesofthespecial
restrictionsofallhisorherclasses.(Exception:Acharacterwhoacquiresthebarbarianclassdoesnotbecomeilliterate.)
Inthespecialcaseofturningundead,bothclericsandexperiencedpaladinshavethesameability.Ifthecharacterspaladin
levelis4thorhigher,hereffectiveturninglevelisherclericlevelplusherpaladinlevelminus3.
Inthespecialcaseofuncannydodge,bothexperiencedbarbariansandexperiencedrogueshavethesameability.Whena
barbarian/roguewouldgainuncannydodgeasecondtime(forhersecondclass),sheinsteadgainsimproveduncanny
dodge,ifshedoesnotalreadyhaveit.Herbarbarianandroguelevelsstacktodeterminetheroguelevelanattackerneeds
toflankher.
Inthespecialcaseofobtainingafamiliar,bothwizardsandsorcerershavethesameability.Asorcerer/wizardstackshis
sorcererandwizardlevelstodeterminethefamiliarsnaturalarmor,Intelligencescore,andspecialabilities.

Feats
Amulticlasscharactergainsfeatsbasedoncharacterlevels,regardlessofindividualclasslevel

AbilityIncreases
Amulticlasscharactergainsabilityscoreincreasesbasedoncharacterlevel,regardlessofindividualclasslevel.

Spells
Thecharactergainsspellsfromallofhisorherspellcastingclassesandkeepsaseparatespelllistforeachclass.Ifaspells
effectisbasedontheclasslevelofthecaster,theplayermustkeeptrackofwhichclasssspelllistthecharacteriscasting
thespellfrom.

FavoredClass
AracewithaFavoredMulticlassofAnytreatstheirhighestlevelclassastheirFavoredClass.

Ability Scores
AbilityModifiers
Eachability,afterchangesmadebecauseofrace,hasamodifierrangingfrom5to+5.Table:AbilityModifiersshowsthe
modifierforeachscore.Table:BonusSpellsshowsbonusspells,whichyoullneedtoknowaboutifyourcharacterisa
spellcaster.
Themodifieristhenumberyouapplytothedierollwhenyourcharactertriestodosomethingrelatedtothatability.You
alsousethemodifierwithsomenumbersthatarentdierolls.Apositivemodifieriscalledabonus,andanegativemodifier
iscalledapenalty.
Table:AbilityModifiers
SCORE MODIFIER
1 5
23 4
45 3
67 2
89 1
1011 0
1213 +1
1415 +2
1617 +3
1819 +4
2021 +5
2223 +6
2425 +7
2627 +8
2829 +9
3031 +10
3233 +11

Page8of462
SCORE MODIFIER
3435 +12
3637 +13
3839 +14
4041 +15
4243 +16
4445 +17
etc...
Table:BonusSpells
SCORE 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1 Cantcastspellstiedtothisability
23 Cantcastspellstiedtothisability
45 Cantcastspellstiedtothisability
67 Cantcastspellstiedtothisability
89 Cantcastspellstiedtothisability
1011
1213 1
1415 1 1
1617 1 1 1
1819 1 1 1 1
2021 2 1 1 1 1
2223 2 2 1 1 1 1
2425 2 2 2 1 1 1 1
2627 2 2 2 2 1 1 1 1
2829 3 2 2 2 2 1 1 1 1
3031 3 3 2 2 2 2 1 1 1
3233 3 3 3 2 2 2 2 1 1
3435 3 3 3 3 2 2 2 2 1
3637 4 3 3 3 3 2 2 2 2
3839 4 4 3 3 3 3 2 2 2
4041 4 4 4 3 3 3 3 2 2
4243 4 4 4 4 3 3 3 3 2
4445 5 4 4 4 4 3 3 3 3
etc...

AbilitiesandSpellcasters
Theabilitythatgovernsbonusspellsdependsonwhattypeofspellcasteryourcharacteris:Intelligenceforwizards;
Wisdomforclerics,druids,paladins,andrangers;orCharismaforsorcerersandbards.Inadditiontohavingahighability
score,aspellcastermustbeofhighenoughclassleveltobeabletocastspellsofagivenspelllevel.(Seetheclass
descriptionsfordetails.)

TheAbilities
Eachabilitypartiallydescribesyourcharacterandaffectssomeofhisorheractions.

Strength(STR)
Strengthmeasuresyourcharactersmuscleandphysicalpower.Thisabilityisespeciallyimportantforfighters,barbarians,
paladins,rangers,andmonksbecauseithelpsthemprevailincombat.Strengthalsolimitstheamountofequipmentyour
charactercancarry.
YouapplyyourcharactersStrengthmodifierto:
Meleeattackrolls.
Damagerollswhenusingameleeweaponorathrownweapon(includingasling).(Exceptions:Offhandattacksreceive
onlyonehalfthecharactersStrengthbonus,whiletwohandedattacksreceiveoneandahalftimestheStrengthbonus.
AStrengthpenalty,butnotabonus,appliestoattacksmadewithabowthatisnotacompositebow.)
Climb,Jump,andSwimchecks.ThesearetheskillsthathaveStrengthastheirkeyability.
Strengthchecks(forbreakingdowndoorsandthelike).

Dexterity(DEX)
Dexteritymeasureshandeyecoordination,agility,reflexes,andbalance.Thisabilityisthemostimportantoneforrogues,
Page9of462
butitsalsohighonthelistforcharacterswhotypicallywearlightormediumarmor(rangersandbarbarians)ornoarmor
atall(monks,wizards,andsorcerers),andforanyonewhowantstobeaskilledarcher.
YouapplyyourcharactersDexteritymodifierto:
Rangedattackrolls,includingthoseforattacksmadewithbows,crossbows,throwingaxes,andotherrangedweapons.
ArmorClass(AC),providedthatthecharactercanreacttotheattack.
Reflexsavingthrows,foravoidingfireballsandotherattacksthatyoucanescapebymovingquickly.
Balance,EscapeArtist,Hide,MoveSilently,OpenLock,Ride,SleightofHand,Tumble,andUseRopechecks.Theseare
theskillsthathaveDexterityastheirkeyability.

Constitution(CON)
Constitutionrepresentsyourcharactershealthandstamina.AConstitutionbonusincreasesacharactershitpoints,sothe
abilityisimportantforallclasses.
YouapplyyourcharactersConstitutionmodifierto:
EachrollofaHitDie(thoughapenaltycanneverdroparesultbelow1thatis,acharacteralwaysgainsatleast1hit
pointeachtimeheorsheadvancesinlevel).
Fortitudesavingthrows,forresistingpoisonandsimilarthreats.
Concentrationchecks.Concentrationisaskill,importanttospellcasters,thathasConstitutionasitskeyability.
IfacharactersConstitutionscorechangesenoughtoalterhisorherConstitutionmodifier,thecharactershitpointsalso
increaseordecreaseaccordingly.

Intelligence(INT)
Intelligencedetermineshowwellyourcharacterlearnsandreasons.Thisabilityisimportantforwizardsbecauseitaffects
howmanyspellstheycancast,howhardtheirspellsaretoresist,andhowpowerfultheirspellscanbe.Itsalsoimportant
foranycharacterwhowantstohaveawideassortmentofskills.
YouapplyyourcharactersIntelligencemodifierto:
Thenumberoflanguagesyourcharacterknowsatthestartofthegame.
Thenumberofskillpointsgainedeachlevel.(Butyourcharacteralwaysgetsatleast1skillpointperlevel.)
Appraise,Craft,DecipherScript,DisableDevice,Forgery,Knowledge,Search,andSpellcraftchecks.Thesearetheskills
thathaveIntelligenceastheirkeyability.
AwizardgainsbonusspellsbasedonherIntelligencescore.TheminimumIntelligencescoreneededtocastawizardspell
is10+thespellslevel.
AnanimalhasanIntelligencescoreof1or2.Acreatureofhumanlikeintelligencehasascoreofatleast3.

Wisdom(WIS)
Wisdomdescribesacharacterswillpower,commonsense,perception,andintuition.WhileIntelligencerepresentsones
abilitytoanalyzeinformation,Wisdomrepresentsbeingintunewithandawareofonessurroundings.Wisdomisthemost
importantabilityforclericsanddruids,anditisalsoimportantforpaladinsandrangers.Ifyouwantyourcharactertohave
acutesenses,putahighscoreinWisdom.EverycreaturehasaWisdomscore.
YouapplyyourcharactersWisdommodifierto:
Willsavingthrows(fornegatingtheeffectofcharmpersonandotherspells).
Heal,Listen,Profession,SenseMotive,Spot,andSurvivalchecks.ThesearetheskillsthathaveWisdomastheirkey
ability.
Clerics,druids,paladins,andrangersgetbonusspellsbasedontheirWisdomscores.TheminimumWisdomscoreneeded
tocastacleric,druid,paladin,orrangerspellis10+thespellslevel.

Charisma(CHA)
Charismameasuresacharactersforceofpersonality,persuasiveness,personalmagnetism,abilitytolead,andphysical
attractiveness.Thisabilityrepresentsactualstrengthofpersonality,notmerelyhowoneisperceivedbyothersinasocial
setting.Charismaismostimportantforpaladins,sorcerers,andbards.Itisalsoimportantforclerics,sinceitaffectstheir
Page10of462
abilitytoturnundead.EverycreaturehasaCharismascore.
YouapplyyourcharactersCharismamodifierto:
Bluff,Diplomacy,Disguise,GatherInformation,HandleAnimal,Intimidate,Perform,andUseMagicDevicechecks.
ThesearetheskillsthathaveCharismaastheirkeyability.
Checksthatrepresentattemptstoinfluenceothers.
Turningchecksforclericsandpaladinsattemptingtoturnzombies,vampires,andotherundead.
SorcerersandbardsgetbonusspellsbasedontheirCharismascores.TheminimumCharismascoreneededtocasta
sorcererorbardspellis10+thespellslevel.

ChangingAbilityScores
Whenanabilityscorechanges,allattributesassociatedwiththatscorechangeaccordingly.Acharacterdoesnot
retroactivelygetadditionalskillpointsforpreviouslevelsifsheincreasesherintelligence.

Races
FavoredClass
Acharactersfavoredclassdoesntcountagainsthimorherwhendeterminingexperiencepointpenaltiesformulticlassing.

RaceandLanguages
AllcharactersknowhowtospeakCommon.Adwarf,elf,gnome,halfelf,halforc,orhalflingalsospeaksaraciallanguage,
asappropriate.AcharacterwhohasanIntelligencebonusat1stlevelspeaksotherlanguagesaswell,oneextralanguage
perpointofIntelligencebonusasastartingcharacter.

Literacy
Anycharacterexceptabarbariancanreadandwriteallthelanguagesheorshespeaks.

ClassRelatedLanguages
Clerics,druids,andwizardscanchoosecertainlanguagesasbonuslanguageseveniftheyrenotonthelistsfoundinthe
racedescriptions.Theseclassrelatedlanguagesareasfollows:

Cleric
Abyssal,Celestial,Infernal.

Druid
Sylvan.

Wizard
Draconic.

SmallCharacters
ASmallcharactergetsa+1sizebonustoArmorClass,a+1sizebonusonattackrolls,anda+4sizebonusonHide
checks.ASmallcharacterscarryingcapacityisthreequartersofthatofaMediumcharacter.
ASmallcharactergenerallymovesabouttwothirdsasfastasaMediumcharacter.
ASmallcharactermustusesmallerweaponsthanaMediumcharacter.

Humans
Medium:AsMediumcreatures,humanshavenospecialbonusesorpenaltiesduetotheirsize.
Humanbaselandspeedis30feet.
1extrafeatat1stlevel.
4extraskillpointsat1stleveland1extraskillpointateachadditionallevel.

Page11of462
AutomaticLanguage:Common.BonusLanguages:Any(otherthansecretlanguages,suchasDruidic).SeetheSpeak
Languageskill.
FavoredClass:Any.Whendeterminingwhetheramulticlasshumantakesanexperiencepointpenalty,hisorherhighest
levelclassdoesnotcount.

Dwarves
+2Constitution,2Charisma.
Medium:AsMediumcreatures,dwarveshavenospecialbonusesorpenaltiesduetotheirsize.
Dwarfbaselandspeedis20feet.However,dwarvescanmoveatthisspeedevenwhenwearingmediumorheavyarmor
orwhencarryingamediumorheavyload(unlikeothercreatures,whosespeedisreducedinsuchsituations).
Darkvision:Dwarvescanseeinthedarkupto60feet.Darkvisionisblackandwhiteonly,butitisotherwiselikenormal
sight,anddwarvescanfunctionjustfinewithnolightatall.
Stonecunning:Thisabilitygrantsadwarfa+2racialbonusonSearchcheckstonoticeunusualstonework,suchas
slidingwalls,stoneworktraps,newconstruction(evenwhenbuilttomatchtheold),unsafestonesurfaces,shakystone
ceilings,andthelike.Somethingthatisntstonebutthatisdisguisedasstonealsocountsasunusualstonework.Adwarf
whomerelycomeswithin10feetofunusualstoneworkcanmakeaSearchcheckasifhewereactivelysearching,anda
dwarfcanusetheSearchskilltofindstoneworktrapsasaroguecan.Adwarfcanalsointuitdepth,sensinghis
approximatedepthundergroundasnaturallyasahumancansensewhichwayisup.
WeaponFamiliarity:Dwarvesmaytreatdwarvenwaraxesanddwarvenurgroshesasmartialweapons,ratherthanexotic
weapons.
Stability:Adwarfgainsa+4bonusonabilitychecksmadetoresistbeingbullrushedortrippedwhenstandingonthe
ground(butnotwhenclimbing,flying,riding,orotherwisenotstandingfirmlyontheground).
+2racialbonusonsavingthrowsagainstpoison.
+2racialbonusonsavingthrowsagainstspellsandspelllikeeffects.
+1racialbonusonattackrollsagainstorcsandgoblinoids.
+4dodgebonustoArmorClassagainstmonstersofthegianttype.AnytimeacreaturelosesitsDexteritybonus(ifany)
toArmorClass,suchaswhenitscaughtflatfooted,itlosesitsdodgebonus,too.
+2racialbonusonAppraisechecksthatarerelatedtostoneormetalitems.
+2racialbonusonCraftchecksthatarerelatedtostoneormetal.
AutomaticLanguages:CommonandDwarven.BonusLanguages:Giant,Gnome,Goblin,Orc,Terran,and
Undercommon.
FavoredClass:Fighter.Amulticlassdwarfsfighterclassdoesnotcountwhendeterminingwhetherhetakesan
experiencepointpenaltyformulticlassing

Elves
+2Dexterity,2Constitution.
Medium:AsMediumcreatures,elveshavenospecialbonusesorpenaltiesduetotheirsize.
Elfbaselandspeedis30feet.
Immunitytomagicsleepeffects,anda+2racialsavingthrowbonusagainstenchantmentspellsoreffects.
LowLightVision:Anelfcanseetwiceasfarasahumaninstarlight,moonlight,torchlight,andsimilarconditionsof
poorillumination.Sheretainstheabilitytodistinguishcoloranddetailundertheseconditions.
WeaponProficiency:ElvesreceivetheMartialWeaponProficiencyfeatsforthelongsword,rapier,longbow(including
compositelongbow),andshortbow(includingcompositeshortbow)asbonusfeats.
+2racialbonusonListen,Search,andSpotchecks.Anelfwhomerelypasseswithin5feetofasecretorconcealeddoor
isentitledtoaSearchchecktonoticeitasifshewereactivelylookingforit.
AutomaticLanguages:CommonandElven.BonusLanguages:Draconic,Gnoll,Gnome,Goblin,Orc,andSylvan.
Page12of462
FavoredClass:Wizard.Amulticlasselfswizardclassdoesnotcountwhendeterminingwhethershetakesanexperience
pointpenaltyformulticlassing.

Gnomes
+2Constitution,2Strength.
Small:AsaSmallcreature,agnomegainsa+1sizebonustoArmorClass,a+1sizebonusonattackrolls,anda+4
sizebonusonHidechecks,butheusessmallerweaponsthanhumansuse,andhisliftingandcarryinglimitsarethree
quartersofthoseofaMediumcharacter.
Gnomebaselandspeedis20feet.
LowLightVision:Agnomecanseetwiceasfarasahumaninstarlight,moonlight,torchlight,andsimilarconditionsof
poorillumination.Heretainstheabilitytodistinguishcoloranddetailundertheseconditions.
WeaponFamiliarity:Gnomesmaytreatgnomehookedhammersasmartialweaponsratherthanexoticweapons.
+2racialbonusonsavingthrowsagainstillusions.
Add+1totheDifficultyClassforallsavingthrowsagainstillusionspellscastbygnomes.Thisadjustmentstackswith
thosefromsimilareffects.
+1racialbonusonattackrollsagainstkoboldsandgoblinoids.
+4dodgebonustoArmorClassagainstmonstersofthegianttype.AnytimeacreaturelosesitsDexteritybonus(ifany)
toArmorClass,suchaswhenitscaughtflatfooted,itlosesitsdodgebonus,too.
+2racialbonusonListenchecks.
+2racialbonusonCraft(alchemy)checks.
AutomaticLanguages:CommonandGnome.BonusLanguages:Draconic,Dwarven,Elven,Giant,Goblin,andOrc.In
addition,agnomecanspeakwithaburrowingmammal(abadger,fox,rabbit,orthelike,seebelow).Thisabilityis
innatetognomes.Seethespeakwithanimalsspelldescription.
SpellLikeAbilities:1/dayspeakwithanimals(burrowingmammalonly,duration1minute).AgnomewithaCharisma
scoreofatleast10alsohasthefollowingspelllikeabilities:1/daydancinglights,ghostsound,prestidigitation.Caster
level1st;saveDC10+gnomesChamodifier+spelllevel.
FavoredClass:Bard.Amulticlassgnomesbardclassdoesnotcountwhendeterminingwhetherhetakesanexperience
pointpenalty.

HalfElves
Medium:AsMediumcreatures,halfelveshavenospecialbonusesorpenaltiesduetotheirsize.
Halfelfbaselandspeedis30feet.
Immunitytosleepspellsandsimilarmagicaleffects,anda+2racialbonusonsavingthrowsagainstenchantmentspells
oreffects.
LowLightVision:Ahalfelfcanseetwiceasfarasahumaninstarlight,moonlight,torchlight,andsimilarconditionsof
poorillumination.Sheretainstheabilitytodistinguishcoloranddetailundertheseconditions.
+1racialbonusonListen,Search,andSpotchecks.
+2racialbonusonDiplomacyandGatherInformationchecks.
ElvenBlood:Foralleffectsrelatedtorace,ahalfelfisconsideredanelf.
AutomaticLanguages:CommonandElven.BonusLanguages:Any(otherthansecretlanguages,suchasDruidic).
FavoredClass:Any.Whendeterminingwhetheramulticlasshalfelftakesanexperiencepointpenalty,herhighestlevel
classdoesnotcount.

HalfOrcs
+2Strength,2Intelligence,2Charisma.AhalforcsstartingIntelligencescoreisalwaysatleast3.Ifthisadjustment
wouldlowerthecharactersscoreto1or2,hisscoreisnevertheless3.
Page13of462
Medium:AsMediumcreatures,halforcshavenospecialbonusesorpenaltiesduetotheirsize.
Halforcbaselandspeedis30feet.
Darkvision:Halforcs(andorcs)canseeinthedarkupto60feet.Darkvisionisblackandwhiteonly,butitisotherwise
likenormalsight,andhalforcscanfunctionjustfinewithnolightatall.
OrcBlood:Foralleffectsrelatedtorace,ahalforcisconsideredanorc.
AutomaticLanguages:CommonandOrc.BonusLanguages:Draconic,Giant,Gnoll,Goblin,andAbyssal.
FavoredClass:Barbarian.Amulticlasshalforcsbarbarianclassdoesnotcountwhendeterminingwhetherhetakesan
experiencepointpenalty.

Halflings
+2Dexterity,2Strength.
Small:AsaSmallcreature,ahalflinggainsa+1sizebonustoArmorClass,a+1sizebonusonattackrolls,anda+4
sizebonusonHidechecks,butsheusessmallerweaponsthanhumansuse,andherliftingandcarryinglimitsarethree
quartersofthoseofaMediumcharacter.
Halflingbaselandspeedis20feet.
+2racialbonusonClimb,Jump,andMoveSilentlychecks.
+1racialbonusonallsavingthrows.
+2moralebonusonsavingthrowsagainstfear:Thisbonusstackswiththehalflings+1bonusonsavingthrowsin
general.
+1racialbonusonattackrollswiththrownweaponsandslings.
+2racialbonusonListenchecks.
AutomaticLanguages:CommonandHalfling.BonusLanguages:Dwarven,Elven,Gnome,Goblin,andOrc.
FavoredClass:Rogue.Amulticlasshalflingsrogueclassdoesnotcountwhendeterminingwhethershetakesan
experiencepointpenaltyformulticlassing.

Classes
Barbarian
Alignment
Anynonlawful.

HitDie
d12.

ClassSkills
Thebarbariansclassskills(andthekeyabilityforeachskill)areClimb(Str),Craft(Int),HandleAnimal(Cha),Intimidate
(Cha),Jump(Str),Listen(Wis),Ride(Dex),Survival(Wis),andSwim(Str).

SkillPointsat1stLevel
(4+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
4+Intmodifier.
Table:TheBarbarian
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +1 +2 +0 +0 Fastmovement(10'),illiteracy,rage1/day
2nd +2 +3 +0 +0 Uncannydodge
3rd +3 +3 +1 +1 Trapsense+1
4th +4 +4 +1 +1 Rage2/day

Page14of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
5th +5 +4 +1 +1 Improveduncannydodge
6th +6/+1 +5 +2 +2 Trapsense+2
7th +7/+2 +5 +2 +2 Damagereduction1/
8th +8/+3 +6 +2 +2 Rage3/day
9th +9/+4 +6 +3 +3 Trapsense+3
10th +10/+5 +7 +3 +3 Damagereduction2/
11th +11/+6/+1 +7 +3 +3 Greaterrage
12th +12/+7/+2 +8 +4 +4 Rage4/day,trapsense+4
13th +13/+8/+3 +8 +4 +4 Damagereduction3/
14th +14/+9/+4 +9 +4 +4 Indomitablewill
15th +15/+10/+5 +9 +5 +5 Trapsense+5
16th +16/+11/+6/+1 +10 +5 +5 Damagereduction4/,rage5/day
17th +17/+12/+7/+2 +10 +5 +5 Tirelessrage
18th +18/+13/+8/+3 +11 +6 +6 Trapsense+6
19th +19/+14/+9/+4 +11 +6 +6 Damagereduction5/
20th +20/+15/+10/+5 +12 +6 +6 Mightyrage,rage6/day

ClassFeatures
Allofthefollowingareclassfeaturesofthebarbarian.

WeaponandArmorProficiency
Abarbarianisproficientwithallsimpleandmartialweapons,lightarmor,mediumarmor,andshields(excepttower
shields).

FastMovement(Ex)
Abarbarianslandspeedisfasterthanthenormforhisraceby+10feet.Thisbenefitappliesonlywhenheiswearingno
armor,lightarmor,ormediumarmorandnotcarryingaheavyload.Applythisbonusbeforemodifyingthebarbarians
speedbecauseofanyloadcarriedorarmorworn.

Illiteracy
Barbariansaretheonlycharacterswhodonotautomaticallyknowhowtoreadandwrite.Abarbarianmayspend2skill
pointstogaintheabilitytoreadandwritealllanguagesheisabletospeak.
Abarbarianwhogainsalevelinanyotherclassautomaticallygainsliteracy.Anyothercharacterwhogainsabarbarian
leveldoesnotlosetheliteracyheorshealreadyhad.

Rage(Ex)
Abarbariancanflyintoarageacertainnumberoftimesperday.Inarage,abarbariantemporarilygainsa+4bonusto
Strength,a+4bonustoConstitution,anda+2moralebonusonWillsaves,buthetakesa2penaltytoArmorClass.The
increaseinConstitutionincreasesthebarbarianshitpointsby2pointsperlevel,butthesehitpointsgoawayattheendof
theragewhenhisConstitutionscoredropsbacktonormal.(Theseextrahitpointsarenotlostfirstthewaytemporaryhit
pointsare.)Whileraging,abarbariancannotuseanyCharisma,Dexterity,orIntelligencebasedskills(exceptforBalance,
EscapeArtist,Intimidate,andRide),theConcentrationskill,oranyabilitiesthatrequirepatienceorconcentration,norcan
hecastspellsoractivatemagicitemsthatrequireacommandword,aspelltrigger(suchasawand),orspellcompletion
(suchasascroll)tofunction.HecanuseanyfeathehasexceptCombatExpertise,itemcreationfeats,andmetamagic
feats.Afitofragelastsforanumberofroundsequalto3+thecharacters(newlyimproved)Constitutionmodifier.A
barbarianmayprematurelyendhisrage.Attheendoftherage,thebarbarianlosestheragemodifiersandrestrictionsand
becomesfatigued(2penaltytoStrength,2penaltytoDexterity,cantchargeorrun)forthedurationofthecurrent
encounter(unlessheisa17thlevelbarbarian,atwhichpointthislimitationnolongerapplies;seebelow).
Abarbariancanflyintoarageonlyonceperencounter.At1stlevelhecanusehisrageabilityonceperday.At4thleveland
everyfourlevelsthereafter,hecanuseitoneadditionaltimeperday(toamaximumofsixtimesperdayat20thlevel).
Enteringaragetakesnotimeitself,butabarbariancandoitonlyduringhisaction,notinresponsetosomeoneelses
action.

UncannyDodge(Ex)
At2ndlevel,abarbarianretainshisDexteritybonustoAC(ifany)evenifheiscaughtflatfootedorstruckbyaninvisible
attacker.However,hestillloseshisDexteritybonustoACifimmobilized.Ifabarbarianalreadyhasuncannydodgefroma
differentclass,heautomaticallygainsimproveduncannydodge(seebelow)instead.

Page15of462
TrapSense(Ex)
Startingat3rdlevel,abarbariangainsa+1bonusonReflexsavesmadetoavoidtrapsanda+1dodgebonustoACagainst
attacksmadebytraps.Thesebonusesriseby+1everythreebarbarianlevelsthereafter(6th,9th,12th,15th,and18thlevel).
Trapsensebonusesgainedfrommultipleclassesstack.

ImprovedUncannyDodge(Ex)
At5thlevelandhigher,abarbariancannolongerbeflanked.Thisdefensedeniesaroguetheabilitytosneakattackthe
barbarianbyflankinghim,unlesstheattackerhasatleastfourmoreroguelevelsthanthetargethasbarbarianlevels.Ifa
characteralreadyhasuncannydodge(seeabove)fromasecondclass,thecharacterautomaticallygainsimproveduncanny
dodgeinstead,andthelevelsfromtheclassesthatgrantuncannydodgestacktodeterminetheminimumlevelarogue
mustbetoflankthecharacter.

DamageReduction(Ex)
At7thlevel,abarbariangainsDamageReduction.Subtract1fromthedamagethebarbariantakeseachtimeheisdealt
damagefromaweaponoranaturalattack.At10thlevel,andeverythreebarbarianlevelsthereafter(13th,16th,and19th
level),thisdamagereductionrisesby1point.Damagereductioncanreducedamageto0butnotbelow0.

GreaterRage(Ex)
At11thlevel,abarbariansbonusestoStrengthandConstitutionduringhisrageeachincreaseto+6,andhismoralebonus
onWillsavesincreasesto+3.ThepenaltytoACremainsat2.

IndomitableWill(Ex)
Whileinarage,abarbarianof14thlevelorhighergainsa+4bonusonWillsavestoresistenchantmentspells.Thisbonus
stackswithallothermodifiers,includingthemoralebonusonWillsaveshealsoreceivesduringhisrage.

TirelessRage(Ex)
At17thlevelandhigher,abarbariannolongerbecomesfatiguedattheendofhisrage.

MightyRage(Ex)
At20thlevel,abarbariansbonusestoStrengthandConstitutionduringhisrageeachincreaseto+8,andhismoralebonus
onWillsavesincreasesto+4.ThepenaltytoACremainsat2.

ExBarbarians
Abarbarianwhobecomeslawfullosestheabilitytorageandcannotgainmorelevelsasabarbarian.Heretainsallthe
otherbenefitsoftheclass(damagereduction,fastmovement,trapsense,anduncannydodge).

Bard
Alignment
Anynonlawful.

HitDie
d6.

ClassSkills
Thebardsclassskills(andthekeyabilityforeachskill)areAppraise(Int),Balance(Dex),Bluff(Cha),Climb(Str),
Concentration(Con),Craft(Int),DecipherScript(Int),Diplomacy(Cha),Disguise(Cha),EscapeArtist(Dex),Gather
Information(Cha),Hide(Dex),Jump(Str),Knowledge(allskills,takenindividually)(Int),Listen(Wis),MoveSilently
(Dex),Perform(Cha),Profession(Wis),SenseMotive(Wis),SleightofHand(Dex),SpeakLanguage(n/a),Spellcraft(Int),
Swim(Str),Tumble(Dex),andUseMagicDevice(Cha).

SkillPointsat1stLevel
(6+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
6+Intmodifier.
Table:TheBard
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +0 +2 +2 Bardicmusic,bardicknowledge,countersong,fascinate,inspirecourage+1
2nd +1 +0 +3 +3
3rd +2 +1 +3 +3 Inspirecompetence
Page16of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
4th +3 +1 +4 +4
5th +3 +1 +4 +4
6th +4 +2 +5 +5 Suggestion
7th +5 +2 +5 +5
8th +6/+1 +2 +6 +6 Inspirecourage+2
9th +6/+1 +3 +6 +6 Inspiregreatness
10th +7/+2 +3 +7 +7
11th +8/+3 +3 +7 +7
12th +9/+4 +4 +8 +8 Songoffreedom
13th +9/+4 +4 +8 +8
14th +10/+5 +4 +9 +9 Inspirecourage+3
15th +11/+6/+1 +5 +9 +9 Inspireheroics
16th +12/+7/+2 +5 +10 +10
17th +12/+7/+2 +5 +10 +10
18th +13/+8/+3 +6 +11 +11 Masssuggestion
19th +14/+9/+4 +6 +11 +11
20th +15/+10/+5 +6 +12 +12 Inspirecourage+4
Table:BardicSpellsPerDay
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH
1st 2
2nd 3 0
3rd 3 1
4th 3 2 0
5th 3 3 1
6th 3 3 2
7th 3 3 2 0
8th 3 3 3 1
9th 3 3 3 2
10th 3 3 3 2 0
11th 3 3 3 3 1
12th 3 3 3 3 2
13th 3 3 3 3 2 0
14th 4 3 3 3 3 1
15th 4 4 3 3 3 2
16th 4 4 4 3 3 2 0
17th 4 4 4 4 3 3 1
18th 4 4 4 4 4 3 2
19th 4 4 4 4 4 4 3
20th 4 4 4 4 4 4 4
Table:BardicSpellsKnown
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH
1st 4
2nd 5 21
3rd 6 3
4th 6 3 21
5th 6 4 3
6th 6 4 3
7th 6 4 4 21
8th 6 4 4 3
9th 6 4 4 3
10th 6 4 4 4 21
11th 6 4 4 4 3
12th 6 4 4 4 3
13th 6 4 4 4 4 21
14th 6 4 4 4 4 3
15th 6 4 4 4 4 3
16th 6 5 4 4 4 4 21
17th 6 5 5 4 4 4 3
18th 6 5 5 5 4 4 3
19th 6 5 5 5 5 4 4
20th 6 5 5 5 5 5 4
1
ProvidedthebardhasahighenoughCharismascoretohaveabonusspellofthislevel.

Page17of462
ClassFeatures
Allofthefollowingareclassfeaturesofthebard.

WeaponandArmorProficiency
Abardisproficientwithallsimpleweapons,plusthelongsword,rapier,sap,shortsword,shortbow,andwhip.Bardsare
proficientwithlightarmorandshields(excepttowershields).Abardcancastbardspellswhilewearinglightarmor
withoutincurringthenormalarcanespellfailurechance.However,likeanyotherarcanespellcaster,abardwearing
mediumorheavyarmororusingashieldincursachanceofarcanespellfailureifthespellinquestionhasasomatic
component(mostdo).Amulticlassbardstillincursthenormalarcanespellfailurechanceforarcanespellsreceivedfrom
otherclasses.

Spells
Abardcastsarcanespells,whicharedrawnfromthebardspelllist.Hecancastanyspellheknowswithoutpreparingit
aheadoftime.Everybardspellhasaverbalcomponent(singing,reciting,ormusic).Tolearnorcastaspell,abardmust
haveaCharismascoreequaltoatleast10+thespell.TheDifficultyClassforasavingthrowagainstabardsspellis10+
thespelllevel+thebardsCharismamodifier.
Likeotherspellcasters,abardcancastonlyacertainnumberofspellsofeachspelllevelperday.Hisbasedailyspell
allotmentisgivenonTable:TheBard.Inaddition,hereceivesbonusspellsperdayifhehasahighCharismascore.When
Table:BardSpellsKnownindicatesthatthebardgets0spellsperdayofagivenspelllevel,hegainsonlythebonusspells
hewouldbeentitledtobasedonhisCharismascoreforthatspelllevel.
Thebardsselectionofspellsisextremelylimited.Abardbeginsplayknowingfour0levelspellsofyourchoice.Atmost
newbardlevels,hegainsoneormorenewspells,asindicatedonTable:BardSpellsKnown.(Unlikespellsperday,the
numberofspellsabardknowsisnotaffectedbyhisCharismascore;thenumbersonTable:BardSpellsKnownarefixed.)
Uponreaching5thlevel,andateverythirdbardlevelafterthat(8th,11th,andsoon),abardcanchoosetolearnanew
spellinplaceofonehealreadyknows.Ineffect,thebardlosestheoldspellinexchangeforthenewone.Thenewspells
levelmustbethesameasthatofthespellbeingexchanged,anditmustbeatleasttwolevelslowerthanthehighestlevel
bardspellthebardcancast.Abardmayswaponlyasinglespellatanygivenlevel,andmustchoosewhetherornotto
swapthespellatthesametimethathegainsnewspellsknownforthelevel.
Asnotedabove,abardneednotpreparehisspellsinadvance.Hecancastanyspellheknowsatanytime,assuminghehas
notyetuseduphisallotmentofspellsperdayforthespellslevel.

BardicKnowledge
Abardmaymakeaspecialbardicknowledgecheckwithabonusequaltohisbardlevel+hisIntelligencemodifiertosee
whetherheknowssomerelevantinformationaboutlocalnotablepeople,legendaryitems,ornoteworthyplaces.(Ifthe
bardhas5ormoreranksinKnowledge(history),hegainsa+2bonusonthischeck.)
Asuccessfulbardicknowledgecheckwillnotrevealthepowersofamagicitembutmaygiveahintastoitsgeneral
function.Abardmaynottake10ortake20onthischeck;thissortofknowledgeisessentiallyrandom.
Table:BardicKnowledgeDCs
DC TYPEOFKNOWLEDGE
10 Common,knownbyatleastasubstantialminoritydrinking;commonlegendsofthelocalpopulation.
20 Uncommonbutavailable,knownbyonlyafewpeoplelegends.
25 Obscure,knownbyfew,hardtocomeby.
30 Extremelyobscure,knownbyveryfew,possiblyforgottenbymostwhoonceknewit,possiblyknownonlybythosewhodont
understandthesignificanceoftheknowledge.

BardicMusic
Onceperdayperbardlevel,abardcanusehissongorpoeticstoproducemagicaleffectsonthosearoundhim(usually
includinghimself,ifdesired).Whiletheseabilitiesfallunderthecategoryofbardicmusicandthedescriptionsdiscuss
singingorplayinginstruments,theycanallbeactivatedbyrecitingpoetry,chanting,singinglyricalsongs,singingmelodies,
whistling,playinganinstrument,orplayinganinstrumentincombinationwithsomespokenperformance.Eachability
requiresbothaminimumbardlevelandaminimumnumberofranksinthePerformskilltoqualify;ifabarddoesnothave
therequirednumberofranksinatleastonePerformskill,hedoesnotgainthebardicmusicabilityuntilheacquiresthe
neededranks.
Startingabardicmusiceffectisastandardaction.Somebardicmusicabilitiesrequireconcentration,whichmeansthebard
musttakeastandardactioneachroundtomaintaintheability.Evenwhileusingbardicmusicthatdoesntrequire
concentration,abardcannotcastspells,activatemagicitemsbyspellcompletion(suchasscrolls),oractivatemagicitems
Page18of462
bymagicword(suchaswands).Justasforcastingaspellwithaverbalcomponent,adeafbardhasa20%chancetofail
whenattemptingtousebardicmusic.Ifhefails,theattemptstillcountsagainsthisdailylimit.

Countersong(Su)
Abardwith3ormoreranksinaPerformskillcanusehismusicorpoeticstocountermagicaleffectsthatdependonsound
(butnotspellsthatsimplyhaveverbalcomponents).Eachroundofthecountersong,hemakesaPerformcheck.Any
creaturewithin30feetofthebard(includingthebardhimself)thatisaffectedbyasonicorlanguagedependentmagical
attackmayusethebardsPerformcheckresultinplaceofitssavingthrowif,afterthesavingthrowisrolled,thePerform
checkresultprovestobehigher.Ifacreaturewithinrangeofthecountersongisalreadyundertheeffectofa
noninstantaneoussonicorlanguagedependentmagicalattack,itgainsanothersavingthrowagainsttheeffecteachround
ithearsthecountersong,butitmustusethebardsPerformcheckresultforthesave.Countersonghasnoeffectagainst
effectsthatdontallowsaves.Thebardmaykeepupthecountersongfor10rounds.

Fascinate(Sp)
Abardwith3ormoreranksinaPerformskillcanusehismusicorpoeticstocauseoneormorecreaturestobecome
fascinatedwithhim.Eachcreaturetobefascinatedmustbewithin90feet,abletoseeandhearthebard,andabletopay
attentiontohim.Thebardmustalsobeabletoseethecreature.Thedistractionofanearbycombatorotherdangers
preventstheabilityfromworking.Foreverythreelevelsabardattainsbeyond1st,hecantargetoneadditionalcreature
withasingleuseofthisability.
Tousetheability,abardmakesaPerformcheck.HischeckresultistheDCforeachaffectedcreaturesWillsaveagainstthe
effect.Ifacreaturessavingthrowsucceeds,thebardcannotattempttofascinatethatcreatureagainfor24hours.Ifits
savingthrowfails,thecreaturesitsquietlyandlistenstothesong,takingnootheractions,foraslongasthebardcontinues
toplayandconcentrate(uptoamaximumof1roundperbardlevel).Whilefascinated,atargettakesa4penaltyonskill
checksmadeasreactions,suchasListenandSpotchecks.AnypotentialthreatrequiresthebardtomakeanotherPerform
checkandallowsthecreatureanewsavingthrowagainstaDCequaltothenewPerformcheckresult.
Anyobviousthreat,suchassomeonedrawingaweapon,castingaspell,oraimingarangedweaponatthetarget,
automaticallybreakstheeffect.Fascinateisanenchantment(compulsion),mindaffectingability.

InspireCourage(Su)
Abardwith3ormoreranksinaPerformskillcanusesongorpoeticstoinspirecourageinhisallies(includinghimself),
bolsteringthemagainstfearandimprovingtheircombatabilities.Tobeaffected,anallymustbeabletohearthebardsing.
Theeffectlastsforaslongastheallyhearsthebardsingandfor5roundsthereafter.Anaffectedallyreceivesa+1morale
bonusonsavingthrowsagainstcharmandfeareffectsanda+1moralebonusonattackandweapondamagerolls.At8th
level,andeverysixbardlevelsthereafter,thisbonusincreasesby1(+2at8th,+3at14th,and+4at20th).Inspire
courageisamindaffectingability.

InspireCompetence(Su)
Abardof3rdlevelorhigherwith6ormoreranksinaPerformskillcanusehismusicorpoeticstohelpanallysucceedata
task.Theallymustbewithin30feetandabletoseeandhearthebard.Thebardmustalsobeabletoseetheally.
Theallygetsa+2competencebonusonskillcheckswithaparticularskillaslongasheorshecontinuestohearthebards
music.Certainusesofthisabilityareinfeasible.Theeffectlastsaslongasthebardconcentrates,uptoamaximumof2
minutes.Abardcantinspirecompetenceinhimself.Inspirecompetenceisamindaffectingability.

Suggestion(Sp)
Abardof6thlevelorhigherwith9ormoreranksinaPerformskillcanmakeasuggestion(asthespell)toacreaturethat
hehasalreadyfascinated(seeabove).Usingthisabilitydoesnotbreakthebardsconcentrationonthefascinateeffect,nor
doesitallowasecondsavingthrowagainstthefascinateeffect.
Makingasuggestiondoesntcountagainstabardsdailylimitonbardicmusicperformances.AWillsavingthrow(DC10+
1/2bardslevel+bardsChamodifier)negatestheeffect.Thisabilityaffectsonlyasinglecreature(butseemass
suggestion,below).Suggestionisanenchantment(compulsion),mindaffecting,languagedependentability.

InspireGreatness(Su)
Abardof9thlevelorhigherwith12ormoreranksinaPerformskillcanusemusicorpoeticstoinspiregreatnessin
himselforasinglewillingallywithin30feet,grantinghimorherextrafightingcapability.Foreverythreelevelsabard
attainsbeyond9th,hecantargetoneadditionalallywithasingleuseofthisability(twoat12thlevel,threeat15th,fourat
18th).Toinspiregreatness,abardmustsingandanallymusthearhimsing.Theeffectlastsforaslongastheallyhearsthe
bardsingandfor5roundsthereafter.Acreatureinspiredwithgreatnessgains2bonusHitDice(d10s),thecommensurate

Page19of462
numberoftemporaryhitpoints(applythetargetsConstitutionmodifier,ifany,tothesebonusHitDice),a+2competence
bonusonattackrolls,anda+1competencebonusonFortitudesaves.ThebonusHitDicecountasregularHitDicefor
determiningtheeffectofspellsthatareHitDicedependant.Inspiregreatnessisamindaffectingability.

SongofFreedom(Sp)
Abardof12thlevelorhigherwith15ormoreranksinaPerformskillcanusemusicorpoeticstocreateaneffect
equivalenttothebreakenchantmentspell(casterlevelequalsthecharactersbardlevel).Usingthisabilityrequires1
minuteofuninterruptedconcentrationandmusic,anditfunctionsonasingletargetwithin30feet.Abardcantusesongof
freedomonhimself.

InspireHeroics(Su)
Abardof15thlevelorhigherwith18ormoreranksinaPerformskillcanusemusicorpoeticstoinspiretremendous
heroisminhimselforasinglewillingallywithin30feet.Foreverythreebardlevelsthecharacterattainsbeyond15th,he
caninspireheroicsinoneadditionalcreature.Toinspireheroics,abardmustsingandanallymusthearthebardsingfora
fullround.Acreaturesoinspiredgainsa+4moralebonusonsavingthrowsanda+4dodgebonustoAC.Theeffectlasts
foraslongastheallyhearsthebardsingandforupto5roundsthereafter.Inspireheroicsisamindaffectingability.

MassSuggestion(Sp)
Thisabilityfunctionslikesuggestion,above,exceptthatabardof18thlevelorhigherwith21ormoreranksinaPerform
skillcanmakethesuggestionsimultaneouslytoanynumberofcreaturesthathehasalreadyfascinated(seeabove).Mass
suggestionisanenchantment(compulsion),mindaffecting,languagedependentability.

ExBards
Abardwhobecomeslawfulinalignmentcannotprogressinlevelsasabard,thoughheretainsallhisbardabilities.

Cleric
Alignment
Aclericsalignmentmustbewithinonestepofhisdeitys(thatis,itmaybeonestepawayoneitherthelawfulchaoticaxis
orthegoodevilaxis,butnotboth).Aclericmaynotbeneutralunlesshisdeitysalignmentisalsoneutral.

HitDie
d8.

ClassSkills
Theclericsclassskills(andthekeyabilityforeachskill)areConcentration(Con),Craft(Int),Diplomacy(Cha),Heal
(Wis),Knowledge(arcana)(Int),Knowledge(history)(Int),Knowledge(religion)(Int),Knowledge(theplanes)(Int),
Profession(Wis),andSpellcraft(Int).

DomainsandClassSkills
AclericwhochoosestheAnimalorPlantdomainaddsKnowledge(nature)(Int)totheclericclassskillslistedabove.A
clericwhochoosestheKnowledgedomainaddsallKnowledge(Int)skillstothelist.AclericwhochoosestheTravel
domainaddsSurvival(Wis)tothelist.AclericwhochoosestheTrickerydomainaddsBluff(Cha),Disguise(Cha),and
Hide(Dex)tothelist.SeeDeity,Domains,andDomainSpells,below,formoreinformation.

SkillPointsat1stLevel
(2+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
2+Intmodifier.
Table:TheCleric
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +2 +0 +2 Turnorrebukeundead
2nd +1 +3 +0 +3
3rd +2 +3 +1 +3
4th +3 +4 +1 +4
5th +3 +4 +1 +4
6th +4 +5 +2 +5
7th +5 +5 +2 +5
8th +6/+1 +6 +2 +6
9th +6/+1 +6 +3 +6
Page20of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
10th +7/+2 +7 +3 +7
11th +8/+3 +7 +3 +7
12th +9/+4 +8 +4 +8
13th +9/+4 +8 +4 +8
14th +10/+5 +9 +4 +9
15th +11/+6/+1 +9 +5 +9
16th +12/+7/+2 +10 +5 +10
17th +12/+7/+2 +10 +5 +10
18th +13/+8/+3 +11 +6 +11
19th +14/+9/+4 +11 +6 +11
20th +15/+10/+5 +12 +6 +12
Table:ClericalSpellsPerDay
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1st 3 1+1
2nd 4 2+1
3rd 4 2+1 1+1
4th 5 3+1 2+1
5th 5 3+1 2+1 1+1
6th 5 3+1 3+1 2+1
7th 6 4+1 3+1 2+1 1+1
8th 6 4+1 3+1 3+1 2+1
9th 6 4+1 4+1 3+1 2+1 1+1
10th 6 4+1 4+1 3+1 3+1 2+1
11th 6 5+1 4+1 4+1 3+1 2+1 1+1
12th 6 5+1 4+1 4+1 3+1 3+1 2+1
13th 6 5+1 5+1 4+1 4+1 3+1 2+1 1+1
14th 6 5+1 5+1 4+1 4+1 3+1 3+1 2+1
15th 6 5+1 5+1 5+1 4+1 4+1 3+1 2+1 1+1
16th 6 5+1 5+1 5+1 4+1 4+1 3+1 3+1 2+1
17th 6 5+1 5+1 5+1 5+1 4+1 4+1 3+1 2+1 1+1
18th 6 5+1 5+1 5+1 5+1 4+1 4+1 3+1 3+1 2+1
19th 6 5+1 5+1 5+1 5+1 5+1 4+1 4+1 3+1 3+1
20th 6 5+1 5+1 5+1 5+1 5+1 4+1 4+1 4+1 4+1
1
Inadditiontothestatednumberofspellsperdayfor1stthrough9thlevelspells,aclericgetsadomainspellforeachspelllevel,
startingat1st.
The+1intheentriesonthistablerepresentsthatspell.Domainspellsareinadditiontoanybonusspellstheclericmayreceivefor
havingahighWisdomscore.

ClassFeatures
Allofthefollowingareclassfeaturesofthecleric.

WeaponandArmorProficiency
Clericsareproficientwithallsimpleweapons,withalltypesofarmor(light,medium,andheavy),andwithshields(except
towershields).
AclericwhochoosestheWardomainreceivestheWeaponFocusfeatrelatedtohisdeitysweaponasabonusfeat.Healso
receivestheappropriateMartialWeaponProficiencyfeatasabonusfeat,iftheweaponfallsintothatcategory.

Aura(Ex)
Aclericofachaotic,evil,good,orlawfuldeityhasaparticularlypowerfulauracorrespondingtothedeitysalignment(see
thedetectevilspellfordetails).ClericswhodontworshipaspecificdeitybutchoosetheChaotic,Evil,Good,orLawful
domainhaveasimilarlypowerfulauraofthecorrespondingalignment.

Spells
Aclericcastsdivinespells,whicharedrawnfromtheclericspelllist.However,hisalignmentmayrestricthimfromcasting
certainspellsopposedtohismoralorethicalbeliefs;seeChaotic,Evil,Good,andLawfulSpells,below.Aclericmustchoose
andpreparehisspellsinadvance(seebelow).
Toprepareorcastaspell,aclericmusthaveaWisdomscoreequaltoatleast10+thespelllevel.TheDifficultyClassfora
savingthrowagainstaclericsspellis10+thespelllevel+theclericsWisdommodifier.
Likeotherspellcasters,aclericcancastonlyacertainnumberofspellsofeachspelllevelperday.Hisbasedailyspell

Page21of462
allotmentisgivenonTable:TheCleric.Inaddition,hereceivesbonusspellsperdayifhehasahighWisdomscore.Acleric
alsogetsonedomainspellofeachspelllevelhecancast,startingat1stlevel.Whenaclericpreparesaspellinadomain
spellslot,itmustcomefromoneofhistwodomains(seeDeities,Domains,andDomainSpells,below).
Clericsmeditateorprayfortheirspells.Eachclericmustchooseatimeatwhichhemustspend1houreachdayinquiet
contemplationorsupplicationtoregainhisdailyallotmentofspells.Timespentrestinghasnoeffectonwhetheracleric
canpreparespells.Aclericmayprepareandcastanyspellontheclericspelllist,providedthathecancastspellsofthat
level,buthemustchoosewhichspellstoprepareduringhisdailymeditation.
Deity,Domains,andDomainSpells:Aclericsdeityinfluenceshisalignment,whatmagichecanperform,hisvalues,and
howothersseehim.Aclericchoosestwodomainsfromamongthosebelongingtohisdeity.Aclericcanselectanalignment
domain(Chaos,Evil,Good,orLaw)onlyifhisalignmentmatchesthatdomain.
Ifaclericisnotdevotedtoaparticulardeity,hestillselectstwodomainstorepresenthisspiritualinclinationsandabilities.
Therestrictiononalignmentdomainsstillapplies.
Eachdomaingivestheclericaccesstoadomainspellateachspelllevelhecancast,from1stonup,aswellasagranted
power.Theclericgetsthegrantedpowersofboththedomainsselected.
Withaccesstotwodomainspellsatagivenspelllevel,aclericpreparesoneortheothereachdayinhisdomainspellslot.
Ifadomainspellisnotontheclericspelllist,aclericcanprepareitonlyinhisdomainspellslot.

SpontaneousCasting
Agoodcleric(oraneutralclericofagooddeity)canchannelstoredspellenergyintohealingspellsthattheclericdidnot
prepareaheadoftime.Theclericcanloseanypreparedspellthatisnotadomainspellinordertocastanycurespellof
thesamespelllevelorlower(acurespellisanyspellwithcureinitsname).
Anevilcleric(oraneutralclericofanevildeity),cantconvertpreparedspellstocurespellsbutcanconvertthemtoinflict
spells(aninflictspellisonewithinflictinitsname).
Aclericwhoisneithergoodnorevilandwhosedeityisneithergoodnorevilcanconvertspellstoeithercurespellsor
inflictspells(playerschoice).Oncetheplayermakesthischoice,itcannotbereversed.Thischoicealsodetermines
whethertheclericturnsorcommandsundead(seebelow).
Chaotic,Evil,Good,andLawfulSpells:Aclericcantcastspellsofanalignmentopposedtohisownorhisdeitys(ifhehas
one).Spellsassociatedwithparticularalignmentsareindicatedbythechaos,evil,good,andlawdescriptorsintheirspell
descriptions.

TurnorRebukeUndead(Su)
Anycleric,regardlessofalignment,hasthepowertoaffectundeadcreaturesbychannelingthepowerofhisfaiththrough
hisholy(orunholy)symbol(seeTurnorRebukeUndead).
Agoodcleric(oraneutralclericwhoworshipsagooddeity)canturnordestroyundeadcreatures.Anevilcleric(ora
neutralclericwhoworshipsanevildeity)insteadrebukesorcommandssuchcreatures.Aneutralclericofaneutraldeity
mustchoosewhetherhisturningabilityfunctionsasthatofagoodclericoranevilcleric.Oncethischoiceismade,it
cannotbereversed.Thisdecisionalsodetermineswhethertheclericcancastspontaneouscureorinflictspells(seeabove).
Aclericmayattempttoturnundeadanumberoftimesperdayequalto3+hisCharismamodifier.Aclericwith5ormore
ranksinKnowledge(religion)getsa+2bonusonturningchecksagainstundead.

BonusLanguages
AclericsbonuslanguageoptionsincludeCelestial,Abyssal,andInfernal(thelanguagesofgood,chaoticevil,andlawful
eviloutsiders,respectively).Thesechoicesareinadditiontothebonuslanguagesavailabletothecharacterbecauseofhis
race.

ExClerics
Aclericwhogrosslyviolatesthecodeofconductrequiredbyhisgodlosesallspellsandclassfeatures,exceptforarmorand
shieldproficienciesandproficiencywithsimpleweapons.Hecannotthereaftergainlevelsasaclericofthatgoduntilhe
atones(seetheatonementspelldescription).

Druid
Alignment
Neutralgood,lawfulneutral,neutral,chaoticneutral,orneutralevil.

Page22of462
HitDie
d8.

ClassSkills
Thedruidsclassskills(andthekeyabilityforeachskill)areConcentration(Con),Craft(Int),Diplomacy(Cha),Handle
Animal(Cha),Heal(Wis),Knowledge(nature)(Int),Listen(Wis),Profession(Wis),Ride(Dex),Spellcraft(Int),Spot
(Wis),Survival(Wis),andSwim(Str).

SkillPointsat1stLevel
(4+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
4+Intmodifier.
Table:TheDruid
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +2 +0 +2 Animalcompanion,naturesense,wildempathy
2nd +1 +3 +0 +3 Woodlandstride
3rd +2 +3 +1 +3 Tracklessstep
4th +3 +4 +1 +4 Resistnatureslure
5th +3 +4 +1 +4 Wildshape(1/day)
6th +4 +5 +2 +5 Wildshape(2/day)
7th +5 +5 +2 +5 Wildshape(3/day)
8th +6/+1 +6 +2 +6 Wildshape(Large)
9th +6/+1 +6 +3 +6 Venomimmunity
10th +7/+2 +7 +3 +7 Wildshape(4/day)
11th +8/+3 +7 +3 +7 Wildshape(Tiny)
12th +9/+4 +8 +4 +8 Wildshape(plant)
13th +9/+4 +8 +4 +8 Athousandfaces
14th +10/+5 +9 +4 +9 Wildshape(5/day)
15th +11/+6/+1 +9 +5 +9 Timelessbody,wildshape(Huge)
16th +12/+7/+2 +10 +5 +10 Wildshape(elemental1/day)
17th +12/+7/+2 +10 +5 +10
18th +13/+8/+3 +11 +6 +11 Wildshape(6/day,elemental2/day)
19th +14/+9/+4 +11 +6 +11
20th +15/+10/+5 +12 +6 +12 Wildshape(elemental3/day,Hugeelemental)
Table:DruidicSpellsPerDay
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1st 3 1
2nd 4 2
3rd 4 2 1
4th 5 3 2
5th 5 3 2 1
6th 5 3 3 2
7th 6 4 3 2 1
8th 6 4 3 3 2
9th 6 4 4 3 2 1
10th 6 4 4 3 3 2
11th 6 5 4 4 3 2 1
12th 6 5 4 4 3 3 2
13th 6 5 5 4 4 3 2 1
14th 6 5 5 4 4 3 3 2
15th 6 5 5 5 4 4 3 2 1
16th 6 5 5 5 4 4 3 3 2
17th 6 5 5 5 5 4 4 3 2 1
18th 6 5 5 5 5 4 4 3 3 2
19th 6 5 5 5 5 5 4 4 3 3
20th 6 5 5 5 5 5 4 4 4 4

ClassFeatures
Allofthefollowingareclassfeaturesofthedruid.

Page23of462
WeaponandArmorProficiency
Druidsareproficientwiththefollowingweapons:club,dagger,dart,quarterstaff,scimitar,sickle,shortspear,sling,and
spear.Theyarealsoproficientwithallnaturalattacks(claw,bite,andsoforth)ofanyformtheyassumewithwildshape
(seebelow).
Druidsareproficientwithlightandmediumarmorbutareprohibitedfromwearingmetalarmor;thus,theymaywearonly
padded,leather,orhidearmor.(Adruidmayalsowearwoodenarmorthathasbeenalteredbytheironwoodspellsothatit
functionsasthoughitweresteel.Seetheironwoodspelldescription)Druidsareproficientwithshields(excepttower
shields)butmustuseonlywoodenones.
Adruidwhowearsprohibitedarmororcarriesaprohibitedshieldisunabletocastdruidspellsoruseanyofher
supernaturalorspelllikeclassabilitieswhiledoingsoandfor24hoursthereafter.

Spells
Adruidcastsdivinespells,whicharedrawnfromthedruidspelllist.Heralignmentmayrestrictherfromcastingcertain
spellsopposedtohermoralorethicalbeliefs;seeChaotic,Evil,Good,andLawfulSpells,below.Adruidmustchooseand
prepareherspellsinadvance(seebelow).
Toprepareorcastaspell,thedruidmusthaveaWisdomscoreequaltoatleast10+thespelllevel.TheDifficultyClassfor
asavingthrowagainstadruidsspellis10+thespelllevel+thedruidsWisdommodifier.
Likeotherspellcasters,adruidcancastonlyacertainnumberofspellsofeachspelllevelperday.Herbasedailyspell
allotmentisgivenonTable:TheDruid.Inaddition,shereceivesbonusspellsperdayifshehasahighWisdomscore.She
doesnothaveaccesstoanydomainspellsorgrantedpowers,asaclericdoes.
Adruidpreparesandcastsspellsthewayaclericdoes,thoughshecannotloseapreparedspelltocastacurespellinits
place(butseeSpontaneousCasting,below).Adruidmayprepareandcastanyspellonthedruidspelllist,providedthat
shecancastspellsofthatlevel,butshemustchoosewhichspellstoprepareduringherdailymeditation.

SpontaneousCasting
Adruidcanchannelstoredspellenergyintosummoningspellsthatshehasntpreparedaheadoftime.Shecanlosea
preparedspellinordertocastanysummonnaturesallyspellofthesamelevelorlower.Chaotic,Evil,Good,andLawful
Spells:Adruidcantcastspellsofanalignmentopposedtoherownorherdeitys(ifshehasone).Spellsassociatedwith
particularalignmentsareindicatedbythechaos,evil,good,andlawdescriptorsintheirspelldescriptions.

BonusLanguages
AdruidsbonuslanguageoptionsincludeSylvan,thelanguageofwoodlandcreatures.Thischoiceisinadditiontothe
bonuslanguagesavailabletothecharacterbecauseofherrace.
AdruidalsoknowsDruidic,asecretlanguageknownonlytodruids,whichshelearnsuponbecominga1stleveldruid.
Druidicisafreelanguageforadruid;thatis,sheknowsitinadditiontoherregularallotmentoflanguagesanditdoesnt
takeupalanguageslot.Druidsareforbiddentoteachthislanguagetonondruids.
Druidichasitsownalphabet.

AnimalCompanion(Ex)
Adruidmaybeginplaywithananimalcompanionselectedfromthefollowinglist:badger,camel,direrat,dog,ridingdog,
eagle,hawk,horse(lightorheavy),owl,pony,snake(SmallorMediumviper),orwolf.Ifthecampaigntakesplacewholly
orpartlyinanaquaticenvironment,thefollowingcreaturesarealsoavailable:crocodile,porpoise,Mediumshark,and
squid.Thisanimalisaloyalcompanionthataccompaniesthedruidonheradventuresasappropriateforitskind.
A1stleveldruidscompanioniscompletelytypicalforitskindexceptasnotedbelow.Asadruidadvancesinlevel,the
animalspowerincreasesasshownonthetable.Ifadruidreleaseshercompanionfromservice,shemaygainanewoneby
performingaceremonyrequiring24uninterruptedhoursofprayer.Thisceremonycanalsoreplaceananimalcompanion
thathasperished.
Adruidof4thlevelorhighermayselectfromalternativelistsofanimals(seebelow).Shouldsheselectananimal
companionfromoneofthesealternativelists,thecreaturegainsabilitiesasifthecharactersdruidlevelwerelowerthanit
actuallyis.Subtractthevalueindicatedintheappropriatelistheaderfromthecharactersdruidlevelandcomparethe
resultwiththedruidlevelentryonthetabletodeterminetheanimalcompanionspowers.(Ifthisadjustmentwouldreduce
thedruidseffectivelevelto0orlower,shecanthavethatanimalasacompanion.)

NatureSense(Ex)
Adruidgainsa+2bonusonKnowledge(nature)andSurvivalchecks.
Page24of462
WildEmpathy(Ex)
Adruidcanimprovetheattitudeofananimal.ThisabilityfunctionsjustlikeaDiplomacycheckmadetoimprovethe
attitudeofaperson.Thedruidrolls1d20andaddsherdruidlevelandherCharismamodifiertodeterminethewild
empathycheckresult.
Thetypicaldomesticanimalhasastartingattitudeofindifferent,whilewildanimalsareusuallyunfriendly.
Tousewildempathy,thedruidandtheanimalmustbeabletostudyeachother,whichmeansthattheymustbewithin30
feetofoneanotherundernormalconditions.Generally,influencingananimalinthiswaytakes1minutebut,aswith
influencingpeople,itmighttakemoreorlesstime.
AdruidcanalsousethisabilitytoinfluenceamagicalbeastwithanIntelligencescoreof1or2,butshetakesa4penalty
onthecheck.

WoodlandStride(Ex)
Startingat2ndlevel,adruidmaymovethroughanysortofundergrowth(suchasnaturalthorns,briars,overgrownareas,
andsimilarterrain)athernormalspeedandwithouttakingdamageorsufferinganyotherimpairment.However,thorns,
briars,andovergrownareasthathavebeenmagicallymanipulatedtoimpedemotionstillaffecther.

TracklessStep(Ex)
Startingat3rdlevel,adruidleavesnotrailinnaturalsurroundingsandcannotbetracked.Shemaychoosetoleaveatrail
ifsodesired.

ResistNaturesLure(Ex)
Startingat4thlevel,adruidgainsa+4bonusonsavingthrowsagainstthespelllikeabilitiesoffey.

WildShape(Su)
At5thlevel,adruidgainstheabilitytoturnherselfintoanySmallorMediumanimalandbackagainonceperday.Her
optionsfornewformsincludeallcreatureswiththeanimaltype.Thisabilityfunctionslikethepolymorphspell,exceptas
notedhere.Theeffectlastsfor1hourperdruidlevel,oruntilshechangesback.Changingform(toanimalorback)isa
standardactionanddoesntprovokeanattackofopportunity.
Theformchosenmustbethatofananimalthedruidisfamiliarwith.
Adruidlosesherabilitytospeakwhileinanimalformbecausesheislimitedtothesoundsthatanormal,untrainedanimal
canmake,butshecancommunicatenormallywithotheranimalsofthesamegeneralgroupingashernewform.(The
normalsoundawildparrotmakesisasquawk,sochangingtothisformdoesnotpermitspeech.)
Adruidcanusethisabilitymoretimesperdayat6th,7th,10th,14th,and18thlevel,asnotedonTable:TheDruid.In
addition,shegainstheabilitytotaketheshapeofaLargeanimalat8thlevel,aTinyanimalat11thlevel,andaHuge
animalat15thlevel.
ThenewformsHitDicecantexceedthecharactersdruidlevel.
At12thlevel,adruidbecomesabletousewildshapetochangeintoaplantcreaturewiththesamesizerestrictionsasfor
animalforms.(Adruidcantusethisabilitytotaketheformofaplantthatisntacreature.)
At16thlevel,adruidbecomesabletousewildshapetochangeintoaSmall,Medium,orLargeelemental(air,earth,fire,
orwater)onceperday.Theseelementalformsareinadditiontohernormalwildshapeusage.Inadditiontothenormal
effectsofwildshape,thedruidgainsalltheelementalsextraordinary,supernatural,andspelllikeabilities.Shealsogains
theelementalsfeatsforaslongasshemaintainsthewildshape,butsheretainsherowncreaturetype.
At18thlevel,adruidbecomesabletoassumeelementalformtwiceperday,andat20thlevelshecandosothreetimesper
day.At20thlevel,adruidmayusethiswildshapeabilitytochangeintoaHugeelemental.

VenomImmunity(Ex)
At9thlevel,adruidgainsimmunitytoallpoisons.

AThousandFaces(Su)
At13thlevel,adruidgainstheabilitytochangeherappearanceatwill,asifusingthealterselfspell,butonlywhileinher
normalform.

TimelessBody(Ex)
Afterattaining15thlevel,adruidnolongertakesabilityscorepenaltiesforagingandcannotbemagicallyaged.Any
penaltiesshemayhavealreadyincurred,however,remaininplace.
Page25of462
Bonusesstillaccrue,andthedruidstilldiesofoldagewhenhertimeisup.

ExDruids
Adruidwhoceasestoreverenature,changestoaprohibitedalignment,orteachestheDruidiclanguagetoanondruid
losesallspellsanddruidabilities(includingheranimalcompanion,butnotincludingweapon,armor,andshield
proficiencies).Shecannotthereaftergainlevelsasadruiduntilsheatones(seetheatonementspelldescription).

TheDruidsAnimalCompanion
Adruidsanimalcompanionisdifferentfromanormalanimalofitskindinmanyways.Thecompanionistreatedasa
magicalbeast,notananimal,forthepurposeofalleffectsthatdependonitstype(thoughitretainsananimalsHD,base
attackbonus,saves,skillpoints,andfeats).Itissuperiortoanormalanimalofitskindandhasspecialpowers,asdescribed
below.
Table:DruidicAnimalCompanion
CLASSLEVEL BONUSHD NATURALARMORADJ. STR/DEXADJ. BONUSTRICKS SPECIAL
1st2nd +0 +0 +0 1 Link,sharespells
3rd5th +2 +2 +1 2 Evasion
6th8th +4 +4 +2 3 Devotion
9th11th +6 +6 +3 4 Multiattack
12th14th +8 +8 +4 5
15th17th +10 +10 +5 6 Improvedevasion
18th20th +12 +12 +6 7

ClassLevel
Thecharactersdruidlevel.Thedruidsclasslevelsstackwithlevelsofanyotherclassesthatareentitledtoananimal
companionforthepurposeofdeterminingthecompanionsabilitiesandthealternativelistsavailabletothecharacter.

BonusHD
Extraeightsided(d8)HitDice,eachofwhichgainsaConstitutionmodifier,asnormal.RememberthatextraHitDice
improvetheanimalcompanionsbaseattackandbasesavebonuses.Ananimalcompanionsbaseattackbonusisthesame
asthatofadruidofalevelequaltotheanimalsHD.AnanimalcompanionhasgoodFortitudeandReflexsaves(treatitas
acharacterwhoselevelequalstheanimalsHD).AnanimalcompaniongainsadditionalskillpointsandfeatsforbonusHD
asnormalforadvancingamonstersHitDice.

NaturalArmorAdj.
Thenumbernotedhereisanimprovementtotheanimalcompanionsexistingnaturalarmorbonus.

Str/DexAdj.
AddthisvaluetotheanimalcompanionsStrengthandDexterityscores.

BonusTricks
Thevaluegiveninthiscolumnisthetotalnumberofbonustricksthattheanimalknowsinadditiontoanythatthedruid
mightchoosetoteachit(seetheHandleAnimalskill).ThesebonustricksdontrequireanytrainingtimeorHandleAnimal
checks,andtheydontcountagainstthenormallimitoftricksknownbytheanimal.Thedruidselectsthesebonustricks,
andonceselected,theycantbechanged.

Link(Ex)
Adruidcanhandleheranimalcompanionasafreeaction,orpushitasamoveaction,evenifshedoesnthaveanyranksin
theHandleAnimalskill.Thedruidgainsa+4circumstancebonusonallwildempathychecksandHandleAnimalchecks
maderegardingananimalcompanion.

ShareSpells(Ex)
Atthedruidsoption,shemayhaveanyspell(butnotanyspelllikeability)shecastsuponherselfalsoaffectheranimal
companion.Theanimalcompanionmustbewithin5feetofheratthetimeofcastingtoreceivethebenefit.Ifthespellor
effecthasadurationotherthaninstantaneous,itstopsaffectingtheanimalcompanionifthecompanionmovesfarther
than5feetawayandwillnotaffecttheanimalagain,evenifitreturnstothedruidbeforethedurationexpires.
Additionally,thedruidmaycastaspellwithatargetofYouonheranimalcompanion(asatouchrangespell)insteadof
onherself.Adruidandheranimalcompanioncansharespellsevenifthespellsnormallydonotaffectcreaturesofthe
companionstype(animal).

Page26of462
Evasion(Ex)
IfananimalcompanionissubjectedtoanattackthatnormallyallowsaReflexsavingthrowforhalfdamage,ittakesno
damageifitmakesasuccessfulsavingthrow.

Devotion(Ex)
Ananimalcompaniongainsa+4moralebonusonWillsavesagainstenchantmentspellsandeffects.

Multiattack
AnanimalcompaniongainsMultiattackasabonusfeatifithasthreeormorenaturalattacksanddoesnotalreadyhave
thatfeat.Ifitdoesnothavetherequisitethreeormorenaturalattacks,theanimalcompanioninsteadgainsasecondattack
withitsprimarynaturalweapon,albeitata5penalty.

ImprovedEvasion(Ex)
WhensubjectedtoanattackthatnormallyallowsaReflexsavingthrowforhalfdamage,ananimalcompaniontakesno
damageifitmakesasuccessfulsavingthrowandonlyhalfdamageifthesavingthrowfails.

AlternativeAnimalCompanions
Adruidofsufficientlyhighlevelcanselectheranimalcompanionfromoneofthefollowinglists,applyingtheindicated
adjustmenttothedruidslevel(inparentheses)forpurposesofdeterminingthecompanionscharacteristicsandspecial
abilities.

4thLevelorHigher(Level3)
Ape(animal)

Bear,black(animal)
Bison(animal)
Boar(animal)
Cheetah(animal)
Crocodile(animal)1
Direbadger
Direbat
Direweasel
Leopard(animal)
Lizard,monitor(animal)
Shark,Large1(animal)
Snake,constrictor(animal)
Snake,Largeviper(animal)
Wolverine(animal)

7thLevelorHigher(Level6)
Bear,brown(animal)

Direwolverine
Crocodile,giant(animal)
Deinonychus(dinosaur)
Direape
Direboar
Direwolf
Elasmosaurus1(dinosaur)
Lion(animal)

Page27of462
Rhinoceros(animal)
Snake,Hugeviper(animal)
Tiger(animal)

10thLevelorHigher(Level9)
Bear,polar(animal)

Direlion
Megaraptor(dinosaur)
Shark,Huge1(animal)
Snake,giantconstrictor(animal)
Whale,orca1(animal)

13thLevelorHigher(Level12)
Direbear

Elephant(animal)
Octopus,giant1(animal)

16thLevelorHigher(Level15)
Direshark1

Diretiger
Squid,giant1(animal)
Triceratops(dinosaur)
Tyrannosaurus(dinosaur)
1
Availableonlyinanaquaticenvironment.

Fighter
Alignment
Any.

HitDie
d10.

ClassSkills
Thefightersclassskills(andthekeyabilityforeachskill)areClimb(Str),Craft(Int),HandleAnimal(Cha),Intimidate
(Cha),Jump(Str),Ride(Dex),andSwim(Str).

SkillPointsat1stLevel
(2+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
2+Intmodifier.
Table:TheFighter
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +1 +2 +0 +0 Bonusfeat
2nd +2 +3 +0 +0 Bonusfeat
3rd +3 +3 +1 +1
4th +4 +4 +1 +1 Bonusfeat
5th +5 +4 +1 +1
6th +6/+1 +5 +2 +2 Bonusfeat
7th +7/+2 +5 +2 +2
8th +8/+3 +6 +2 +2 Bonusfeat
9th +9/+4 +6 +3 +3

Page28of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
10th +10/+5 +7 +3 +3 Bonusfeat
11th +11/+6/+1 +7 +3 +3
12th +12/+7/+2 +8 +4 +4 Bonusfeat
13th +13/+8/+3 +8 +4 +4
14th +14/+9/+4 +9 +4 +4 Bonusfeat
15th +15/+10/+5 +9 +5 +5
16th +16/+11/+6/+1 +10 +5 +5 Bonusfeat
17th +17/+12/+7/+2 +10 +5 +5
18th +18/+13/+8/+3 +11 +6 +6 Bonusfeat
19th +19/+14/+9/+4 +11 +6 +6
20th +20/+15/+10/+5 +12 +6 +6 Bonusfeat

ClassFeatures
Allofthefollowingareclassfeaturesofthefighter.

WeaponandArmorProficiency
Afighterisproficientwithallsimpleandmartialweaponsandwithallarmor(heavy,medium,andlight)andshields
(includingtowershields).

BonusFeats
At1stlevel,afightergetsabonuscombatorientedfeatinadditiontothefeatthatany1stlevelcharactergetsandthe
bonusfeatgrantedtoahumancharacter.Thefightergainsanadditionalbonusfeatat2ndlevelandeverytwofighter
levelsthereafter(4th,6th,8th,10th,12th,14th,16th,18th,and20th).Thesebonusfeatsmustbedrawnfromthefeats
notedasfighterbonusfeats.Afightermuststillmeetallprerequisitesforabonusfeat,includingabilityscoreandbase
attackbonusminimums.
Thesebonusfeatsareinadditiontothefeatthatacharacterofanyclassgetsfromadvancinglevels.Afighterisnotlimited
tothelistoffighterbonusfeatswhenchoosingthesefeats.

Monk
Alignment
Anylawful.

HitDie
d8.

ClassSkills
Themonksclassskills(andthekeyabilityforeachskill)areBalance(Dex),Climb(Str),Concentration(Con),Craft(Int),
Diplomacy(Cha),EscapeArtist(Dex),Hide(Dex),Jump(Str),Knowledge(arcana)(Int),Knowledge(religion)(Int),
Listen(Wis),MoveSilently(Dex),Perform(Cha),Profession(Wis),SenseMotive(Wis),Spot(Wis),Swim(Str),and
Tumble(Dex).

SkillPointsat1stLevel
(4+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
4+Intmodifier.
Table:TheMonk
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +2 +2 +2 Bonusfeat,Flurryofblows,Unarmedstrike
2nd +1 +3 +3 +3 Bonusfeat,evasion
3rd +2 +3 +3 +3 Stillmind
4th +3 +4 +4 +4 Kistrike(magic),Slowfall20ft.
5th +3 +4 +4 +4 Purityofbody
6th +4 +5 +5 +5 Bonusfeat,Slowfall30ft.
7th +5 +5 +5 +5 Wholenessofbody
8th +6/+1 +6 +6 +6 Slowfall40ft.
9th +6/+1 +6 +6 +6 Improvedevasion
10th +7/+2 +7 +7 +7 Kistrike(lawful),Slowfall50ft.
11th +8/+3 +7 +7 +7 Diamondbody,Greaterflurry

Page29of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
12th +9/+4 +8 +8 +8 Abundantstep,Slowfall60ft.
13th +9/+4 +8 +8 +8 Diamondsoul
14th +10/+5 +9 +9 +9 Slowfall70ft.
15th +11/+6/+1 +9 +9 +9 Quiveringpalm
16th +12/+7/+2 +10 +10 +10 Kistrike(adamantine),Slowfall80ft.
17th +12/+7/+2 +10 +10 +10 Timelessbody,Tongueofthesunandmoon
18th +13/+8/+3 +11 +11 +11 Slowfall90ft.
19th +14/+9/+4 +11 +11 +11 Emptybody
20th +15/+10/+5 +12 +12 +12 Perfectself,Slowfallanydistance
Table:MonkUnarmedCombat
LEVEL FLURRYOFBLOWSATTACKBONUS UNARMEDDAMAGE1 ACBONUS UNARMOREDSPEEDBONUS
1st 2/2 1d6 +0 +0ft.
2nd 1/1 1d6 +0 +0ft.
3rd +0/+0 1d6 +0 +10ft.
4th +1/+1 1d8 +0 +10ft.
5th +2/+2 1d8 +1 +10ft.
6th +3/+3 1d8 +1 +20ft.
7th +4/+4 1d8 +1 +20ft.
8th +5/+5/+0 1d10 +1 +20ft.
9th +6/+6/+1 1d10 +1 +30ft.
10th +7/+7/+2 1d10 +2 +30ft.
11th +8/+8/+8/+3 1d10 +2 +30ft.
12th +9/+9/+9/+4 2d6 +2 +40ft.
13th +9/+9/+9/+4 2d6 +2 +40ft.
14th +10/+10/+10/+5 2d6 +2 +40ft.
15th +11/+11/+11/+6/+1 2d6 +3 +50ft.
16th +12/+12/+12/+7/+2 2d8 +3 +50ft.
17th +12/+12/+12/+7/+2 2d8 +3 +50ft.
18th +13/+13/+13/+8/+3 2d8 +3 +60ft.
19th +14/+14/+14/+9/+4 2d8 +3 +60ft.
20th +15/+15/+15/+10/+5 2d10 +4 +60ft.
1
ThevalueshownisforMediummonks.SeeTable:SmallorLargeMonkUnarmedDamageforSmallorLargemonks.

ClassFeatures
Allofthefollowingareclassfeaturesofthemonk.

WeaponandArmorProficiency
Monksareproficientwithclub,crossbow(lightorheavy),dagger,handaxe,javelin,kama,nunchaku,quarterstaff,sai,
shuriken,siangham,andsling.
Monksarenotproficientwithanyarmororshields
Whenwearingarmor,usingashield,orcarryingamediumorheavyload,amonklosesherACbonus,aswellasherfast
movementandflurryofblowsabilities.

ACBonus(Ex)
Whenunarmoredandunencumbered,themonkaddsherWisdombonus(ifany)toherAC.Inaddition,amonkgainsa+1
bonustoACat5thlevel.Thisbonusincreasesby1foreveryfivemonklevelsthereafter(+2at10th,+3at15th,and+4at
20thlevel).
ThesebonusestoACapplyevenagainsttouchattacksorwhenthemonkisflatfooted.Shelosesthesebonuseswhensheis
immobilizedorhelpless,whenshewearsanyarmor,whenshecarriesashield,orwhenshecarriesamediumorheavy
load.

FlurryofBlows(Ex)
Whenunarmored,amonkmaystrikewithaflurryofblowsattheexpenseofaccuracy.Whendoingso,shemaymakeone
extraattackinaroundatherhighestbaseattackbonus,butthisattacktakesa2penalty,asdoeseachotherattackmade
thatround.TheresultingmodifiedbaseattackbonusesareshownintheFlurryofBlowsAttackBonuscolumnonTable:
TheMonk.Thispenaltyappliesfor1round,soitalsoaffectsattacksofopportunitythemonkmightmakebeforehernext
action.Whenamonkreaches5thlevel,thepenaltylessensto1,andat9thlevelitdisappears.Amonkmustuseafull
attackactiontostrikewithaflurryofblows.

Page30of462
Whenusingflurryofblows,amonkmayattackonlywithunarmedstrikesorwithspecialmonkweapons(kama,nunchaku,
quarterstaff,sai,shuriken,andsiangham).Shemayattackwithunarmedstrikesandspecialmonkweaponsinterchangeably
asdesired.Whenusingweaponsaspartofaflurryofblows,amonkappliesherStrengthbonus(notStrbonusx11/2orx

1/2)toherdamagerollsforallsuccessfulattacks,whethershewieldsaweaponinoneorbothhands.Themonkcantuse
anyweaponotherthanaspecialmonkweaponaspartofaflurryofblows.
Inthecaseofthequarterstaff,eachendcountsasaseparateweaponforthepurposeofusingtheflurryofblowsability.
Eventhoughthequarterstaffrequirestwohandstouse,amonkmaystillintersperseunarmedstrikeswithquarterstaff
strikes,assumingthatshehasenoughattacksinherflurryofblowsroutinetodoso.
Whenamonkreaches11thlevel,herflurryofblowsabilityimproves.Inadditiontothestandardsingleextraattackshe
getsfromflurryofblows,shegetsasecondextraattackatherfullbaseattackbonus.

UnarmedStrike
At1stlevel,amonkgainsImprovedUnarmedStrikeasabonusfeat.Amonksattacksmaybewitheitherfist
interchangeablyorevenfromelbows,knees,andfeet.Thismeansthatamonkmayevenmakeunarmedstrikeswithher
handsfull.Thereisnosuchthingasanoffhandattackforamonkstrikingunarmed.Amonkmaythusapplyherfull
Strengthbonusondamagerollsforallherunarmedstrikes.
Usuallyamonksunarmedstrikesdeallethaldamage,butshecanchoosetodealnonlethaldamageinsteadwithnopenalty
onherattackroll.Shehasthesamechoicetodeallethalornonlethaldamagewhilegrappling.
Amonksunarmedstrikeistreatedbothasamanufacturedweaponandanaturalweaponforthepurposeofspellsand
effectsthatenhanceorimproveeithermanufacturedweaponsornaturalweapons.
Amonkalsodealsmoredamagewithherunarmedstrikesthananormalpersonwould,asshownonTable:TheMonk.The
unarmeddamageonTable:TheMonkisforMediummonks.ASmallmonkdealslessdamagethantheamountgiventhere
withherunarmedattacks,whileaLargemonkdealsmoredamage;seetheSmallorLargeMonkUnarmedDamagetable.
Table:SmallorLargeMonkUnarmedDamage
LEVEL DAMAGE(SMALLMONK) DAMAGE(LARGEMONK)
1st3rd 1d4 1d8
4th7th 1d6 2d6
8th11th 1d8 2d8
12th15th 1d10 3d6
16th19th 2d6 3d8
20th 2d8 4d8

BonusFeat
At1stlevel,amonkmayselecteitherImprovedGrappleorStunningFistasabonusfeat.At2ndlevel,shemayselecteither
CombatReflexesorDeflectArrowsasabonusfeat.At6thlevel,shemayselecteitherImprovedDisarmorImprovedTripas
abonusfeat.Amonkneednothaveanyoftheprerequisitesnormallyrequiredforthesefeatstoselectthem.

Evasion(Ex)
At2ndlevelorhigherifamonkmakesasuccessfulReflexsavingthrowagainstanattackthatnormallydealshalfdamage
onasuccessfulsave,sheinsteadtakesnodamage.Evasioncanbeusedonlyifamonkiswearinglightarmorornoarmor.A
helplessmonkdoesnotgainthebenefitofevasion.

FastMovement(Ex)
At3rdlevel,amonkgainsanenhancementbonustoherspeed,asshownonTable:TheMonk.Amonkinarmororcarrying
amediumorheavyloadlosesthisextraspeed.

StillMind(Ex)
Amonkof3rdlevelorhighergainsa+2bonusonsavingthrowsagainstspellsandeffectsfromtheschoolofenchantment.

KiStrike(Su)
At4thlevel,amonksunarmedattacksareempoweredwithki.Herunarmedattacksaretreatedasmagicweaponsforthe
purposeofdealingdamagetocreatureswithdamagereduction.Kistrikeimproveswiththecharactersmonklevel.At10th
level,herunarmedattacksarealsotreatedaslawfulweaponsforthepurposeofdealingdamagetocreatureswithdamage
reduction.At16thlevel,herunarmedattacksaretreatedasadamantineweaponsforthepurposeofdealingdamageto
creatureswithdamagereductionandbypassinghardness.

Page31of462
SlowFall(Ex)
At4thlevelorhigher,amonkwithinarmsreachofawallcanuseittoslowherdescent.Whenfirstusingthisability,she
takesdamageasifthefallwere20feetshorterthanitactuallyis.Themonksabilitytoslowherfall(thatis,toreducethe
effectivedistanceofthefallwhennexttoawall)improveswithhermonkleveluntilat20thlevelshecanuseanearbywall
toslowherdescentandfallanydistancewithoutharm.

PurityofBody(Ex)
At5thlevel,amonkgainsimmunitytoalldiseasesexceptforsupernaturalandmagicaldiseases.

WholenessofBody(Su)
At7thlevelorhigher,amonkcanhealherownwounds.Shecanhealanumberofhitpointsofdamageequaltotwiceher
currentmonkleveleachday,andshecanspreadthishealingoutamongseveraluses.

ImprovedEvasion(Ex)
At9thlevel,amonksevasionabilityimproves.ShestilltakesnodamageonasuccessfulReflexsavingthrowagainst
attacks,buthenceforthshetakesonlyhalfdamageonafailedsave.Ahelplessmonkdoesnotgainthebenefitofimproved
evasion.

DiamondBody(Su)
At11thlevel,amonkgainsimmunitytopoisonsofallkinds.

AbundantStep(Su)
At12thlevelorhigher,amonkcanslipmagicallybetweenspaces,asifusingthespelldimensiondoor,onceperday.Her
casterlevelforthiseffectisonehalfhermonklevel(roundeddown).

DiamondSoul(Ex)
At13thlevel,amonkgainsspellresistanceequaltohercurrentmonklevel+10.Inordertoaffectthemonkwithaspell,a
spellcastermustgetaresultonacasterlevelcheck(1d20+casterlevel)thatequalsorexceedsthemonksspellresistance.

QuiveringPalm(Su)
Startingat15thlevel,amonkcansetupvibrationswithinthebodyofanothercreaturethatcanthereafterbefatalifthe
monksodesires.Shecanusethisquiveringpalmattackonceaweek,andshemustannounceherintentbeforemakingher
attackroll.Constructs,oozes,plants,undead,incorporealcreatures,andcreaturesimmunetocriticalhitscannotbe
affected.Otherwise,ifthemonkstrikessuccessfullyandthetargettakesdamagefromtheblow,thequiveringpalmattack
succeeds.Thereafterthemonkcantrytoslaythevictimatanylatertime,aslongastheattemptismadewithinanumber
ofdaysequaltohermonklevel.Tomakesuchanattempt,themonkmerelywillsthetargettodie(afreeaction),and
unlessthetargetmakesaFortitudesavingthrow(DC10+1/2themonkslevel+themonksWismodifier),itdies.Ifthe
savingthrowissuccessful,thetargetisnolongerindangerfromthatparticularquiveringpalmattack,butitmaystillbe
affectedbyanotheroneatalatertime.

TimelessBody(Ex)
Uponattaining17thlevel,amonknolongertakespenaltiestoherabilityscoresforagingandcannotbemagicallyaged.
Anysuchpenaltiesthatshehasalreadytaken,however,remaininplace.Bonusesstillaccrue,andthemonkstilldiesofold
agewhenhertimeisup.

TongueoftheSunandMoon(Ex)
Amonkof17thlevelorhighercanspeakwithanylivingcreature.

EmptyBody(Su)
At19thlevel,amonkgainstheabilitytoassumeanetherealstatefor1roundpermonklevelperday,asthoughusingthe
spelletherealness.Shemaygoetherealonanumberofdifferentoccasionsduringanysingleday,aslongasthetotal
numberofroundsspentinanetherealstatedoesnotexceedhermonklevel.

PerfectSelf
At20thlevel,amonkbecomesamagicalcreature.Sheisforevermoretreatedasanoutsiderratherthanasahumanoid(or
whateverthemonkscreaturetypewas)forthepurposeofspellsandmagicaleffects.Additionally,themonkgainsdamage
reduction10/magic,whichallowshertoignorethefirst10pointsofdamagefromanyattackmadebyanonmagical
weaponorbyanynaturalattackmadebyacreaturethatdoesnthavesimilardamagereduction.Unlikeotheroutsiders,the
monkcanstillbebroughtbackfromthedeadasifshewereamemberofherpreviouscreaturetype.

Page32of462
ExMonks
Amonkwhobecomesnonlawfulcannotgainnewlevelsasamonkbutretainsallmonkabilities.
Likeamemberofanyotherclass,amonkmaybeamulticlasscharacter,butmulticlassmonksfaceaspecialrestriction.A
monkwhogainsanewclassor(ifalreadymulticlass)raisesanotherclassbyalevelmayneveragainraisehermonklevel,
thoughsheretainsallhermonkabilities.

Paladin
Alignment
Lawfulgood.

HitDie
d10.

ClassSkills
Thepaladinsclassskills(andthekeyabilityforeachskill)areConcentration(Con),Craft(Int),Diplomacy(Cha),Handle
Animal(Cha),Heal(Wis),Knowledge(nobilityandroyalty)(Int),Knowledge(religion)(Int),Profession(Wis),Ride(Dex),
andSenseMotive(Wis).

SkillPointsat1stLevel
(2+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
2+Intmodifier.
Table:ThePaladin
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +1 +2 +0 +0 Auraofgood,Detectevil,Smiteevil1/day
2nd +2 +3 +0 +0 Divinegrace,Layonhands
3rd +3 +3 +1 +1 Auraofcourage,Divinehealth
4th +4 +4 +1 +1 Turnundead
5th +5 +4 +1 +1 Smiteevil2/day,Specialmount
6th +6/+1 +5 +2 +2 Removedisease1/week
7th +7/+2 +5 +2 +2
8th +8/+3 +6 +2 +2
9th +9/+4 +6 +3 +3 Removedisease2/week
10th +10/+5 +7 +3 +3 Smiteevil3/day
11th +11/+6/+1 +7 +3 +3
12th +12/+7/+2 +8 +4 +4 Removedisease3/week
13th +13/+8/+3 +8 +4 +4
14th +14/+9/+4 +9 +4 +4
15th +15/+10/+5 +9 +5 +5 Removedisease4/week,Smiteevil4/day
16th +16/+11/+6/+1 +10 +5 +5
17th +17/+12/+7/+2 +10 +5 +5
18th +18/+13/+8/+3 +11 +6 +6 Removedisease5/week
19th +19/+14/+9/+4 +11 +6 +6
20th +20/+15/+10/+5 +12 +6 +6 Smiteevil5/day
Table:PaladinSpellsPerDay
LEVEL 1ST 2ND 3RD 4TH
1st
2nd
3rd
4th 0
5th 0
6th 1
7th 1
8th 1 0
9th 1 0
10th 1 1
11th 1 1 0
12th 1 1 1
13th 1 1 1

Page33of462
LEVEL 1ST 2ND 3RD 4TH
14th 2 1 1 0
15th 2 1 1 1
16th 2 2 1 1
17th 2 2 2 1
18th 3 2 2 1
19th 3 3 3 2
20th 3 3 3 3

ClassFeatures
Allofthefollowingareclassfeaturesofthepaladin.

WeaponandArmorProficiency
Paladinsareproficientwithallsimpleandmartialweapons,withalltypesofarmor(heavy,medium,andlight),andwith
shields(excepttowershields).

AuraofGood(Ex)
Thepowerofapaladinsauraofgood(seethedetectgoodspell)isequaltoherpaladinlevel.

DetectEvil(Sp)
Atwill,apaladincanusedetectevil,asthespell.

SmiteEvil(Su)
Onceperday,apaladinmayattempttosmiteevilwithonenormalmeleeattack.SheaddsherCharismabonus(ifany)to
herattackrollanddeals1extrapointofdamageperpaladinlevel.Ifthepaladinaccidentallysmitesacreaturethatisnot
evil,thesmitehasnoeffect,buttheabilityisstillusedupforthatday.
At5thlevel,andateveryfivelevelsthereafter,thepaladinmaysmiteeviloneadditionaltimeperday,asindicatedon
Table:ThePaladin,toamaximumoffivetimesperdayat20thlevel.

DivineGrace(Su)
At2ndlevel,apaladingainsabonusequaltoherCharismabonus(ifany)onallsavingthrows.

LayonHands(Su)
Beginningat2ndlevel,apaladinwithaCharismascoreof12orhighercanhealwounds(herownorthoseofothers)by
touch.EachdayshecanhealatotalnumberofhitpointsofdamageequaltoherpaladinlevelxherCharismabonus.A
paladinmaychoosetodivideherhealingamongmultiplerecipients,andshedoesnthavetouseitallatonce.Usinglayon
handsisastandardaction.
Alternatively,apaladincanuseanyorallofthishealingpowertodealdamagetoundeadcreatures.Usinglayonhandsin
thiswayrequiresasuccessfulmeleetouchattackanddoesntprovokeanattackofopportunity.Thepaladindecideshow
manyofherdailyallotmentofpointstouseasdamageaftersuccessfullytouchinganundeadcreature.

AuraofCourage(Su)
Beginningat3rdlevel,apaladinisimmunetofear(magicalorotherwise).Eachallywithin10feetofhergainsa+4
moralebonusonsavingthrowsagainstfeareffects.
Thisabilityfunctionswhilethepaladinisconscious,butnotifsheisunconsciousordead.

DivineHealth(Ex)
At3rdlevel,apaladingainsimmunitytoalldiseases,includingsupernaturalandmagicaldiseases.

TurnUndead(Su)
Whenapaladinreaches4thlevel,shegainsthesupernaturalabilitytoturnundead.Shemayusethisabilityanumberof
timesperdayequalto3+herCharismamodifier.Sheturnsundeadasaclericofthreelevelslowerwould.

Spells
Beginningat4thlevel,apaladingainstheabilitytocastasmallnumberofdivinespells,whicharedrawnfromthepaladin
spelllist.Apaladinmustchooseandprepareherspellsinadvance.
Toprepareorcastaspell,apaladinmusthaveaWisdomscoreequaltoatleast10+thespelllevel.TheDifficultyClassfor
asavingthrowagainstapaladinsspellis10+thespelllevel+thepaladinsWisdommodifier.
Likeotherspellcasters,apaladincancastonlyacertainnumberofspellsofeachspelllevelperday.Herbasedailyspell

Page34of462
allotmentisgivenonTable:ThePaladin.Inaddition,shereceivesbonusspellsperdayifshehasahighWisdomscore.
WhenTable:ThePaladinindicatesthatthepaladingets0spellsperdayofagivenspelllevel,shegainsonlythebonus
spellsshewouldbeentitledtobasedonherWisdomscoreforthatspelllevelThepaladindoesnothaveaccesstoany
domainspellsorgrantedpowers,asaclericdoes.
Apaladinpreparesandcastsspellsthewayaclericdoes,thoughshecannotloseapreparedspelltospontaneouslycasta
curespellinitsplace.Apaladinmayprepareandcastanyspellonthepaladinspelllist,providedthatshecancastspellsof
thatlevel,butshemustchoosewhichspellstoprepareduringherdailymeditation.
Through3rdlevel,apaladinhasnocasterlevel.At4thlevelandhigher,hercasterlevelisonehalfherpaladinlevel.

SpecialMount(Sp)
Uponreaching5thlevel,apaladingainstheserviceofanunusuallyintelligent,strong,andloyalsteedtoserveherinher
crusadeagainstevil(seebelow).Thismountisusuallyaheavywarhorse(foraMediumpaladin)orawarpony(foraSmall
paladin).
Onceperday,asafullroundaction,apaladinmaymagicallycallhermountfromthecelestialrealmsinwhichitresides.
Themountimmediatelyappearsadjacenttothepaladinandremainsfor2hoursperpaladinlevel;itmaybedismissedat
anytimeasafreeaction.Themountisthesamecreatureeachtimeitissummoned,thoughthepaladinmayreleasea
particularmountfromservice.
Eachtimethemountiscalled,itappearsinfullhealth,regardlessofanydamageitmayhavetakenpreviously.Themount
alsoappearswearingorcarryinganygearithadwhenitwaslastdismissed.Callingamountisaconjuration(calling)
effect.
Shouldthepaladinsmountdie,itimmediatelydisappears,leavingbehindanyequipmentitwascarrying.Thepaladinmay
notsummonanothermountforthirtydaysoruntilshegainsapaladinlevel,whichevercomesfirst,evenifthemountis
somehowreturnedfromthedead.Duringthisthirtydayperiod,thepaladintakesa1penaltyonattackandweapon
damagerolls.

RemoveDisease(Sp)
At6thlevel,apaladincanproducearemovediseaseeffect,asthespell,onceperweek.Shecanusethisabilityone
additionaltimeperweekforeverythreelevelsafter6th(twiceperweekat9th,threetimesat12th,andsoforth).

CodeofConduct
Apaladinmustbeoflawfulgoodalignmentandlosesallclassabilitiesifsheeverwillinglycommitsanevilact.
Additionally,apaladinscoderequiresthatsherespectlegitimateauthority,actwithhonor(notlying,notcheating,not
usingpoison,andsoforth),helpthoseinneed(providedtheydonotusethehelpforevilorchaoticends),andpunish
thosewhoharmorthreateninnocents.

Associates
Whileshemayadventurewithcharactersofanygoodorneutralalignment,apaladinwillneverknowinglyassociatewith
evilcharacters,norwillshecontinueanassociationwithsomeonewhoconsistentlyoffendshermoralcode.Apaladinmay
acceptonlyhenchmen,followers,orcohortswhoarelawfulgood.

ExPaladins
Apaladinwhoceasestobelawfulgood,whowillfullycommitsanevilact,orwhogrosslyviolatesthecodeofconductloses
allpaladinspellsandabilities(includingtheserviceofthepaladinsmount,butnotweapon,armor,andshield
proficiencies).Shemaynotprogressanyfartherinlevelsasapaladin.Sheregainsherabilitiesandadvancementpotential
ifsheatonesforherviolations(seetheatonementspelldescription),asappropriate.
Likeamemberofanyotherclass,apaladinmaybeamulticlasscharacter,butmulticlasspaladinsfaceaspecialrestriction.
Apaladinwhogainsalevelinanyclassotherthanpaladinmayneveragainraiseherpaladinlevel,thoughsheretainsall
herpaladinabilities.

ThePaladinsMount
Thepaladinsmountissuperiortoanormalmountofitskindandhasspecialpowers,asdescribedbelow.Thestandard
mountforaMediumpaladinisaheavywarhorse,andthestandardmountforaSmallpaladinisawarpony.Anotherkind
ofmount,suchasaridingdog(forahalflingpaladin)oraLargeshark(forapaladininanaquaticcampaign)maybe
allowedaswell.
Apaladinsmountistreatedasamagicalbeast,notananimal,forthepurposeofalleffectsthatdependonitstype(though

Page35of462
itretainsananimalsHD,baseattackbonus,saves,skillpoints,andfeats).
Table:ThePaladin'sMount
PALADINLEVEL BONUSHD NATURALARMORADJ. STRADJ. INT SPECIAL
5th7th +2 +4 +1 6 Empathiclink,improvedevasion,sharespells,sharesavingthrows
8th10th +4 +6 +2 7 Improvedspeed
11th14th +6 +8 +3 8 Commandcreaturesofitskind
15th20th +8 +10 +4 9 Spellresistance

BonusHD
Extraeightsided(d8)HitDice,eachofwhichgainsaConstitutionmodifier,asnormal.ExtraHitDiceimprovethemounts
baseattackandbasesavebonuses.Aspecialmountsbaseattackbonusisequaltothatofaclericofalevelequaltothe
mountsHD.AmounthasgoodFortitudeandReflexsaves(treatitasacharacterwhoselevelequalstheanimalsHD).The
mountgainsadditionalskillpointsorfeatsforbonusHDasnormalforadvancingamonstersHitDice.

NaturalArmorAdj.
Thenumberonthetableisanimprovementtothemountsexistingnaturalarmorbonus.

StrAdj.
AddthisfiguretothemountsStrengthscore.

Int
ThemountsIntelligencescore.

EmpathicLink(Su)
Thepaladinhasanempathiclinkwithhermountouttoadistanceofupto1mile.Thepaladincannotseethroughthe
mountseyes,buttheycancommunicateempathically.
Notethatevenintelligentmountsseetheworlddifferentlyfromhumans,somisunderstandingsarealwayspossible.
Becauseofthisempathiclink,thepaladinhasthesameconnectiontoanitemorplacethathermountdoes,justaswitha
masterandhisfamiliar(seeFamiliars).

ImprovedEvasion(Ex)
WhensubjectedtoanattackthatnormallyallowsaReflexsavingthrowforhalfdamage,amounttakesnodamageifit
makesasuccessfulsavingthrowandhalfdamageifthesavingthrowfails.

ShareSpells
Atthepaladinsoption,shemayhaveanyspell(butnotanyspelllikeability)shecastsonherselfalsoaffecthermount.
Themountmustbewithin5feetatthetimeofcastingtoreceivethebenefit.Ifthespelloreffecthasadurationotherthan
instantaneous,itstopsaffectingthemountifitmovesfartherthan5feetawayandwillnotaffectthemountagainevenifit
returnstothepaladinbeforethedurationexpires.Additionally,thepaladinmaycastaspellwithatargetofYouonher
mount(asatouchrangespell)insteadofonherself.Apaladinandhermountcansharespellsevenifthespellsnormally
donotaffectcreaturesofthemountstype(magicalbeast).

ShareSavingThrows
Foreachofitssavingthrows,themountusesitsownbasesavebonusorthepaladins,whicheverishigher.Themount
appliesitsownabilitymodifierstosaves,anditdoesntshareanyotherbonusesonsavesthatthemastermighthave.

ImprovedSpeed(Ex)
Themountsspeedincreasesby10feet.
Command(Sp):Onceperdaypertwopaladinlevelsofitsmaster,amountcanusethisabilitytocommandotherany
normalanimalofapproximatelythesamekindasitself(forwarhorsesandwarponies,thiscategoryincludesdonkeys,
mules,andponies),aslongasthetargetcreaturehasfewerHitDicethanthemount.Thisabilityfunctionslikethe
commandspell,butthemountmustmakeaDC21Concentrationchecktosucceedifitsbeingriddenatthetime.Ifthe
checkfails,theabilitydoesnotworkthattime,butitstillcountsagainstthemountsdailyuses.Eachtargetmayattempta
Willsave(DC10+1/2paladinslevel+paladinsChamodifier)tonegatetheeffect.

SpellResistance(Ex)
Amountsspellresistanceequalsitsmasterspaladinlevel+5.Toaffectthemountwithaspell,aspellcastermustgeta
resultonacasterlevelcheck(1d20+casterlevel)thatequalsorexceedsthemountsspellresistance.

Page36of462
Ranger
Alignment
Any.

HitDie
d8.

ClassSkills
Therangersclassskills(andthekeyabilityforeachskill)areClimb(Str),Concentration(Con),Craft(Int),HandleAnimal
(Cha),Heal(Wis),Hide(Dex),Jump(Str),Knowledge(dungeoneering)(Int),Knowledge(geography)(Int),Knowledge
(nature)(Int),Listen(Wis),MoveSilently(Dex),Profession(Wis),Ride(Dex),Search(Int),Spot(Wis),Survival(Wis),
Swim(Str),andUseRope(Dex).

SkillPointsat1stLevel
(6+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
6+Intmodifier.
Table:TheRanger
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +1 +2 +2 +0 1stfavoredenemy,Track,wildempathy
2nd +2 +3 +3 +0 Combatstyle
3rd +3 +3 +3 +1 Endurance
4th +4 +4 +4 +1 Animalcompanion
5th +5 +4 +4 +1 2ndfavoredenemy
6th +6/+1 +5 +5 +2 Improvedcombatstyle
7th +7/+2 +5 +5 +2 Woodlandstride
8th +8/+3 +6 +6 +2 Swifttracker
9th +9/+4 +6 +6 +3 Evasion
10th +10/+5 +7 +7 +3 3rdfavoredenemy
11th +11/+6/+1 +7 +7 +3 Combatstylemastery
12th +12/+7/+2 +8 +8 +4
13th +13/+8/+3 +8 +8 +4 Camouflage
14th +14/+9/+4 +9 +9 +4
15th +15/+10/+5 +9 +9 +5 4thfavoredenemy
16th +16/+11/+6/+1 +10 +10 +5
17th +17/+12/+7/+2 +10 +10 +5 Hideinplainsight
18th +18/+13/+8/+3 +11 +11 +6
19th +19/+14/+9/+4 +11 +11 +6
20th +20/+15/+10/+5 +12 +12 +6 5thfavoredenemy
Table:RangerSpellsperDay
LEVEL 1ST 2ND 3RD 4TH
1st
2nd
3rd
4th 0
5th 0
6th 1
7th 1
8th 1 0
9th 1 0
10th 1 1
11th 1 1 0
12th 1 1 1
13th 1 1 1
14th 2 1 1 0
15th 2 1 1 1
16th 2 2 1 1
17th 2 2 2 1
18th 3 2 2 1
19th 3 3 3 2

Page37of462
LEVEL 1ST 2ND 3RD 4TH
20th 3 3 3 3

ClassFeatures
Allofthefollowingareclassfeaturesoftheranger.

WeaponandArmorProficiency
Arangerisproficientwithallsimpleandmartialweapons,andwithlightarmorandshields(excepttowershields).

FavoredEnemy(Ex)
At1stlevel,arangermayselectatypeofcreaturefromamongthosegivenonTable:RangerFavoredEnemies.Theranger
gainsa+2bonusonBluff,Listen,SenseMotive,Spot,andSurvivalcheckswhenusingtheseskillsagainstcreaturesofthis
type.Likewise,hegetsa+2bonusonweapondamagerollsagainstsuchcreatures.
At5thlevelandeveryfivelevelsthereafter(10th,15th,and20thlevel),therangermayselectanadditionalfavoredenemy
fromthosegivenonthetable.Inaddition,ateachsuchinterval,thebonusagainstanyonefavoredenemy(includingthe
onejustselected,ifsodesired)increasesby2.
Iftherangerchooseshumanoidsoroutsidersasafavoredenemy,hemustalsochooseanassociatedsubtype,asindicated
onthetable.Ifaspecificcreaturefallsintomorethanonecategoryoffavoredenemy,therangersbonusesdonotstack;he
simplyuseswhicheverbonusishigher.
Table:RangerFavoredEnemies
TYPE(SUBTYPE) TYPE(SUBTYPE)
Aberration Humanoid(reptilian)
Animal Magicalbeast
Construct Monstroushumanoid
Dragon Ooze
Elemental Outsider(air)
Fey Outsider(chaotic)
Giant Outsider(earth)
Humanoid(aquatic) Outsider(evil)
Humanoid(dwarf) Outsider(fire)
Humanoid(elf) Outsider(good)
Humanoid(goblinoid) Outsider(lawful)
Humanoid(gnoll) Outsider(native)
Humanoid(gnome) Outsider(water)
Humanoid(halfling) Plant
Humanoid(human) Undead
Humanoid(orc) Vermin

Track
ArangergainsTrackasabonusfeat.

WildEmpathy(Ex)
Arangercanimprovetheattitudeofananimal.ThisabilityfunctionsjustlikeaDiplomacychecktoimprovetheattitudeof
aperson.Therangerrolls1d20andaddshisrangerlevelandhisCharismabonustodeterminethewildempathycheck
result.Thetypicaldomesticanimalhasastartingattitudeofindifferent,whilewildanimalsareusuallyunfriendly.
Tousewildempathy,therangerandtheanimalmustbeabletostudyeachother,whichmeansthattheymustbewithin30
feetofoneanotherundernormalvisibilityconditions.Generally,influencingananimalinthiswaytakes1minute,but,as
withinfluencingpeople,itmighttakemoreorlesstime.
TherangercanalsousethisabilitytoinfluenceamagicalbeastwithanIntelligencescoreof1or2,buthetakesa4
penaltyonthecheck.

CombatStyle(Ex)
At2ndlevel,arangermustselectoneoftwocombatstylestopursue:archeryortwoweaponcombat.Thischoiceaffects
thecharactersclassfeaturesbutdoesnotrestricthisselectionoffeatsorspecialabilitiesinanyway.
Iftherangerselectsarchery,heistreatedashavingtheRapidShotfeat,evenifhedoesnothavethenormalprerequisites
forthatfeat.
Iftherangerselectstwoweaponcombat,heistreatedashavingtheTwoWeaponFightingfeat,evenifhedoesnothave
thenormalprerequisitesforthatfeat.

Page38of462
Thebenefitsoftherangerschosenstyleapplyonlywhenhewearslightornoarmor.Helosesallbenefitsofhiscombat
stylewhenwearingmediumorheavyarmor.

Endurance
ArangergainsEnduranceasabonusfeatat3rdlevel.

AnimalCompanion(Ex)
At4thlevel,arangergainsananimalcompanionselectedfromthefollowinglist:badger,camel,direrat,dog,ridingdog,
eagle,hawk,horse(lightorheavy),owl,pony,snake(SmallorMediumviper),orwolf.Ifthecampaigntakesplacewholly
orpartlyinanaquaticenvironment,thefollowingcreaturesmaybeaddedtotherangerslistofoptions:crocodile,
porpoise,Mediumshark,andsquid.Thisanimalisaloyalcompanionthataccompaniestherangeronhisadventuresas
appropriateforitskind.
Thisabilityfunctionslikethedruidabilityofthesamename,exceptthattherangerseffectivedruidlevelisonehalfhis
rangerlevel.Arangermayselectfromthealternativelistsofanimalcompanionsjustasadruidcan,thoughagainhis
effectivedruidlevelishalfhisrangerlevel.Likeadruid,arangercannotselectanalternativeanimalifthechoicewould
reducehiseffectivedruidlevelbelow1st.

Spells
Beginningat4thlevel,arangergainstheabilitytocastasmallnumberofdivinespells,whicharedrawnfromtheranger
spelllist.Arangermustchooseandpreparehisspellsinadvance(seebelow).
Toprepareorcastaspell,arangermusthaveaWisdomscoreequaltoatleast10+thespelllevel.TheDifficultyClassfor
asavingthrowagainstarangersspellis10+thespelllevel+therangersWisdommodifier.
Likeotherspellcasters,arangercancastonlyacertainnumberofspellsofeachspelllevelperday.Hisbasedailyspell
allotmentisgivenonTable:TheRanger.Inaddition,hereceivesbonusspellsperdayifhehasahighWisdomscore.When
Table:TheRangerindicatesthattherangergets0spellsperdayofagivenspelllevel,hegainsonlythebonusspellshe
wouldbeentitledtobasedonhisWisdomscoreforthatspelllevel.Therangerdoesnothaveaccesstoanydomainspellsor
grantedpowers,asaclericdoes.
Arangerpreparesandcastsspellsthewayaclericdoes,thoughhecannotloseapreparedspelltocastacurespellinits
place.Arangermayprepareandcastanyspellontherangerspelllist,providedthathecancastspellsofthatlevel,buthe
mustchoosewhichspellstoprepareduringhisdailymeditation.
Through3rdlevel,arangerhasnocasterlevel.At4thlevelandhigher,hiscasterlevelisonehalfhisrangerlevel.

ImprovedCombatStyle(Ex)
At6thlevel,arangersaptitudeinhischosencombatstyle(archeryortwoweaponcombat)improves.Ifheselected
archeryat2ndlevel,heistreatedashavingtheManyshotfeat,evenifhedoesnothavethenormalprerequisitesforthat
feat.
Iftherangerselectedtwoweaponcombatat2ndlevel,heistreatedashavingtheImprovedTwoWeaponFightingfeat,
evenifhedoesnothavethenormalprerequisitesforthatfeat.
Asbefore,thebenefitsoftherangerschosenstyleapplyonlywhenhewearslightornoarmor.Helosesallbenefitsofhis
combatstylewhenwearingmediumorheavyarmor.

WoodlandStride(Ex)
Startingat7thlevel,arangermaymovethroughanysortofundergrowth(suchasnaturalthorns,briars,overgrownareas,
andsimilarterrain)athisnormalspeedandwithouttakingdamageorsufferinganyotherimpairment.
However,thorns,briars,andovergrownareasthatareenchantedormagicallymanipulatedtoimpedemotionstillaffect
him.

SwiftTracker(Ex)
Beginningat8thlevel,arangercanmoveathisnormalspeedwhilefollowingtrackswithouttakingthenormal5penalty.
Hetakesonlya10penalty(insteadofthenormal20)whenmovingatuptotwicenormalspeedwhiletracking.

Evasion(Ex)
At9thlevel,arangercanavoidevenmagicalandunusualattackswithgreatagility.IfhemakesasuccessfulReflexsaving
throwagainstanattackthatnormallydealshalfdamageonasuccessfulsave,heinsteadtakesnodamage.Evasioncanbe
usedonlyiftherangeriswearinglightarmorornoarmor.Ahelplessrangerdoesnotgainthebenefitofevasion.

Page39of462
CombatStyleMastery(Ex)
At11thlevel,arangersaptitudeinhischosencombatstyle(archeryortwoweaponcombat)improvesagain.Ifheselected
archeryat2ndlevel,heistreatedashavingtheImprovedPreciseShotfeat,evenifhedoesnothavethenormal
prerequisitesforthatfeat.
Iftherangerselectedtwoweaponcombatat2ndlevel,heistreatedashavingtheGreaterTwoWeaponFightingfeat,even
ifhedoesnothavethenormalprerequisitesforthatfeat.
Asbefore,thebenefitsoftherangerschosenstyleapplyonlywhenhewearslightornoarmor.Helosesallbenefitsofhis
combatstylewhenwearingmediumorheavyarmor.

Camouflage(Ex)
Arangerof13thlevelorhighercanusetheHideskillinanysortofnaturalterrain,eveniftheterraindoesntgrantcover
orconcealment.

HideinPlainSight(Ex)
Whileinanysortofnaturalterrain,arangerof17thlevelorhighercanusetheHideskillevenwhilebeingobserved.

Rogue
Alignment
Any.

HitDie
d6.

ClassSkills
Theroguesclassskills(andthekeyabilityforeachskill)areAppraise(Int),Balance(Dex),Bluff(Cha),Climb(Str),Craft
(Int),DecipherScript(Int),Diplomacy(Cha),DisableDevice(Int),Disguise(Cha),EscapeArtist(Dex),Forgery(Int),
GatherInformation(Cha),Hide(Dex),Intimidate(Cha),Jump(Str),Knowledge(local)(Int),Listen(Wis),MoveSilently
(Dex),OpenLock(Dex),Perform(Cha),Profession(Wis),Search(Int),SenseMotive(Wis),SleightofHand(Dex),Spot
(Wis),Swim(Str),Tumble(Dex),UseMagicDevice(Cha),andUseRope(Dex).

SkillPointsat1stLevel
(8+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
8+Intmodifier.
Table:TheRogue
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +0 +2 +0 Sneakattack+1d6,trapfinding
2nd +1 +0 +3 +0 Evasion
3rd +2 +1 +3 +1 Sneakattack+2d6,trapsense+1
4th +3 +1 +4 +1 Uncannydodge
5th +3 +1 +4 +1 Sneakattack+3d6
6th +4 +2 +5 +2 Trapsense+2
7th +5 +2 +5 +2 Sneakattack+4d6
8th +6/+1 +2 +6 +2 Improveduncannydodge
9th +6/+1 +3 +6 +3 Sneakattack+5d6,trapsense+3
10th +7/+2 +3 +7 +3 Specialability
11th +8/+3 +3 +7 +3 Sneakattack+6d6
12th +9/+4 +4 +8 +4 Trapsense+4
13th +9/+4 +4 +8 +4 Sneakattack+7d6,specialability
14th +10/+5 +4 +9 +4
15th +11/+6/+1 +5 +9 +5 Sneakattack+8d6,trapsense+5
16th +12/+7/+2 +5 +10 +5 Specialability
17th +12/+7/+2 +5 +10 +5 Sneakattack+9d6
18th +13/+8/+3 +6 +11 +6 Trapsense+6
19th +14/+9/+4 +6 +11 +6 Sneakattack+10d6,specialability
20th +15/+10/+5 +6 +12 +6

Page40of462
ClassFeatures
Allofthefollowingareclassfeaturesoftherogue.

WeaponandArmorProficiency
Roguesareproficientwithallsimpleweapons,plusthehandcrossbow,rapier,shortbow,andshortsword.Roguesare
proficientwithlightarmor,butnotwithshields.

SneakAttack
Ifaroguecancatchanopponentwhenheisunabletodefendhimselfeffectivelyfromherattack,shecanstrikeavitalspot
forextradamage.
TheroguesattackdealsextradamageanytimehertargetwouldbedeniedaDexteritybonustoAC(whetherthetarget
actuallyhasaDexteritybonusornot),orwhentherogueflankshertarget.Thisextradamageis1d6at1stlevel,andit
increasesby1d6everytworoguelevelsthereafter.Shouldtheroguescoreacriticalhitwithasneakattack,thisextra
damageisnotmultiplied.
Rangedattackscancountassneakattacksonlyifthetargetiswithin30feet.
Withasap(blackjack)oranunarmedstrike,aroguecanmakeasneakattackthatdealsnonlethaldamageinsteadoflethal
damage.Shecannotuseaweaponthatdealslethaldamagetodealnonlethaldamageinasneakattack,notevenwiththe
usual4penalty.
Aroguecansneakattackonlylivingcreatureswithdiscernibleanatomiesundead,constructs,oozes,plants,and
incorporealcreatureslackvitalareastoattack.Anycreaturethatisimmunetocriticalhitsisnotvulnerabletosneak
attacks.Theroguemustbeabletoseethetargetwellenoughtopickoutavitalspotandmustbeabletoreachsuchaspot.
Aroguecannotsneakattackwhilestrikingacreaturewithconcealmentorstrikingthelimbsofacreaturewhosevitalsare
beyondreach.

Trapfinding
Rogues(andonlyrogues)canusetheSearchskilltolocatetrapswhenthetaskhasaDifficultyClasshigherthan20.
FindinganonmagicaltraphasaDCofatleast20,orhigherifitiswellhidden.FindingamagictraphasaDCof25+the
levelofthespellusedtocreateit.
Rogues(andonlyrogues)canusetheDisableDeviceskilltodisarmmagictraps.AmagictrapgenerallyhasaDCof25+
thelevelofthespellusedtocreateit.
AroguewhobeatsatrapsDCby10ormorewithaDisableDevicecheckcanstudyatrap,figureouthowitworks,and
bypassit(withherparty)withoutdisarmingit.

Evasion(Ex)
At2ndlevelandhigher,aroguecanavoidevenmagicalandunusualattackswithgreatagility.Ifshemakesasuccessful
Reflexsavingthrowagainstanattackthatnormallydealshalfdamageonasuccessfulsave,sheinsteadtakesnodamage.
Evasioncanbeusedonlyiftherogueiswearinglightarmorornoarmor.Ahelplessroguedoesnotgainthebenefitof
evasion.

TrapSense(Ex)
At3rdlevel,aroguegainsanintuitivesensethatalertshertodangerfromtraps,givinghera+1bonusonReflexsaves
madetoavoidtrapsanda+1dodgebonustoACagainstattacksmadebytraps.Thesebonusesriseto+2whentherogue
reaches6thlevel,to+3whenshereaches9thlevel,to+4whenshereaches12thlevel,to+5at15th,andto+6at18th
level.
Trapsensebonusesgainedfrommultipleclassesstack.

UncannyDodge(Ex)
Startingat4thlevel,aroguecanreacttodangerbeforehersenseswouldnormallyallowhertodoso.Sheretainsher
DexteritybonustoAC(ifany)evenifsheiscaughtflatfootedorstruckbyaninvisibleattacker.However,shestilllosesher
DexteritybonustoACifimmobilized.
Ifaroguealreadyhasuncannydodgefromadifferentclasssheautomaticallygainsimproveduncannydodge(seebelow)
instead.

ImprovedUncannyDodge(Ex)
Arogueof8thlevelorhighercannolongerbeflanked.

Page41of462
Thisdefensedeniesanotherroguetheabilitytosneakattackthecharacterbyflankingher,unlesstheattackerhasatleast
fourmoreroguelevelsthanthetargetdoes.
Ifacharacteralreadyhasuncannydodge(seeabove)fromasecondclass,thecharacterautomaticallygainsimproved
uncannydodgeinstead,andthelevelsfromtheclassesthatgrantuncannydodgestacktodeterminetheminimumrogue
levelrequiredtoflankthecharacter.

SpecialAbilities
Onattaining10thlevel,andateverythreelevelsthereafter(13th,16th,and19th),aroguegainsaspecialabilityofher
choicefromamongthefollowingoptions.
CripplingStrike(Ex):Aroguewiththisabilitycansneakattackopponentswithsuchprecisionthatherblowsweakenand
hamperthem.Anopponentdamagedbyoneofhersneakattacksalsotakes2pointsofStrengthdamage.Abilitypointslost
todamagereturnontheirownattherateof1pointperdayforeachdamagedability.
DefensiveRoll(Ex):Theroguecanrollwithapotentiallylethalblowtotakelessdamagefromitthansheotherwisewould.
Onceperday,whenshewouldbereducedto0orfewerhitpointsbydamageincombat(fromaweaponorotherblow,not
aspellorspecialability),theroguecanattempttorollwiththedamage.Tousethisability,theroguemustattemptaReflex
savingthrow(DC=damagedealt).Ifthesavesucceeds,shetakesonlyhalfdamagefromtheblow;ifitfails,shetakesfull
damage.Shemustbeawareoftheattackandabletoreacttoitinordertoexecuteherdefensiverollifsheisdeniedher
DexteritybonustoAC,shecantusethisability.SincethiseffectwouldnotnormallyallowacharactertomakeaReflex
saveforhalfdamage,theroguesevasionabilitydoesnotapplytothedefensiveroll.
ImprovedEvasion(Ex):Thisabilityworkslikeevasion,exceptthatwhiletheroguestilltakesnodamageonasuccessful
Reflexsavingthrowagainstattackshenceforthshehenceforthtakesonlyhalfdamageonafailedsave.Ahelplessrogue
doesnotgainthebenefitofimprovedevasion.
Opportunist(Ex):Onceperround,theroguecanmakeanattackofopportunityagainstanopponentwhohasjustbeen
struckfordamageinmeleebyanothercharacter.Thisattackcountsastheroguesattackofopportunityforthatround.
EvenaroguewiththeCombatReflexesfeatcantusetheopportunistabilitymorethanonceperround.
SkillMastery:Theroguebecomessocertainintheuseofcertainskillsthatshecanusethemreliablyevenunderadverse
conditions.Upongainingthisability,sheselectsanumberofskillsequalto3+herIntelligencemodifier.Whenmakinga
skillcheckwithoneoftheseskills,shemaytake10evenifstressanddistractionswouldnormallypreventherfromdoing
so.Aroguemaygainthisspecialabilitymultipletimes,selectingadditionalskillsforittoapplytoeachtime.
SlipperyMind(Ex):Thisabilityrepresentstheroguesabilitytowrigglefreefrommagicaleffectsthatwouldotherwise
controlorcompelher.Ifaroguewithslipperymindisaffectedbyanenchantmentspelloreffectandfailshersavingthrow,
shecanattemptitagain1roundlateratthesameDC.Shegetsonlythisoneextrachancetosucceedonhersavingthrow.
Feat:Aroguemaygainabonusfeatinplaceofaspecialability.

Sorcerer
Alignment
Any.

HitDie
d4.

ClassSkills
Thesorcerersclassskills(andthekeyabilityforeachskill)areBluff(Cha),Concentration(Con),Craft(Int),Knowledge
(arcana)(Int),Profession(Wis),andSpellcraft(Int).

SkillPointsat1stLevel
(2+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
2+Intmodifier.
Table:TheSorcerer
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +0 +0 +2 Summonfamiliar
2nd +1 +0 +0 +3

Page42of462
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
3rd +1 +1 +1 +3
4th +2 +1 +1 +4
5th +2 +1 +1 +4
6th +3 +2 +2 +5
7th +3 +2 +2 +5
8th +4 +2 +2 +6
9th +4 +3 +3 +6
10th +5 +3 +3 +7
11th +5 +3 +3 +7
12th +6/+1 +4 +4 +8
13th +6/+1 +4 +4 +8
14th +7/+2 +4 +4 +9
15th +7/+2 +5 +5 +9
16th +8/+3 +5 +5 +10
17th +8/+3 +5 +5 +10
18th +9/+4 +6 +6 +11
19th +9/+4 +6 +6 +11
20th +10/+5 +6 +6 +12
Table:SorcererSpellsPerDay
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1st 5 3
2nd 6 4
3rd 6 5
4th 6 6 3
5th 6 6 4
6th 6 6 5 3
7th 6 6 6 4
8th 6 6 6 5 3
9th 6 6 6 6 4
10th 6 6 6 6 5 3
11th 6 6 6 6 6 4
12th 6 6 6 6 6 5 3
13th 6 6 6 6 6 6 4
14th 6 6 6 6 6 6 5 3
15th 6 6 6 6 6 6 6 4
16th 6 6 6 6 6 6 6 5 3
17th 6 6 6 6 6 6 6 6 4
18th 6 6 6 6 6 6 6 6 5 3
19th 6 6 6 6 6 6 6 6 6 4
20th 6 6 6 6 6 6 6 6 6 6
Table:SorcererSpellsKnown
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1st 4 2
2nd 5 2
3rd 5 3
4th 6 3 1
5th 6 4 2
6th 7 4 2 1
7th 7 5 3 2
8th 8 5 3 2 1
9th 8 5 4 3 2
10th 9 5 4 3 2 1
11th 9 5 5 4 3 2
12th 9 5 5 4 3 2 1
13th 9 5 5 4 4 3 2
14th 9 5 5 4 4 3 2 1
15th 9 5 5 4 4 4 3 2
16th 9 5 5 4 4 4 3 2 1
17th 9 5 5 4 4 4 3 3 2
18th 9 5 5 4 4 4 3 3 2 1
19th 9 5 5 4 4 4 3 3 3 2
20th 9 5 5 4 4 4 3 3 3 3

Page43of462
ClassFeatures
Allofthefollowingareclassfeaturesofthesorcerer.

WeaponandArmorProficiency
Sorcerersareproficientwithallsimpleweapons.Theyarenotproficientwithanytypeofarmororshield.Armorofany
typeinterfereswithasorcerersgestures,whichcancausehisspellswithsomaticcomponentstofail.

Spells
Asorcerercastsarcanespellswhicharedrawnprimarilyfromthesorcerer/wizardspelllist.Hecancastanyspellheknows
withoutpreparingitaheadoftime,thewayawizardoraclericmust(seebelow).
Tolearnorcastaspell,asorcerermusthaveaCharismascoreequaltoatleast10+thespelllevel.TheDifficultyClassfor
asavingthrowagainstasorcerersspellis10+thespelllevel+thesorcerersCharismamodifier.
Likeotherspellcasters,asorcerercancastonlyacertainnumberofspellsofeachspelllevelperday.Hisbasedailyspell
allotmentisgivenonTable:TheSorcerer.Inaddition,hereceivesbonusspellsperdayifhehasahighCharismascore.
Asorcerersselectionofspellsisextremelylimited.Asorcererbeginsplayknowingfour0levelspellsandtwo1stlevel
spellsofyourchoice.Ateachnewsorcererlevel,hegainsoneormorenewspells,asindicatedonTable:SorcererSpells
Known.(Unlikespellsperday,thenumberofspellsasorcererknowsisnotaffectedbyhisCharismascore;thenumberson
Table:SorcererSpellsKnownarefixed.)Thesenewspellscanbecommonspellschosenfromthesorcerer/wizardspelllist,
ortheycanbeunusualspellsthatthesorcererhasgainedsomeunderstandingofbystudy.Thesorcerercantusethis
methodofspellacquisitiontolearnspellsatafasterrate,however.
Uponreaching4thlevel,andateveryevennumberedsorcererlevelafterthat(6th,8th,andsoon),asorcerercanchoose
tolearnanewspellinplaceofonehealreadyknows.Ineffect,thesorcererlosestheoldspellinexchangeforthenew
one.Thenewspellslevelmustbethesameasthatofthespellbeingexchanged,anditmustbeatleasttwolevelslower
thanthehighestlevelsorcererspellthesorcerercancast.Asorcerermayswaponlyasinglespellatanygivenlevel,and
mustchoosewhetherornottoswapthespellatthesametimethathegainsnewspellsknownforthelevel.
Unlikeawizardoracleric,asorcererneednotpreparehisspellsinadvance.Hecancastanyspellheknowsatanytime,
assuminghehasnotyetuseduphisspellsperdayforthatspelllevel.Hedoesnothavetodecideaheadoftimewhich
spellshellcast.

Familiar
Asorcerercanobtainafamiliar(seebelow).Doingsotakes24hoursandusesupmagicalmaterialsthatcost100gp.A
familiarisamagicalbeastthatresemblesasmallanimalandisunusuallytoughandintelligent.Thecreatureservesasa
companionandservant.
Thesorcererchoosesthekindoffamiliarhegets.Asthesorcereradvancesinlevel,hisfamiliaralsoincreasesinpower.
Ifthefamiliardiesorisdismissedbythesorcerer,thesorcerermustattemptaDC15Fortitudesavingthrow.Failuremeans
heloses200experiencepointspersorcererlevel;successreducesthelosstoonehalfthatamount.However,asorcerers
experiencepointtotalcannevergobelow0astheresultofafamiliarsdemiseordismissal.Aslainordismissedfamiliar
cannotbereplacedforayearandday.Aslainfamiliarcanberaisedfromthedeadjustasacharactercanbe,anditdoes
notlosealeveloraConstitutionpointwhenthishappyeventoccurs.
Acharacterwithmorethanoneclassthatgrantsafamiliarmayhaveonlyonefamiliaratatime.

Wizard
Alignment
Any.

HitDie
d4.

ClassSkills
Thewizardsclassskills(andthekeyabilityforeachskill)areConcentration(Con),Craft(Int),DecipherScript(Int),
Knowledge(allskills,takenindividually)(Int),Profession(Wis),andSpellcraft(Int).SeeChapter4:Skillsforskill
descriptions.

Page44of462
SkillPointsat1stLevel
(2+Intmodifier)x4.

SkillPointsatEachAdditionalLevel
2+Intmodifier.
Table:TheWizard
LEVEL BASEATTACKBONUS FORTSAVE REFSAVE WILLSAVE SPECIAL
1st +0 +0 +0 +2 Summonfamiliar,ScribeScroll
2nd +1 +0 +0 +3
3rd +1 +1 +1 +3
4th +2 +1 +1 +4
5th +2 +1 +1 +4 Bonusfeat
6th +3 +2 +2 +5
7th +3 +2 +2 +5
8th +4 +2 +2 +6
9th +4 +3 +3 +6
10th +5 +3 +3 +7 Bonusfeat
11th +5 +3 +3 +7
12th +6/+1 +4 +4 +8
13th +6/+1 +4 +4 +8
14th +7/+2 +4 +4 +9
15th +7/+2 +5 +5 +9 Bonusfeat
16th +8/+3 +5 +5 +10
17th +8/+3 +5 +5 +10
18th +9/+4 +6 +6 +11
19th +9/+4 +6 +6 +11
20th +10/+5 +6 +6 +12 Bonusfeat
Table:WizardSpellsPerDay
LEVEL 0 1ST 2ND 3RD 4TH 5TH 6TH 7TH 8TH 9TH
1st 3 1
2nd 4 2
3rd 4 2 1
4th 4 3 2
5th 4 3 2 1
6th 4 3 3 2
7th 4 4 3 2 1
8th 4 4 3 3 2
9th 4 4 4 3 2 1
10th 4 4 4 3 3 2
11th 4 4 4 4 3 2 1
12th 4 4 4 4 3 3 2
13th 4 4 4 4 4 3 2 1
14th 4 4 4 4 4 3 3 2
15th 4 4 4 4 4 4 3 2 1
16th 4 4 4 4 4 4 3 3 2
17th 4 4 4 4 4 4 4 3 2 1
18th 4 4 4 4 4 4 4 3 3 2
19th 4 4 4 4 4 4 4 4 3 3
20th 4 4 4 4 4 4 4 4 4 4

ClassFeatures
Allofthefollowingareclassfeaturesofthewizard.

WeaponandArmorProficiency
Wizardsareproficientwiththeclub,dagger,heavycrossbow,lightcrossbow,andquarterstaff,butnotwithanytypeof
armororshield.Armorofanytypeinterfereswithawizardsmovements,whichcancauseherspellswithsomatic
componentstofail.

Spells
Awizardcastsarcanespellswhicharedrawnfromthesorcerer/wizardspelllist.Awizardmustchooseandprepareher
spellsaheadoftime(seebelow).
Tolearn,prepare,orcastaspell,thewizardmusthaveanIntelligencescoreequaltoatleast10+thespelllevel.The
Page45of462
DifficultyClassforasavingthrowagainstawizardsspellis10+thespelllevel+thewizardsIntelligencemodifier.
Likeotherspellcasters,awizardcancastonlyacertainnumberofspellsofeachspelllevelperday.Herbasedailyspell
allotmentisgivenonTable:TheWizard.Inaddition,shereceivesbonusspellsperdayifshehasahighIntelligencescore.
Unlikeabardorsorcerer,awizardmayknowanynumberofspells.Shemustchooseandprepareherspellsaheadoftime
bygettingagoodnightssleepandspending1hourstudyingherspellbook.Whilestudying,thewizarddecideswhichspells
toprepare.

BonusLanguages
AwizardmaysubstituteDraconicforoneofthebonuslanguagesavailabletothecharacterbecauseofherrace.

Familiar
Awizardcanobtainafamiliarinexactlythesamemannerasasorcerercan.Seethesorcererdescriptionandthe
informationonFamiliarsbelowfordetails.

ScribeScroll
At1stlevel,awizardgainsScribeScrollasabonusfeat.

BonusFeats
At5th,10th,15th,and20thlevel,awizardgainsabonusfeat.Ateachsuchopportunity,shecanchooseametamagicfeat,
anitemcreationfeat,orSpellMastery.Thewizardmuststillmeetallprerequisitesforabonusfeat,includingcasterlevel
minimums.
Thesebonusfeatsareinadditiontothefeatthatacharacterofanyclassgetsfromadvancinglevels.Thewizardisnot
limitedtothecategoriesofitemcreationfeats,metamagicfeats,orSpellMasterywhenchoosingthesefeats.

Spellbooks
Awizardmuststudyherspellbookeachdaytoprepareherspells.Shecannotprepareanyspellnotrecordedinher
spellbook,exceptforreadmagic,whichallwizardscanpreparefrommemory.
Awizardbeginsplaywithaspellbookcontainingall0levelwizardspells(exceptthosefromherprohibitedschoolor
schools,ifany;seeSchoolSpecialization,below)plusthree1stlevelspellsofyourchoice.ForeachpointofIntelligence
bonusthewizardhas,thespellbookholdsoneadditional1stlevelspellofyourchoice.Ateachnewwizardlevel,shegains
twonewspellsofanyspelllevelorlevelsthatshecancast(basedonhernewwizardlevel)forherspellbook.Atanytime,a
wizardcanalsoaddspellsfoundinotherwizardsspellbookstoherown.

SchoolSpecialization
Aschoolisoneofeightgroupingsofspells,eachdefinedbyacommontheme.Ifdesired,awizardmayspecializeinone
schoolofmagic(seebelow).Specializationallowsawizardtocastextraspellsfromherchosenschool,butshethennever
learnstocastspellsfromsomeotherschools.
Aspecialistwizardcanprepareoneadditionalspellofherspecialtyschoolperspellleveleachday.Shealsogainsa+2
bonusonSpellcraftcheckstolearnthespellsofherchosenschool.
Thewizardmustchoosewhethertospecializeand,ifshedoesso,chooseherspecialtyat1stlevel.Atthistime,shemust
alsogiveuptwootherschoolsofmagic(unlessshechoosestospecializeindivination;seebelow),whichbecomeher
prohibitedschools.
Awizardcannevergiveupdivinationtofulfillthisrequirement.
Spellsoftheprohibitedschoolorschoolsarenotavailabletothewizard,andshecantevencastsuchspellsfromscrollsor
firethemfromwands.Shemaynotchangeeitherherspecializationorherprohibitedschoolslater.
Theeightschoolsofarcanemagicareabjuration,conjuration,divination,enchantment,evocation,illusion,necromancy,
andtransmutation.
Spellsthatdonotfallintoanyoftheseschoolsarecalleduniversalspells.

Abjuration
Spellsthatprotect,block,orbanish.Anabjurationspecialistiscalledanabjurer.

Conjuration
Spellsthatbringcreaturesormaterialstothecaster.Aconjurationspecialistiscalledaconjurer.

Page46of462
Divination
Spellsthatrevealinformation.Adivinationspecialistiscalledadiviner.Unliketheotherspecialists,adivinermustgiveup
onlyoneotherschool.

Enchantment
Spellsthatimbuetherecipientwithsomepropertyorgrantthecasterpoweroveranotherbeing.Anenchantmentspecialist
iscalledanenchanter.

Evocation
Spellsthatmanipulateenergyorcreatesomethingfromnothing.Anevocationspecialistiscalledanevoker.

Illusion
Spellsthatalterperceptionorcreatefalseimages.Anillusionspecialistiscalledanillusionist.

Necromancy
Spellsthatmanipulate,create,ordestroylifeorlifeforce.Anecromancyspecialistiscalledanecromancer.

Transmutation
Spellsthattransformtherecipientphysicallyorchangeitspropertiesinamoresubtleway.Atransmutationspecialistis
calledatransmuter.

Universal
Notaschool,butacategoryforspellsthatallwizardscanlearn.Awizardcannotselectuniversalasaspecialtyschooloras
aprohibitedschool.Onlyalimitednumberofspellsfallintothiscategory.

Familiars
Afamiliarisanormalanimalthatgainsnewpowersandbecomesamagicalbeastwhensummonedtoservicebyasorcerer
orwizard.Itretainstheappearance,HitDice,baseattackbonus,basesavebonuses,skills,andfeatsofthenormalanimalit
oncewas,butitistreatedasamagicalbeastinsteadofananimalforthepurposeofanyeffectthatdependsonitstype.
Onlyanormal,unmodifiedanimalmaybecomeafamiliar.Ananimalcompanioncannotalsofunctionasafamiliar.
Afamiliaralsograntsspecialabilitiestoitsmaster(asorcererorwizard),asgivenonthetablebelow.Thesespecialabilities
applyonlywhenthemasterandfamiliararewithin1mileofeachother.
Levelsofdifferentclassesthatareentitledtofamiliarsstackforthepurposeofdetermininganyfamiliarabilitiesthat
dependonthemasterslevel.
Table:TheWizard'sFamiliarList
FAMILIAR SPECIAL
Bat Mastergainsa+3bonusonListenchecks
Cat Mastergainsa+3bonusonMoveSilentlychecks
Hawk Mastergainsa+3bonusonSpotchecksinbrightlight
Lizard Mastergainsa+3bonusonClimbchecks
Owl Mastergainsa+3bonusonSpotchecksinshadows
Rat Mastergainsa+2bonusonFortitudesaves
Raven1 Mastergainsa+3bonusonAppraisechecks
Snake2 Mastergainsa+3bonusonBluffchecks
Toad Mastergains+3hitpoints
Weasel Mastergainsa+2bonusonReflexsaves
1
Aravenfamiliarcanspeakonelanguageofitsmasterschoiceasasupernaturalability.
2
Tinyviper.
Table:TheWizard'sFamiliar
MASTERCLASSLEVEL NATURALARMORADJ. INT SPECIAL
1st2nd +1 6 Alertness,improvedevasion,sharespells,empathiclink
3rd4th +2 7 Delivertouchspells
5th6th +3 8 Speakwithmaster
7th8th +4 9 Speakwithanimalsofitskind
9th10th +5 10
11th12th +6 11 Spellresistance
13th14th +7 12 Scryonfamiliar
15th16th +8 13
17th18th +9 14

Page47of462
MASTERCLASSLEVEL NATURALARMORADJ. INT SPECIAL
19th20th +10 15

HitDice
ForthepurposeofeffectsrelatedtonumberofHitDice,usethemasterscharacterlevelorthefamiliarsnormalHDtotal,
whicheverishigher.

HitPoints
Thefamiliarhasonehalfthemasterstotalhitpoints(notincludingtemporaryhitpoints),roundeddown,regardlessofits
actualHitDice.

Attacks
Usethemastersbaseattackbonus,ascalculatedfromallhisclasses.UsethefamiliarsDexterityorStrengthmodifier,
whicheverisgreater,togetthefamiliarsmeleeattackbonuswithnaturalweapons.
Damageequalsthatofanormalcreatureofthefamiliarskind.

SavingThrows
Foreachsavingthrow,useeitherthefamiliarsbasesavebonus(Fortitude+2,Reflex+2,Will+0)orthemasters(as
calculatedfromallhisclasses),whicheverisbetter.Thefamiliarusesitsownabilitymodifierstosaves,anditdoesntshare
anyoftheotherbonusesthatthemastermighthaveonsaves.

Skills
Foreachskillinwhicheitherthemasterorthefamiliarhasranks,useeitherthenormalskillranksforananimalofthat
typeorthemastersskillranks,whicheverarebetter.Ineithercase,thefamiliarusesitsownabilitymodifiers.Regardlessof
afamiliarstotalskillmodifiers,someskillsmayremainbeyondthefamiliarsabilitytouse.

FamiliarAbilityDescriptions
Allfamiliarshavespecialabilities(orimpartabilitiestotheirmasters)dependingonthemasterscombinedlevelinclasses
thatgrantfamiliars,asshownonthetablebelow.Theabilitiesgivenonthetablearecumulative.

NaturalArmorAdj.
Thenumbernotedhereisanimprovementtothefamiliarsexistingnaturalarmorbonus.

Int
ThefamiliarsIntelligencescore.

Alertness(Ex)
Whileafamiliariswithinarmsreach,themastergainstheAlertnessfeat.

ImprovedEvasion(Ex)
WhensubjectedtoanattackthatnormallyallowsaReflexsavingthrowforhalfdamage,afamiliartakesnodamageifit
makesasuccessfulsavingthrowandhalfdamageevenifthesavingthrowfails.

ShareSpells
Atthemastersoption,hemayhaveanyspell(butnotanyspelllikeability)hecastsonhimselfalsoaffecthisfamiliar.The
familiarmustbewithin5feetatthetimeofcastingtoreceivethebenefit.
Ifthespelloreffecthasadurationotherthaninstantaneous,itstopsaffectingthefamiliarifitmovesfartherthan5feet
awayandwillnotaffectthefamiliaragainevenifitreturnstothemasterbeforethedurationexpires.Additionally,the
mastermaycastaspellwithatargetofYouonhisfamiliar(asatouchrangespell)insteadofonhimself.
Amasterandhisfamiliarcansharespellsevenifthespellsnormallydonotaffectcreaturesofthefamiliarstype(magical
beast).

EmpathicLink(Su)
Themasterhasanempathiclinkwithhisfamiliarouttoadistanceofupto1mile.Themastercannotseethroughthe
familiarseyes,buttheycancommunicateempathically.Becauseofthelimitednatureofthelink,onlygeneralemotional
contentcanbecommunicated.
Becauseofthisempathiclink,themasterhasthesameconnectiontoanitemorplacethathisfamiliardoes.

Page48of462
DeliverTouchSpells(Su)
Ifthemasteris3rdlevelorhigher,afamiliarcandelivertouchspellsforhim.Ifthemasterandthefamiliarareincontact
atthetimethemastercastsatouchspell,hecandesignatehisfamiliarasthetoucher.Thefamiliarcanthendeliverthe
touchspelljustasthemastercould.Asusual,ifthemastercastsanotherspellbeforethetouchisdelivered,thetouchspell
dissipates.

SpeakwithMaster(Ex)
Ifthemasteris5thlevelorhigher,afamiliarandthemastercancommunicateverballyasiftheywereusingacommon
language.Othercreaturesdonotunderstandthecommunicationwithoutmagicalhelp.

SpeakwithAnimalsofItsKind(Ex)
Ifthemasteris7thlevelorhigher,afamiliarcancommunicatewithanimalsofapproximatelythesamekindasitself
(includingdirevarieties):batswithbats,ratswithrodents,catswithfelines,hawksandowlsandravenswithbirds,lizards
andsnakeswithreptiles,toadswithamphibians,weaselswithsimilarcreatures(weasels,minks,polecats,ermines,skunks,
wolverines,andbadgers).Suchcommunicationislimitedbytheintelligenceoftheconversingcreatures.

SpellResistance(Ex)
Ifthemasteris11thlevelorhigher,afamiliargainsspellresistanceequaltothemasterslevel+5.Toaffectthefamiliar
withaspell,anotherspellcastermustgetaresultonacasterlevelcheck(1d20+casterlevel)thatequalsorexceedsthe
familiarsspellresistance.

ScryonFamiliar(Sp)
Ifthemasteris13thlevelorhigher,hemayscryonhisfamiliar(asifcastingthescryingspell)onceperday.

ArcaneSpellsAndArmor
Wizardsandsorcerersdonotknowhowtoweararmoreffectively.
Ifdesired,theycanweararmoranyway(thoughtheyllbeclumsyinit),ortheycangaintrainingintheproperuseof
armor(withthevariousArmorProficiencyfeatslight,medium,andheavyandtheShieldProficiencyfeat),ortheycan
multiclasstoaddaclassthatgrantsthemarmorproficiency.Evenifawizardorsorcereriswearingarmorwithwhichheor
sheisproficient,however,itmightstillinterferewithspellcasting.
Armorrestrictsthecomplicatedgesturesthatawizardsorsorcerermustmakewhilecastinganyspellthathasasomatic
component(mostdo).Thearmorandshielddescriptionslistthearcanespellfailurechancefordifferentarmorsand
shields.
Bycontrast,bardsnotonlyknowhowtowearlightarmoreffectively,buttheycanalsoignorethearcanespellfailure
chanceforsucharmor.Abardwearingarmorheavierthanlightorusinganytypeofshieldincursthenormalarcanespell
failurechance,evenifhebecomesproficientwiththatarmor.
Ifaspelldoesnthaveasomaticcomponent,anarcanespellcastercancastitwithnoproblemwhilewearingarmor.Such
spellscanalsobecastevenifthecastershandsareboundorifheorsheisgrappling(althoughConcentrationchecksstill
applynormally).Also,themetamagicfeatStillSpellallowsaspellcastertoprepareorcastaspellatonespelllevelhigher
thannormalwithoutthesomaticcomponent.Thisalsoprovidesawaytocastaspellwhilewearingarmorwithoutrisking
arcanespellfailure.

Description
Alignment
Acreaturesgeneralmoralandpersonalattitudesarerepresentedbyitsalignment:lawfulgood,neutralgood,chaoticgood,
lawfulneutral,neutral,chaoticneutral,lawfulevil,neutralevil,orchaoticevil.
Alignmentisatoolfordevelopingyourcharactersidentity.Itisnotastraitjacketforrestrictingyourcharacter.Each
alignmentrepresentsabroadrangeofpersonalitytypesorpersonalphilosophies,sotwocharactersofthesamealignment
canstillbequitedifferentfromeachother.Inaddition,fewpeoplearecompletelyconsistent.

GoodVs.Evil
Goodcharactersandcreaturesprotectinnocentlife.Evilcharactersandcreaturesdebaseordestroyinnocentlife,whether
forfunorprofit.
Goodimpliesaltruism,respectforlife,andaconcernforthedignityofsentientbeings.Goodcharactersmakepersonal
Page49of462
sacrificestohelpothers.
Evilimplieshurting,oppressing,andkillingothers.Someevilcreaturessimplyhavenocompassionforothersandkill
withoutqualmsifdoingsoisconvenient.Othersactivelypursueevil,killingforsportoroutofdutytosomeevildeityor
master.
Peoplewhoareneutralwithrespecttogoodandevilhavecompunctionsagainstkillingtheinnocentbutlackthe
commitmenttomakesacrificestoprotectorhelpothers.Neutralpeoplearecommittedtoothersbypersonalrelationships.
Beinggoodorevilcanbeaconsciouschoice.Formostpeople,though,beinggoodorevilisanattitudethatonerecognizes
butdoesnotchoose.Beingneutralonthegoodevilaxisusuallyrepresentsalackofcommitmentonewayortheother,but
forsomeitrepresentsapositivecommitmenttoabalancedview.Whileacknowledgingthatgoodandevilareobjective
states,notjustopinions,thesefolkmaintainthatabalancebetweenthetwoistheproperplaceforpeople,oratleastfor
them.
Animalsandothercreaturesincapableofmoralactionareneutralratherthangoodorevil.Evendeadlyvipersandtigers
thateatpeopleareneutralbecausetheylackthecapacityformorallyrightorwrongbehavior.

LawVs.Chaos
Lawfulcharacterstellthetruth,keeptheirword,respectauthority,honortradition,andjudgethosewhofallshortoftheir
duties.
Chaoticcharactersfollowtheirconsciences,resentbeingtoldwhattodo,favornewideasovertradition,anddowhatthey
promiseiftheyfeellikeit.
Lawimplieshonor,trustworthiness,obediencetoauthority,andreliability.Onthedownside,lawfulnesscanincludeclose
mindedness,reactionaryadherencetotradition,judgmentalness,andalackofadaptability.Thosewhoconsciouslypromote
lawfulnesssaythatonlylawfulbehaviorcreatesasocietyinwhichpeoplecandependoneachotherandmaketheright
decisionsinfullconfidencethatotherswillactastheyshould.
Chaosimpliesfreedom,adaptability,andflexibility.Onthedownside,chaoscanincluderecklessness,resentmenttoward
legitimateauthority,arbitraryactions,andirresponsibility.Thosewhopromotechaoticbehaviorsaythatonlyunfettered
personalfreedomallowspeopletoexpressthemselvesfullyandletssocietybenefitfromthepotentialthatitsindividuals
havewithinthem.
Someonewhoisneutralwithrespecttolawandchaoshasanormalrespectforauthorityandfeelsneitheracompulsionto
obeynoracompulsiontorebel.Sheishonestbutcanbetemptedintolyingordeceivingothers.
Devotiontolaworchaosmaybeaconsciouschoice,butmoreoftenitisapersonalitytraitthatisrecognizedratherthan
beingchosen.Neutralityonthelawfulchaoticaxisisusuallysimplyamiddlestate,astateofnotfeelingcompelledtoward
onesideortheother.Somefewsuchneutrals,however,espouseneutralityassuperiortolaworchaos,regardingeachas
anextremewithitsownblindspotsanddrawbacks.
Animalsandothercreaturesincapableofmoralactionareneutral.Dogsmaybeobedientandcatsfreespirited,buttheydo
nothavethemoralcapacitytobetrulylawfulorchaotic.

TheNineAlignments
Ninedistinctalignmentsdefineallthepossiblecombinationsofthelawfulchaoticaxiswiththegoodevilaxis.Each
alignmentdescriptionbelowdepictsatypicalcharacterofthatalignment.Rememberthatindividualsvaryfromthisnorm,
andthatagivencharactermayactmoreorlessinaccordwithhisorheralignmentfromdaytoday.Usethesedescriptions
asguidelines,notasscripts.
Thefirstsixalignments,lawfulgoodthroughchaoticneutral,arethestandardalignmentsforplayercharacters.Thethree
evilalignmentsareformonstersandvillains.

LawfulGood,Crusader
Alawfulgoodcharacteractsasagoodpersonisexpectedorrequiredtoact.Shecombinesacommitmenttoopposeevil
withthedisciplinetofightrelentlessly.Shetellsthetruth,keepsherword,helpsthoseinneed,andspeaksoutagainst
injustice.Alawfulgoodcharacterhatestoseetheguiltygounpunished.
Lawfulgoodisthebestalignmentyoucanbebecauseitcombineshonorandcompassion.

NeutralGood,Benefactor
Aneutralgoodcharacterdoesthebestthatagoodpersoncando.Heisdevotedtohelpingothers.Heworkswithkingsand
magistratesbutdoesnotfeelbeholdentothem..

Page50of462
Neutralgoodisthebestalignmentyoucanbebecauseitmeansdoingwhatisgoodwithoutbiasfororagainstorder.

ChaoticGood,Rebel
Achaoticgoodcharacteractsashisconsciencedirectshimwithlittleregardforwhatothersexpectofhim.Hemakeshis
ownway,butheskindandbenevolent.Hebelievesingoodnessandrightbuthaslittleuseforlawsandregulations.He
hatesitwhenpeopletrytointimidateothersandtellthemwhattodo.Hefollowshisownmoralcompass,which,although
good,maynotagreewiththatofsociety.
Chaoticgoodisthebestalignmentyoucanbebecauseitcombinesagoodheartwithafreespirit.

LawfulNeutral,Judge
Alawfulneutralcharacteractsaslaw,tradition,orapersonalcodedirectsher.Orderandorganizationareparamountto
her.Shemaybelieveinpersonalorderandlivebyacodeorstandard,orshemaybelieveinorderforallandfavorastrong,
organizedgovernment.
Lawfulneutralisthebestalignmentyoucanbebecauseitmeansyouarereliableandhonorablewithoutbeingazealot.

Neutral,Undecided
Aneutralcharacterdoeswhatseemstobeagoodidea.Shedoesntfeelstronglyonewayortheotherwhenitcomesto
goodvs.evilorlawvs.chaos.Mostneutralcharactersexhibitalackofconvictionorbiasratherthanacommitmentto
neutrality.Suchacharacterthinksofgoodasbetterthanevilafterall,shewouldratherhavegoodneighborsandrulers
thanevilones.Still,shesnotpersonallycommittedtoupholdinggoodinanyabstractoruniversalway.
Someneutralcharacters,ontheotherhand,committhemselvesphilosophicallytoneutrality.Theyseegood,evil,law,and
chaosasprejudicesanddangerousextremes.Theyadvocatethemiddlewayofneutralityasthebest,mostbalancedroadin
thelongrun.
Neutralisthebestalignmentyoucanbebecauseitmeansyouactnaturally,withoutprejudiceorcompulsion.

ChaoticNeutral,FreeSpirit
Achaoticneutralcharacterfollowshiswhims.Heisanindividualistfirstandlast.Hevalueshisownlibertybutdoesnt
strivetoprotectothersfreedom.Heavoidsauthority,resentsrestrictions,andchallengestraditions.Achaoticneutral
characterdoesnotintentionallydisruptorganizationsaspartofacampaignofanarchy.Todoso,hewouldhavetobe
motivatedeitherbygood(andadesiretoliberateothers)orevil(andadesiretomakethosedifferentfromhimselfsuffer).
Achaoticneutralcharactermaybeunpredictable,buthisbehaviorisnottotallyrandom.Heisnotaslikelytojumpoffa
bridgeastocrossit.
Chaoticneutralisthebestalignmentyoucanbebecauseitrepresentstruefreedomfrombothsocietysrestrictionsanda
dogooderszeal.

LawfulEvil,Dominator
Alawfulevilvillainmethodicallytakeswhathewantswithinthelimitsofhiscodeofconductwithoutregardforwhomit
hurts.Hecaresabouttradition,loyalty,andorderbutnotaboutfreedom,dignity,orlife.Heplaysbytherulesbutwithout
mercyorcompassion.Heiscomfortableinahierarchyandwouldliketorule,butiswillingtoserve.Hecondemnsothers
notaccordingtotheiractionsbutaccordingtorace,religion,homeland,orsocialrank.Heisloathtobreaklawsor
promises.
Thisreluctancecomespartlyfromhisnatureandpartlybecausehedependsonordertoprotecthimselffromthosewho
opposehimonmoralgrounds.Somelawfulevilvillainshaveparticulartaboos,suchasnotkillingincoldblood(buthaving
underlingsdoit)ornotlettingchildrencometoharm(ifitcanbehelped).Theyimaginethatthesecompunctionsputthem
aboveunprincipledvillains.
Somelawfulevilpeopleandcreaturescommitthemselvestoevilwithazeallikethatofacrusadercommittedtogood.
Beyondbeingwillingtohurtothersfortheirownends,theytakepleasureinspreadingevilasanenduntoitself.Theymay
alsoseedoingevilaspartofadutytoanevildeityormaster.
Lawfulevilissometimescalleddiabolical,becausedevilsaretheepitomeoflawfulevil.
Lawfulevilisthemostdangerousalignmentbecauseitrepresentsmethodical,intentional,andfrequentlysuccessfulevil.

NeutralEvil,Malefactor
Aneutralevilvillaindoeswhatevershecangetawaywith.Sheisoutforherself,pureandsimple.Sheshedsnotearsfor
thoseshekills,whetherforprofit,sport,orconvenience.Shehasnoloveoforderandholdsnoillusionthatfollowinglaws,
traditions,orcodeswouldmakeheranybetterormorenoble.Ontheotherhand,shedoesnthavetherestlessnatureor

Page51of462
loveofconflictthatachaoticevilvillainhas.
Someneutralevilvillainsholdupevilasanideal,committingevilforitsownsake.Mostoften,suchvillainsaredevotedto
evildeitiesorsecretsocieties.
Neutralevilisthemostdangerousalignmentbecauseitrepresentspureevilwithouthonorandwithoutvariation.

ChaoticEvil,Destroyer
Achaoticevilcharacterdoeswhateverhisgreed,hatred,andlustfordestructiondrivehimtodo.Heishottempered,
vicious,arbitrarilyviolent,andunpredictable.Ifheissimplyoutforwhateverhecanget,heisruthlessandbrutal.Ifheis
committedtothespreadofevilandchaos,heisevenworse.Thankfully,hisplansarehaphazard,andanygroupshejoins
orformsarepoorlyorganized.Typically,chaoticevilpeoplecanbemadetoworktogetheronlybyforce,andtheirleader
lastsonlyaslongashecanthwartattemptstotoppleorassassinatehim.
Chaoticevilissometimescalleddemonicbecausedemonsaretheepitomeofchaoticevil.
Chaoticevilisthemostdangerousalignmentbecauseitrepresentsthedestructionnotonlyofbeautyandlifebutalsoof
theorderonwhichbeautyandlifedepend.

VitalStatistics
Age
Youcanchooseorrandomlygenerateyourcharactersage.Ifyouchooseit,itmustbeatleasttheminimumageforthe
charactersraceandclass(seeTable:RandomStartingAges).Yourcharactersminimumstartingageistheadulthoodageof
hisorherraceplusthenumberofdiceindicatedintheentrycorrespondingtothecharactersraceandclassonTable:
RandomStartingAges.
Alternatively,refertoTable:RandomStartingAgesandrolldicetodeterminehowoldyourcharacteris.
Table:RandomStartingAges
RACE ADULTHOOD BARBARIAN,ROGUE,SORCERER BARD,FIGHTER,PALADIN,RANGER CLERIC,DRUID,MONK,WIZARD
Human 15years +1d4 +1d6 +2d6
Dwarf 40years +3d6 +5d6 +7d6
Elf 110years +4d6 +6d6 +10d6
Gnome 40years +4d6 +6d6 +9d6
Halfelf 20years +1d6 +2d6 +3d6
Halforc 14years +1d4 +1d6 +2d6
Halfling 20years +2d4 +3d6 +4d6
Withage,acharactersphysicalabilityscoresdecreaseandhisorhermentalabilityscoresincrease(seeTable:Aging
Effects).Theeffectsofeachagingsteparecumulative.However,noneofacharactersabilityscorescanbereducedbelow1
inthisway.
Whenacharacterreachesvenerableage,secretlyrollhisorhermaximumage,whichisthenumberfromtheVenerable
columnonTable:AgingEffectsplustheresultofthedicerollindicatedontheMaximumAgecolumnonthattable,and
recordstheresult,whichtheplayerdoesnotknow.Acharacterwhoreacheshisorhermaximumagediesofoldageat
sometimeduringthefollowingyear.
Themaximumagesareforplayercharacters.Mostpeopleintheworldatlargediefrompestilence,accidents,infections,or
violencebeforegettingtovenerableage.
Table:AgingEffects
RACE MIDDLEAGE1 OLD2 VENERABLE3 MAXIMUMAGE
Human 35years 53years 70years +2d20years
Dwarf 125years 188years 250years +2d%years
Elf 175years 263years 350years +4d%years
Gnome 100years 150years 200years +3d%years
Halfelf 62years 93years 125years +3d20years
Halforc 30years 45years 60years +2d10years
Halfling 50years 75years 100years +5d20years
1
Atmiddleage,1toStr,Dex,andCon;+1toInt,Wis,andCha.
2
Atoldage,2toStr,Dex,andCon;+1toInt,Wis,andCha.
3
Atvenerableage,3toStr,Dex,andCon;+1toInt,Wis,andCha.

Page52of462
HeightAndWeight
ThedicerollgivenintheHeightModifiercolumndeterminesthecharactersextraheightbeyondthebaseheight.That
samenumbermultipliedbythedicerollorquantitygivenintheWeightModifiercolumndeterminesthecharactersextra
weightbeyondthebaseweight.
Table:RandomHeightandWeight
RACE BASEHEIGHT HEIGHTMODIFIER BASEWEIGHT WEIGHTMODIFIER
Human,male 410 +2d10 120lb. (2d4)lb.
Human,female 45 +2d10 85lb. (2d4)lb.
Dwarf,male 39 +2d4 130lb. (2d6)lb.
Dwarf,female 37 +2d4 100lb. (2d6)lb.
Elf,male 45 +2d6 85lb. (1d6)lb.
Elf,female 45 +2d6 80lb. (1d6)lb.
Gnome,male 30 +2d4 40lb. 1lb.
Gnome,female 210 +2d4 35lb. 1lb.
Halfelf,male 47 +2d8 100lb. (2d4)lb.
Halfelf,female 45 +2d8 80lb. (2d4)lb.
Halforc,male 410 +2d12 150lb. (2d6)lb.
Halforc,female 45 +2d12 110lb. (2d6)lb.
Halfling,male 28 +2d4 30lb. 1lb.
Halfling,female 26 +2d4 25lb. 1lb.

Skills
SkillsSummary
GettingSkills
Eachskillpointyouspendonaclassskillgetsyou1rankinthatskill.Classskillsaretheskillsfoundonyourcharacters
classskilllist.Eachskillpointyouspendonacrossclassskillgetsyourcharacter1/2rankinthatskill.Crossclassskillsare
skillsnotfoundonyourcharactersclassskilllist.(Halfranksdonotimproveyourskillcheck,buttwo1/2ranksmake1
rank.)Youcantsaveskillpointstospendlater.
Themaximumrankinaclassskillisthecharacterslevel+3.Ifitsacrossclassskill,themaximumrankishalfofthat
number(donotroundupordown).
Regardlessofwhetheraskillispurchasedasaclassskilloracrossclassskill,ifitisaclassskillforanyofyourclasses,your
maximumrankequalsyourtotalcharacterlevel+3.

UsingSkills
Tomakeaskillcheck,roll:1d20+skillmodifier(Skillmodifier=skillrank+abilitymodifier+miscellaneousmodifiers)
Whenyourcharacterusesaskill,youmakeaskillchecktoseehowwellheorshedoes.Thehighertheresultoftheskill
check,thebetter.Basedonthecircumstances,yourresultmustmatchorbeataparticularnumber(aDCortheresultofan
opposedskillcheck)forthechecktobesuccessful.Theharderthetask,thehigherthenumberyouneedtoroll.
Circumstancescanaffectyourcheck.Acharacterwhoisfreetoworkwithoutdistractionscanmakeacarefulattemptand
avoidsimplemistakes.Acharacterwhohaslotsoftimecantryoverandoveragain,therebyassuringthebestoutcome.If
othershelp,thecharactermaysucceedwhereotherwiseheorshewouldfail.

DifficultyClass
SomechecksaremadeagainstaDifficultyClass(DC).TheDCisanumber(setusingtheskillrulesasaguideline)thatyou
mustscoreasaresultonyourskillcheckinordertosucceed.
Table:DifficultyClassExamples
DIFFICULTY(DC) SKILLUSEDINEXAMPLE EXAMPLE
Veryeasy(0) Spot Noticesomethinglargeinplainsight
Easy(5) Climb Climbaknottedrope
Average(10) Listen Hearanapproachingguard
Tough(15) DisableDevice Rigawagonwheeltofalloff
Challenging(20) Swim Swiminstormywater
Formidable(25) OpenLock Openanaveragelock
Heroic(30) Jump Leapacrossa30footchasm
Nearlyimpossible(40) Survival Trackasquadoforcsacrosshardgroundafter24hoursofrainfall

Page53of462
OpposedChecks
Anopposedcheckisacheckwhosesuccessorfailureisdeterminedbycomparingthecheckresulttoanothercharacters
checkresult.Inanopposedcheck,thehigherresultsucceeds,whilethelowerresultfails.Incaseofatie,thehigherskill
modifierwins.Ifthesescoresarethesame,rollagaintobreakthetie.
Table:ExampleOpposedChecks
TASK SKILL(KEYABILITY) OPPOSINGSKILL(KEYABILITY)
Consomeone Bluff(Cha) SenseMotive(Wis)
Pretendtobesomeoneelse Disguise(Cha) Spot(Wis)
Createafalsemap Forgery(Int) Forgery(Int)
Hidefromsomeone Hide(Dex) Spot(Wis)
Makeabullybackdown Intimidate(Cha) Special1
Sneakuponsomeone MoveSilently(Dex) Listen(Wis)
Stealacoinpouch SleightofHand(Dex) Spot(Wis)
Tieaprisonersecurely UseRope(Dex) EscapeArtist(Dex)
1
AnIntimidatecheckisopposedbythetargetslevelcheck,notaskillcheck.SeetheIntimidateskilldescriptionformoreinformation.

TryingAgain
Ingeneral,youcantryaskillcheckagainifyoufail,andyoucankeeptryingindefinitely.Someskills,however,have
consequencesoffailurethatmustbetakenintoaccount.Afewskillsarevirtuallyuselessonceacheckhasfailedonan
attempttoaccomplishaparticulartask.Formostskills,whenacharacterhassucceededonceatagiventask,additional
successesaremeaningless.

UntrainedSkillChecks
Generally,ifyourcharacterattemptstouseaskillheorshedoesnotpossess,youmakeaskillcheckasnormal.Theskill
modifierdoesnthaveaskillrankaddedinbecausethecharacterhasnoranksintheskill.Anyotherapplicablemodifiers,
suchasthemodifierfortheskillskeyability,areappliedtothecheck.
Manyskillscanbeusedonlybysomeonewhoistrainedinthem.

FavorableandUnfavorableConditions
Somesituationsmaymakeaskilleasierorhardertouse,resultinginabonusorpenaltytotheskillmodifierforaskill
checkorachangetotheDCoftheskillcheck.
Thechanceofsuccesscanbealteredinfourwaystotakeintoaccountexceptionalcircumstances.
1. Givetheskillusera+2circumstancebonustorepresentconditionsthatimproveperformance,suchashavingthe
perfecttoolforthejob,gettinghelpfromanothercharacter(seeCombiningSkillAttempts),orpossessingunusually
accurateinformation.
2. Givetheskillusera2circumstancepenaltytorepresentconditionsthathamperperformance,suchasbeingforcedto
useimprovisedtoolsorhavingmisleadinginformation.
3. ReducetheDCby2torepresentcircumstancesthatmakethetaskeasier,suchashavingafriendlyaudienceordoing
workthatcanbesubpar.
4. IncreasetheDCby2torepresentcircumstancesthatmakethetaskharder,suchashavinganuncooperativeaudienceor
doingworkthatmustbeflawless.
Conditionsthataffectyourcharactersabilitytoperformtheskillchangetheskillmodifier.Conditionsthatmodifyhowwell
thecharacterhastoperformtheskilltosucceedchangetheDC.Abonustotheskillmodifierandareductioninthechecks
DChavethesameresult:Theycreateabetterchanceofsuccess.Buttheyrepresentdifferentcircumstances,andsometimes
thatdifferenceisimportant.

TimeandSkillChecks
Usingaskillmighttakearound,takenotime,ortakeseveralroundsorevenlonger.Mostskillusesarestandardactions,
moveactions,orfullroundactions.Typesofactionsdefinehowlongactivitiestaketoperformwithintheframeworkofa
combatround(6seconds)andhowmovementistreatedwithrespecttotheactivity.Someskillchecksareinstantand
representreactionstoanevent,orareincludedaspartofanaction.
Theseskillchecksarenotactions.Otherskillchecksrepresentpartofmovement.

CheckswithoutRolls
Askillcheckrepresentsanattempttoaccomplishsomegoal,usuallywhileundersomesortoftimepressureordistraction.

Page54of462
Sometimes,though,acharactercanuseaskillundermorefavorableconditionsandeliminatetheluckfactor.

Taking10
Whenyourcharacterisnotbeingthreatenedordistracted,youmaychoosetotake10.Insteadofrolling1d20fortheskill
check,calculateyourresultasifyouhadrolleda10.Formanyroutinetasks,taking10makesthemautomatically
successful.Distractionsorthreats(suchascombat)makeitimpossibleforacharactertotake10.Inmostcases,taking10is
purelyasafetymeasureyouknow(orexpect)thatanaveragerollwillsucceedbutfearthatapoorrollmightfail,soyou
electtosettlefortheaverageroll(a10).Taking10isespeciallyusefulinsituationswhereaparticularlyhighrollwouldnt
help.

Taking20
Whenyouhaveplentyoftime(generally2minutesforaskillthatcannormallybecheckedin1round,onefullround
action,oronestandardaction),youarefacedwithnothreatsordistractions,andtheskillbeingattemptedcarriesno
penaltiesforfailure,youcantake20.Inotherwords,eventuallyyouwillgeta20on1d20ifyourollenoughtimes.Instead
ofrolling1d20fortheskillcheck,justcalculateyourresultasifyouhadrolleda20.
Taking20meansyouaretryinguntilyougetitright,anditassumesthatyoufailmanytimesbeforesucceeding.Taking20
takestwentytimesaslongasmakingasinglecheckwouldtake.
Sincetaking20assumesthatthecharacterwillfailmanytimesbeforesucceeding,ifyoudidattempttotake20onaskill
thatcarriespenaltiesforfailure,yourcharacterwouldautomaticallyincurthosepenaltiesbeforeheorshecouldcomplete
thetask.Commontake20skillsincludeEscapeArtist,OpenLock,andSearch.

CombiningSkillAttempts
Whenmorethanonecharactertriesthesameskillatthesametimeandforthesamepurpose,theireffortsmayoverlap.

IndividualEvents
Often,severalcharactersattemptsomeactionandeachsucceedsorfailsindependently.TheresultofonecharactersClimb
checkdoesnotinfluencetheresultsofothercharactersClimbcheck.

AidAnother
Youcanhelpanothercharacterachievesuccessonhisorherskillcheckbymakingthesamekindofskillcheckina
cooperativeeffort.Ifyourolla10orhigheronyourcheck,thecharacteryouarehelpinggetsa+2bonustohisorher
check,aspertheruleforfavorableconditions.(Youcanttake10onaskillchecktoaidanother.)Inmanycases,a
charactershelpwontbebeneficial,oronlyalimitednumberofcharacterscanhelpatonce.
Incaseswheretheskillrestrictswhocanachievecertainresultsyoucantaidanothertograntabonustoataskthatyour
charactercouldntachievealone.

SkillSynergy
Itspossibleforacharactertohavetwoskillsthatworkwelltogether.Ingeneral,having5ormoreranksinoneskillgives
thecharactera+2bonusonskillcheckswitheachofitssynergisticskills,asnotedintheskilldescription.Insomecases,
thisbonusappliesonlytospecificusesoftheskillinquestion,andnottoallchecks.Someskillsprovidebenefitsonother
checksmadebyacharacter,suchasthosechecksrequiredtousecertainclassfeatures.

AbilityChecks
Sometimesacharactertriestodosomethingtowhichnospecificskillreallyapplies.Inthesecases,youmakeanability
check.Anabilitycheckisarollof1d20plustheappropriateabilitymodifier.Essentially,youremakinganuntrainedskill
check.
Insomecases,anactionisastraighttestofonesabilitywithnoluckinvolved.Justasyouwouldntmakeaheightcheckto
seewhoistaller,youdontmakeaStrengthchecktoseewhoisstronger.
Thenormaltake10andtake20rulesapplyforabilitychecks.

SkillDescriptions
Thissectiondescribeseachskill,includingcommonusesandtypicalmodifiers.Characterscansometimesuseskillsfor
purposesotherthanthosenotedhere.
Hereistheformatforskilldescriptions.

Page55of462
SkillName
Theskillnamelineincludes(inadditiontothenameoftheskill)thefollowinginformation.

KeyAbility
Theabbreviationoftheabilitywhosemodifierappliestotheskillcheck.Exception:SpeakLanguagehasNoneasitskey
abilitybecausetheuseofthisskilldoesnotrequireacheck.

TrainedOnly
Ifthisnotationisincludedintheskillnameline,youmusthaveatleast1rankintheskilltouseit.Ifitisomitted,theskill
canbeuseduntrained(witharankof0).Ifanyspecialnotesapplytotrainedoruntraineduse,theyarecoveredinthe
Untrainedsection(seebelow).

ArmorCheckPenalty
Ifthisnotationisincludedintheskillnameline,anarmorcheckpenaltyapplies(whenappropriate)tochecksusingthis
skill.Ifthisentryisabsent,anarmorcheckpenaltydoesnotapply.

Check
Whatacharacter(youintheskilldescription)candowithasuccessfulskillcheckandthecheck'sDC.

Action
Thetypeofactionusingtheskillrequires,ortheamountoftimerequiredforacheck.

TryAgain
Anyconditionsthatapplytosuccessiveattemptstousetheskillsuccessfully.Iftheskilldoesn'tallowyoutoattemptthe
sametaskmorethanonce,oriffailurecarriesaninherentpenalty(suchaswiththeClimbskill),youcan'ttake20.Ifthis
paragraphisomitted,theskillcanberetriedwithoutanyinherentpenalty,otherthantheadditionaltimerequired.

Special
Anyextrafactsthatapplytotheskill,suchasspecialeffectsderivingfromitsuseorbonusesthatcertaincharactersreceive
becauseofclass,featchoices,orrace.

Synergy
Someskillsgrantabonustotheuseofoneormoreotherskillsbecauseofasynergisticeffect.Thisentry,whenpresent,
indicateswhatbonusesthisskillmaygrantorreceivebecauseofsuchsynergies.SeeTable4\x{2013}5foracompletelist
ofbonusesgrantedbysynergybetweenskills(orbetweenaskillandaclassfeature).

Restriction
Thefullutilityofcertainskillsisrestrictedtocharactersofcertainclassesorcharacterswhopossesscertainfeats.Thisentry
indicateswhetheranysuchrestrictionsexistfortheskill.

Untrained
Thisentryindicateswhatacharacterwithoutatleast1rankintheskillcandowithit.Ifthisentrydoesn'tappear,itmeans
thattheskillfunctionsnormallyforuntrainedcharacters(ifitcanbeuseduntrained)orthatanuntrainedcharactercan't
attemptcheckswiththisskill(forskillsthataredesignatedasTrainedOnly).

Appraise(Int)
Check
YoucanappraisecommonorwellknownobjectswithaDC12Appraisecheck.Failuremeansthatyouestimatethevalueat
50%to150%(2d6+3times10%,)ofitsactualvalue.
AppraisingarareorexoticitemrequiresasuccessfulcheckagainstDC15,20,orhigher.Ifthecheckissuccessful,you
estimatethevaluecorrectly;failuremeansyoucannotestimatetheitemsvalue.
Amagnifyingglassgivesyoua+2circumstancebonusonAppraisechecksinvolvinganyitemthatissmallorhighly
detailed,suchasagem.Amerchantsscalegivesyoua+2circumstancebonusonAppraisechecksinvolvinganyitemsthat
arevaluedbyweight,includinganythingmadeofpreciousmetals.
Thesebonusesstack.

Action
Appraisinganitemtakes1minute(tenconsecutivefullroundactions).

Page56of462
TryAgain
No.Youcannottryagainonthesameobject,regardlessofsuccess.

Special
Adwarfgetsa+2racialbonusonAppraisechecksthatarerelatedtostoneormetalitemsbecausedwarvesarefamiliar
withvaluableitemsofallkinds(especiallythosemadeofstoneormetal).
Themasterofaravenfamiliargainsa+3bonusonAppraisechecks.
AcharacterwiththeDiligentfeatgetsa+2bonusonAppraisechecks.

Synergy
Ifyouhave5ranksinanyCraftskill,yougaina+2bonusonAppraisechecksrelatedtoitemsmadewiththatCraftskill.

Untrained
Forcommonitems,failureonanuntrainedcheckmeansnoestimate.Forrareitems,successmeansanestimateof50%to
150%(2d6+3times10%).

Balance(Dex;ArmorCheckPenalty)
Check
Youcanwalkonaprecarioussurface.Asuccessfulcheckletsyoumoveathalfyourspeedalongthesurfacefor1round.A
failureby4orlessmeansyoucantmovefor1round.Afailureby5ormoremeansyoufall.Thedifficultyvarieswiththe
surface,asfollows:
Table:BalanceDCs
NARROWSURFACE BALANCEDC1 DIFFICULTSURFACE BALANCEDC1
712incheswide 10 Unevenflagstone 102
26incheswide 15 Hewnstonefloor 102
Lessthan2incheswide 20 Slopedorangledfloor 102
1
AddmodifiersfromNarrowSurfaceModifiers,below,asappropriate.
2
Onlyifrunningorcharging.Failureby4orlessmeansthecharactercantrunorcharge,butmayotherwiseactnormally.
Table:NarrowSurfaceModifiers
SURFACE DCMODIFIER1
Lightlyobstructed +2
Severelyobstructed +5
Lightlyslippery +2
Severelyslippery +5
Slopedorangled +2
1
AddtheappropriatemodifiertotheBalanceDCofanarrowsurface.Thesemodifiersstack.

BeingAttackedwhileBalancing
Youareconsideredflatfootedwhilebalancing,sinceyoucantmovetoavoidablow,andthusyouloseyourDexterity
bonustoAC(ifany).Ifyouhave5ormoreranksinBalance,youarentconsideredflatfootedwhilebalancing.Ifyoutake
damagewhilebalancing,youmustmakeanotherBalancecheckagainstthesameDCtoremainstanding.

AcceleratedMovement
Youcantrytowalkacrossaprecarioussurfacemorequicklythannormal.Ifyouaccepta5penalty,youcanmoveyourfull
speedasamoveaction.(MovingtwiceyourspeedinaroundrequirestwoBalancechecks,oneforeachmoveactionused.)
Youmayalsoacceptthispenaltyinordertochargeacrossaprecarioussurface;chargingrequiresoneBalancecheckfor
eachmultipleofyourspeed(orfractionthereof)thatyoucharge.

Action
None.ABalancecheckdoesntrequireanaction;itismadeaspartofanotheractionorasareactiontoasituation.

Special
IfyouhavetheAgilefeat,yougeta+2bonusonBalancechecks.

Synergy
Ifyouhave5ormoreranksinTumble,yougeta+2bonusonBalancechecks.

Page57of462
Bluff(Cha)
Check
ABluffcheckisopposedbythetargetsSenseMotivecheck.Seetheaccompanyingtableforexamplesofdifferentkindsof
bluffsandthemodifiertothetargetsSenseMotivecheckforeachone.
Favorableandunfavorablecircumstancesweighheavilyontheoutcomeofabluff.Twocircumstancescanweighagainst
you:Thebluffishardtobelieve,ortheactionthatthetargetisaskedtotakegoesagainstitsselfinterest,nature,
personality,orders,orthelike.Ifitsimportant,youcandistinguishbetweenabluffthatfailsbecausethetargetdoesnt
believeitandonethatfailsbecauseitjustaskstoomuchofthetarget.Forinstance,ifthetargetgetsa+10bonusonits
SenseMotivecheckbecausethebluffdemandssomethingrisky,andtheSenseMotivechecksucceedsby10orless,then
thetargetdidntsomuchseethroughthebluffasprovereluctanttogoalongwithit.Atargetthatsucceedsby11ormore
hasseenthroughthebluff.
AsuccessfulBluffcheckindicatesthatthetargetreactsasyouwish,atleastforashorttime(usually1roundorless)or
believessomethingthatyouwantittobelieve.Bluff,however,isnotasuggestionspell.
Abluffrequiresinteractionbetweenyouandthetarget.Creaturesunawareofyoucannotbebluffed.

FeintinginCombat
YoucanalsouseBlufftomisleadanopponentinmeleecombat(sothatitcantdodgeyournextattackeffectively).Tofeint,
makeaBluffcheckopposedbyyourtargetsSenseMotivecheck,butinthiscase,thetargetmayadditsbaseattackbonus
totherollalongwithanyotherapplicablemodifiers.
IfyourBluffcheckresultexceedsthisspecialSenseMotivecheckresult,yourtargetisdenieditsDexteritybonustoAC(if
any)forthenextmeleeattackyoumakeagainstit.Thisattackmustbemadeonorbeforeyournextturn.
Feintinginthiswayagainstanonhumanoidisdifficultbecauseitshardertoreadastrangecreaturesbodylanguage;you
takea4penaltyonyourBluffcheck.AgainstacreatureofanimalIntelligence(1or2)itsevenharder;youtakea8
penalty.Againstanonintelligentcreature,itsimpossible.
Feintingincombatdoesnotprovokeanattackofopportunity.

CreatingaDiversiontoHide
YoucanusetheBluffskilltohelpyouhide.AsuccessfulBluffcheckgivesyouthemomentarydiversionyouneedtoattempt
aHidecheckwhilepeopleareawareofyou.Thisusagedoesnotprovokeanattackofopportunity.

DeliveringaSecretMessage
YoucanuseBlufftogetamessageacrosstoanothercharacterwithoutothersunderstandingit.TheDCis15forsimple
messages,or20forcomplexmessages,especiallythosethatrelyongettingacrossnewinformation.Failureby4orless
meansyoucantgetthemessageacross.Failureby5ormoremeansthatsomefalseinformationhasbeenimpliedor
inferred.AnyonelisteningtotheexchangecanmakeaSenseMotivecheckopposedbytheBluffcheckyoumadeto
transmitinordertointerceptyourmessage(seeSenseMotive).

Action
Varies.ABluffcheckmadeaspartofgeneralinteractionalwaystakesatleast1round(andisatleastafullroundaction),
butitcantakemuchlongerifyoutrysomethingelaborate.ABluffcheckmadetofeintincombatorcreateadiversionto
hideisastandardaction.ABluffcheckmadetodeliverasecretmessagedoesnttakeanaction;itispartofnormal
communication.

TryAgain
Varies.Generally,afailedBluffcheckinsocialinteractionmakesthetargettoosuspiciousforyoutotryagaininthesame
circumstances,butyoumayretryfreelyonBluffchecksmadetofeintincombat.Retriesarealsoallowedwhenyouare
tryingtosendamessage,butyoumayattemptsucharetryonlyonceperround.
Eachretrycarriesthesamechanceofmiscommunication.

Special
ArangergainsabonusonBluffcheckswhenusingthisskillagainstafavoredenemy.
Themasterofasnakefamiliargainsa+3bonusonBluffchecks.
IfyouhavethePersuasivefeat,yougeta+2bonusonBluffchecks.

Page58of462
Synergy
Ifyouhave5ormoreranksinBluff,yougeta+2bonusonDiplomacy,Intimidate,andSleightofHandchecks,aswellas
onDisguisechecksmadewhenyouknowyourebeingobservedandyoutrytoactincharacter.
Table:BluffExamples
EXAMPLECIRCUMSTANCES SENSEMOTIVEMODIFIER
Thetargetwantstobelieveyou. 5
Thebluffisbelievableanddoesntaffectthetargetmuch. +0
Thebluffisalittlehardtobelieveorputsthetargetatsomerisk. +5
Thebluffishardtobelieveorputsthetargetatsignificantrisk. +10
Thebluffiswayoutthere,almosttooincredibletoconsider. +20

Climb(Str;ArmorCheckPenalty)
Check
WithasuccessfulClimbcheck,youcanadvanceup,down,oracrossaslope,awall,orsomeothersteepincline(orevena
ceilingwithhandholds)atonequarteryournormalspeed.Aslopeisconsideredtobeanyinclineatananglemeasuring
lessthan60degrees;awallisanyinclineatananglemeasuring60degreesormore.
AClimbcheckthatfailsby4orlessmeansthatyoumakenoprogress,andonethatfailsby5ormoremeansthatyoufall
fromwhateverheightyouhavealreadyattained.
Aclimberskitgivesyoua+2circumstancebonusonClimbchecks.
TheDCofthecheckdependsontheconditionsoftheclimb.Comparethetaskwiththoseonthefollowingtableto
determineanappropriateDC.
Table:ClimbDCs
EXAMPLESURFACEORACTIVITY CLIMBDC
Aslopetoosteeptowalkup,oraknottedropewithawalltobraceagainst. 0
Aropewithawalltobraceagainst,oraknottedrope,oraropeaffectedbytheropetrickspell. 5
Asurfacewithledgestoholdontoandstandon,suchasaveryroughwallorashipsrigging. 10
Anysurfacewithadequatehandholdsandfootholds(naturalorartificial),suchasaveryroughnaturalrocksurface15
oratree,oranunknottedrope,orpullingyourselfupwhendanglingbyyourhands.
Anunevensurfacewithsomenarrowhandholdsandfootholds,suchasatypicalwallinadungeonorruins. 20
Aroughsurface,suchasanaturalrockwallorabrickwall. 25
Anoverhangorceilingwithhandholdsbutnofootholds. 25
Aperfectlysmooth,flat,verticalsurfacecannotbeclimbed.
Table:ClimbDCModifiers
EXAMPLESURFACEORACTIVITY CLIMBDCMODIFIER1
Climbingachimney(artificialornatural)orotherlocationwhereyoucanbraceagainsttwooppositewalls 10
(reducesDCby10).
Climbingacornerwhereyoucanbraceagainstperpendicularwalls(reducesDCby5). 5
Surfaceisslippery(increasesDCby5). +5
1
Thesemodifiersarecumulative;useanythatapply.
Youneedbothhandsfreetoclimb,butyoumayclingtoawallwithonehandwhileyoucastaspellortakesomeother
actionthatrequiresonlyonehand.Whileclimbing,youcantmovetoavoidablow,soyouloseyourDexteritybonustoAC
(ifany).Youalsocantuseashieldwhileclimbing.
Anytimeyoutakedamagewhileclimbing,makeaClimbcheckagainsttheDCoftheslopeorwall.Failuremeansyoufall
fromyourcurrentheightandsustaintheappropriatefallingdamage.

AcceleratedClimbing
Youtrytoclimbmorequicklythannormal.Byacceptinga5penalty,youcanmovehalfyourspeed(insteadofonequarter
yourspeed).

MakingYourOwnHandholdsandFootholds
Youcanmakeyourownhandholdsandfootholdsbypoundingpitonsintoawall.Doingsotakes1minuteperpiton,and
onepitonisneededper3feetofdistance.Aswithanysurfacethatoffershandholdsandfootholds,awallwithpitonsinit
hasaDCof15.Inthesameway,aclimberwithahandaxeorsimilarimplementcancuthandholdsinanicewall.

CatchingYourselfWhenFalling
Itspracticallyimpossibletocatchyourselfonawallwhilefalling.MakeaClimbcheck(DC=wallsDC+20)todoso.Its
mucheasiertocatchyourselfonaslope(DC=slopesDC+10).
Page59of462
CatchingaFallingCharacterWhileClimbing
Ifsomeoneclimbingaboveyouoradjacenttoyoufalls,youcanattempttocatchthefallingcharacterifheorsheiswithin
yourreach.Doingsorequiresasuccessfulmeleetouchattackagainstthefallingcharacter(thoughheorshecanvoluntarily
foregoanyDexteritybonustoACifdesired).Ifyouhit,youmustimmediatelyattemptaClimbcheck(DC=wallsDC+
10).Successindicatesthatyoucatchthefallingcharacter,buthisorhertotalweight,includingequipment,cannotexceed
yourheavyloadlimitoryouautomaticallyfall.IfyoufailyourClimbcheckby4orless,youfailtostopthecharactersfall
butdontloseyourgriponthewall.Ifyoufailby5ormore,youfailtostopthecharactersfallandbeginfallingaswell.

Action
Climbingispartofmovement,soitsgenerallypartofamoveaction(andmaybecombinedwithothertypesofmovement
inamoveaction).EachmoveactionthatincludesanyclimbingrequiresaseparateClimbcheck.Catchingyourselfor
anotherfallingcharacterdoesnttakeanaction.

Special
Youcanusearopetohaulacharacterupward(orloweracharacter)throughsheerstrength.Youcanliftdoubleyour
maximumloadinthismanner.
Ahalflinghasa+2racialbonusonClimbchecksbecausehalflingsareagileandsurefooted.
Themasterofalizardfamiliargainsa+3bonusonClimbchecks.
IfyouhavetheAthleticfeat,yougeta+2bonusonClimbchecks.
Acreaturewithaclimbspeedhasa+8racialbonusonallClimbchecks.ThecreaturemustmakeaClimbchecktoclimb
anywallorslopewithaDChigherthan0,butitalwayscanchoosetotake10,evenifrushedorthreatenedwhileclimbing.
Ifacreaturewithaclimbspeedchoosesanacceleratedclimb(seeabove),itmovesatdoubleitsclimbspeed(oratitsland
speed,whicheverisslower)andmakesasingleClimbcheckata5penalty.SuchacreatureretainsitsDexteritybonusto
ArmorClass(ifany)whileclimbing,andopponentsgetnospecialbonustotheirattacksagainstit.Itcannot,however,use
therunactionwhileclimbing.

Synergy
Ifyouhave5ormoreranksinUseRope,yougeta+2bonusonClimbchecksmadetoclimbarope,aknottedrope,ora
ropeandwallcombination.

Concentration(Con)
Check
YoumustmakeaConcentrationcheckwheneveryoumightpotentiallybedistracted(bytakingdamage,byharshweather,
andsoon)whileengagedinsomeactionthatrequiresyourfullattention.Suchactionsincludecastingaspell,
concentratingonanactivespell,directingaspell,usingaspelllikeability,orusingaskillthatwouldprovokeanattackof
opportunity.Ingeneral,ifanactionwouldntnormallyprovokeanattackofopportunity,youneednotmakea
Concentrationchecktoavoidbeingdistracted.
IftheConcentrationchecksucceeds,youmaycontinuewiththeactionasnormal.Ifthecheckfails,theactionautomatically
failsandiswasted.Ifyouwereintheprocessofcastingaspell,thespellislost.Ifyouwereconcentratingonanactive
spell,thespellendsasifyouhadceasedconcentratingonit.Ifyouweredirectingaspell,thedirectionfailsbutthespell
remainsactive.Ifyouwereusingaspelllikeability,thatuseoftheabilityislost.Askillusealsofails,andinsomecasesa
failedskillcheckmayhaveotherramificationsaswell.
ThetablebelowsummarizesvarioustypesofdistractionsthatcauseyoutomakeaConcentrationcheck.Ifthedistraction
occurswhileyouaretryingtocastaspell,youmustaddthelevelofthespellyouaretryingtocasttotheappropriate
ConcentrationDC.Ifmorethanonetypeofdistractionispresent,makeacheckforeachone;anyfailedConcentration
checkindicatesthatthetaskisnotcompleted.
Table:ConcentrationDCs
DISTRACTION CONCENTRATIONDC1
Damagedduringtheaction.2 10+damagedealt
Takingcontinuousdamageduringthedamagelastdealtaction.3 10+halfofcontinuous
Distractedbynondamagingspell.4 DistractingspellssaveDC
Vigorousmotion(onamovingmount,takingabouncywagonride,inasmallboatinroughwater, 10
belowdecksinastormtossedship).
Violentmotion(onagallopinghorse,takingaveryroughwagonride,inasmallboatinrapids,onthe 15
deckofastormtossedship).

Page60of462
DISTRACTION CONCENTRATIONDC1
Extraordinarilyviolentmotion(earthquake). 20
Entangled. 15
Grapplingorpinned.(Youcancastonlyspellswithoutsomaticcomponentsforwhichyouhaveany 20
requiredmaterialcomponentinhand.)
Weatherisahighwindcarryingblindingrainorsleet. 5
Weatheriswinddrivenhail,dust,ordebris. 10
Weathercausedbyaspell,suchasstormofvengeance.4 DistractingspellssaveDC
1
Ifyouaretryingtocast,concentrateon,ordirectaspellwhenthedistractionoccurs,addthelevelofthespelltotheindicatedDC.
2
Suchasduringthecastingofaspellwithacastingtimeof1roundormore,ortheexecutionofanactivitythattakesmorethana
singlefullroundaction(suchasDisableDevice).Also,damagestemmingfromanattackofopportunityorreadiedattackmadein
responsetothespellbeingcast(forspellswithacastingtimeof1action)ortheactionbeingtaken(foractivitiesrequiringnomorethan
afullroundaction).(SeealsoDistractingSpellcasters,page160.)
3
Suchasfromacidarrow.
4
Ifthespellallowsnosave,usethesaveDCitwouldhaveifitdidallowasave.

Action
None.MakingaConcentrationcheckdoesnttakeanaction;itiseitherafreeaction(whenattemptedreactively)orpartof
anotheraction(whenattemptedactively).

TryAgain
Yes,thoughasuccessdoesntcanceltheeffectofapreviousfailure,suchasthelossofaspellyouwerecastingorthe
disruptionofaspellyouwereconcentratingon.

Special
YoucanuseConcentrationtocastaspell,useaspelllikeability,oruseaskilldefensively,soastoavoidattacksof
opportunityaltogether.Thisdoesntapplytootheractionsthatmightprovokeattacksofopportunity.
TheDCofthecheckis15(plusthespellslevel,ifcastingaspellorusingaspelllikeabilitydefensively).Ifthe
Concentrationchecksucceeds,youmayattempttheactionnormallywithoutprovokinganyattacksofopportunity.A
successfulConcentrationcheckstilldoesntallowyoutotake10onanothercheckifyouareinastressfulsituation;you
mustmakethechecknormally.IftheConcentrationcheckfails,therelatedactionalsoautomaticallyfails(withany
appropriateramifications),andtheactioniswasted,justasifyourconcentrationhadbeendisruptedbyadistraction.
AcharacterwiththeCombatCastingfeatgetsa+4bonusonConcentrationchecksmadetocastaspelloruseaspelllike
abilitywhileonthedefensiveorwhilegrapplingorpinned.

Craft(Int)
LikeKnowledge,Perform,andProfession,Craftisactuallyanumberofseparateskills.YoucouldhaveseveralCraftskills,
eachwithitsownranks,eachpurchasedasaseparateskill.
ACraftskillisspecificallyfocusedoncreatingsomething.Ifnothingiscreatedbytheendeavor,itprobablyfallsunderthe
headingofaProfessionskill.

Check
Youcanpracticeyourtradeandmakeadecentliving,earningabouthalfyourcheckresultingoldpiecesperweekof
dedicatedwork.Youknowhowtousethetoolsofyourtrade,howtoperformthecraftsdailytasks,howtosupervise
untrainedhelpers,andhowtohandlecommonproblems.(Untrainedlaborersandassistantsearnanaverageof1silver
pieceperday.)
ThebasicfunctionoftheCraftskill,however,istoallowyoutomakeanitemoftheappropriatetype.TheDCdependson
thecomplexityoftheitemtobecreated.TheDC,yourcheckresults,andthepriceoftheitemdeterminehowlongittakes
tomakeaparticularitem.Theitemsfinishedpricealsodeterminesthecostofrawmaterials.
Insomecases,thefabricatespellcanbeusedtoachievetheresultsofaCraftcheckwithnoactualcheckinvolved.
However,youmustmakeanappropriateCraftcheckwhenusingthespelltomakearticlesrequiringahighdegreeof
craftsmanship.
AsuccessfulCraftcheckrelatedtowoodworkinginconjunctionwiththecastingoftheironwoodspellenablesyoutomake
woodenitemsthathavethestrengthofsteel.
Whencastingthespellminorcreation,youmustsucceedonanappropriateCraftchecktomakeacomplexitem.

Page61of462
Allcraftsrequireartisanstoolstogivethebestchanceofsuccess.Ifimprovisedtoolsareused,thecheckismadewitha2
circumstancepenalty.Ontheotherhand,masterworkartisanstoolsprovidea+2circumstancebonusonthecheck.
Todeterminehowmuchtimeandmoneyittakestomakeanitem,followthesesteps.
1. Findtheitemsprice.Putthepriceinsilverpieces(1gp=10sp).
2. FindtheDCfromthetablebelow.
3. Payonethirdoftheitemspriceforthecostofrawmaterials.
4. MakeanappropriateCraftcheckrepresentingoneweekswork.Ifthechecksucceeds,multiplyyourcheckresultbythe
DC.IftheresulttheDCequalsthepriceoftheiteminsp,thenyouhavecompletedtheitem.(IftheresulttheDC
equalsdoubleortriplethepriceoftheiteminsilverpieces,thenyouvecompletedthetaskinonehalforonethirdof
thetime.OthermultiplesoftheDCreducethetimeinthesamemanner.)IftheresulttheDCdoesntequaltheprice,
thenitrepresentstheprogressyouvemadethisweek.RecordtheresultandmakeanewCraftcheckforthenextweek.
Eachweek,youmakemoreprogressuntilyourtotalreachesthepriceoftheiteminsilverpieces.
Ifyoufailacheckby4orless,youmakenoprogressthisweek.
Ifyoufailby5ormore,youruinhalftherawmaterialsandhavetopayhalftheoriginalrawmaterialcostagain.

ProgressbytheDay
Youcanmakechecksbythedayinsteadofbytheweek.Inthiscaseyourprogress(checkresultDC)isincopperpieces
insteadofsilverpieces.

CreatingMasterworkItems
Youcanmakeamasterworkitemaweapon,suitofarmor,shield,ortoolthatconveysabonusonitsusethroughits
exceptionalcraftsmanship,notthroughbeingmagical.Tocreateamasterworkitem,youcreatethemasterworkcomponent
asifitwereaseparateiteminadditiontothestandarditem.Themasterworkcomponenthasitsownprice(300gpfora
weaponor150gpforasuitofarmororashield)andaCraftDCof20.Onceboththestandardcomponentandthe
masterworkcomponentarecompleted,themasterworkitemisfinished.Note:Thecostyoupayforthemasterwork
componentisonethirdofthegivenamount,justasitisforthecostinrawmaterials.

RepairingItems
Generally,youcanrepairanitembymakingchecksagainstthesameDCthatittooktomaketheiteminthefirstplace.The
costofrepairinganitemisonefifthoftheitemsprice.
WhenyouusetheCraftskilltomakeaparticularsortofitem,theDCforchecksinvolvingthecreationofthatitemare
typicallyasgivenonthefollowingtable.
ITEM CRAFTSKILL CRAFTDC
Acid Alchemy1 15
Alchemistsfire,smokestick,ortindertwig Alchemy1 20
Antitoxin,sunrod,tanglefootbag,orthunderstone Alchemy1 25
Armororshield Armorsmithing 10+ACbonus
Longboworshortbow Bowmaking 12
Compositelongboworcompositeshortbow Bowmaking 15
Compositelongboworcompositeshortbowwithhighstrengthrating Bowmaking 15+(2rating)
Crossbow Weaponsmithing 15
Simplemeleeorthrownweapon Weaponsmithing 12
Martialmeleeorthrownweapon Weaponsmithing 15
Exoticmeleeorthrownweapon Weaponsmithing 18
Mechanicaltrap Trapmaking Varies2
Verysimpleitem(woodenspoon) Varies 5
Typicalitem(ironpot) Varies 10
Highqualityitem(bell) Varies 15
Complexorsuperioritem(lock) Varies 20
1
Youmustbeaspellcastertocraftanyoftheseitems.
2
Trapshavetheirownrulesforconstruction.

Action
Doesnotapply.Craftchecksaremadebythedayorweek(seeabove).

Page62of462
TryAgain
Yes,buteachtimeyoumissby5ormore,youruinhalftherawmaterialsandhavetopayhalftheoriginalrawmaterial
costagain.

Special
Adwarfhasa+2racialbonusonCraftchecksthatarerelatedtostoneormetal,becausedwarvesareespeciallycapable
withstoneworkandmetalwork.
Agnomehasa+2racialbonusonCraft(alchemy)checksbecausegnomeshavesensitivenoses.
Youmayvoluntarilyadd+10totheindicatedDCtocraftanitem.Thisallowsyoutocreatetheitemmorequickly(since
youllbemultiplyingthishigherDCbyyourCraftcheckresulttodetermineprogress).Youmustdecidewhethertoincrease
theDCbeforeyoumakeeachweeklyordailycheck.
TomakeanitemusingCraft(alchemy),youmusthavealchemicalequipmentandbeaspellcaster.Ifyouareworkingina
city,youcanbuywhatyouneedaspartoftherawmaterialscosttomaketheitem,butalchemicalequipmentisdifficultor
impossibletocomebyinsomeplaces.Purchasingandmaintaininganalchemistslabgrantsa+2circumstancebonuson
Craft(alchemy)checksbecauseyouhavetheperfecttoolsforthejob,butitdoesnotaffectthecostofanyitemsmade
usingtheskill.

Synergy
Ifyouhave5ranksinaCraftskill,yougeta+2bonusonAppraisechecksrelatedtoitemsmadewiththatCraftskill.

DecipherScript(Int;TrainedOnly)
Check
Youcandecipherwritinginanunfamiliarlanguageoramessagewritteninanincompleteorarchaicform.ThebaseDCis
20forthesimplestmessages,25forstandardtexts,and30orhigherforintricate,exotic,orveryoldwriting.
Ifthechecksucceeds,youunderstandthegeneralcontentofapieceofwritingaboutonepagelong(ortheequivalent).If
thecheckfails,makeaDC5Wisdomchecktoseeifyouavoiddrawingafalseconclusionaboutthetext.(Successmeans
thatyoudonotdrawafalseconclusion;failuremeansthatyoudo.)
BoththeDecipherScriptcheckand(ifnecessary)theWisdomcheckaremadesecretly,sothatyoucanttellwhetherthe
conclusionyoudrawistrueorfalse.

Action
Decipheringtheequivalentofasinglepageofscripttakes1minute(tenconsecutivefullroundactions).

TryAgain
No.

Special
AcharacterwiththeDiligentfeatgetsa+2bonusonDecipherScriptchecks.

Synergy
Ifyouhave5ormoreranksinDecipherScript,yougeta+2bonusonUseMagicDevicechecksinvolvingscrolls.

Diplomacy(Cha)
Check
Youcanchangetheattitudesofothers(nonplayercharacters)withasuccessfulDiplomacycheck;seetheInfluencingNPC
Attitudessidebar,below,forbasicDCs.Innegotiations,participantsrollopposedDiplomacychecks,andthewinnergains
theadvantage.Opposedchecksalsoresolvesituationswhentwoadvocatesordiplomatspleadoppositecasesinahearing
beforeathirdparty.

InfluencingNPCAttitudes
UsethetablebelowtodeterminetheeffectivenessofDiplomacychecks(orCharismachecks)madetoinfluencethe
attitudeofanonplayercharacter,orwildempathychecksmadetoinfluencetheattitudeofananimalormagicalbeast.
Table:InfluencingNPCAttitudes
INITIALATTITUDE NEWATTITUDE(DCTOACHIEVE)
HOSTILE UNFRIENDLY INDIFFERENT FRIENDLY HELPFUL

Page63of462
INITIALATTITUDE NEWATTITUDE(DCTOACHIEVE)
Hostile Lessthan20 20 25 35 50
Unfriendly Lessthan5 5 15 25 40
Indifferent Lessthan1 1 15 30
Friendly Lessthan1 1 20
Helpful Lessthan1 1
Table:ReactionsbyAttitude
ATTITUDE MEANS POSSIBLEACTIONS
Hostile Willtakeriskstohurtyou Attack,interfere,berate,flee
Unfriendly Wishesyouill Mislead,gossip,avoid,watchsuspiciously,insult
Indifferent Doesntmuchcare Sociallyexpectedinteraction
Friendly Wishesyouwell Chat,advise,offerlimitedhelp,advocate
Helpful Willtakeriskstohelpyou Protect,backup,heal,aid

Action
ChangingothersattitudeswithDiplomacygenerallytakesatleast1fullminute(10consecutivefullroundactions).In
somesituations,thistimerequirementmaygreatlyincrease.ArushedDiplomacycheckcanbemadeasafullroundaction,
butyoutakea10penaltyonthecheck.

TryAgain
Optional,butnotrecommendedbecauseretriesusuallydonotwork.EveniftheinitialDiplomacychecksucceeds,theother
charactercanbepersuadedonlysofar,andaretrymaydomoreharmthangood.Iftheinitialcheckfails,theother
characterhasprobablybecomemorefirmlycommittedtohisposition,andaretryisfutile.

Special
Ahalfelfhasa+2racialbonusonDiplomacychecks.
IfyouhavetheNegotiatorfeat,yougeta+2bonusonDiplomacychecks.

Synergy
Ifyouhave5ormoreranksinBluff,Knowledge(nobilityandroyalty),orSenseMotive,yougeta+2bonusonDiplomacy
checks.

DisableDevice(Int;TrainedOnly)
Check
TheDisableDevicecheckismadesecretly,sothatyoudontnecessarilyknowwhetheryouvesucceeded.
TheDCdependsonhowtrickythedeviceis.Disabling(orriggingorjamming)afairlysimpledevicehasaDCof10;more
intricateandcomplexdeviceshavehigherDCs.
Ifthechecksucceeds,youdisablethedevice.Ifitfailsby4orless,youhavefailedbutcantryagain.Ifyoufailby5or
more,somethinggoeswrong.Ifthedeviceisatrap,youspringit.Ifyoureattemptingsomesortofsabotage,youthinkthe
deviceisdisabled,butitstillworksnormally.
Youalsocanrigsimpledevicessuchassaddlesorwagonwheelstoworknormallyforawhileandthenfailorfalloffsome
timelater(usuallyafter1d4roundsorminutesofuse).
Table:DisableDeviceDCs
DEVICE TIME DISABLEDEVICEDC1 EXAMPLE
Simple 1round 10 Jamalock
Tricky 1d4rounds 15 Sabotageawagonwheel
Difficult 2d4rounds 20 Disarmatrap,resetatrap
Wicked 2d4rounds 25 Disarmacomplextrap,cleverlysabotageaclockworkdevice
1
Ifyouattempttoleavebehindnotraceofyourtampering,add5totheDC.
ItspossibletoruinmanytrapswithoutmakingaDisableDevicecheck.

RangedAttackTraps
Onceatrapslocationisknown,theobviouswaytoruinitistosmashthemechanismassumingthemechanismcanbe
accessed.Failingthat,itspossibletopluguptheholesfromwhichtheprojectilesemerge.Doingthispreventsthetrapfrom
firingunlessitsammunitiondoesenoughdamagetobreakthroughtheplugs.

Page64of462
MeleeAttackTraps
Thesedevicescanbethwartedbysmashingthemechanismorblockingtheweapons,asnotedabove.Alternatively,ifa
characterstudiesthetrapasittriggers,hemightbeabletotimehisdodgesjustrighttoavoiddamage.Acharacterwhois
doingnothingbutstudyingatrapwhenitfirstgoesoffgainsa+4dodgebonusagainstitsattacksifitistriggeredagain
withinthenextminute.

Pits
Disablingapittrapgenerallyruinsonlythetrapdoor,makingitanuncoveredpit.Fillinginthepitorbuildingamakeshift
bridgeacrossitisanapplicationofmanuallabor,nottheDisableDeviceskill.Characterscouldneutralizeanyspikesatthe
bottomofapitbyattackingthemtheybreakjustasdaggersdo.

Action
TheamountoftimeneededtomakeaDisableDevicecheckdependsonthetask,asnotedabove.Disablingasimpledevice
takes1roundandisafullroundaction.Anintricateorcomplexdevicerequires1d4or2d4rounds.

TryAgain
Varies.Youcanretryifyouhavemissedthecheckby4orless,thoughyoumustbeawarethatyouhavefailedinorderto
tryagain.

Special
IfyouhavetheNimbleFingersfeat,yougeta+2bonusonDisableDevicechecks.
AroguewhobeatsatrapsDCby10ormorecanstudythetrap,figureouthowitworks,andbypassit(alongwithher
companions)withoutdisarmingit.

Restriction
Rogues(andothercharacterswiththetrapfindingclassfeature)candisarmmagictraps.AmagictrapgenerallyhasaDCof
25+thespelllevelofthemagicusedtocreateit.
Thespellsfiretrap,glyphofwarding,symbol,andteleportationcirclealsocreatetrapsthataroguecandisarmwitha
successfulDisableDevicecheck.Spikegrowthandspikestones,however,createmagictrapsagainstwhichDisableDevice
checksdonotsucceed.Seetheindividualspelldescriptionsfordetails.

Disguise(Cha)
Check
YourDisguisecheckresultdetermineshowgoodthedisguiseis,anditisopposedbyothersSpotcheckresults.Ifyoudont
drawanyattentiontoyourself,othersdonotgettomakeSpotchecks.Ifyoucometotheattentionofpeoplewhoare
suspicious(suchasaguardwhoiswatchingcommonerswalkingthroughacitygate),itcanbeassumedthatsuch
observersaretaking10ontheirSpotchecks.
YougetonlyoneDisguisecheckperuseoftheskill,evenifseveralpeoplearemakingSpotchecksagainstit.TheDisguise
checkismadesecretly,sothatyoucantbesurehowgoodtheresultis.
Theeffectivenessofyourdisguisedependsinpartonhowmuchyoureattemptingtochangeyourappearance.
Table:DisguiseCheckModifiers
DISGUISE DISGUISECHECKMODIFIER
Minordetailsonly +5
Disguisedasdifferentgender1 2
Disguisedasdifferentrace1 2
Disguisedasdifferentagecategory1 22
1
Thesemodifiersarecumulative;useanythatapply.
2
Perstepofdifferencebetweenyouractualagecategoryandyourdisguisedagecategory.Thestepsare:young(youngerthan
adulthood),adulthood,middleage,old,andvenerable.
Ifyouareimpersonatingaparticularindividual,thosewhoknowwhatthatpersonlookslikegetabonusontheirSpot
checksaccordingtothetablebelow.Furthermore,theyareautomaticallyconsideredtobesuspiciousofyou,soopposed
checksarealwayscalledfor.
Table:ViewerSpotCheckBonus
FAMILIARITY VIEWERSSPOTCHECKBONUS
Recognizesonsight +4
Friendsorassociates +6
Page65of462
FAMILIARITY VIEWERSSPOTCHECKBONUS
Closefriends +8
Intimate +10
Usually,anindividualmakesaSpotchecktoseethroughyourdisguiseimmediatelyuponmeetingyouandeachhour
thereafter.Ifyoucasuallymeetmanydifferentcreatures,eachforashorttime,checkonceperdayorhour,usingan
averageSpotmodifierforthegroup.

Action
Creatingadisguiserequires1d310minutesofwork.

TryAgain
Yes.Youmaytrytoredoafaileddisguise,butonceothersknowthatadisguisewasattempted,theyllbemoresuspicious.

Special
Magicthataltersyourform,suchasalterself,disguiseself,polymorph,orshapechange,grantsyoua+10bonuson
Disguisechecks(seetheindividualspelldescriptions).YoumustsucceedonaDisguisecheckwitha+10bonustoduplicate
theappearanceofaspecificindividualusingtheveilspell.Divinationmagicthatallowspeopletoseethroughillusions
(suchastrueseeing)doesnotpenetrateamundanedisguise,butitcannegatethemagicalcomponentofamagically
enhancedone.
YoumustmakeaDisguisecheckwhenyoucastasimulacrumspelltodeterminehowgoodthelikenessis.
IfyouhavetheDeceptivefeat,yougeta+2bonusonDisguisechecks.

Synergy
Ifyouhave5ormoreranksinBluff,yougeta+2bonusonDisguisecheckswhenyouknowthatyourebeingobservedand
youtrytoactincharacter.

EscapeArtist(Dex;ArmorCheckPenalty)
Check
ThetablebelowgivestheDCstoescapevariousformsofrestraints.

Ropes
YourEscapeArtistcheckisopposedbythebindersUseRopecheck.Sinceitseasiertotiesomeoneupthantoescapefrom
beingtiedup,thebindergetsa+10bonusonhisorhercheck.

ManaclesandMasterworkManacles
TheDCformanaclesissetbytheirconstruction.

TightSpace
TheDCnotedonthetableisforgettingthroughaspacewhereyourheadfitsbutyourshouldersdont.Ifthespaceislong
youmayneedtomakemultiplechecks.Youcantgetthroughaspacethatyourheaddoesnotfitthrough.

Grappler
YoucanmakeanEscapeArtistcheckopposedbyyourenemysgrapplechecktogetoutofagrappleoroutofapinned
condition(sothatyoureonlygrappling).
Table:EscapeArtistDCs
RESTRAINT ESCAPEARTISTDC
RopesBinders UseRopecheckat+10
Net,animateropespell,commandplantsspell,controlplantsspell,orentanglespell 20
Snarespell 23
Manacles 30
Tightspace 30
Masterworkmanacles 35
Grappler Grapplersgrapplecheckresult

Action
MakinganEscapeArtistchecktoescapefromropebindings,manacles,orotherrestraints(exceptagrappler)requires1
minuteofwork.Escapingfromanetorananimaterope,commandplants,controlplants,orentanglespellisafullround
action.Escapingfromagrappleorpinisastandardaction.Squeezingthroughatightspacetakesatleast1minute,maybe
longer,dependingonhowlongthespaceis.
Page66of462
TryAgain
Varies.Youcanmakeanothercheckafterafailedcheckifyouresqueezingyourwaythroughatightspace,makingmultiple
checks.Ifthesituationpermits,youcanmakeadditionalchecks,oreventake20,aslongasyourenotbeingactively
opposed.

Special
IfyouhavetheAgilefeat,yougeta+2bonusonEscapeArtistchecks.

Synergy
Ifyouhave5ormoreranksinEscapeArtist,yougeta+2bonusonUseRopecheckstobindsomeone.
Ifyouhave5ormoreranksinUseRope,yougeta+2bonusonEscapeArtistcheckswhenescapingfromropebonds.

Forgery(Int)
Check
Forgeryrequireswritingmaterialsappropriatetothedocumentbeingforged,enoughlightorsufficientvisualacuitytosee
thedetailsofwhatyourewriting,waxforseals(ifappropriate),andsometime.Toforgeadocumentonwhichthe
handwritingisnotspecifictoaperson(militaryorders,agovernmentdecree,abusinessledger,orthelike),youneedonly
tohaveseenasimilardocumentbefore,andyougaina+8bonusonyourcheck.Toforgeasignature,youneedan
autographofthatpersontocopy,andyougaina+4bonusonthecheck.Toforgealongerdocumentwritteninthehandof
someparticularperson,alargesampleofthatpersonshandwritingisneeded.
TheForgerycheckismadesecretly,sothatyourenotsurehowgoodyourforgeryis.AswithDisguise,youdontevenneed
tomakeacheckuntilsomeoneexaminesthework.YourForgerycheckisopposedbytheForgerycheckofthepersonwho
examinesthedocumenttocheckitsauthenticity.Theexaminergainsmodifiersonhisorhercheckifanyoftheconditions
onthetablebelowexist.
Table:ForgeryCheckModifiers
CONDITION READERSFORGERYCHECKMODIFIER
Typeofdocumentunknowntoreader 2
Typeofdocumentsomewhatknowntoreader +0
Typeofdocumentwellknowntoreader +2
Handwritingnotknowntoreader 2
Handwritingsomewhatknowntoreader +0
Handwritingintimatelyknowntoreader +2
Readeronlycasuallyreviewsthedocument 2
Adocumentthatcontradictsprocedure,orders,orpreviousknowledge,oronethatrequiressacrificeonthepartofthe
personcheckingthedocumentcanincreasethatcharacterssuspicion(andthuscreatefavorablecircumstancesforthe
checkersopposingForgerycheck).

Action
Forgingaveryshortandsimpledocumenttakesabout1minute.Alongerormorecomplexdocumenttakes1d4minutes
perpage.

TryAgain
Usually,no.Aretryisneverpossibleafteraparticularreaderdetectsaparticularforgery.Butthedocumentcreatedbythe
forgermightstillfoolsomeoneelse.TheresultofaForgerycheckforaparticulardocumentmustbeusedforeveryinstance
ofadifferentreaderexaminingthedocument.Noreadercanattempttodetectaparticularforgerymorethanonce;ifthat
oneopposedcheckgoesinfavoroftheforger,thenthereadercanttryusinghisownskillagain,evenifhessuspicious
aboutthedocument.

Special
IfyouhavetheDeceitfulfeat,yougeta+2bonusonForgerychecks.

Restriction
Forgeryislanguagedependent;thus,toforgedocumentsanddetectforgeries,youmustbeabletoreadandwritethe
languageinquestion.AbarbariancantlearntheForgeryskillunlesshehaslearnedtoreadandwrite.

Page67of462
GatherInformation(Cha)
Check
Aneveningstime,afewgoldpiecesforbuyingdrinksandmakingfriends,andaDC10GatherInformationcheckgetyoua
generalideaofacitysmajornewsitems,assumingtherearenoobviousreasonswhytheinformationwouldbewithheld.
Thehigheryourcheckresult,thebettertheinformation.
Ifyouwanttofindoutaboutaspecificrumor,oraspecificitem,orobtainamap,ordosomethingelsealongthoselines,
theDCforthecheckis15to25,orevenhigher.

Action
AtypicalGatherInformationchecktakes1d4+1hours.

TryAgain
Yes,butittakestimeforeachcheck.Furthermore,youmaydrawattentiontoyourselfifyourepeatedlypursueacertain
typeofinformation.

Special
IfyouhavetheInvestigatorfeat,yougeta+2bonusonGatherInformationchecks.

Synergy
Ifyouhave5ormoreranksinKnowledge(local),yougeta+2bonusonGatherInformationchecks.

HandleAnimal(Cha;TrainedOnly)
Check
TheDCdependsonwhatyouaretryingtodo.
Table:HandleAnimalDCs
TASK HANDLEANIMALDC
Handleananimal 10
Pushananimal 25
Teachananimalatrick 15or201
Trainananimalforageneralpurpose 15or201
Rearawildanimal 15+HDofanimal
1
Seethespecifictrickorpurposebelow
Table:TrickorPurposeDCs
GENERALPURPOSE DC
Combatriding 20
Fighting 20
Guarding 20
Heavylabor 15
Hunting 20
Performance 15
Riding 15

HandleanAnimal
Thistaskinvolvescommandingananimaltoperformataskortrickthatitknows.Iftheanimaliswoundedorhastaken
anynonlethaldamageorabilityscoredamage,theDCincreasesby2.Ifyourchecksucceeds,theanimalperformsthetask
ortrickonitsnextaction.

PushanAnimal
Topushananimalmeanstogetittoperformataskortrickthatitdoesntknowbutisphysicallycapableofperforming.
Thiscategoryalsocoversmakingananimalperformaforcedmarchorforcingittohustleformorethan1hourbetween
sleepcycles.Iftheanimaliswoundedorhastakenanynonlethaldamageorabilityscoredamage,theDCincreasesby2.If
yourchecksucceeds,theanimalperformsthetaskortrickonitsnextaction.

TeachanAnimalaTrick
YoucanteachananimalaspecifictrickwithoneweekofworkandasuccessfulHandleAnimalcheckagainsttheindicated
DC.AnanimalwithanIntelligencescoreof1canlearnamaximumofthreetricks,whileananimalwithanIntelligence
scoreof2canlearnamaximumofsixtricks.Possibletricks(andtheirassociatedDCs)include,butarenotnecessarily
limitedto,thefollowing.

Page68of462
Attack(DC20):Theanimalattacksapparentenemies.Youmaypointtoaparticularcreaturethatyouwishtheanimalto
attack,anditwillcomplyifable.Normally,ananimalwillattackonlyhumanoids,monstroushumanoids,giants,orother
animals.Teachingananimaltoattackallcreatures(includingsuchunnaturalcreaturesasundeadandaberrations)counts
astwotricks.
Come(DC15):Theanimalcomestoyou,evenifitnormallywouldnotdoso.
Defend(DC20):Theanimaldefendsyou(orisreadytodefendyouifnothreatispresent),evenwithoutanycommand
beinggiven.Alternatively,youcancommandtheanimaltodefendaspecificothercharacter.
Down(DC15):Theanimalbreaksofffromcombatorotherwisebacksdown.Ananimalthatdoesntknowthistrick
continuestofightuntilitmustflee(duetoinjury,afeareffect,orthelike)oritsopponentisdefeated.
Fetch(DC15):Theanimalgoesandgetssomething.Ifyoudonotpointoutaspecificitem,theanimalfetchessome
randomobject.
Guard(DC20):Theanimalstaysinplaceandpreventsothersfromapproaching.
Heel(DC15):Theanimalfollowsyouclosely,eventoplaceswhereitnormallywouldntgo.
Perform(DC15):Theanimalperformsavarietyofsimpletricks,suchassittingup,rollingover,roaringorbarking,andso
on.
Seek(DC15):Theanimalmovesintoanareaandlooksaroundforanythingthatisobviouslyaliveoranimate.
Stay(DC15):Theanimalstaysinplace,waitingforyoutoreturn.Itdoesnotchallengeothercreaturesthatcomeby,
thoughitstilldefendsitselfifitneedsto.
Track(DC20):Theanimaltracksthescentpresentedtoit.(Thisrequirestheanimaltohavethescentability)
Work(DC15):Theanimalpullsorpushesamediumorheavyload.

TrainanAnimalforaPurpose
Ratherthanteachingananimalindividualtricks,youcansimplytrainitforageneralpurpose.Essentially,ananimals
purposerepresentsapreselectedsetofknowntricksthatfitintoacommonscheme,suchasguardingorheavylabor.The
animalmustmeetallthenormalprerequisitesforalltricksincludedinthetrainingpackage.Ifthepackageincludesmore
thanthreetricks,theanimalmusthaveanIntelligencescoreof2.
Ananimalcanbetrainedforonlyonegeneralpurpose,thoughifthecreatureiscapableoflearningadditionaltricks(above
andbeyondthoseincludedinitsgeneralpurpose),itmaydoso.Trainingananimalforapurposerequiresfewerchecks
thanteachingindividualtricksdoes,butnolesstime.
CombatRiding(DC20):Ananimaltrainedtobearariderintocombatknowsthetricksattack,come,defend,down,guard,
andheel.Trainingananimalforcombatridingtakessixweeks.Youmayalsoupgradeananimaltrainedforridingtoone
trainedforcombatridingbyspendingthreeweeksandmakingasuccessfulDC20HandleAnimalcheck.Thenewgeneral
purposeandtrickscompletelyreplacetheanimalspreviouspurposeandanytricksitonceknew.Warhorsesandridingdogs
arealreadytrainedtobearridersintocombat,andtheydontrequireanyadditionaltrainingforthispurpose.
Fighting(DC20):Ananimaltrainedtoengageincombatknowsthetricksattack,down,andstay.Trainingananimalfor
fightingtakesthreeweeks.
Guarding(DC20):Ananimaltrainedtoguardknowsthetricksattack,defend,down,andguard.Trainingananimalfor
guardingtakesfourweeks.
HeavyLabor(DC15):Ananimaltrainedforheavylaborknowsthetrickscomeandwork.Trainingananimalforheavy
labortakestwoweeks.
Hunting(DC20):Ananimaltrainedforhuntingknowsthetricksattack,down,fetch,heel,seek,andtrack.Trainingan
animalforhuntingtakessixweeks.
Performance(DC15):Ananimaltrainedforperformanceknowsthetrickscome,fetch,heel,perform,andstay.Trainingan
animalforperformancetakesfiveweeks.
Riding(DC15):Ananimaltrainedtobearariderknowsthetrickscome,heel,andstay.Trainingananimalforridingtakes
threeweeks.

Page69of462
RearaWildAnimal
Torearananimalmeanstoraiseawildcreaturefrominfancysothatitbecomesdomesticated.Ahandlercanrearasmany
asthreecreaturesofthesamekindatonce.
Asuccessfullydomesticatedanimalcanbetaughttricksatthesametimeitsbeingraised,oritcanbetaughtasa
domesticatedanimallater.

Action
Varies.Handlingananimalisamoveaction,whilepushingananimalisafullroundaction.(Adruidorrangercanhandle
heranimalcompanionasafreeactionorpushitasamoveaction.)Fortaskswithspecifictimeframesnotedabove,you
mustspendhalfthistime(attherateof3hoursperdayperanimalbeinghandled)workingtowardcompletionofthetask
beforeyouattempttheHandleAnimalcheck.Ifthecheckfails,yourattempttoteach,rear,ortraintheanimalfailsandyou
neednotcompletetheteaching,rearing,ortrainingtime.Ifthechecksucceeds,youmustinvesttheremainderofthetime
tocompletetheteaching,rearing,ortraining.Ifthetimeisinterruptedorthetaskisnotfollowedthroughtocompletion,
theattempttoteach,rear,ortraintheanimalautomaticallyfails.

TryAgain
Yes,exceptforrearingananimal.

Special
YoucanusethisskillonacreaturewithanIntelligencescoreof1or2thatisnotananimal,buttheDCofanysuchcheck
increasesby5.Suchcreatureshavethesamelimitontricksknownasanimalsdo.
Adruidorrangergainsa+4circumstancebonusonHandleAnimalchecksinvolvingheranimalcompanion.
Inaddition,adruidsorrangersanimalcompanionknowsoneormorebonustricks,whichdontcountagainstthenormal
limitontricksknownanddontrequireanytrainingtimeorHandleAnimalcheckstoteach.
IfyouhavetheAnimalAffinityfeat,yougeta+2bonusonHandleAnimalchecks.

Synergy
Ifyouhave5ormoreranksinHandleAnimal,yougeta+2bonusonRidechecksandwildempathychecks.

Untrained
IfyouhavenoranksinHandleAnimal,youcanuseaCharismachecktohandleandpushdomesticanimals,butyoucant
teach,rear,ortrainanimals.AdruidorrangerwithnoranksinHandleAnimalcanuseaCharismachecktohandleand
pushheranimalcompanion,butshecantteach,rear,ortrainothernondomesticanimals.

Heal(Wis)
Check
TheDCandeffectdependonthetaskyouattempt.
Table:HealDCs
TASKHEAL DC
Firstaid 15
Longtermcare 15
Treatwoundfromcaltrop,spikegrowth,orspikestones 15
Treatpoison PoisonssaveDC
Treatdisease DiseasessaveDC

FirstAid
Youusuallyusefirstaidtosaveadyingcharacter.Ifacharacterhasnegativehitpointsandislosinghitpoints(attherate
of1perround,1perhour,or1perday),youcanmakehimorherstable.Astablecharacterregainsnohitpointsbutstops
losingthem.

LongTermCare
Providinglongtermcaremeanstreatingawoundedpersonforadayormore.IfyourHealcheckissuccessful,thepatient
recovershitpointsorabilityscorepoints(losttoabilitydamage)attwicethenormalrate:2hitpointsperlevelforafull8
hoursofrestinaday,or4hitpointsperlevelforeachfulldayofcompleterest;2abilityscorepointsforafull8hoursof
restinaday,or4abilityscorepointsforeachfulldayofcompleterest.
Youcantendasmanyassixpatientsatatime.Youneedafewitemsandsupplies(bandages,salves,andsoon)thatare

Page70of462
easytocomebyinsettledlands.Givinglongtermcarecountsaslightactivityforthehealer.Youcannotgivelongtermcare
toyourself.

TreatWoundfromCaltrop,SpikeGrowth,orSpikeStones
Acreaturewoundedbysteppingonacaltropmovesatonehalfnormalspeed.AsuccessfulHealcheckremovesthis
movementpenalty.
AcreaturewoundedbyaspikegrowthorspikestonesspellmustsucceedonaReflexsaveortakeinjuriesthatreducehis
speedbyonethird.Anothercharactercanremovethispenaltybytaking10minutestodressthevictimsinjuriesand
succeedingonaHealcheckagainstthespellssaveDC.

TreatPoison
Totreatpoisonmeanstotendasinglecharacterwhohasbeenpoisonedandwhoisgoingtotakemoredamagefromthe
poison(orsuffersomeothereffect).Everytimethepoisonedcharactermakesasavingthrowagainstthepoison,youmake
aHealcheck.Thepoisonedcharacterusesyourcheckresultorhisorhersavingthrow,whicheverishigher.

TreatDisease
Totreatadiseasemeanstotendasinglediseasedcharacter.Everytimeheorshemakesasavingthrowagainstdisease
effects,youmakeaHealcheck.Thediseasedcharacterusesyourcheckresultorhisorhersavingthrow,whicheveris
higher.

Action
Providingfirstaid,treatingawound,ortreatingpoisonisastandardaction.Treatingadiseaseortendingacreature
woundedbyaspikegrowthorspikestonesspelltakes10minutesofwork.Providinglongtermcarerequires8hoursof
lightactivity.

TryAgain
Varies.Generallyspeaking,youcanttryaHealcheckagainwithoutproofoftheoriginalchecksfailure.Youcanalways
retryachecktoprovidefirstaid,assumingthetargetofthepreviousattemptisstillalive.

Special
AcharacterwiththeSelfSufficientfeatgetsa+2bonusonHealchecks.
Ahealerskitgivesyoua+2circumstancebonusonHealchecks.

Hide(Dex;ArmorCheckPenalty)
Check
YourHidecheckisopposedbytheSpotcheckofanyonewhomightseeyou.Youcanmoveuptoonehalfyournormal
speedandhideatnopenalty.Whenmovingataspeedgreaterthanonehalfbutlessthanyournormalspeed,youtakea5
penalty.Itspracticallyimpossible(20penalty)tohidewhileattacking,runningorcharging.
AcreaturelargerorsmallerthanMediumtakesasizebonusorpenaltyonHidechecksdependingonitssizecategory:Fine
+16,Diminutive+12,Tiny+8,Small+4,Large4,Huge8,Gargantuan12,Colossal16.
YouneedcoverorconcealmentinordertoattemptaHidecheck.Totalcoverortotalconcealmentusually(butnotalways;
seeSpecial,below)obviatestheneedforaHidecheck,sincenothingcanseeyouanyway.
Ifpeopleareobservingyou,evencasually,youcanthide.Youcanrunaroundacornerorbehindcoversothatyoureoutof
sightandthenhide,buttheothersthenknowatleastwhereyouwent.
Ifyourobserversaremomentarilydistracted(suchasbyaBluffcheck;seebelow),though,youcanattempttohide.While
theothersturntheirattentionfromyou,youcanattemptaHidecheckifyoucangettoahidingplaceofsomekind.(Asa
generalguideline,thehidingplacehastobewithin1footperrankyouhaveinHide.)Thischeck,however,ismadeata
10penaltybecauseyouhavetomovefast.

Sniping
Ifyouvealreadysuccessfullyhiddenatleast10feetfromyourtarget,youcanmakeonerangedattack,thenimmediately
hideagain.Youtakea20penaltyonyourHidechecktoconcealyourselfaftertheshot.

CreatingaDiversiontoHide
YoucanuseBlufftohelpyouhide.AsuccessfulBluffcheckcangiveyouthemomentarydiversionyouneedtoattempta
Hidecheckwhilepeopleareawareofyou.

Page71of462
Action
Usuallynone.Normally,youmakeaHidecheckaspartofmovement,soitdoesnttakeaseparateaction.However,hiding
immediatelyafterarangedattack(seeSniping,above)isamoveaction.

Special
Ifyouareinvisible,yougaina+40bonusonHidechecksifyouareimmobile,ora+20bonusonHidechecksifyoure
moving.
IfyouhavetheStealthyfeat,yougeta+2bonusonHidechecks.

Intimidate(Cha)
Check
Youcanchangeanothersbehaviorwithasuccessfulcheck.YourIntimidatecheckisopposedbythetargetsmodifiedlevel
check(1d20+characterlevelorHitDice+targetsWisdombonus[ifany]+targetsmodifiersonsavesagainstfear).If
youbeatyourtargetscheckresult,youmaytreatthetargetasfriendly,butonlyforthepurposeofactionstakenwhileit
remainsintimidated.(Thatis,thetargetretainsitsnormalattitude,butwillchat,advise,offerlimitedhelp,oradvocateon
yourbehalfwhileintimidated.SeetheDiplomacyskill,above,foradditionaldetails.)Theeffectlastsaslongasthetarget
remainsinyourpresence,andfor1d610minutesafterward.Afterthistime,thetargetsdefaultattitudetowardyoushifts
tounfriendly(or,ifnormallyunfriendly,tohostile).
Ifyoufailthecheckby5ormore,thetargetprovidesyouwithincorrectoruselessinformation,orotherwisefrustrates
yourefforts.

DemoralizeOpponent
YoucanalsouseIntimidatetoweakenanopponentsresolveincombat.Todoso,makeanIntimidatecheckopposedbythe
targetsmodifiedlevelcheck(seeabove).Ifyouwin,thetargetbecomesshakenfor1round.Ashakencharactertakesa2
penaltyonattackrolls,abilitychecks,andsavingthrows.Youcanintimidateonlyanopponentthatyouthreateninmelee
combatandthatcanseeyou.

Action
Varies.Changinganothersbehaviorrequires1minuteofinteraction.Intimidatinganopponentincombatisastandard
action.

TryAgain
Optional,butnotrecommendedbecauseretriesusuallydonotwork.Eveniftheinitialchecksucceeds,theothercharacter
canbeintimidatedonlysofar,andaretrydoesnthelp.Iftheinitialcheckfails,theothercharacterhasprobablybecome
morefirmlyresolvedtoresisttheintimidator,andaretryisfutile.

Special
Yougaina+4bonusonyourIntimidatecheckforeverysizecategorythatyouarelargerthanyourtarget.Conversely,you
takea4penaltyonyourIntimidatecheckforeverysizecategorythatyouaresmallerthanyourtarget.
Acharacterimmunetofearcantbeintimidated,norcannonintelligentcreatures.
IfyouhavethePersuasivefeat,yougeta+2bonusonIntimidatechecks.

Synergy
Ifyouhave5ormoreranksinBluff,yougeta+2bonusonIntimidatechecks.

Jump(Str;ArmorCheckPenalty)
Check
TheDCandthedistanceyoucancovervaryaccordingtothetypeofjumpyouareattempting(seebelow).
YourJumpcheckismodifiedbyyourspeed.Ifyourspeedis30feetthennomodifierbasedonspeedappliestothecheck.If
yourspeedislessthan30feet,youtakea6penaltyforevery10feetofspeedlessthan30feet.Ifyourspeedisgreater
than30feet,yougaina+4bonusforevery10feetbeyond30feet.
AllJumpDCsgivenhereassumethatyougetarunningstart,whichrequiresthatyoumoveatleast20feetinastraightline
beforeattemptingthejump.Ifyoudonotgetarunningstart,theDCforthejumpisdoubled.
Distancemovedbyjumpingiscountedagainstyournormalmaximummovementinaround.

Page72of462
IfyouhaveranksinJumpandyousucceedonaJumpcheck,youlandonyourfeet(whenappropriate).Ifyouattempta
Jumpcheckuntrained,youlandproneunlessyoubeattheDCby5ormore.

LongJump
Alongjumpisahorizontaljump,madeacrossagaplikeachasmorstream.Atthemidpointofthejump,youattaina
verticalheightequaltoonequarterofthehorizontaldistance.TheDCforthejumpisequaltothedistancejumped(in
feet).
Ifyourchecksucceeds,youlandonyourfeetatthefarend.Ifyoufailthecheckbylessthan5,youdontclearthedistance,
butyoucanmakeaDC15Reflexsavetograbthefaredgeofthegap.Youendyourmovementgraspingthefaredge.If
thatleavesyoudanglingoverachasmorgap,gettinguprequiresamoveactionandaDC15Climbcheck.
Table:LongJumpDCs
LONGJUMPDISTANCE JUMPDC1
5feet 5
10feet 10
15feet 15
20feet 20
25feet 25
30feet 30
1
Requiresa20footrunningstart.Withoutarunningstart,doubletheDC.

HighJump
Ahighjumpisaverticalleapmadetoreachaledgehighaboveortograspsomethingoverhead.TheDCisequalto4times
thedistancetobecleared.
Ifyoujumpeduptograbsomething,asuccessfulcheckindicatesthatyoureachedthedesiredheight.Ifyouwishtopull
yourselfup,youcandosowithamoveactionandaDC15Climbcheck.IfyoufailtheJumpcheck,youdonotreachthe
height,andyoulandonyourfeetinthesamespotfromwhichyoujumped.Aswithalongjump,theDCisdoubledifyou
donotgetarunningstartofatleast20feet.
Table:HighJumpDCs
HIGHJUMPDISTANCE1 JUMPDC2
1foot 4
2feet 8
3feet 12
4feet 16
5feet 20
6feet 24
7feet 28
8feet 32
1
Notincludingverticalreach;seebelow.
2
Requiresa20footrunningstart.Withoutarunningstart,doubletheDC.
Obviously,thedifficultyofreachingagivenheightvariesaccordingtothesizeofthecharacterorcreature.Themaximum
verticalreach(heightthecreaturecanreachwithoutjumping)foranaveragecreatureofagivensizeisshownonthetable
below.(AsaMediumcreature,atypicalhumancanreach8feetwithoutjumping.)
Table:VerticalReach
CREATURESIZE VERTICALREACH
Colossal 128ft.
Gargantuan 64ft.
Huge 32ft.
Large 16ft.
Medium 8ft.
Small 4ft.
Tiny 2ft.
Diminutive 1ft.
Fine 1/2ft.

HopUp
Youcanjumpupontoanobjectastallasyourwaist,suchasatableorsmallboulder,withaDC10Jumpcheck.Doingso
countsas10feetofmovement,soifyourspeedis30feet,youcouldmove20feet,thenhopupontoacounter.Youdonot
needtogetarunningstarttohopup,sotheDCisnotdoubledifyoudonotgetarunningstart.

Page73of462
JumpingDown
Ifyouintentionallyjumpfromaheight,youtakelessdamagethanyouwouldifyoujustfell.TheDCtojumpdownfroma
heightis15.Youdonothavetogetarunningstarttojumpdown,sotheDCisnotdoubledifyoudonotgetarunning
start.
Ifyousucceedonthecheck,youtakefallingdamageasifyouhaddropped10fewerfeetthanyouactuallydid.

Action
None.AJumpcheckisincludedinyourmovement,soitispartofamoveaction.Ifyourunoutofmovementmidjump,
yournextaction(eitheronthisturnor,ifnecessary,onyournextturn)mustbeamoveactiontocompletethejump.

Special
Effectsthatincreaseyourmovementalsoincreaseyourjumpingdistance,sinceyourcheckismodifiedbyyourspeed.
Ahalflinghasa+2racialbonusonJumpchecksbecausehalflingsareagileandathletic.
IfyouhavetheRunfeat,yougeta+4bonusonJumpchecksforanyjumpsmadeafterarunningstart.
IfyouhavetheAcrobaticfeat,yougeta+2bonusonJumpchecks.

Synergy
Ifyouhave5ormoreranksinTumble,yougeta+2bonusonJumpchecks.
Ifyouhave5ormoreranksinJump,yougeta+2bonusonTumblechecks.

Knowledge(Int;TrainedOnly)
LiketheCraftandProfessionskills,Knowledgeactuallyencompassesanumberofunrelatedskills.Knowledgerepresentsa
studyofsomebodyoflore,possiblyanacademicorevenscientificdiscipline.
Belowarelistedtypicalfieldsofstudy.
Arcana(ancientmysteries,magictraditions,arcanesymbols,crypticphrases,constructs,dragons,magicalbeasts)
Architectureandengineering(buildings,aqueducts,bridges,fortifications)
Dungeoneering(aberrations,caverns,oozes,spelunking)
Geography(lands,terrain,climate,people)
History(royalty,wars,colonies,migrations,foundingofcities)
Local(legends,personalities,inhabitants,laws,customs,traditions,humanoids)
Nature(animals,fey,giants,monstroushumanoids,plants,seasonsandcycles,weather,vermin)
Nobilityandroyalty(lineages,heraldry,familytrees,mottoes,personalities)
Religion(godsandgoddesses,mythichistory,ecclesiastictradition,holysymbols,undead)
Theplanes(theInnerPlanes,theOuterPlanes,theAstralPlane,theEtherealPlane,outsiders,elementals,magicrelated
totheplanes)

Check
AnsweringaquestionwithinyourfieldofstudyhasaDCof10(forreallyeasyquestions),15(forbasicquestions),or20to
30(forreallytoughquestions).
Inmanycases,youcanusethisskilltoidentifymonstersandtheirspecialpowersorvulnerabilities.Ingeneral,theDCof
suchacheckequals10+themonstersHD.Asuccessfulcheckallowsyoutorememberabitofusefulinformationabout
thatmonster.
Forevery5pointsbywhichyourcheckresultexceedstheDC,yourecallanotherpieceofusefulinformation.

Action
Usuallynone.Inmostcases,makingaKnowledgecheckdoesnttakeanactionyousimplyknowtheansweroryoudont.

TryAgain
No.Thecheckrepresentswhatyouknow,andthinkingaboutatopicasecondtimedoesntletyouknowsomethingthat
youneverlearnedinthefirstplace.
Page74of462
Synergy
Ifyouhave5ormoreranksinKnowledge(arcana),yougeta+2bonusonSpellcraftchecks.
Ifyouhave5ormoreranksinKnowledge(architectureandengineering),yougeta+2bonusonSearchchecksmadeto
findsecretdoorsorhiddencompartments.
Ifyouhave5ormoreranksinKnowledge(geography),yougeta+2bonusonSurvivalchecksmadetokeepfromgetting
lostortoavoidnaturalhazards.
Ifyouhave5ormoreranksinKnowledge(history),yougeta+2bonusonbardicknowledgechecks.
Ifyouhave5ormoreranksinKnowledge(local),yougeta+2bonusonGatherInformationchecks.
Ifyouhave5ormoreranksinKnowledge(nature),yougeta+2bonusonSurvivalchecksmadeinabovegroundnatural
environments(aquatic,desert,forest,hill,marsh,mountains,orplains).
Ifyouhave5ormoreranksinKnowledge(nobilityandroyalty),yougeta+2bonusonDiplomacychecks.
Ifyouhave5ormoreranksinKnowledge(religion),yougeta+2bonusonturningchecksagainstundead.
Ifyouhave5ormoreranksinKnowledge(theplanes),yougeta+2bonusonSurvivalchecksmadewhileonotherplanes.
Ifyouhave5ormoreranksinKnowledge(dungeoneering),yougeta+2bonusonSurvivalchecksmadewhile
underground.
Ifyouhave5ormoreranksinSurvival,yougeta+2bonusonKnowledge(nature)checks.

Untrained
AnuntrainedKnowledgecheckissimplyanIntelligencecheck.Withoutactualtraining,youknowonlycommonknowledge
(DC10orlower).

Listen(Wis)
Check
YourListencheckiseithermadeagainstaDCthatreflectshowquietthenoiseisthatyoumighthear,oritisopposedby
yourtargetsMoveSilentlycheck.
Table:ListenDCs
SOUND LISTENDC
Abattle 10
Peopletalking1 0
Apersoninmediumarmorwalkingataslowpace(10ft./round)tryingnottomakeanynoise. 5
Anunarmoredpersonwalkingataslowpace(15ft./round)tryingnottomakeanynoise 10
A1stlevelrogueusingMoveSilentlytosneakpastthelistener 15
Peoplewhispering1 15
Acatstalking 19
Anowlglidinginforakill 30
1
IfyoubeattheDCby10ormore,youcanmakeoutwhatsbeingsaid,assumingthatyouunderstandthelanguage.
Table:ListenDCModifiers
CONDITION LISTENDCMODIFIER
Throughadoor +5
Throughastonewall +15
Per10feetofdistance 1
Listenerdistracted 5
Inthecaseofpeopletryingtobequiet,theDCsgivenonthetablecouldbereplacedbyMoveSilentlychecks,inwhichcase
theindicatedDCwouldbetheiraveragecheckresult.

Action
Varies.Everytimeyouhaveachancetohearsomethinginareactivemanner(suchaswhensomeonemakesanoiseoryou
moveintoanewarea),youcanmakeaListencheckwithoutusinganaction.Tryingtohearsomethingyoufailedtohear
previouslyisamoveaction.

TryAgain
Yes.Youcantrytohearsomethingthatyoufailedtohearpreviouslywithnopenalty.

Page75of462
Special
Whenseveralcharactersarelisteningtothesamething,asingle1d20rollcanbeusedforalltheindividualsListenchecks.
Afascinatedcreaturetakesa4penaltyonListenchecksmadeasreactions.
IfyouhavetheAlertnessfeat,yougeta+2bonusonListenchecks.
AsleepingcharactermaymakeListenchecksata10penalty.Asuccessfulcheckawakensthesleeper.

MoveSilently(Dex;ArmorCheckPenalty)
Check
YourMoveSilentlycheckisopposedbytheListencheckofanyonewhomighthearyou.Youcanmoveuptoonehalfyour
normalspeedatnopenalty.Whenmovingataspeedgreaterthanonehalfbutlessthanyourfullspeed,youtakea5
penalty.Itspracticallyimpossible(20penalty)tomovesilentlywhilerunningorcharging.
Noisysurfaces,suchasbogsorundergrowth,aretoughtomovesilentlyacross.Whenyoutrytosneakacrosssucha
surface,youtakeapenaltyonyourMoveSilentlycheckasindicatedbelow.
Table:MoveSilentlyDCModifiers
SURFACE CHECKMODIFIER
Noisy(scree,shallowordeepbog,undergrowth,denserubble) 2
Verynoisy(denseundergrowth,deepsnow) 5

Action
None.AMoveSilentlycheckisincludedinyourmovementorotheractivity,soitispartofanotheraction.

Special
IfyouhavetheStealthyfeat,yougeta+2bonusonMoveSilentlychecks.

OpenLock(Dex;TrainedOnly)
AttemptinganOpenLockcheckwithoutasetofthievestoolsimposesa2circumstancepenaltyonthecheck,evenifa
simpletoolisemployed.Ifyouusemasterworkthievestools,yougaina+2circumstancebonusonthecheck.

Check
TheDCforopeningalockvariesfrom20to40,dependingonthequalityofthelock,asgivenonthetablebelow.
Table:OpenLockDCs
LOCK DC
Verysimplelock 20
Averagelock 25
Goodlock 30
Amazinglock 40

Action
Openingalockisafullroundaction.

Special
IfyouhavetheNimbleFingersfeat,yougeta+2bonusonOpenLockchecks.

Untrained
Youcannotpicklocksuntrained,butyoumightsuccessfullyforcethemopen.

Perform(Cha)
LikeCraft,Knowledge,andProfession,Performisactuallyanumberofseparateskills.
YoucouldhaveseveralPerformskills,eachwithitsownranks,eachpurchasedasaseparateskill.
EachoftheninecategoriesofthePerformskillincludesavarietyofmethods,instruments,ortechniques,asmalllistof
whichisprovidedforeachcategorybelow.
Act(comedy,drama,mime)
Comedy(buffoonery,limericks,joketelling)

Page76of462
Dance(ballet,waltz,jig)
Keyboardinstruments(harpsichord,piano,pipeorgan)
Oratory(epic,ode,storytelling)
Percussioninstruments(bells,chimes,drums,gong)
Stringinstruments(fiddle,harp,lute,mandolin)
Windinstruments(flute,panpipes,recorder,shawm,trumpet)
Sing(ballad,chant,melody)

Check
Youcanimpressaudienceswithyourtalentandskill.
PERFORMDC PERFORMANCE
10 Routineperformance.Tryingtoearnmoneybyplayinginpublicisessentiallybegging.Youcanearn1d10cp/day.
15 Enjoyableperformance.Inaprosperouscity,youcanearn1d10sp/day.
20 Greatperformance.Inaprosperouscity,youcanearn3d10sp/day.Intime,youmaybeinvitedtojoinaprofessional
troupeandmaydeveloparegionalreputation.
25 Memorableperformance.Inaprosperouscity,youcanearn1d6gp/day.Intime,youmaycometotheattentionofnoble
patronsanddevelopanationalreputation.
30 Extraordinaryperformance.Inaprosperouscity,youcanearn3d6gp/day.Intime,youmaydrawattentionfromdistant
potentialpatrons,orevenfromextraplanarbeings.
Amasterworkmusicalinstrumentgivesyoua+2circumstancebonusonPerformchecksthatinvolveitsuse.

Action
Varies.Tryingtoearnmoneybyplayinginpublicrequiresanywherefromaneveningsworktoafulldaysperformance.
ThebardsspecialPerformbasedabilitiesaredescribedinthatclasssdescription.

TryAgain
Yes.Retriesareallowed,buttheydontnegatepreviousfailures,andanaudiencethathasbeenunimpressedinthepastis
likelytobeprejudicedagainstfutureperformances.(IncreasetheDCby2foreachpreviousfailure.)

Special
Abardmusthaveatleast3ranksinaPerformskilltoinspirecourageinhisallies,ortousehiscountersongorhisfascinate
ability.Abardneeds6ranksinaPerformskilltoinspirecompetence,9rankstousehissuggestionability,12ranksto
inspiregreatness,15rankstousehissongoffreedomability,18rankstoinspireheroics,and21rankstousehismass
suggestionability.SeeBardicMusicinthebardclassdescription.
InadditiontousingthePerformskill,youcanentertainpeoplewithsleightofhand,tumbling,tightropewalking,andspells
(especiallyillusions).

Profession(Wis;TrainedOnly)
LikeCraft,Knowledge,andPerform,Professionisactuallyanumberofseparateskills.YoucouldhaveseveralProfession
skills,eachwithitsownranks,eachpurchasedasaseparateskill.WhileaCraftskillrepresentsabilityincreatingormaking
anitem,aProfessionskillrepresentsanaptitudeinavocationrequiringabroaderrangeoflessspecificknowledge.

Check
Youcanpracticeyourtradeandmakeadecentliving,earningabouthalfyourProfessioncheckresultingoldpiecesper
weekofdedicatedwork.Youknowhowtousethetoolsofyourtrade,howtoperformtheprofessionsdailytasks,howto
supervisehelpers,andhowtohandlecommonproblems.

Action
Notapplicable.Asinglecheckgenerallyrepresentsaweekofwork.

TryAgain
Varies.AnattempttouseaProfessionskilltoearnanincomecannotberetried.Youarestuckwithwhateverweeklywage
yourcheckresultbroughtyou.Anothercheckmaybemadeafteraweektodetermineanewincomeforthenextperiodof
time.Anattempttoaccomplishsomespecifictaskcanusuallyberetried.

Page77of462
Untrained
Untrainedlaborersandassistants(thatis,characterswithoutanyranksinProfession)earnanaverageof1silverpieceper
day.

Ride(Dex)
Ifyouattempttorideacreaturethatisillsuitedasamount,youtakea5penaltyonyourRidechecks.

Check
Typicalridingactionsdontrequirechecks.Youcansaddle,mount,ride,anddismountfromamountwithoutaproblem.
Thefollowingtasksdorequirechecks.
Table:RideDCs
TASK RIDEDC
Guidewithknees 5
Stayinsaddle 5
Fightwithwarhorse 10
Cover 15
Softfall 15
Leap 15
Spurmount 15
Controlmountinbattle 20
Fastmountordismount 201
1
Armorcheckpenaltyapplies.

GuidewithKnees
Youcanreactinstantlytoguideyourmountwithyourkneessothatyoucanusebothhandsincombat.MakeyourRide
checkatthestartofyourturn.Ifyoufail,youcanuseonlyonehandthisroundbecauseyouneedtousetheotherto
controlyourmount.

StayinSaddle
Youcanreactinstantlytotrytoavoidfallingwhenyourmountrearsorboltsunexpectedlyorwhenyoutakedamage.This
usagedoesnottakeanaction.

FightwithWarhorse
Ifyoudirectyourwartrainedmounttoattackinbattle,youcanstillmakeyourownattackorattacksnormally.Thisusage
isafreeaction.

Cover
Youcanreactinstantlytodropdownandhangalongsideyourmount,usingitascover.Youcantattackorcastspellswhile
usingyourmountascover.IfyoufailyourRidecheck,youdontgetthecoverbenefit.Thisusagedoesnottakeanaction.

SoftFall
Youcanreactinstantlytotrytotakenodamagewhenyoufalloffamountwhenitiskilledorwhenitfalls,forexample.
IfyoufailyourRidecheck,youtake1d6pointsoffallingdamage.Thisusagedoesnottakeanaction.

Leap
Youcangetyourmounttoleapobstaclesaspartofitsmovement.UseyourRidemodifierorthemountsJumpmodifier,
whicheverislower,toseehowfarthecreaturecanjump.IfyoufailyourRidecheck,youfalloffthemountwhenitleaps
andtaketheappropriatefallingdamage(atleast1d6points).Thisusagedoesnottakeanaction,butispartofthemounts
movement.

SpurMount
Youcanspuryourmounttogreaterspeedwithamoveaction.AsuccessfulRidecheckincreasesthemountsspeedby10
feetfor1roundbutdeals1pointofdamagetothecreature.Youcanusethisabilityeveryround,buteachconsecutive
roundofadditionalspeeddealstwiceasmuchdamagetothemountasthepreviousround(2points,4points,8points,and
soon).

ControlMountinBattle
Asamoveaction,youcanattempttocontrolalighthorse,pony,heavyhorse,orothermountnottrainedforcombatriding
whileinbattle.IfyoufailtheRidecheck,youcandonothingelseinthatround.Youdonotneedtorollforwarhorsesor
warponies.
Page78of462
FastMountorDismount
Youcanattempttomountordismountfromamountofuptoonesizecategorylargerthanyourselfasafreeaction,
providedthatyoustillhaveamoveactionavailablethatround.IfyoufailtheRidecheck,mountingordismountingisa
moveaction.Youcantusefastmountordismountonamountmorethanonesizecategorylargerthanyourself.

Action
Varies.Mountingordismountingnormallyisamoveaction.Otherchecksareamoveaction,afreeaction,ornoactionat
all,asnotedabove.

Special
Ifyouareridingbareback,youtakea5penaltyonRidechecks.
Ifyourmounthasamilitarysaddleyougeta+2circumstancebonusonRidechecksrelatedtostayinginthesaddle.
TheRideskillisaprerequisiteforthefeatsMountedArchery,MountedCombat,RideByAttack,SpiritedCharge,Trample.
IfyouhavetheAnimalAffinityfeat,yougeta+2bonusonRidechecks.

Synergy
Ifyouhave5ormoreranksinHandleAnimal,yougeta+2bonusonRidechecks.

Search(Int)
Check
Yougenerallymustbewithin10feetoftheobjectorsurfacetobesearched.ThetablebelowgivesDCsfortypicaltasks
involvingtheSearchskill.
Table:SearchDCs
TASK SEARCHDC
Ransackachestfullofjunktofindacertainitem 10
Noticeatypicalsecretdoororasimpletrap 20
Findadifficultnonmagicaltrap(rogueonly)1 21orhigher
Findamagictrap(rogueonly)1 25+levelofspellusedtocreatetrap
Noticeawellhiddensecretdoor 30
Findafootprint Varies2
1
Dwarves(eveniftheyarenotrogues)canuseSearchtofindtrapsbuiltintooroutofstone.
2
AsuccessfulSearchcheckcanfindafootprintorsimilarsignofacreaturespassage,butitwontletyoufindorfollowatrail.Seethe
TrackfeatfortheappropriateDC.

Action
Ittakesafullroundactiontosearcha5footby5footareaoravolumeofgoods5feetonaside.

Special
Anelfhasa+2racialbonusonSearchchecks,andahalfelfhasa+1racialbonus.Anelf(butnotahalfelf)whosimply
passeswithin5feetofasecretorconcealeddoorcanmakeaSearchchecktofindthatdoor.
IfyouhavetheInvestigatorfeat,yougeta+2bonusonSearchchecks.
Thespellsexplosiverunes,firetrap,glyphofwarding,symbol,andteleportationcirclecreatemagictrapsthataroguecan
findbymakingasuccessfulSearchcheckandthencanattempttodisarmbyusingDisableDevice.Identifyingthelocation
ofasnarespellhasaDCof23.SpikegrowthandspikestonescreatemagictrapsthatcanbefoundusingSearch,but
againstwhichDisableDevicechecksdonotsucceed.Seetheindividualspelldescriptionsfordetails.
Activeabjurationspellswithin10feetofeachotherfor24hoursormorecreatebarelyvisibleenergyfluctuations.These
fluctuationsgiveyoua+4bonusonSearchcheckstolocatesuchabjurationspells.

Synergy
Ifyouhave5ormoreranksinSearch,yougeta+2bonusonSurvivalcheckstofindorfollowtracks.

Restriction
WhileanyonecanuseSearchtofindatrapwhoseDCis20orlower,onlyaroguecanuseSearchtolocatetrapswithhigher
DCs.(Exception:ThespellfindtrapstemporarilyenablesaclerictousetheSearchskillasifhewerearogue.)
Adwarf,evenonewhoisnotarogue,canusetheSearchskilltofindadifficulttrap(onewithaDChigherthan20)ifthe

Page79of462
trapisbuiltintooroutofstone.Hegainsa+2racialbonusontheSearchcheckfromhisstonecunningability.

SenseMotive(Wis)
Check
Asuccessfulcheckletsyouavoidbeingbluffed(seetheBluffskill).Youcanalsousethisskilltodeterminewhen
somethingisup(thatis,somethingoddisgoingon)ortoassesssomeonestrustworthiness.
Table:SenseMotiveDCs
TASK SENSEMOTIVEDC
Hunch 20
Senseenchantment 25or15
Discernsecretmessage Varies

Hunch
Thisuseoftheskillinvolvesmakingagutassessmentofthesocialsituation.Youcangetthefeelingfromanothersbehavior
thatsomethingiswrong,suchaswhenyouretalkingtoanimpostor.Alternatively,youcangetthefeelingthatsomeoneis
trustworthy.

SenseEnchantment
Youcantellthatsomeonesbehaviorisbeinginfluencedbyanenchantmenteffect(bydefinition,amindaffectingeffect),
evenifthatpersonisntawareofit.TheusualDCis25,butifthetargetisdominated(seedominateperson),theDCisonly
15becauseofthelimitedrangeofthetargetsactivities.

DiscernSecretMessage
YoumayuseSenseMotivetodetectthatahiddenmessageisbeingtransmittedviatheBluffskill.Inthiscase,yourSense
MotivecheckisopposedbytheBluffcheckofthecharactertransmittingthemessage.Foreachpieceofinformationrelating
tothemessagethatyouaremissing,youtakea2penaltyonyourSenseMotivecheck.Ifyousucceedby4orless,you
knowthatsomethinghiddenisbeingcommunicated,butyoucantlearnanythingspecificaboutitscontent.Ifyoubeatthe
DCby5ormore,youinterceptandunderstandthemessage.Ifyoufailby4orless,youdontdetectanyhidden
communication.Ifyoufailby5ormore,youinfersomefalseinformation.

Action
TryingtogaininformationwithSenseMotivegenerallytakesatleast1minute,andyoucouldspendawholeeveningtrying
togetasenseofthepeoplearoundyou.

TryAgain
No,thoughyoumaymakeaSenseMotivecheckforeachBluffcheckmadeagainstyou.

Special
ArangergainsabonusonSenseMotivecheckswhenusingthisskillagainstafavoredenemy.
IfyouhavetheNegotiatorfeat,yougeta+2bonusonSenseMotivechecks.

Synergy
Ifyouhave5ormoreranksinSenseMotive,yougeta+2bonusonDiplomacychecks.

SleightOfHand(Dex;TrainedOnly;ArmorCheckPenalty)
Check
ADC10SleightofHandcheckletsyoupalmacoinsized,unattendedobject.Performingaminorfeatoflegerdemain,such
asmakingacoindisappear,alsohasaDCof10unlessanobserverisdeterminedtonotewheretheitemwent.
Whenyouusethisskillundercloseobservation,yourskillcheckisopposedbytheobserversSpotcheck.Theobservers
successdoesntpreventyoufromperformingtheaction,justfromdoingitunnoticed.
Youcanhideasmallobject(includingalightweaponoraneasilyconcealedrangedweapon,suchasadart,sling,orhand
crossbow)onyourbody.YourSleightofHandcheckisopposedbytheSpotcheckofanyoneobservingyouortheSearch
checkofanyonefriskingyou.Inthelattercase,thesearchergainsa+4bonusontheSearchcheck,sinceitsgenerally
easiertofindsuchanobjectthantohideit.Adaggeriseasiertohidethanmostlightweapons,andgrantsyoua+2bonus
onyourSleightofHandchecktoconcealit.Anextraordinarilysmallobject,suchasacoin,shuriken,orring,grantsyoua

Page80of462
+4bonusonyourSleightofHandchecktoconcealit,andheavyorbaggyclothing(suchasacloak)grantsyoua+2bonus
onthecheck.
Drawingahiddenweaponisastandardactionanddoesntprovokeanattackofopportunity.
Ifyoutrytotakesomethingfromanothercreature,youmustmakeaDC20SleightofHandchecktoobtainit.The
opponentmakesaSpotchecktodetecttheattempt,opposedbythesameSleightofHandcheckresultyouachievedwhen
youtriedtograbtheitem.Anopponentwhosucceedsonthischecknoticestheattempt,regardlessofwhetheryougotthe
item.
YoucanalsouseSleightofHandtoentertainanaudienceasthoughyouwereusingthePerformskill.Insuchacase,your
actencompasseselementsoflegerdemain,juggling,andthelike.
Table:SleightofHandDCs
SLEIGHTOFHANDDC TASK
10 Palmacoinsizedobject,makeacoindisappear
20 Liftasmallobjectfromaperson

Action
AnySleightofHandchecknormallyisastandardaction.However,youmayperformaSleightofHandcheckasafree
actionbytakinga20penaltyonthecheck.

TryAgain
Yes,butafteraninitialfailure,asecondSleightofHandattemptagainstthesametarget(orwhileyouarebeingwatched
bythesameobserverwhonoticedyourpreviousattempt)increasestheDCforthetaskby10.

Special
IfyouhavetheDeftHandsfeat,yougeta+2bonusonSleightofHandchecks.

Synergy
Ifyouhave5ormoreranksinBluff,yougeta+2bonusonSleightofHandchecks.

Untrained
AnuntrainedSleightofHandcheckissimplyaDexteritycheck.Withoutactualtraining,youcantsucceedonanySleightof
HandcheckwithaDChigherthan10,exceptforhidinganobjectonyourbody.

SpeakLanguage(None;TrainedOnly)
Table:CommonLanguagesandTheirAlphabets
LANGUAGE TYPICALSPEAKERS ALPHABET
Abyssal Demons,chaoticeviloutsiders Infernal
Aquan Waterbasedcreatures Elven
Auran Airbasedcreatures Draconic
Celestial Goodoutsiders Celestial
Common Humans,halflings,halfelves,halforcs Common
Draconic Kobolds,troglodytes,lizardfolk,dragons Draconic
Druidic Druids(only) Druidic
Dwarven Dwarves Dwarven
Elven Elves Elven
Giant Ogres,giants Dwarven
Gnome Gnomes Dwarven
Goblin Goblins,hobgoblins,bugbears Dwarven
Gnoll Gnolls Common
Halfling Halflings Common
Ignan Firebasedcreatures Draconic
Infernal Devils,lawfuleviloutsiders Infernal
Orc Orcs Dwarven
Sylvan Dryads,brownies,leprechauns Elven
Terran Xornsandotherearthbasedcreatures Dwarven
Undercommon Drow Elven

Action
Notapplicable.

Page81of462
TryAgain
Notapplicable.TherearenoSpeakLanguagecheckstofail.
TheSpeakLanguageskilldoesntworklikeotherskills.Languagesworkasfollows.
Youstartat1stlevelknowingoneortwolanguages(basedonyourrace),plusanadditionalnumberoflanguagesequal
toyourstartingIntelligencebonus.
YoucanpurchaseSpeakLanguagejustlikeanyotherskill,butinsteadofbuyingarankinit,youchooseanewlanguage
thatyoucanspeak.
YoudontmakeSpeakLanguagechecks.Youeitherknowalanguageoryoudont.
Aliteratecharacter(anyonebutabarbarianwhohasnotspentskillpointstobecomeliterate)canreadandwriteany
languagehespeaks.Eachlanguagehasanalphabet,thoughsometimesseveralspokenlanguagesshareasingle
alphabet.

Spellcraft(Int;TrainedOnly)
Usethisskilltoidentifyspellsastheyarecastorspellsalreadyinplace.
Table:SpellcraftDCs
SPELLCRAFTDC TASK
13 Whenusingreadmagic,identifyaglyphofwarding.Noactionrequired.
15+spelllevel Identifyaspellbeingcast.(Youmustseeorhearthespellsverbalorsomaticcomponents.)Noactionrequired.No
retry.
15+spelllevel Learnaspellfromaspellbookorscroll(wizardonly).Noretryforthatspelluntilyougainatleast1rankin
Spellcraft(evenifyoufindanothersourcetotrytolearnthespellfrom).Requires8hours.
15+spelllevel Prepareaspellfromaborrowedspellbook(wizardonly).Onetryperday.Noextratimerequired.
15+spelllevel Whencastingdetectmagic,determinetheschoolofmagicinvolvedintheauraofasingleitemorcreatureyoucan
see.(Iftheauraisnotaspelleffect,theDCis15+onehalfcasterlevel.)Noactionrequired.
19 Whenusingreadmagic,identifyasymbol.Noactionrequired.
20+spelllevel Identifyaspellthatsalreadyinplaceandineffect.Youmustbeabletoseeordetecttheeffectsofthespell.No
actionrequired.Noretry.
20+spelllevel Identifymaterialscreatedorshapedbymagic,suchasnotingthatanironwallistheresultofawallofironspell.
Noactionrequired.Noretry.
20+spelllevel Decipherawrittenspell(suchasascroll)withoutusingreadmagic.Onetryperday.Requiresafullroundaction.
25+spelllevel Afterrollingasavingthrowagainstaspelltargetedonyou,determinewhatthatspellwas.Noactionrequired.No
retry.
25 Identifyapotion.Requires1minute.Noretry.
20 Drawadiagramtoallowdimensionalanchortobecastonamagiccirclespell.Requires10minutes.Noretry.This
checkismadesecretlysoyoudonotknowtheresult.
30orhigher Understandastrangeoruniquemagicaleffect,suchastheeffectsofamagicstream.Timerequiredvaries.Noretry.

Check
Youcanidentifyspellsandmagiceffects.TheDCsforSpellcraftchecksrelatingtovarioustasksaresummarizedonthe
tableabove.

Action
Varies,asnotedabove.

TryAgain
Seeabove.

Special
Ifyouareaspecialistwizard,yougeta+2bonusonSpellcraftcheckswhendealingwithaspelloreffectfromyour
specialtyschool.Youtakea5penaltywhendealingwithaspelloreffectfromaprohibitedschool(andsometasks,suchas
learningaprohibitedspell,arejustimpossible).
IfyouhavetheMagicalAptitudefeat,yougeta+2bonusonSpellcraftchecks.

Synergy
Ifyouhave5ormoreranksinKnowledge(arcana),yougeta+2bonusonSpellcraftchecks.
Ifyouhave5ormoreranksinUseMagicDevice,yougeta+2bonusonSpellcraftcheckstodecipherspellsonscrolls.

Page82of462
Ifyouhave5ormoreranksinSpellcraft,yougeta+2bonusonUseMagicDevicechecksrelatedtoscrolls.
Additionally,certainspellsallowyoutogaininformationaboutmagic,providedthatyoumakeasuccessfulSpellcraftcheck
asdetailedinthespelldescription.

Spot(Wis)
Check
TheSpotskillisusedprimarilytodetectcharactersorcreatureswhoarehiding.Typically,yourSpotcheckisopposedby
theHidecheckofthecreaturetryingnottobeseen.Sometimesacreatureisntintentionallyhidingbutisstilldifficultto
see,soasuccessfulSpotcheckisnecessarytonoticeit.
ASpotcheckresulthigherthan20generallyletsyoubecomeawareofaninvisiblecreaturenearyou,thoughyoucant
actuallyseeit.
Spotisalsousedtodetectsomeoneindisguise(seetheDisguiseskill),andtoreadlipswhenyoucanthearorunderstand
whatsomeoneissaying.
Spotchecksmaybecalledfortodeterminethedistanceatwhichanencounterbegins.Apenaltyappliesonsuchchecks,
dependingonthedistancebetweenthetwoindividualsorgroups,andanadditionalpenaltymayapplyifthecharacter
makingtheSpotcheckisdistracted(notconcentratingonbeingobservant).
Table:SpotModifiers
CONDITION PENALTY
Per10feetofdistance 1
Spotterdistracted 5

ReadLips
Tounderstandwhatsomeoneissayingbyreadinglips,youmustbewithin30feetofthespeaker,beabletoseehimorher
speak,andunderstandthespeakerslanguage.(Thisuseoftheskillislanguagedependent.)ThebaseDCis15,butit
increasesforcomplexspeechoraninarticulatespeaker.Youmustmaintainalineofsighttothelipsbeingread.
IfyourSpotchecksucceeds,youcanunderstandthegeneralcontentofaminutesworthofspeaking,butyouusuallystill
misscertaindetails.Ifthecheckfailsby4orless,youcantreadthespeakerslips.Ifthecheckfailsby5ormore,youdraw
someincorrectconclusionaboutthespeech.Thecheckisrolledsecretlyinthiscase,sothatyoudontknowwhetheryou
succeededormissedby5.

Action
Varies.EverytimeyouhaveachancetospotsomethinginareactivemanneryoucanmakeaSpotcheckwithoutusingan
action.Tryingtospotsomethingyoufailedtoseepreviouslyisamoveaction.Toreadlips,youmustconcentrateforafull
minutebeforemakingaSpotcheck,andyoucantperformanyotheraction(otherthanmovingatuptohalfspeed)during
thisminute.

TryAgain
Yes.Youcantrytospotsomethingthatyoufailedtoseepreviouslyatnopenalty.Youcanattempttoreadlipsonceper
minute.

Special
Afascinatedcreaturetakesa4penaltyonSpotchecksmadeasreactions.
IfyouhavetheAlertnessfeat,yougeta+2bonusonSpotchecks.
ArangergainsabonusonSpotcheckswhenusingthisskillagainstafavoredenemy.
Anelfhasa+2racialbonusonSpotchecks.
Ahalfelfhasa+1racialbonusonSpotchecks.
Themasterofahawkfamiliargainsa+3bonusonSpotchecksindaylightorotherlightedareas.
Themasterofanowlfamiliargainsa+3bonusonSpotchecksinshadowyorotherdarkenedareas.

Survival(Wis)
Check
Youcankeepyourselfandotherssafeandfedinthewild.ThetablebelowgivestheDCsforvarioustasksthatrequire
Page83of462
Survivalchecks.
SurvivaldoesnotallowyoutofollowdifficulttracksunlessyouarearangerorhavetheTrackfeat(seetheRestriction
sectionbelow).
Table:SurvivalDCs
TASK SURVIVALDC
Getalonginthewild.Moveuptoonehalfyouroverlandspeedwhilehuntingandforaging(nofoodorwatersupplies 10
needed).Youcanprovidefoodandwaterforoneotherpersonforevery2pointsbywhichyourcheckresultexceeds10.
Gaina+2bonusonallFortitudesavesagainstsevereweatherwhilemovinguptoonehalfyouroverlandspeed,orgaina 15
+4bonusifyouremainstationary.Youmaygrantthesamebonustooneothercharacterforevery1pointbywhichyour
Survivalcheckresultexceeds15.
Keepfromgettinglostoravoidnaturalhazards,suchasquicksand. 15
Predicttheweatherupto24hoursinadvance.Forevery5pointsbywhichyourSurvivalcheckresultexceeds15,youcan 15
predicttheweatherforoneadditionaldayinadvance.
Followtracks(seetheTrackfeat). Varies

Action
Varies.AsingleSurvivalcheckmayrepresentactivityoverthecourseofhoursorafullday.ASurvivalcheckmadetofind
tracksisatleastafullroundaction,anditmaytakeevenlonger.

TryAgain
Varies.ForgettingalonginthewildorforgainingtheFortitudesavebonusnotedinthetableabove,youmakeaSurvival
checkonceevery24hours.Theresultofthatcheckappliesuntilthenextcheckismade.Toavoidgettinglostoravoid
naturalhazards,youmakeaSurvivalcheckwheneverthesituationcallsforone.Retriestoavoidgettinglostinaspecific
situationortoavoidaspecificnaturalhazardarenotallowed.Forfindingtracks,youcanretryafailedcheckafter1hour
(outdoors)or10minutes(indoors)ofsearching.

Restriction
WhileanyonecanuseSurvivaltofindtracks(regardlessoftheDC),ortofollowtrackswhentheDCforthetaskis10or
lower,onlyaranger(oracharacterwiththeTrackfeat)canuseSurvivaltofollowtrackswhenthetaskhasahigherDC.

Special
Ifyouhave5ormoreranksinSurvival,youcanautomaticallydeterminewheretruenorthliesinrelationtoyourself.
ArangergainsabonusonSurvivalcheckswhenusingthisskilltofindorfollowthetracksofafavoredenemy.
IfyouhavetheSelfSufficientfeat,yougeta+2bonusonSurvivalchecks.

Synergy
Ifyouhave5ormoreranksinSurvival,yougeta+2bonusonKnowledge(nature)checks.
Ifyouhave5ormoreranksinKnowledge(dungeoneering),yougeta+2bonusonSurvivalchecksmadewhile
underground.
Ifyouhave5ormoreranksinKnowledge(nature),yougeta+2bonusonSurvivalchecksinabovegroundnatural
environments(aquatic,desert,forest,hill,marsh,mountains,andplains).
Ifyouhave5ormoreranksinKnowledge(geography),yougeta+2bonusonSurvivalchecksmadetokeepfromgetting
lostortoavoidnaturalhazards.
Ifyouhave5ormoreranksinKnowledge(theplanes),yougeta+2bonusonSurvivalchecksmadewhileonotherplanes.
Ifyouhave5ormoreranksinSearch,yougeta+2bonusonSurvivalcheckstofindorfollowtracks.

Swim(Str;ArmorCheckPenalty)
Check
MakeaSwimcheckonceperroundwhileyouareinthewater.Successmeansyoumayswimatuptoonehalfyourspeed
(asafullroundaction)oratonequarteryourspeed(asamoveaction).Ifyoufailby4orless,youmakenoprogress
throughthewater.Ifyoufailby5ormore,yougounderwater.
Ifyouareunderwater,eitherbecauseyoufailedaSwimcheckorbecauseyouareswimmingunderwaterintentionally,you
mustholdyourbreath.YoucanholdyourbreathforanumberofroundsequaltoyourConstitutionscore,butonlyifyou
donothingotherthantakemoveactionsorfreeactions.Ifyoutakeastandardactionorafullroundaction(suchas

Page84of462
makinganattack),theremainderofthedurationforwhichyoucanholdyourbreathisreducedby1round.(Effectively,a
characterincombatcanholdhisorherbreathonlyhalfaslongasnormal.)Afterthatperiodoftime,youmustmakeaDC
10Constitutioncheckeveryroundtocontinueholdingyourbreath.Eachround,theDCforthatcheckincreasesby1.Ifyou
failtheConstitutioncheck,youbegintodrown.
TheDCfortheSwimcheckdependsonthewater,asgivenonthetablebelow.
Table:SwimDCs
WATER SWIMDC
Calmwater 10
Roughwater 15
Stormywater 201
1
Youcanttake10onaSwimcheckinstormywater,evenifyouarentotherwisebeingthreatenedordistracted.
Eachhourthatyouswim,youmustmakeaDC20Swimcheckortake1d6pointsofnonlethaldamagefromfatigue.

Action
AsuccessfulSwimcheckallowsyoutoswimonequarterofyourspeedasamoveactionoronehalfyourspeedasafull
roundaction.

Special
Swimchecksaresubjecttodoublethenormalarmorcheckpenaltyandencumbrancepenalty.
IfyouhavetheAthleticfeat,yougeta+2bonusonSwimchecks.
IfyouhavetheEndurancefeat,yougeta+4bonusonSwimchecksmadetoavoidtakingnonlethaldamagefromfatigue.
AcreaturewithaswimspeedcanmovethroughwateratitsindicatedspeedwithoutmakingSwimchecks.Itgainsa+8
racialbonusonanySwimchecktoperformaspecialactionoravoidahazard.Thecreaturealwayscanchoosetotake10
onaSwimcheck,evenifdistractedorendangeredwhenswimming.Suchacreaturecanusetherunactionwhile
swimming,providedthatitswimsinastraightline.

Tumble(Dex;TrainedOnly;ArmorCheckPenalty)
Youcantusethisskillifyourspeedhasbeenreducedbyarmor,excessequipment,orloot.

Check
Youcanlandsoftlywhenyoufallortumblepastopponents.Youcanalsotumbletoentertainanaudience(asthoughusing
thePerformskill).TheDCsforvarioustasksinvolvingtheTumbleskillaregivenonthetablebelow.
Table:TumbleDCs
TASK TUMBLEDC
Treatafallasifitwere10feetshorterthanitreallyiswhendeterminingdamage. 15
Tumbleatonehalfspeedaspartofnormalmovement,provokingnoattacksofopportunitywhiledoingso.Failuremeans 15
youprovokeattacksofopportunitynormally.Checkseparatelyforeachopponentyoumovepast,intheorderinwhichyou
passthem(playerschoiceoforderincaseofatie).Eachadditionalenemyafterthefirstadds+2totheTumbleDC.
Tumbleatonehalfspeedthroughanareaoccupiedbyanenemy(over,under,oraroundtheopponent)aspartofnormal 25
movement,provokingnoattacksofopportunitywhiledoingso.Failuremeansyoustopbeforeenteringtheenemyoccupied
areaandprovokeanattackofopportunityfromthatenemy.Checkseparatelyforeachopponent.Eachadditionalenemy
afterthefirstadds+2totheTumbleDC.
Obstructedorotherwisetreacheroussurfaces,suchasnaturalcavernfloorsorundergrowth,aretoughtotumblethrough.
TheDCforanyTumblecheckmadetotumbleintosuchasquareismodifiedasindicatedbelow.
Table:TumbleDCModifiers
SURFACEIS... DCMODIFIER
Lightlyobstructed(scree,lightrubble,shallowbog1,undergrowth) +2
Severelyobstructed(naturalcavernfloor,denserubble,denseundergrowth) +5
Lightlyslippery(wetfloor) +2
Severelyslippery(icesheet) +5
Slopedorangled +2
1
Tumblingisimpossibleinadeepbog.

AcceleratedTumbling
Youtrytotumblepastorthroughenemiesmorequicklythannormal.Byacceptinga10penaltyonyourTumblechecks,
youcanmoveatyourfullspeedinsteadofonehalfyourspeed.

Page85of462
Action
Notapplicable.Tumblingispartofmovement,soaTumblecheckispartofamoveaction.

TryAgain
Usuallyno.Anaudience,onceithasjudgedatumblerasanuninterestingperformer,isnotreceptivetorepeat
performances.
Youcantrytoreducedamagefromafallasaninstantreactiononlyonceperfall.

Special
Ifyouhave5ormoreranksinTumble,yougaina+3dodgebonustoACwhenfightingdefensivelyinsteadoftheusual+2
dodgebonustoAC.
Ifyouhave5ormoreranksinTumble,yougaina+6dodgebonustoACwhenexecutingthetotaldefensestandardaction
insteadoftheusual+4dodgebonustoAC.
IfyouhavetheAcrobaticfeat,yougeta+2bonusonTumblechecks.

Synergy
Ifyouhave5ormoreranksinTumble,yougeta+2bonusonBalanceandJumpchecks.
Ifyouhave5ormoreranksinJump,yougeta+2bonusonTumblechecks.

UseMagicDevice(Cha;TrainedOnly)
Usethisskilltoactivatemagic

Check
Youcanusethisskilltoreadaspellortoactivateamagicitem.UseMagicDeviceletsyouuseamagicitemasifyouhad
thespellabilityorclassfeaturesofanotherclass,asifyouwereadifferentrace,orasifyouwereofadifferentalignment.
YoumakeaUseMagicDevicecheckeachtimeyouactivateadevicesuchasawand.Ifyouareusingthechecktoemulate
analignmentorsomeotherqualityinanongoingmanner,youneedtomaketherelevantUseMagicDevicecheckonceper
hour.
Youmustconsciouslychoosewhichrequirementtoemulate.Thatis,youmustknowwhatyouaretryingtoemulatewhen
youmakeaUseMagicDevicecheckforthatpurpose.TheDCsforvarioustasksinvolvingUseMagicDevicechecksare
summarizedonthetablebelow.
Table:UseMagicDeviceDCs
TASK USEMAGICDEVICEDC
Activateblindly 25
Decipherawrittenspell 25+spelllevel
Useascroll 20+casterlevel
Useawand 20
Emulateaclassfeature 20
Emulateanabilityscore Seetext
Emulatearace 25
Emulateanalignment 30

ActivateBlindly
Somemagicitemsareactivatedbyspecialwords,thoughts,oractions.Youcanactivatesuchanitemasifyouwereusing
theactivationword,thought,oraction,evenwhenyourenotandevenifyoudontknowit.Youdohavetoperformsome
equivalentactivityinordertomakethecheck.Thatis,youmustspeak,wavetheitemaround,orotherwiseattempttoget
ittoactivate.Yougetaspecial+2bonusonyourUseMagicDevicecheckifyouveactivatedtheiteminquestionatleast
oncebefore.Ifyoufailby9orless,youcantactivatethedevice.Ifyoufailby10ormore,yousufferamishap.Amishap
meansthatmagicalenergygetsreleasedbutitdoesntdowhatyouwantedittodo.Thedefaultmishapsarethattheitem
affectsthewrongtargetorthatuncontrolledmagicalenergyisreleased,dealing2d6pointsofdamagetoyou.Thismishap
isinadditiontothechanceforamishapthatyounormallyrunwhenyoucastaspellfromascrollthatyoucouldnot
otherwisecastyourself.

DecipheraWrittenSpell
ThisusageworksjustlikedecipheringawrittenspellwiththeSpellcraftskill,exceptthattheDCis5pointshigher.
Decipheringawrittenspellrequires1minuteofconcentration.

Page86of462
EmulateanAbilityScore
Tocastaspellfromascroll,youneedahighscoreintheappropriateability(Intelligenceforwizardspells,Wisdomfor
divinespells,orCharismaforsorcererorbardspells).Youreffectiveabilityscore(appropriatetotheclassyoureemulating
whenyoutrytocastthespellfromthescroll)isyourUseMagicDevicecheckresultminus15.Ifyoualreadyhaveahigh
enoughscoreintheappropriateability,youdontneedtomakethischeck.

EmulateanAlignment
Somemagicitemshavepositiveornegativeeffectsbasedontheusersalignment.UseMagicDeviceletsyouusethese
itemsasifyouwereofanalignmentofyourchoice.Youcanemulateonlyonealignmentatatime.

EmulateaClassFeature
Sometimesyouneedtouseaclassfeaturetoactivateamagicitem.Inthiscase,youreffectivelevelintheemulatedclass
equalsyourUseMagicDevicecheckresultminus20.Thisskilldoesnotletyouactuallyusetheclassfeatureofanother
class.Itjustletsyouactivateitemsasifyouhadthatclassfeature.Iftheclasswhosefeatureyouareemulatinghasan
alignmentrequirement,youmustmeetit,eitherhonestlyorbyemulatinganappropriatealignmentwithaseparateUse
MagicDevicecheck(seeabove).

EmulateaRace
Somemagicitemsworkonlyformembersofcertainraces,orworkbetterformembersofthoseraces.Youcanusesuchan
itemasifyouwerearaceofyourchoice.Youcanemulateonlyoneraceatatime.

UseaScroll
Ifyouarecastingaspellfromascroll,youhavetodecipheritfirst.Normally,tocastaspellfromascroll,youmusthave
thescrollsspellonyourclassspelllist.UseMagicDeviceallowsyoutouseascrollasifyouhadaparticularspellonyour
classspelllist.TheDCisequalto20+thecasterlevelofthespellyouaretryingtocastfromthescroll.Inaddition,casting
aspellfromascrollrequiresaminimumscore(10+spelllevel)intheappropriateability.Ifyoudonthaveasufficient
scoreinthatability,youmustemulatetheabilityscorewithaseparateUseMagicDevicecheck(seeabove).
Thisuseoftheskillalsoappliestootherspellcompletionmagicitems.

UseaWand
Normally,touseawand,youmusthavethewandsspellonyourclassspelllist.Thisuseoftheskillallowsyoutousea
wandasifyouhadaparticularspellonyourclassspelllist.Thisuseoftheskillalsoappliestootherspelltriggermagic
items,suchasstaffs.

Action
None.TheUseMagicDevicecheckismadeaspartoftheaction(ifany)requiredtoactivatethemagicitem.

TryAgain
Yes,butifyoueverrollanatural1whileattemptingtoactivateanitemandyoufail,thenyoucanttrytoactivatethatitem
againfor24hours.

Special
Youcannottake10withthisskill.
YoucantaidanotheronUseMagicDevicechecks.Onlytheuseroftheitemmayattemptsuchacheck.
IfyouhavetheMagicalAptitudefeat,yougeta+2bonusonUseMagicDevicechecks.

Synergy
Ifyouhave5ormoreranksinSpellcraft,yougeta+2bonusonUseMagicDevicechecksrelatedtoscrolls.
Ifyouhave5ormoreranksinDecipherScript,yougeta+2bonusonUseMagicDevicechecksrelatedtoscrolls.
Ifyouhave5ormoreranksinUseMagicDevice,yougeta+2bonustoSpellcraftchecksmadetodecipherspellson
scrolls.

UseRope(Dex)
Check
Mosttaskswitharopearerelativelysimple.TheDCsforvarioustasksutilizingthisskillaresummarizedonthetablebelow.
Table:UseRopeDCs

Page87of462
USEROPEDC TASK
10 Tieafirmknot
101 Secureagrapplinghook
15 Tieaspecialknot,suchasonethatslips,slidesslowly,orloosenswithatug
15 Tiearopearoundyourselfonehanded
15 Splicetworopestogether
Varies Bindacharacter
1
Add2totheDCforevery10feetthehookisthrown;seebelow.

SecureaGrapplingHook
SecuringagrapplinghookrequiresaUseRopecheck(DC10,+2forevery10feetofdistancethegrapplinghookis
thrown,toamaximumDCof20at50feet).Failureby4orlessindicatesthatthehookfailstocatchandfalls,allowingyou
totryagain.Failureby5ormoreindicatesthatthegrapplinghookinitiallyholds,butcomeslooseafter1d4roundsof
supportingweight.Thischeckismadesecretly,sothatyoudontknowwhethertheropewillholdyourweight.

BindaCharacter
Whenyoubindanothercharacterwitharope,anyEscapeArtistcheckthattheboundcharactermakesisopposedbyyour
UseRopecheck.
Yougeta+10bonusonthischeckbecauseitiseasiertobindsomeonethantoescapefrombonds.Youdontevenmake
yourUseRopecheckuntilsomeonetriestoescape.

Action
Varies.Throwingagrapplinghookisastandardactionthatprovokesanattackofopportunity.Tyingaknot,tyingaspecial
knot,ortyingaropearoundyourselfonehandedisafullroundactionthatprovokesanattackofopportunity.Splicingtwo
ropestogethertakes5minutes.Bindingacharactertakes1minute.

Special
Asilkropegivesyoua+2circumstancebonusonUseRopechecks.Ifyoucastananimateropespellonarope,yougeta
+2circumstancebonusonanyUseRopechecksyoumakewhenusingthatrope.
Thesebonusesstack.
IfyouhavetheDeftHandsfeat,yougeta+2bonusonUseRopechecks.

Synergy
Ifyouhave5ormoreranksinUseRope,yougeta+2bonusonClimbchecksmadetoclimbarope,aknottedrope,ora
ropeandwallcombination.
Ifyouhave5ormoreranksinUseRope,yougeta+2bonusonEscapeArtistcheckswhenescapingfromropebonds.
Ifyouhave5ormoreranksinEscapeArtist,yougeta+2bonusonchecksmadetobindsomeone.

Feats
Prerequisites
Somefeatshaveprerequisites.Yourcharactermusthavetheindicatedabilityscore,classfeature,feat,skill,baseattack
bonus,orotherqualitydesignatedinordertoselectorusethatfeat.Acharactercangainafeatatthesamelevelatwhich
heorhegainstheprerequisite.
Acharactercantuseafeatifheorhehaslostaprerequisite.

TypesOfFeats
Somefeatsaregeneral,meaningthatnospecialrulesgovernthemasagroup.Othersareitemcreationfeats,whichallow
spellcasterstocreatemagicitemsofallsorts.Ametamagicfeatletsaspellcasterprepareandcastaspellwithgreatereffect,
albeitasifthespellwereahigherspelllevelthanitactuallyis.

FighterBonusFeats
Anyfeatdesignatedasafighterfeatcanbeselectedasafightersbonusfeat.Thisdesignationdoesnotrestrictcharactersof
otherclassesfromselectingthesefeats,assumingthattheymeetanyprerequisites.

Page88of462
ItemCreationFeats
Anitemcreationfeatletsaspellcastercreateamagicitemofacertaintype.Regardlessofthetypeofitemstheyinvolve,
thevariousitemcreationfeatsallhavecertainfeaturesincommon.

XPCost
Experiencethatthespellcasterwouldnormallykeepisexpendedwhenmakingamagicitem.TheXPcostequals1/25of
thecostoftheitemingoldpieces.AcharactercannotspendsomuchXPonanitemthatheorshelosesalevel.However,
upongainingenoughXPtoattainanewlevel,heorshecanimmediatelyexpendXPoncreatinganitemratherthan
keepingtheXPtoadvancealevel.

RawMaterialsCost
Thecostofcreatingamagicitemequalsonehalfthesalecostoftheitem.
Usinganitemcreationfeatalsorequiresaccesstoalaboratoryormagicalworkshop,specialtools,andsoon.Acharacter
generallyhasaccesstowhatheorsheneedsunlessunusualcircumstancesapply.

Time
Thetimetocreateamagicitemdependsonthefeatandthecostoftheitem.Theminimumtimeisoneday.

ItemCost
BrewPotion,CraftWand,andScribeScrollcreateitemsthatdirectlyreproducespelleffects,andthepoweroftheseitems
dependsontheircasterlevelthatis,aspellfromsuchanitemhasthepoweritwouldhaveifcastbyaspellcasterofthat
level.Thepriceoftheseitems(andthustheXPcostandthecostoftherawmaterials)alsodependsonthecasterlevel.The
casterlevelmustbehighenoughthatthespellcastercreatingtheitemcancastthespellatthatlevel.Tofindthefinalprice
ineachcase,multiplythecasterlevelbythespelllevel,thenmultiplytheresultbyaconstant,asshownbelow:
Scrolls:Baseprice=spelllevelxcasterlevelx25gp.

Potions:Baseprice=spelllevelxcasterlevelx50gp.

Wands:Baseprice=spelllevelxcasterlevelx750gp.

A0levelspellisconsideredtohaveaspelllevelof1/2forthepurposeofthiscalculation.

ExtraCosts
Anypotion,scroll,orwandthatstoresaspellwithacostlymaterialcomponentoranXPcostalsocarriesacommensurate
cost.Forpotionsandscrolls,thecreatormustexpendthematerialcomponentorpaytheXPcostwhencreatingtheitem.
Forawand,thecreatormustexpendfiftycopiesofthematerialcomponentorpayfiftytimestheXPcost.
SomemagicitemssimilarlyincurextracostsinmaterialcomponentsorXP,asnotedintheirdescriptions.

MetamagicFeats
Asaspellcastersknowledgeofmagicgrows,shecanlearntocastspellsinwaysslightlydifferentfromthewaysinwhich
thespellswereoriginallydesignedorlearned.Preparingandcastingaspellinsuchawayisharderthannormalbut,thanks
tometamagicfeats,atleastitispossible.Spellsmodifiedbyametamagicfeatuseaspellslothigherthannormal.This
doesnotchangethelevelofthespell,sotheDCforsavingthrowsagainstitdoesnotgoup.

WizardsandDivineSpellcasters
Wizardsanddivinespellcastersmustpreparetheirspellsinadvance.Duringpreparation,thecharacterchooseswhichspells
topreparewithmetamagicfeats(andthuswhichonestakeuphigherlevelspellslotsthannormal).

SorcerersandBards
Sorcerersandbardschoosespellsastheycastthem.Theycanchoosewhentheycasttheirspellswhethertoapplytheir
metamagicfeatstoimprovethem.Aswithotherspellcasters,theimprovedspellusesupahigherlevelspellslot.But
becausethesorcererorbardhasnotpreparedthespellinametamagicforminadvance,hemustapplythemetamagicfeat
onthespot.Therefore,suchacharactermustalsotakemoretimetocastametamagicspell(oneenhancedbyametamagic
feat)thanhedoestocastaregularspell.Ifthespellsnormalcastingtimeis1action,castingametamagicversionisafull
roundactionforasorcererorbard.(Thisisntthesameasa1roundcastingtime.)
Foraspellwithalongercastingtime,ittakesanextrafullroundactiontocastthespell.

SpontaneousCastingandMetamagicFeats
Aclericspontaneouslycastingacureorinflictspellcancastametamagicversionofitinstead.Extratimeisalsorequiredin

Page89of462
thiscase.Castinga1actionmetamagicspellspontaneouslyisafullroundaction,andaspellwithalongercastingtime
takesanextrafullroundactiontocast.

EffectsofMetamagicFeatsonaSpell
Inallways,ametamagicspelloperatesatitsoriginalspelllevel,eventhoughitispreparedandcastasahigherlevelspell.
Savingthrowmodificationsarenotchangedunlessstatedotherwiseinthefeatdescription.
Themodificationsmadebythesefeatsonlyapplytospellscastdirectlybythefeatuser.Aspellcastercantuseametamagic
feattoalteraspellbeingcastfromawand,scroll,orotherdevice.
Metamagicfeatsthateliminatecomponentsofaspelldonteliminatetheattackofopportunityprovokedbycastingaspell
whilethreatened.However,castingaspellmodifiedbyQuickenSpelldoesnotprovokeanattackofopportunity.
Metamagicfeatscannotbeusedwithallspells.Seethespecificfeatdescriptionsforthespellsthataparticularfeatcant
modify.

MultipleMetamagicFeatsonaSpell
Aspellcastercanapplymultiplemetamagicfeatstoasinglespell.Changestoitslevelarecumulative.Youcantapplythe
samemetamagicfeatmorethanoncetoasinglespell.

MagicItemsandMetamagicSpells
Withtherightitemcreationfeat,youcanstoreametamagicversionofaspellinascroll,potion,orwand.Levellimitsfor
potionsandwandsapplytothespellshigherspelllevel(aftertheapplicationofthemetamagicfeat).Acharacterdoesnt
needthemetamagicfeattoactivateanitemstoringametamagicversionofaspell.

CounterspellingMetamagicSpells
Whetherornotaspellhasbeenenhancedbyametamagicfeatdoesnotaffectitsvulnerabilitytocounterspellingorits
abilitytocounterspellanotherspell.

FeatDescriptions
Hereistheformatforfeatdescriptions.

FeatName
ThenameoftheFeat.

Prerequisite
Aminimumabilityscore,anotherfeatorfeats,aminimumbaseattackbonus,aminimumnumberofranksinoneormore
skills,oraclasslevelthatacharactermusthaveinordertoacquirethisfeat.Thisentryisabsentifafeathasno
prerequisite.Afeatmayhavemorethanoneprerequisite.

Benefit
Whatthefeatenablesthecharacter(youinthefeatdescription)todo.Ifacharacterhasthesamefeatmorethanonce,
itsbenefitsdonotstackunlessindicatedotherwiseinthedescription.
Ingeneral,havingafeattwiceisthesameashavingitonce.

Normal
Whatacharacterwhodoesnothavethisfeatislimitedtoorrestrictedfromdoing.Ifnothavingthefeatcausesno
particulardrawback,thisentryisabsent.

Special
Additionalfactsaboutthefeatthatmaybehelpfulwhenyoudecidewhethertoacquirethefeat.

Acrobatic[General]
Benefit
Yougeta+2bonusonallJumpchecksandTumblechecks.

Agile[General]
Benefit
Yougeta+2bonusonallBalancechecksandEscapeArtistchecks.
Page90of462
Alertness[General]
Benefit
Yougeta+2bonusonallListenchecksandSpotchecks.

Special
ThemasterofafamiliargainsthebenefitoftheAlertnessfeatwheneverthefamiliariswithinarmsreach.

AnimalAffinity[General]
Benefit
Yougeta+2bonusonallHandleAnimalchecksandRidechecks.

ArmorProficiency(Heavy)[General]
Prerequisites
ArmorProficiency(light),ArmorProficiency(medium).

Benefit
SeeArmorProficiency(light).

Normal
SeeArmorProficiency(light).

Special
Fighters,paladins,andclericsautomaticallyhaveArmorProficiency(heavy)asabonusfeat.Theyneednotselectit.

ArmorProficiency(Light)[General]
Benefit
Whenyouwearatypeofarmorwithwhichyouareproficient,thearmorcheckpenaltyforthatarmorappliesonlyto
Balance,Climb,EscapeArtist,Hide,Jump,MoveSilently,PickPocket,andTumblechecks.

Normal
Acharacterwhoiswearingarmorwithwhichsheisnotproficientappliesitsarmorcheckpenaltytoattackrollsandtoall
skillchecksthatinvolvemoving,includingRide.

Special
Allcharactersexceptwizards,sorcerers,andmonksautomaticallyhaveArmorProficiency(light)asabonusfeat.Theyneed
notselectit.

ArmorProficiency(Medium)[General]
Prerequisite
ArmorProficiency(light).

Benefit
SeeArmorProficiency(light).

Normal
SeeArmorProficiency(light).

Special
Fighters,barbarians,paladins,clerics,druids,andbardsautomaticallyhaveArmorProficiency(medium)asabonusfeat.
Theyneednotselectit.

Athletic[General]
Benefit
Yougeta+2bonusonallClimbchecksandSwimchecks.

Page91of462
AugmentSummoning[General]
Prerequisite
SpellFocus(conjuration).

Benefit
Eachcreatureyouconjurewithanysummonspellgainsa+4enhancementbonustoStrengthandConstitutionforthe
durationofthespellthatsummonedit.

BlindFight[General]
Benefit
Inmelee,everytimeyoumissbecauseofconcealment,youcanrerollyourmisschancepercentilerollonetimetoseeifyou
actuallyhit.
Aninvisibleattackergetsnoadvantagesrelatedtohittingyouinmelee.Thatis,youdontloseyourDexteritybonusto
ArmorClass,andtheattackerdoesntgettheusual+2bonusforbeinginvisible.Theinvisibleattackersbonusesdostill
applyforrangedattacks,however.
Youtakeonlyhalftheusualpenaltytospeedforbeingunabletosee.Darknessandpoorvisibilityingeneralreducesyour
speedtothreequartersnormal,insteadofonehalf.

Normal
Regularattackrollmodifiersforinvisibleattackerstryingtohityouapply,andyouloseyourDexteritybonustoAC.The
speedreductionfordarknessandpoorvisibilityalsoapplies.

Special
TheBlindFightfeatisofnouseagainstacharacterwhoisthesubjectofablinkspell.
AfightermayselectBlindFightasoneofhisfighterbonusfeats.

BrewPotion[ItemCreation]
Prerequisite
Casterlevel3rd.

Benefit
Youcancreateapotionofany3rdlevelorlowerspellthatyouknowandthattargetsoneormorecreatures.Brewinga
potiontakesoneday.Whenyoucreateapotion,yousetthecasterlevel,whichmustbesufficienttocastthespellin
questionandnohigherthanyourownlevel.Thebasepriceofapotionisitsspelllevelxitscasterlevelx50gp.Tobrewa

potion,youmustspend1/25ofthisbasepriceinXPanduseuprawmaterialscostingonehalfthisbaseprice.
Whenyoucreateapotion,youmakeanychoicesthatyouwouldnormallymakewhencastingthespell.Whoeverdrinksthe
potionisthetargetofthespell.
AnypotionthatstoresaspellwithacostlymaterialcomponentoranXPcostalsocarriesacommensuratecost.Inaddition
tothecostsderivedfromthebaseprice,youmustexpendthematerialcomponentorpaytheXPwhencreatingthepotion.

Cleave[General]
Prerequisites
Str13,PowerAttack.

Benefit
Ifyoudealacreatureenoughdamagetomakeitdrop(typicallybydroppingittobelow0hitpointsorkillingit),youget
animmediate,extrameleeattackagainstanothercreaturewithinreach.Youcannottakea5footstepbeforemakingthis
extraattack.Theextraattackiswiththesameweaponandatthesamebonusastheattackthatdroppedtheprevious
creature.Youcanusethisabilityonceperround.

Special
AfightermayselectCleaveasoneofhisfighterbonusfeats.

Page92of462
CombatCasting[General]
Benefit
Yougeta+4bonusonConcentrationchecksmadetocastaspelloruseaspelllikeabilitywhileonthedefensiveorwhile
youaregrapplingorpinned.

CombatExpertise[General]
Prerequisite
Int13.

Benefit
Whenyouusetheattackactionorthefullattackactioninmelee,youcantakeapenaltyofasmuchas5onyourattack
rollandaddthesamenumber(+5orless)asadodgebonustoyourArmorClass.Thisnumbermaynotexceedyourbase
attackbonus.ThechangestoattackrollsandArmorClasslastuntilyournextaction.

Normal
AcharacterwithouttheCombatExpertisefeatcanfightdefensivelywhileusingtheattackorfullattackactiontotakea4
penaltyonattackrollsandgaina+2dodgebonustoArmorClass.

Special
AfightermayselectCombatExpertiseasoneofhisfighterbonusfeats.

CombatReflexes[General]
Benefit
YoumaymakeanumberofadditionalattacksofopportunityequaltoyourDexteritybonus.
Withthisfeat,youmayalsomakeattacksofopportunitywhileflatfooted.

Normal
Acharacterwithoutthisfeatcanmakeonlyoneattackofopportunityperroundandcantmakeattacksofopportunity
whileflatfooted.

Special
TheCombatReflexesfeatdoesnotallowaroguetouseheropportunistabilitymorethanonceperround.
AfightermayselectCombatReflexesasoneofhisfighterbonusfeats.
AmonkmayselectCombatReflexesasabonusfeatat2ndlevel.

CraftMagicArmsAndArmor[ItemCreation]
Prerequisite
Casterlevel5th.

Benefit
Youcancreateanymagicweapon,armor,orshieldwhoseprerequisitesyoumeet.Enhancingaweapon,suitofarmor,or
shieldtakesonedayforeach1,000gpinthepriceofitsmagicalfeatures.Toenhanceaweapon,suitofarmor,orshield,
youmustspend1/25ofitsfeaturestotalpriceinXPanduseuprawmaterialscostingonehalfofthistotalprice.
Theweapon,armor,orshieldtobeenhancedmustbeamasterworkitemthatyouprovide.Itscostisnotincludedinthe
abovecost.
Youcanalsomendabrokenmagicweapon,suitofarmor,orshieldifitisonethatyoucouldmake.Doingsocostshalfthe
XP,halftherawmaterials,andhalfthetimeitwouldtaketocraftthatiteminthefirstplace.

CraftRod[ItemCreation]
Prerequisite
Casterlevel9th.

Page93of462
Benefit
Youcancreateanyrodwhoseprerequisitesyoumeet.Craftingarodtakesonedayforeach1,000gpinitsbaseprice.To
craftarod,youmustspend1/25ofitsbasepriceinXPanduseuprawmaterialscostingonehalfofitsbaseprice.
SomerodsincurextracostsinmaterialcomponentsorXP,asnotedintheirdescriptions.Thesecostsareinadditiontothose
derivedfromtherodsbaseprice.

CraftStaff[ItemCreation]
Prerequisite
Casterlevel12th.

Benefit
Youcancreateanystaffwhoseprerequisitesyoumeet.
Craftingastafftakesonedayforeach1,000gpinitsbaseprice.Tocraftastaff,youmustspend1/25ofitsbasepriceinXP
anduseuprawmaterialscostingonehalfofitsbaseprice.Anewlycreatedstaffhas50charges.
SomestaffsincurextracostsinmaterialcomponentsorXP,asnotedintheirdescriptions.Thesecostsareinadditionto
thosederivedfromthestaffsbaseprice.

CraftWand[ItemCreation]
Prerequisite
Casterlevel5th.

Benefit
Youcancreateawandofany4thlevelorlowerspellthatyouknow.Craftingawandtakesonedayforeach1,000gpinits
baseprice.Thebasepriceofawandisitscasterlevelxthespelllevelx750gp.Tocraftawand,youmustspend1/25of

thisbasepriceinXPanduseuprawmaterialscostingonehalfofthisbaseprice.Anewlycreatedwandhas50charges.
AnywandthatstoresaspellwithacostlymaterialcomponentoranXPcostalsocarriesacommensuratecost.Inaddition
tothecostderivedfromthebaseprice,youmustexpendfiftycopiesofthematerialcomponentorpayfiftytimestheXP
cost.

CraftWondrousItem[ItemCreation]
Prerequisite
Casterlevel3rd.

Benefit
Youcancreateanywondrousitemwhoseprerequisitesyoumeet.Enchantingawondrousitemtakesonedayforeach
1,000gpinitsprice.Toenchantawondrousitem,youmustspend1/25oftheitemspriceinXPanduseuprawmaterials
costinghalfofthisprice.
Youcanalsomendabrokenwondrousitemifitisonethatyoucouldmake.DoingsocostshalftheXP,halftheraw
materials,andhalfthetimeitwouldtaketocraftthatiteminthefirstplace.
SomewondrousitemsincurextracostsinmaterialcomponentsorXP,asnotedintheirdescriptions.Thesecostsarein
additiontothosederivedfromtheitemsbaseprice.Youmustpaysuchacosttocreateanitemortomendabrokenone.

Deceitful[General]
Benefit
Yougeta+2bonusonallDisguisechecksandForgerychecks.

DeflectArrows[General]
Prerequisites
Dex13,ImprovedUnarmedStrike.

Page94of462
Benefit
Youmusthaveatleastonehandfree(holdingnothing)tousethisfeat.Onceperroundwhenyouwouldnormallybehit
witharangedweapon,youmaydeflectitsothatyoutakenodamagefromit.Youmustbeawareoftheattackandnot
flatfooted.
Attemptingtodeflectarangedweapondoesntcountasanaction.Unusuallymassiverangedweaponsandrangedattacks
generatedbyspelleffectscantbedeflected.

Special
AmonkmayselectDeflectArrowsasabonusfeatat2ndlevel,evenifshedoesnotmeettheprerequisites.
AfightermayselectDeflectArrowsasoneofhisfighterbonusfeats.

DeftHands[General]
Benefit
Yougeta+2bonusonallSleightofHandchecksandUseRopechecks.

Diehard[General]
Prerequisite
Endurance.

Benefit
Whenreducedtobetween1and9hitpoints,youautomaticallybecomestable.Youdonthavetorolld%toseeifyou
lose1hitpointeachround.
Whenreducedtonegativehitpoints,youmaychoosetoactasifyouweredisabled,ratherthandying.Youmustmakethis
decisionassoonasyouarereducedtonegativehitpoints(evenifitisntyourturn).Ifyoudonotchoosetoactasifyou
weredisabled,youimmediatelyfallunconscious.
Whenusingthisfeat,youcantakeeitherasinglemoveorstandardactioneachturn,butnotboth,andyoucannottakea
fullroundaction.Youcantakeamoveactionwithoutfurtherinjuringyourself,butifyouperformanystandardaction(or
anyotheractiondeemedasstrenuous,includingsomefreeactions,suchascastingaquickenedspell)youtake1pointof
damageaftercompletingtheact.Ifyoureach10hitpoints,youimmediatelydie.

Normal
Acharacterwithoutthisfeatwhoisreducedtobetween1and9hitpointsisunconsciousanddying.

Diligent[General]
Benefit
Yougeta+2bonusonallAppraisechecksandDecipherScriptchecks.

Dodge[General]
Prerequisite
Dex13.

Benefit
Duringyouraction,youdesignateanopponentandreceivea+1dodgebonustoArmorClassagainstattacksfromthat
opponent.Youcanselectanewopponentonanyaction.
AconditionthatmakesyouloseyourDexteritybonustoArmorClass(ifany)alsomakesyoulosedodgebonuses.Also,
dodgebonusesstackwitheachother,unlikemostothertypesofbonuses.

Special
AfightermayselectDodgeasoneofhisfighterbonusfeats.

Page95of462
EmpowerSpell[Metamagic]
Benefit
Allvariable,numericeffectsofanempoweredspellareincreasedbyonehalf.
Savingthrowsandopposedrollsarenotaffected,norarespellswithoutrandomvariables.Anempoweredspellusesupa
spellslottwolevelshigherthanthespellsactuallevel.

Endurance[General]
Benefit
Yougaina+4bonusonthefollowingchecksandsaves:Swimchecksmadetoresistnonlethaldamage,Constitutionchecks
madetocontinuerunning,Constitutionchecksmadetoavoidnonlethaldamagefromaforcedmarch,Constitutionchecks
madetoholdyourbreath,Constitutionchecksmadetoavoidnonlethaldamagefromstarvationorthirst,Fortitudesaves
madetoavoidnonlethaldamagefromhotorcoldenvironments,andFortitudesavesmadetoresistdamagefrom
suffocation.Also,youmaysleepinlightormediumarmorwithoutbecomingfatigued.

Normal
Acharacterwithoutthisfeatwhosleepsinmediumorheavierarmorisautomaticallyfatiguedthenextday.

Special
ArangerautomaticallygainsEnduranceasabonusfeatat3rdlevel.Heneednotselectit.

EnlargeSpell[Metamagic]
Benefit
Youcanalteraspellwitharangeofclose,medium,orlongtoincreaseitsrangeby100%.Anenlargedspellwitharangeof
closenowhasarangeof50ft.+5ft./level,whilemediumrangespellshavearangeof200ft.+20ft./levelandlong
rangespellshavearangeof800ft.+80ft./level.Anenlargedspellusesupaspellslotonelevelhigherthanthespells
actuallevel.
Spellswhoserangesarenotdefinedbydistance,aswellasspellswhoserangesarenotclose,medium,orlong,donothave
increasedranges.

EschewMaterials[General]
Benefit
Youcancastanyspellthathasamaterialcomponentcosting1gporlesswithoutneedingthatcomponent.(Thecastingof
thespellstillprovokesattacksofopportunityasnormal.)Ifthespellrequiresamaterialcomponentthatcostsmorethan1
gp,youmusthavethematerialcomponentathandtocastthespell,justasnormal.

ExoticWeaponProficiency[General]
Chooseatypeofexoticweapon.Youunderstandhowtousethattypeofexoticweaponincombat.

Prerequisite
Baseattackbonus+1(plusStr13forbastardswordordwarvenwaraxe).

Benefit
Youmakeattackrollswiththeweaponnormally.

Normal
Acharacterwhousesaweaponwithwhichheorsheisnotproficienttakesa4penaltyonattackrolls.

Special
YoucangainExoticWeaponProficiencymultipletimes.Eachtimeyoutakethefeat,itappliestoanewtypeofexotic
weapon.ProficiencywiththebastardswordorthedwarvenwaraxehasanadditionalprerequisiteofStr13.
AfightermayselectExoticWeaponProficiencyasoneofhisfighterbonusfeats.

Page96of462
ExtendSpell[Metamagic]
Benefit
Anextendedspelllaststwiceaslongasnormal.Aspellwithadurationofconcentration,instantaneous,orpermanentis
notaffectedbythisfeat.Anextendedspellusesupaspellslotonelevelhigherthanthespellsactuallevel.

ExtraTurning[General]
Prerequisite
Abilitytoturnorrebukecreatures.

Benefit
Eachtimeyoutakethisfeat,youcanuseyourabilitytoturnorrebukecreaturesfourmoretimesperdaythannormal.
Ifyouhavetheabilitytoturnorrebukemorethanonekindofcreatureeachofyourturningorrebukingabilitiesgainsfour
additionalusesperday.

Normal
Withoutthisfeat,acharactercantypicallyturnorrebukeundead(orothercreatures)anumberoftimesperdayequalto3
+hisorherCharismamodifier.

Special
YoucangainExtraTurningmultipletimes.Itseffectsstack.Eachtimeyoutakethefeat,youcanuseeachofyourturningor
rebukingabilitiesfouradditionaltimesperday.

FarShot[General]
Prerequisite
PointBlankShot.

Benefit
Whenyouuseaprojectileweapon,suchasabow,itsrangeincrementincreasesbyonehalf(multiplyby11/2).Whenyou
useathrownweapon,itsrangeincrementisdoubled.

Special
AfightermayselectFarShotasoneofhisfighterbonusfeats.

ForgeRing[ItemCreation]
Prerequisite
Casterlevel12th.

Benefit
Youcancreateanyringwhoseprerequisitesyoumeet.Craftingaringtakesonedayforeach1,000gpinitsbaseprice.To
craftaring,youmustspend1/25ofitsbasepriceinXPanduseuprawmaterialscostingonehalfofitsbaseprice.
Youcanalsomendabrokenringifitisonethatyoucouldmake.DoingsocostshalftheXP,halftherawmaterials,andhalf
thetimeitwouldtaketoforgethatringinthefirstplace.
SomemagicringsincurextracostsinmaterialcomponentsorXP,asnotedintheirdescriptions.Youmustpaysuchacostto
forgesucharingortomendabrokenone.

GreatCleave[General]
Prerequisites
Str13,Cleave,PowerAttack,baseattackbonus+4.

Benefit
ThisfeatworkslikeCleave,exceptthatthereisnolimittothenumberoftimesyoucanuseitperround.

Special
AfightermayselectGreatCleaveasoneofhisfighterbonusfeats.
Page97of462
GreatFortitude[General]
Benefit
Yougeta+2bonusonallFortitudesavingthrows.

GreaterSpellFocus[General]
ChooseaschoolofmagictowhichyoualreadyhaveappliedtheSpellFocusfeat.

Benefit
Add+1totheDifficultyClassforallsavingthrowsagainstspellsfromtheschoolofmagicyouselect.Thisbonusstacks
withthebonusfromSpellFocus.

Special
Youcangainthisfeatmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewschoolof
magictowhichyoualreadyhaveappliedtheSpellFocusfeat.

GreaterSpellPenetration[General]
Prerequisite
SpellPenetration.

Benefit
Yougeta+2bonusoncasterlevelchecks(1d20+casterlevel)madetoovercomeacreaturesspellresistance.Thisbonus
stackswiththeonefromSpellPenetration.

GreaterTwoWeaponFighting[General]
Prerequisites
Dex19,ImprovedTwoWeaponFighting,TwoWeaponFighting,baseattackbonus+11.

Benefit
Yougetathirdattackwithyouroffhandweapon,albeitata10penalty.

Special
AfightermayselectGreaterTwoWeaponFightingasoneofhisfighterbonusfeats.
An11thlevelrangerwhohaschosenthetwoweaponcombatstyleistreatedashavingGreaterTwoWeaponFighting,even
ifhedoesnothavetheprerequisitesforit,butonlywhenheiswearinglightornoarmor.

GreaterWeaponFocus[General]
ChooseonetypeofweaponforwhichyouhavealreadyselectedWeaponFocus.Youcanalsochooseunarmedstrikeor
grappleasyourweaponforpurposesofthisfeat.

Prerequisites
Proficiencywithselectedweapon,WeaponFocuswithselectedweapon,fighterlevel8th.

Benefit
Yougaina+1bonusonallattackrollsyoumakeusingtheselectedweapon.Thisbonusstackswithotherbonuseson
attackrolls,includingtheonefromWeaponFocus(seebelow).

Special
YoucangainGreaterWeaponFocusmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanew
typeofweapon.
AfightermusthaveGreaterWeaponFocuswithagivenweapontogaintheGreaterWeaponSpecializationfeatforthat
weapon.
AfightermayselectGreaterWeaponFocusasoneofhisfighterbonusfeats.

Page98of462
GreaterWeaponSpecialization[General]
ChooseonetypeofweaponforwhichyouhavealreadyselectedWeaponSpecialization.Youcanalsochooseunarmed
strikeorgrappleasyourweaponforpurposesofthisfeat.

Prerequisites
Proficiencywithselectedweapon,GreaterWeaponFocuswithselectedweapon,WeaponFocuswithselectedweapon,
WeaponSpecializationwithselectedweapon,fighterlevel12th.

Benefit
Yougaina+2bonusonalldamagerollsyoumakeusingtheselectedweapon.Thisbonusstackswithotherbonuseson
damagerolls,includingtheonefromWeaponSpecialization(seebelow).

Special
YoucangainGreaterWeaponSpecializationmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itapplies
toanewtypeofweapon.
AfightermayselectGreaterWeaponSpecializationasoneofhisfighterbonusfeats.

HeightenSpell[Metamagic]
Benefit
Aheightenedspellhasahigherspelllevelthannormal(uptoamaximumof9thlevel).Unlikeothermetamagicfeats,
HeightenSpellactuallyincreasestheeffectivelevelofthespellthatitmodifies.Alleffectsdependentonspelllevel(suchas
savingthrowDCsandabilitytopenetratealesserglobeofinvulnerability)arecalculatedaccordingtotheheightenedlevel.
Theheightenedspellisasdifficulttoprepareandcastasaspellofitseffectivelevel.

ImprovedBullRush[General]
Prerequisites
Str13,PowerAttack.

Benefit
Whenyouperformabullrushyoudonotprovokeanattackofopportunityfromthedefender.Youalsogaina+4bonuson
theopposedStrengthcheckyoumaketopushbackthedefender.

Special
AfightermayselectImprovedBullRushasoneofhisfighterbonusfeats.

ImprovedCounterspell[General]
Benefit
Whencounterspelling,youmayuseaspellofthesameschoolthatisoneormorespelllevelshigherthanthetargetspell.

Normal
Withoutthisfeat,youmaycounteraspellonlywiththesamespellorwithaspellspecificallydesignatedascounteringthe
targetspell.

ImprovedCritical[General]
Chooseonetypeofweapon.

Prerequisite
Proficientwithweapon,baseattackbonus+8.

Benefit
Whenusingtheweaponyouselected,yourthreatrangeisdoubled.

Special
YoucangainImprovedCriticalmultipletimes.Theeffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewtype
ofweapon.

Page99of462
Thiseffectdoesntstackwithanyothereffectthatexpandsthethreatrangeofaweapon.
AfightermayselectImprovedCriticalasoneofhisfighterbonusfeats.

ImprovedDisarm[General]
Prerequisites
Int13,CombatExpertise.

Benefit
Youdonotprovokeanattackofopportunitywhenyouattempttodisarmanopponent,nordoestheopponenthavea
chancetodisarmyou.Youalsogaina+4bonusontheopposedattackrollyoumaketodisarmyouropponent.

Normal
Seethenormaldisarmrules.

Special
AfightermayselectImprovedDisarmasoneofhisfighterbonusfeats.
AmonkmayselectImprovedDisarmasabonusfeatat6thlevel,evenifshedoesnotmeettheprerequisites.

ImprovedFamiliar[General]
Thisfeatallowsspellcasterstoacquireanewfamiliarfromanonstandardlist,butonlywhentheycouldnormallyacquirea
newfamiliar.

Prerequisites
Abilitytoacquireanewfamiliar,compatiblealignment,sufficientlyhighlevel(seebelow).

Benefit
Whenchoosingafamiliar,thecreatureslistedbelowarealsoavailabletothespellcaster.Thespellcastermaychoosea
familiarwithanalignmentuptoonestepawayoneachofthealignmentaxes(lawfulthroughchaotic,goodthroughevil).
Table:ImprovedFamiliarByAlignment
FAMILIAR ALIGNMENT ARCANESPELLCASTERLEVEL
Shockerlizard Neutral 5th
Stirge Neutral 5th
Formianworker Lawfulneutral 7th
Imp Lawfulevil 7th
Pseudodragon Neutralgood 7th
Quasit Chaoticevil 7th
Improvedfamiliarsotherwiseusetherulesforregularfamiliars,withtwoexceptions:Ifthecreaturestypeissomething
otherthananimal,itstypedoesnotchange;andimprovedfamiliarsdonotgaintheabilitytospeakwithothercreaturesof
theirkind(althoughmanyofthemalreadyhavetheabilitytocommunicate).
Thelistinthetableabovepresentsonlyafewpossibleimprovedfamiliars.Almostanycreatureofthesamegeneralsize
andpowerasthoseonthelistmakesasuitablefamiliar.Noristhemastersalignmenttheonlypossiblecategorization.For
instance,improvedfamiliarscouldbeassignedbythemasterscreaturetypeorsubtype,asshownontheImprovedFamiliar
ByCharacterTypeorSubTypetable.
Table:ImprovedFamiliarByCharacterTypeorSubType
FAMILIAR TYPE/SUBTYPE ARCANESPELLCASTERLEVEL
Celestialhawk1 Good 3rd
FiendishTinyvipersnake2 Evil 3rd
Airelemental,Small Air 5th
Earthelemental,Small Earth 5th
Fireelemental,Small Fire 5th
Shockerlizard Electricity 5th
Waterelemental,Small Water 5th
Homunculus3 Undead 7th
Icemephit Cold 7th
1
Orothercelestialanimalfromthestandardfamiliarlist.
2
Orotherfiendishanimalfromthestandardfamiliarlist.

Page100of462
3
Themastermustfirstcreatethehomunculus,substitutingichororanotherpartofthemastersbodyforbloodifnecessary.

ImprovedFeint[General]
Prerequisites
Int13,CombatExpertise.

Benefit
YoucanmakeaBluffchecktofeintincombatasamoveaction.

Normal
Feintingincombatisastandardaction.
AfightermayselectImprovedFeintasoneofhisfighterbonusfeats.

ImprovedGrapple[General]
Prerequisites
Dex13,ImprovedUnarmedStrike.

Benefit
Youdonotprovokeanattackofopportunitywhenyoumakeatouchattacktostartagrapple.Youalsogaina+4bonuson
allgrapplechecks,regardlessofwhetheryoustartedthegrapple.

Normal
Withoutthisfeat,youprovokeanattackofopportunitywhenyoumakeatouchattacktostartagrapple.

Special
AfightermayselectImprovedGrappleasoneofhisfighterbonusfeats.
AmonkmayselectImprovedGrappleasabonusfeatat1stlevel,evenifshedoesnotmeettheprerequisites.

ImprovedInitiative[General]
Benefit
Yougeta+4bonusoninitiativechecks.

Special
AfightermayselectImprovedInitiativeasoneofhisfighterbonusfeats.

ImprovedOverrun[General]
Prerequisites
Str13,PowerAttack.

Benefit
Whenyouattempttooverrunanopponent,thetargetmaynotchoosetoavoidyou.Youalsogaina+4bonusonyour
Strengthchecktoknockdownyouropponent.

Normal
Withoutthisfeat,thetargetofanoverruncanchoosetoavoidyouortoblockyou.

Special
AfightermayselectImprovedOverrunasoneofhisfighterbonusfeats.

ImprovedPreciseShot[General]
Prerequisites
Dex19,PointBlankShot,PreciseShot,baseattackbonus+11.

Benefit
YourrangedattacksignoretheACbonusgrantedtotargetsbyanythinglessthantotalcover,andthemisschancegranted
Page101of462
totargetsbyanythinglessthantotalconcealment.Totalcoverandtotalconcealmentprovidetheirnormalbenefitsagainst
yourrangedattacks.
Inaddition,whenyoushootorthrowrangedweaponsatagrapplingopponent,youautomaticallystrikeattheopponent
youhavechosen.

Normal
Seethenormalrulesontheeffectsofcoverandconcealment.Withoutthisfeat,acharacterwhoshootsorthrowsaranged
weaponatatargetinvolvedinagrapplemustrollrandomlytoseewhichgrapplingcombatanttheattackstrikes.

Special
AfightermayselectImprovedPreciseShotasoneofhisfighterbonusfeats.
An11thlevelrangerwhohaschosenthearcherycombatstyleistreatedashavingImprovedPreciseShot,evenifhedoes
nothavetheprerequisitesforit,butonlywhenheiswearinglightornoarmor.

ImprovedShieldBash[General]
Prerequisite
ShieldProficiency.

Benefit
Whenyouperformashieldbash,youmaystillapplytheshieldsshieldbonustoyourAC.

Normal
Withoutthisfeat,acharacterwhoperformsashieldbashlosestheshieldsshieldbonustoACuntilhisorhernextturn.

Special
AfightermayselectImprovedShieldBashasoneofhisfighterbonusfeats.

ImprovedSunder[General]
Prerequisites
Str13,PowerAttack.

Benefit
Whenyoustrikeatanobjectheldorcarriedbyanopponent(suchasaweaponorshield),youdonotprovokeanattackof
opportunity(seeSunder,page158).
Youalsogaina+4bonusonanyattackrollmadetoattackanobjectheldorcarriedbyanothercharacter.

Normal
Withoutthisfeat,youprovokeanattackofopportunitywhenyoustrikeatanobjectheldorcarriedbyanothercharacter.

Special
AfightermayselectImprovedSunderasoneofhisfighterbonusfeats(seepage38).

ImprovedTrip[General]
Prerequisites
Int13,CombatExpertise.

Benefit
Youdonotprovokeanattackofopportunitywhenyouattempttotripanopponentwhileyouareunarmed.Youalsogaina
+4bonusonyourStrengthchecktotripyouropponent.
Ifyoutripanopponentinmeleecombat,youimmediatelygetameleeattackagainstthatopponentasifyouhadntused
yourattackforthetripattempt.

Normal
Withoutthisfeat,youprovokeanattackofopportunitywhenyouattempttotripanopponentwhileyouareunarmed.

Page102of462
Special
At6thlevel,amonkmayselectImprovedTripasabonusfeat,evenifshedoesnothavetheprerequisites.
AfightermayselectImprovedTripasoneofhisfighterbonusfeats.

ImprovedTurning[General]
Prerequisite
Abilitytoturnorrebukecreatures.

Benefit
Youturnorrebukecreaturesasifyouwereonelevelhigherthanyouareintheclassthatgrantsyoutheability.

ImprovedTwoWeaponFighting[General]
Prerequisites
Dex17,TwoWeaponFighting,baseattackbonus+6.

Benefit
Inadditiontothestandardsingleextraattackyougetwithanoffhandweapon,yougetasecondattackwithit,albeitata
5penalty.

Normal
Withoutthisfeat,youcanonlygetasingleextraattackwithanoffhandweapon.

Special
AfightermayselectImprovedTwoWeaponFightingasoneofhisfighterbonusfeats.
A6thlevelrangerwhohaschosenthetwoweaponcombatstyleistreatedashavingImprovedTwoWeaponFighting,even
ifhedoesnothavetheprerequisitesforit,butonlywhenheiswearinglightornoarmor.

ImprovedUnarmedStrike[General]
Benefit
Youareconsideredtobearmedevenwhenunarmedthatis,youdonotprovokeattacksoropportunityfromarmed
opponentswhenyouattackthemwhileunarmed.However,youstillgetanattackofopportunityagainstanyopponentwho
makesanunarmedattackonyou.
Inaddition,yourunarmedstrikescandeallethalornonlethaldamage,atyouroption.

Normal
Withoutthisfeat,youareconsideredunarmedwhenattackingwithanunarmedstrike,andyoucandealonlynonlethal
damagewithsuchanattack.

Special
AmonkautomaticallygainsImprovedUnarmedStrikeasabonusfeatat1stlevel.Sheneednotselectit.
AfightermayselectImprovedUnarmedStrikeasoneofhisfighterbonusfeats.

Investigator[General]
Benefit
Yougeta+2bonusonallGatherInformationchecksandSearchchecks.

IronWill[General]
Benefit
Yougeta+2bonusonallWillsavingthrows.

Page103of462
Leadership[General]
Prerequisite
Characterlevel6th.

Benefits
Havingthisfeatenablesthecharactertoattractloyalcompanionsanddevotedfollowers,subordinateswhoassisther.See
thetablebelowforwhatsortofcohortandhowmanyfollowersthecharactercanrecruit.
LeadershipModifiers:SeveralfactorscanaffectacharactersLeadershipscore,causingittovaryfromthebasescore
(characterlevel+Chamodifier).Acharactersreputation(fromthepointofviewofthecohortorfollowerheistryingto
attract)raisesorlowershisLeadershipscore:
Table:LeadershipReputationModifiers
LEADERSREPUTATION MODIFIER
Greatrenown +2
Fairnessandgenerosity +1
Specialpower +1
Failure 1
Aloofness 1
Cruelty 2
Othermodifiersmayapplywhenthecharactertriestoattractacohort:
Table:AttractingaCohortModifiers
THELEADER... MODIFIER
Hasafamiliar,specialmount,oranimalcompanion 2
Recruitsacohortofadifferentalignment 1
Causedthedeathofacohort 21
1
Cumulativepercohortkilled.
Followershavedifferentprioritiesfromcohorts.Whenthecharactertriestoattractanewfollower,useanyofthefollowing
modifiersthatapply.
Table:AttractingFollowersModifiers
THELEADER... MODIFIER
Hasastronghold,baseofoperations,guildhouse,orthelike +2
Movesaroundalot 1
Causedthedeathofotherfollowers 1
Table:FollowersbyLevel
LEADERSHIPSCORE COHORTLEVEL NUMBEROFFOLLOWERSBYLEVEL
1ST 2ND 3RD 4TH 5TH 6TH
1orlower
2 1st
3 2nd
4 3rd
5 3rd
6 4th
7 5th
8 5th
9 6th
10 7th 5
11 7th 6
12 8th 8
13 9th 10 1
14 10th 15 1
15 10th 20 2 1
16 11th 25 2 1
17 12th 30 3 1 1
18 12th 35 3 1 1
19 13th 40 4 2 1 1
20 14th 50 5 3 2 1
21 15th 60 6 3 2 1 1
22 15th 75 7 4 2 2 1
23 16th 90 9 5 3 2 1
24 17th 110 11 6 3 2 1
Page104of462
LEADERSHIPSCORE COHORTLEVEL NUMBEROFFOLLOWERSBYLEVEL
25orhigher 17th 135 13 7 4 2 2

LeadershipScore
AcharactersbaseLeadershipscoreequalshislevelplusanyCharismamodifier.Inordertotakeintoaccountnegative
Charismamodifiers,thistableallowsforverylowLeadershipscores,butthecharactermuststillbe6thlevelorhigherin
ordertogaintheLeadershipfeat.OutsidefactorscanaffectacharactersLeadershipscore,asdetailedabove.

CohortLevel
Thecharactercanattractacohortofuptothislevel.RegardlessofacharactersLeadershipscore,hecanonlyrecruita
cohortwhoistwoormorelevelslowerthanhimself.Thecohortshouldbeequippedwithgearappropriateforitslevel.A
charactercantrytoattractacohortofaparticularrace,class,andalignment.Thecohortsalignmentmaynotbeopposed
totheleadersalignmentoneitherthelawvschaosorgoodvsevilaxis,andtheleadertakesaLeadershippenaltyifhe
recruitsacohortofanalignmentdifferentfromhisown.

CohortsearningXP
ThecohortdoesnotcountasapartymemberwhendeterminingthepartysXP.
DividethecohortslevelbythelevelofthePCwithwhomheorheisassociated(thecharacterwiththeLeadershipfeat
whoattractedthecohort).
MultiplythisresultbythetotalXPawardedtothePCandaddthatnumberofexperiencepointstothecohortstotal.
IfacohortgainsenoughXPtobringittoalevelonelowerthantheassociatedPCscharacterlevel,thecohortdoesnotgain
thenewlevelitsnewXPtotalis1lessthantheamountneededattainthenextlevel.

NumberofFollowersbyLevel
Thecharactercanleaduptotheindicatednumberofcharactersofeachlevel.Followersaresimilartocohorts,except
theyregenerallylowlevelNPCs.Becausetheyregenerallyfiveormorelevelsbehindthecharactertheyfollow,theyre
rarelyeffectiveincombat.
Followersdontearnexperienceandthusdontgainlevels.However,whenacharacterwithLeadershipattainsanewlevel,
theplayerconsultsthetableabovetodetermineifhehasacquiredmorefollowers,someofwhichmaybehigherlevelthan
theexistingfollowers.(Youdontconsultthetabletoseeifyourcohortgainslevels,however,becausecohortsearn
experienceontheirown.)

LightningReflexes[General]
Benefit
Yougeta+2bonusonallReflexsavingthrows.

MagicalAptitude[General]
Benefit
Yougeta+2bonusonallSpellcraftchecksandUseMagicDevicechecks.

Manyshot[General]
Prerequisites
Dex17,PointBlankShot,RapidShot,baseattackbonus+6

Benefit
Asastandardaction,youmayfiretwoarrowsatasingleopponentwithin30feet.Botharrowsusethesameattackroll
(witha4penalty)todeterminesuccessanddealdamagenormally(butseeSpecial).
Foreveryfivepointsofbaseattackbonusyouhaveabove+6,youmayaddoneadditionalarrowtothisattack,toa
maximumoffourarrowsatabaseattackbonusof+16.However,eacharrowafterthesecondaddsacumulative2
penaltyontheattackroll(foratotalpenaltyof6forthreearrowsand8forfour).
Damagereductionandotherresistancesapplyseparatelyagainsteacharrowfired.

Special
Regardlessofthenumberofarrowsyoufire,youapplyprecisionbaseddamageonlyonce.Ifyouscoreacriticalhit,only

Page105of462
thefirstarrowfireddealscriticaldamage;allothersdealregulardamage.
AfightermayselectManyshotasoneofhisfighterbonusfeats.
A6thlevelrangerwhohaschosenthearcherycombatstyleistreatedashavingManyshotevenifhedoesnothavethe
prerequisitesforit,butonlywhenheiswearinglightornoarmor.

MartialWeaponProficiency[General]
Chooseatypeofmartialweapon.Youunderstandhowtousethattypeofmartialweaponincombat.

Benefit
Youmakeattackrollswiththeselectedweaponnormally.

Normal
Whenusingaweaponwithwhichyouarenotproficient,youtakea4penaltyonattackrolls.

Special
Barbarians,fighters,paladins,andrangersareproficientwithallmartialweapons.Theyneednotselectthisfeat.
YoucangainMartialWeaponProficiencymultipletimes.Eachtimeyoutakethefeat,itappliestoanewtypeofweapon.
AclericwhochoosestheWardomainautomaticallygainstheMartialWeaponProficiencyfeatrelatedtohisdeitysfavored
weaponasabonusfeat,iftheweaponisamartialone.Heneednotselectit.

MaximizeSpell[Metamagic]
Benefit
Allvariable,numericeffectsofaspellmodifiedbythisfeataremaximized.Savingthrowsandopposedrollsarenot
affected,norarespellswithoutrandomvariables.Amaximizedspellusesupaspellslotthreelevelshigherthanthespells
actuallevel.
Anempowered,maximizedspellgainstheseparatebenefitsofeachfeat:themaximumresultplusonehalfthenormally
rolledresult.

Mobility[General]
Prerequisites
Dex13,Dodge.

Benefit
Yougeta+4dodgebonustoArmorClassagainstattacksofopportunitycausedwhenyoumoveoutoforwithina
threatenedarea.AconditionthatmakesyouloseyourDexteritybonustoArmorClass(ifany)alsomakesyoulosedodge
bonuses.
Dodgebonusesstackwitheachother,unlikemosttypesofbonuses.

Special
AfightermayselectMobilityasoneofhisfighterbonusfeats.

MountedArchery[General]
Prerequisites
Ride1rank,MountedCombat.

Benefit
Thepenaltyyoutakewhenusingarangedweaponwhilemountedishalved:2insteadof4ifyourmountistakinga
doublemove,and4insteadof8ifyourmountisrunning.

Special
AfightermayselectMountedArcheryasoneofhisfighterbonusfeats.

Page106of462
MountedCombat[General]
Prerequisite
Ride1rank.

Benefit
Onceperroundwhenyourmountishitincombat,youmayattemptaRidecheck(asareaction)tonegatethehit.Thehit
isnegatedifyourRidecheckresultisgreaterthantheopponentsattackroll.(Essentially,theRidecheckresultbecomesthe
mountsArmorClassifitshigherthanthemountsregularAC.)

Special
AfightermayselectMountedCombatasoneofhisfighterbonusfeats.

NaturalSpell[General]
Prerequisites
Wis13,wildshapeability.

Benefit
Youcancompletetheverbalandsomaticcomponentsofspellswhileinawildshape.Yousubstitutevariousnoisesand
gesturesforthenormalverbalandsomaticcomponentsofaspell.
Youcanalsouseanymaterialcomponentsorfocusesyoupossess,evenifsuchitemsaremeldedwithinyourcurrentform.
Thisfeatdoesnotpermittheuseofmagicitemswhileyouareinaformthatcouldnotordinarilyusethem,andyoudonot
gaintheabilitytospeakwhileinawildshape.

Negotiator[General]
Benefit
Yougeta+2bonusonallDiplomacychecksandSenseMotivechecks.

NimbleFingers[General]
Benefit
Yougeta+2bonusonallDisableDevicechecksandOpenLockchecks.

Persuasive[General]
Benefit
Yougeta+2bonusonallBluffchecksandIntimidatechecks.

PointBlankShot[General]
Benefit
Yougeta+1bonusonattackanddamagerollswithrangedweaponsatrangesofupto30feet.

Special
AfightermayselectPointBlankShotasoneofhisfighterbonusfeats.

PowerAttack[General]
Prerequisite
Str13.

Benefit
Onyouraction,beforemakingattackrollsforaround,youmaychoosetosubtractanumberfromallmeleeattackrollsand
addthesamenumbertoallmeleedamagerolls.Thisnumbermaynotexceedyourbaseattackbonus.Thepenaltyon
attacksandbonusondamageapplyuntilyournextturn.

Page107of462
Special
Ifyouattackwithatwohandedweapon,orwithaonehandedweaponwieldedintwohands,insteadaddtwicethe
numbersubtractedfromyourattackrolls.YoucantaddthebonusfromPowerAttacktothedamagedealtwithalight
weapon(exceptwithunarmedstrikesornaturalweaponattacks),eventhoughthepenaltyonattackrollsstillapplies.
(Normally,youtreatadoubleweaponasaonehandedweaponandalightweapon.Ifyouchoosetouseadoubleweapon
likeatwohandedweapon,attackingwithonlyoneendofitinaround,youtreatitasatwohandedweapon.)
AfightermayselectPowerAttackasoneofhisfighterbonusfeats.

PreciseShot[General]
Prerequisite
PointBlankShot.

Benefit
Youcanshootorthrowrangedweaponsatanopponentengagedinmeleewithouttakingthestandard4penaltyonyour
attackroll.

Special
AfightermayselectPreciseShotasoneofhisfighterbonusfeats.

QuickDraw[General]
Prerequisite
Baseattackbonus+1.

Benefit
Youcandrawaweaponasafreeactioninsteadofasamoveaction.Youcandrawahiddenweapon(seetheSleightof
Handskill)asamoveaction.
Acharacterwhohasselectedthisfeatmaythrowweaponsathisfullnormalrateofattacks(muchlikeacharacterwitha
bow).

Normal
Withoutthisfeat,youmaydrawaweaponasamoveaction,or(ifyourbaseattackbonusis+1orhigher)asafreeaction
aspartofmovement.Withoutthisfeat,youcandrawahiddenweaponasastandardaction.

Special
AfightermayselectQuickDrawasoneofhisfighterbonusfeats.

QuickenSpell[Metamagic]
Benefit
Castingaquickenedspellisafreeaction.Youcanperformanotheraction,evencastinganotherspell,inthesameroundas
youcastaquickenedspell.Youmaycastonlyonequickenedspellperround.Aspellwhosecastingtimeismorethan1full
roundactioncannotbequickened.Aquickenedspellusesupaspellslotfourlevelshigherthanthespellsactuallevel.
Castingaquickenedspelldoesntprovokeanattackofopportunity.

Special
Thisfeatcantbeappliedtoanyspellcastspontaneously(includingsorcererspells,bardspells,andclericordruidspells
castspontaneously),sinceapplyingametamagicfeattoaspontaneouslycastspellautomaticallyincreasesthecastingtime
toafullroundaction.

RapidReload[General]
Chooseatypeofcrossbow(hand,light,orheavy).

Prerequisite
WeaponProficiency(crossbowtypechosen).

Page108of462
Benefit
Thetimerequiredforyoutoreloadyourchosentypeofcrossbowisreducedtoafreeaction(forahandorlightcrossbow)
oramoveaction(foraheavycrossbow).Reloadingacrossbowstillprovokesanattackofopportunity.
Ifyouhaveselectedthisfeatforhandcrossboworlightcrossbow,youmayfirethatweaponasmanytimesinafullattack
actionasyoucouldattackifyouwereusingabow.

Normal
Acharacterwithoutthisfeatneedsamoveactiontoreloadahandorlightcrossbow,orafullroundactiontoreloada
heavycrossbow.

Special
YoucangainRapidReloadmultipletimes.Eachtimeyoutakethefeat,itappliestoanewtypeofcrossbow.
AfightermayselectRapidReloadasoneofhisfighterbonusfeats.

RapidShot[General]
Prerequisites
Dex13,PointBlankShot.

Benefit
Youcangetoneextraattackperroundwitharangedweapon.Theattackisatyourhighestbaseattackbonus,buteach
attackyoumakeinthatround(theextraoneandthenormalones)takesa2penalty.Youmustusethefullattackactionto
usethisfeat.

Special
AfightermayselectRapidShotasoneofhisfighterbonusfeats.
A2ndlevelrangerwhohaschosenthearcherycombatstyleistreatedashavingRapidShot,evenifhedoesnothavethe
prerequisitesforit,butonlywhenheiswearinglightornoarmor.

RideByAttack[General]
Prerequisites
Ride1rank,MountedCombat.

Benefit
Whenyouaremountedandusethechargeaction,youmaymoveandattackasifwithastandardchargeandthenmove
again(continuingthestraightlineofthecharge).Yourtotalmovementfortheroundcantexceeddoubleyourmounted
speed.Youandyourmountdonotprovokeanattackofopportunityfromtheopponentthatyouattack.

Special
AfightermayselectRideByAttackasoneofhisfighterbonusfeats.

Run[General]
Benefit
Whenrunning,youmovefivetimesyournormalspeed(ifwearinglightornoarmorandcarryingnomorethanalight
load)orfourtimesyourspeed(ifwearingmediumorheavyarmororcarryingamediumorheavyload).Ifyoumakea
jumpafterarunningstart(seetheJumpskilldescription),yougaina+4bonusonyourJumpcheck.Whilerunning,you
retainyourDexteritybonustoAC.

Normal
Youmovefourtimesyourspeedwhilerunning(ifwearinglightornoarmorandcarryingnomorethanalightload)or
threetimesyourspeed(ifwearingmediumorheavyarmororcarryingamediumorheavyload),andyouloseyour
DexteritybonustoAC.

Page109of462
ScribeScroll[ItemCreation]
Prerequisite
Casterlevel1st.

Benefit
Youcancreateascrollofanyspellthatyouknow.Scribingascrolltakesonedayforeach1,000gpinitsbaseprice.The
basepriceofascrollisitsspelllevelxitscasterlevelx25gp.Toscribeascroll,youmustspend1/25ofthisbasepricein

XPanduseuprawmaterialscostingonehalfofthisbaseprice.
AnyscrollthatstoresaspellwithacostlymaterialcomponentoranXPcostalsocarriesacommensuratecost.Inaddition
tothecostsderivedfromthebaseprice,youmustexpendthematerialcomponentorpaytheXPwhenscribingthescroll.

SelfSufficient[General]
Benefit
Yougeta+2bonusonallHealchecksandSurvivalchecks.

ShieldProficiency[General]
Benefit
Youcanuseashieldandtakeonlythestandardpenalties.

Normal
Whenyouareusingashieldwithwhichyouarenotproficient,youtaketheshieldsarmorcheckpenaltyonattackrolls
andonallskillchecksthatinvolvemoving,includingRidechecks.

Special
Barbarians,bards,clerics,druids,fighters,paladins,andrangersautomaticallyhaveShieldProficiencyasabonusfeat.They
neednotselectit.

ShotOnTheRun[General]
Prerequisites
Dex13,Dodge,Mobility,PointBlankShot,baseattackbonus+4.

Benefit
Whenusingtheattackactionwitharangedweapon,youcanmovebothbeforeandaftertheattack,providedthatyour
totaldistancemovedisnotgreaterthanyourspeed.

Special
AfightermayselectShotontheRunasoneofhisfighterbonusfeats.

SilentSpell[Metamagic]
Benefit
Asilentspellcanbecastwithnoverbalcomponents.Spellswithoutverbalcomponentsarenotaffected.Asilentspelluses
upaspellslotonelevelhigherthanthespellsactuallevel.

Special
Bardspellscannotbeenhancedbythismetamagicfeat.

SimpleWeaponProficiency[General]
Benefit
Youmakeattackrollswithsimpleweaponsnormally.

Normal
Whenusingaweaponwithwhichyouarenotproficient,youtakea4penaltyonattackrolls.

Page110of462
Special
Allcharactersexceptfordruids,monks,rogues,andwizardsareautomaticallyproficientwithallsimpleweapons.They
neednotselectthisfeat.

SkillFocus[General]
Chooseaskill.

Benefit
Yougeta+3bonusonallchecksinvolvingthatskill.

Special
Youcangainthisfeatmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewskill.

SnatchArrows[General]
Prerequisites
Dex15,DeflectArrows,ImprovedUnarmedStrike.

Benefit
WhenusingtheDeflectArrowsfeatyoumaycatchtheweaponinsteadofjustdeflectingit.Thrownweaponscan
immediatelybethrownbackattheoriginalattacker(eventhoughitisntyourturn)orkeptforlateruse.
Youmusthaveatleastonehandfree(holdingnothing)tousethisfeat.

Special
AfightermayselectSnatchArrowsasoneofhisfighterbonusfeats.

SpellFocus[General]
Chooseaschoolofmagic.

Benefit
Add+1totheDifficultyClassforallsavingthrowsagainstspellsfromtheschoolofmagicyouselect.

Special
Youcangainthisfeatmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewschoolof
magic.

SpellMastery[Special]
Prerequisite
Wizardlevel1st.

Benefit
Eachtimeyoutakethisfeat,chooseanumberofspellsequaltoyourIntelligencemodifierthatyoualreadyknow.From
thatpointon,youcanpreparethesespellswithoutreferringtoaspellbook.

Normal
Withoutthisfeat,youmustuseaspellbooktoprepareallyourspells,exceptreadmagic.

SpellPenetration[General]
Benefit
Yougeta+2bonusoncasterlevelchecks(1d20+casterlevel)madetoovercomeacreaturesspellresistance.

SpiritedCharge[General]
Prerequisites
Ride1rank,MountedCombat,RideByAttack.

Page111of462
Benefit
Whenmountedandusingthechargeaction,youdealdoubledamagewithameleeweapon(ortripledamagewithalance).

Special
AfightermayselectSpiritedChargeasoneofhisfighterbonusfeats.

SpringAttack[General]
Prerequisites
Dex13,Dodge,Mobility,baseattackbonus+4.

Benefit
Whenusingtheattackactionwithameleeweapon,youcanmovebothbeforeandaftertheattack,providedthatyourtotal
distancemovedisnotgreaterthanyourspeed.Movinginthiswaydoesnotprovokeanattackofopportunityfromthe
defenderyouattack,thoughitmightprovokeattacksofopportunityfromothercreatures,ifappropriate.Youcantusethis
featifyouarewearingheavyarmor.
Youmustmoveatleast5feetbothbeforeandafteryoumakeyourattackinordertoutilizethebenefitsofSpringAttack.

Special
AfightermayselectSpringAttackasoneofhisfighterbonusfeats.

Stealthy[General]
Benefit
Yougeta+2bonusonallHidechecksandMoveSilentlychecks.

StillSpell[Metamagic]
Benefit
Astilledspellcanbecastwithnosomaticcomponents.
Spellswithoutsomaticcomponentsarenotaffected.Astilledspellusesupaspellslotonelevelhigherthanthespells
actuallevel.

StunningFist[General]
Prerequisites
Dex13,Wis13,ImprovedUnarmedStrike,baseattackbonus+8.

Benefit
Youmustdeclarethatyouareusingthisfeatbeforeyoumakeyourattackroll(thus,afailedattackrollruinstheattempt).
StunningFistforcesafoedamagedbyyourunarmedattacktomakeaFortitudesavingthrow(DC10+1/2yourcharacter
level+yourWismodifier),inadditiontodealingdamagenormally.Adefenderwhofailsthissavingthrowisstunnedfor1
round(untiljustbeforeyournextaction).Astunnedcharactercantact,losesanyDexteritybonustoAC,andtakesa2
penaltytoAC.Youmayattemptastunningattackonceperdayforeveryfourlevelsyouhaveattained(butseeSpecial),
andnomorethanonceperround.Constructs,oozes,plants,undead,incorporealcreatures,andcreaturesimmuneto
criticalhitscannotbestunned.

Special
AmonkmayselectStunningFistasabonusfeatat1stlevel,evenifshedoesnotmeettheprerequisites.Amonkwho
selectsthisfeatmayattemptastunningattackanumberoftimesperdayequaltohermonklevel,plusonemoretimeper
dayforeveryfourlevelsshehasinclassesotherthanmonk.
AfightermayselectStunningFistasoneofhisfighterbonusfeats.

Toughness[General]
Benefit
Yougain+3hitpoints.

Page112of462
Special
Acharactermaygainthisfeatmultipletimes.Itseffectsstack.

TowerShieldProficiency[General]
Prerequisite
ShieldProficiency.

Benefit
Youcanuseatowershieldandsufferonlythestandardpenalties.

Normal
Acharacterwhoisusingashieldwithwhichheorsheisnotproficienttakestheshieldsarmorcheckpenaltyonattack
rollsandonallskillchecksthatinvolvemoving,includingRide.

Special
FightersautomaticallyhaveTowerShieldProficiencyasabonusfeat.Theyneednotselectit.

Track[General]
Benefit
Tofindtracksortofollowthemfor1milerequiresasuccessfulSurvivalcheck.YoumustmakeanotherSurvivalcheck
everytimethetracksbecomedifficulttofollow.
Youmoveathalfyournormalspeed(oratyournormalspeedwitha5penaltyonthecheck,oratuptotwiceyournormal
speedwitha20penaltyonthecheck).TheDCdependsonthesurfaceandtheprevailingconditions,asgivenonthe
TrackingSurfaceDCstable.
Table:TrackingSurfaceDCs
SURFACE DC SURFACE DC
Verysoftground 5 Firmground 15
Softground 10 Hardground 20

VerySoftGround
Anysurface(freshsnow,thickdust,wetmud)thatholdsdeep,clearimpressionsoffootprints.

SoftGround
Anysurfacesoftenoughtoyieldtopressure,butfirmerthanwetmudorfreshsnow,inwhichacreatureleavesfrequent
butshallowfootprints.

FirmGround
Mostnormaloutdoorsurfaces(suchaslawns,fields,woods,andthelike)orexceptionallysoftordirtyindoorsurfaces
(thickrugsandverydirtyordustyfloors).Thecreaturemightleavesometraces(brokenbranchesortuftsofhair),butit
leavesonlyoccasionalorpartialfootprints.

HardGround
Anysurfacethatdoesntholdfootprintsatall,suchasbarerockoranindoorfloor.Moststreambedsfallintothiscategory,
sinceanyfootprintsleftbehindareobscuredorwashedaway.Thecreatureleavesonlytraces(scuffmarksordisplaced
pebbles).
SeveralmodifiersmayapplytotheSurvivalcheck,asgivenontheTrackingConditionDCModifierstable.
Table:TrackingConditionDCModifiers
CONDITION DCMODIFIER
Everythreecreaturesinthegroupbeingtracked 1
SIZEOFCREATUREORCREATURESBEINGTRACKED:1
Fine +8
Diminutive +4
Tiny +2
Small +1
Medium +0
Large 1
Huge 2
Gargantuan 4
Page113of462
CONDITION DCMODIFIER
Colossal 8
Every24hourssincethetrailwasmade +1
Everyhourofrainsincethetrailwasmade +1
Freshsnowcoversincethetrailwasmade +10
POORVISIBILITY:2
Overcastormoonlessnight +6
Moonlight +3
Fogorprecipitation +3
Trackedpartyhidestrail(andmovesathalfspeed) +5
1
Foragroupofmixedsizes,applyonlythemodifierforthelargestsizecategory.
2
Applyonlythelargestmodifierfromthiscategory.
IfyoufailaSurvivalcheck,youcanretryafter1hour(outdoors)or10minutes(indoors)ofsearching.

Normal
Withoutthisfeat,youcanusetheSurvivalskilltofindtracks,butyoucanfollowthemonlyiftheDCforthetaskis10or
lower.Alternatively,youcanusetheSearchskilltofindafootprintorsimilarsignofacreaturespassageusingtheDCs
givenabove,butyoucantuseSearchtofollowtracks,evenifsomeoneelsehasalreadyfoundthem.

Special
ArangerautomaticallyhasTrackasabonusfeat.Heneednotselectit.
Thisfeatdoesnotallowyoutofindorfollowthetracksmadebyasubjectofapasswithouttracespell.

Trample[General]
Prerequisites
Ride1rank,MountedCombat.

Benefit
Whenyouattempttooverrunanopponentwhilemounted,yourtargetmaynotchoosetoavoidyou.Yourmountmay
makeonehoofattackagainstanytargetyouknockdown,gainingthestandard+4bonusonattackrollsagainstprone
targets.

Special
AfightermayselectTrampleasoneofhisfighterbonusfeats.

TwoWeaponDefense[General]
Prerequisites
Dex15,TwoWeaponFighting.

Benefit
Whenwieldingadoubleweaponortwoweapons(notincludingnaturalweaponsorunarmedstrikes),yougaina+1shield
bonustoyourAC.
Whenyouarefightingdefensivelyorusingthetotaldefenseaction,thisshieldbonusincreasesto+2.

Special
AfightermayselectTwoWeaponDefenseasoneofhisfighterbonusfeats.

TwoWeaponFighting[General]
Youcanfightwithaweaponineachhand.Youcanmakeoneextraattackeachroundwiththesecondweapon.

Prerequisite
Dex15.

Benefit
Yourpenaltiesonattackrollsforfightingwithtwoweaponsarereduced.Thepenaltyforyourprimaryhandlessensby2
andtheoneforyouroffhandlessensby6.

Page114of462
Normal
Ifyouwieldasecondweaponinyouroffhand,youcangetoneextraattackperroundwiththatweapon.Whenfightingin
thiswayyousuffera6penaltywithyourregularattackorattackswithyourprimaryhandanda10penaltytotheattack
withyouroffhand.Ifyouroffhandweaponislightthepenaltiesarereducedby2each.(Anunarmedstrikeisalways
consideredlight.)

Special
A2ndlevelrangerwhohaschosenthetwoweaponcombatstyleistreatedashavingTwoWeaponFighting,evenifhedoes
nothavetheprerequisiteforit,butonlywhenheiswearinglightornoarmor.
AfightermayselectTwoWeaponFightingasoneofhisfighterbonusfeats.

WeaponFinesse[General]
Prerequisite
Baseattackbonus+1.

Benefit
Withalightweapon,rapier,whip,orspikedchainmadeforacreatureofyoursizecategory,youmayuseyourDexterity
modifierinsteadofyourStrengthmodifieronattackrolls.Ifyoucarryashield,itsarmorcheckpenaltyappliestoyour
attackrolls.

Special
AfightermayselectWeaponFinesseasoneofhisfighterbonusfeats.
Naturalweaponsarealwaysconsideredlightweapons.

WeaponFocus[General]
Chooseonetypeofweapon.Youcanalsochooseunarmedstrikeorgrapple(orray,ifyouareaspellcaster)asyourweapon
forpurposesofthisfeat.

Prerequisites
Proficiencywithselectedweapon,baseattackbonus+1.

Benefit
Yougaina+1bonusonallattackrollsyoumakeusingtheselectedweapon.

Special
Youcangainthisfeatmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewtypeof
weapon.
AfightermayselectWeaponFocusasoneofhisfighterbonusfeats.HemusthaveWeaponFocuswithaweapontogainthe
WeaponSpecializationfeatforthatweapon.

WeaponSpecialization[General]
ChooseonetypeofweaponforwhichyouhavealreadyselectedtheWeaponFocusfeat.Youcanalsochooseunarmed
strikeorgrappleasyourweaponforpurposesofthisfeat.Youdealextradamagewhenusingthisweapon.

Prerequisites
Proficiencywithselectedweapon,WeaponFocuswithselectedweapon,fighterlevel4th.

Benefit
Yougaina+2bonusonalldamagerollsyoumakeusingtheselectedweapon.

Special
Youcangainthisfeatmultipletimes.Itseffectsdonotstack.Eachtimeyoutakethefeat,itappliestoanewtypeof
weapon.
AfightermayselectWeaponSpecializationasoneofhisfighterbonusfeats.

Page115of462
WhirlwindAttack[General]
Prerequisites
Dex13,Int13,CombatExpertise,Dodge,Mobility,SpringAttack,baseattackbonus+4.

Benefit
Whenyouusethefullattackaction,youcangiveupyourregularattacksandinsteadmakeonemeleeattackatyourfull
baseattackbonusagainsteachopponentwithinreach.
WhenyouusetheWhirlwindAttackfeat,youalsoforfeitanybonusorextraattacksgrantedbyotherfeats,spells,or
abilities.

Special
AfightermayselectWhirlwindAttackasoneofhisfighterbonusfeats.

WidenSpell[Metamagic]
Benefit
Youcanalteraburst,emanation,line,orspreadshapedspelltoincreaseitsarea.Anynumericmeasurementsofthespells
areaincreaseby100%.Awidenedspellusesupaspellslotthreelevelshigherthanthespellsactuallevel.
Spellsthatdonothaveanareaofoneofthesefoursortsarenotaffectedbythisfeat.

Equipment
Assumeacharacterownsatleastoneoutfitofnormalclothes.Pickanyoneofthefollowingclothingoutfits:artisansoutfit,
entertainersoutfit,explorersoutfit,monksoutfit,peasantsoutfit,scholarsoutfit,ortravelersoutfit.

WealthandMoney
Coins
Themostcommoncoinisthegoldpiece(gp).Agoldpieceisworth10silverpieces.Eachsilverpieceisworth10copper
pieces(cp).Inadditiontocopper,silver,andgoldcoins,therearealsoplatinumpieces(pp),whichareeachworth10gp.
Thestandardcoinweighsaboutathirdofanounce(fiftytothepound).
Table:Coins
EXCHANGEVALUE
CP SP GP PP
Copperpiece(cp)= 1 1/10 1/100 1/1,000
Silverpiece(sp)= 10 1 1/10 1/100
Goldpiece(gp)= 100 10 1 1/10
Platinumpiece(pp)= 1,000 100 10 1

WealthOtherThanCoins
Merchantscommonlyexchangetradegoodswithoutusingcurrency.Asameansofcomparison,sometradegoodsare
detailedbelow.
Table:TradeGoods
COST ITEM
1cp Onepoundofwheat
2cp Onepoundofflour,oronechicken
1sp Onepoundofiron
5sp Onepoundoftobaccoorcopper
1gp Onepoundofcinnamon,oronegoat
2gp Onepoundofgingerorpepper,oronesheep
3gp Onepig
4gp Onesquareyardoflinen
5gp Onepoundofsaltorsilver
10gp Onesquareyardofsilk,oronecow
15gp Onepoundofsaffronorcloves,oroneox

SellingLoot
Ingeneral,acharactercansellsomethingforhalfitslistedprice.
Page116of462
Tradegoodsaretheexceptiontothehalfpricerule.Atradegood,inthissense,isavaluablegoodthatcanbeeasily
exchangedalmostasifitwerecashitself.

Weapons
WeaponCategories
Weaponsaregroupedintoseveralinterlockingsetsofcategories.
Thesecategoriespertaintowhattrainingisneededtobecomeproficientinaweaponsuse(simple,martial,orexotic),the
weaponsusefulnesseitherinclosecombat(melee)oratadistance(ranged,whichincludesboththrownandprojectile
weapons),itsrelativeencumbrance(light,onehanded,ortwohanded),anditssize(Small,Medium,orLarge).

Simple,Martial,andExoticWeapons
Anybodybutadruid,monk,rogue,orwizardisproficientwithallsimpleweapons.Barbarians,fighters,paladins,and
rangersareproficientwithallsimpleandallmartialweapons.Charactersofotherclassesareproficientwithanassortment
ofmainlysimpleweaponsandpossiblyalsosomemartialorevenexoticweapons.Acharacterwhousesaweaponwith
whichheorsheisnotproficienttakesa4penaltyonattackrolls.

MeleeandRangedWeapons
Meleeweaponsareusedformakingmeleeattacks,thoughsomeofthemcanbethrownaswell.Rangedweaponsare
thrownweaponsorprojectileweaponsthatarenoteffectiveinmelee.

ReachWeapons
Glaives,guisarmes,lances,longspears,ranseurs,spikedchains,andwhipsarereachweapons.Areachweaponisamelee
weaponthatallowsitswieldertostrikeattargetsthatarentadjacenttohimorher.Mostreachdoublethewieldersnatural
reach,meaningthatatypicalSmallorMediumwielderofsuchaweaponcanattackacreature10feetaway,butnota
creatureinanadjacentsquare.AtypicalLargecharacterwieldingareachweaponoftheappropriatesizecanattacka
creature15or20feetaway,butnotadjacentcreaturesorcreaturesupto10feetaway.

DoubleWeapons
Direflails,dwarvenurgroshes,gnomehookedhammers,orcdoubleaxes,quarterstaffs,andtwobladedswordsaredouble
weapons.Acharactercanfightwithbothendsofadoubleweaponasiffightingwithtwoweapons,butheorsheincursall
thenormalattackpenaltiesassociatedwithtwoweaponcombat,justasthoughthecharacterwerewieldingaonehanded
weaponandalightweapon.
Thecharactercanalsochoosetouseadoubleweapontwohanded,attackingwithonlyoneendofit.Acreaturewieldinga
doubleweaponinonehandcantuseitasadoubleweapononlyoneendoftheweaponcanbeusedinanygivenround.

ThrownWeapons
Daggers,clubs,shortspears,spears,darts,javelins,throwingaxes,lighthammers,tridents,shuriken,andnetsarethrown
weapons.ThewielderapplieshisorherStrengthmodifiertodamagedealtbythrownweapons(exceptforsplash
weapons).Itispossibletothrowaweaponthatisntdesignedtobethrown(thatis,ameleeweaponthatdoesnthavea
numericentryintheRangeIncrementcolumnonTable:Weapons),butacharacterwhodoessotakesa4penaltyonthe
attackroll.Throwingalightoronehandedweaponisastandardaction,whilethrowingatwohandedweaponisafull
roundaction.Regardlessofthetypeofweapon,suchanattackscoresathreatonlyonanaturalrollof20anddealsdouble
damageonacriticalhit.Suchaweaponhasarangeincrementof10feet.

ProjectileWeapons
Lightcrossbows,slings,heavycrossbows,shortbows,compositeshortbows,longbows,compositelongbows,hand
crossbows,andrepeatingcrossbowsareprojectileweapons.Mostprojectileweaponsrequiretwohandstouse(seespecific
weapondescriptions).AcharactergetsnoStrengthbonusondamagerollswithaprojectileweaponunlessitsaspecially
builtcompositeshortbow,speciallybuiltcompositelongbow,orsling.IfthecharacterhasapenaltyforlowStrength,apply
ittodamagerollswhenheorsheusesaboworasling.

Ammunition
Projectileweaponsuseammunition:arrows(forbows),bolts(forcrossbows),orslingbullets(forslings).Whenusinga
bow,acharactercandrawammunitionasafreeaction;crossbowsandslingsrequireanactionforreloading.Generally
speaking,ammunitionthathitsitstargetisdestroyedorrendereduseless,whilenormalammunitionthatmisseshasa50%
chanceofbeingdestroyedorlost.
Althoughtheyarethrownweapons,shurikenaretreatedasammunitionforthepurposesofdrawingthem,crafting

Page117of462
masterworkorotherwisespecialversionsofthem(seeMasterworkWeapons),andwhathappenstothemaftertheyare
thrown.

Light,OneHanded,andTwoHandedMeleeWeapons
Thisdesignationisameasureofhowmucheffortittakestowieldaweaponincombat.Itindicateswhetheramelee
weapon,whenwieldedbyacharacteroftheweaponssizecategory,isconsideredalightweapon,aonehandedweapon,or
atwohandedweapon.

Light
Alightweaponiseasiertouseinonesoffhandthanaonehandedweaponis,anditcanbeusedwhilegrappling.Alight
weaponisusedinonehand.AddthewieldersStrengthbonus(ifany)todamagerollsformeleeattackswithalight
weaponifitsusedintheprimaryhand,oronehalfthewieldersStrengthbonusifitsusedintheoffhand.Usingtwo
handstowieldalightweapongivesnoadvantageondamage;theStrengthbonusappliesasthoughtheweaponwereheld
inthewieldersprimaryhandonly.
Anunarmedstrikeisalwaysconsideredalightweapon.

OneHanded
Aonehandedweaponcanbeusedineithertheprimaryhandortheoffhand.AddthewieldersStrengthbonustodamage
rollsformeleeattackswithaonehandedweaponifitsusedintheprimaryhand,or1/2hisorherStrengthbonusifits
usedintheoffhand.Ifaonehandedweaponiswieldedwithtwohandsduringmeleecombat,add11/2timesthe
charactersStrengthbonustodamagerolls.

TwoHanded
Twohandsarerequiredtouseatwohandedmeleeweaponeffectively.Apply11/2timesthecharactersStrengthbonusto
damagerollsformeleeattackswithsuchaweapon.

WeaponSize
Everyweaponhasasizecategory.Thisdesignationindicatesthesizeofthecreatureforwhichtheweaponwasdesigned.
Aweaponssizecategoryisntthesameasitssizeasanobject.Instead,aweaponssizecategoryiskeyedtothesizeofthe
intendedwielder.Ingeneral,alightweaponisanobjecttwosizecategoriessmallerthanthewielder,aonehandedweapon
isanobjectonesizecategorysmallerthanthewielder,andatwohandedweaponisanobjectofthesamesizecategoryas
thewielder.
InappropriatelySizedWeapons:Acreaturecantmakeoptimumuseofaweaponthatisntproperlysizedforit.A
cumulative2penaltyappliesonattackrollsforeachsizecategoryofdifferencebetweenthesizeofitsintendedwielder
andthesizeofitsactualwielder.Ifthecreatureisntproficientwiththeweapona4nonproficiencypenaltyalsoapplies.
Themeasureofhowmucheffortittakestouseaweapon(whethertheweaponisdesignatedasalight,onehanded,or
twohandedweaponforaparticularwielder)isalteredbyonestepforeachsizecategoryofdifferencebetweenthe
wielderssizeandthesizeofthecreatureforwhichtheweaponwasdesigned.Ifaweaponsdesignationwouldbechanged
tosomethingotherthanlight,onehanded,ortwohandedbythisalteration,thecreaturecantwieldtheweaponatall.

ImprovisedWeapons
Sometimesobjectsnotcraftedtobeweaponsnonethelessseeuseincombat.Becausesuchobjectsarenotdesignedforthis
use,anycreaturethatusesoneincombatisconsideredtobenonproficientwithitandtakesa4penaltyonattackrolls
madewiththatobject.Todeterminethesizecategoryandappropriatedamageforanimprovisedweapon,compareits
relativesizeanddamagepotentialtotheweaponlisttofindareasonablematch.Animprovisedweaponscoresathreaton
anaturalrollof20anddealsdoubledamageonacriticalhit.Animprovisedthrownweaponhasarangeincrementof10
feet.

WeaponQualities
Hereistheformatforweaponentries(givenascolumnheadingsonTable:Weapons,below).

Cost
Thisvalueistheweaponscostingoldpieces(gp)orsilverpieces(sp).Thecostincludesmiscellaneousgearthatgoeswith
theweapon.
ThiscostisthesameforaSmallorMediumversionoftheweapon.ALargeversioncoststwicethelistedprice.

Page118of462
Damage
TheDamagecolumnsgivethedamagedealtbytheweapononasuccessfulhit.ThecolumnlabeledDmg(S)isforSmall
weapons.ThecolumnlabeledDmg(M)isforMediumweapons.Iftwodamagerangesaregiventhentheweaponisa
doubleweapon.Usetheseconddamagefiguregivenforthedoubleweaponsextraattack.

Critical
Theentryinthiscolumnnoteshowtheweaponisusedwiththerulesforcriticalhits.Whenyourcharacterscoresacritical
hit,rollthedamagetwo,three,orfourtimes,asindicatedbyitscriticalmultiplier(usingallapplicablemodifiersoneach
roll),andaddalltheresultstogether.
Exception:Extradamageoverandaboveaweaponsnormaldamageisnotmultipliedwhenyouscoreacriticalhit.
X2:Theweapondealsdoubledamageonacriticalhit.
X3:Theweapondealstripledamageonacriticalhit.
X3/X4:Oneheadofthisdoubleweapondealstripledamageonacriticalhit.Theotherheaddealsquadrupledamageona
criticalhit.
X4:Theweapondealsquadrupledamageonacriticalhit.
1920/x2:Theweaponscoresathreatonanaturalrollof19or20(insteadofjust20)anddealsdoubledamageona
criticalhit.(Theweaponhasathreatrangeof1920.)
1820/x2:Theweaponscoresathreatonanaturalrollof18,19,or20(insteadofjust20)anddealsdoubledamageona
criticalhit.(Theweaponhasathreatrangeof1820.)

RangeIncrement
Anyattackatlessthanthisdistanceisnotpenalizedforrange.However,eachfullrangeincrementimposesacumulative2
penaltyontheattackroll.Athrownweaponhasamaximumrangeoffiverangeincrements.Aprojectileweaponcanshoot
outtotenrangeincrements.

Weight
ThiscolumngivestheweightofaMediumversionoftheweapon.HalvethisnumberforSmallweaponsanddoubleitfor
Largeweapons.

Type
Weaponsareclassifiedaccordingtothetypeofdamagetheydeal:bludgeoning,piercing,orslashing.Somemonstersmay
beresistantorimmunetoattacksfromcertaintypesofweapons.
Someweaponsdealdamageofmultipletypes.Ifaweaponisoftwotypes,thedamageitdealsisnothalfonetypeandhalf
another;allofitisbothtypes.Therefore,acreaturewouldhavetobeimmunetobothtypesofdamagetoignoreanyofthe
damagefromsuchaweapon.
Inothercases,aweaponcandealeitheroftwotypesofdamage.Inasituationwhenthedamagetypeissignificant,the
wieldercanchoosewhichtypeofdamagetodealwithsuchaweapon.

Special
Someweaponshavespecialfeatures.Seetheweapondescriptionsfordetails.

WeaponDescriptions
Table:SimpleWeapons
SIMPLEWEAPONS COST DMG(S) DMG(M) CRITICAL RANGEINCREMENT WEIGHT1 TYPE2
UnarmedAttacks
Gauntlet 2gp 1d2 1d3 x2 1lb. Bludgeoning
Unarmedstrike 1d23 1d33 x2 Bludgeoning
LIGHTMELEEWEAPONS
Dagger 2gp 1d3 1d4 1920/x2 10ft. 1lb. Piercingorslashing
Dagger,punching 2gp 1d3 1d4 x3 1lb. Piercing
Gauntlet,spiked 5gp 1d3 1d4 x2 1lb. Piercing
Mace,light 5gp 1d4 1d6 x2 4lb. Bludgeoning
Sickle 6gp 1d4 1d6 x2 2lb. Slashing
ONEHANDEDMELEEWEAPONS
Club 1d4 1d6 x2 10ft. 3lb. Bludgeoning
Mace,heavy 12gp 1d6 1d8 x2 8lb. Bludgeoning

Page119of462
SIMPLEWEAPONS COST DMG(S) DMG(M) CRITICAL RANGEINCREMENT WEIGHT1 TYPE2
Morningstar 8gp 1d6 1d8 x2 6lb. Bludgeoningandpiercing
Shortspear 1gp 1d4 1d6 x2 20ft. 3lb. Piercing
TWOHANDEDMELEEWEAPONS
Longspear4 5gp 1d6 1d8 x3 9lb. Piercing
Quarterstaff5 1d4/1d4 1d6/1d6 x2 4lb. Bludgeoning
Spear 2gp 1d6 1d8 x3 20ft. 6lb. Piercing
RANGEDWEAPONS
Crossbow,heavy 50gp 1d8 1d10 1920/x2 120ft. 8lb. Piercing
Bolts,crossbow(10) 1gp 1lb.
Crossbow,light 35gp 1d6 1d8 1920/x2 80ft. 4lb. Piercing
Bolts,crossbow(10) 1gp 1lb.
Dart 5sp 1d3 1d4 x2 20ft. 1/2lb. Piercing
Javelin 1gp 1d4 1d6 x2 30ft. 2lb. Piercing
Sling 1d3 1d4 x2 50ft. 0lb. Bludgeoning
Bullets,sling(10) 1sp 5lb.
Table:MartialWeapons
MARTIALWEAPONS COST DMG(S) DMG(M) CRITICAL RANGEINCREMENT WEIGHT1 TYPE2
LIGHTMELEEWEAPONS
Axe,throwing 8gp 1d4 1d6 x2 10ft. 2lb. Slashing
Hammer,light 1gp 1d3 1d4 x2 20ft. 2lb. Bludgeoning
Handaxe 6gp 1d4 1d6 x3 3lb. Slashing
Kukri 8gp 1d3 1d4 1820/x2 2lb. Slashing
Pick,light 4gp 1d3 1d4 x4 3lb. Piercing
Sap 1gp 1d43 1d63 x2 2lb. Bludgeoning
Shield,light special 1d2 1d3 x2 special Bludgeoning
Spikedarmor special 1d4 1d6 x2 special Piercing
Spikedshield,light special 1d3 1d4 x2 special Piercing
Sword,short 10gp 1d4 1d6 1920/x2 2lb. Piercing
ONEHANDEDMELEEWEAPONS
Battleaxe 10gp 1d6 1d8 x3 6lb. Slashing
Flail 8gp 1d6 1d8 x2 5lb. Bludgeoning
Longsword 15gp 1d6 1d8 1920/x2 4lb. Slashing
Pick,heavy 8gp 1d4 1d6 x4 6lb. Piercing
Rapier 20gp 1d4 1d6 1820/x2 2lb. Piercing
Scimitar 15gp 1d4 1d6 1820/x2 4lb. Slashing
Shield,heavy special 1d3 1d4 x2 special Bludgeoning
Spikedshield,heavy special 1d4 1d6 x2 special Piercing
Trident 15gp 1d6 1d8 x2 10ft. 4lb. Piercing
Warhammer 12gp 1d6 1d8 x3 5lb. Bludgeoning
TWOHANDEDMELEEWEAPONS
Falchion 75gp 1d6 2d4 1820/x2 8lb. Slashing
Glaive4 8gp 1d8 1d10 x3 10lb. Slashing
Greataxe 20gp 1d10 1d12 x3 12lb. Slashing
Greatclub 5gp 1d8 1d10 x2 8lb. Bludgeoning
Flail,heavy 15gp 1d8 1d10 1920/x2 10lb. Bludgeoning
Greatsword 50gp 1d10 2d6 1920/x2 8lb. Slashing
Guisarme4 9gp 1d6 2d4 x3 12lb. Slashing
Halberd 10gp 1d8 1d10 x3 12lb. Piercingorslashing
Lance4 10gp 1d6 1d8 x3 10lb. Piercing
Ranseur4 10gp 1d6 2d4 x3 12lb. Piercing
Scythe 18gp 1d6 2d4 x4 10lb. Piercingorslashing
RANGEDWEAPONS
Longbow 75gp 1d6 1d8 x3 100ft. 3lb. Piercing
Arrows(20) 1gp 3lb.
Longbow,composite 100gp 1d6 1d8 x3 110ft. 3lb. Piercing
Arrows(20) 1gp 3lb.
Shortbow 30gp 1d4 1d6 x3 60ft. 2lb. Piercing
Arrows(20) 1gp 3lb.
Shortbow,composite 75gp 1d4 1d6 x3 70ft. 2lb. Piercing
Arrows(20) 1gp 3lb.
Table:ExoticWeapons

Page120of462
EXOTICWEAPONS COST DMG(S) DMG(M) CRITICAL RANGEINCREMENT WEIGHT1 TYPE2
LIGHTMELEEWEAPONS
Kama 2gp 1d4 1d6 x2 2lb. Slashing
Nunchaku 2gp 1d4 1d6 x2 2lb. Bludgeoning
Sai 1gp 1d3 1d4 x2 10ft. 1lb. Bludgeoning
Siangham 3gp 1d4 1d6 x2 1lb. Piercing
ONEHANDEDMELEEWEAPONS
Sword,bastard 35gp 1d8 1d10 1920/x2 6lb. Slashing
Waraxe,dwarven 30gp 1d8 1d10 x3 8lb. Slashing
Whip4 1gp 1d23 1d33 x2 2lb. Slashing
TWOHANDEDMELEEWEAPONS
Axe,orcdouble5 60gp 1d6/1d6 1d8/1d8 x3 15lb. Slashing
Chain,spiked4 25gp 1d6 2d4 x2 10lb. Piercing
Flail,dire5 90gp 1d6/1d6 1d8/1d8 x2 10lb. Bludgeoning
Hammer,gnomehooked5 20gp 1d6/1d4 1d8/1d6 x3/x4 6lb. Bludgeoningandpiercing
Sword,twobladed5 100gp 1d6/1d6 1d8/1d8 1920/x2 10lb. Slashing
Urgrosh,dwarven5 50gp 1d6/1d4 1d8/1d6 x3 12lb. Slashingorpiercing
RANGEDWEAPONS
Bolas 5gp 1d33 1d43 x2 10ft. 2lb. Bludgeoning
Crossbow,hand 100gp 1d3 1d4 1920/x2 30ft. 2lb. Piercing
Bolts(10) 1gp 1lb.
Crossbow,repeatingheavy 400gp 1d8 1d10 1920/x2 120ft. 12lb. Piercing
Bolts(5) 1gp 1lb.
Crossbow,repeatinglight 250gp 1d6 1d8 1920/x2 80ft. 6lb. Piercing
Bolts(5) 1gp 1lb.
Net 20gp 10ft. 6lb.
Shuriken(5) 1gp 1 1d2 x2 10ft. 1/2lb. Piercing
1
WeightfiguresareforMediumweapons.ASmallweaponweighshalfasmuch,andaLargeweaponweighstwiceasmuch.
2
Whentwotypesaregiven,theweaponisbothtypesiftheentryspecifiesand,oreithertype(playerschoiceattimeofattack)ifthe
entryspecifiesor.
3
Theweapondealsnonlethaldamageratherthanlethaldamage.
4
Reachweapon.
5
Doubleweapon.

MasterworkWeapons
Amasterworkweaponisafinelycraftedversionofanormalweapon.Wieldingitprovidesa+1enhancementbonuson
attackrolls.
Youcantaddthemasterworkqualitytoaweaponafteritiscreated;itmustbecraftedasamasterworkweapon(seethe
Craftskill).Themasterworkqualityadds300gptothecostofanormalweapon(or6gptothecostofasingleunitof
ammunition).Addingthemasterworkqualitytoadoubleweaponcoststwicethenormalincrease(+600gp).
Masterworkammunitionisdamaged(effectivelydestroyed)whenused.Theenhancementbonusofmasterwork
ammunitiondoesnotstackwithanyenhancementbonusoftheprojectileweaponfiringit.
Allmagicweaponsareautomaticallyconsideredtobeofmasterworkquality.Theenhancementbonusgrantedbythe
masterworkqualitydoesntstackwiththeenhancementbonusprovidedbytheweaponsmagic.
Eventhoughsometypesofarmorandshieldscanbeusedasweapons,youcantcreateamasterworkversionofsuchan
itemthatconfersanenhancementbonusonattackrolls.Instead,masterworkarmorandshieldshavelessenedarmorcheck
penalties.

Armor
ArmorQualities
Towearheavierarmoreffectively,acharactercanselecttheArmorProficiencyfeats,butmostclassesareautomatically
proficientwiththearmorsthatworkbestforthem.
Armorandshieldscantakedamagefromsometypesofattacks.
Hereistheformatforarmorentries(givenascolumnheadingsonTable:ArmorandShields,below).

Page121of462
Cost
ThecostofthearmorforSmallorMediumhumanoidcreatures.SeeArmorforUnusualCreatures,below,forarmorprices
forothercreatures.

Armor/ShieldBonus
EacharmorgrantsanarmorbonustoAC,whileshieldsgrantashieldbonustoAC.Thearmorbonusfromasuitofarmor
doesntstackwithothereffectsoritemsthatgrantanarmorbonus.Similarly,theshieldbonusfromashielddoesntstack
withothereffectsthatgrantashieldbonus.

MaximumDexBonus
ThisnumberisthemaximumDexteritybonustoACthatthistypeofarmorallows.Heavierarmorslimitmobility,reducing
thewearersabilitytododgeblows.ThisrestrictiondoesntaffectanyotherDexterityrelatedabilities.
EvenifacharactersDexteritybonustoACdropsto0becauseofarmor,thissituationdoesnotcountaslosingaDexterity
bonustoAC.
Yourcharactersencumbrance(theamountofgearheorshecarries)mayalsorestrictthemaximumDexteritybonusthat
canbeappliedtohisorherArmorClass.
Shields:ShieldsdonotaffectacharactersmaximumDexteritybonus.

ArmorCheckPenalty
Anyarmorheavierthanleatherhurtsacharactersabilitytousesomeskills.Anarmorcheckpenaltynumberisthepenalty
thatappliestoBalance,Climb,EscapeArtist,Hide,Jump,MoveSilently,SleightofHand,andTumblechecksbyacharacter
wearingacertainkindofarmor.DoublethenormalarmorcheckpenaltyisappliedtoSwimchecks.Acharacters
encumbrance(theamountofgearcarried,includingarmor)mayalsoapplyanarmorcheckpenalty.
Shields:Ifacharacteriswearingarmorandusingashield,botharmorcheckpenaltiesapply.
NonproficientwithArmorWorn:Acharacterwhowearsarmorand/orusesashieldwithwhichheorsheisnotproficient
takesthearmors(and/orshields)armorcheckpenaltyonattackrollsandonallStrengthbasedandDexteritybased
abilityandskillchecks.Thepenaltyfornonproficiencywitharmorstackswiththepenaltyfornonproficiencywithshields.

Speed
Mediumorheavyarmorslowsthewearerdown.ThenumberonTable:ArmorandShieldsisthecharactersspeedwhile
wearingthearmor.Humans,elves,halfelves,andhalforcshaveanunencumberedspeedof30feet.Shieldsdonotaffecta
charactersspeed.

Weight
ThiscolumngivestheweightofthearmorsizedforaMediumwearer.ArmorfittedforSmallcharactersweighshalfas
much,andarmorforLargecharactersweighstwiceasmuch.

ArmorDescriptions
Table:LightArmor
ARMOR COST ACBONUS MAXDEXBONUS CHECKPENALTY SPEED WEIGHT1
Padded 5gp +1 +8 0 30ft. 10lb.
Leather 10gp +2 +6 0 30ft. 15lb.
Studdedleather 25gp +3 +5 1 30ft. 20lb.
Chainshirt 100gp +4 +4 2 30ft. 25lb.
Table:MediumArmor
ARMOR COST ACBONUS MAXDEXBONUS CHECKPENALTY SPEED WEIGHT1
Hide 15gp +3 +4 3 20ft. 25lb.
Scalemail 50gp +4 +3 4 20ft. 30lb.
Chainmail 150gp +5 +2 5 20ft. 40lb.
Breastplate 200gp +5 +3 4 20ft. 30lb.
Table:HeavyArmor
ARMOR COST ACBONUS MAXDEXBONUS CHECKPENALTY SPEED WEIGHT1
Splintmail 200gp +6 +0 7 20ft.2 45lb.
Bandedmail 250gp +6 +1 6 20ft.2 35lb.
Halfplate 600gp +7 +0 7 20ft.2 50lb.
Fullplate 1,500gp +8 +1 6 20ft.2 50lb.
Table:Shields
SHIELD COST ACBONUS MAXDEXBONUS CHECKPENALTY SPEED WEIGHT1

Page122of462
Buckler 15gp +1 1 5lb.
Shield,lightwooden 3gp +1 1 5lb.
Shield,lightsteel 9gp +1 1 6lb.
Shield,heavywooden 7gp +2 2 10lb.
Shield,heavysteel 20gp +2 2 15lb.
Shield,tower 30gp +43 +2 10 45lb.
Table:ArmorandShieldExtras
EXTRA COST ACBONUS MAXDEXBONUS CHECKPENALTY SPEED WEIGHT1
Armorspikes +50gp +10lb.
Gauntlet,locked 8gp Special +5lb.
Shieldspikes +10gp +5lb.
1
WeightfiguresareforarmorsizedtofitMediumcharacters.
2
Whenrunninginheavyarmor,youmoveonlytripleyourspeed,notquadruple.
3
Atowershieldcaninsteadgrantyoucover.Seethedescription.

MasterworkArmor
Justaswithweapons,youcanpurchaseorcraftmasterworkversionsofarmororshields.Suchawellmadeitemfunctions
likethenormalversion,exceptthatitsarmorcheckpenaltyislessenedby1.
Amasterworksuitofarmororshieldcostsanextra150gpoverandabovethenormalcostforthattypeofarmororshield.
Themasterworkqualityofasuitofarmororshieldneverprovidesabonusonattackordamagerolls,evenifthearmoror
shieldisusedasaweapon.
Allmagicarmorsandshieldsareautomaticallyconsideredtobeofmasterworkquality.
Youcantaddthemasterworkqualitytoarmororashieldafteritiscreated;itmustbecraftedasamasterworkitem.

SleepinginArmor
Acharacterwhosleepsinmediumorheavyarmorisautomaticallyfatiguedthenextday.Heorshetakesa2penaltyon
StrengthandDexterityandcantchargeorrun.Sleepinginlightarmordoesnotcausefatigue.

GettingIntoandOutofArmor
Thetimerequiredtodonarmordependsonitstype;seeTable:DonningArmor.

Don
Thiscolumntellshowlongittakesacharactertoputthearmoron.(Oneminuteis10rounds.)Readying(strappingon)a
shieldisonlyamoveaction.

DonHastily
Thiscolumntellshowlongittakestoputthearmoroninahurry.Thearmorcheckpenaltyandarmorbonusforhastily
donnedarmorareeach1pointworsethannormal.

Remove
Thiscolumntellshowlongittakestogetthearmoroff.Loosingashield(removingitfromthearmanddroppingit)isonly
amoveaction.
Table:DonningArmor
ARMORTYPE DON DONHASTILY REMOVE
Shield(any) 1moveaction n/a 1moveaction
Padded,leather,hide,studdedleather,orchainshirt 1minute 5rounds 1minute1
Breastplate,scalemail,chainmail,bandedmail,orsplintmail 4minutes1 1minute 1minute1
Halfplateorfullplate 4minutes2 4minutes1 1d4+1minutes1
1
Ifthecharacterhassomehelp,cutthistimeinhalf.Asinglecharacterdoingnothingelsecanhelponeortwoadjacentcharacters.Two
characterscanthelpeachotherdonarmoratthesametime.
2
Thewearermusthavehelptodonthisarmor.Withouthelp,itcanbedonnedonlyhastily.

GoodsandServices
AdventuringGear
Table:AdventuringGear
ITEM COST WEIGHT ITEM COST WEIGHT
Backpack(empty) 2gp 2lb.1 Lock,Good 80gp 1lb.

Page123of462
ITEM COST WEIGHT ITEM COST WEIGHT
Barrel(empty) 2gp 30lb. Lock,Amazing 150gp 1lb.
Basket(empty) 4sp 1lb. Manacles 15gp 2lb.
Bedroll 1sp 5lb.1 Manacles,masterwork 50gp 2lb.
Bell 1gp Mirror,smallsteel 10gp 1/2lb.
Blanket,winter 5sp 3lb.1 Mug/Tankard,clay 2cp 1lb.
Blockandtackle 5gp 5lb. Oil(1pintflask) 1sp 1lb.
Bottle,wine,glass 2gp Paper(sheet) 4sp
Bucket(empty) 5sp 2lb. Parchment(sheet) 2sp
Caltrops 1gp 2lb. Pick,miners 3gp 10lb.
Candle 1cp Pitcher,clay 2cp 5lb.
Canvas(sq.yd.) 1sp 1lb. Piton 1sp 1/2lb.
Case,maporscroll 1gp 1/2lb. Pole,10foot 2sp 8lb.
Chain(10ft.) 30gp 2lb. Pot,iron 5sp 10lb.
Chalk,1piece 1cp Pouch,belt(empty) 1gp 1/2lb.1
Chest(empty) 2gp 25lb. Ram,portable 10gp 20lb.
Crowbar 2gp 5lb. Rations,trail(perday) 5sp 1lb.1
Firewood(perday) 1cp 20lb. Rope,hempen(50ft.) 1gp 10lb.
Fishhook 1sp Rope,silk(50ft.) 10gp 5lb.
Fishingnet,25sq.ft. 4gp 5lb. Sack(empty) 1sp 1/2lb.1
Flask(empty) 3cp 11/2lb. Sealingwax 1gp 1lb.
Flintandsteel 1gp Sewingneedle 5sp
Grapplinghook 1gp 4lb. Signalwhistle 8sp
Hammer 5sp 2lb. Signetring 5gp
Ink(1oz.vial) 8gp Sledge 1gp 10lb.
Inkpen 1sp Soap(perlb.) 5sp 1lb.
Jug,clay 3cp 9lb. Spadeorshovel 2gp 8lb.
Ladder,10foot 5cp 20lb. Spyglass 1,000gp 1lb.
Lamp,common 1sp 1lb. Tent 10gp 20lb.1
Lantern,bullseye 12gp 3lb. Torch 1cp 1lb.
Lantern,hooded 7gp 2lb. Vial,inkorpotion 1gp 1/10lb.
Lock,Verysimple 20gp 1lb. Waterskin 1gp 4lb.1
Lock,Average 40gp 1lb. Whetstone 2cp 1lb.
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
Afewofthepiecesofadventuringgearfoundontheabovetablearedescribedbelow,alongwithanyspecialbenefitsthey
conferontheuser(you).
Caltrops:Acaltropisafourprongedironspikecraftedsothatoneprongfacesupnomatterhowthecaltropcomestorest.
Youscattercaltropsonthegroundinthehopethatyourenemiessteponthemorareatleastforcedtoslowdowntoavoid
them.One2poundbagofcaltropscoversanarea5feetsquare.
Eachtimeacreaturemovesintoanareacoveredbycaltrops(orspendsaroundfightingwhilestandinginsuchanarea),it
mightsteponone.Thecaltropsmakeanattackroll(baseattackbonus+0)againstthecreature.Forthisattack,the
creaturesshield,armor,anddeflectionbonusesdonotcount.Ifthecreatureiswearingshoesorotherfootwear,itgetsa
+2armorbonustoAC.Ifthecaltropssucceedontheattack,thecreaturehassteppedonone.Thecaltropdeals1pointof
damage,andthecreaturesspeedisreducedbyonehalfbecauseitsfootiswounded.Thismovementpenaltylastsfor24
hours,oruntilthecreatureissuccessfullytreatedwithaDC15Healcheck,oruntilitreceivesatleast1pointofmagical
curing.Achargingorrunningcreaturemustimmediatelystopifitstepsonacaltrop.Anycreaturemovingathalfspeedor
slowercanpickitswaythroughabedofcaltropswithnotrouble.
Caltropsmaynotbeeffectiveagainstunusualopponents.
Candle:Acandledimlyilluminatesa5footradiusandburnsfor1hour.
Chain:Chainhashardness10and5hitpoints.ItcanbeburstwithaDC26Strengthcheck.
Crowbar:Acrowbaritgrantsa+2circumstancebonusonStrengthchecksmadeforsuchpurposes.Ifusedincombat,treat
acrowbarasaonehandedimprovisedweaponthatdealsbludgeoningdamageequaltothatofaclubofitssize.
FlintandSteel:Lightingatorchwithflintandsteelisafullroundaction,andlightinganyotherfirewiththemtakesat
Page124of462
leastthatlong.
GrapplingHook:ThrowingagrapplinghooksuccessfullyrequiresaUseRopecheck(DC10,+2per10feetofdistance
thrown).
Hammer:Ifahammerisusedincombat,treatitasaonehandedimprovisedweaponthatdealsbludgeoningdamageequal
tothatofaspikedgauntletofitssize.
Ink:Thisisblackink.Youcanbuyinkinothercolors,butitcoststwiceasmuch.
Jug,Clay:Thisbasicceramicjugisfittedwithastopperandholds1gallonofliquid.
Lamp,Common:Alampclearlyilluminatesa15footradius,providesshadowyilluminationouttoa30footradius,and
burnsfor6hoursonapintofoil.Youcancarryalampinonehand.
Lantern,Bullseye:Abullseyelanternprovidesclearilluminationina60footconeandshadowyilluminationina120foot
cone.Itburnsfor6hoursonapintofoil.Youcancarryabullseyelanterninonehand.
Lantern,Hooded:Ahoodedlanternclearlyilluminatesa30footradiusandprovidesshadowyilluminationina60foot
radius.Itburnsfor6hoursonapintofoil.Youcancarryahoodedlanterninonehand.
Lock:TheDCtoopenalockwiththeOpenLockskilldependsonthelocksquality:simple(DC20),average(DC25),good
(DC30),orsuperior(DC40).
ManaclesandManacles,Masterwork:ManaclescanbindaMediumcreature.AmanacledcreaturecanusetheEscapeArtist
skilltoslipfree(DC30,orDC35formasterworkmanacles).BreakingthemanaclesrequiresaStrengthcheck(DC26,or
DC28formasterworkmanacles).Manacleshavehardness10and10hitpoints.
Mostmanacleshavelocks;addthecostofthelockyouwanttothecostofthemanacles.
Forthesamecost,youcanbuymanaclesforaSmallcreature.
ForaLargecreature,manaclescosttentimestheindicatedamount,andforaHugecreature,onehundredtimesthis
amount.Gargantuan,Colossal,Tiny,Diminutive,andFinecreaturescanbeheldonlybyspeciallymademanacles.
Oil:Apintofoilburnsfor6hoursinalantern.Youcanuseaflaskofoilasasplashweapon.Usetherulesforalchemists
fire,exceptthatittakesafullroundactiontoprepareaflaskwithafuse.Onceitisthrown,thereisa50%chanceofthe
flaskignitingsuccessfully.
Youcanpourapintofoilonthegroundtocoveranarea5feetsquare,providedthatthesurfaceissmooth.Iflit,theoil
burnsfor2roundsanddeals1d3pointsoffiredamagetoeachcreatureinthearea.
Ram,Portable:Thisironshodwoodenbeamgivesyoua+2circumstancebonusonStrengthchecksmadetobreakopena
dooranditallowsasecondpersontohelpyouwithouthavingtoroll,increasingyourbonusby2.
Rope,Hempen:Thisropehas2hitpointsandcanbeburstwithaDC23Strengthcheck.
Rope,Silk:Thisropehas4hitpointsandcanbeburstwithaDC24Strengthcheck.Itissosupplethatitprovidesa+2
circumstancebonusonUseRopechecks.
Spyglass:Objectsviewedthroughaspyglassaremagnifiedtotwicetheirsize.
Torch:Torchburnsfor1hour,clearlyilluminatinga20footradiusandprovidingshadowyilluminationouttoa40foot
radius.Ifatorchisusedincombat,treatitasaonehandedimprovisedweaponthatdealsbludgeoningdamageequalto
thatofagauntletofitssize,plus1pointoffiredamage.
Vial:Vialholds1ounceofliquid.Thestopperedcontainerusuallyisnomorethan1inchwideand3incheshigh.

SpecialSubstancesandItems
Table:SpecialSubstancesandItems
ITEM COST WEIGHT ITEM COST WEIGHT
Acid(flask) 10gp 1lb. Smokestick 20gp 1/2lb.
Alchemistsfire(flask) 20gp 1lb. Sunrod 2gp 1lb.
Antitoxin(vial) 50gp Tanglefootbag 50gp 4lb.
Everburningtorch 110gp 1lb. Thunderstone 30gp 1lb.
Holywater(flask) 25gp 1lb. Tindertwig 1gp
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
Page125of462
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
AnyofthesesubstancesexceptfortheeverburningtorchandholywatercanbemadebyacharacterwiththeCraft
(alchemy)skill.
Acid:Youcanthrowaflaskofacidasasplashweapon.Treatthisattackasarangedtouchattackwitharangeincrementof
10feet.Adirecthitdeals1d6pointsofaciddamage.Everycreaturewithin5feetofthepointwheretheacidhitstakes1
pointofaciddamagefromthesplash.
AlchemistsFire:Youcanthrowaflaskofalchemistsfireasasplashweapon.Treatthisattackasarangedtouchattackwith
arangeincrementof10feet.
Adirecthitdeals1d6pointsoffiredamage.Everycreaturewithin5feetofthepointwheretheflaskhitstakes1pointof
firedamagefromthesplash.Ontheroundfollowingadirecthit,thetargettakesanadditional1d6pointsofdamage.If
desired,thetargetcanuseafullroundactiontoattempttoextinguishtheflamesbeforetakingthisadditionaldamage.
ExtinguishingtheflamesrequiresaDC15Reflexsave.Rollingonthegroundprovidesthetargeta+2bonusonthesave.
Leapingintoalakeormagicallyextinguishingtheflamesautomaticallysmothersthefire.
Antitoxin:Ifyoudrinkantitoxin,yougeta+5alchemicalbonusonFortitudesavingthrowsagainstpoisonfor1hour.
EverburningTorch:Thisotherwisenormaltorchhasacontinualflamespellcastuponit.Aneverburningtorchclearly
illuminatesa20footradiusandprovidesshadowyilluminationouttoa40footradius.
HolyWater:Holywaterdamagesundeadcreaturesandeviloutsidersalmostasifitwereacid.Aflaskofholywatercanbe
thrownasasplashweapon.
Treatthisattackasarangedtouchattackwitharangeincrementof10feet.Aflaskbreaksifthrownagainstthebodyofa
corporealcreature,buttouseitagainstanincorporealcreature,youmustopentheflaskandpourtheholywateroutonto
thetarget.Thus,youcandouseanincorporealcreaturewithholywateronlyifyouareadjacenttoit.Doingsoisaranged
touchattackthatdoesnotprovokeattacksofopportunity.
Adirecthitbyaflaskofholywaterdeals2d4pointsofdamagetoanundeadcreatureoraneviloutsider.Eachsuch
creaturewithin5feetofthepointwheretheflaskhitstakes1pointofdamagefromthesplash.
Templestogooddeitiessellholywateratcost(makingnoprofit).
Smokestick:Thisalchemicallytreatedwoodenstickinstantlycreatesthick,opaquesmokewhenignited.Thesmokefillsa
10footcube(treattheeffectasafogcloudspell,exceptthatamoderateorstrongerwinddissipatesthesmokein1
round).Thestickisconsumedafter1round,andthesmokedissipatesnaturally.
Sunrod:This1footlong,goldtipped,ironrodglowsbrightlywhenstruck.Itclearlyilluminatesa30footradiusand
providesshadowyilluminationina60footradius.Itglowsfor6hours,afterwhichthegoldtipisburnedoutand
worthless.
TanglefootBag:Whenyouthrowatanglefootbagatacreature(asarangedtouchattackwitharangeincrementof10
feet),thebagcomesapartandthegooburstsout,entanglingthetargetandthenbecomingtoughandresilientupon
exposuretoair.Anentangledcreaturetakesa2penaltyonattackrollsanda4penaltytoDexterityandmustmakeaDC
15Reflexsaveorbegluedtothefloor,unabletomove.Evenonasuccessfulsave,itcanmoveonlyathalfspeed.Hugeor
largercreaturesareunaffectedbyatanglefootbag.Aflyingcreatureisnotstucktothefloor,butitmustmakeaDC15
Reflexsaveorbeunabletofly(assumingitusesitswingstofly)andfalltotheground.Atanglefootbagdoesnotfunction
underwater.
Acreaturethatisgluedtothefloor(orunabletofly)canbreakfreebymakingaDC17Strengthcheckorbydealing15
pointsofdamagetothegoowithaslashingweapon.Acreaturetryingtoscrapegoooffitself,oranothercreatureassisting,
doesnotneedtomakeanattackroll;hittingthegooisautomatic,afterwhichthecreaturethathitmakesadamagerollto
seehowmuchofthegoowasscrapedoff.Oncefree,thecreaturecanmove(includingflying)athalfspeed.Acharacter
capableofspellcastingwhoisboundbythegoomustmakeaDC15Concentrationchecktocastaspell.Thegoobecomes
brittleandfragileafter2d4rounds,crackingapartandlosingitseffectiveness.Anapplicationofuniversalsolventtoastuck
creaturedissolvesthealchemicalgooimmediately.
Thunderstone:Youcanthrowthisstoneasarangedattackwitharangeincrementof20feet.Whenitstrikesahardsurface
(orisstruckhard),itcreatesadeafeningbangthatistreatedasasonicattack.Eachcreaturewithina10footradiusspread
mustmakeaDC15Fortitudesaveorbedeafenedfor1hour.Adeafenedcreature,inadditiontotheobviouseffects,takes
a4penaltyoninitiativeandhasa20%chancetomiscastandloseanyspellwithaverbalcomponentthatittriestocast.

Page126of462
Sinceyoudontneedtohitaspecifictarget,youcansimplyaimataparticular5footsquare.TreatthetargetsquareasAC
5.
Tindertwig:Thealchemicalsubstanceontheendofthissmall,woodenstickigniteswhenstruckagainstaroughsurface.
Creatingaflamewithatindertwigismuchfasterthancreatingaflamewithflintandsteel(oramagnifyingglass)and
tinder.Lightingatorchwithatindertwigisastandardaction(ratherthanafullroundaction),andlightinganyotherfire
withoneisatleastastandardaction.

ToolsAndSkillKits
Table:ToolsandSkillKits
ITEM COST WEIGHT ITEM COST WEIGHT
Alchemistslab 500gp 40lb. Magnifyingglass 100gp
Artisanstools 5gp 5lb. Musicalinstrument,common 5gp 3lb.1
Artisanstools,masterwork 55gp 5lb. Musicalinstrument,masterwork 100gp 3lb.1
Climberskit 80gp 5lb.1 Scale,merchants 2gp 1lb.
Disguisekit 50gp 8lb.1 Spellcomponentpouch 5gp 2lb.
Healerskit 50gp 1lb. Spellbook,wizards(blank) 15gp 3lb.
Hollyandmistletoe Thievestools 30gp 1lb.
Holysymbol,wooden 1gp Thievestools,masterwork 100gp 2lb.
Holysymbol,silver 25gp 1lb. Tool,masterwork 50gp 1lb.
Hourglass 25gp 1lb. Waterclock 1,000gp 200lb.
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
AlchemistsLab:Analchemistslabalwayshastheperfecttoolformakingalchemicalitems,soitprovidesa+2
circumstancebonusonCraft(alchemy)checks.IthasnobearingonthecostsrelatedtotheCraft(alchemy)skill.Without
thislab,acharacterwiththeCraft(alchemy)skillisassumedtohaveenoughtoolstousetheskillbutnotenoughtogetthe
+2bonusthatthelabprovides.
ArtisansTools:Thesespecialtoolsincludetheitemsneededtopursueanycraft.Withoutthem,youhavetouseimprovised
tools(2penaltyonCraftchecks),ifyoucandothejobatall.
ArtisansTools,Masterwork:Thesetoolsservethesamepurposeasartisanstools(above),butmasterworkartisanstools
aretheperfecttoolsforthejob,soyougeta+2circumstancebonusonCraftchecksmadewiththem.
ClimbersKit:Thisistheperfecttoolforclimbingandgivesyoua+2circumstancebonusonClimbchecks.
DisguiseKit:Thekitistheperfecttoolfordisguiseandprovidesa+2circumstancebonusonDisguisechecks.Adisguisekit
isexhaustedaftertenuses.
HealersKit:Itistheperfecttoolforhealingandprovidesa+2circumstancebonusonHealchecks.Ahealerskitis
exhaustedaftertenuses.
HolySymbol,SilverorWooden:Aholysymbolfocusespositiveenergy.Aclericorpaladinusesitasthefocusforhisspells
andasatoolforturningundead.Eachreligionhasitsownholysymbol.
UnholySymbols:Anunholysymbolislikeaholysymbolexceptthatitfocusesnegativeenergyandisusedbyevilclerics
(orbyneutralclericswhowanttocastevilspellsorcommandundead).
MagnifyingGlass:Thissimplelensallowsacloserlookatsmallobjects.Itisalsousefulasasubstituteforflintandsteel
whenstartingfires.Lightingafirewithamagnifyingglassrequireslightasbrightassunlighttofocus,tindertoignite,and
atleastafullroundaction.Amagnifyingglassgrantsa+2circumstancebonusonAppraisechecksinvolvinganyitemthat
issmallorhighlydetailed.
MusicalInstrument,CommonorMasterwork:Amasterworkinstrumentgrantsa+2circumstancebonusonPerformchecks
involvingitsuse.
Scale,Merchants:Ascalegrantsa+2circumstancebonusonAppraisechecksinvolvingitemsthatarevaluedbyweight,
includinganythingmadeofpreciousmetals.
SpellComponentPouch:Aspellcasterwithaspellcomponentpouchisassumedtohaveallthematerialcomponentsand
focusesneededforspellcasting,exceptforthosecomponentsthathaveaspecificcost,divinefocuses,andfocusesthat
wouldntfitinapouch.
Page127of462
Spellbook,Wizards(Blank):Aspellbookhas100pagesofparchment,andeachspelltakesuponepageperspelllevel(one
pageeachfor0levelspells).
ThievesTools:ThiskitcontainsthetoolsyouneedtousetheDisableDeviceandOpenLockskills.Withoutthesetools,you
mustimprovisetools,andyoutakea2circumstancepenaltyonDisableDeviceandOpenLockschecks.
ThievesTools,Masterwork:Thiskitcontainsextratoolsandtoolsofbettermake,whichgranta+2circumstancebonuson
DisableDeviceandOpenLockchecks.
Tool,Masterwork:Thiswellmadeitemistheperfecttoolforthejob.Itgrantsa+2circumstancebonusonarelatedskill
check(ifany).Bonusesprovidedbymultiplemasterworkitemsusedtowardthesameskillcheckdonotstack.
WaterClock:Thislarge,bulkycontrivancegivesthetimeaccuratetowithinhalfanhourperdaysinceitwaslastset.It
requiresasourceofwater,anditmustbekeptstillbecauseitmarkstimebytheregulatedflowofdropletsofwater.

Clothing
Table:Clothing
ITEM COST WEIGHT ITEM COST WEIGHT
Artisansoutfit 1gp 4lb.1 Monksoutfit 5gp 2lb.1
Clericsvestments 5gp 6lb.1 Noblesoutfit 75gp 10lb.1
Coldweatheroutfit 8gp 7lb.1 Peasantsoutfit 1sp 2lb.1
Courtiersoutfit 30gp 6lb.1 Royaloutfit 200gp 15lb.1
Entertainersoutfit 3gp 4lb.1 Scholarsoutfit 5gp 6lb.1
Explorersoutfit 10gp 8lb.1 Travelersoutfit 1gp 5lb.1
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
ArtisansOutfit:Thisoutfitincludesashirtwithbuttons,askirtorpantswithadrawstring,shoes,andperhapsacaporhat.
Itmayalsoincludeabeltoraleatherorclothapronforcarryingtools.
ClericsVestments:Theseecclesiasticalclothesareforperformingpriestlyfunctions,notforadventuring.
ColdWeatherOutfit:Acoldweatheroutfitincludesawoolcoat,linenshirt,woolcap,heavycloak,thickpantsorskirt,and
boots.Thisoutfitgrantsa+5circumstancebonusonFortitudesavingthrowsagainstexposuretocoldweather.
CourtiersOutfit:Thisoutfitincludesfancy,tailoredclothesinwhateverfashionhappenstobethecurrentstyleinthe
courtsofthenobles.Anyonetryingtoinfluencenoblesorcourtierswhilewearingstreetdresswillhaveahardtimeofit(2
penaltyonCharismabasedskillcheckstoinfluencesuchindividuals).Ifyouwearthisoutfitwithoutjewelry(costingan
additional50gp),youlooklikeanoutofplacecommoner.
EntertainersOutfit:Thissetofflashy,perhapsevengaudy,clothesisforentertaining.Whiletheoutfitlookswhimsical,its
practicaldesignletsyoutumble,dance,walkatightrope,orjustrun(iftheaudienceturnsugly).
ExplorersOutfit:Thisisafullsetofclothesforsomeonewhoneverknowswhattoexpect.Itincludessturdyboots,leather
breechesoraskirt,abelt,ashirt(perhapswithavestorjacket),gloves,andacloak.Ratherthanaleatherskirt,aleather
overtunicmaybewornoveraclothskirt.Theclotheshaveplentyofpockets(especiallythecloak).Theoutfitalsoincludes
anyextraitemsyoumightneed,suchasascarforawidebrimmedhat.
MonksOutfit:Thissimpleoutfitincludessandals,loosebreeches,andalooseshirt,andisallboundtogetherwithsashes.
Theoutfitisdesignedtogiveyoumaximummobility,anditsmadeofhighqualityfabric.Youcanhidesmallweaponsin
pocketshiddeninthefolds,andthesashesarestrongenoughtoserveasshortropes.
NoblesOutfit:Thissetofclothesisdesignedspecificallytobeexpensiveandtoshowit.Preciousmetalsandgemsare
workedintotheclothing.Tofitintothenoblecrowd,everywouldbenoblealsoneedsasignetring(seeAdventuringGear,
above)andjewelry(worthatleast100gp).
PeasantsOutfit:Thissetofclothesconsistsofalooseshirtandbaggybreeches,oralooseshirtandskirtoroverdress.Cloth
wrappingsareusedforshoes.
RoyalOutfit:Thisisjusttheclothing,nottheroyalscepter,crown,ring,andotheraccoutrements.Royalclothesare
ostentatious,withgems,gold,silk,andfurinabundance.
ScholarsOutfit:Perfectforascholar,thisoutfitincludesarobe,abelt,acap,softshoes,andpossiblyacloak.
Page128of462
TravelersOutfit:Thissetofclothesconsistsofboots,awoolskirtorbreeches,asturdybelt,ashirt(perhapswithavestor
jacket),andanamplecloakwithahood.
Table:Food,Drink,andLodging
ITEM COST WEIGHT ITEM COST WEIGHT
Ale,Gallon 2sp 8lb. Meals(perday),
Ale,Mug 4cp 1lb. Meals(perday),Good 5sp
Banquet(perperson) 10gp Meals(perday),Common 3sp
Bread,perloaf 2cp 1/2lb. Meals(perday),Poor 1sp
Cheese,hunkof 1sp 1/2lb. Meat,chunkof 3sp 1/2lb.
Innstay(perday),Good 2gp Wine,Common(pitcher) 2sp 6lb.
Innstay(perday),Common 5sp Wine,Fine(bottle) 10gp 11/2lb.
Innstay(perday),Poor 2sp
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
Inn:Pooraccommodationsataninnamounttoaplaceonthefloornearthehearth.Commonaccommodationsconsistofa
placeonaraised,heatedfloor,theuseofablanketandapillow.Goodaccommodationsconsistofasmall,privateroom
withonebed,someamenities,andacoveredchamberpotinthecorner.
Meals:Poormealsmightbecomposedofbread,bakedturnips,onions,andwater.Commonmealsmightconsistofbread,
chickenstew,carrots,andwatereddownaleorwine.Goodmealsmightbecomposedofbreadandpastries,beef,peas,and
aleorwine.

MountsandRelatedGear
Table:MountsandRelatedGear
ITEM COST WEIGHT ITEM COST WEIGHT
Barding,Mediumcreature x2 x1 Warhorse,light 150gp
Barding,Largecreature x4 x2 Warpony 100gp
Bitandbridle 2gp 1lb. Saddle,Military 20gp 30lb.
Dog,guard 25gp Saddle,Pack 5gp 15lb.
Dog,riding 150gp Saddle,Riding 10gp 25lb.
Donkeyormule 8gp Saddle,ExoticMilitary 60gp 40lb.
Feed(perday) 5cp 10lb. Saddle,ExoticPack 15gp 20lb.
Horse,heavy 200gp Saddle,ExoticRiding 30gp 30lb.
Horse,light 75gp Saddlebags 4gp 8lb.
Pony 30gp Stabling(perday) 5sp
Warhorse,heavy 400gp
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
Barding,MediumCreatureandLargeCreature:Bardingisatypeofarmorthatcoversthehead,neck,chest,body,and
possiblylegsofahorseorothermount.Bardingmadeofmediumorheavyarmorprovidesbetterprotectionthanlight
barding,butattheexpenseofspeed.BardingcanbemadeofanyofthearmortypesfoundonTable:ArmorandShields.
Armorforahorse(aLargenonhumanoidcreature)costsfourtimesasmuchasarmorforahuman(aMediumhumanoid
creature)andalsoweighstwiceasmuchasthearmorfoundonTable:ArmorandShields(seeArmorforUnusual
Creatures).IfthebardingisforaponyorotherMediummount,thecostisonlydouble,andtheweightisthesameasfor
Mediumarmorwornbyahumanoid.Mediumorheavybardingslowsamountthatwearsit,asshownonthetablebelow.
Table:MountSpeedinBarding
BASESPEED
BARDING (40FT.) (50FT.) (60FT.)
Medium 30ft. 35ft. 40ft.
Heavy 30ft.1 35ft.1 40ft.1
1
Amountwearingheavyarmormovesatonlytripleitsnormalspeedwhenrunninginsteadofquadruple.
Flyingmountscantflyinmediumorheavybarding.

Page129of462
RemovingandfittingbardingtakesfivetimesaslongasthefiguresgivenonTable:DonningArmor.Abardedanimal
cannotbeusedtocarryanyloadotherthantheriderandnormalsaddlebags.
Dog,Riding:ThisMediumdogisspeciallytrainedtocarryaSmallhumanoidrider.Itisbraveincombatlikeawarhorse.
Youtakenodamagewhenyoufallfromaridingdog.
DonkeyorMule:Donkeysandmulesarestolidinthefaceofdanger,hardy,surefooted,andcapableofcarryingheavyloads
overvastdistances.Unlikeahorse,adonkeyoramuleiswilling(thoughnoteager)toenterdungeonsandotherstrangeor
threateningplaces.
Feed:Horses,donkeys,mules,andponiescangrazetosustainthemselves,butprovidingfeedforthemismuchbetter.If
youhavearidingdog,youhavetofeeditatleastsomemeat.
Horse:Ahorse(otherthanapony)issuitableasamountforahuman,dwarf,elf,halfelf,orhalforc.Aponyissmaller
thanahorseandisasuitablemountforagnomeorhalfling.
Warhorsesandwarponiescanberiddeneasilyintocombat.Lighthorses,ponies,andheavyhorsesarehardtocontrolin
combat.
Saddle,Exotic:Anexoticsaddleislikeanormalsaddleofthesamesortexceptthatitisdesignedforanunusualmount.
Exoticsaddlescomeinmilitary,pack,andridingstyles.
Saddle,Military:Amilitarysaddlebracestherider,providinga+2circumstancebonusonRidechecksrelatedtostayingin
thesaddle.Ifyoureknockedunconsciouswhileinamilitarysaddle,youhavea75%chancetostayinthesaddle
(comparedto50%foraridingsaddle).
Saddle,Pack:Apacksaddleholdsgearandsupplies,butnotarider.Itholdsasmuchgearasthemountcancarry.
Saddle,Riding:Thestandardridingsaddlesupportsarider.
Table:Transport
ITEM COST WEIGHT ITEM COST WEIGHT
Carriage 100gp 600lb. Oar 2gp 10lb.
Cart 15gp 200lb. Sailingship 10,000gp
Galley 30,000gp Sled 20gp 300lb.
Keelboat 3,000gp Wagon 35gp 400lb.
Longship 10,000gp Warship 25,000gp
Rowboat 50gp 100lb.
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
Carriage:Thisfourwheeledvehiclecantransportasmanyasfourpeoplewithinanenclosedcab,plustwodrivers.In
general,twohorses(orotherbeastsofburden)drawit.Acarriagecomeswiththeharnessneededtopullit.
Cart:Thistwowheeledvehiclecanbedrawnbyasinglehorse(orotherbeastofburden).Itcomeswithaharness.
Galley:Thisthreemastedshiphasseventyoarsoneithersideandrequiresatotalcrewof200.Agalleyis130feetlongand
20feetwide,anditcancarry150tonsofcargoor250soldiers.For8,000gpmore,itcanbefittedwitharamandcastles
withfiringplatformsfore,aft,andamidships.Thisshipcannotmakeseavoyagesandstickstothecoast.Itmovesabout4
milesperhourwhenbeingrowedorundersail.
Keelboat:This50to75footlongshipis15to20feetwideandhasafewoarstosupplementitssinglemastwithasquare
sail.Ithasacrewofeighttofifteenandcancarry40to50tonsofcargoor100soldiers.Itcanmakeseavoyages,aswellas
saildownrivers(thankstoitsflatbottom).Itmovesabout1mileperhour.
Longship:This75footlongshipwithfortyoarsrequiresatotalcrewof50.Ithasasinglemastandasquaresail,anditcan
carry50tonsofcargoor120soldiers.Alongshipcanmakeseavoyages.Itmovesabout3milesperhourwhenbeingrowed
orundersail.
Rowboat:This8to12footlongboatholdstwoorthreeMediumpassengers.Itmovesabout11/2milesperhour.
SailingShip:Thislarger,seaworthyshipis75to90feetlongand20feetwideandhasacrewof20.Itcancarry150tonsof
cargo.Ithassquaresailsonitstwomastsandcanmakeseavoyages.Itmovesabout2milesperhour.
Sled:Thisisawagononrunnersformovingthroughsnowandoverice.Ingeneral,twohorses(orotherbeastsofburden)
Page130of462
drawit.Asledcomeswiththeharnessneededtopullit.
Wagon:Thisisafourwheeled,openvehiclefortransportingheavyloads.Ingeneral,twohorses(orotherbeastsof
burden)drawit.Awagoncomeswiththeharnessneededtopullit.
Warship:This100footlongshiphasasinglemast,althoughoarscanalsopropelit.Ithasacrewof60to80rowers.This
shipcancarry160soldiers,butnotforlongdistances,sincethereisntroomforsuppliestosupportthatmanypeople.The
warshipcannotmakeseavoyagesandstickstothecoast.Itisnotusedforcargo.Itmovesabout21/2milesperhourwhen
beingrowedorundersail.
Table:SpellcastingandServices
ITEM COST WEIGHT ITEM COST WEIGHT
Coachcab 3cp/mile 600lb. Spell,2ndlevel lvlx20
10lb.
gp2
Hireling,trained 3sp/day 200lb. Spell,3rdlevel lvlx30

gp2
Hireling,untrained 1sp/day Spell,4thlevel lvlx40 300lb.
gp2
Messenger 2cp/mile Spell,5thlevel lvlx50 400lb.
gp2
Roadorgatetoll 1cp Spell,6thlevel lvlx60
gp2
Shipspassage 1sp/mile 100lb. Spell,7thlevel lvlx70
gp2
Spell,0level lvlx5gp
2
Spell,8thlevel lvlx80
gp2
Spell,1stlevel lvlx10gp
2
Spell,9thlevel lvlx90
gp2
Noweight,ornoweightworthnoting.
1
TheseitemsweighonequarterthisamountwhenmadeforSmallcharacters.ContainersforSmallcharactersalsocarryonequarterthe
normalamount.
2
Seespelldescriptionforadditionalcosts.Iftheadditionalcostsputthespellstotalcostabove3,000gp,thatspellisnotgenerally
available.
Sometimesthebestsolutionforaproblemistohiresomeoneelsetotakecareofit.
CoachCab:Thepricegivenisforarideinacoachthattransportspeople(andlightcargo)betweentowns.Forarideina
cabthattransportspassengerswithinacity,1copperpieceusuallytakesyouanywhereyouneedtogo.
Hireling,Trained:Theamountgivenisthetypicaldailywageformercenarywarriors,masons,craftsmen,scribes,
teamsters,andothertrainedhirelings.Thisvaluerepresentsaminimumwage;manysuchhirelingsrequiresignificantly
higherpay.
Hireling,Untrained:Theamountshownisthetypicaldailywageforlaborers,porters,cooks,maids,andothermenial
workers.
Messenger:Thisentryincludeshorseridingmessengersandrunners.Thosewillingtocarryamessagetoaplacetheywere
goinganywaymayaskforonlyhalftheindicatedamount.
RoadorGateToll:Atollissometimeschargedtocrossawelltrodden,wellkept,andwellguardedroadtopayforpatrols
onitandforitsupkeep.Occasionally,alargewalledcitychargesatolltoenterorexit(orsometimesjusttoenter).
ShipsPassage:Mostshipsdonotspecializeinpassengers,butmanyhavethecapabilitytotakeafewalongwhen
transportingcargo.DoublethegivencostforcreatureslargerthanMediumorcreaturesthatareotherwisedifficulttobring
aboardaship.
Spell:Theindicatedamountishowmuchitcoststogetaspellcastertocastaspellforyou.Thiscostassumesthatyoucan
gotothespellcasterandhavethespellcastathisorherconvenience(generallyatleast24hourslater,sothatthe
spellcasterhastimetopreparethespellinquestion).Ifyouwanttobringthespellcastersomewheretocastaspellyou
needtonegotiatewithhimorher,andthedefaultanswerisno.
ThecostgivenisforaspellwithnocostforamaterialcomponentorfocuscomponentandnoXPcost.Ifthespellincludes
amaterialcomponent,addthecostofthatcomponenttothecostofthespell.
Ifthespellhasafocuscomponent(otherthanadivinefocus),add1/10thecostofthatfocustothecostofthespell.Ifthe
spellhasanXPcost,add5gpperXPlost.

Page131of462
Furthermore,ifaspellhasdangerousconsequences,thespellcasterwillcertainlyrequireproofthatyoucanandwillpayfor
dealingwithanysuchconsequences(thatis,assumingthatthespellcasterevenagreestocastsuchaspell,whichisnt
certain).Inthecaseofspellsthattransportthecasterandcharactersoveradistance,youwilllikelyhavetopayfortwo
castingsofthespell,evenifyouarentreturningwiththecaster.
Inaddition,noteverytownorvillagehasaspellcasterofsufficientleveltocastanyspell.Ingeneral,youmusttraveltoa
smalltown(orlargersettlement)tobereasonablyassuredoffindingaspellcastercapableofcasting1stlevelspells,alarge
townfor2ndlevelspells,asmallcityfor3rdor4thlevelspells,alargecityfor5thor6thlevelspells,andametropolisfor
7thor8thlevelspells.Evenametropolisisntguaranteedtohavealocalspellcasterabletocast9thlevelspells.

Combat
HowCombatWorks
Combatiscyclical;everybodyactsinturninaregularcycleofrounds.Combatfollowsthissequence:
1. Eachcombatantstartsoutflatfooted.Onceacombatantacts,heorsheisnolongerflatfooted.
2. Determinewhichcharactersareawareoftheiropponentsatthestartofthebattle.Ifsomebutnotallofthecombatants
areawareoftheiropponents,asurpriseroundhappensbeforeregularroundsofcombatbegin.Thecombatantswhoare
awareoftheopponentscanactinthesurpriseround,sotheyrollforinitiative.Ininitiativeorder(highesttolowest),
combatantswhostartedthebattleawareoftheiropponentseachtakeoneaction(eitherastandardactionoramove
action)duringthesurpriseround.Combatantswhowereunawaredonotgettoactinthesurpriseround.Ifnooneor
everyonestartsthebattleaware,thereisnosurpriseround.
3. Combatantswhohavenotyetrolledinitiativedoso.Allcombatantsarenowreadytobegintheirfirstregularroundof
combat.
4. Combatantsactininitiativeorder(highesttolowest).
5. Wheneveryonehashadaturn,thecombatantwiththehighestinitiativeactsagain,andsteps4and5repeatuntil
combatends.

CombatStatistics
Thissectionsummarizesthestatisticsthatdeterminesuccessincombat,andthendetailshowtouse

AttackRoll
Anattackrollrepresentsyourattempttostrikeyouropponentonyourturninaround.Whenyoumakeanattackroll,you
rollad20andaddyourattackbonus.(Othermodifiersmayalsoapplytothisroll.)Ifyourresultequalsorbeatsthetargets
ArmorClass,youhitanddealdamage.
AutomaticMissesandHits:Anatural1(thed20comesup1)onanattackrollisalwaysamiss.Anatural20(thed20
comesup20)isalwaysahit.Anatural20isalsoathreatapossiblecriticalhit.

AttackBonus
YourattackbonuswithameleeweaponisBaseAttackBonus+Strengthmodifier+sizemodifier
Witharangedweapon,yourattackbonusisBaseAttackBonus+Dexteritymodifier+sizemodifier+rangepenalty
Table:SizeModifiers
SIZE SIZEMODIFIER SIZE SIZEMODIFIER
Colossal 8 Small +1
Gargantuan 4 Tiny +2
Huge 2 Diminutive +4
Large 1 Fine +8
Medium +0

Damage
Whenyourattacksucceeds,youdealdamage.Thetypeofweaponuseddeterminestheamountofdamageyoudeal.Effects
thatmodifyweapondamageapplytounarmedstrikesandthenaturalphysicalattackformsofcreatures.
Damagereducesatargetscurrenthitpoints.

Page132of462
MinimumDamage
Ifpenaltiesreducethedamageresulttolessthan1,ahitstilldeals1pointofdamage.

StrengthBonus
Whenyouhitwithameleeorthrownweapon,includingasling,addyourStrengthmodifiertothedamageresult.A
Strengthpenalty,butnotabonus,appliesonattacksmadewithabowthatisnotacompositebow.

OffHandWeapon
Whenyoudealdamagewithaweaponinyouroffhand,youaddonly1/2yourStrengthbonus.

WieldingaWeaponTwoHanded
Whenyoudealdamagewithaweaponthatyouarewieldingtwohanded,youadd11/2timesyourStrengthbonus.
However,youdontgetthishigherStrengthbonuswhenusingalightweaponwithtwohands.

MultiplyingDamage
Sometimesyoumultiplydamagebysomefactor,suchasonacriticalhit.Rollthedamage(withallmodifiers)multiple
timesandtotaltheresults.Note:Whenyoumultiplydamagemorethanonce,eachmultiplierworksofftheoriginal,
unmultiplieddamage.

Exception
Extradamagediceoverandaboveaweaponsnormaldamagearenevermultiplied.

AbilityDamage
Certaincreaturesandmagicaleffectscancausetemporaryabilitydamage(areductiontoanabilityscore).

ArmorClass
YourArmorClass(AC)representshowharditisforopponentstolandasolid,damagingblowonyou.Itstheattackroll
resultthatanopponentneedstoachievetohityou.YourACisequaltothefollowing:10+armorbonus+shieldbonus+
Dexteritymodifier+sizemodifier
NotethatarmorlimitsyourDexteritybonus,soifyourewearingarmor,youmightnotbeabletoapplyyourwhole
DexteritybonustoyourAC.
SometimesyoucantuseyourDexteritybonus(ifyouhaveone).Ifyoucantreacttoablow,youcantuseyourDexterity
bonustoAC.(IfyoudonthaveaDexteritybonus,nothinghappens.)

OtherModifiers
ManyotherfactorsmodifyyourAC.

EnhancementBonuses
Enhancementeffectsmakeyourarmorbetter.

DeflectionBonus
MagicaldeflectioneffectswardoffattacksandimproveyourAC.

NaturalArmor
NaturalarmorimprovesyourAC.

DodgeBonuses
SomeotherACbonusesrepresentactivelyavoidingblows.Thesebonusesarecalleddodgebonuses.Anysituationthat
deniesyouyourDexteritybonusalsodeniesyoudodgebonuses.(Wearingarmor,however,doesnotlimitthesebonusesthe
wayitlimitsaDexteritybonustoAC.)Unlikemostsortsofbonuses,dodgebonusesstackwitheachother.

TouchAttacks
Someattacksdisregardarmor,includingshieldsandnaturalarmor.Inthesecases,theattackermakesatouchattackroll
(eitherrangedormelee).Whenyouarethetargetofatouchattack,yourACdoesntincludeanyarmorbonus,shield
bonus,ornaturalarmorbonus.Allothermodifiers,suchasyoursizemodifier,Dexteritymodifier,anddeflectionbonus(if
any)applynormally.

HitPoints
Whenyourhitpointtotalreaches0,youredisabled.Whenitreaches1,youredying.Whenitgetsto10,youredead.

Page133of462
Speed
Yourspeedtellsyouhowfaryoucanmoveinaroundandstilldosomething,suchasattackorcastaspell.Yourspeed
dependsmostlyonyourraceandwhatarmoryourewearing.
Dwarves,gnomes,andhalflingshaveaspeedof20feet(4squares),or15feet(3squares)whenwearingmediumorheavy
armor(exceptfordwarves,whomove20feetinanyarmor).
Humans,elves,halfelves,andhalforcshaveaspeedof30feet(6squares),or20feet(4squares)inmediumorheavy
armor.
Ifyouusetwomoveactionsinaround(sometimescalledadoublemoveaction),youcanmoveuptodoubleyourspeed.
Ifyouspendtheentireroundtorunallout,youcanmoveuptoquadrupleyourspeed(ortripleifyouareinheavyarmor).

SavingThrows
Generally,whenyouaresubjecttoanunusualormagicalattack,yougetasavingthrowtoavoidorreducetheeffect.Like
anattackroll,asavingthrowisad20rollplusabonusbasedonyourclass,level,andanabilityscore.Yoursavingthrow
modifieris:Basesavebonus+abilitymodifier
ThethreedifferentkindsofsavingthrowsareFortitude,Reflex,andWill.

Fortitude
Thesesavesmeasureyourabilitytostanduptophysicalpunishmentorattacksagainstyourvitalityandhealth.Applyyour
ConstitutionmodifiertoyourFortitudesavingthrows.

Reflex
Thesesavestestyourabilitytododgeareaattacks.ApplyyourDexteritymodifiertoyourReflexsavingthrows.

Will
Thesesavesreflectyourresistancetomentalinfluenceaswellasmanymagicaleffects.ApplyyourWisdommodifiertoyour
Willsavingthrows.

SavingThrowDifficultyClass
TheDCforasaveisdeterminedbytheattackitself.

AutomaticFailuresandSuccesses
Anatural1(thed20comesup1)onasavingthrowisalwaysafailure(andmaycausedamagetoexposeditems;seeItems
SurvivingafteraSavingThrow).Anatural20(thed20comesup20)isalwaysasuccess.

Initiative
InitiativeChecks
Atthestartofabattle,eachcombatantmakesaninitiativecheck.AninitiativecheckisaDexteritycheck.Eachcharacter
applieshisorherDexteritymodifiertotheroll.Charactersactinorder,countingdownfromhighestresulttolowest.In
everyroundthatfollows,thecharactersactinthesameorder(unlessacharactertakesanactionthatresultsinhisorher
initiativechanging;seeSpecialInitiativeActions).
Iftwoormorecombatantshavethesameinitiativecheckresult,thecombatantswhoaretiedactinorderoftotalinitiative
modifier(highestfirst).Ifthereisstillatie,thetiedcharactersshouldrollagaintodeterminewhichoneofthemgoes
beforetheother.

FlatFooted
Atthestartofabattle,beforeyouhavehadachancetoact(specifically,beforeyourfirstregularturnintheinitiative
order),youareflatfooted.YoucantuseyourDexteritybonustoAC(ifany)whileflatfooted.Barbariansandrogueshave
theuncannydodgeextraordinaryability,whichallowsthemtoavoidlosingtheirDexteritybonustoACduetobeingflat
footed.
Aflatfootedcharactercantmakeattacksofopportunity.

Inaction
Evenifyoucanttakeactions,youretainyourinitiativescoreforthedurationoftheencounter.

Surprise
Whenacombatstarts,ifyouarenotawareofyouropponentsandtheyareawareofyou,youresurprised.

Page134of462
DeterminingAwareness
Sometimesallthecombatantsonasideareawareoftheiropponents,sometimesnoneare,andsometimesonlysomeof
themare.Sometimesafewcombatantsoneachsideareawareandtheothercombatantsoneachsideareunaware.
DeterminingawarenessmaycallforListenchecks,Spotchecks,orotherchecks.

TheSurpriseRound
Ifsomebutnotallofthecombatantsareawareoftheiropponents,asurpriseroundhappensbeforeregularroundsbegin.
Anycombatantsawareoftheopponentscanactinthesurpriseround,sotheyrollforinitiative.Ininitiativeorder(highest
tolowest),combatantswhostartedthebattleawareoftheiropponentseachtakeastandardactionduringthesurprise
round.Youcanalsotakefreeactionsduringthesurpriseround.Ifnooneoreveryoneissurprised,nosurpriseround
occurs.

UnawareCombatants
Combatantswhoareunawareatthestartofbattledontgettoactinthesurpriseround.Unawarecombatantsareflat
footedbecausetheyhavenotactedyet,sotheyloseanyDexteritybonustoAC.

AttacksofOpportunity
Sometimesacombatantinameleeletsherguarddown.Inthiscase,combatantsnearhercantakeadvantageofherlapse
indefensetoattackherforfree.Thesefreeattacksarecalledattacksofopportunity.

ThreatenedSquares
Youthreatenallsquaresintowhichyoucanmakeameleeattack,evenwhenitisnotyouraction.Generally,thatmeans
everythinginallsquaresadjacenttoyourspace(includingdiagonally).Anenemythattakescertainactionswhileina
threatenedsquareprovokesanattackofopportunityfromyou.Ifyoureunarmed,youdontnormallythreatenanysquares
andthuscantmakeattacksofopportunity.

ReachWeapons
MostcreaturesofMediumorsmallersizehaveareachofonly5feet.Thismeansthattheycanmakemeleeattacksonly
againstcreaturesupto5feet(1square)away.However,SmallandMediumcreatureswieldingreachweaponsthreaten
moresquaresthanatypicalcreature.Inaddition,mostcreatureslargerthanMediumhaveanaturalreachof10feetor
more.

ProvokinganAttackofOpportunity
Twokindsofactionscanprovokeattacksofopportunity:movingoutofathreatenedsquareandperforminganaction
withinathreatenedsquare.

Moving
Movingoutofathreatenedsquareusuallyprovokesanattackofopportunityfromthethreateningopponent.Therearetwo
commonmethodsofavoidingsuchanattackthe5footstepandthewithdrawaction(seebelow).

PerformingaDistractingAct
Someactions,whenperformedinathreatenedsquare,provokeattacksofopportunityasyoudivertyourattentionfromthe
battle.Table:ActionsinCombatnotesmanyoftheactionsthatprovokeattacksofopportunity.
Rememberthatevenactionsthatnormallyprovokeattacksofopportunitymayhaveexceptionstothisrule.

MakinganAttackofOpportunity
Anattackofopportunityisasinglemeleeattack,andyoucanonlymakeoneperround.Youdonthavetomakeanattack
ofopportunityifyoudontwantto.
Anexperiencedcharactergetsadditionalregularmeleeattacks(byusingthefullattackaction),butatalowerattack
bonus.Youmakeyourattackofopportunity,however,atyournormalattackbonusevenifyouvealreadyattackedinthe
round.
Anattackofopportunityinterruptsthenormalflowofactionsintheround.Ifanattackofopportunityisprovoked,
immediatelyresolvetheattackofopportunity,thencontinuewiththenextcharactersturn(orcompletethecurrentturn,if
theattackofopportunitywasprovokedinthemidstofacharactersturn).

CombatReflexesandAdditionalAttacksofOpportunity
IfyouhavetheCombatReflexesfeatyoucanaddyourDexteritymodifiertothenumberofattacksofopportunityyoucan
makeinaround.Thisfeatdoesnotletyoumakemorethanoneattackforagivenopportunity,butifthesameopponent

Page135of462
provokestwoattacksofopportunityfromyou,youcouldmaketwoseparateattacksofopportunity(sinceeachone
representsadifferentopportunity).Movingoutofmorethanonesquarethreatenedbythesameopponentinthesame
rounddoesntcountasmorethanoneopportunityforthatopponent.Alltheseattacksareatyourfullnormalattackbonus.

ActionsinCombat
TheCombatRound
Eachroundrepresents6secondsinthegameworld.Aroundpresentsanopportunityforeachcharacterinvolvedina
combatsituationtotakeanaction.
Eachroundsactivitybeginswiththecharacterwiththehighestinitiativeresultandthenproceeds,inorder,fromthere.
Eachroundofacombatusesthesameinitiativeorder.Whenacharactersturncomesupintheinitiativesequence,that
characterperformshisentireroundsworthofactions.(Forexceptions,seeAttacksofOpportunityandSpecialInitiative
Actions.)
Foralmostallpurposes,thereisnorelevancetotheendofaroundorthebeginningofaround.Aroundcanbeasegment
ofgametimestartingwiththefirstcharactertoactandendingwiththelast,butitusuallymeansaspanoftimefromone
roundtothesameinitiativecountinthenextround.Effectsthatlastacertainnumberofroundsendjustbeforethesame
initiativecountthattheybeganon.

ActionTypes
Anactionstypeessentiallytellsyouhowlongtheactiontakestoperform(withintheframeworkofthe6secondcombat
round)andhowmovementistreated.Therearefourtypesofactions:standardactions,moveactions,fullroundactions,
andfreeactions.
Inanormalround,youcanperformastandardactionandamoveaction,oryoucanperformafullroundaction.Youcan
alsoperformoneormorefreeactions.Youcanalwaystakeamoveactioninplaceofastandardaction.
Insomesituations(suchasinasurpriseround),youmaybelimitedtotakingonlyasinglemoveactionorstandardaction.

StandardAction
Astandardactionallowsyoutodosomething,mostcommonlymakeanattackorcastaspell.SeeTable:ActionsinCombat
forotherstandardactions.

MoveAction
Amoveactionallowsyoutomoveyourspeedorperformanactionthattakesasimilaramountoftime.SeeTable:Actions
inCombat.
Youcantakeamoveactioninplaceofastandardaction.Ifyoumovenoactualdistanceinaround(commonlybecauseyou
haveswappedyourmoveforoneormoreequivalentactions),youcantakeone5footstepeitherbefore,during,orafter
theaction.

FullRoundAction
Afullroundactionconsumesallyoureffortduringaround.Theonlymovementyoucantakeduringafullroundactionis
a5footstepbefore,during,oraftertheaction.Youcanalsoperformfreeactions(seebelow).
Somefullroundactionsdonotallowyoutotakea5footstep.
Somefullroundactionscanbetakenasstandardactions,butonlyinsituationswhenyouarelimitedtoperformingonlya
standardactionduringyourround.Thedescriptionsofspecificactions,below,detailwhichactionsallowthisoption.

FreeAction
Freeactionsconsumeaverysmallamountoftimeandeffort.Youcanperformoneormorefreeactionswhiletaking
anotheractionnormally.However,therearereasonablelimitsonwhatyoucanreallydoforfree.

NotanAction
Someactivitiesaresominorthattheyarenotevenconsideredfreeactions.Theyliterallydonttakeanytimeatalltodo
andareconsideredaninherentpartofdoingsomethingelse.

RestrictedActivity
Insomesituations,youmaybeunabletotakeafullroundsworthofactions.Insuchcases,youarerestrictedtotakingonly
asinglestandardactionorasinglemoveaction(plusfreeactionsasnormal).Youcanttakeafullroundaction(though
youcanstartorcompleteafullroundactionbyusingastandardaction;seebelow).

Page136of462
Table:StandardActions
STANDARDACTION AOO1 STANDARDACTION AOO1
Attack(melee) No Lowerspellresistance No
Attack(ranged) Yes Makeadyingfriendstable(seeHealskill) Yes
Attack(unarmed) Yes Overrun No
Activateamagicitemotherthanapotionoroil No Readascroll Yes
Aidanother Maybe2 Ready(triggersastandardaction) No
Bullrush No Sunderaweapon(attack) Yes
Castaspell(1standardactioncastingtime) Yes Sunderanobject(attack) Maybe3
Concentratetomaintainanactivespell No Totaldefense No
Dismissaspell No Turnorrebukeundead No
Drawahiddenweapon(seeSleightofHandskill) No Useextraordinaryability No
Drinkapotionorapplyanoil Yes Useskillthattakes1action Usually
Escapeagrapple No Usespelllikeability Yes
Feint No Usesupernaturalability No
Lightatorchwithatindertwig Yes
Table:MoveActions
MOVEACTION AOO1 MOVEACTION AOO1
Move Yes Moveaheavyobject Yes
Controlafrightenedmount Yes Pickupanitem Yes
Directorredirectanactivespell No Sheatheaweapon Yes
Drawaweapon4 No Standupfromprone Yes
Loadahandcrossboworlightcrossbow Yes Readyorlooseashield4 No
Openorcloseadoor No Retrieveastoreditem Yes
Mountahorseordismount No
Table:FullRoundActions
FULLROUNDACTION AOO1 FULLROUNDACTION AOO1
Fullattack No Lockorunlockweaponinlockedgauntlet Yes
Charge5 No Preparetothrowsplashweapon Yes
Delivercoupdegrace Yes Run Yes
Escapefromanet Yes Useskillthattakes1round Usually
Extinguishflames No Usetouchspellonuptosixfriends Yes
Lightatorch Yes Withdraw5 No
Loadaheavyorrepeatingcrossbow Yes
Table:FreeActions
FREEACTION AOO1 FREEACTION AOO1
Castaquickenedspell No Droptothefloor No
Ceaseconcentrationonaspell No Preparespellcomponentstocastaspell6 No
Dropanitem No Speak No
Table:NotActions
NOACTION AOO1 NOACTION AOO1
Delay No 5footstep No
Table:VariableTypeActions
VARIABLETYPEACTION AOO1 VARIABLETYPEACTION AOO1
Disarm7 Yes Tripanopponent7 No
Grapple7 Yes Usefeat8 Varies
1
Regardlessoftheaction,ifyoumoveoutofathreatenedsquare,youusuallyprovokeanattackofopportunity.Thiscolumnindicates
whethertheactionitself,notmoving,provokesanattackofopportunity.
2
Ifyouaidsomeoneperforminganactionthatwouldnormallyprovokeanattackofopportunity,thentheactofaidinganotherprovokes
anattackofopportunityaswell.
3
Iftheobjectisbeingheld,carried,orwornbyacreature,yes.Ifnot,no.
4
Ifyouhaveabaseattackbonusof+1orhigher,youcancombineoneoftheseactionswitharegularmove.IfyouhavetheTwo
WeaponFightingfeat,youcandrawtwolightoronehandedweaponsinthetimeitwouldnormallytakeyoutodrawone.
5
Maybetakenasastandardactionifyouarelimitedtotakingonlyasingleactioninaround.
6
Unlessthecomponentisanextremelylargeorawkwarditem.
7
Theseattackformssubstituteforameleeattack,notanaction.Asmeleeattacks,theycanbeusedonceinanattackorchargeaction,
oneormoretimesinafullattackaction,orevenasanattackofopportunity.
8
Thedescriptionofafeatdefinesitseffect.

Page137of462
StandardActions
Attack
Makinganattackisastandardaction.
MeleeAttacks:Withanormalmeleeweapon,youcanstrikeanyopponentwithin5feet.(Opponentswithin5feetare
consideredadjacenttoyou.)Somemeleeweaponshavereach,asindicatedintheirdescriptions.Withatypicalreach
weapon,youcanstrikeopponents10feetaway,butyoucantstrikeadjacentfoes(thosewithin5feet).
UnarmedAttacks:Strikingfordamagewithpunches,kicks,andheadbuttsismuchlikeattackingwithameleeweapon,
exceptforthefollowing:
AttacksofOpportunity:Attackingunarmedprovokesanattackofopportunityfromthecharacteryouattack,providedshe
isarmed.Theattackofopportunitycomesbeforeyourattack.Anunarmedattackdoesnotprovokeattacksofopportunity
fromotherfoesnordoesitprovokeanattackofopportunityfromanunarmedfoe.
Anunarmedcharactercanttakeattacksofopportunity(butseeArmedUnarmedAttacks,below).
ArmedUnarmedAttacks:Sometimesacharactersorcreaturesunarmedattackcountsasanarmedattack.Amonk,a
characterwiththeImprovedUnarmedStrikefeat,aspellcasterdeliveringatouchattackspell,andacreaturewithnatural
physicalweaponsallcountasbeingarmed.
Notethatbeingarmedcountsforbothoffenseanddefense(thecharactercanmakeattacksofopportunity)
UnarmedStrikeDamage:AnunarmedstrikefromaMediumcharacterdeals1d3pointsofdamage(plusyourStrength
modifier,asnormal).ASmallcharactersunarmedstrikedeals1d2pointsofdamage,whileaLargecharactersunarmed
strikedeals1d4pointsofdamage.Alldamagefromunarmedstrikesisnonlethaldamage.Unarmedstrikescountaslight
weapons(forpurposesoftwoweaponattackpenaltiesandsoon).
DealingLethalDamage:Youcanspecifythatyourunarmedstrikewilldeallethaldamagebeforeyoumakeyourattackroll,
butyoutakea4penaltyonyourattackroll.IfyouhavetheImprovedUnarmedStrikefeat,youcandeallethaldamage
withanunarmedstrikewithouttakingapenaltyontheattackroll.
RangedAttacks:Witharangedweapon,youcanshootorthrowatanytargetthatiswithintheweaponsmaximumrange
andinlineofsight.Themaximumrangeforathrownweaponisfiverangeincrements.Forprojectileweapons,itisten
rangeincrements.Somerangedweaponshaveshortermaximumranges,asspecifiedintheirdescriptions.
AttackRolls:Anattackrollrepresentsyourattemptstostrikeyouropponent.
Yourattackrollis1d20+yourattackbonuswiththeweaponyoureusing.IftheresultisatleastashighasthetargetsAC,
youhitanddealdamage.
AutomaticMissesandHits:Anatural1(thed20comesup1)ontheattackrollisalwaysamiss.Anatural20(thed20
comesup20)isalwaysahit.Anatural20isalsoathreatapossiblecriticalhit.
DamageRolls:IftheattackrollresultequalsorexceedsthetargetsAC,theattackhitsandyoudealdamage.Rollthe
appropriatedamageforyourweapon.Damageisdeductedfromthetargetscurrenthitpoints.
MultipleAttacks:Acharacterwhocanmakemorethanoneattackperroundmustusethefullattackaction(seeFullRound
Actions,below)inordertogetmorethanoneattack.
ShootingorThrowingintoaMelee:Ifyoushootorthrowarangedweaponatatargetengagedinmeleewithafriendly
character,youtakea4penaltyonyourattackroll.Twocharactersareengagedinmeleeiftheyareenemiesofeachother
andeitherthreatenstheother.(Anunconsciousorotherwiseimmobilizedcharacterisnotconsideredengagedunlessheis
actuallybeingattacked.)
Ifyourtarget(orthepartofyourtargetyoureaimingat,ifitsabigtarget)isatleast10feetawayfromthenearest
friendlycharacter,youcanavoidthe4penalty,evenifthecreatureyoureaimingatisengagedinmeleewithafriendly
character.
PreciseShot:IfyouhavethePreciseShotfeatyoudonttakethispenalty.
FightingDefensivelyasaStandardAction:Youcanchoosetofightdefensivelywhenattacking.Ifyoudoso,youtakea4
penaltyonallattacksinaroundtogaina+2dodgebonustoACforthesameround.
CriticalHits:Whenyoumakeanattackrollandgetanatural20(thed20shows20),youhitregardlessofyourtargets
ArmorClass,andyouhavescoredathreat.Thehitmightbeacriticalhit(orcrit).Tofindoutifitsacriticalhit,you
immediatelymakeacriticalrollanotherattackrollwithallthesamemodifiersastheattackrollyoujustmade.Ifthe

Page138of462
criticalrollalsoresultsinahitagainstthetargetsAC,youroriginalhitisacriticalhit.(Thecriticalrolljustneedstohitto
giveyouacrit.Itdoesntneedtocomeup20again.)Ifthecriticalrollisamiss,thenyourhitisjustaregularhit.
Acriticalhitmeansthatyourollyourdamagemorethanonce,withallyourusualbonuses,andaddtherollstogether.
Unlessotherwisespecified,thethreatrangeforacriticalhitonanattackrollis20,andthemultiplierisx2.
Exception:Extradamageoverandaboveaweaponsnormaldamageisnotmultipliedwhenyouscoreacriticalhit.
IncreasedThreatRange:Sometimesyourthreatrangeisgreaterthan20.Thatis,youcanscoreathreatonalowernumber.
Insuchcases,arolloflowerthan20isnotanautomatichit.Anyattackrollthatdoesntresultinahitisnotathreat.
IncreasedCriticalMultiplier:Someweaponsdealbetterthandoubledamageonacriticalhit.
SpellsandCriticalHits:Aspellthatrequiresanattackrollcanscoreacriticalhit.Aspellattackthatrequiresnoattackroll
cannotscoreacriticalhit.

CastaSpell
Mostspellsrequire1standardactiontocast.Youcancastsuchaspelleitherbeforeorafteryoutakeamoveaction.
Note:YouretainyourDexteritybonustoACwhilecasting.
SpellComponents:Tocastaspellwithaverbal(V)component,yourcharactermustspeakinafirmvoice.Ifyouregagged
orintheareaofasilencespell,youcantcastsuchaspell.Aspellcasterwhohasbeendeafenedhasa20%chancetospoil
anyspellhetriestocastifthatspellhasaverbalcomponent.
Tocastaspellwithasomatic(S)component,youmustgesturefreelywithatleastonehand.Youcantcastaspellofthis
typewhilebound,grappling,orwithbothyourhandsfulloroccupied.
Tocastaspellwithamaterial(M),focus(F),ordivinefocus(DF)component,youhavetohavethepropermaterials,as
describedbythespell.Unlessthesematerialsareelaboratepreparingthesematerialsisafreeaction.Formaterial
componentsandfocuseswhosecostsarenotlisted,youcanassumethatyouhavethemifyouhaveyourspellcomponent
pouch.
Somespellshaveanexperiencepoint(XP)componentandentailanexperiencepointcosttoyou.Nospellcanrestorethe
lostXP.YoucannotspendsomuchXPthatyoulosealevel,soyoucannotcastthespellunlessyouhaveenoughXPtospare.
However,youmay,ongainingenoughXPtoachieveanewlevel,immediatelyspendtheXPoncastingthespellratherthan
keepingittoadvancealevel.TheXPareexpendedwhenyoucastthespell,whetherornotthecastingsucceeds.
Concentration:Youmustconcentratetocastaspell.Ifyoucantconcentrateyoucantcastaspell.Ifyoustartcastingaspell
butsomethinginterfereswithyourconcentrationyoumustmakeaConcentrationcheckorlosethespell.ThechecksDC
dependsonwhatisthreateningyourconcentration(seetheConcentrationskill).Ifyoufail,thespellfizzleswithnoeffect.
Ifyoupreparespells,itislostfrompreparation.Ifyoucastatwill,itcountsagainstyourdailylimitofspellseventhough
youdidnotcastitsuccessfully.
ConcentratingtoMaintainaSpell:Somespellsrequirecontinuedconcentrationtokeepthemgoing.Concentratingto
maintainaspellisastandardactionthatdoesntprovokeanattackofopportunity.Anythingthatcouldbreakyour
concentrationwhencastingaspellcankeepyoufromconcentratingtomaintainaspell.Ifyourconcentrationbreaks,the
spellends.
CastingTime:Mostspellshaveacastingtimeof1standardaction.Aspellcastinthismannerimmediatelytakeseffect.
AttacksofOpportunity:Generally,ifyoucastaspell,youprovokeattacksofopportunityfromthreateningenemies.Ifyou
takedamagefromanattackofopportunity,youmustmakeaConcentrationcheck(DC10+pointsofdamagetaken+
spelllevel)orlosethespell.Spellsthatrequireonlyafreeactiontocastdontprovokeattacksofopportunity.
CastingontheDefensive:Castingaspellwhileonthedefensivedoesnotprovokeanattackofopportunity.Itdoes,
however,requireaConcentrationcheck(DC15+spelllevel)topulloff.Failuremeansthatyoulosethespell.
TouchSpellsinCombat:Manyspellshavearangeoftouch.Tousethesespells,youcastthespellandthentouchthe
subject,eitherinthesameroundoranytimelater.Inthesameroundthatyoucastthespell,youmayalsotouch(or
attempttotouch)thetarget.Youmaytakeyourmovebeforecastingthespell,aftertouchingthetarget,orbetweencasting
thespellandtouchingthetarget.Youcanautomaticallytouchonefriendorusethespellonyourself,buttotouchan
opponent,youmustsucceedonanattackroll.
TouchAttacks:Touchinganopponentwithatouchspellisconsideredtobeanarmedattackandthereforedoesnot
provokeattacksofopportunity.However,theactofcastingaspelldoesprovokeanattackofopportunity.Touchattacks
comeintwotypes:meleetouchattacksandrangedtouchattacks.Youcanscorecriticalhitswitheithertypeofattack.Your
Page139of462
opponentsACagainstatouchattackdoesnotincludeanyarmorbonus,shieldbonus,ornaturalarmorbonus.Hissize
modifier,Dexteritymodifier,anddeflectionbonus(ifany)allapplynormally.
HoldingtheCharge:Ifyoudontdischargethespellintheroundwhenyoucastthespell,youcanholdthedischargeofthe
spell(holdthecharge)indefinitely.Youcancontinuetomaketouchattacksroundafterround.Youcantouchonefriendas
astandardactionoruptosixfriendsasafullroundaction.Ifyoutouchanythingoranyonewhileholdingacharge,even
unintentionally,thespelldischarges.Ifyoucastanotherspell,thetouchspelldissipates.Alternatively,youmaymakea
normalunarmedattack(oranattackwithanaturalweapon)whileholdingacharge.Inthiscase,youarentconsidered
armedandyouprovokeattacksofopportunityasnormalfortheattack.(Ifyourunarmedattackornaturalweaponattack
doesntprovokeattacksofopportunity,neitherdoesthisattack.)Iftheattackhits,youdealnormaldamageforyour
unarmedattackornaturalweaponandthespelldischarges.Iftheattackmisses,youarestillholdingthecharge.
DismissaSpell:Dismissinganactivespellisastandardactionthatdoesntprovokeattacksofopportunity.

ActivateMagicItem
Manymagicitemsdontneedtobeactivated.However,certainmagicitemsneedtobeactivated,especiallypotions,scrolls,
wands,rods,andstaffs.Activatingamagicitemisastandardaction(unlesstheitemdescriptionindicatesotherwise).
SpellCompletionItems:Activatingaspellcompletionitemistheequivalentofcastingaspell.Itrequiresconcentrationand
provokesattacksofopportunity.Youlosethespellifyourconcentrationisbroken,andyoucanattempttoactivatetheitem
whileonthedefensive,aswithcastingaspell.
SpellTrigger,CommandWord,orUseActivatedItems:Activatinganyofthesekindsofitemsdoesnotrequireconcentration
anddoesnotprovokeattacksofopportunity.

UseSpecialAbility
Usingaspecialabilityisusuallyastandardaction,butwhetheritisastandardaction,afullroundaction,ornotanaction
atallisdefinedbytheability.
SpellLikeAbilities:Usingaspelllikeabilityworkslikecastingaspellinthatitrequiresconcentrationandprovokesattacks
ofopportunity.Spelllikeabilitiescanbedisrupted.Ifyourconcentrationisbroken,theattempttousetheabilityfails,but
theattemptcountsasifyouhadusedtheability.Thecastingtimeofaspelllikeabilityis1standardaction,unlessthe
abilitydescriptionnotesotherwise.
UsingaSpellLikeAbilityontheDefensive:Youmayattempttouseaspelllikeabilityonthedefensive,justaswithcasting
aspell.IftheConcentrationcheck(DC15+spelllevel)fails,youcantusetheability,buttheattemptcountsasifyouhad
usedtheability.
SupernaturalAbilities:Usingasupernaturalabilityisusuallyastandardaction(unlessdefinedotherwisebytheabilitys
description).Itsusecannotbedisrupted,doesnotrequireconcentration,anddoesnotprovokeattacksofopportunity.
ExtraordinaryAbilities:Usinganextraordinaryabilityisusuallynotanactionbecausemostextraordinaryabilities
automaticallyhappeninareactivefashion.Thoseextraordinaryabilitiesthatareactionsareusuallystandardactionsthat
cannotbedisrupted,donotrequireconcentration,anddonotprovokeattacksofopportunity.

TotalDefense
Youcandefendyourselfasastandardaction.Yougeta+4dodgebonustoyourACfor1round.YourACimprovesatthe
startofthisaction.YoucantcombinetotaldefensewithfightingdefensivelyorwiththebenefitoftheCombatExpertise
feat(sincebothofthoserequireyoutodeclareanattackorfullattack).Youcantmakeattacksofopportunitywhileusing
totaldefense.

Start/CompleteFullRoundAction
Thestartfullroundactionstandardactionletsyoustartundertakingafullroundaction,whichyoucancompleteinthe
followingroundbyusinganotherstandardaction.Youcantusethisactiontostartorcompleteafullattack,charge,run,or
withdraw.

MoveActions
Withtheexceptionofspecificmovementrelatedskills,mostmoveactionsdontrequireacheck.

Move
Thesimplestmoveactionismovingyourspeed.Ifyoutakethiskindofmoveactionduringyourturn,youcantalsotakea
5footstep.
Manynonstandardmodesofmovementarecoveredunderthiscategory,includingclimbing(uptoonequarterofyour

Page140of462
speed)andswimming(uptoonequarterofyourspeed).
AcceleratedClimbing:Youcanclimbonehalfyourspeedasamoveactionbyacceptinga5penaltyonyourClimbcheck.
Crawling:Youcancrawl5feetasamoveaction.Crawlingincursattacksofopportunityfromanyattackerswhothreaten
youatanypointofyourcrawl.

DraworSheatheaWeapon
Drawingaweaponsothatyoucanuseitincombat,orputtingitawaysothatyouhaveafreehand,requiresamoveaction.
Thisactionalsoappliestoweaponlikeobjectscarriedineasyreach,suchaswands.Ifyourweaponorweaponlikeobjectis
storedinapackorotherwiseoutofeasyreach,treatthisactionasretrievingastoreditem.
Ifyouhaveabaseattackbonusof+1orhigher,youmaydrawaweaponasafreeactioncombinedwitharegularmove.If
youhavetheTwoWeaponFightingfeat,youcandrawtwolightoronehandedweaponsinthetimeitwouldnormallytake
youtodrawone.
Drawingammunitionforusewitharangedweapon(suchasarrows,bolts,slingbullets,orshuriken)isafreeaction.

ReadyorLooseaShield
StrappingashieldtoyourarmtogainitsshieldbonustoyourAC,orunstrappinganddroppingashieldsoyoucanuse
yourshieldhandforanotherpurpose,requiresamoveaction.Ifyouhaveabaseattackbonusof+1orhigher,youcan
readyorlooseashieldasafreeactioncombinedwitharegularmove.
Droppingacarried(butnotworn)shieldisafreeaction.

ManipulateanItem
Inmostcases,movingormanipulatinganitemisamoveaction.
Thisincludesretrievingorputtingawayastoreditem,pickingupanitem,movingaheavyobject,andopeningadoor.
Examplesofthiskindofaction,alongwithwhethertheyincuranattackofopportunity,aregiveninTable:Actionsin
Combat.

DirectorRedirectaSpell
Somespellsallowyoutoredirecttheeffecttonewtargetsorareasafteryoucastthespell.Redirectingaspellrequiresa
moveactionanddoesnotprovokeattacksofopportunityorrequireconcentration.

StandUp
Standingupfromapronepositionrequiresamoveactionandprovokesattacksofopportunity.

Mount/DismountaSteed
Mountingordismountingfromasteedrequiresamoveaction.
FastMountorDismount:YoucanmountordismountasafreeactionwithaDC20Ridecheck(yourarmorcheckpenalty,if
any,appliestothischeck).Ifyoufailthecheck,mountingordismountingisamoveactioninstead.(Youcantattemptafast
mountorfastdismountunlessyoucanperformthemountordismountasamoveactioninthecurrentround.)

FullRoundActions
Afullroundactionrequiresanentireroundtocomplete.Thus,itcantbecoupledwithastandardoramoveaction,though
ifitdoesnotinvolvemovinganydistance,youcantakea5footstep.

FullAttack
Ifyougetmorethanoneattackperroundbecauseyourbaseattackbonusishighenough,becauseyoufightwithtwo
weaponsoradoubleweaponorforsomespecialreasonyoumustuseafullroundactiontogetyouradditionalattacks.You
donotneedtospecifythetargetsofyourattacksaheadoftime.Youcanseehowtheearlierattacksturnoutbefore
assigningthelaterones.
Theonlymovementyoucantakeduringafullattackisa5footstep.Youmaytakethestepbefore,after,orbetweenyour
attacks.
Ifyougetmultipleattacksbecauseyourbaseattackbonusishighenough,youmustmaketheattacksinorderfromhighest
bonustolowest.Ifyouareusingtwoweapons,youcanstrikewitheitherweaponfirst.Ifyouareusingadoubleweapon,
youcanstrikewitheitherpartoftheweaponfirst.
DecidingbetweenanAttackoraFullAttack:Afteryourfirstattack,youcandecidetotakeamoveactioninsteadofmaking
yourremainingattacks,dependingonhowthefirstattackturnsout.Ifyouvealreadytakena5footstep,youcantuse
Page141of462
yourmoveactiontomoveanydistance,butyoucouldstilluseadifferentkindofmoveaction.
FightingDefensivelyasaFullRoundAction:Youcanchoosetofightdefensivelywhentakingafullattackaction.Ifyoudo
so,youtakea4penaltyonallattacksinaroundtogaina+2dodgebonustoACforthesameround.
Cleave:TheextraattackgrantedbytheCleavefeatorGreatCleavefeatcanbetakenwhenevertheyapply.Thisisan
exceptiontothenormallimittothenumberofattacksyoucantakewhennotusingafullattackaction.

CastaSpell
Aspellthattakes1roundtocastisafullroundaction.Itcomesintoeffectjustbeforethebeginningofyourturninthe
roundafteryoubegancastingthespell.Youthenactnormallyafterthespelliscompleted.
Aspellthattakes1minutetocastcomesintoeffectjustbeforeyourturn1minutelater(andforeachofthose10rounds,
youarecastingaspellasafullroundaction).Theseactionsmustbeconsecutiveanduninterrupted,orthespell
automaticallyfails.
Whenyoubeginaspellthattakes1roundorlongertocast,youmustcontinuetheinvocations,gestures,andconcentration
fromoneroundtojustbeforeyourturninthenextround(atleast).Ifyouloseconcentrationafterstartingthespelland
beforeitiscomplete,youlosethespell.
Youonlyprovokeattacksofopportunitywhenyoubegincastingaspell,eventhoughyoumightcontinuecastingforatleast
onefullround.Whilecastingaspell,youdontthreatenanysquaresaroundyou.
ThisactionisotherwiseidenticaltothecastaspellactiondescribedunderStandardActions.
CastingaMetamagicSpell:Sorcerersandbardsmusttakemoretimetocastametamagicspell(oneenhancedbya
metamagicfeat)thanaregularspell.Ifaspellsnormalcastingtimeis1standardaction,castingametamagicversionofthe
spellisafullroundactionforasorcererorbard.Notethatthisisntthesameasaspellwitha1roundcastingtimethe
spelltakeseffectinthesameroundthatyoubegincasting,andyouarentrequiredtocontinuetheinvocations,gestures,
andconcentrationuntilyournextturn.Forspellswithalongercastingtime,ittakesanextrafullroundactiontocastthe
metamagicspell.
Clericsmusttakemoretimetospontaneouslycastametamagicversionofacureorinflictspell.Spontaneouslycastinga
metamagicversionofaspellwithacastingtimeof1standardactionisafullroundaction,andspellswithlongercasting
timestakeanextrafullroundactiontocast.

UseSpecialAbility
Usingaspecialabilityisusuallyastandardaction,butsomemaybefullroundactions,asdefinedbytheability.

Withdraw
Withdrawingfrommeleecombatisafullroundaction.Whenyouwithdraw,youcanmoveuptodoubleyourspeed.The
squareyoustartoutinisnotconsideredthreatenedbyanyopponentyoucansee,andthereforevisibleenemiesdonotget
attacksofopportunityagainstyouwhenyoumovefromthatsquare.(Invisibleenemiesstillgetattacksofopportunity
againstyou,andyoucantwithdrawfromcombatifyoureblinded.)Youcanttakea5footstepduringthesameroundin
whichyouwithdraw.
If,duringtheprocessofwithdrawing,youmoveoutofathreatenedsquare(otherthantheoneyoustartedin),enemiesget
attacksofopportunityasnormal.
Youmaynotwithdrawusingaformofmovementforwhichyoudonthavealistedspeed.
Notethatdespitethenameofthisaction,youdontactuallyhavetoleavecombatentirely.
RestrictedWithdraw:Ifyouarelimitedtotakingonlyastandardactioneachroundyoucanwithdrawasastandardaction.
Inthiscase,youmaymoveuptoyourspeed(ratherthanuptodoubleyourspeed).

Run
Youcanrunasafullroundaction.(Ifyoudo,youdonotalsogeta5footstep.)Whenyourun,youcanmoveuptofour
timesyourspeedinastraightline(orthreetimesyourspeedifyoureinheavyarmor).YouloseanyDexteritybonustoAC
unlessyouhavetheRunfeat
YoucanrunforanumberofroundsequaltoyourConstitutionscore,butafterthatyoumustmakeaDC10Constitution
checktocontinuerunning.Youmustcheckagaineachroundinwhichyoucontinuetorun,andtheDCofthischeck
increasesby1foreachcheckyouhavemade.Whenyoufailthischeck,youmuststoprunning.Acharacterwhohasrunto
hislimitmustrestfor1minute(10rounds)beforerunningagain.Duringarestperiod,acharactercanmovenofasterthan

Page142of462
anormalmoveaction.
Youcantrunacrossdifficultterrainorifyoucantseewhereyouregoing.
Arunrepresentsaspeedofabout12milesperhourforanunencumberedhuman.

Move5FeetthroughDifficultTerrain
Insomesituations,yourmovementmaybesohamperedthatyoudonthavesufficientspeedeventomove5feet(asingle
square).Insuchacase,youmayspendafullroundactiontomove5feet(1square)inanydirection,evendiagonally.Even
thoughthislookslikea5footstep,itsnot,andthusitprovokesattacksofopportunitynormally.

FreeActions
Freeactionsdonttakeanytimeatall,thoughtheremaybelimitstothenumberoffreeactionsyoucanperforminaturn.
Freeactionsrarelyincurattacksofopportunity.Somecommonfreeactionsaredescribedbelow.

DropanItem
Droppinganiteminyourspaceorintoanadjacentsquareisafreeaction.

DropProne
Droppingtoapronepositioninyourspaceisafreeaction.

Speak
Ingeneral,speakingisafreeactionthatyoucanperformevenwhenitisntyourturn.Speakingmorethanfewsentencesis
generallybeyondthelimitofafreeaction.

CeaseConcentrationonSpell
Youcanstopconcentratingonanactivespellasafreeaction.

CastaQuickenedSpell
Youcancastaquickenedspell(seetheQuickenSpellfeat)oranyspellwhosecastingtimeisdesignatedasafreeactionas
afreeaction.Onlyonesuchspellcanbecastinanyround,andsuchspellsdontcounttowardyournormallimitofone
spellperround.Castingaspellwithacastingtimeofafreeactiondoesntincuranattackofopportunity.

MiscellaneousActions
Take5FootStep
Youcanmove5feetinanyroundwhenyoudontperformanyotherkindofmovement.Takingthis5footstepnever
provokesanattackofopportunity.Youcanttakemorethanone5footstepinaround,andyoucanttakea5footstepin
thesameroundwhenyoumoveanydistance.
Youcantakea5footstepbefore,during,orafteryourotheractionsintheround.
Youcanonlytakea5footstepifyourmovementisnthamperedbydifficultterrainordarkness.Anycreaturewithaspeed
of5feetorlesscanttakea5footstep,sincemovingeven5feetrequiresamoveactionforsuchaslowcreature.
Youmaynottakea5footstepusingaformofmovementforwhichyoudonothavealistedspeed.

UseFeat
Certainfeatsletyoutakespecialactionsincombat.Otherfeatsdonotrequireactionsthemselves,buttheygiveyoua
bonuswhenattemptingsomethingyoucanalreadydo.Somefeatsarenotmeanttobeusedwithintheframeworkof
combat.Theindividualfeatdescriptionstellyouwhatyouneedtoknowaboutthem.

UseSkill
Mostskillusesarestandardactions,butsomemightbemoveactions,fullroundactions,freeactions,orsomethingelse
entirely.
Theindividualskilldescriptionstellyouwhatsortsofactionsarerequiredtoperformskills.

InjuryAndDeath
Yourhitpointsmeasurehowhardyouaretokill.Nomatterhowmanyhitpointsyoulose,yourcharacterisnthinderedin
anywayuntilyourhitpointsdropto0orlower.

LossofHitPoints
Themostcommonwaythatyourcharactergetshurtistotakelethaldamageandlosehitpoints
Page143of462
WhatHitPointsRepresent
Hitpointsmeantwothingsinthegameworld:theabilitytotakephysicalpunishmentandkeepgoing,andtheabilityto
turnaseriousblowintoalessseriousone.

EffectsofHitPointDamage
Damagedoesntslowyoudownuntilyourcurrenthitpointsreach0orlower.At0hitpoints,youredisabled.
Atfrom1to9hitpoints,youredying.
At10orlower,youredead.

MassiveDamage
Ifyoueversustainasingleattackdeals50pointsofdamageormoreanditdoesntkillyououtright,youmustmakeaDC
15Fortitudesave.Ifthissavingthrowfails,youdieregardlessofyourcurrenthitpoints.Ifyoutake50pointsofdamageor
morefrommultipleattacks,nooneofwhichdealt50ormorepointsofdamageitself,themassivedamageruledoesnot
apply.

Disabled(0HitPoints)
Whenyourcurrenthitpointsdroptoexactly0,youredisabled.
Youcanonlytakeasinglemoveorstandardactioneachturn(butnotboth,norcanyoutakefullroundactions).Youcan
takemoveactionswithoutfurtherinjuringyourself,butifyouperformanystandardaction(oranyotherstrenuousaction)
youtake1pointofdamageafterthecompletingtheact.Unlessyouractivityincreasedyourhitpoints,youarenowat1
hitpoints,andyouredying.
Healingthatraisesyourhitpointsabove0makesyoufullyfunctionalagain,justasifyoudneverbeenreducedto0or
fewerhitpoints.
Youcanalsobecomedisabledwhenrecoveringfromdying.Inthiscase,itsasteptowardrecovery,andyoucanhavefewer
than0hitpoints(seeStableCharactersandRecovery,below).

Dying(1to9HitPoints)
Whenyourcharacterscurrenthitpointsdroptobetween1and9inclusive,hesdying.
Adyingcharacterimmediatelyfallsunconsciousandcantakenoactions.
Adyingcharacterloses1hitpointeveryround.Thiscontinuesuntilthecharacterdiesorbecomesstable(seebelow).

Dead(10HitPointsorLower)
Whenyourcharacterscurrenthitpointsdropto10orlower,orifhetakesmassivedamage(seeabove),hesdead.A
charactercanalsodiefromtakingabilitydamageorsufferinganabilitydrainthatreduceshisConstitutionto0.

StableCharactersAndRecovery
Onthenextturnafteracharacterisreducedtobetween1and9hitpointsandonallsubsequentturns,rolld%tosee
whetherthedyingcharacterbecomesstable.Hehasa10%chanceofbecomingstable.Ifhedoesnt,heloses1hitpoint.(A
characterwhosunconsciousordyingcantuseanyspecialactionthatchangestheinitiativecountonwhichhisaction
occurs.)
Ifthecharactershitpointsdropto10orlower,hesdead.
YoucankeepadyingcharacterfromlosinganymorehitpointsandmakehimstablewithaDC15Healcheck.
Ifanysortofhealingcuresthedyingcharacterofeven1pointofdamage,hestopslosinghitpointsandbecomesstable.
Healingthatraisesthedyingcharactershitpointsto0makeshimconsciousanddisabled.Healingthatraiseshishitpoints
to1ormoremakeshimfullyfunctionalagain,justasifhedneverbeenreducedto0orlower.Aspellcasterretainsthe
spellcastingcapabilityshehadbeforedroppingbelow0hitpoints.
Astablecharacterwhohasbeentendedbyahealerorwhohasbeenmagicallyhealedeventuallyregainsconsciousnessand
recovershitpointsnaturally.Ifthecharacterhasnoonetotendhim,however,hislifeisstillindanger,andhemayyetslip
away.

RecoveringwithHelp
Onehourafteratended,dyingcharacterbecomesstable,rolld%.Hehasa10%chanceofbecomingconscious,atwhich
pointheisdisabled(asifhehad0hitpoints).Ifheremainsunconscious,hehasthesamechancetoreviveandbecome

Page144of462
disabledeveryhour.Evenifunconscious,herecovershitpointsnaturally.Heisbacktonormalwhenhishitpointsriseto1
orhigher.

RecoveringwithoutHelp
Aseverelywoundedcharacterleftaloneusuallydies.Hehasasmallchance,however,ofrecoveringonhisown.
Acharacterwhobecomesstableonhisown(bymakingthe10%rollwhiledying)andwhohasnoonetotendtohimstill
loseshitpoints,justataslowerrate.Hehasa10%chanceeachhourofbecomingconscious.Eachtimehemisseshishourly
rolltobecomeconscious,heloses1hitpoint.Healsodoesnotrecoverhitpointsthroughnaturalhealing.
Evenoncehebecomesconsciousandisdisabled,anunaidedcharacterstilldoesnotrecoverhitpointsnaturally.Instead,
eachdayhehasa10%chancetostartrecoveringhitpointsnaturally(startingwiththatday);otherwise,heloses1hit
point.
Onceanunaidedcharacterstartsrecoveringhitpointsnaturally,heisnolongerindangerofnaturallylosinghitpoints
(evenifhiscurrenthitpointtotalisnegative).

Healing
Aftertakingdamage,youcanrecoverhitpointsthroughnaturalhealingorthroughmagicalhealing.Inanycase,youcant
regainhitpointspastyourfullnormalhitpointtotal.

NaturalHealing
Withafullnightsrest(8hoursofsleepormore),yourecover1hitpointpercharacterlevel.Anysignificantinterruption
duringyourrestpreventsyoufromhealingthatnight.
Ifyouundergocompletebedrestforanentiredayandnight,yourecovertwiceyourcharacterlevelinhitpoints.

MagicalHealing
Variousabilitiesandspellscanrestorehitpoints.

HealingLimits
Youcanneverrecovermorehitpointsthanyoulost.Magicalhealingwontraiseyourcurrenthitpointshigherthanyour
fullnormalhitpointtotal.

HealingAbilityDamage
Abilitydamageistemporary,justashitpointdamageis.Abilitydamagereturnsattherateof1pointpernightofrest(8
hours)foreachaffectedabilityscore.Completebedrestrestores2pointsperday(24hours)foreachaffectedabilityscore.

TemporaryHitPoints
Certaineffectsgiveacharactertemporaryhitpoints.Whenacharactergainstemporaryhitpoints,notehiscurrenthitpoint
total.Whenthetemporaryhitpointsgoawaythecharactershitpointsdroptohiscurrenthitpointtotal.Ifthecharacters
hitpointsarebelowhiscurrenthitpointtotalatthattime,allthetemporaryhitpointshavealreadybeenlostandthe
charactershitpointtotaldoesnotdropfurther.
Whentemporaryhitpointsarelost,theycannotberestoredasrealhitpointscanbe,evenbymagic.

IncreasesinConstitutionScoreandCurrentHitPoints
AnincreaseinacharactersConstitutionscore,evenatemporaryone,cangivehermorehitpoints(aneffectivehitpoint
increase),butthesearenottemporaryhitpoints.Theycanberestoredandtheyarenotlostfirstastemporaryhitpoints
are.

NonlethalDamage
DealingNonlethalDamage
Certainattacksdealnonlethaldamage.Othereffects,suchasheatorbeingexhausted,alsodealnonlethaldamage.When
youtakenonlethaldamage,keeparunningtotalofhowmuchyouveaccumulated.Donotdeductthenonlethaldamage
numberfromyourcurrenthitpoints.Itisnotrealdamage.Instead,whenyournonlethaldamageequalsyourcurrenthit
points,yourestaggered,andwhenitexceedsyourcurrenthitpoints,youfallunconscious.Itdoesntmatterwhetherthe
nonlethaldamageequalsorexceedsyourcurrenthitpointsbecausethenonlethaldamagehasgoneuporbecauseyour
currenthitpointshavegonedown.

NonlethalDamagewithaWeaponthatDealsLethalDamage
Youcanuseameleeweaponthatdealslethaldamagetodealnonlethaldamageinstead,butyoutakea4penaltyonyour
attackroll.
Page145of462
LethalDamagewithaWeaponthatDealsNonlethalDamage
Youcanuseaweaponthatdealsnonlethaldamage,includinganunarmedstrike,todeallethaldamageinstead,butyou
takea4penaltyonyourattackroll.

StaggeredandUnconscious
Whenyournonlethaldamageequalsyourcurrenthitpoints,yourestaggered.Youcanonlytakeastandardactionora
moveactionineachround.Youceasebeingstaggeredwhenyourcurrenthitpointsonceagainexceedyournonlethal
damage.
Whenyournonlethaldamageexceedsyourcurrenthitpoints,youfallunconscious.Whileunconscious,youarehelpless.
Spellcasterswhofallunconsciousretainanyspellcastingabilitytheyhadbeforegoingunconscious.

HealingNonlethalDamage
Youhealnonlethaldamageattherateof1hitpointperhourpercharacterlevel.
Whenaspelloramagicalpowercureshitpointdamage,italsoremovesanequalamountofnonlethaldamage.

Movement,Position,AndDistance
Miniaturesareonthe30mmscaleaminiaturefigureofasixfoottallhumanisapproximately30mmtall.Asquareonthe
battlegridis1inchacross,representinga5footby5footarea.Yourtacticalspeedisdeterminedbyyourraceandyour
armor(seeTable:TacticalSpeed).Yourspeedwhileunarmoredisyourbaselandspeed.

Encumbrance
Acharacterencumberedbycarryingalargeamountofgear,treasure,orfallencomradesmaymoveslowerthannormal.

HamperedMovement
Difficultterrain,obstacles,orpoorvisibilitycanhampermovement.

MovementinCombat
Generally,youcanmoveyourspeedinaroundandstilldosomething(takeamoveactionandastandardaction).
Ifyoudonothingbutmove(thatis,ifyouusebothofyouractionsinaroundtomoveyourspeed),youcanmovedouble
yourspeed.
Ifyouspendtheentireroundrunning,youcanmovequadrupleyourspeed.Ifyoudosomethingthatrequiresafullround
youcanonlytakea5footstep.

BonusestoSpeed
Abarbarianhasa+10footbonustohisspeed(unlessheswearingheavyarmor).Experiencedmonksalsohavehigher
speed(unlesstheyrewearingarmorofanysort).Inaddition,manyspellsandmagicitemscanaffectacharactersspeed.
Alwaysapplyanymodifierstoacharactersspeedbeforeadjustingthecharactersspeedbasedonarmororencumbrance,
andrememberthatmultiplebonusesofthesametypetoacharactersspeeddontstack.
Table:TacticalSpeed
RACE NOARMORORLIGHTARMOR MEDIUMORHEAVYARMOR
Human,elf,halfelf,halforc 30ft.(6squares) 20ft.(4squares)
Dwarf 20ft.(4squares) 20ft.(4squares)
Halfling,gnome 20ft.(4squares) 15ft.(3squares)

MeasuringDistance
Diagonals
Whenmeasuringdistance,thefirstdiagonalcountsas1square,thesecondcountsas2squares,thethirdcountsas1,the
fourthas2,andsoon.
Youcantmovediagonallypastacorner(evenbytakinga5footstep).Youcanmovediagonallypastacreature,evenan
opponent.
Youcanalsomovediagonallypastotherimpassableobstacles,suchaspits.

ClosestCreature
Whenitsimportanttodeterminetheclosestsquareorcreaturetoalocation,iftwosquaresorcreaturesareequallyclose,
randomlydeterminewhichonecountsasclosestbyrollingadie.

Page146of462
MovingthroughaSquare
Friend
Youcanmovethroughasquareoccupiedbyafriendlycharacter,unlessyouarecharging.Whenyoumovethroughasquare
occupiedbyafriendlycharacter,thatcharacterdoesntprovideyouwithcover.

Opponent
Youcantmovethroughasquareoccupiedbyanopponent,unlesstheopponentishelpless.Youcanmovethroughasquare
occupiedbyahelplessopponentwithoutpenalty.(Somecreatures,particularlyverylargeones,maypresentanobstacle
evenwhenhelpless.Insuchcases,eachsquareyoumovethroughcountsas2squares.)

EndingYourMovement
Youcantendyourmovementinthesamesquareasanothercreatureunlessitishelpless.

Overrun
Duringyourmovementoraspartofacharge,youcanattempttomovethroughasquareoccupiedbyanopponent.

Tumbling
Atrainedcharactercanattempttotumblethroughasquareoccupiedbyanopponent(seetheTumbleskill).

VerySmallCreature
AFine,Diminutive,orTinycreaturecanmoveintoorthroughanoccupiedsquare.Thecreatureprovokesattacksof
opportunitywhendoingso.

SquareOccupiedbyCreatureThreeSizesLargerorSmaller
Anycreaturecanmovethroughasquareoccupiedbyacreaturethreesizecategorieslargerthanitis.
Abigcreaturecanmovethroughasquareoccupiedbyacreaturethreesizecategoriessmallerthanitis.

DesignatedExceptions
Somecreaturesbreaktheaboverules.Acreaturethatcompletelyfillsthesquaresitoccupiescannotbemovedpast,even
withtheTumbleskillorsimilarspecialabilities.

TerrainandObstacles
DifficultTerrain
Difficultterrainhampersmovement.Eachsquareofdifficultterraincountsas2squaresofmovement.(Eachdiagonalmove
intoadifficultterrainsquarecountsas3squares.)Youcantrunorchargeacrossdifficultterrain.
Ifyouoccupysquareswithdifferentkindsofterrain,youcanmoveonlyasfastasthemostdifficultterrainyouoccupywill
allow.
Flyingandincorporealcreaturesarenothamperedbydifficultterrain.

Obstacles
Likedifficultterrain,obstaclescanhampermovement.Ifanobstaclehampersmovementbutdoesntcompletelyblockit
eachobstructedsquareorobstaclebetweensquarescountsas2squaresofmovement.Youmustpaythiscosttocrossthe
barrier,inadditiontothecosttomoveintothesquareontheotherside.Ifyoudonthavesufficientmovementtocrossthe
barrierandmoveintothesquareontheotherside,youcantcrossthebarrier.Someobstaclesmayalsorequireaskillcheck
tocross.
Ontheotherhand,someobstaclesblockmovemententirely.Acharactercantmovethroughablockingobstacle.
Flyingandincorporealcreaturescanavoidmostobstacles

Squeezing
Insomecases,youmayhavetosqueezeintoorthroughanareathatisntaswideasthespaceyoutakeup.Youcan
squeezethroughorintoaspacethatisatleasthalfaswideasyournormalspace.Eachmoveintoorthroughanarrow
spacecountsasifitwere2squares,andwhilesqueezedinanarrowspaceyoutakea4penaltyonattackrollsanda4
penaltytoAC.
WhenaLargecreature(whichnormallytakesupfoursquares)squeezesintoaspacethatsonesquarewide,thecreatures
miniaturefigureoccupiestwosquares,centeredonthelinebetweenthetwosquares.Forabiggercreature,centerthe
creaturelikewiseintheareaitsqueezesinto.

Page147of462
Acreaturecansqueezepastanopponentwhilemovingbutitcantenditsmovementinanoccupiedsquare.
Tosqueezethroughorintoaspacelessthanhalfyourspaceswidth,youmustusetheEscapeArtistskill.Youcantattack
whileusingEscapeArtisttosqueezethroughorintoanarrowspace,youtakea4penaltytoAC,andyouloseany
DexteritybonustoAC.

SpecialMovementRules
AccidentallyEndingMovementinanIllegalSpace
Sometimesacharacterendsitsmovementwhilemovingthroughaspacewhereitsnotallowedtostop.Whenthat
happens,putyourminiatureinthelastlegalpositionyouoccupied,ortheclosestlegalposition,iftheresalegalposition
thatscloser.

DoubleMovementCost
Whenyourmovementishamperedinsomeway,yourmovementusuallycostsdouble.Forexample,eachsquareof
movementthroughdifficultterraincountsas2squares,andeachdiagonalmovethroughsuchterraincountsas3squares
(justastwodiagonalmovesnormallydo).
Ifmovementcostisdoubledtwice,theneachsquarecountsas4squares(oras6squaresifmovingdiagonally).If
movementcostisdoubledthreetimes,theneachsquarecountsas8squares(12ifdiagonal)andsoon.Thisisanexception
tothegeneralrulethattwodoublingsareequivalenttoatripling.

MinimumMovement
Despitepenaltiestomovement,youcantakeafullroundactiontomove5feet(1square)inanydirection,evendiagonally.
(Thisruledoesntallowyoutomovethroughimpassableterrainortomovewhenallmovementisprohibited.)Such
movementprovokesattacksofopportunityasnormal(despitethedistancecovered,thismoveisnta5footstep).

BigandLittleCreaturesinCombat
CreaturessmallerthanSmallorlargerthanMediumhavespecialrulesrelatingtoposition.

Tiny,Diminutive,andFineCreatures
Verysmallcreaturestakeuplessthan1squareofspace.Thismeansthatmorethanonesuchcreaturecanfitintoasingle
square.ATinycreaturetypicallyoccupiesaspaceonly21/2feetacross,sofourcanfitintoasinglesquare.Twentyfive
Diminutivecreaturesor100Finecreaturescanfitintoasinglesquare.Creaturesthattakeuplessthan1squareofspace
typicallyhaveanaturalreachof0feet,meaningtheycantreachintoadjacentsquares.Theymustenteranopponents
squaretoattackinmelee.Thisprovokesanattackofopportunityfromtheopponent.Youcanattackintoyourownsquare
ifyouneedto,soyoucanattacksuchcreaturesnormally.Sincetheyhavenonaturalreach,theydonotthreatenthe
squaresaroundthem.Youcanmovepastthemwithoutprovokingattacksofopportunity.Theyalsocantflankanenemy.

Large,Huge,Gargantuan,andColossalCreatures
Verylargecreaturestakeupmorethan1square.
Creaturesthattakeupmorethan1squaretypicallyhaveanaturalreachof10feetormore,meaningthattheycanreach
targetseveniftheyarentinadjacentsquares.
Unlikewhensomeoneusesareachweapon,acreaturewithgreaterthannormalnaturalreach(morethan5feet)still
threatenssquaresadjacenttoit.Acreaturewithgreaterthannormalnaturalreachusuallygetsanattackofopportunity
againstyouifyouapproachit,becauseyoumustenterandmovewithintherangeofitsreachbeforeyoucanattackit.
(Thisattackofopportunityisnotprovokedifyoutakea5footstep.)
Largeorlargercreaturesusingreachweaponscanstrikeuptodoubletheirnaturalreachbutcantstrikeattheirnatural
reachorless.
Table:CreatureSizeandScale
CREATURESIZE SPACE1 NATURALREACH1
Fine 1/2ft. 0
Diminutive 1ft. 0
Tiny 21/2ft. 0
Small 5ft. 5ft.
Medium 5ft. 5ft.
Large(tall) 10ft. 10ft.
Large(long) 10ft. 5ft.
Huge(tall) 15ft. 15ft.
Huge(long) 15ft. 10ft.

Page148of462
CREATURESIZE SPACE1 NATURALREACH1
Gargantuan(tall) 20ft. 20ft.
Gargantuan(long) 20ft. 15ft.
Colossal(tall) 30ft. 30ft.
Colossal(long) 30ft. 20ft.
1
Thesevaluesaretypicalforcreaturesoftheindicatedsize.Someexceptionsexist.

CombatModifiers
FavorableandUnfavorableConditions
Table:AttackRollModifiers
ATTACKERIS... MELEE RANGED
Dazzled 1 1
Entangled 21 21
Flankingdefender +2
Invisible +22 +22
Onhigherground +1 +0
Prone 4 3
Shakenorfrightened 2 2
Squeezingthroughaspace 4 4
1
Anentangledcharacteralsotakesa4penaltytoDexterity,whichmayaffecthisattackroll.
2
ThedefenderlosesanyDexteritybonustoAC.Thisbonusdoesntapplyifthetargetisblinded.
3
Mostrangedweaponscantbeusedwhiletheattackerisprone,butyoucanuseacrossboworshurikenwhileproneatnopenalty.
Table:ArmorClassModifiers
DEFENDERIS... MELEE RANGED
Behindcover +4 +4
Blinded 21 21
Concealedorinvisible SeeConcealment
Cowering 21 21
Entangled +02 +02
Flatfooted(suchassurprised,balancing,climbing) +0 1
+01
Grappling(butattackerisnot) +0 1
+01,3
Helpless(suchasparalyzed,sleeping,orbound) 44 +04
Kneelingorsitting 2 +2
Pinned 44 +04
Prone 4 +4
Squeezingthroughaspace 4 4
Stunned 21 21
1
ThedefenderlosesanyDexteritybonustoAC.
2
Anentangledcharactertakesa4penaltytoDexterity.
3
Rollrandomlytoseewhichgrapplingcombatantyoustrike.ThatdefenderlosesanyDexteritybonustoAC.
4
TreatthedefendersDexterityas0(5modifier).Roguescansneakattackhelplessorpinneddefenders.

Cover
Todeterminewhetheryourtargethascoverfromyourrangedattack,chooseacornerofyoursquare.Ifanylinefromthis
cornertoanycornerofthetargetssquarepassesthroughasquareorborderthatblockslineofeffectorprovidescover,or
throughasquareoccupiedbyacreature,thetargethascover(+4toAC).
Whenmakingameleeattackagainstanadjacenttarget,yourtargethascoverifanylinefromyoursquaretothetargets
squaregoesthroughawall(includingalowwall).Whenmakingameleeattackagainstatargetthatisntadjacenttoyou
(suchaswithareachweapon),usetherulesfordeterminingcoverfromrangedattacks.

LowObstaclesandCover
Alowobstacle(suchasawallnohigherthanhalfyourheight)providescover,butonlytocreatureswithin30feet(6
squares)ofit.Theattackercanignorethecoverifhesclosertotheobstaclethanhistarget.

CoverandAttacksofOpportunity
Youcantexecuteanattackofopportunityagainstanopponentwithcoverrelativetoyou.

Page149of462
CoverandReflexSaves
Covergrantsyoua+2bonusonReflexsavesagainstattacksthatoriginateorburstoutfromapointontheothersideof
thecoverfromyou.Notethatspreadeffectscanextendaroundcornersandthusnegatethiscoverbonus.

CoverandHideChecks
YoucanusecovertomakeaHidecheck.Withoutcover,youusuallyneedconcealment(seebelow)tomakeaHidecheck.

SoftCover
Creatures,evenyourenemies,canprovideyouwithcoveragainstmeleeattacks,givingyoua+4bonustoAC.However,
suchsoftcoverprovidesnobonusonReflexsaves,nordoessoftcoverallowyoutomakeaHidecheck.

BigCreaturesandCover
Anycreaturewithaspacelargerthan5feet(1square)determinescoveragainstmeleeattacksslightlydifferentlythan
smallercreaturesdo.Suchacreaturecanchooseanysquarethatitoccupiestodetermineifanopponenthascoveragainst
itsmeleeattacks.Similarly,whenmakingameleeattackagainstsuchacreature,youcanpickanyofthesquaresitoccupies
todetermineifithascoveragainstyou.

TotalCover
Ifyoudonthavelineofeffecttoyourtargetheisconsideredtohavetotalcoverfromyou.Youcantmakeanattackagainst
atargetthathastotalcover.

VaryingDegreesofCover
Insomecases,covermayprovideagreaterbonustoACandReflexsaves.Insuchsituationsthenormalcoverbonusesto
ACandReflexsavescanbedoubled(to+8and+4,respectively).Acreaturewiththisimprovedcovereffectivelygains
improvedevasionagainstanyattacktowhichtheReflexsavebonusapplies.Furthermore,improvedcoverprovidesa+10
bonusonHidechecks.

Concealment
Todeterminewhetheryourtargethasconcealmentfromyourrangedattack,chooseacornerofyoursquare.Ifanyline
fromthiscornertoanycornerofthetargetssquarepassesthroughasquareorborderthatprovidesconcealment,the
targethasconcealment.
Whenmakingameleeattackagainstanadjacenttarget,yourtargethasconcealmentifhisspaceisentirelywithinaneffect
thatgrantsconcealment.Whenmakingameleeattackagainstatargetthatisntadjacenttoyouusetherulesfor
determiningconcealmentfromrangedattacks.
Inaddition,somemagicaleffectsprovideconcealmentagainstallattacks,regardlessofwhetheranyintervening
concealmentexists.

ConcealmentMissChance
Concealmentgivesthesubjectofasuccessfulattacka20%chancethattheattackermissedbecauseoftheconcealment.If
theattackerhits,thedefendermustmakeamisschancepercentilerolltoavoidbeingstruck.Multipleconcealment
conditionsdonotstack.

ConcealmentandHideChecks
YoucanuseconcealmenttomakeaHidecheck.Withoutconcealment,youusuallyneedcovertomakeaHidecheck.

TotalConcealment
Ifyouhavelineofeffecttoatargetbutnotlineofsightheisconsideredtohavetotalconcealmentfromyou.Youcant
attackanopponentthathastotalconcealment,thoughyoucanattackintoasquarethatyouthinkheoccupies.Asuccessful
attackintoasquareoccupiedbyanenemywithtotalconcealmenthasa50%misschance(insteadofthenormal20%miss
chanceforanopponentwithconcealment).
Youcantexecuteanattackofopportunityagainstanopponentwithtotalconcealment,evenifyouknowwhatsquareor
squarestheopponentoccupies.

IgnoringConcealment
Concealmentisntalwayseffective.Ashadowyareaordarknessdoesntprovideanyconcealmentagainstanopponentwith
darkvision.Characterswithlowlightvisioncanseeclearlyforagreaterdistancewiththesamelightsourcethanother
characters.Althoughinvisibilityprovidestotalconcealment,sightedopponentsmaystillmakeSpotcheckstonoticethe
locationofaninvisiblecharacter.Aninvisiblecharactergainsa+20bonusonHidechecksifmoving,ora+40bonuson
Page150of462
Hidecheckswhennotmoving(eventhoughopponentscantseeyou,theymightbeabletofigureoutwhereyouarefrom
othervisualclues).

VaryingDegreesofConcealment
Certainsituationsmayprovidemoreorlessthantypicalconcealment,andmodifythemisschanceaccordingly.

Flanking
Whenmakingameleeattack,yougeta+2flankingbonusifyouropponentisthreatenedbyacharacterorcreature
friendlytoyouontheopponentsoppositeborderoroppositecorner.
Whenindoubtaboutwhethertwofriendlycharactersflankanopponentinthemiddle,traceanimaginarylinebetweenthe
twofriendlycharacterscenters.Ifthelinepassesthroughoppositebordersoftheopponentsspace(includingcornersof
thoseborders),thentheopponentisflanked.Ifaflankertakesupmorethan1square,itgetstheflankingbonusifany
squareitoccupiescountsforflanking.
Onlyacreatureorcharacterthatthreatensthedefendercanhelpanattackergetaflankingbonus.
Creatureswithareachof0feetcantflankanopponent.

HelplessDefenders
Ahelplessopponentissomeonewhoisbound,sleeping,paralyzed,unconscious,orotherwiseatyourmercy.

RegularAttack
Ahelplesscharactertakesa4penaltytoACagainstmeleeattacks,butnopenaltytoACagainstrangedattacks.
AhelplessdefendercantuseanyDexteritybonustoAC.Infact,hisDexterityscoreistreatedasifitwere0andhis
DexteritymodifiertoACasifitwere5(andaroguecansneakattackhim).

CoupdeGrace
Asafullroundaction,youcanuseameleeweapontodeliveracoupdegracetoahelplessopponent.Youcanalsousea
boworcrossbow,providedyouareadjacenttothetarget.
Youautomaticallyhitandscoreacriticalhit.Ifthedefendersurvivesthedamage,hemustmakeaFortitudesave(DC10+
damagedealt)ordie.Aroguealsogetsherextrasneakattackdamageagainstahelplessopponentwhendeliveringacoup
degrace.
Deliveringacoupdegraceprovokesattacksofopportunityfromthreateningopponents.
Youcantdeliveracoupdegraceagainstacreaturethatisimmunetocriticalhits.Youcandeliveracoupdegraceagainsta
creaturewithtotalconcealment,butdoingthisrequirestwoconsecutivefullroundactions(onetofindthecreatureonce
youvedeterminedwhatsquareitsin,andonetodeliverthecoupdegrace).

SpecialAttacks
Table:SpecialAttacks
SPECIALATTACK BRIEFDESCRIPTION
Aidanother Grantanallya+2bonusonattacksorAC
Bullrush Pushanopponentback5feetormore
Charge Moveuptotwiceyourspeedandattackwith+2bonus
Disarm Knockaweaponfromyouropponentshands
Feint NegateyouropponentsDexbonustoAC
Grapple Wrestlewithanopponent
Overrun Plowpastoroveranopponentasyoumove
Sunder Strikeanopponentsweaponorshield
Throwsplashweapon Throwcontainerofdangerousliquidattarget
Trip Tripanopponent
Turn(rebuke)undead Channelpositive(ornegative)energytoturnaway(orawe)undead
Twoweaponfighting Fightwithaweaponineachhand

AidAnother
Inmeleecombat,youcanhelpafriendattackordefendbydistractingorinterferingwithanopponent.Ifyoureinposition
tomakeameleeattackonanopponentthatisengagingafriendinmeleecombat,youcanattempttoaidyourfriendasa
standardaction.YoumakeanattackrollagainstAC10.Ifyousucceed,yourfriendgainseithera+2bonusonhisnext

Page151of462
attackrollagainstthatopponentora+2bonustoACagainstthatopponentsnextattack(yourchoice),aslongasthat
attackcomesbeforethebeginningofyournextturn.Multiplecharacterscanaidthesamefriend,andsimilarbonusesstack.
Youcanalsousethisstandardactiontohelpafriendinotherways,suchaswhenheisaffectedbyaspell,ortoassist
anothercharactersskillcheck.

BullRush
Youcanmakeabullrushasastandardaction(anattack)oraspartofacharge(seeCharge,below).Whenyoumakeabull
rush,youattempttopushanopponentstraightbackinsteadofdamaginghim.Youcanonlybullrushanopponentwhois
onesizecategorylargerthanyou,thesamesize,orsmaller.

InitiatingaBullRush
First,youmoveintothedefendersspace.Doingthisprovokesanattackofopportunityfromeachopponentthatthreatens
you,includingthedefender.(IfyouhavetheImprovedBullRushfeat,youdontprovokeanattackofopportunityfromthe
defender.)Anyattackofopportunitymadebyanyoneotherthanthedefenderagainstyouduringabullrushhasa25%
chanceofaccidentallytargetingthedefenderinstead,andanyattackofopportunitybyanyoneotherthanyouagainstthe
defenderlikewisehasa25%chanceofaccidentallytargetingyou.(Whensomeonemakesanattackofopportunity,make
theattackrollandthenrolltoseewhethertheattackwentastray.)
Second,youandthedefendermakeopposedStrengthchecks.Youeachadda+4bonusforeachsizecategoryyouare
largerthanMediumora4penaltyforeachsizecategoryyouaresmallerthanMedium.Yougeta+2bonusifyouare
charging.Thedefendergetsa+4bonusifhehasmorethantwolegsorisotherwiseexceptionallystable.

BullRushResults
IfyoubeatthedefendersStrengthcheckresult,youpushhimback5feet.Ifyouwishtomovewiththedefender,youcan
pushhimbackanadditional5feetforeach5pointsbywhichyourcheckresultisgreaterthanthedefenderscheckresult.
Youcant,however,exceedyournormalmovementlimit.(Note:Thedefenderprovokesattacksofopportunityifheis
moved.Sodoyou,ifyoumovewithhim.Thetwoofyoudonotprovokeattacksofopportunityfromeachother,however.)
IfyoufailtobeatthedefendersStrengthcheckresult,youmove5feetstraightbacktowhereyouwerebeforeyoumoved
intohisspace.Ifthatspaceisoccupied,youfallproneinthatspace.

Charge
Chargingisaspecialfullroundactionthatallowsyoutomoveuptotwiceyourspeedandattackduringtheaction.
However,itcarriestightrestrictionsonhowyoucanmove.

MovementDuringaCharge
Youmustmovebeforeyourattack,notafter.Youmustmoveatleast10feet(2squares)andmaymoveuptodoubleyour
speeddirectlytowardthedesignatedopponent.
Youmusthaveaclearpathtowardtheopponent,andnothingcanhinderyourmovement(suchasdifficultterrainor
obstacles).Hereswhatitmeanstohaveaclearpath.First,youmustmovetotheclosestspacefromwhichyoucanattack
theopponent.(Ifthisspaceisoccupiedorotherwiseblocked,youcantcharge.)Second,ifanylinefromyourstartingspace
totheendingspacepassesthroughasquarethatblocksmovement,slowsmovement,orcontainsacreature(evenanally),
youcantcharge.(Helplesscreaturesdontstopacharge.)
Ifyoudonthavelineofsighttotheopponentatthestartofyourturn,youcantchargethatopponent.
Youcanttakea5footstepinthesameroundasacharge.
Ifyouareabletotakeonlyastandardactionoramoveactiononyourturn,youcanstillcharge,butyouareonlyallowed
tomoveuptoyourspeed(insteadofuptodoubleyourspeed).Youcantusethisoptionunlessyouarerestrictedtotaking
onlyastandardactionormoveactiononyourturn.

AttackingonaCharge
Aftermoving,youmaymakeasinglemeleeattack.Yougeta+2bonusontheattackroll.andtakea2penaltytoyourAC
untilthestartofyournextturn.
Achargingcharactergetsa+2bonusontheStrengthcheckmadetobullrushoroverrunanopponent(seeBullRush,
above,andOverrun,below).
Evenifyouhaveextraattacks,suchasfromhavingahighenoughbaseattackbonusorfromusingmultipleweapons,you
onlygettomakeoneattackduringacharge.

Page152of462
LancesandChargeAttacks
Alancedealsdoubledamageifemployedbyamountedcharacterinacharge.

WeaponsReadiedagainstaCharge
Spears,tridents,andcertainotherpiercingweaponsdealdoubledamagewhenreadied(set)andusedagainstacharging
character.

Disarm
Asameleeattack,youmayattempttodisarmyouropponent.Ifyoudosowithaweapon,youknocktheopponents
weaponoutofhishandsandtotheground.Ifyouattemptthedisarmwhileunarmed,youendupwiththeweaponinyour
hand.
Ifyoureattemptingtodisarmameleeweapon,followthestepsoutlinedhere.Iftheitemyouareattemptingtodisarmisnt
ameleeweaponthedefendermaystillopposeyouwithanattackroll,buttakesapenaltyandcantattempttodisarmyou
inreturnifyourattemptfails.
Step1:AttackofOpportunity.Youprovokeanattackofopportunityfromthetargetyouaretryingtodisarm.(Ifyouhave
theImprovedDisarmfeat,youdontincuranattackofopportunityformakingadisarmattempt.)Ifthedefendersattackof
opportunitydealsanydamage,yourdisarmattemptfails.
Step2:OpposedRolls.Youandthedefendermakeopposedattackrollswithyourrespectiveweapons.Thewielderofa
twohandedweapononadisarmattemptgetsa+4bonusonthisroll,andthewielderofalightweapontakesa4penalty.
(Anunarmedstrikeisconsideredalightweapon,soyoualwaystakeapenaltywhentryingtodisarmanopponentbyusing
anunarmedstrike.)Ifthecombatantsareofdifferentsizes,thelargercombatantgetsabonusontheattackrollof+4per
differenceinsizecategory.Ifthetargeteditemisntameleeweapon,thedefendertakesa4penaltyontheroll.
StepThree:Consequences.Ifyoubeatthedefender,thedefenderisdisarmed.Ifyouattemptedthedisarmactionunarmed,
younowhavetheweapon.Ifyouwerearmed,thedefendersweaponisonthegroundinthedefenderssquare.
Ifyoufailonthedisarmattempt,thedefendermayimmediatelyreactandattempttodisarmyouwiththesamesortof
opposedmeleeattackroll.Hisattemptdoesnotprovokeanattackofopportunityfromyou.Ifhefailshisdisarmattempt,
youdonotsubsequentlygetafreedisarmattemptagainsthim.
Note:Adefenderwearingspikedgauntletscantbedisarmed.Adefenderusingaweaponattachedtoalockedgauntletgets
a+10bonustoresistbeingdisarmed.

GrabbingItems
Youcanuseadisarmactiontosnatchanitemwornbythetarget.Ifyouwanttohavetheiteminyourhand,thedisarm
mustbemadeasanunarmedattack.
Iftheitemispoorlysecuredorotherwiseeasytosnatchorcutawaytheattackergetsa+4bonus.Unlikeonanormal
disarmattempt,failingtheattemptdoesntallowthedefendertoattempttodisarmyou.Thisotherwisefunctions
identicallytoadisarmattempt,asnotedabove.
Youcantsnatchanitemthatiswellsecuredunlessyouhavepinnedthewearer(seeGrapple).Eventhen,thedefender
gainsa+4bonusonhisrolltoresisttheattempt.

Feint
Feintingisastandardaction.Tofeint,makeaBluffcheckopposedbyaSenseMotivecheckbyyourtarget.Thetargetmay
addhisbaseattackbonustothisSenseMotivecheck.IfyourBluffcheckresultexceedsyourtargetsSenseMotivecheck
result,thenextmeleeattackyoumakeagainstthetargetdoesnotallowhimtousehisDexteritybonustoAC(ifany).This
attackmustbemadeonorbeforeyournextturn.
Whenfeintinginthiswayagainstanonhumanoidyoutakea4penalty.AgainstacreatureofanimalIntelligence(1or2),
youtakea8penalty.Againstanonintelligentcreature,itsimpossible.
Feintingincombatdoesnotprovokeattacksofopportunity.

FeintingasaMoveAction
WiththeImprovedFeintfeat,youcanattemptafeintasamoveactioninsteadofasastandardaction.

Grapple
GrappleChecks
Repeatedlyinagrapple,youneedtomakeopposedgrapplechecksagainstanopponent.Agrapplecheckislikeamelee

Page153of462
attackroll.Yourattackbonusonagrapplecheckis:Baseattackbonus+Strengthmodifier+specialsizemodifier
SpecialSizeModifier:Thespecialsizemodifierforagrapplecheckisasfollows:Colossal+16,Gargantuan+12,Huge+8,
Large+4,Medium+0,Small4,Tiny8,Diminutive12,Fine16.Usethisnumberinplaceofthenormalsizemodifier
youusewhenmakinganattackroll.

StartingaGrapple
Tostartagrapple,youneedtograbandholdyourtarget.Startingagrapplerequiresasuccessfulmeleeattackroll.Ifyou
getmultipleattacks,youcanattempttostartagrapplemultipletimes(atsuccessivelylowerbaseattackbonuses).
Step1:AttackofOpportunity.Youprovokeanattackofopportunityfromthetargetyouaretryingtograpple.Iftheattack
ofopportunitydealsdamage,thegrappleattemptfails.(Certainmonstersdonotprovokeattacksofopportunitywhenthey
attempttograpple,nordocharacterswiththeImprovedGrapplefeat.)Iftheattackofopportunitymissesorfailstodeal
damage,proceedtoStep2.
Step2:Grab.Youmakeameleetouchattacktograbthetarget.Ifyoufailtohitthetarget,thegrappleattemptfails.Ifyou
succeed,proceedtoStep3.
Step3:Hold.Makeanopposedgrapplecheckasafreeaction.
Ifyousucceed,youandyourtargetarenowgrappling,andyoudealdamagetothetargetasifwithanunarmedstrike.
Ifyoulose,youfailtostartthegrapple.Youautomaticallyloseanattempttoholdifthetargetistwoormoresize
categorieslargerthanyouare.
Incaseofatie,thecombatantwiththehighergrapplecheckmodifierwins.Ifthisisatie,rollagaintobreakthetie.
Step4:MaintainGrapple.Tomaintainthegrappleforlaterrounds,youmustmoveintothetargetsspace.(Thismovement
isfreeanddoesntcountaspartofyourmovementintheround.)
Moving,asnormal,provokesattacksofopportunityfromthreateningopponents,butnotfromyourtarget.
Ifyoucantmoveintoyourtargetsspace,youcantmaintainthegrappleandmustimmediatelyletgoofthetarget.To
grappleagain,youmustbeginatStep1.

GrapplingConsequences
Whileyouregrappling,yourabilitytoattackothersanddefendyourselfislimited.
NoThreatenedSquares:Youdontthreatenanysquareswhilegrappling.
NoDexterityBonus:YouloseyourDexteritybonustoAC(ifyouhaveone)againstopponentsyouarentgrappling.(You
canstilluseitagainstopponentsyouaregrappling.)
NoMovement:Youcantmovenormallywhilegrappling.Youmay,however,makeanopposedgrapplecheck(seebelow)to
movewhilegrappling.

IfYoureGrappling
Whenyouaregrappling(regardlessofwhostartedthegrapple),youcanperformanyofthefollowingactions.Someof
theseactionstaketheplaceofanattack(ratherthanbeingastandardactionoramoveaction).Ifyourbaseattackbonus
allowsyoumultipleattacks,youcanattemptoneoftheseactionsinplaceofeachofyourattacks,butatsuccessivelylower
baseattackbonuses.
ActivateaMagicItem:Youcanactivateamagicitem,aslongastheitemdoesntrequireaspellcompletiontrigger.You
dontneedtomakeagrapplechecktoactivatetheitem.
AttackYourOpponent:Youcanmakeanattackwithanunarmedstrike,naturalweapon,orlightweaponagainstanother
characteryouaregrappling.Youtakea4penaltyonsuchattacks.Youcantattackwithtwoweaponswhilegrappling,
evenifbotharelightweapons.
CastaSpell:Youcanattempttocastaspellwhilegrapplingorevenwhilepinned(seebelow),provideditscastingtimeis
nomorethan1standardaction,ithasnosomaticcomponent,andyouhaveinhandanymaterialcomponentsorfocuses
youmightneed.Anyspellthatrequirespreciseandcarefulactionisimpossibletocastwhilegrapplingorbeingpinned.If
thespellisonethatyoucancastwhilegrappling,youmustmakeaConcentrationcheck(DC20+spelllevel)orlosethe
spell.Youdonthavetomakeasuccessfulgrapplechecktocastthespell.
DamageYourOpponent:Whilegrappling,youcandealdamagetoyouropponentequivalenttoanunarmedstrike.Makean
opposedgrapplecheckinplaceofanattack.Ifyouwin,youdealnonlethaldamageasnormalforyourunarmedstrike(1d3

Page154of462
pointsforMediumattackersor1d2pointsforSmallattackers,plusStrengthmodifiers).Ifyouwanttodeallethaldamage,
youtakea4penaltyonyourgrapplecheck.
Theexceptiontothisismonks.Theydealmoredamageonanunarmedstrikethanothercharacters,andthedamageis
lethal.However,theycanchoosetodealtheirdamageasnonlethaldamagewhengrapplingwithouttakingtheusual4
penaltyforchanginglethaldamagetononlethaldamage.
DrawaLightWeapon:Youcandrawalightweaponasamoveactionwithasuccessfulgrapplecheck.
EscapefromGrapple:Youcanescapeagrapplebywinninganopposedgrapplecheckinplaceofmakinganattack.Youcan
makeanEscapeArtistcheckinplaceofyourgrapplecheckifyousodesire,butthisrequiresastandardaction.Ifmorethan
oneopponentisgrapplingyou,yourgrapplecheckresulthastobeatalltheirindividualcheckresultstoescape.(Opponents
donthavetotrytoholdyouiftheydontwantto.)Ifyouescape,youfinishtheactionbymovingintoanyspaceadjacent
toyouropponent(s).
Move:Youcanmovehalfyourspeed(bringingallothersengagedinthegrapplewithyou)bywinninganopposedgrapple
check.Thisrequiresastandardaction,andyoumustbeatalltheotherindividualcheckresultstomovethegrapple.
Note:Yougeta+4bonusonyourgrapplechecktomoveapinnedopponent,butonlyifnooneelseisinvolvedinthe
grapple.
RetrieveaSpellComponent:Youcanproduceaspellcomponentfromyourpouchwhilegrapplingbyusingafullround
action.Doingsodoesnotrequireasuccessfulgrapplecheck.
PinYourOpponent:Youcanholdyouropponentimmobilefor1roundbywinninganopposedgrapplecheck(madein
placeofanattack).Onceyouhaveanopponentpinned,youhaveafewoptionsavailabletoyou(seebelow).
BreakAnothersPin:Ifyouaregrapplinganopponentwhohasanothercharacterpinned,youcanmakeanopposed
grapplecheckinplaceofanattack.Ifyouwin,youbreaktheholdthattheopponenthasovertheothercharacter.The
characterisstillgrappling,butisnolongerpinned.
UseOpponentsWeapon:Ifyouropponentisholdingalightweapon,youcanuseittoattackhim.Makeanopposed
grapplecheck(inplaceofanattack).Ifyouwin,makeanattackrollwiththeweaponwitha4penalty(doingthisdoesnt
requireanotheraction).
Youdontgainpossessionoftheweaponbyperformingthisaction.

IfYourePinninganOpponent
Youcanattempttodamageyouropponentwithanopposedgrapplecheck,youcanattempttouseyouropponentsweapon
againsthim,oryoucanattempttomovethegrapple(alldescribedabove).Atyouroption,youcanpreventapinned
opponentfromspeaking.
Youcanuseadisarmactiontoremoveorgrabawayawellsecuredobjectwornbyapinnedopponent,buthegetsa+4
bonusonhisrolltoresistyourattempt(seeDisarm).
Youmayvoluntarilyreleaseapinnedcharacterasafreeaction;ifyoudoso,youarenolongerconsideredtobegrappling
thatcharacter(andviceversa).
Youcantdraworuseaweapon(againstthepinnedcharacteroranyothercharacter),escapeanothersgrapple,retrievea
spellcomponent,pinanothercharacter,orbreakanotherspinwhileyouarepinninganopponent.

IfYourePinnedbyanOpponent
Whenanopponenthaspinnedyou,youareheldimmobile(butnothelpless)for1round.Whileyourepinned,youtakea
4penaltytoyourACagainstopponentsotherthantheonepinningyou.Atyouropponentsoption,youmayalsobeunable
tospeak.Onyourturn,youcantrytoescapethepinbymakinganopposedgrapplecheckinplaceofanattack.Youcan
makeanEscapeArtistcheckinplaceofyourgrapplecheckifyouwant,butthisrequiresastandardaction.Ifyouwin,you
escapethepin,butyourestillgrappling.

JoiningaGrapple
Ifyourtargetisalreadygrapplingsomeoneelse,youcanuseanattacktostartagrapple,asabove,exceptthatthetarget
doesntgetanattackofopportunityagainstyou,andyourgrabautomaticallysucceeds.Youstillhavetomakeasuccessful
opposedgrapplechecktobecomepartofthegrapple.
Iftherearemultipleopponentsinvolvedinthegrapple,youpickonetomaketheopposedgrapplecheckagainst.

Page155of462
MultipleGrapplers
Severalcombatantscanbeinasinglegrapple.Uptofourcombatantscangrappleasingleopponentinagivenround.
Creaturesthatareoneormoresizecategoriessmallerthanyoucountforhalf,creaturesthatareonesizecategorylarger
thanyoucountdouble,andcreaturestwoormoresizecategorieslargercountquadruple.
Whenyouaregrapplingwithmultipleopponents,youchooseoneopponenttomakeanopposedcheckagainst.The
exceptionisanattempttoescapefromthegrapple;tosuccessfullyescape,yourgrapplecheckmustbeatthecheckresults
ofeachopponent.

MountedCombat
HorsesinCombat:Warhorsesandwarponiescanservereadilyascombatsteeds.Lighthorses,ponies,andheavyhorses,
however,arefrightenedbycombat.Ifyoudontdismount,youmustmakeaDC20Ridecheckeachroundasamoveaction
tocontrolsuchahorse.Ifyousucceed,youcanperformastandardactionafterthemoveaction.Ifyoufail,themove
actionbecomesafullroundactionandyoucantdoanythingelseuntilyournextturn.
Yourmountactsonyourinitiativecountasyoudirectit.Youmoveatitsspeed,butthemountusesitsactiontomove.
Ahorse(notapony)isaLargecreatureandthustakesupaspace10feet(2squares)across.Forsimplicity,assumethat
youshareyourmountsspaceduringcombat.

CombatwhileMounted
WithaDC5Ridecheck,youcanguideyourmountwithyourkneessoastousebothhandstoattackordefendyourself.
Thisisafreeaction.
Whenyouattackacreaturesmallerthanyourmountthatisonfoot,yougetthe+1bonusonmeleeattacksforbeingon
higherground.Ifyourmountmovesmorethan5feet,youcanonlymakeasinglemeleeattack.Essentially,youhaveto
waituntilthemountgetstoyourenemybeforeattacking,soyoucantmakeafullattack.Evenatyourmountsfullspeed,
youdonttakeanypenaltyonmeleeattackswhilemounted.
Ifyourmountcharges,youalsotaketheACpenaltyassociatedwithacharge.Ifyoumakeanattackattheendofthe
charge,youreceivethebonusgainedfromthecharge.Whenchargingonhorseback,youdealdoubledamagewithalance
(seeCharge).
Youcanuserangedweaponswhileyourmountistakingadoublemove,butata4penaltyontheattackroll.Youcanuse
rangedweaponswhileyourmountisrunning(quadruplespeed),ata8penalty.Ineithercase,youmaketheattackroll
whenyourmounthascompletedhalfitsmovement.Youcanmakeafullattackwitharangedweaponwhileyourmountis
moving.Likewise,youcantakemoveactionsnormally

CastingSpellswhileMounted
Youcancastaspellnormallyifyourmountmovesuptoanormalmove(itsspeed)eitherbeforeorafteryoucast.Ifyou
haveyourmountmovebothbeforeandafteryoucastaspell,thenyourecastingthespellwhilethemountismoving,and
youhavetomakeaConcentrationcheckduetothevigorousmotion(DC10+spelllevel)orlosethespell.Ifthemountis
running(quadruplespeed),youcancastaspellwhenyourmounthasmoveduptotwiceitsspeed,butyourConcentration
checkismoredifficultduetotheviolentmotion(DC15+spelllevel).

IfYourMountFallsinBattle
Ifyourmountfalls,youhavetosucceedonaDC15Ridechecktomakeasoftfallandtakenodamage.Ifthecheckfails,
youtake1d6pointsofdamage.

IfYouAreDropped
Ifyouareknockedunconscious,youhavea50%chancetostayinthesaddle(or75%ifyoureinamilitarysaddle).
Otherwiseyoufallandtake1d6pointsofdamage.
Withoutyoutoguideit,yourmountavoidscombat.

Overrun
Youcanattemptanoverrunasastandardactiontakenduringyourmove,oraspartofacharge.(Ingeneral,youcannot
takeastandardactionduringamove;thisisanexception.)Withanoverrun,youattempttoplowpastoroveryour
opponent(andmovethroughhissquare)asyoumove.Youcanonlyoverrunanopponentwhoisonesizecategorylarger
thanyou,thesamesize,orsmaller.Youcanmakeonlyoneoverrunattemptperround.
Ifyoureattemptingtooverrunanopponent,followthesesteps.
Step1:AttackofOpportunity.Sinceyoubegintheoverrunbymovingintothedefendersspace,youprovokeanattackof
Page156of462
opportunityfromthedefender.
Step2:OpponentAvoids?Thedefenderhastheoptiontosimplyavoidyou.Ifheavoidsyou,hedoesntsufferanyilleffect.
Ifyouwereattemptingtheoverrunaspartofacharge,youmaykeepmoving.(Youcanalwaysmovethroughasquare
occupiedbysomeonewholetsyouby.)Ineithercase,theoverrunattemptdoesntcountagainstyouractionsthisround
(exceptforanymovementrequiredtoentertheopponentssquare).Ifyouropponentdoesntavoidyou,movetoStep3.
Step3:OpponentBlocks?Ifyouropponentblocksyou,makeaStrengthcheckopposedbythedefendersDexterityor
Strengthcheck(whicheverabilityscorehasthehighermodifier).Acombatantgetsa+4bonusonthecheckforeverysize
categoryheislargerthanMediumora4penaltyforeverysizecategoryheissmallerthanMedium.Yougaina+2bonus
onyourStrengthcheckifyoumadetheoverrunaspartofacharge.Thedefendergetsa+4bonusonhischeckifhehas
morethantwolegsorisotherwisemorestablethananormalhumanoid.Ifyouwin,youknockthedefenderprone.Ifyou
lose,thedefendermayimmediatelyreactandmakeaStrengthcheckopposedbyyourDexterityorStrengthcheck
(includingthesizemodifiersnotedabove,butnoothermodifiers)totrytoknockyouprone.
Step4:Consequences.Ifyousucceedinknockingyouropponentprone,youcancontinueyourmovementasnormal.Ifyou
failandareknockedproneinturn,youhavetomove5feetbackthewayyoucameandfallprone,endingyourmovement
there.Ifyoufailbutarenotknockedprone,youhavetomove5feetbackthewayyoucame,endingyourmovementthere.
Ifthatsquareisoccupied,youfallproneinthatsquare.

ImprovedOverrun
IfyouhavetheImprovedOverrunfeat,yourtargetmaynotchoosetoavoidyou.

MountedOverrun(Trample)
Ifyouattemptanoverrunwhilemounted,yourmountmakestheStrengthchecktodeterminethesuccessorfailureofthe
overrunattack(andappliesitssizemodifier,ratherthanyours).IfyouhavetheTramplefeatandattemptanoverrunwhile
mounted,yourtargetmaynotchoosetoavoidyou,andifyouknockyouropponentpronewiththeoverrun,yourmount
maymakeonehoofattackagainstyouropponent.

Sunder
Youcanuseameleeattackwithaslashingorbludgeoningweapontostrikeaweaponorshieldthatyouropponentis
holding.Ifyoureattemptingtosunderaweaponorshield,followthestepsoutlinedhere.(Attackingheldobjectsother
thanweaponsorshieldsiscoveredbelow.)
Table:CommonArmor,Weapon,andShieldHardnessandHitPoints
WEAPONORSHIELD HARDNESS HP1
Lightblade 10 2
Onehandedblade 10 5
Twohandedblade 10 10
Lightmetalhaftedweapon 10 10
Onehandedmetalhaftedweapon 10 20
Lighthaftedweapon 5 2
Onehandedhaftedweapon 5 5
Twohandedhaftedweapon 5 10
Projectileweapon 5 5
Armor special2 armorbonusx5

Buckler 10 5
Lightwoodenshield 5 7
Heavywoodenshield 5 15
Lightsteelshield 10 10
Heavysteelshield 10 20
Towershield 5 20
1
ThehpvaluegivenisforMediumarmor,weapons,andshields.Divideby2foreachsizecategoryoftheitemsmallerthanMedium,or
multiplyitby2foreachsizecategorylargerthanMedium.
2
Variesbymaterial.
Step1:AttackofOpportunity.Youprovokeanattackofopportunityfromthetargetwhoseweaponorshieldyouaretrying
tosunder.(IfyouhavetheImprovedSunderfeat,youdontincuranattackofopportunityformakingtheattempt.)
Step2:OpposedRolls.Youandthedefendermakeopposedattackrollswithyourrespectiveweapons.Thewielderofa
twohandedweapononasunderattemptgetsa+4bonusonthisroll,andthewielderofalightweapontakesa4penalty.
Ifthecombatantsareofdifferentsizes,thelargercombatantgetsabonusontheattackrollof+4perdifferenceinsize
category.
Page157of462
Step3:Consequences.Ifyoubeatthedefender,rolldamageanddealittotheweaponorshield.SeeTable:Common
Armor,Weapon,andShieldHardnessandHitPointstodeterminehowmuchdamageyoumustdealtodestroytheweapon
orshield.
Ifyoufailthesunderattempt,youdontdealanydamage.

SunderingaCarriedorWornObject
Youdontuseanopposedattackrolltodamageacarriedorwornobject.Instead,justmakeanattackrollagainstthe
objectsAC.AcarriedorwornobjectsACisequalto10+itssizemodifier+theDexteritymodifierofthecarryingor
wearingcharacter.Attackingacarriedorwornobjectprovokesanattackofopportunityjustasattackingaheldobjectdoes.
Toattempttosnatchawayanitemwornbyadefenderratherthandamageit,seeDisarm.Youcantsunderarmorwornby
anothercharacter.

ThrowSplashWeapon
Asplashweaponisarangedweaponthatbreaksonimpact,splashingorscatteringitscontentsoveritstargetandnearby
creaturesorobjects.Toattackwithasplashweapon,makearangedtouchattackagainstthetarget.Thrownweapons
requirenoweaponproficiency,soyoudonttakethe4nonproficiencypenalty.Ahitdealsdirecthitdamagetothetarget,
andsplashdamagetoallcreatureswithin5feetofthetarget.
Youcaninsteadtargetaspecificgridintersection.TreatthisasarangedattackagainstAC5.However,ifyoutargetagrid
intersection,creaturesinalladjacentsquaresaredealtthesplashdamage,andthedirecthitdamageisnotdealttoany
creature.(Youcanttargetagridintersectionoccupiedbyacreature,suchasaLargeorlargercreature;inthiscase,youre
aimingatthecreature.)
Ifyoumissthetarget(whetheraimingatacreatureoragridintersection),roll1d8.Thisdeterminesthemisdirectionofthe
throw,with1beingstraightbackatyouand2through8countingclockwisearoundthegridintersectionortargetcreature.
Then,countanumberofsquaresintheindicateddirectionequaltotherangeincrementofthethrow.
Afteryoudeterminewheretheweaponlanded,itdealssplashdamagetoallcreaturesinadjacentsquares.

Trip
Youcantrytotripanopponentasanunarmedmeleeattack.Youcanonlytripanopponentwhoisonesizecategorylarger
thanyou,thesamesize,orsmaller.

MakingaTripAttack
Makeanunarmedmeleetouchattackagainstyourtarget.Thisprovokesanattackofopportunityfromyourtargetas
normalforunarmedattacks.
Ifyourattacksucceeds,makeaStrengthcheckopposedbythedefendersDexterityorStrengthcheck(whicheverability
scorehasthehighermodifier).Acombatantgetsa+4bonusforeverysizecategoryheislargerthanMediumora4
penaltyforeverysizecategoryheissmallerthanMedium.Thedefendergetsa+4bonusonhischeckifhehasmorethan
twolegsorisotherwisemorestablethananormalhumanoid.Ifyouwin,youtripthedefender.Ifyoulose,thedefender
mayimmediatelyreactandmakeaStrengthcheckopposedbyyourDexterityorStrengthchecktotrytotripyou.

AvoidingAttacksofOpportunity
IfyouhavetheImprovedTripfeat,orifyouaretrippingwithaweapon(seebelow),youdontprovokeanattackof
opportunityformakingatripattack.

BeingTripped(Prone)
Atrippedcharacterisprone.Standingupisamoveaction.

TrippingaMountedOpponent
Youmaymakeatripattackagainstamountedopponent.ThedefendermaymakeaRidecheckinplaceofhisDexterityor
Strengthcheck.Ifyousucceed,youpulltheriderfromhismount.

TrippingwithaWeapon
Someweaponscanbeusedtomaketripattacks.Inthiscase,youmakeameleetouchattackwiththeweaponinsteadofan
unarmedmeleetouchattack,andyoudontprovokeanattackofopportunity.
Ifyouaretrippedduringyourowntripattempt,youcandroptheweapontoavoidbeingtripped.

TurnorRebukeUndead
Goodclericsandpaladinsandsomeneutralclericscanchannelpositiveenergy,whichcanhalt,driveoff(rout),ordestroy

Page158of462
undead.
Evilclericsandsomeneutralclericscanchannelnegativeenergy,whichcanhalt,awe(rebuke),control(command),or
bolsterundead.
Regardlessoftheeffect,thegeneraltermfortheactivityisturning.Whenattemptingtoexercisetheirdivinecontrolover
thesecreatures,charactersmaketurningchecks.
Turningundeadisasupernaturalabilitythatacharactercanperformasastandardaction.Itdoesnotprovokeattacksof
opportunity.
Youmustpresentyourholysymboltoturnundead.Turningisconsideredanattack.

TimesperDay
Youmayattempttoturnundeadanumberoftimesperdayequalto3+yourCharismamodifier.Youcanincreasethis
numberbytakingtheExtraTurningfeat.

Range
Youturntheclosestturnableundeadfirst,andyoucantturnundeadthataremorethan60feetawayorthathavetotal
coverrelativetoyou.Youdontneedlineofsighttoatarget,butyoudoneedlineofeffect.

TurningCheck
Thefirstthingyoudoisrollaturningchecktoseehowpowerfulanundeadcreatureyoucanturn.ThisisaCharisma
check(1d20+yourCharismamodifier).Table:TurningUndeadgivesyoutheHitDiceofthemostpowerfulundeadyou
canaffect,relativetoyourlevel.Onagiventurningattempt,youcanturnnoundeadcreaturewhoseHitDiceexceedthe
resultonthistable.

TurningDamage
IfyourrollonTable:TurningUndeadishighenoughtoletyouturnatleastsomeoftheundeadwithin60feet,roll2d6+
yourclericlevel+yourCharismamodifierforturningdamage.ThatshowmanytotalHitDiceofundeadyoucanturn.
IfyourCharismascoreisaverageorlow,itspossibletorollfewerHitDiceofundeadturnedthanindicatedonTable:
TurningUndead.
Youmayskipoveralreadyturnedundeadthatarestillwithinrange,sothatyoudonotwasteyourturningcapacityon
them.

EffectandDurationofTurning
Turnedundeadfleefromyoubythebestandfastestmeansavailabletothem.Theyfleefor10rounds(1minute).Ifthey
cannotflee,theycower(givinganyattackrollsagainstthema+2bonus).Ifyouapproachwithin10feetofthem,however,
theyovercomebeingturnedandactnormally.(Youcanstandwithin10feetwithoutbreakingtheturningeffectyoujust
cantapproachthem.)Youcanattackthemwithrangedattacks(fromatleast10feetaway),andotherscanattackthemin
anyfashion,withoutbreakingtheturningeffect.

EvilClericsandUndead
Evilclericschannelnegativeenergytorebuke(awe)orcommand(control)undeadratherthanchannelingpositiveenergy
toturnordestroythem.Anevilclericmakestheequivalentofaturningcheck.Undeadthatwouldbeturnedarerebuked
instead,andthosethatwouldbedestroyedarecommanded.

NeutralClericsandUndead
Aclericofneutralalignmentcaneitherturnundeadbutnotrebukethem,orrebukeundeadbutnotturnthem.SeeTurnor
RebukeUndeadformoreinformation.
Evenifaclericisneutral,channelingpositiveenergyisagoodactandchannelingnegativeenergyisevil.

PaladinsandUndead
Beginningat4thlevel,paladinscanturnundeadasiftheywereclericsofthreelevelslowerthantheyactuallyare.

DestroyingUndead
Ifyouhavetwiceasmanylevels(ormore)astheundeadhaveHitDice,youdestroyanythatyouwouldnormallyturn.

Rebuked
Anevilclericmaychannelnegativeenergytorebuketheundead.Arebukedundeadcreaturecowersasifinawe(attack
rollsagainstthecreaturegeta+2bonus).Theeffectlasts10rounds.

Page159of462
Commanded
Anevilclericmaychannelnegativeenergytocommandtheundead.Acommandedundeadcreatureisunderthemental
controloftheevilcleric.Theclericmusttakeastandardactiontogivementalorderstoacommandedundead.Atanyone
time,theclericmaycommandanynumberofundeadwhosetotalHitDicedonotexceedhislevel.Hemayvoluntarily
relinquishcommandonanycommandedundeadcreatureorcreaturesinordertocommandnewones.

DispellingTurning
Anevilclericmaychannelnegativeenergytodispelagoodclericsturningeffect.Theevilclericmakesaturningcheckasif
attemptingtorebuketheundead.Iftheturningcheckresultisequaltoorgreaterthantheturningcheckresultthatthe
goodclericscoredwhenturningtheundead,thentheundeadarenolongerturned.Theevilclericrollsturningdamageof
2d6+clericlevel+CharismamodifiertoseehowmanyHitDiceworthofundeadhecanaffectinthisway(asifhewere
rebukingthem).

BolsteringUndead
Anevilclericmayalsobolsterundeadcreaturesagainstturninginadvance.Hemakesaturningcheckasifattemptingto
rebuketheundead,buttheHitDiceresultonTable:TurningUndeadbecomestheundeadcreatureseffectiveHitDiceas
farasturningisconcerned(providedtheresultishigherthanthecreaturesactualHitDice).Thebolsteringlasts10
rounds.Anevilundeadclericcanbolsterhimselfinthismanner.

TurningOtherCreatures
Someclericshavetheabilitytoturncreaturesotherthanundead.
Theturningcheckresultisdeterminedasnormal.
Table:TurningUndead
TURNINGCHECKRESULT MOSTPOWERFULUNDEADAFFECTED(MAXIMUMHITDICE)
0orlower Clericslevel4
13 Clericslevel3
46 Clericslevel2
79 Clericslevel1
1012 Clericslevel
1315 Clericslevel+1
1618 Clericslevel+2
1921 Clericslevel+3
22orhigher Clericslevel+4

TwoWeaponFighting
Ifyouwieldasecondweaponinyouroffhand,youcangetoneextraattackperroundwiththatweapon.Yousuffera6
penaltywithyourregularattackorattackswithyourprimaryhandanda10penaltytotheattackwithyouroffhand
whenyoufightthisway.Youcanreducethesepenaltiesintwoways:
Ifyouroffhandweaponislight,thepenaltiesarereducedby2each.(Anunarmedstrikeisalwaysconsideredlight.)
TheTwoWeaponFightingfeatlessenstheprimaryhandpenaltyby2,andtheoffhandpenaltyby6.
Table:TwoWeaponFightingPenaltiessummarizestheinteractionofallthesefactors.
Table:TwoWeaponFightingPenalties
CIRCUMSTANCES PRIMARYHAND OFFHAND
Normalpenalties 6 10
Offhandweaponislight 4 8
TwoWeaponFightingfeat 4 4
OffhandweaponislightandTwoWeaponFightingfeat 2 2

DoubleWeapons
Youcanuseadoubleweapontomakeanextraattackwiththeoffhandendoftheweaponasifyouwerefightingwithtwo
weapons.Thepenaltiesapplyasiftheoffhandendoftheweaponwerealightweapon.

ThrownWeapons
Thesamerulesapplywhenyouthrowaweaponfromeachhand.Treatadartorshurikenasalightweaponwhenusedin
thismanner,andtreatabolas,javelin,net,orslingasaonehandedweapon.

SpecialInitiativeActions
Herearewaystochangewhenyouactduringcombatbyalteringyourplaceintheinitiativeorder.
Page160of462
Delay
Bychoosingtodelay,youtakenoactionandthenactnormallyonwhateverinitiativecountyoudecidetoact.Whenyou
delay,youvoluntarilyreduceyourowninitiativeresultfortherestofthecombat.Whenyournew,lowerinitiativecount
comesuplaterinthesameround,youcanactnormally.Youcanspecifythisnewinitiativeresultorjustwaituntilsome
timelaterintheroundandactthen,thusfixingyournewinitiativecountatthatpoint.
Younevergetbackthetimeyouspendwaitingtoseewhatsgoingtohappen.Youcant,however,interruptanyoneelses
action(asyoucanwithareadiedaction).

InitiativeConsequencesofDelaying
Yourinitiativeresultbecomesthecountonwhichyoutookthedelayedaction.Ifyoucometoyournextactionandhavenot
yetperformedanaction,youdontgettotakeadelayedaction(thoughyoucandelayagain).
Ifyoutakeadelayedactioninthenextround,beforeyourregularturncomesup,yourinitiativecountrisestothatnew
pointintheorderofbattle,andyoudonotgetyourregularactionthatround.

Ready
Thereadyactionletsyoupreparetotakeanactionlater,afteryourturnisoverbutbeforeyournextonehasbegun.
Readyingisastandardaction.Itdoesnotprovokeanattackofopportunity(thoughtheactionthatyoureadymightdoso).

ReadyinganAction
Youcanreadyastandardaction,amoveaction,orafreeaction.Todoso,specifytheactionyouwilltakeandthe
conditionsunderwhichyouwilltakeit.Then,anytimebeforeyournextaction,youmaytakethereadiedactionin
responsetothatcondition.Theactionoccursjustbeforetheactionthattriggersit.Ifthetriggeredactionispartofanother
charactersactivities,youinterrupttheothercharacter.Assumingheisstillcapableofdoingso,hecontinueshisactions
onceyoucompleteyourreadiedaction.Yourinitiativeresultchanges.Fortherestoftheencounter,yourinitiativeresultis
thecountonwhichyoutookthereadiedaction,andyouactimmediatelyaheadofthecharacterwhoseactiontriggered
yourreadiedaction.
Youcantakea5footstepaspartofyourreadiedaction,butonlyifyoudontotherwisemoveanydistanceduringthe
round.

InitiativeConsequencesofReadying
Yourinitiativeresultbecomesthecountonwhichyoutookthereadiedaction.Ifyoucometoyournextactionandhavenot
yetperformedyourreadiedaction,youdontgettotakethereadiedaction(thoughyoucanreadythesameactionagain).
Ifyoutakeyourreadiedactioninthenextround,beforeyourregularturncomesup,yourinitiativecountrisestothatnew
pointintheorderofbattle,andyoudonotgetyourregularactionthatround.

DistractingSpellcasters
Youcanreadyanattackagainstaspellcasterwiththetriggerifshestartscastingaspell.Ifyoudamagethespellcaster,she
maylosethespellshewastryingtocast(asdeterminedbyherConcentrationcheckresult).

ReadyingtoCounterspell
Youmayreadyacounterspellagainstaspellcaster(oftenwiththetriggerifshestartscastingaspell).Inthiscase,when
thespellcasterstartsaspell,yougetachancetoidentifyitwithaSpellcraftcheck(DC15+spelllevel).Ifyoudo,andif
youcancastthatsamespell(areabletocastitandhaveitprepared,ifyoupreparespells),youcancastthespellasa
counterspellandautomaticallyruintheotherspellcastersspell.Counterspellingworksevenifonespellisdivineandthe
otherarcane.
Aspellcastercanusedispelmagictocounterspellanotherspellcaster,butitdoesntalwayswork.

ReadyingaWeaponagainstaCharge
Youcanreadycertainpiercingweapons,settingthemtoreceivecharges.Areadiedweaponofthistypedealsdouble
damageifyouscoreahitwithitagainstachargingcharacter.

Special Abilities and Conditions


SpecialAbilityTypes
Aspecialabilityiseitherextraordinary,spelllike,orsupernaturalinnature.

Page161of462
ExtraordinaryAbilities(Ex)
Extraordinaryabilitiesarenonmagical.Theyare,however,notsomethingthatjustanyonecandoorevenlearntodo
withoutextensivetraining.Effectsorareasthatnegateordisruptmagichavenoeffectonextraordinaryabilities.

SpellLikeAbilities(Sp)
Spelllikeabilities,asthenameimplies,arespellsandmagicalabilitiesthatareverymuchlikespells.Spelllikeabilitiesare
subjecttospellresistanceanddispelmagic.Theydonotfunctioninareaswheremagicissuppressedornegated(suchasan
antimagicfield).

SupernaturalAbilities(Su)
Supernaturalabilitiesaremagicalbutnotspelllike.Supernaturalabilitiesarenotsubjecttospellresistanceanddonot
functioninareaswheremagicissuppressedornegated(suchasanantimagicfield).Asupernaturalabilityseffectcannot
bedispelledandisnotsubjecttocounterspells.Seethetablebelowforasummaryofthetypesofspecialabilities.
Table:SpecialAbilityTypes
SPECIALABILITYTYPE EXTRAORDINARY SPELLLIKE SUPERNATURAL
Dispel No Yes Yes
Spellresistance No Yes No
Antimagicfield No Yes Yes
Attackofopportunity No Yes No
Dispel:Candispelmagicandsimilarspellsdispeltheeffectsofabilitiesofthattype?
SpellResistance:Doesspellresistanceprotectacreaturefromtheseabilities?
AntimagicField:Doesanantimagicfieldorsimilarmagicsuppresstheability?
AttackofOpportunity:Doesusingtheabilityprovokeattacksofopportunitythewaythatcastingaspelldoes?

SpecialAbilities
AbilityScoreLoss
Variousattackscauseabilityscoreloss,eitherabilitydamageorabilitydrain.Pointslosttoabilitydamagereturnattherate
of1pointperday(ordoublethatifthecharactergetscompletebedrest)toeachdamagedability,andthespellslesser
restorationandrestorationoffsetabilitydamageaswell.Abilitydrain,however,ispermanent,thoughrestorationcan
restoreeventhoselostabilityscorepoints.
Whileanylossisdebilitating,losingallpointsinanabilityscorecanbedevastating.
Strength0meansthatthecharactercannotmoveatall.Helieshelplessontheground.
Dexterity0meansthatthecharactercannotmoveatall.Hestandsmotionless,rigid,andhelpless.
Constitution0meansthatthecharacterisdead.
Intelligence0meansthatthecharactercannotthinkandisunconsciousinacomalikestupor,helpless.
Wisdom0meansthatthecharacteriswithdrawnintoadeepsleepfilledwithnightmares,helpless.
Charisma0meansthatthecharacteriswithdrawnintoacatatonic,comalikestupor,helpless.
Keepingtrackofnegativeabilityscorepointsisnevernecessary.Acharactersabilityscorecantdropbelow0.
Havingascoreof0inanabilityisdifferentfromhavingnoabilityscorewhatsoever.
Somespellsorabilitiesimposeaneffectiveabilityscorereduction,whichisdifferentfromabilityscoreloss.Anysuch
reductiondisappearsattheendofthespellsorabilitysduration,andtheabilityscoreimmediatelyreturnstoitsformer
value.
IfacharactersConstitutionscoredrops,thenheloses1hitpointperHitDieforeverypointbywhichhisConstitution
modifierdrops.AhitpointscorecantbereducedbyConstitutiondamageordraintolessthan1hitpointperHitDie.
Theabilitythatsomecreatureshavetodrainabilityscoresisasupernaturalone,requiringsomesortofattack.Such
creaturesdonotdrainabilitiesfromenemieswhentheenemiesstrikethem,evenwithunarmedattacksornatural
weapons.

Antimagic
Anantimagicfieldspelloreffectcancelsmagicaltogether.Anantimagiceffecthasthefollowingpowersandcharacteristics.
Nosupernaturalability,spelllikeability,orspellworksinanareaofantimagic(butextraordinaryabilitiesstillwork).
Page162of462
Antimagicdoesnotdispelmagic;itsuppressesit.Onceamagicaleffectisnolongeraffectedbytheantimagic(the
antimagicfades,thecenteroftheeffectmovesaway,andsoon),themagicreturns.Spellsthatstillhavepartoftheir
durationleftbeginfunctioningagain,magicitemsareonceagainuseful,andsoforth.
Spellareasthatincludebothanantimagicareaandanormalarea,butarenotcenteredintheantimagicarea,still
functioninthenormalarea.Ifthespellscenterisintheantimagicarea,thenthespellissuppressed.
Golemsandotherconstructs,elementals,outsiders,andcorporealundead,stillfunctioninanantimagicarea(though
theantimagicareasuppressestheirspellcastingandtheirsupernaturalandspelllikeabilitiesnormally).Ifsuch
creaturesaresummonedorconjured,however,seebelow.
Summonedorconjuredcreaturesofanytype,aswellasincorporealundead,winkoutiftheyentertheareaofan
antimagiceffect.Theyreappearinthesamespotoncethefieldgoesaway.
Magicitemswithcontinuouseffectsdonotfunctionintheareaofanantimagiceffect,buttheireffectsarenotcanceled
(sothecontentsofabagofholdingareunavailable,butneitherspilloutnordisappearforever).
Twoantimagicareasinthesameplacedonotcanceleachotherout,nordotheystack.
Wallofforce,prismaticwall,andprismaticspherearenotaffectedbyantimagic.Breakenchantment,dispelmagic,and
greaterdispelmagicspellsdonotdispelantimagic.Magesdisjunctionhasa1%chancepercasterlevelofdestroyingan
antimagicfield.Iftheantimagicfieldsurvivesthedisjunction,noitemswithinitaredisjoined.

BlindsightandBlindsense
Blindsight
Somecreatureshaveblindsight,theextraordinaryabilitytouseanonvisualsense(oracombinationofsuchsenses)to
operateeffectivelywithoutvision.Suchsensemayincludesensitivitytovibrations,acutescent,keenhearing,or
echolocation.Thisabilitymakesinvisibilityandconcealment(evenmagicaldarkness)irrelevanttothecreature(thoughit
stillcantseeetherealcreatures).Thisabilityoperatesouttoarangespecifiedinthecreaturedescription.
Blindsightneverallowsacreaturetodistinguishcolororvisualcontrast.Acreaturecannotreadwithblindsight.
Blindsightdoesnotsubjectacreaturetogazeattacks(eventhoughdarkvisiondoes).
Blindingattacksdonotpenalizecreaturesusingblindsight.
Deafeningattacksthwartblindsightifitreliesonhearing.
Blindsightworksunderwaterbutnotinavacuum.
Blindsightnegatesdisplacementandblureffects.

Blindsense
Othercreatureshaveblindsense,alesserabilitythatletsthecreaturenoticethingsitcannotsee,butwithouttheprecision
ofblindsight.ThecreaturewithblindsenseusuallydoesnotneedtomakeSpotorListencheckstonoticeandlocate
creatureswithinrangeofitsblindsenseability,providedthatithaslineofeffecttothatcreature.Anyopponentthecreature
cannotseehastotalconcealment(50%misschance)againstthecreaturewithblindsense,andtheblindsensingcreature
stillhasthenormalmisschancewhenattackingfoesthathaveconcealment.Visibilitystillaffectsthemovementofa
creaturewithblindsense.AcreaturewithblindsenseisstilldenieditsDexteritybonustoArmorClassagainstattacksfrom
creaturesitcannotsee.

BreathWeapon
Acreatureattackingwithabreathweaponisactuallyexpellingsomethingfromitsmouth(ratherthanconjuringitby
meansofaspellorsomeothermagicaleffect).Mostcreatureswithbreathweaponsarelimitedtoanumberofusesperday
orbyaminimumlengthoftimethatmustpassbetweenuses.Suchcreaturesareusuallysmartenoughtosavetheirbreath
weaponuntiltheyreallyneedit.
Usingabreathweaponistypicallyastandardaction.
Noattackrollisnecessary.Thebreathsimplyfillsitsstatedarea.
Anycharactercaughtintheareamustmaketheappropriatesavingthroworsufferthebreathweaponsfulleffect.In
manycases,acharacterwhosucceedsonhissavingthrowstilltakeshalfdamageorsomeotherreducedeffect.
Breathweaponsaresupernaturalabilitiesexceptwherenoted.
Creaturesareimmunetotheirownbreathweapons.

Page163of462
Creaturesunabletobreathecanstillusebreathweapons.(Thetermissomethingofamisnomer.)

CharmandCompulsion
Manyabilitiesandspellscancloudthemindsofcharactersandmonsters,leavingthemunabletotellfriendfromfoeor
worseyet,deceivingthemintothinkingthattheirformerfriendsarenowtheirworstenemies.Twogeneraltypesof
enchantmentsaffectcharactersandcreatures:charmsandcompulsions.
Charminganothercreaturegivesthecharmingcharactertheabilitytobefriendandsuggestcoursesofactionstohisminion,
buttheservitudeisnotabsoluteormindless.Charmsofthistypeincludethevariouscharmspells.Essentially,acharmed
characterretainsfreewillbutmakeschoicesaccordingtoaskewedviewoftheworld.
Acharmedcreaturedoesntgainanymagicalabilitytounderstandhisnewfriendslanguage.
Acharmedcharacterretainshisoriginalalignmentandallegiances,generallywiththeexceptionthathenowregardsthe
charmingcreatureasadearfriendandwillgivegreatweighttohissuggestionsanddirections.
Acharmedcharacterfightshisformeralliesonlyiftheythreatenhisnewfriend,andeventhenheusestheleastlethal
meansathisdisposalaslongasthesetacticsshowanypossibilityofsuccess(justashewouldinafightbetweentwo
actualfriends).
AcharmedcharacterisentitledtoanopposedCharismacheckagainsthismasterinordertoresistinstructionsor
commandsthatwouldmakehimdosomethinghewouldntnormallydoevenforaclosefriend.Ifhesucceeds,he
decidesnottogoalongwiththatorderbutremainscharmed.
Acharmedcharacterneverobeysacommandthatisobviouslysuicidalorgrievouslyharmfultoher.
Ifthecharmingcreaturecommandshisminiontodosomethingthattheinfluencedcharacterwouldbeviolently
opposedto,thesubjectmayattemptanewsavingthrowtobreakfreeoftheinfluencealtogether.
Acharmedcharacterwhoisopenlyattackedbythecreaturewhocharmedhimorbythatcreaturesapparentalliesis
automaticallyfreedofthespelloreffect.
Compulsionisadifferentmatteraltogether.Acompulsionoverridesthesubjectsfreewillinsomewayorsimplychanges
thewaythesubjectsmindworks.Acharmmakesthesubjectafriendofthecaster;acompulsionmakesthesubjectobey
thecaster.
Regardlessofwhetheracharacterischarmedorcompelled,hewontvolunteerinformationortacticsthathismaster
doesntaskfor.

ColdImmunity
Acreaturewithcoldimmunitynevertakescolddamage.Ithasvulnerabilitytofire,whichmeansittakeshalfagainas
much(+50%)damageasnormalfromfire,regardlessofwhetherasavingthrowisallowed,orifthesaveisasuccessor
failure.

DamageReduction
Somemagiccreatureshavethesupernaturalabilitytoinstantlyhealdamagefromweaponsortoignoreblowsaltogetheras
thoughtheywereinvulnerable.
Thenumericalpartofacreaturesdamagereductionistheamountofhitpointsthecreatureignoresfromnormalattacks.
Usually,acertaintypeofweaponcanovercomethisreduction.Thisinformationisseparatedfromthedamagereduction
numberbyaslash.Damagereductionmaybeovercomebyspecialmaterials,bymagicweapons(anyweaponwitha+1or
higherenhancementbonus,notcountingtheenhancementfrommasterworkquality),certaintypesofweapons(suchas
slashingorbludgeoning),andweaponsimbuedwithanalignment.Ifadashfollowstheslashthenthedamagereductionis
effectiveagainstanyattackthatdoesnotignoredamagereduction.
Ammunitionfiredfromaprojectileweaponwithanenhancementbonusof+1orhigheristreatedasamagicweaponfor
thepurposeofovercomingdamagereduction.Similarly,ammunitionfiredfromaprojectileweaponwithanalignment
gainsthealignmentofthatprojectileweapon(inadditiontoanyalignmentitmayalreadyhave).
Wheneverdamagereductioncompletelynegatesthedamagefromanattack,italsonegatesmostspecialeffectsthat
accompanytheattack,suchasinjurytypepoison,amonksstunning,andinjurytypedisease.Damagereductiondoesnot
negatetouchattacks,energydamagedealtalongwithanattack,orenergydrains.Nordoesitaffectpoisonsordiseases
deliveredbyinhalation,ingestion,orcontact.
Attacksthatdealnodamagebecauseofthetargetsdamagereductiondonotdisruptspells.

Page164of462
Spells,spelllikeabilities,andenergyattacks(evennonmagicalfire)ignoredamagereduction.
Sometimesdamagereductionisinstanthealing.Sometimesdamagereductionrepresentsthecreaturestoughhideorbody,.
Ineithercase,characterscanseethatconventionalattacksdontwork.
Ifacreaturehasdamagereductionfrommorethanonesource,thetwoformsofdamagereductiondonotstack.Instead,
thecreaturegetsthebenefitofthebestdamagereductioninagivensituation.

Darkvision
Darkvisionistheextraordinaryabilitytoseewithnolightsourceatall,outtoarangespecifiedforthecreature.Darkvision
isblackandwhiteonly(colorscannotbediscerned).Itdoesnotallowcharacterstoseeanythingthattheycouldnotsee
otherwiseinvisibleobjectsarestillinvisible,andillusionsarestillvisibleaswhattheyseemtobe.Likewise,darkvision
subjectsacreaturetogazeattacksnormally.Thepresenceoflightdoesnotspoildarkvision.

DeathAttacks
Inmostcases,adeathattackallowsthevictimaFortitudesavetoavoidtheaffect,butifthesavefails,thecharacterdies
instantly.
Raisedeaddoesntworkonsomeonekilledbyadeathattack.
Deathattacksslayinstantly.Avictimcannotbemadestableandtherebykeptalive.
Incaseitmatters,adeadcharacter,nomatterhowshedied,has10hitpoints.
Thespelldeathwardprotectsacharacteragainsttheseattacks.

Disease
Whenacharacterisinjuredbyacontaminatedattacktouchesanitemsmearedwithdiseasedmatter,orconsumesdisease
taintedfoodordrink,hemustmakeanimmediateFortitudesavingthrow.Ifhesucceeds,thediseasehasnoeffecthis
immunesystemfoughtofftheinfection.Ifhefails,hetakesdamageafteranincubationperiod.Onceperdayafterward,he
mustmakeasuccessfulFortitudesavingthrowtoavoidrepeateddamage.Twosuccessfulsavingthrowsinarowindicate
thathehasfoughtoffthediseaseandrecovers,takingnomoredamage.
TheseFortitudesavingthrowscanberolledsecretlysothattheplayerdoesntknowwhetherthediseasehastakenhold.

DiseaseDescriptions
Diseaseshavevarioussymptomsandarespreadthroughanumberofvectors.Thecharacteristicsofseveraltypicaldiseases
aresummarizedonTable:Diseasesanddefinedbelow.
Disease:Diseaseswhosenamesareprintedinitalicinthetablearesupernaturalinnature.Theothersareextraordinary.
Infection:Thediseasesmethodofdeliveryingested,inhaled,viainjury,orcontact.Keepinmindthatsomeinjurydiseases
maybetransmittedbyassmallaninjuryasafleabiteandthatmostinhaleddiseasescanalsobeingested(andviceversa).
DC:TheDifficultyClassfortheFortitudesavingthrowstopreventinfection(ifthecharacterhasbeeninfected),toprevent
eachinstanceofrepeateddamage,andtorecoverfromthedisease.
IncubationPeriod:Thetimebeforedamagebegins.
Damage:Theabilitydamagethecharactertakesafterincubationandeachdayafterward.

TypesofDiseases
Typicaldiseasesincludethefollowing:
BlindingSickness:Spreadintaintedwater.
CackleFever:Symptomsincludehighfever,disorientation,andfrequentboutsofhideouslaughter.Alsoknownasthe
shrieks.
DemonFever:Nighthagsspreadit.Cancausepermanentabilitydrain.
DevilChills:Barbazuandpitfiendsspreadit.Ittakesthree,nottwo,successfulsavesinarowtorecoverfromdevilchills.
FilthFever:Direratsandotyughsspreadit.Thoseinjuredwhileinfilthysurroundingsmightalsocatchit.
Mindfire:Feelslikeyourbrainisburning.Causesstupor.
MummyRot:Spreadbymummies.Successfulsavingthrowsdonotallowthecharactertorecover(thoughtheydoprevent
damagenormally).
Page165of462
RedAche:Skinturnsred,bloated,andwarmtothetouch.
TheShakes:Causesinvoluntarytwitches,tremors,andfits.
SlimyDoom:Victimturnsintoinfectiousgoofromtheinsideout.Cancausepermanentabilitydrain.
Table:Diseases
Disease InfectionDC Incubation Damage
Blindingsickness Ingested16 1d3days 1d4Str1
Cacklefever Inhaled16 1day 1d6Wis
Demonfever Injury18 1day 1d6Con2
Devilchills3 Injury14 1d4days 1d4Str
Filthfever Injury12 1d3days 1d3Dex,1d3Con
Mindfire Inhaled12 1day 1d4Int
Mummyrot4 Contact20 1day 1d6Con
Redache Injury15 1d3days 1d6Str
Shakes Contact13 1day 1d8Dex
Slimydoom Contact14 1day 1d4Con2
1Eachtimethevictimtakes2ormoredamagefromthedisease,hemustmakeanotherFortitudesaveorbepermanentlyblinded.
2Whendamaged,charactermustsucceedonanothersavingthrowor1pointofdamageispermanentdraininstead.
3ThevictimmustmakethreesuccessfulFortitudesavingthrowsinarowtorecoverfromdevilchills.
4Successfulsavesdonotallowthecharactertorecover.Onlymagicalhealingcansavethecharacter.

HealingaDisease
UseoftheHealskillcanhelpadiseasedcharacter.Everytimeadiseasedcharactermakesasavingthrowagainstdisease
effects,thehealermakesacheck.ThediseasedcharactercanusethehealersresultinplaceofhissavingthrowiftheHeal
checkresultishigher.Thediseasedcharactermustbeinthehealerscareandmusthavespenttheprevious8hoursresting.
Charactersrecoverpointslosttoabilityscoredamageatarateof1perdayperabilitydamaged,andthisruleapplieseven
whileadiseaseisinprogress.Thatmeansthatacharacterwithaminordiseasemightbeabletowithstanditwithout
accumulatinganydamage.

EnergyDrainandNegativeLevels
Somehorriblecreatures,especiallyundeadmonsters,possessafearsomesupernaturalabilitytodrainlevelsfromthose
theystrikeincombat.Thecreaturemakinganenergydrainattackdrawsaportionofitsvictimslifeforcefromher.Most
energydrainattacksrequireasuccessfulmeleeattackrollmerephysicalcontactisnotenough.Eachsuccessfulenergy
drainattackbestowsoneormorenegativelevelsontheopponent.Acreaturetakesthefollowingpenaltiesforeach
negativelevelithasgained.
1onallskillchecksandabilitychecks.
1onattackrollsandsavingthrows.
5hitpoints.
1effectivelevel(wheneverthecreatureslevelisusedinadierollorcalculation,reduceitbyoneforeachnegativelevel).
Ifthevictimcastsspells,shelosesaccesstoonespellasifshehadcastherhighestlevel,currentlyavailablespell.(Ifshe
hasmorethanonespellatherhighestlevel,shechooseswhichsheloses.)Inaddition,whenshenextpreparesspellsor
regainsspellslots,shegetsonelessspellslotatherhighestspelllevel.
Negativelevelsremainfor24hoursoruntilremovedwithaspell,suchasrestoration.After24hours,theafflictedcreature
mustattemptaFortitudesave(DC10+1/2attackersHD+attackersChamodifier).(TheDCisprovidedintheattackers
description.)Ifthesavingthrowsucceeds,thenegativelevelgoesawaywithnoharmtothecreature.Theafflictedcreature
makesaseparatesavingthrowforeachnegativelevelithasgained.Ifthesavefails,thenegativelevelgoesaway,butthe
creatureslevelisalsoreducedbyone.
Acharacterwithnegativelevelsatleastequaltohercurrentlevel,ordrainedbelow1stlevel,isinstantlyslain.Depending
onthecreaturethatkilledher,shemayrisethenextnightasamonsterofthatkind.Ifnot,sherisesasawight.Acreature
gains5temporaryhitpointsforeachnegativelevelitbestows(thoughnotifthenegativeleveliscausedbyaspellor
similareffect).

Etherealness
PhasespidersandcertainothercreaturescanexistontheEtherealPlane.WhileontheEtherealPlane,acreatureiscalled

Page166of462
ethereal.Unlikeincorporealcreatures,etherealcreaturesarenotpresentontheMaterialPlane.
Etherealcreaturesareinvisible,inaudible,insubstantial,andscentlesstocreaturesontheMaterialPlane.Evenmost
magicalattackshavenoeffectonthem.Seeinvisibilityandtrueseeingrevealetherealcreatures.
AnetherealcreaturecanseeandhearintotheMaterialPlaneina60footradius,thoughmaterialobjectsstillblocksight
andsound.(Anetherealcreaturecantseethroughamaterialwall,forinstance.)Anetherealcreatureinsideanobjecton
theMaterialPlanecannotsee.ThingsontheMaterialPlane,however,lookgray,indistinct,andghostly.Anethereal
creaturecantaffecttheMaterialPlane,notevenmagically.Anetherealcreature,however,interactswithotherethereal
creaturesandobjectsthewaymaterialcreaturesinteractwithmaterialcreaturesandobjects.
EvenifacreatureontheMaterialPlanecanseeanetherealcreaturetheetherealcreatureisonanotherplane.Onlyforce
effectscanaffecttheetherealcreatures.If,ontheotherhand,bothcreaturesareethereal,theycanaffecteachother
normally.
AforceeffectoriginatingontheMaterialPlaneextendsontotheEtherealPlane,sothatawallofforceblocksanethereal
creature,andamagicmissilecanstrikeone(providedthespellcastercanseetheetherealtarget).Gazeeffectsand
abjurationsalsoextendfromtheMaterialPlanetotheEtherealPlane.NoneoftheseeffectsextendfromtheEtherealPlane
totheMaterialPlane.
Etherealcreaturesmoveinanydirection(includingupordown)atwill.Theydonotneedtowalkontheground,and
materialobjectsdontblockthem(thoughtheycantseewhiletheireyesarewithinsolidmaterial).
GhostshaveapowercalledmanifestationthatallowsthemtoappearontheMaterialPlaneasincorporealcreatures.Still,
theyareontheEtherealPlane,andanotheretherealcreaturecaninteractnormallywithamanifestingghost.Ethereal
creaturespassthroughandoperateinwateraseasilyasair.Etherealcreaturesdonotfallortakefallingdamage.

EvasionandImprovedEvasion
Theseextraordinaryabilitiesallowthetargetofanareaattacktoleaportwistoutoftheway.Roguesandmonkshave
evasionandimprovedevasionasclassfeatures,butcertainothercreatureshavetheseabilities,too.
IfsubjectedtoanattackthatallowsaReflexsaveforhalfdamage,acharacterwithevasiontakesnodamageona
successfulsave.
AswithaReflexsaveforanycreature,acharactermusthaveroomtomoveinordertoevade.Aboundcharacterorone
squeezingthroughanareacannotuseevasion.
AswithaReflexsaveforanycreature,evasionisareflexiveability.Thecharacterneednotknowthattheattackiscoming
touseevasion.
Roguesandmonkscannotuseevasioninmediumorheavyarmor.Somecreatureswiththeevasionabilityasaninnate
qualitydonothavethislimitation.
Improvedevasionislikeevasion,exceptthatevenonafailedsavingthrowthecharactertakesonlyhalfdamage.

FastHealing
Acreaturewithfasthealinghastheextraordinaryabilitytoregainhitpointsatanexceptionalrate.Exceptforwhatis
notedhere,fasthealingislikenaturalhealing.
Atthebeginningofeachofthecreaturesturns,ithealsacertainnumberofhitpoints(definedinitsdescription).
Unlikeregeneration,fasthealingdoesnotallowacreaturetoregroworreattachlostbodyparts.
Acreaturethathastakenbothnonlethalandlethaldamagehealsthenonlethaldamagefirst.
Fasthealingdoesnotrestorehitpointslostfromstarvation,thirst,orsuffocation.
Fasthealingdoesnotincreasethenumberofhitpointsregainedwhenacreaturepolymorphs.

Fear
Spells,magicitems,andcertainmonsterscanaffectcharacterswithfear.Inmostcases,thecharactermakesaWillsaving
throwtoresistthiseffect,andafailedrollmeansthatthecharacterisshaken,frightened,orpanicked.

Shaken
Characterswhoareshakentakea2penaltyonattackrolls,savingthrows,skillchecks,andabilitychecks.

Page167of462
Frightened
Characterswhoarefrightenedareshaken,andinadditiontheyfleefromthesourceoftheirfearasquicklyastheycan.
Theycanchoosethepathoftheirflight.Otherthanthatstipulation,oncetheyareoutofsight(orhearing)ofthesourceof
theirfear,theycanactastheywant.However,ifthedurationoftheirfearcontinues,characterscanbeforcedtofleeonce
moreifthesourceoftheirfearpresentsitselfagain.Charactersunabletofleecanfight(thoughtheyarestillshaken).

Panicked
Characterswhoarepanickedareshaken,andtheyrunawayfromthesourceoftheirfearasquicklyastheycan.Otherthan
runningawayfromthesource,theirpathisrandom.Theyfleefromallotherdangersthatconfrontthemratherthanfacing
thosedangers.Panickedcharacterscoweriftheyarepreventedfromfleeing.

BecomingEvenMoreFearful
Feareffectsarecumulative.Ashakencharacterwhoismadeshakenagainbecomesfrightened,andashakencharacterwho
ismadefrightenedbecomespanickedinstead.Afrightenedcharacterwhoismadeshakenorfrightenedbecomespanicked
instead.

FireImmunity
Acreaturewithfireimmunitynevertakesfiredamage.Ithasvulnerabilitytocold,whichmeansittakeshalfagainasmuch
(+50%)damageasnormalfromcold,regardlessofwhetherasavingthrowisallowed,orifthesaveisasuccessorfailure.

GaseousForm
Somecreatureshavethesupernaturalorspelllikeabilitytotaketheformofacloudofvapororgas.
Creaturesingaseousformcantrunbutcanfly.Agaseouscreaturecanmoveaboutanddothethingsthatacloudofgas
canconceivablydo,suchasflowthroughthecrackunderadoor.Itcant,however,passthroughsolidmatter.Gaseous
creaturescantattackphysicallyorcastspellswithverbal,somatic,material,orfocuscomponents.Theylosetheir
supernaturalabilities(exceptforthesupernaturalabilitytoassumegaseousform,ofcourse).
Creaturesingaseousformhavedamagereduction10/magic.Spells,spelllikeabilities,andsupernaturalabilitiesaffect
themnormally.Creaturesingaseousformloseallbenefitofmaterialarmor(includingnaturalarmor),thoughsize,
Dexterity,deflectionbonuses,andarmorbonusesfromforcearmorstillapply.
Gaseouscreaturesdonotneedtobreatheandareimmunetoattacksinvolvingbreathing(troglodytestench,poisongas,
andthelike).
Gaseouscreaturescantenterwaterorotherliquid.Theyarenotetherealorincorporeal.Theyareaffectedbywindsor
otherformsofmovingairtotheextentthatthewindpushestheminthedirectionthewindismoving.However,eventhe
strongestwindcantdisperseordamageacreatureingaseousform.
DiscerningacreatureingaseousformfromnaturalmistrequiresaDC15Spotcheck.Creaturesingaseousformattempting
tohideinanareawithmist,smoke,orothergasgaina+20bonus.

GazeAttack
Whilethemedusasgazeiswellknown,gazeattackscanalsocharm,curse,orevenkill.Gazeattacksnotproducedbya
spellaresupernatural.
Eachcharacterwithinrangeofagazeattackmustattemptasavingthrow(whichcanbeaFortitudeorWillsave)each
roundatthebeginningofhisturn.
Anopponentcanaverthiseyesfromthecreaturesface,lookingatthecreaturesbody,watchingitsshadow,ortrackingthe
creatureinareflectivesurface.Eachround,theopponenthasa50%chanceofnothavingtomakeasavingthrow.The
creaturewiththegazeattackgainsconcealmentrelativetotheopponent.Anopponentcanshuthiseyes,turnhisbackon
thecreature,orwearablindfold.Inthesecases,theopponentdoesnotneedtomakeasavingthrow.Thecreaturewiththe
gazeattackgainstotalconcealmentrelativetotheopponent.
Acreaturewithagazeattackcanactivelyattempttouseitsgazeasanattackaction.Thecreaturesimplychoosesatarget
withinrange,andthatopponentmustattemptasavingthrow.Ifthetargethaschosentodefendagainstthegazeas
discussedabove,theopponentgetsachancetoavoidthesavingthrow(either50%chanceforavertingeyesor100%
chanceforshuttingeyes).Itispossibleforanopponenttosaveagainstacreaturesgazetwiceduringthesameround,once
beforeitsownactionandonceduringthecreaturesaction.
Lookingatthecreaturesimage(suchasinamirrororaspartofanillusion)doesnotsubjecttheviewertoagazeattack.
Acreatureisimmunetoitsowngazeattack.

Page168of462
Ifvisibilityislimited(bydimlighting,afog,orthelike)sothatitresultsinconcealment,thereisapercentagechanceequal
tothenormalmisschanceforthatdegreeofconcealmentthatacharacterwontneedtomakeasavingthrowinagiven
round.Thischanceisnotcumulativewiththechanceforavertingyoureyes,butisrolledseparately.
Invisiblecreaturescannotusegazeattacks.
Charactersusingdarkvisionincompletedarknessareaffectedbyagazeattacknormally.
Unlessspecifiedotherwise,acreaturewithagazeattackcancontrolitsgazeattackandturnitoffwhensodesired.

Incorporeality
Spectres,wraiths,andafewothercreatureslackphysicalbodies.Suchcreaturesareinsubstantialandcantbetouchedby
nonmagicalmatterorenergy.Likewise,theycannotmanipulateobjectsorexertphysicalforceonobjects.However,
incorporealbeingshaveatangiblepresencethatsometimesseemslikeaphysicalattackagainstacorporealcreature.
Incorporealcreaturesarepresentonthesameplaneasthecharacters,andcharactershavesomechancetoaffectthem.
Incorporealcreaturescanbeharmedonlybyotherincorporealcreatures,bymagicweapons,orbyspells,spelllikeeffects,
orsupernaturaleffects.Theyareimmunetoallnonmagicalattackforms.Theyarenotburnedbynormalfires,affectedby
naturalcold,orharmedbymundaneacids.
Evenwhenstruckbymagicormagicweapons,anincorporealcreaturehasa50%chancetoignoreanydamagefroma
corporealsourceexceptforaforceeffectordamagedealtbyaghosttouchweapon.
Incorporealcreaturesareimmunetocriticalhits,extradamagefrombeingfavoredenemies,andfromsneakattacks.They
moveinanydirection(includingupordown)atwill.Theydonotneedtowalkontheground.Theycanpassthroughsolid
objectsatwill,althoughtheycannotseewhentheireyesarewithinsolidmatter.
Incorporealcreatureshidinginsidesolidobjectsgeta+2circumstancebonusonListenchecks,becausesolidobjectscarry
soundwell.Pinpointinganopponentfrominsideasolidobjectusesthesamerulesaspinpointinginvisibleopponents(see
Invisibility,below).
Incorporealcreaturesareinaudibleunlesstheydecidetomakenoise.
Thephysicalattacksofincorporealcreaturesignorematerialarmor,evenmagicarmor,unlessitismadeofforce(suchas
magearmororbracersofarmor)orhastheghosttouchability.
Incorporealcreaturespassthroughandoperateinwateraseasilyastheydoinair.
Incorporealcreaturescannotfallortakefallingdamage.
Corporealcreaturescannottriporgrappleincorporealcreatures.
Incorporealcreatureshavenoweightanddonotsetofftrapsthataretriggeredbyweight.
Incorporealcreaturesdonotleavefootprints,havenoscent,andmakenonoiseunlesstheymanifest,andeventhenthey
onlymakenoiseintentionally.

Invisibility
Theabilitytomoveaboutunseenisnotfoolproof.Whiletheycantbeseen,invisiblecreaturescanbeheard,smelled,or
felt.
Invisibilitymakesacreatureundetectablebyvision,includingdarkvision.
Invisibilitydoesnot,byitself,makeacreatureimmunetocriticalhits,butitdoesmakethecreatureimmunetoextra
damagefrombeingarangersfavoredenemyandfromsneakattacks.
Acreaturecangenerallynoticethepresenceofanactiveinvisiblecreaturewithin30feetwithaDC20Spotcheck.The
observergainsahunchthatsomethingstherebutcantseeitortargetitaccuratelywithanattack.Acreaturewhois
holdingstillisveryhardtonotice(DC30).Aninanimateobject,anunlivingcreatureholdingstill,oracompletely
immobilecreatureisevenhardertospot(DC40).Itspracticallyimpossible(+20DC)topinpointaninvisiblecreatures
locationwithaSpotcheck,andevenifacharactersucceedsonsuchacheck,theinvisiblecreaturestillbenefitsfromtotal
concealment(50%misschance).
Acreaturecanusehearingtofindaninvisiblecreature.AcharactercanmakeaListencheckforthispurposeasafree
actioneachround.AListencheckresultatleastequaltotheinvisiblecreaturesMoveSilentlycheckresultrevealsits
presence.(AcreaturewithnoranksinMoveSilentlymakesaMoveSilentlycheckasaDexteritychecktowhichanarmor
checkpenaltyapplies.)Asuccessfulcheckletsacharacterhearaninvisiblecreatureovertheresomewhere.Itspractically

Page169of462
impossibletopinpointthelocationofaninvisiblecreature.AListencheckthatbeatstheDCby20pinpointstheinvisible
creatureslocation.
Table:ListenDCstoDetectInvisibleCreatures
INVISIBLECREATUREIS... DC
Incombatorspeaking 0
Movingathalfspeed MoveSilentlycheckresult
Movingatfullspeed MoveSilentlycheckresult4
Runningorcharging MoveSilentlycheckresult20
Somedistanceaway +1per10feet
Behindanobstacle(door) +5
Behindanobstacle(stonewall) +15
Acreaturecangropeabouttofindaninvisiblecreature.Acharactercanmakeatouchattackwithhishandsoraweapon
intotwoadjacent5footsquaresusingastandardaction.Ifaninvisibletargetisinthedesignatedarea,thereisa50%miss
chanceonthetouchattack.Ifsuccessful,thegropingcharacterdealsnodamagebuthassuccessfullypinpointedthe
invisiblecreaturescurrentlocation.(Iftheinvisiblecreaturemoves,itslocation,obviously,isonceagainunknown.)
Ifaninvisiblecreaturestrikesacharacter,thecharacterstruckstillknowsthelocationofthecreaturethatstruckhim(until,
ofcourse,theinvisiblecreaturemoves).Theonlyexceptionisiftheinvisiblecreaturehasareachgreaterthan5feet.In
thiscase,thestruckcharacterknowsthegenerallocationofthecreaturebuthasnotpinpointedtheexactlocation.
Ifacharactertriestoattackaninvisiblecreaturewhoselocationhehaspinpointed,heattacksnormally,buttheinvisible
creaturestillbenefitsfromfullconcealment(andthusa50%misschance).Aparticularlylargeandslowcreaturemightget
asmallermisschance.
Ifacharactertriestoattackaninvisiblecreaturewhoselocationhehasnotpinpointed,havetheplayerchoosethespace
wherethecharacterwilldirecttheattack.Iftheinvisiblecreatureisthere,conducttheattacknormally.Iftheenemysnot
there,rollthemisschanceasifitwerethere,dontlettheplayerseetheresult,andtellhimthatthecharacterhasmissed.
Thatwaytheplayerdoesntknowwhethertheattackmissedbecausetheenemysnotthereorbecauseyousuccessfully
rolledthemisschance.
Ifaninvisiblecharacterpicksupavisibleobject,theobjectremainsvisible.Onecouldcoataninvisibleobjectwithflourto
atleastkeeptrackofitsposition(untiltheflourfellofforblewaway).Aninvisiblecreaturecanpickupasmallvisibleitem
andhideitonhisperson(tuckedinapocketorbehindacloak)andrenderiteffectivelyinvisible.
Invisiblecreaturesleavetracks.Theycanbetrackednormally.Footprintsinsand,mud,orothersoftsurfacescangive
enemiescluestoaninvisiblecreatureslocation.
Aninvisiblecreatureinthewaterdisplaceswater,revealingitslocation.Theinvisiblecreature,however,isstillhardtosee
andbenefitsfromconcealment.
Acreaturewiththescentabilitycandetectaninvisiblecreatureasitwouldavisibleone.
AcreaturewiththeBlindFightfeathasabetterchancetohitaninvisiblecreature.Rollthemisschancetwice,andhe
missesonlyifbothrollsindicateamiss.(Alternatively,makeone25%misschancerollratherthantwo50%misschance
rolls.)
Acreaturewithblindsightcanattack(andotherwiseinteractwith)creaturesregardlessofinvisibility.
Aninvisibleburningtorchstillgivesofflight,asdoesaninvisibleobjectwithalightspell(orsimilarspell)castuponit.
Etherealcreaturesareinvisible.Sinceetherealcreaturesarenotmateriallypresent,Spotchecks,Listenchecks,Scent,Blind
Fight,andblindsightdonthelplocatethem.Incorporealcreaturesareofteninvisible.Scent,BlindFight,andblindsight
donthelpcreaturesfindorattackinvisible,incorporealcreatures,butSpotchecksandpossiblyListencheckscanhelp.
Invisiblecreaturescannotusegazeattacks.
Invisibilitydoesnotthwartdetectspells.
Sincesomecreaturescandetectorevenseeinvisiblecreatures,itishelpfultobeabletohideevenwheninvisible.

LevelLoss
AcharacterwholosesalevelinstantlylosesoneHitDie.Thecharactersbaseattackbonus,basesavingthrowbonuses,and
specialclassabilitiesarenowreducedtothenew,lowerlevel.Likewise,thecharacterlosesanyabilityscoregain,skill
ranks,andanyfeatassociatedwiththelevel(ifapplicable).Iftheexactabilityscoreorskillranksincreasedfromalevel
nowlostisunknown(ortheplayerhasforgotten),lose1pointfromthehighestabilityscoreorranksfromthehighest

Page170of462
rankedskills.Ifafamiliarorcompanioncreaturehasabilitiestiedtoacharacterwhohaslostalevel,thecreaturesabilities
areadjustedtofitthecharactersnewlevel.
Thevictimsexperiencepointtotalisimmediatelysettothemidpointofthepreviouslevel.

LowLightVision
Characterswithlowlightvisionhaveeyesthataresosensitivetolightthattheycanseetwiceasfarasnormalindimlight.
Lowlightvisioniscolorvision.Aspellcasterwithlowlightvisioncanreadascrollaslongaseventhetiniestcandleflameis
nexttoherasasourceoflight.
Characterswithlowlightvisioncanseeoutdoorsonamoonlitnightaswellastheycanduringtheday.

Paralysis
Somemonstersandspellshavethesupernaturalorspelllikeabilitytoparalyzetheirvictims,immobilizingthemthrough
magicalmeans.(ParalysisfromtoxinsisdiscussedinthePoisonsectionbelow.)
Aparalyzedcharactercannotmove,speak,ortakeanyphysicalaction.Heisrootedtothespot,frozenandhelpless.Not
evenfriendscanmovehislimbs.Hemaytakepurelymentalactions,suchascastingaspellwithnocomponents.
Awingedcreatureflyingintheairatthetimethatitbecomesparalyzedcannotflapitswingsandfalls.Aswimmercant
swimandmaydrown.

Poison
Whenacharactertakesdamagefromanattackwithapoisonedweapon,touchesanitemsmearedwithcontactpoison,
consumespoisonedfoodordrink,orisotherwisepoisoned,hemustmakeaFortitudesavingthrow.Ifhefails,hetakesthe
poisonsinitialdamage(usuallyabilitydamage).Evenifhesucceeds,hetypicallyfacesmoredamage1minutelater,which
hecanalsoavoidwithasuccessfulFortitudesavingthrow.
Onedoseofpoisonsmearedonaweaponorsomeotherobjectaffectsjustasingletarget.Apoisonedweaponorobject
retainsitsvenomuntiltheweaponscoresahitortheobjectistouched(unlessthepoisoniswipedoffbeforeatargetcomes
incontactwithit).Anypoisonsmearedonanobjectorexposedtotheelementsinanywayremainspotentuntilitis
touchedorused.
Althoughsupernaturalandspelllikepoisonsarepossible,poisonouseffectsarealmostalwaysextraordinary.

PoisonTypes
Poisonscanbedividedintofourbasictypesaccordingtothemethodbywhichtheireffectisdelivered,asfollows.
Contact:Merelytouchingthistypeofpoisonnecessitatesasavingthrow.Itcanbeactivelydeliveredviaaweaponora
touchattack.Evenifacreaturehassufficientdamagereductiontoavoidtakinganydamagefromtheattack,thepoisoncan
stillaffectit.Achestorotherobjectcanbesmearedwithcontactpoisonaspartofatrap.
Ingested:Ingestedpoisonsarevirtuallyimpossibletoutilizeinacombatsituation.Apoisonercouldadministerapotionto
anunconsciouscreatureorattempttodupesomeoneintodrinkingoreatingsomethingpoisoned.Assassinsandother
characterstendtouseingestedpoisonsoutsideofcombat.
Inhaled:Inhaledpoisonsareusuallycontainedinfragilevialsoreggshells.Theycanbethrownasarangedattackwitha
rangeincrementof10feet.Whenitstrikesahardsurface(orisstruckhard),thecontainerreleasesitspoison.Onedose
spreadstofillthevolumeofa10footcube.Eachcreaturewithintheareamustmakeasavingthrow.(Holdingonesbreath
isineffectiveagainstinhaledpoisons;theyaffectthenasalmembranes,tearducts,andotherpartsofthebody.)
Injury:Thispoisonmustbedeliveredthroughawound.Ifacreaturehassufficientdamagereductiontoavoidtakingany
damagefromtheattack,thepoisondoesnotaffectit.Trapsthatcausedamagefromweapons,needles,andthelike
sometimescontaininjurypoisons.

PoisonCharacteristics
ThecharacteristicsofpoisonsaresummarizedonTable:Poisons.Termsonthetablearedefinedbelow.
Type:Thepoisonsmethodofdelivery(contact,ingested,inhaled,orviaaninjury)andtheFortitudesaveDCtoavoidthe
poisonsdamage.
InitialDamage:Thedamagethecharactertakesimmediatelyuponfailinghissavingthrowagainstthispoison.Ability
damageistemporaryunlessmarkedwithanasterisk(*),inwhichcasethelossisapermanentdrain.Paralysislastsfor2d6
minutes.
SecondaryDamage:Theamountofdamagethecharactertakes1minuteafterexposureasaresultofthepoisoning,ifhe
Page171of462
failsasecondsavingthrow.Unconsciousnesslastsfor1d3hours.Abilitydamagemarkedwithanasteriskispermanent
draininsteadoftemporarydamage.
Price:Thecostofonedose(onevial)ofthepoison.Itisnotpossibletouseorapplypoisoninanyquantitysmallerthan
onedose.Thepurchaseandpossessionofpoisonisalwaysillegal,andeveninbigcitiesitcanbeobtainedonlyfrom
specialized,lessthanreputablesources.

PerilsofUsingPoison
Acharacterhasa5%chanceofexposinghimselftoapoisonwheneverheappliesittoaweaponorotherwisereadiesitfor
use.Additionally,acharacterwhorollsanatural1onanattackrollwithapoisonedweaponmustmakeaDC15Reflex
saveoraccidentallypoisonhimselfwiththeweapon.

PoisonImmunities
Creatureswithnaturalpoisonattacksareimmunetotheirownpoison.Nonlivingcreatures(constructsandundead)and
creatureswithoutmetabolisms(suchaselementals)arealwaysimmunetopoison.Oozes,plants,andcertainkindsof
outsidersarealsoimmunetopoison,althoughconceivablyspecialpoisonscouldbeconcoctedspecificallytoharmthem.
Table:Poisons
POISON TYPE INITIALDAMAGE SECONDARYDAMAGE PRICE
Nitharit ContactDC13 0 3d6Con 650gp
Sassoneleafresidue ContactDC16 2d12hp 1d6Con 300gp
Malyssrootpaste ContactDC16 1Dex 2d4Dex 500gp
Terinavroot ContactDC16 1d6Dex 2d6Dex 750gp
Blacklotusextract ContactDC20 3d6Con 3d6Con 4,500gp
Dragonbile ContactDC26 3d6Str 0 1,500gp
Stripedtoadstool IngestedDC11 1Wis 2d6Wis+1d4Int 180gp
Arsenic IngestedDC13 1Con 1d8Con 120gp
Idmoss IngestedDC14 1d4Int 2d6Int 125gp
Oiloftaggit IngestedDC15 0 Unconsciousness 90gp
Lichdust IngestedDC17 2d6Str 1d6Str 250gp
Darkreaverpowder IngestedDC18 2d6Con 1d6Con+1d6Str 300gp
Ungoldust InhaledDC15 1Cha 1d6Cha+1Cha* 1,000gp
Insanitymist InhaledDC15 1d4Wis 2d6Wis 1,500gp
Burntothurfumes InhaledDC18 1Con* 3d6Con 2,100gp
Blackaddervenom InjuryDC11 1d6Con 1d6Con 120gp
Smallcentipedepoison InjuryDC11 1d2Dex 1d2Dex 90gp
Bloodroot InjuryDC12 0 1d4Con+1d3Wis 100gp
Drowpoison InjuryDC13 Unconsciousness Unconsciousnessfor2d4hours 75gp
Greenbloodoil InjuryDC13 1Con 1d2Con 100gp
Bluewhinnis InjuryDC14 1Con Unconsciousness 120gp
Mediumspidervenom InjuryDC14 1d4Str 1d4Str 150gp
Shadowessence InjuryDC17 1Str* 2d6Str 250gp
Wyvernpoison InjuryDC17 2d6Con 2d6Con 3,000gp
Largescorpionvenom InjuryDC18 1d6Str 1d6Str 200gp
Giantwasppoison InjuryDC18 1d6Dex 1d6Dex 210gp
Deathblade InjuryDC20 1d6Con 2d6Con 1,800gp
Purplewormpoison InjuryDC24 1d6Str 2d6Str 700gp
*Permanentdrain,nottemporarydamage.

Polymorph
Magiccancausecreaturesandcharacterstochangetheirshapessometimesagainsttheirwill,butusuallytogainan
advantage.Polymorphedcreaturesretaintheirownmindsbuthavenewphysicalforms.
Thepolymorphspelldefinesthegeneralpolymorpheffect.
Sincecreaturesdonotchangetypes,aslayingorbaneweapondesignedtokillorharmcreaturesofaspecifictypeaffects
thosecreatureseveniftheyarepolymorphed.Likewise,acreaturepolymorphedintotheformofacreatureofadifferent
typeisnotsubjecttoslayingandbaneeffectsdirectedatthattypeofcreature.
Arangersfavoredenemybonusisbasedonknowingwhatthefoeis,soifacreaturethatisarangersfavoredenemy
polymorphsintoanotherform,therangerisdeniedhisbonus.
Adwarfsbonusforfightinggiantsisbasedonshapeandsize,sohedoesnotgainabonusagainstagiantpolymorphed
intosomethingelse,butdoesgainthebonusagainstanycreaturepolymorphedintoagiant.

Page172of462
Psionics
Telepathy,mentalcombatandpsychicpowerspsionicsisacatchallwordthatdescribesspecialmentalabilitiespossessed
byvariouscreatures.Thesearespelllikeabilitiesthatacreaturegeneratesfromthepowerofitsmindalonenoother
outsidemagicalforceorritualisneeded.Eachpsioniccreaturesdescriptioncontainsdetailsonitspsionicabilities.
PsionicattacksalmostalwaysallowWillsavingthrowstoresistthem.However,notallpsionicattacksarementalattacks.
Somepsionicabilitiesallowthepsioniccreaturetoreshapeitsownbody,healitswounds,orteleportgreatdistances.Some
psioniccreaturescanseeintothefuture,thepast,andthepresent(infarofflocales)aswellasreadthemindsofothers.

Rays
Allrayattacksrequiretheattackertomakeasuccessfulrangedtouchattackagainstthetarget.Rayshavevaryingranges,
whicharesimplemaximums.Araysattackrollnevertakesarangepenalty.Evenifarayhits,itusuallyallowsthetargetto
makeasavingthrow(FortitudeorWill).RaysneverallowaReflexsavingthrow,butifacharactersDexteritybonustoAC
ishigh,itmightbehardtohitherwiththerayinthefirstplace.

Regeneration
Creatureswiththisextraordinaryabilityrecoverfromwoundsquicklyandcanevenregroworreattachseveredbodyparts.
Damagedealttothecreatureistreatedasnonlethaldamage,andthecreatureautomaticallycuresitselfofnonlethal
damageatafixedrate.
Certainattackforms,typicallyfireandacid,dealdamagetothecreaturenormally;thatsortofdamagedoesntconvertto
nonlethaldamageandsodoesntgoaway.Thecreaturesdescriptionincludesthedetails.
Creatureswithregenerationcanregrowlostportionsoftheirbodiesandcanreattachseveredlimbsorbodyparts.Severed
partsdieiftheyarenotreattached.
Regenerationdoesnotrestorehitpointslostfromstarvation,thirst,orsuffocation.
Attackformsthatdontdealhitpointdamageignoreregeneration.
Anattackthatcancauseinstantdeathonlythreatensthecreaturewithdeathifitisdeliveredbyweaponsthatdealitlethal
damage.

ResistancetoEnergy
Acreaturewithresistancetoenergyhastheability(usuallyextraordinary)toignoresomedamageofacertaintypeeach
round,butitdoesnothavetotalimmunity.
Eachresistanceabilityisdefinedbywhatenergytypeitresistsandhowmanypointsofdamageareresisted.Itdoesnt
matterwhetherthedamagehasamundaneormagicalsource.
Whenresistancecompletelynegatesthedamagefromanenergyattack,theattackdoesnotdisruptaspell.Thisresistance
doesnotstackwiththeresistancethataspellmightprovide.

Scent
Thisextraordinaryabilityletsacreaturedetectapproachingenemies,sniffouthiddenfoes,andtrackbysenseofsmell.
Acreaturewiththescentabilitycandetectopponentsbysenseofsmell,generallywithin30feet.Iftheopponentis
upwind,therangeis60feet.Ifitisdownwind,therangeis15feet.Strongscents,suchassmokeorrottinggarbage,canbe
detectedattwicetherangesnotedabove.Overpoweringscents,suchasskunkmuskortroglodytestench,canbedetected
atthreetimestheseranges.
Thecreaturedetectsanothercreaturespresencebutnotitsspecificlocation.Notingthedirectionofthescentisamove
action.Ifitmoveswithin5feetofthescentssource,thecreaturecanpinpointthatsource.
AcreaturewiththeTrackfeatandthescentabilitycanfollowtracksbysmell,makingaWisdomchecktofindorfollowa
track.ThetypicalDCforafreshtrailis10.TheDCincreasesordecreasesdependingonhowstrongthequarrysodoris,the
numberofcreatures,andtheageofthetrail.Foreachhourthatthetrailiscold,theDCincreasesby2.Theability
otherwisefollowstherulesfortheTrackfeat.Creaturestrackingbyscentignoretheeffectsofsurfaceconditionsandpoor
visibility.
Creatureswiththescentabilitycanidentifyfamiliarodorsjustashumansdofamiliarsights.
Water,particularlyrunningwater,ruinsatrailforairbreathingcreatures.Waterbreathingcreaturesthathavethescent
ability,however,canuseitinthewatereasily.
False,powerfulodorscaneasilymaskotherscents.Thepresenceofsuchanodorcompletelyspoilstheabilitytoproperly
Page173of462
detectoridentifycreatures,andthebaseSurvivalDCtotrackbecomes20ratherthan10.

SpellResistance
Spellresistanceistheextraordinaryabilitytoavoidbeingaffectedbyspells.(Somespellsalsograntspellresistance.)
Toaffectacreaturethathasspellresistance,aspellcastermustmakeacasterlevelcheck(1d20+casterlevel)atleast
equaltothecreaturesspellresistance.(ThedefendersspellresistanceislikeanArmorClassagainstmagicalattacks.)Ifthe
casterfailsthecheck,thespelldoesntaffectthecreature.Thepossessordoesnothavetodoanythingspecialtousespell
resistance.Thecreatureneednotevenbeawareofthethreatforitsspellresistancetooperate.
Onlyspellsandspelllikeabilitiesaresubjecttospellresistance.Extraordinaryandsupernaturalabilities(including
enhancementbonusesonmagicweapons)arenot.Acreaturecanhavesomeabilitiesthataresubjecttospellresistanceand
somethatarenot.Evensomespellsignorespellresistance;seeWhenSpellResistanceApplies,below.
Acreaturecanvoluntarilyloweritsspellresistance.Doingsoisastandardactionthatdoesnotprovokeanattackof
opportunity.Onceacreaturelowersitsresistance,itremainsdownuntilthecreaturesnextturn.Atthebeginningofthe
creaturesnextturn,thecreaturesspellresistanceautomaticallyreturnsunlessthecreatureintentionallykeepsitdown
(alsoastandardactionthatdoesnotprovokeanattackofopportunity).
Acreaturesspellresistanceneverinterfereswithitsownspells,items,orabilities.
Acreaturewithspellresistancecannotimpartthispowertoothersbytouchingthemorstandingintheirmidst.Onlythe
rarestofcreaturesandafewmagicitemshavetheabilitytobestowspellresistanceuponanother.
Spellresistancedoesnotstack.Itoverlaps.

WhenSpellResistanceApplies
Eachspellincludesanentrythatindicateswhetherspellresistanceappliestothespell.Ingeneral,whetherspellresistance
appliesdependsonwhatthespelldoes:
TargetedSpells:Spellresistanceappliesifthespellistargetedatthecreature.Someindividuallytargetedspellscanbe
directedatseveralcreaturessimultaneously.Insuchcases,acreaturesspellresistanceappliesonlytotheportionofthe
spellactuallytargetedatthatcreature.Ifseveraldifferentresistantcreaturesaresubjectedtosuchaspell,eachchecksits
spellresistanceseparately.
AreaSpells:Spellresistanceappliesiftheresistantcreatureiswithinthespellsarea.Itprotectstheresistantcreature
withoutaffectingthespellitself.
EffectSpells:Mosteffectspellssummonorcreatesomethingandarenotsubjecttospellresistance.Sometimes,however,
spellresistanceappliestoeffectspells,usuallytothosethatactuponacreaturemoreorlessdirectly,suchasweb.
Spellresistancecanprotectacreaturefromaspellthatsalreadybeencast.Checkspellresistancewhenthecreatureisfirst
affectedbythespell.
Checkspellresistanceonlyonceforanyparticularcastingofaspelloruseofaspelllikeability.Ifspellresistancefailsthe
firsttime,itfailseachtimethecreatureencountersthatsamecastingofthespell.Likewise,ifthespellresistancesucceeds
thefirsttime,italwayssucceeds.Ifthecreaturehasvoluntarilylowereditsspellresistanceandisthensubjectedtoaspell,
thecreaturestillhasasinglechancetoresistthatspelllater,whenitsspellresistanceisup.
Spellresistancehasnoeffectunlesstheenergycreatedorreleasedbythespellactuallygoestoworkontheresistant
creaturesmindorbody.Ifthespellactsonanythingelseandthecreatureisaffectedasaconsequence,norollisrequired.
Creaturescanbeharmedbyaspellwithoutbeingdirectlyaffected.
Spellresistancedoesnotapplyifaneffectfoolsthecreaturessensesorrevealssomethingaboutthecreature.
Magicactuallyhastobeworkingforspellresistancetoapply.Spellsthathaveinstantaneousdurationsbutlastingresults
arentsubjecttospellresistanceunlesstheresistantcreatureisexposedtothespelltheinstantitiscast.
Whenindoubtaboutwhetheraspellseffectisdirectorindirect,considerthespellsschool:
Abjuration:Thetargetcreaturemustbeharmed,changed,orrestrictedinsomemannerforspellresistancetoapply.
Perceptionchangesarentsubjecttospellresistance.
Abjurationsthatblockornegateattacksarenotsubjecttoanattackersspellresistanceitistheprotectedcreaturethatis
affectedbythespell(becomingimmuneorresistanttotheattack).
Conjuration:Thesespellsareusuallynotsubjecttospellresistanceunlessthespellconjuressomeformofenergy.Spells

Page174of462
thatsummoncreaturesorproduceeffectsthatfunctionlikecreaturesarenotsubjecttospellresistance.
Divination:Thesespellsdonotaffectcreaturesdirectlyandarenotsubjecttospellresistance,eventhoughwhattheyreveal
aboutacreaturemightbeverydamaging.
Enchantment:Sinceenchantmentspellsaffectcreaturesminds,theyaretypicallysubjecttospellresistance.
Evocation:Ifanevocationspelldealsdamagetothecreature,ithasadirecteffect.Ifthespelldamagessomethingelse,it
hasanindirecteffect.
Illusion:Thesespellsarealmostneversubjecttospellresistance.Illusionsthatentailadirectattackareexceptions.
Necromancy:Mostofthesespellsalterthetargetcreatureslifeforceandaresubjecttospellresistance.Unusual
necromancyspellsthatdontaffectothercreaturesdirectlyarenotsubjecttospellresistance.
Transmutation:Thesespellsaresubjecttospellresistanceiftheytransformthetargetcreature.Transmutationspellsare
notsubjecttospellresistanceiftheyaretargetedonapointinspaceinsteadofonacreature.Sometransmutationsmake
objectsharmful(ormoreharmful),suchasmagicstone.Eventhesespellsarenotgenerallysubjecttospellresistance
becausetheyaffecttheobjects,notthecreaturesagainstwhichtheobjectsareused.Spellresistanceworksagainstmagic
stoneonlyifthecreaturewithspellresistanceisholdingthestoneswhentheclericcastsmagicstoneonthem.

SuccessfulSpellResistance
Spellresistancepreventsaspelloraspelllikeabilityfromaffectingorharmingtheresistantcreature,butitneverremoves
amagicaleffectfromanothercreatureornegatesaspellseffectonanothercreature.Spellresistancepreventsaspellfrom
disruptinganotherspell.
Againstanongoingspellthathasalreadybeencast,afailedcheckagainstspellresistanceallowstheresistantcreatureto
ignoreanyeffectthespellmighthave.Themagiccontinuestoaffectothersnormally.

Tremorsense
Acreaturewithtremorsenseautomaticallysensesthelocationofanythingthatisincontactwiththegroundandwithin
range.
Ifnostraightpathexiststhroughthegroundfromthecreaturetothosethatitssensing,thentherangedefinesthe
maximumdistanceoftheshortestindirectpath.Itmustitselfbeincontactwiththeground,andthecreaturesmustbe
moving.
Aslongastheothercreaturesaretakingphysicalactions,includingcastingspellswithsomaticcomponents,theyre
consideredmoving;theydonthavetomovefromplacetoplaceforacreaturewithtremorsensetodetectthem.

TurnResistance
Somecreatures(usuallyundead)arelesseasilyaffectedbytheturningabilityofclericsorpaladins.
Turnresistanceisanextraordinaryability.
Whenresolvingaturn,rebuke,command,orbolsterattempt,addedtheappropriatebonustothecreaturesHitDicetotal.

Conditions
Ifmorethanoneconditionaffectsacharacter,applythemall.Ifcertaineffectscantcombine,applythemostsevereeffect.

AbilityDamaged
Thecharacterhastemporarilylost1ormoreabilityscorepoints.Lostpointsreturnatarateof1perdayunlessnoted
otherwisebytheconditiondealingthedamage.AcharacterwithStrength0fallstothegroundandishelpless.Acharacter
withDexterity0isparalyzed.AcharacterwithConstitution0isdead.AcharacterwithIntelligence,Wisdom,orCharisma0
isunconscious.Abilitydamageisdifferentfrompenaltiestoabilityscores,whichgoawaywhentheconditionscausing
themgoaway.

AbilityDrained
Thecharacterhaspermanentlylost1ormoreabilityscorepoints.Thecharactercanregainthesepointsonlythrough
magicalmeans.AcharacterwithStrength0fallstothegroundandishelpless.AcharacterwithDexterity0isparalyzed.A
characterwithConstitution0isdead.AcharacterwithIntelligence,Wisdom,orCharisma0isunconscious.

Blinded
Thecharactercannotsee.Hetakesa2penaltytoArmorClass,loseshisDexteritybonustoAC(ifany),movesathalf

Page175of462
speed,andtakesa4penaltyonSearchchecksandonmostStrengthandDexteritybasedskillchecks.Allchecksand
activitiesthatrelyonvision(suchasreadingandSpotchecks)automaticallyfail.Allopponentsareconsideredtohavetotal
concealment(50%misschance)totheblindedcharacter.Characterswhoremainblindedforalongtimegrowaccustomed
tothesedrawbacksandcanovercomesomeofthem.

BlownAway
Dependingonitssize,acreaturecanbeblownawaybywindsofhighvelocity.Acreatureonthegroundthatisblownaway
isknockeddownandrolls1d4x10feet,taking1d4pointsofnonlethaldamageper10feet.Aflyingcreaturethatisblown
awayisblownback2d6x10feetandtakes2d6pointsofnonlethaldamageduetobatteringandbuffering.

Checked
Preventedfromachievingforwardmotionbyanappliedforce,suchaswind.Checkedcreaturesonthegroundmerelystop.
Checkedflyingcreaturesmovebackadistancespecifiedinthedescriptionoftheeffect.

Confused
Aconfusedcharactersactionsaredeterminedbyrollingd%atthebeginningofhisturn:0110,attackcasterwithmeleeor
rangedweapons(orclosewithcasterifattackingisnotpossible);1120,actnormally;2150,donothingbutbabble
incoherently;5170,fleeawayfromcasterattoppossiblespeed;71100,attacknearestcreature(forthispurpose,a
familiarcountsaspartofthesubjectsself).Aconfusedcharacterwhocantcarryouttheindicatedactiondoesnothingbut
babbleincoherently.Attackersarenotatanyspecialadvantagewhenattackingaconfusedcharacter.Anyconfused
characterwhoisattackedautomaticallyattacksitsattackersonitsnextturn,aslongasitisstillconfusedwhenitsturn
comes.Aconfusedcharacterdoesnotmakeattacksofopportunityagainstanycreaturethatitisnotalreadydevotedto
attacking(eitherbecauseofitsmostrecentactionorbecauseithasjustbeenattacked).

Cowering
Thecharacterisfrozeninfearandcantakenoactions.Acoweringcharactertakesa2penaltytoArmorClassandloses
herDexteritybonus(ifany).

Dazed
Thecreatureisunabletoactnormally.Adazedcreaturecantakenoactions,buthasnopenaltytoAC.
Adazedconditiontypicallylasts1round.

Dazzled
Thecreatureisunabletoseewellbecauseofoverstimulationoftheeyes.Adazzledcreaturetakesa1penaltyonattack
rolls,Searchchecks,andSpotchecks.

Dead
Thecharactershitpointsarereducedto10,hisConstitutiondropsto0,orheiskilledoutrightbyaspelloreffect.The
characterssoulleaveshisbody.Deadcharacterscannotbenefitfromnormalormagicalhealing,buttheycanberestoredto
lifeviamagic.Adeadbodydecaysnormallyunlessmagicallypreserved,butmagicthatrestoresadeadcharactertolifealso
restoresthebodyeithertofullhealthortoitsconditionatthetimeofdeath(dependingonthespellordevice).Eitherway,
resurrectedcharactersneednotworryaboutrigormortis,decomposition,andotherconditionsthataffectdeadbodies.

Deafened
Adeafenedcharactercannothear.Shetakesa4penaltyoninitiativechecks,automaticallyfailsListenchecks,andhasa
20%chanceofspellfailurewhencastingspellswithverbalcomponents.Characterswhoremaindeafenedforalongtime
growaccustomedtothesedrawbacksandcanovercomesomeofthem.

Disabled
Acharacterwith0hitpoints,oronewhohasnegativehitpointsbuthasbecomestableandconscious,isdisabled.A
disabledcharactermaytakeasinglemoveactionorstandardactioneachround(butnotboth,norcanshetakefullround
actions).Shemovesathalfspeed.Takingmoveactionsdoesntriskfurtherinjury,butperforminganystandardaction(or
anyotheractiontheDMdeemsstrenuous,includingsomefreeactionssuchascastingaquickenedspell)deals1pointof
damageafterthecompletionoftheact.Unlesstheactionincreasedthedisabledcharactershitpoints,sheisnowin
negativehitpointsanddying.
Adisabledcharacterwithnegativehitpointsrecovershitpointsnaturallyifsheisbeinghelped.Otherwise,eachdayshe
hasa10%chancetostartrecoveringhitpointsnaturally(startingwiththatday);otherwise,sheloses1hitpoint.Oncean
unaidedcharacterstartsrecoveringhitpointsnaturally,sheisnolongerindangeroflosinghitpoints(evenifhercurrent
hitpointsarenegative).
Page176of462
Dying
Adyingcharacterisunconsciousandneardeath.Shehas1to9currenthitpoints.Adyingcharactercantakenoactions
andisunconscious.Attheendofeachround(startingwiththeroundinwhichthecharacterdroppedbelow0hitpoints),
thecharacterrollsd%toseewhethershebecomesstable.Shehasa10%chancetobecomestable.Ifshedoesnot,sheloses
1hitpoint.Ifadyingcharacterreaches10hitpoints,sheisdead.

EnergyDrained
Thecharactergainsoneormorenegativelevels,whichmightpermanentlydrainthecharacterslevels.Ifthesubjecthasat
leastasmanynegativelevelsasHitDice,hedies.Eachnegativelevelgivesacreaturethefollowingpenalties:1penaltyon
attackrolls,savingthrows,skillchecks,abilitychecks;lossof5hitpoints;and1toeffectivelevel(fordeterminingthe
power,duration,DC,andotherdetailsofspellsorspecialabilities).Inaddition,aspellcasterlosesonespellorspellslot
fromthehighestspelllevelcastable.

Entangled
Thecharacterisensnared.Beingentangledimpedesmovement,butdoesnotentirelypreventitunlessthebondsare
anchoredtoanimmobileobjectortetheredbyanopposingforce.Anentangledcreaturemovesathalfspeed,cannotrunor
charge,andtakesa2penaltyonallattackrollsanda4penaltytoDexterity.Anentangledcharacterwhoattemptstocast
aspellmustmakeaConcentrationcheck(DC15+thespellslevel)orlosethespell.

Exhausted
Anexhaustedcharactermovesathalfspeedandtakesa6penaltytoStrengthandDexterity.After1hourofcompleterest,
anexhaustedcharacterbecomesfatigued.Afatiguedcharacterbecomesexhaustedbydoingsomethingelsethatwould
normallycausefatigue.

Fascinated
Afascinatedcreatureisentrancedbyasupernaturalorspelleffect.Thecreaturestandsorsitsquietly,takingnoactions
otherthantopayattentiontothefascinatingeffect,foraslongastheeffectlasts.Ittakesa4penaltyonskillchecksmade
asreactions,suchasListenandSpotchecks.Anypotentialthreat,suchasahostilecreatureapproaching,allowsthe
fascinatedcreatureanewsavingthrowagainstthefascinatingeffect.Anyobviousthreat,suchassomeonedrawinga
weapon,castingaspell,oraimingarangedweaponatthefascinatedcreature,automaticallybreakstheeffect.Afascinated
creaturesallymayshakeitfreeofthespellasastandardaction.

Fatigued
Afatiguedcharactercanneitherrunnorchargeandtakesa2penaltytoStrengthandDexterity.Doinganythingthat
wouldnormallycausefatiguecausesthefatiguedcharactertobecomeexhausted.After8hoursofcompleterest,fatigued
charactersarenolongerfatigued.

FlatFooted
Acharacterwhohasnotyetactedduringacombatisflatfooted,notyetreactingnormallytothesituation.Aflatfooted
characterloseshisDexteritybonustoAC(ifany)andcannotmakeattacksofopportunity.

Frightened
Afrightenedcreaturefleesfromthesourceofitsfearasbestitcan.Ifunabletoflee,itmayfight.Afrightenedcreature
takesa2penaltyonallattackrolls,savingthrows,skillchecks,andabilitychecks.Afrightenedcreaturecanusespecial
abilities,includingspells,toflee;indeed,thecreaturemustusesuchmeansiftheyaretheonlywaytoescape.
Frightenedislikeshaken,exceptthatthecreaturemustfleeifpossible.Panickedisamoreextremestateoffear.

Grappling
Engagedinwrestlingorsomeotherformofhandtohandstrugglewithoneormoreattackers.Agrapplingcharactercan
undertakeonlyalimitednumberofactions.Hedoesnotthreatenanysquares,andloseshisDexteritybonustoAC(ifany)
againstopponentsheisntgrappling.

Helpless
Ahelplesscharacterisparalyzed,held,bound,sleeping,unconscious,orotherwisecompletelyatanopponentsmercy.A
helplesstargetistreatedashavingaDexterityof0(5modifier).Meleeattacksagainstahelplesstargetgeta+4bonus
(equivalenttoattackingapronetarget).Rangedattacksgetsnospecialbonusagainsthelplesstargets.Roguescansneak
attackhelplesstargets.
Asafullroundaction,anenemycanuseameleeweapontodeliveracoupdegracetoahelplessfoe.Anenemycanalso
useaboworcrossbow,providedheisadjacenttothetarget.Theattackerautomaticallyhitsandscoresacriticalhit.(A
Page177of462
roguealsogetshersneakattackdamagebonusagainstahelplessfoewhendeliveringacoupdegrace.)Ifthedefender
survives,hemustmakeaFortitudesave(DC10+damagedealt)ordie.
Deliveringacoupdegraceprovokesattacksofopportunity.
Creaturesthatareimmunetocriticalhitsdonottakecriticaldamage,nordotheyneedtomakeFortitudesavestoavoid
beingkilledbyacoupdegrace.

Incorporeal
Havingnophysicalbody.Incorporealcreaturesareimmunetoallnonmagicalattackforms.Theycanbeharmedonlyby
otherincorporealcreatures,+1orbettermagicweapons,spells,spelllikeeffects,orsupernaturaleffects.

Invisible
Visuallyundetectable.Aninvisiblecreaturegainsa+2bonusonattackrollsagainstsightedopponents,andignoresits
opponentsDexteritybonusestoAC(ifany).(SeeInvisibility,underSpecialAbilities.)

KnockedDown
Dependingontheirsize,creaturescanbeknockeddownbywindsofhighvelocity.Creaturesonthegroundareknocked
pronebytheforceofthewind.Flyingcreaturesareinsteadblownback1d6x10feet.

Nauseated
Experiencingstomachdistress.Nauseatedcreaturesareunabletoattack,castspells,concentrateonspells,ordoanything
elserequiringattention.Theonlyactionsuchacharactercantakeisasinglemoveactionperturn.

Panicked
Apanickedcreaturemustdropanythingitholdsandfleeattopspeedfromthesourceofitsfear,aswellasanyother
dangersitencounters,alongarandompath.Itcanttakeanyotheractions.Inaddition,thecreaturetakesa2penaltyon
allsavingthrows,skillchecks,andabilitychecks.Ifcornered,apanickedcreaturecowersanddoesnotattack,typically
usingthetotaldefenseactionincombat.Apanickedcreaturecanusespecialabilities,includingspells,toflee;indeed,the
creaturemustusesuchmeansiftheyaretheonlywaytoescape.
Panickedisamoreextremestateoffearthanshakenorfrightened.

Paralyzed
Aparalyzedcharacterisfrozeninplaceandunabletomoveoract.AparalyzedcharacterhaseffectiveDexterityand
Strengthscoresof0andishelpless,butcantakepurelymentalactions.Awingedcreatureflyingintheairatthetimethat
itbecomesparalyzedcannotflapitswingsandfalls.Aparalyzedswimmercantswimandmaydrown.Acreaturecanmove
throughaspaceoccupiedbyaparalyzedcreatureallyornot.Eachsquareoccupiedbyaparalyzedcreature,however,
countsas2squares.

Petrified
Apetrifiedcharacterhasbeenturnedtostoneandisconsideredunconscious.Ifapetrifiedcharactercracksorbreaks,but
thebrokenpiecesarejoinedwiththebodyashereturnstoflesh,heisunharmed.Ifthecharacterspetrifiedbodyis
incompletewhenitreturnstoflesh,thebodyislikewiseincompleteandthereissomeamountofpermanenthitpointloss
and/ordebilitation.

Pinned
Heldimmobile(butnothelpless)inagrapple.

Prone
Thecharacterisontheground.Anattackerwhoispronehasa4penaltyonmeleeattackrollsandcannotusearanged
weapon(exceptforacrossbow).Adefenderwhoispronegainsa+4bonustoArmorClassagainstrangedattacks,but
takesa4penaltytoACagainstmeleeattacks.
Standingupisamoveequivalentactionthatprovokesanattackofopportunity.

Shaken
Ashakencharactertakesa2penaltyonattackrolls,savingthrows,skillchecks,andabilitychecks.
Shakenisalessseverestateoffearthanfrightenedorpanicked.

Sickened
Thecharactertakesa2penaltyonallattackrolls,weapondamagerolls,savingthrows,skillchecks,andabilitychecks.
Page178of462
Stable
Acharacterwhowasdyingbutwhohasstoppedlosinghitpointsandstillhasnegativehitpointsisstable.Thecharacteris
nolongerdying,butisstillunconscious.Ifthecharacterhasbecomestablebecauseofaidfromanothercharacter(suchas
aHealcheckormagicalhealing),thenthecharacternolongerloseshitpoints.Hehasa10%chanceeachhourof
becomingconsciousanddisabled(eventhoughhishitpointsarestillnegative).
Ifthecharacterbecamestableonhisownandhasnthadhelp,heisstillatriskoflosinghitpoints.Eachhour,hehasa10%
chanceofbecomingconsciousanddisabled.Otherwiseheloses1hitpoint.

Staggered
Acharacterwhosenonlethaldamageexactlyequalshiscurrenthitpointsisstaggered.Astaggeredcharactermaytakea
singlemoveactionorstandardactioneachround(butnotboth,norcanshetakefullroundactions).
Acharacterwhosecurrenthitpointsexceedhisnonlethaldamageisnolongerstaggered;acharacterwhosenonlethal
damageexceedshishitpointsbecomesunconscious.

Stunned
Astunnedcreaturedropseverythingheld,canttakeactions,takesa2penaltytoAC,andloseshisDexteritybonustoAC
(ifany).

Turned
Affectedbyaturnundeadattempt.Turnedundeadfleefor10rounds(1minute)bythebestandfastestmeansavailableto
them.Iftheycannotflee,theycower.

Unconscious
Knockedoutandhelpless.Unconsciousnesscanresultfromhavingcurrenthitpointsbetween1and9,orfromnonlethal
damageinexcessofcurrenthitpoints.

Spell Casting
SpellList
AnMorFappearingattheendofaspellsnameinthespelllistsdenotesaspellwithamaterialorfocuscomponent,
respectively,thatisnotnormallyincludedinaspellcomponentpouch.AnXdenotesaspellwithanXPcomponentpaidby
thecaster.

TermsUsed
OrderofPresentation
Inthespelllistsandthespelldescriptionsthatfollowthem,thespellsarepresentedinalphabeticalorderbynameexcept
forthosebelongingtocertainspellchains.
Whenaspellsnamebeginswithlesser,greater,ormass,thespelldescriptionisalphabetizedunderthesecondword
ofthespellnameinstead.

HitDice
ThetermHitDiceisusedsynonymouslywithcharacterlevelsforeffectsthataffectanumberofHitDiceofcreatures.
CreatureswithHitDiceonlyfromtheirrace,notfromclasses,havecharacterlevelsequaltotheirHitDice.

CasterLevel
Aspellspoweroftendependsoncasterlevel,whichisdefinedasthecastersclasslevelforthepurposeofcastinga
particularspell.AcreaturewithnoclasseshasacasterlevelequaltoitsHitDiceunlessotherwisespecified.Theword
levelinthespellliststhatfollowalwaysreferstocasterlevel.

CreaturesandCharacters
Thewordscreatureandcharacterareusedsynonymouslyinthespelldescriptions.

BardSpells
0LevelBardSpells(Cantrips)
DancingLights:Createstorchesorotherlights.

Daze:Humanoidcreatureof4HDorlesslosesnextaction.
Page179of462
DetectMagic:Detectsspellsandmagicitemswithin60ft.
Flare:Dazzlesonecreature(1onattackrolls).
GhostSound:Figmentsounds.
KnowDirection:Youdiscernnorth.
Light:Objectshineslikeatorch.
Lullaby:Makessubjectdrowsy;5onSpotandListenchecks,2onWillsavesagainstsleep.
MageHand:5poundtelekinesis.
Mending:Makesminorrepairsonanobject.
Message:Whisperedconversationatdistance.
Open/Close:Opensorclosessmallorlightthings.
Prestidigitation:Performsminortricks.
ReadMagic:Readscrollsandspellbooks.
Resistance:Subjectgains+1onsavingthrows.
SummonInstrument:Summonsoneinstrumentofthecasterschoice.

1stLevelBardSpells
Alarm:Wardsanareafor2hours/level.

AnimateRope:Makesaropemoveatyourcommand.
CauseFear:Onecreatureof5HDorlessfleesfor1d4rounds.
CharmPerson:Makesonepersonyourfriend.
ComprehendLanguages:Youunderstandallspokenandwrittenlanguages.
CureLightWounds:Cures1d8damage+1/level(max+5).
DetectSecretDoors:Revealshiddendoorswithin60ft.
DisguiseSelf:Changesyourappearance.
Erase:Mundaneormagicalwritingvanishes.
ExpeditiousRetreat:Yourspeedincreasesby30ft.
FeatherFall:Objectsorcreaturesfallslowly.
Grease:Makes10ft.squareoroneobjectslippery.
HideousLaughter:Subjectlosesactionsfor1round/level.
Hypnotism:Fascinates2d4HDofcreatures.
IdentifyM:Determinespropertiesofmagicitem.
LesserConfusion:Onecreatureisconfusedfor1round.
MagicMouthM:Speaksoncewhentriggered.
MagicAura:Altersobjectsmagicaura.
ObscureObject:Masksobjectagainstscrying.
RemoveFear:Suppressesfearorgives+4onsavesagainstfearforonesubject+oneperfourlevels.
SilentImage:Createsminorillusionofyourdesign.
Sleep:Puts4HDofcreaturesintomagicalslumber.
SummonMonsterI:Callsextraplanarcreaturetofightforyou.
UndetectableAlignment:Concealsalignmentfor24hours.

Page180of462
UnseenServant:Invisibleforceobeysyourcommands.
Ventriloquism:Throwsvoicefor1min./level.

2ndLevelBardSpells
AlterSelf:Assumeformofasimilarcreature.

AnimalMessenger:SendsaTinyanimaltoaspecificplace.
AnimalTrance:Fascinates2d6HDofanimals.
Blindness/Deafness:Makessubjectblindordeaf.
Blur:Attacksmisssubject20%ofthetime.
CalmEmotions:Calmscreatures,negatingemotioneffects.
CatsGrace:Subjectgains+4toDexfor1min./level.
CureModerateWounds:Cures2d8damage+1/level(max+10).
Darkness:20ft.radiusofsupernaturalshadow.
DazeMonster:Livingcreatureof6HDorlesslosesnextaction.
DelayPoison:Stopspoisonfromharmingsubjectfor1hour/level.
DetectThoughts:Allowslisteningtosurfacethoughts.
EaglesSplendor:Subjectgains+4toChafor1min./level.
Enthrall:Captivatesallwithin100ft.+10ft./level.
FoxsCunning:Subjectgains+4toIntfor1min./level.
Glitterdust:Blindscreatures,outlinesinvisiblecreatures.
Heroism:Gives+2onattackrolls,saves,skillchecks.
HoldPerson:Paralyzesonehumanoidfor1round/level.
HypnoticPattern:Fascinates(2d4+level)HDofcreatures.
Invisibility:Subjectisinvisiblefor1min./leveloruntilitattacks.
LocateObject:Sensesdirectiontowardobject(specificortype).
MinorImage:Assilentimage,plussomesound.
MirrorImage:Createsdecoyduplicatesofyou(1d4+1perthreelevels,max8).
Misdirection:Misleadsdivinationsforonecreatureorobject.
Pyrotechnics:Turnsfireintoblindinglightorchokingsmoke.
Rage:Gives+2toStrandCon,+1onWillsaves,2toAC.
Scare:Panicscreaturesoflessthan6HD.
Shatter:Sonicvibrationdamagesobjectsorcrystallinecreatures.
Silence:Negatessoundin15ft.radius.
SoundBurst:Deals1d8sonicdamagetosubjects;maystunthem.
Suggestion:Compelssubjecttofollowstatedcourseofaction.
SummonMonsterII:Callsextraplanarcreaturetofightforyou.
SummonSwarm:Summonsswarmofbats,rats,orspiders.
Tongues:Speakanylanguage.
WhisperingWind:Sendsashortmessage1mile/level.

Page181of462
3rdLevelBardSpells
Blink:Yourandomlyvanishandreappearfor1round/level.

CharmMonster:Makesmonsterbelieveitisyourally.
Clairaudience/Clairvoyance:Hearorseeatadistancefor1min./level.
Confusion:Subjectsbehaveoddlyfor1round/level.
CrushingDespair:Subjectstake2onattackrolls,damagerolls,saves,andchecks.
CureSeriousWounds:Cures3d8damage+1/level(max+15).
Daylight:60ft.radiusofbrightlight.
DeepSlumber:Puts10HDofcreaturestosleep.
DispelMagic:Cancelsmagicalspellsandeffects.
Displacement:Attacksmisssubject50%.
Fear:Subjectswithinconefleefor1round/level.
GaseousForm:Subjectbecomesinsubstantialandcanflyslowly.
Geas,Lesser:Commandssubjectof7HDorless.
Glibness:Yougain+30bonusonBluffchecks,andyourliescanescapemagicaldiscernment.
GoodHope:Subjectsgain+2onattackrolls,damagerolls,saves,andchecks.
Haste:Onecreature/levelmovesfaster,+1onattackrolls,AC,andReflexsaves.
IllusoryScriptM:Onlyintendedreadercandecipher.
InvisibilitySphere:Makeseveryonewithin10ft.invisible.
MajorImage:Assilentimage,plussound,smellandthermaleffects.
PhantomSteed:Magichorseappearsfor1hour/level.
RemoveCurse:Freesobjectorpersonfromcurse.
ScryingF:Spiesonsubjectfromadistance.
SculptSound:Createsnewsoundsorchangesexistingones.
SecretPage:Changesonepagetohideitsrealcontent.
SeeInvisibility:Revealsinvisiblecreaturesorobjects.
SepiaSnakeSigilM:Createstextsymbolthatimmobilizesreader.
Slow:Onesubject/leveltakesonlyoneaction/round,2toACandattackrolls.
SpeakwithAnimals:Youcancommunicatewithanimals.
SummonMonsterIII:Callsextraplanarcreaturetofightforyou.
TinyHut:Createsshelterfortencreatures.

4thLevelBardSpells
BreakEnchantment:Freessubjectsfromenchantments,alterations,curses,andpetrification.

CureCriticalWounds:Cures4d8damage+1/level(max+20).
DetectScrying:Alertsyouofmagicaleavesdropping.
DimensionDoor:Teleportsyoushortdistance.
DominatePerson:Controlshumanoidtelepathically.
FreedomofMovement:Subjectmovesnormallydespiteimpediments.
HallucinatoryTerrain:Makesonetypeofterrainappearlikeanother(fieldintoforest,orthelike).

Page182of462
HoldMonster:Asholdperson,butanycreature.
Invisibility,Greater:Asinvisibility,butsubjectcanattackandstayinvisible.
LegendLoreMF:Letsyoulearntalesaboutaperson,place,orthing.
LocateCreature:Indicatesdirectiontofamiliarcreature.
ModifyMemory:Changes5minutesofsubjectsmemories.
NeutralizePoison:Immunizessubjectagainstpoison,detoxifiesvenominoronsubject.
RainbowPattern:Lightsfascinate24HDofcreatures.
RepelVermin:Insects,spiders,andotherverminstay10ft.away.
SecureShelter:Createssturdycottage.
ShadowConjuration:Mimicsconjuringbelow4thlevel,butonly20%real.
Shout:Deafensallwithinconeanddeals5d6sonicdamage.
SpeakwithPlants:Youcantalktonormalplantsandplantcreatures.
SummonMonsterIV:Callsextraplanarcreaturetofightforyou.
ZoneofSilence:Keepseavesdroppersfromoverhearingconversations.

5thLevelBardSpells
CureLightWounds,Mass:Cures1d8damage+1/levelformanycreatures.

DispelMagic,Greater:Asdispelmagic,but+20oncheck.
Dream:Sendsmessagetoanyonesleeping.
FalseVisionM:Foolsscryingwithanillusion.
Heroism,Greater:Gives+4bonusonattackrolls,saves,skillchecks;immunitytofear;temporaryhp.
MindFog:Subjectsinfogget10toWisandWillchecks.
MirageArcana:Ashallucinatoryterrain,plusstructures.
Mislead:Turnsyouinvisibleandcreatesillusorydouble.
Nightmare:Sendsvisiondealing1d10damage,fatigue.
PersistentImage:Asmajorimage,butnoconcentrationrequired.
Seeming:Changesappearanceofonepersonpertwolevels.
ShadowEvocation:Mimicsevocationoflowerthan5thlevel,butonly20%real.
ShadowWalk:Stepintoshadowtotravelrapidly.
SongofDiscord:Forcestargetstoattackeachother.
Suggestion,Mass:Assuggestion,plusonesubject/level.
SummonMonsterV:Callsextraplanarcreaturetofightforyou.

6thLevelBardSpells
AnalyzeDweomerF:Revealsmagicalaspectsofsubject.

AnimateObjects:Objectsattackyourfoes.
CatsGrace,Mass:Ascatsgrace,affectsonesubject/level.
CharmMonster,Mass:Ascharmmonster,butallwithin30ft.
CureModerateWounds,Mass:Cures2d8damage+1/levelformanycreatures.
EaglesSplendor,Mass:Aseaglessplendor,affectsonesubject/level.
Eyebite:Targetbecomespanicked,sickened,andcomatose.

Page183of462
FindthePath:Showsmostdirectwaytoalocation.
FoxsCunning,Mass:Asfoxscunning,affectsonesubject/level.
Geas/Quest:Aslessergeas,plusitaffectsanycreature.
HeroesFeast:Foodforonecreature/levelcuresandgrantscombatbonuses.
IrresistibleDance:Forcessubjecttodance.
PermanentImage:Includessight,sound,andsmell.
ProgrammedImageM:Asmajorimage,plustriggeredbyevent.
ProjectImage:Illusorydoublecantalkandcastspells.
Scrying,Greater:Asscrying,butfasterandlonger.
Shout,Greater:Devastatingyelldeals10d6sonicdamage;stunscreatures,damagesobjects.
SummonMonsterVI:Callsextraplanarcreaturetofightforyou.
SympatheticVibration:Deals2d10damage/roundtofreestandingstructure.
Veil:Changesappearanceofgroupofcreatures.

ClericSpells
0LevelClericSpells(Orisons)
CreateWater:Creates2gallons/levelofpurewater.

CureMinorWounds:Cures1pointofdamage.
DetectMagic:Detectsspellsandmagicitemswithin60ft.
DetectPoison:Detectspoisoninonecreatureorobject.
Guidance:+1ononeattackroll,savingthrow,orskillcheck.
InflictMinorWounds:Touchattack,1pointofdamage.
Light:Objectshineslikeatorch.
Mending:Makesminorrepairsonanobject.
PurifyFoodandDrink:Purifies1cu.ft./leveloffoodorwater.
ReadMagic:Readscrollsandspellbooks.
Resistance:Subjectgains+1onsavingthrows.
Virtue:Subjectgains1temporaryhp.

1stLevelClericSpells
Bane:Enemiestake1onattackrollsandsavesagainstfear.

Bless:Alliesgain+1onattackrollsandsavesagainstfear.
BlessWaterM:Makesholywater.
CauseFear:Onecreatureof5HDorlessfleesfor1d4rounds.
Command:Onesubjectobeysselectedcommandfor1round.
ComprehendLanguages:Youunderstandallspokenandwrittenlanguages.
CureLightWounds:Cures1d8damage+1/level(max+5).
CurseWaterM:Makesunholywater.
Deathwatch:Revealshowneardeathsubjectswithin30ft.are.
DetectChaos/Evil/Good/Law:Revealscreatures,spells,orobjectsofselectedalignment.
DetectUndead:Revealsundeadwithin60ft.

Page184of462
DivineFavor:Yougain+1perthreelevelsonattackanddamagerolls.
Doom:Onesubjecttakes2onattackrolls,damagerolls,saves,andchecks.
EndureElements:Existcomfortablyinhotorcoldenvironments.
EntropicShield:Rangedattacksagainstyouhave20%misschance.
HidefromUndead:Undeadcantperceiveonesubject/level.
InflictLightWounds:Touchdeals1d8damage+1/level(max+5).
MagicStone:Threestonesgain+1onattack,deal1d6+1damage.
MagicWeapon:Weapongains+1bonus.
ObscuringMist:Fogsurroundsyou.
ProtectionfromChaos/Evil/Good/Law:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
RemoveFear:Suppressesfearorgives+4onsavesagainstfearforonesubject+oneperfourlevels.
Sanctuary:Opponentscantattackyou,andyoucantattack.
ShieldofFaith:Auragrants+2orhigherdeflectionbonus.
SummonMonsterI:Callsextraplanarcreaturetofightforyou.

2ndLevelClericSpells
Aid:+1onattackrollsandsavesagainstfear,1d8temporaryhp+1/level(max+10).

AlignWeapon:Weaponbecomesgood,evil,lawful,orchaotic.
AuguryMF:Learnswhetheranactionwillbegoodorbad.
BearsEndurance:Subjectgains+4toConfor1min./level.
BullsStrength:Subjectgains+4toStrfor1min./level.
CalmEmotions:Calmscreatures,negatingemotioneffects.
ConsecrateM:Fillsareawithpositiveenergy,makingundeadweaker.
CureModerateWounds:Cures2d8damage+1/level(max+10).
Darkness:20ft.radiusofsupernaturalshadow.
DeathKnell:Killsdyingcreature;yougain1d8temporaryhp,+2toStr,and+1level.
DelayPoison:Stopspoisonfromharmingsubjectfor1hour/level.
DesecrateM:Fillsareawithnegativeenergy,makingundeadstronger.
EaglesSplendor:Subjectgains+4toChafor1min./level.
Enthrall:Captivatesallwithin100ft.+10ft./level.
FindTraps:Noticetrapsasaroguedoes.
GentleRepose:Preservesonecorpse.
HoldPerson:Paralyzesonehumanoidfor1round/level.
InflictModerateWounds:Touchattack,2d8damage+1/level(max+10).
MakeWhole:Repairsanobject.
OwlsWisdom:Subjectgains+4toWisfor1min./level.
RemoveParalysis:Freesoneormorecreaturesfromparalysisorsloweffect.
ResistEnergy:Ignores10(ormore)pointsofdamage/attackfromspecifiedenergytype.
Restoration,Lesser:Dispelsmagicalabilitypenaltyorrepairs1d4abilitydamage.
Shatter:Sonicvibrationdamagesobjectsorcrystallinecreatures.

Page185of462
ShieldOtherF:Youtakehalfofsubjectsdamage.
Silence:Negatessoundin15ft.radius.
SoundBurst:Deals1d8sonicdamagetosubjects;maystunthem.
SpiritualWeapon:Magicweaponattacksonitsown.
Status:Monitorscondition,positionofallies.
SummonMonsterII:Callsextraplanarcreaturetofightforyou.
UndetectableAlignment:Concealsalignmentfor24hours.
ZoneofTruth:Subjectswithinrangecannotlie.

3rdLevelClericSpells
AnimateDeadM:Createsundeadskeletonsandzombies.

BestowCurse:6toanabilityscore;4onattackrolls,saves,andchecks;or50%chanceoflosingeachaction.
Blindness/Deafness:Makessubjectblindedordeafened.
Contagion:Infectssubjectwithchosendisease.
ContinualFlameM:Makesapermanent,heatlesstorch.
CreateFoodandWater:Feedsthreehumans(oronehorse)/level.
CureSeriousWounds:Cures3d8damage+1/level(max+15).
Daylight:60ft.radiusofbrightlight.
DeeperDarkness:Objectshedssupernaturalshadowin60ft.radius.
DispelMagic:Cancelsspellsandmagicaleffects.
GlyphofWardingM:Inscriptionharmsthosewhopassit.
HelpingHand:Ghostlyhandleadssubjecttoyou.
InflictSeriousWounds:Touchattack,3d8damage+1/level(max+15).
InvisibilityPurge:Dispelsinvisibilitywithin5ft./level.
LocateObject:Sensesdirectiontowardobject(specificortype).
MagicCircleagainstChaos/Evil/Good/Law:Asprotectionspells,but10ft.radiusand10min./level.
MagicVestment:Armororshieldgains+1enhancementperfourlevels.
MeldintoStone:Youandyourgearmergewithstone.
ObscureObject:Masksobjectagainstscrying.
Prayer:Allies+1bonusonmostrolls,enemies1penalty.
ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
RemoveBlindness/Deafness:Curesnormalormagicalconditions.
RemoveCurse:Freesobjectorpersonfromcurse.
RemoveDisease:Curesalldiseasesaffectingsubject.
SearingLight:Raydeals1d8/twolevelsdamage,moreagainstundead.
SpeakwithDead:Corpseanswersonequestion/twolevels.
StoneShape:Sculptsstoneintoanyshape.
SummonMonsterIII:Callsextraplanarcreaturetofightforyou.
WaterBreathing:Subjectscanbreatheunderwater.
WaterWalk:Subjecttreadsonwaterasifsolid.

Page186of462
WindWall:Deflectsarrows,smallercreatures,andgases.

4thLevelClericSpells
AirWalk:Subjecttreadsonairasifsolid(climbat45degreeangle).

ControlWater:Raisesorlowersbodiesofwater.
CureCriticalWounds:Cures4d8damage+1/level(max+20).
DeathWard:Grantsimmunitytodeathspellsandnegativeenergyeffects.
DimensionalAnchor:Barsextradimensionalmovement.
DiscernLies:Revealsdeliberatefalsehoods.
Dismissal:Forcesacreaturetoreturntonativeplane.
DivinationM:Providesusefuladviceforspecificproposedactions.
DivinePower:Yougainattackbonus,+6toStr,and1hp/level.
FreedomofMovement:Subjectmovesnormallydespiteimpediments.
GiantVermin:Turnscentipedes,scorpions,orspidersintogiantvermin.
ImbuewithSpellAbility:Transferspellstosubject.
InflictCriticalWounds:Touchattack,4d8damage+1/level(max+20).
MagicWeapon,Greater:+1bonus/fourlevels(max+5).
NeutralizePoison:Immunizessubjectagainstpoison,detoxifiesvenominoronsubject.
PlanarAlly,LesserX:Exchangeserviceswitha6HDextraplanarcreature.
Poison:Touchdeals1d10Condamage,repeatsin1min.
RepelVermin:Insects,spiders,andotherverminstay10ft.away.
RestorationM:Restoreslevelandabilityscoredrains.
Sending:Deliversshortmessageanywhere,instantly.
SpellImmunity:Subjectisimmunetoonespellperfourlevels.
SummonMonsterIV:Callsextraplanarcreaturetofightforyou.
Tongues:Speakanylanguage.

5thLevelClericSpells
AtonementFX:Removesburdenofmisdeedsfromsubject.

BreakEnchantment:Freessubjectsfromenchantments,alterations,curses,andpetrification.
Command,Greater:Ascommand,butaffectsonesubject/level.
CommuneX:Deityanswersoneyesornoquestion/level.
CureLightWounds,Mass:Cures1d8damage+1/levelformanycreatures.
DispelChaos/Evil/Good/Law:+4bonusagainstattacks.
DisruptingWeapon:Meleeweapondestroysundead.
FlameStrike:Smitefoeswithdivinefire(1d6/leveldamage).
HallowM:Designateslocationasholy.
InflictLightWounds,Mass:Deals1d8damage+1/leveltomanycreatures.
InsectPlague:Locustswarmsattackcreatures.
MarkofJustice:Designatesactionthatwilltriggercurseonsubject.
PlaneShiftF:Asmanyaseightsubjectstraveltoanotherplane.

Page187of462
RaiseDeadM:Restoreslifetosubjectwhodiedaslongasoneday/levelago.
RighteousMight:Yoursizeincreases,andyougaincombatbonuses.
ScryingF:Spiesonsubjectfromadistance.
SlayLiving:Touchattackkillssubject.
SpellResistance:SubjectgainsSR12+level.
SummonMonsterV:Callsextraplanarcreaturetofightforyou.
SymbolofPainM:Triggeredrunewracksnearbycreatureswithpain.
SymbolofSleepM:Triggeredruneputsnearbycreaturesintocatatonicslumber.
TrueSeeingM:Letsyouseeallthingsastheyreallyare.
UnhallowM:Designateslocationasunholy.
WallofStone:Createsastonewallthatcanbeshaped.

6thLevelClericSpells
AnimateObjects:Objectsattackyourfoes.

AntilifeShell:10ft.fieldhedgesoutlivingcreatures.
Banishment:Banishes2HD/levelofextraplanarcreatures.
BearsEndurance,Mass:Asbearsendurance,affectsonesubject/level.
BladeBarrier:Wallofbladesdeals1d6/leveldamage.
BullsStrength,Mass:Asbullsstrength,affectsonesubject/level.
CreateUndead:Createghouls,ghasts,mummies,ormohrgs.
CureModerateWounds,Mass:Cures2d8damage+1/levelformanycreatures.
DispelMagic,Greater:Asdispelmagic,butupto+20oncheck.
EaglesSplendor,Mass:Aseaglessplendor,affectsonesubject/level.
FindthePath:Showsmostdirectwaytoalocation.
ForbiddanceM:Blocksplanartravel,damagescreaturesofdifferentalignment.
Geas/Quest:Aslessergeas,plusitaffectsanycreature.
GlyphofWarding,Greater:Asglyphofwarding,butupto10d8damageor6thlevelspell.
Harm:Deals10points/leveldamagetotarget.
Heal:Cures10points/levelofdamage,alldiseasesandmentalconditions.
HeroesFeast:Foodforonecreature/levelcuresandgrantscombatbonuses.
InflictModerateWounds,Mass:Deals2d8damage+1/leveltomanycreatures.
OwlsWisdom,Mass:Asowlswisdom,affectsonesubject/level.
PlanarAllyX:Aslesserplanarally,butupto12HD.
SummonMonsterVI:Callsextraplanarcreaturetofightforyou.
SymbolofFearM:Triggeredrunepanicsnearbycreatures.
SymbolofPersuasionM:Triggeredrunecharmsnearbycreatures.
UndeathtoDeathM:Destroys1d4HD/levelundead(max20d4).
WindWalk:Youandyouralliesturnvaporousandtravelfast.
WordofRecall:Teleportsyoubacktodesignatedplace.

Page188of462
7thLevelClericSpells
Blasphemy:Kills,paralyzes,weakens,ordazesnonevilsubjects.
ControlWeather:Changesweatherinlocalarea.
CureSeriousWounds,Mass:Cures3d8damage+1/levelformanycreatures.
DestructionF:Killssubjectanddestroysremains.
Dictum:Kills,paralyzes,slows,ordeafensnonlawfulsubjects.
EtherealJaunt:Youbecomeetherealfor1round/level.
HolyWord:Kills,paralyzes,blinds,ordeafensnongoodsubjects.
InflictSeriousWounds,Mass:Deals3d8damage+1/leveltomanycreatures.
RefugeM:Altersitemtotransportitspossessortoyou.
Regenerate:Subjectsseveredlimbsgrowback,cures4d8damage+1/level(max+35).
Repulsion:Creaturescantapproachyou.
Restoration,GreaterX:Asrestoration,plusrestoresalllevelsandabilityscores.
ResurrectionM:Fullyrestoredeadsubject.
Scrying,Greater:Asscrying,butfasterandlonger.
SummonMonsterVII:Callsextraplanarcreaturetofightforyou.
SymbolofStunningM:Triggeredrunestunsnearbycreatures.
SymbolofWeaknessM:Triggeredruneweakensnearbycreatures.
WordofChaos:Kills,confuses,stuns,ordeafensnonchaoticsubjects.

8thLevelClericSpells
AntimagicField:Negatesmagicwithin10ft.

CloakofChaosF:+4toAC,+4resistance,andSR25againstlawfulspells.
CreateGreaterUndeadM:Createshadows,wraiths,spectres,ordevourers.
CureCriticalWounds,Mass:Cures4d8damage+1/levelformanycreatures.
DimensionalLock:Teleportationandinterplanartravelblockedforoneday/level.
DiscernLocation:Revealsexactlocationofcreatureorobject.
Earthquake:Intensetremorshakes5ft./levelradius.
FireStorm:Deals1d6/levelfiredamage.
HolyAuraF:+4toAC,+4resistance,andSR25againstevilspells.
PlanarAlly,GreaterX:Aslesserplanarally,butupto18HD.
InflictCriticalWounds,Mass:Deals4d8damage+1/leveltomanycreatures.
ShieldofLawF:+4toAC,+4resistance,andSR25againstchaoticspells.
SpellImmunity,Greater:Asspellimmunity,butupto8thlevelspells.
SummonMonsterVIII:Callsextraplanarcreaturetofightforyou.
SymbolofDeathM:Triggeredruneslaysnearbycreatures.
SymbolofInsanityM:Triggeredrunerendersnearbycreaturesinsane.
UnholyAuraF:+4toAC,+4resistance,andSR25againstgoodspells.

9thLevelClericSpells
AstralProjectionM:ProjectsyouandcompanionsontoAstralPlane.

Page189of462
EnergyDrain:Subjectgains2d4negativelevels.
Etherealness:TraveltoEtherealPlanewithcompanions.
GateX:Connectstwoplanesfortravelorsummoning.
Heal,Mass:Asheal,butwithseveralsubjects.
Implosion:Killsonecreature/round.
MiracleX:Requestsadeitysintercession.
SoulBindF:Trapsnewlydeadsoultopreventresurrection.
StormofVengeance:Stormrainsacid,lightning,andhail.
SummonMonsterIX:Callsextraplanarcreaturetofightforyou.
TrueResurrectionM:Asresurrection,plusremainsarentneeded.

ClericDomains
AirDomain
GrantedPowers:Turnordestroyearthcreaturesasagoodclericturnsundead.Rebuke,command,orbolsteraircreatures
asanevilclericrebukesundead.Usetheseabilitiesatotalnumberoftimesperdayequalto3+yourCharismamodifier.
Thisgrantedpowerisasupernaturalability.
DomainSpells:
1. ObscuringMist:Fogsurroundsyou.
2. WindWall:Deflectsarrows,smallercreatures,andgases.
3. GaseousForm:Subjectbecomesinsubstantialandcanflyslowly.
4. AirWalk:Subjecttreadsonairasifsolid(climbat45degreeangle).
5. ControlWinds:Changewinddirectionandspeed.
6. ChainLightning:1d6/leveldamage;1secondarybolt/leveleachdealshalfdamage.
7. ControlWeather:Changesweatherinlocalarea.
8. Whirlwind:Cyclonedealsdamageandcanpickupcreatures.
9. ElementalSwarm*:Summonsmultipleelementals.
*Castasanairspellonly.

AnimalDomain
GrantedPowers:Youcanusespeakwithanimalsonceperdayasaspelllikeability.
AddKnowledge(nature)toyourlistofclericclassskills.
DomainSpells:
1. CalmAnimals:Calms(2d4+level)HDofanimals.
2. HoldAnimal:Paralyzesoneanimalfor1round/level.
3. DominateAnimal:Subjectanimalobeyssilentmentalcommands.
4. SummonNaturesAllyIV*:Callscreaturetofight.
5. CommunewithNature:Learnaboutterrainfor1mile/level.
6. AntilifeShell:10ft.fieldhedgesoutlivingcreatures.
7. AnimalShapes:Oneally/levelpolymorphsintochosenanimal.
8. SummonNaturesAllyVIII*:Callscreaturetofight.
9. ShapechangeF:Transformsyouintoanycreature,andchangeformsonceperround.
*Canonlysummonanimals.

Page190of462
ChaosDomain
GrantedPower:Youcastchaosspellsat+1casterlevel.
DomainSpells:
1. ProtectionfromLaw:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
2. Shatter:Sonicvibrationdamagesobjectsorcrystallinecreatures.
3. MagicCircleagainstLaw:Asprotectionspells,but10ft.radiusand10min./level.
4. ChaosHammer:Damagesandstaggerslawfulcreatures.
5. DispelLaw:+4bonusagainstattacksbylawfulcreatures.
6. AnimateObjects:Objectsattackyourfoes.
7. WordofChaos:Kills,confuses,stuns,ordeafensnonchaoticsubjects.
8. CloakofChaosF:+4toAC,+4resistance,SR25againstlawfulspells.
9. SummonMonsterIX*:Callsextraplanarcreaturetofightforyou.
*Castasachaosspellonly.

DeathDomain
GrantedPower:Youmayuseadeathtouchonceperday.Yourdeathtouchisasupernaturalabilitythatproducesadeath
effect.Youmustsucceedonameleetouchattackagainstalivingcreature(usingtherulesfortouchspells).Whenyou
touch,roll1d6perclericlevelyoupossess.Ifthetotalatleastequalsthecreaturescurrenthitpoints,itdies(nosave).
DomainSpells:
1. CauseFear:Onecreatureof5HDorlessfleesfor1d4rounds.
2. DeathKnell:Killdyingcreatureandgain1d8temporaryhp,+2toStr,and+1casterlevel.
3. AnimateDeadM:Createsundeadskeletonsandzombies.
4. DeathWard:Grantsimmunitytodeathspellsandnegativeenergyeffects.
5. SlayLiving:Touchattackkillssubject.
6. CreateUndeadM:Createghouls,ghasts,mummies,ormohrgs.
7. DestructionF:Killssubjectanddestroysremains.
8. CreateGreaterUndeadM:Createshadows,wraiths,spectres,rdevourers.
9. WailoftheBanshee:Killsonecreature/level.

DestructionDomain
GrantedPower:Yougainthesmitepower,thesupernaturalabilitytomakeasinglemeleeattackwitha+4bonusonattack
rollsandabonusondamagerollsequaltoyourclericlevel(ifyouhit).Youmustdeclarethesmitebeforemakingthe
attack.Thisabilityisusableonceperday.
DomainSpells:
1. InflictLightWounds:Touchattack,1d8damage+1/level(max+5).
2. Shatter:Sonicvibrationdamagesobjectsorcrystallinecreatures.
3. Contagion:Infectssubjectwithchosendisease.
4. InflictCriticalWounds:Touchattack,4d8damage+1/level(max+20).
5. InflictLightWounds,Mass:Deals1d8damage+1/leveltoanycreatures.
6. Harm:Deals10points/leveldamagetotarget.
7. Disintegrate:Makesonecreatureorobjectvanish.
8. Earthquake:Intensetremorshakes5ft./levelradius.
9. Implosion:Killsonecreature/round.

Page191of462
EarthDomain
GrantedPower:Turnordestroyaircreaturesasagoodclericturnsundead.Rebuke,command,orbolsterearthcreaturesas
anevilclericrebukesundead.Usetheseabilitiesatotalnumberoftimesperdayequalto3+yourCharismamodifier.This
grantedpowerisasupernaturalability.
DomainSpells:
1. MagicStone:Threestonesbecome+1projectiles,1d6+1damage.
2. SoftenEarthandStone:Turnsstonetoclayordirttosandormud.
3. StoneShape:Sculptsstoneintoanyshape.
4. SpikeStones:Creaturesinareatake1d8damage,maybelowed.
5. WallofStone:Createsastonewallthatcanbeshaped.
6. StoneskinM:Ignore10pointsofdamageperattack.
7. Earthquake:Intensetremorshakes5ft./levelradius.
8. IronBody:Yourbodybecomeslivingiron.
9. ElementalSwarm*:Summonsmultipleelementals.
*Castasanearthspellonly.

EvilDomain
GrantedPower:Youcastevilspellsat+1casterlevel.
DomainSpells:
1. ProtectionfromGood:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
2. DesecrateM:Fillsareawithnegativeenergy,makingundeadstronger.
3. MagicCircleagainstGood:Asprotectionspells,but10ft.radiusand10min./level.
4. UnholyBlight:Damagesandsickensgoodcreatures.
5. DispelGood:+4bonusagainstattacksbygoodcreatures.
6. CreateUndeadM:Createghouls,ghasts,mummies,ormohrgs.
7. Blasphemy:Kills,paralyzes,weakens,ordazesnonevilsubjects.
8. UnholyAuraF:+4toAC,+4resistance,SR25againstgoodspells.
9. SummonMonsterIX*:Callsextraplanarcreaturetofightforyou.
*Castasanevilspellonly.

FireDomain
GrantedPower:Turnordestroywatercreaturesasagoodclericturnsundead.Rebuke,command,orbolsterfirecreatures
asanevilclericrebukesundead.Usetheseabilitiesatotalnumberoftimesperdayequalto3+yourCharismamodifier.
Thisgrantedpowerisasupernaturalability.
DomainSpells:
1. BurningHands:1d4/levelfiredamage(max5d4).
2. ProduceFlame:1d6damage+1/level,touchorthrown.
3. ResistEnergy*:Ignores10(ormore)pointsofdamage/attackfromspecifiedenergytype.
4. WallofFire:Deals2d4firedamageoutto10ft.and1d4outto20ft.Passingthroughwalldeals2d6damage+1/level.
5. FireShield:Creaturesattackingyoutakefiredamage;youreprotectedfromheatorcold.
6. FireSeeds:Acornsandberriesbecomegrenadesandbombs.
7. FireStorm:Deals1d6/levelfiredamage.
8. IncendiaryCloud:Clouddeals4d6firedamage/round.

Page192of462
9. ElementalSwarm**:Summonsmultipleelementals.
*Resistcoldorfireonly.
**Castasafirespellonly.

GoodDomain
GrantedPower:Youcastgoodspellsat+1casterlevel.
DomainSpells:
1. ProtectionfromEvil:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
2. Aid:+1onattackrolls,+1onsavesagainstfear,1d8temporaryhp+1/level(max+10).
3. MagicCircleagainstEvil:Asprotectionspells,but10ft.radiusand10min./level.
4. HolySmite:Damagesandblindsevilcreatures.
5. DispelEvil:+4bonusagainstattacksbyevilcreatures.
6. BladeBarrier:Wallofbladesdeals1d6/leveldamage.
7. HolyWordF:Kills,paralyzes,slows,ordeafensnongoodsubjects.
8. HolyAura:+4toAC,+4resistance,andSR25againstevilspells.
9. SummonMonsterIX*:Callsextraplanarcreaturetofightforyou.
*Castasagoodspellonly.

HealingDomain
GrantedPower:Youcasthealingspellsat+1casterlevel.
DomainSpells:
1. CureLightWounds:Cures1d8damage+1/level(max+5).
2. CureModerateWounds:Cures2d8damage+1/level(max+10).
3. CureSeriousWounds:Cures3d8damage+1/level(max+15).
4. CureCriticalWounds:Cures4d8damage+1/level(max+20).
5. CureLightWounds,Mass:Cures1d8damage+1/level(max+25)formanycreatures.
6. Heal:Cures10points/levelofdamage,alldiseasesandmentalconditions.
7. Regenerate:Subjectsseveredlimbsgrowback,cures4d8damage+1/level(max+35).
8. CureCriticalWounds,Mass:Cures4d8damage+1/level(max+40)formanycreatures.
9. Heal,Mass:Asheal,butwithseveralsubjects.

KnowledgeDomain
GrantedPower:AddallKnowledgeskillstoyourlistofclericclassskills.Youcastdivinationspellsat+1casterlevel.
DomainSpells:
1. DetectSecretDoors:Revealshiddendoorswithin60ft.
2. DetectThoughts:Allowslisteningtosurfacethoughts.
3. Clairaudience/Clairvoyance:Hearorseeatadistancefor1min./level.
4. DivinationM:Providesusefuladviceforspecificproposedactions.
5. TrueSeeingM:Letsyouseeallthingsastheyreallyare.
6. FindthePath:Showsmostdirectwaytoalocation.
7. LegendLoreMF:Letsyoulearntalesaboutaperson,place,orthing.
8. DiscernLocation:Revealsexactlocationofcreatureorobject.

Page193of462
9. Foresight:Sixthsensewarnsofimpendingdanger.

LawDomain
GrantedPower:Youcastlawspellsat+1casterlevel.
DomainSpells:
1. ProtectionfromChaos:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
2. CalmEmotions:Calmscreatures,negatingemotioneffects.
3. MagicCircleagainstChaos:Asprotectionspells,but10ft.radiusand10min./level.
4. OrdersWrath:Damagesanddazeschaoticcreatures.
5. DispelChaos:+4bonusagainstattacksbychaoticcreatures.
6. HoldMonster:Asholdperson,butanycreature.
7. Dictum:Kills,paralyzes,slows,ordeafensnonlawfulsubjects.
8. ShieldofLawF:+4toAC,+4resistance,andSR25againstchaoticspells.
9. SummonMonsterIX*:Callsextraplanarcreaturetofightforyou.
*Castasalawspellonly.

LuckDomain
GrantedPower:Yougainthepowerofgoodfortune,whichisusableonceperday.Thisextraordinaryabilityallowsyouto
rerollonerollthatyouhavejustmadebeforetheDMdeclareswhethertherollresultsinsuccessorfailure.Youmusttake
theresultofthereroll,evenifitsworsethantheoriginalroll.
DomainSpells:
1. EntropicShield:Rangedattacksagainstyouhave20%misschance.
2. Aid:+1onattackrolls,+1againstfear,1d8temporaryhp+1/level(max+10).
3. ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
4. FreedomofMovement:Subjectmovesnormallydespiteimpediments.
5. BreakEnchantment:Freessubjectsfromenchantments,alterations,curses,andpetrification.
6. Mislead:Turnsyouinvisibleandcreatesillusorydouble.
7. SpellTurning:Reflect1d4+6spelllevelsbackatcaster.
8. MomentofPrescience:Yougaininsightbonusonsingleattackroll,check,orsave.
9. MiracleX:Requestsadeitysintercession.

MagicDomain
GrantedPower:Usescrolls,wands,andotherdeviceswithspellcompletionorspelltriggeractivationasawizardofone
halfyourclericlevel(atleast1stlevel).Forthepurposeofusingascrollorothermagicdevice,ifyouarealsoawizard,
actualwizardlevelsandtheseeffectivewizardlevelsstack.
DomainSpells:
1. MagicAura:Altersobjectsmagicaura.
2. Identify:Determinespropertiesofmagicitem.
3. DispelMagic:Cancelsmagicalspellsandeffects.
4. ImbuewithSpellAbility:Transferspellstosubject.
5. SpellResistance:SubjectgainsSR12+level.
6. AntimagicField:Negatesmagicwithin10ft.
7. SpellTurning:Reflect1d4+6spelllevelsbackatcaster.
8. ProtectionfromSpellsMF:Confers+8resistancebonus.
Page194of462
9. MagesDisjunction:Dispelsmagic,disenchantsmagicitems.

PlantDomain
GrantedPowers:Rebukeorcommandplantcreaturesasanevilclericrebukesorcommandsundead.Usethisabilityatotal
numberoftimesperdayequalto3+yourCharismamodifier.Thisgrantedpowerisasupernaturalability.AddKnowledge
(nature)toyourlistofclericclassskills.
DomainSpells:
1. Entangle:Plantsentangleeveryonein40ft.radius.
2. Barkskin:Grants+2(orhigher)enhancementtonaturalarmor.
3. PlantGrowth:Growsvegetation,improvescrops.
4. CommandPlants:Swaytheactionsofoneormoreplantcreatures.
5. WallofThorns:Thornsdamageanyonewhotriestopass.
6. RepelWood:Pushesawaywoodenobjects.
7. AnimatePlants:Oneormoretreesanimateandfightforyou.
8. ControlPlants:Controlactionsofoneormoreplantcreatures.
9. Shambler:Summons1d4+2shamblingmoundstofightforyou.

ProtectionDomain
GrantedPower:Youcangenerateaprotectivewardasasupernaturalability.Grantsomeoneyoutoucharesistancebonus
equaltoyourclericlevelonhisorhernextsavingthrow.Activatingthispowerisastandardaction.Theprotectivewardis
anabjurationeffectwithadurationof1hourthatisusableonceperday.
DomainSpells:
1. Sanctuary:Opponentscantattackyou,andyoucantattack.
2. ShieldOtherF:Youtakehalfofsubjectsdamage.
3. ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
4. SpellImmunity:Subjectisimmunetoonespellperfourlevels.
5. SpellResistance:SubjectgainsSR12+level.
6. AntimagicField:Negatesmagicwithin10ft.
7. Repulsion:Creaturescantapproachyou.
8. MindBlank:Subjectisimmunetomental/emotionalmagicandscrying.
9. PrismaticSphere:Asprismaticwall,butsurroundsonallsides.

StrengthDomain
GrantedPower:Youcanperformafeatofstrengthasasupernaturalability.YougainanenhancementbonustoStrength
equaltoyourclericlevel.Activatingthepowerisafreeaction,thepowerlasts1round,anditisusableonceperday.
DomainSpells:
1. EnlargePerson:Humanoidcreaturedoublesinsize.
2. BullsStrength:Subjectgains+4toStrfor1min./level.
3. MagicVestment:Armororshieldgains+1enhancementperfourlevels.
4. SpellImmunity:Subjectisimmunetoonespellperfourlevels.
5. RighteousMight:Yoursizeincreases,andyougaincombatbonuses.
6. StoneskinM:Ignore10pointsofdamageperattack.
7. GraspingHand:Largehandprovidescover,pushes,orgrapples.
8. ClenchedFist:Largehandprovidescover,pushes,orattacksyourfoes.

Page195of462
9. CrushingHand:Largehandprovidescover,pushes,orcrushesyourfoes.

SunDomain
GrantedPower:Onceperday,youcanperformagreaterturningagainstundeadinplaceofaregularturning.Thegreater
turningislikeanormalturningexceptthattheundeadcreaturesthatwouldbeturnedaredestroyedinstead.
DomainSpells:
1. EndureElements:Existcomfortablyinhotorcoldenvironments.
2. HeatMetal:Makemetalsohotitdamagesthosewhotouchit.
3. SearingLight:Raydeals1d8/twolevels,moreagainstundead.
4. FireShield:Creaturesattackingyoutakefiredamage;youreprotectedfromheatorcold.
5. FlameStrike:Smitefoeswithdivinefire(1d6/leveldamage).
6. FireSeeds:Acornsandberriesbecomegrenadesandbombs.
7. Sunbeam:Beamblindsanddeals4d6damage.
8. Sunburst:Blindsallwithin10ft.,deals6d6damage.
9. PrismaticSphere:Asprismaticwall,butsurroundsonallsides.

TravelDomain
GrantedPowers:Foratotaltimeperdayof1roundperclericlevelyoupossess,youcanactnormallyregardlessofmagical
effectsthatimpedemovementasifyouwereaffectedbythespellfreedomofmovement.Thiseffectoccursautomaticallyas
soonasitapplies,lastsuntilitrunsoutorisnolongerneeded,andcanoperatemultipletimesperday(uptothetotaldaily
limitofrounds).Thisgrantedpowerisasupernaturalability.AlsoaddSurvivaltoyourlistofclericclassskills.
DomainSpells:
1. Longstrider:Increasesyourspeed.
2. LocateObject:Sensesdirectiontowardobject(specificortype).
3. Fly:Subjectfliesatspeedof60ft.
4. DimensionDoor:Teleportsyoushortdistance.
5. Teleport:Instantlytransportsyouasfaras100miles/level.
6. FindthePath:Showsmostdirectwaytoalocation.
7. Teleport,Greater:Asteleport,butnorangelimitandnoofftargetarrival.
8. PhaseDoor:Createsaninvisiblepassagethroughwoodorstone.
9. AstralProjectionM:ProjectsyouandcompanionsontoAstralPlane.

TrickeryDomain
GrantedPower:AddBluff,Disguise,andHidetoyourlistofclericclassskills.
DomainSpells:
1. DisguiseSelf:Disguiseownappearance.
2. Invisibility:Subjectinvisible1min./leveloruntilitattacks.
3. NondetectionM:Hidessubjectfromdivination,scrying.
4. Confusion:Subjectsbehaveoddlyfor1round/level.
5. FalseVisionM:Foolsscryingwithanillusion.
6. Mislead:Turnsyouinvisibleandcreatesillusorydouble.
7. Screen:Illusionhidesareafromvision,scrying.
8. PolymorphAnyObject:Changesanysubjectintoanythingelse.
9. TimeStop:Youactfreelyfor1d4+1rounds.
Page196of462
WarDomain
GrantedPower:FreeMartialWeaponProficiencywithdeitysfavoredweapon(ifnecessary)andWeaponFocuswiththe
deitysfavoredweapon.
DomainSpells:
1. MagicWeapon:Weapongains+1bonus.
2. SpiritualWeapon:Magicalweaponattacksonitsown.
3. MagicVestment:Armororshieldgains+1enhancementperfourlevels.
4. DivinePower:Yougainattackbonus,+6toStr,and1hp/level.
5. FlameStrike:Smitefoeswithdivinefire(1d6/leveldamage).
6. BladeBarrier:Wallofbladesdeals1d6/leveldamage.
7. PowerWordBlind:Blindscreaturewith200hporless.
8. PowerWordStun:Stunscreaturewith150hporless.
9. PowerWordKill:Killscreaturewith100hporless.

WaterDomain
GrantedPower:Turnordestroyfirecreaturesasagoodclericturnsundead.Rebuke,command,orbolsterwatercreatures
asanevilclericrebukesundead.Usetheseabilitiesatotalnumberoftimesperdayequalto3+yourCharismamodifier.
Thisgrantedpowerisasupernaturalability.
DomainSpells:
1. ObscuringMist:Fogsurroundsyou.
2. FogCloud:Fogobscuresvision.
3. WaterBreathing:Subjectscanbreatheunderwater.
4. ControlWater:Raisesorlowersbodiesofwater.
5. IceStorm:Haildeals5d6damageincylinder40ft.across.
6. ConeofCold:1d6/levelcolddamage.
7. AcidFog:Fogdealsaciddamage.
8. HorridWilting:Deals1d6/leveldamagewithin30ft.
9. ElementalSwarm*:Summonsmultipleelementals.
*Castasawaterspellonly.

DruidSpells
0LevelDruidSpells(Orisons)
CreateWater:Creates2gallons/levelofpurewater.

CureMinorWounds:Cures1pointofdamage.
DetectMagic:Detectsspellsandmagicitemswithin60ft.
DetectPoison:Detectspoisoninonecreatureorobject.
Flare:Dazzlesonecreature(1penaltyonattackrolls).
Guidance:+1ononeattackroll,savingthrow,orskillcheck.
KnowDirection:Youdiscernnorth.
Light:Objectshineslikeatorch.
Mending:Makesminorrepairsonanobject.
PurifyFoodandDrink:Purifies1cu.ft./leveloffoodorwater.
ReadMagic:Readscrollsandspellbooks.
Page197of462
Resistance:Subjectgains+1bonusonsavingthrows.
Virtue:Subjectgains1temporaryhp.

1stLevelDruidSpells
CalmAnimals:Calms(2d4+level)HDofanimals.

CharmAnimal:Makesoneanimalyourfriend.
CureLightWounds:Cures1d8damage+1/level(max+5).
DetectAnimalsorPlants:Detectskindsofanimalsorplants.
DetectSnaresandPits:Revealsnaturalorprimitivetraps.
EndureElements:Existcomfortablyinhotorcoldenvironments.
Entangle:Plantsentangleeveryonein40ft.radius.
FaerieFire:Outlinessubjectswithlight,cancelingblur,concealment,andthelike.
Goodberry:2d4berrieseachcure1hp(max8hp/24hours).
HidefromAnimals:Animalscantperceiveonesubject/level.
Jump:SubjectgetsbonusonJumpchecks.
Longstrider:Yourspeedincreasesby10ft.
MagicFang:Onenaturalweaponofsubjectcreaturegets+1onattackanddamagerolls.
MagicStone:Threestonesgain+1onattackrolls,deal1d6+1damage.
ObscuringMist:Fogsurroundsyou.
PasswithoutTrace:Onesubject/levelleavesnotracks.
ProduceFlame:1d6damage+1/level,touchorthrown.
Shillelagh:Cudgelorquarterstaffbecomes+1weapon(1d10damage)for1min./level.
SpeakwithAnimals:Youcancommunicatewithanimals.
SummonNaturesAllyI:Callscreaturetofight.

2ndLevelDruidSpells
AnimalMessenger:SendsaTinyanimaltoaspecificplace.

AnimalTrance:Fascinates2d6HDofanimals.
Barkskin:Grants+2(orhigher)enhancementtonaturalarmor.
BearsEndurance:Subjectgains+4toConfor1min./level.
BullsStrength:Subjectgains+4toStrfor1min./level.
CatsGrace:Subjectgains+4toDexfor1min./level.
ChillMetal:Coldmetaldamagesthosewhotouchit.
DelayPoison:Stopspoisonfromharmingsubjectfor1hour/level.
FireTrapM:Openedobjectdeals1d4+1/leveldamage.
FlameBlade:Touchattackdeals1d8+1/twolevelsdamage.
FlamingSphere:Createsrollingballoffire,2d6damage,lasts1round/level.
FogCloud:Fogobscuresvision.
GustofWind:Blowsawayorknocksdownsmallercreatures.
HeatMetal:Makemetalsohotitdamagesthosewhotouchit.
HoldAnimal:Paralyzesoneanimalfor1round/level.

Page198of462
OwlsWisdom:Subjectgains+4toWisfor1min./level.
ReduceAnimal:Shrinksonewillinganimal.
ResistEnergy:Ignores10(ormore)pointsofdamage/attackfromspecifiedenergytype.
Restoration,Lesser:Dispelsmagicalabilitypenaltyorrepairs1d4abilitydamage.
SoftenEarthandStone:Turnsstonetoclayordirttosandormud.
SpiderClimb:Grantsabilitytowalkonwallsandceilings.
SummonNaturesAllyII:Callscreaturetofight.
SummonSwarm:Summonsswarmofbats,rats,orspiders.
TreeShape:Youlookexactlylikeatreefor1hour/level.
WarpWood:Bendswood(shaft,handle,door,plank).
WoodShape:Rearrangeswoodenobjectstosuityou.

3rdLevelDruidSpells
CallLightning:Callsdownlightningbolts(3d6perbolt)fromsky.

Contagion:Infectssubjectwithchosendisease.
CureModerateWounds:Cures2d8damage+1/level(max+10).
Daylight:60ft.radiusofbrightlight.
DiminishPlants:Reducessizeorblightsgrowthofnormalplants.
DominateAnimal:Subjectanimalobeyssilentmentalcommands.
MagicFang,Greater:Onenaturalweaponofsubjectcreaturegets+1/threelevelsonattackanddamagerolls(max
+5).
MeldintoStone:Youandyourgearmergewithstone.
NeutralizePoison:Immunizessubjectagainstpoison,detoxifiesvenominoronsubject.
PlantGrowth:Growsvegetation,improvescrops.
Poison:Touchdeals1d10Condamage,repeatsin1min.
ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
Quench:Extinguishesnonmagicalfiresoronemagicitem.
RemoveDisease:Curesalldiseasesaffectingsubject.
SleetStorm:Hampersvisionandmovement.
Snare:Createsamagicboobytrap.
SpeakwithPlants:Youcantalktonormalplantsandplantcreatures.
SpikeGrowth:Creaturesinareatake1d4damage,maybeslowed.
StoneShape:Sculptsstoneintoanyshape.
SummonNaturesAllyIII:Callscreaturetofight.
WaterBreathing:Subjectscanbreatheunderwater.
WindWall:Deflectsarrows,smallercreatures,andgases.

4thLevelDruidSpells
AirWalk:Subjecttreadsonairasifsolid(climbat45degreeangle).

AntiplantShell:Keepsanimatedplantsatbay.
Blight:Withersoneplantordeals1d6/leveldamagetoplantcreature.

Page199of462
CommandPlants:Swaytheactionsofoneormoreplantcreatures.
ControlWater:Raisesorlowersbodiesofwater.
CureSeriousWounds:Cures3d8damage+1/level(max+15).
DispelMagic:Cancelsspellsandmagicaleffects.
FlameStrike:Smitefoeswithdivinefire(1d6/leveldamage).
FreedomofMovement:Subjectmovesnormallydespiteimpediments.
GiantVermin:Turnscentipedes,scorpions,orspidersintogiantvermin.
IceStorm:Haildeals5d6damageincylinder40ft.across.
Reincarnate:Bringsdeadsubjectbackinarandombody.
RepelVermin:Insects,spiders,andotherverminstay10ft.away.
RustingGrasp:Yourtouchcorrodesironandalloys.
ScryingF:Spiesonsubjectfromadistance.
SpikeStones:Creaturesinareatake1d8damage,maybeslowed.
SummonNaturesAllyIV:Callscreaturetofight.

5thLevelDruidSpells
AnimalGrowth:Oneanimal/twolevelsdoublesinsize.

Atonement:Removesburdenofmisdeedsfromsubject.
AwakenX:Animalortreegainshumanintellect.
BalefulPolymorph:Transformssubjectintoharmlessanimal.
CallLightningStorm:Ascalllightning,but5d6damageperbolt.
CommunewithNature:Learnaboutterrainfor1mile/level.
ControlWinds:Changewinddirectionandspeed.
CureCriticalWounds:Cures4d8damage+1/level(max+20).
DeathWard:Grantsimmunitytoalldeathspellsandnegativeenergyeffects.
HallowM:Designateslocationasholy.
InsectPlague:Locustswarmsattackcreatures.
StoneskinM:Ignore10pointsofdamageperattack.
SummonNaturesAllyV:Callscreaturetofight.
TransmuteMudtoRock:Transformstwo10ft.cubesperlevel.
TransmuteRocktoMud:Transformstwo10ft.cubesperlevel.
TreeStride:Stepfromonetreetoanotherfaraway.
UnhallowM:Designateslocationasunholy.
WallofFire:Deals2d4firedamageoutto10ft.and1d4outto20ft.Passingthroughwalldeals2d6damage+1/level.
WallofThorns:Thornsdamageanyonewhotriestopass.

6thLevelDruidSpells
AntilifeShell:10ft.radiusfieldhedgesoutlivingcreatures.

BearsEndurance,Mass:Asbearsendurance,affectsonesubject/level.
BullsStrength,Mass:Asbullsstrength,affectsonesubject/level.
CatsGrace,Mass:Ascatsgrace,affectsonesubject/level.

Page200of462
CureLightWounds,Mass:Cures1d8damage+1/levelformanycreatures.
DispelMagic,Greater:Asdispelmagic,but+20oncheck.
FindthePath:Showsmostdirectwaytoalocation.
FireSeeds:Acornsandberriesbecomegrenadesandbombs.
Ironwood:Magicwoodisstrongassteel.
Liveoak:Oakbecomestreantguardian.
MoveEarth:Digstrenchesandbuildshills.
OwlsWisdom,Mass:Asowlswisdom,affectsonesubject/level.
RepelWood:Pushesawaywoodenobjects.
Spellstaff:Storesonespellinwoodenquarterstaff.
StoneTell:Talktonaturalorworkedstone.
SummonNaturesAllyVI:Callscreaturetofight.
TransportviaPlants:Moveinstantlyfromoneplanttoanotherofthesamekind.
WallofStone:Createsastonewallthatcanbeshaped.

7thLevelDruidSpells
AnimatePlants:Oneormoreplantsanimateandfightforyou.

Changestaff:Yourstaffbecomesatreantoncommand.
ControlWeather:Changesweatherinlocalarea.
CreepingDoom:Swarmsofcentipedesattackatyourcommand.
CureModerateWounds,Mass:Cures2d8damage+1/levelformanycreatures.
FireStorm:Deals1d6/levelfiredamage.
Heal:Cures10points/levelofdamage,alldiseasesandmentalconditions.
Scrying,Greater:Asscrying,butfasterandlonger.
SummonNaturesAllyVII:Callscreaturetofight.
Sunbeam:Beamblindsanddeals4d6damage.
TransmuteMetaltoWood:Metalwithin40ft.becomeswood.
TrueSeeingM:Letsyouseeallthingsastheyreallyare.
WindWalk:Youandyouralliesturnvaporousandtravelfast.

8thLevelDruidSpells
AnimalShapes:Oneally/levelpolymorphsintochosenanimal.

ControlPlants:Controlactionsofoneormoreplantcreatures.
CureSeriousWounds,Mass:Cures3d8damage+1/levelformanycreatures.
Earthquake:Intensetremorshakes5ft./levelradius.
FingerofDeath:Killsonesubject.
RepelMetalorStone:Pushesawaymetalandstone.
ReverseGravity:Objectsandcreaturesfallupward.
SummonNaturesAllyVIII:Callscreaturetofight.
Sunburst:Blindsallwithin10ft.,deals6d6damage.
Whirlwind:Cyclonedealsdamageandcanpickupcreatures.

Page201of462
WordofRecall:Teleportsyoubacktodesignatedplace.

9thLevelDruidSpells
Antipathy:Objectorlocationaffectedbyspellrepelscertaincreatures.

CureCriticalWounds,Mass:Cures4d8damage+1/levelformanycreatures.
ElementalSwarm:Summonsmultipleelementals.
Foresight:Sixthsensewarnsofimpendingdanger.
Regenerate:Subjectsseveredlimbsgrowback,cures4d8damage+1/level(max+35).
Shambler:Summons1d4+2shamblingmoundstofightforyou.
ShapechangeF:Transformsyouintoanycreature,andchangeformsonceperround.
StormofVengeance:Stormrainsacid,lightning,andhail.
SummonNaturesAllyIX:Callscreaturetofight.
SympathyM:Objectorlocationattractscertaincreatures.

PaladinSpells
1stLevelPaladinSpells
Bless:Alliesgain+1onattackrollsand+1onsavesagainstfear.

BlessWater:Makesholywater.
BlessWeapon:Weaponstrikestrueagainstevilfoes.
CreateWater:Creates2gallons/levelofpurewater.
CureLightWounds:Cures1d8damage+1/level(max+5).
DetectPoison:Detectspoisoninonecreatureorsmallobject.
DetectUndead:Revealsundeadwithin60ft.
DivineFavor:Yougain+1perthreelevelsonattackanddamagerolls.
EndureElements:Existcomfortablyinhotorcoldenvironments.
MagicWeapon:Weapongains+1bonus.
ProtectionfromChaos/Evil:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
ReadMagic:Readscrollsandspellbooks.
Resistance:Subjectgains+1onsavingthrows.
Restoration,Lesser:Dispelsmagicalabilitypenaltyorrepairs1d4abilitydamage.
Virtue:Subjectgains1temporaryhp.

2ndLevelPaladinSpells
BullsStrength:Subjectgains+4toStrfor1min./level.

DelayPoison:Stopspoisonfromharmingsubjectfor1hour/level.
EaglesSplendor:Subjectgains+4toChafor1min./level.
OwlsWisdom:Subjectgains+4toWisfor1min./level.
RemoveParalysis:Freesoneormorecreaturesfromparalysisorsloweffect.
ResistEnergy:Ignores10(ormore)pointsofdamage/attackfromspecifiedenergytype.
ShieldOtherF:Youtakehalfofsubjectsdamage.
UndetectableAlignment:Concealsalignmentfor24hours.
ZoneofTruth:Subjectswithinrangecannotlie.

Page202of462
3rdLevelPaladinSpells
CureModerateWounds:Cures2d8damage+1/level(max+10).

Daylight:60ft.radiusofbrightlight.
DiscernLies:Revealsdeliberatefalsehoods.
DispelMagic:Cancelsspellsandmagicaleffects.
HealMount:Ashealonwarhorseorotherspecialmount.
MagicCircleagainstChaos:Asprotectionfromchaos,but10ft.radiusand10min./level.
MagicCircleagainstEvil:Asprotectionfromevil,but10ft.radiusand10min./level.
MagicWeapon,Greater:+1bonus/fourlevels(max+5).
Prayer:Allies+1bonusonmostrolls,enemies1penalty.
RemoveBlindness/Deafness:Curesnormalormagicalconditions.
RemoveCurse:Freesobjectorpersonfromcurse.

4thLevelPaladinSpells
BreakEnchantment:Freessubjectsfromenchantments,alterations,curses,andpetrification.

CureSeriousWounds:Cures3d8damage+1/level(max+15).
DeathWard:Grantsimmunitytodeathspellsandnegativeenergyeffects.
DispelChaos:+4bonusagainstattacksbychaoticcreatures.
DispelEvil:+4bonusagainstattacksbyevilcreatures.
HolySword:Weaponbecomes+5,deals+2d6damageagainstevil.
MarkofJustice:Designatesactionthatwilltriggercurseonsubject.
NeutralizePoison:Immunizessubjectagainstpoison,detoxifiesvenominoronsubject.
RestorationM:Restoreslevelandabilityscoredrains.

RangerSpells
1stLevelRangerSpells
Alarm:Wardsanareafor2hours/level.

AnimalMessenger:SendsaTinyanimaltoaspecificplace.
CalmAnimals:Calms(2d4+level)HDofanimals.
CharmAnimal:Makesoneanimalyourfriend.
DelayPoison:Stopspoisonfromharmingsubjectfor1hour/level.
DetectAnimalsorPlants:Detectskindsofanimalsorplants.
DetectPoison:Detectspoisoninonecreatureorobject.
DetectSnaresandPits:Revealsnaturalorprimitivetraps.
EndureElements:Existcomfortablyinhotorcoldenvironments.
Entangle:Plantsentangleeveryonein40ft.radiuscircle.
HidefromAnimals:Animalscantperceiveonesubject/level.
Jump:SubjectgetsbonusonJumpchecks.
Longstrider:Increasesyourspeed.
MagicFang:Onenaturalweaponofsubjectcreaturegets+1onattackanddamagerolls.
PasswithoutTrace:Onesubject/levelleavesnotracks.
ReadMagic:Readscrollsandspellbooks.
Page203of462
ResistEnergy:Ignores10(ormore)pointsofdamage/attackfromspecifiedenergytype.
SpeakwithAnimals:Youcancommunicatewithanimals.
SummonNaturesAllyI:Callsanimaltofightforyou.

2ndLevelRangerSpells
Barkskin:Grants+2(orhigher)enhancementtonaturalarmor.

BearsEndurance:Subjectgains+4toConfor1min./level.
CatsGrace:Subjectgains+4toDexfor1min./level.
CureLightWounds:Cures1d8damage+1/level(max+5).
HoldAnimal:Paralyzesoneanimalfor1round/level.
OwlsWisdom:Subjectgains+4toWisfor1min./level.
ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
Snare:Createsamagicboobytrap.
SpeakwithPlants:Youcantalktonormalplantsandplantcreatures.
SpikeGrowth:Creaturesinareatake1d4damage,maybeslowed.
SummonNaturesAllyII:Callsanimaltofightforyou.
WindWall:Deflectsarrows,smallercreatures,andgases.

3rdLevelRangerSpells
CommandPlants:Swaytheactionsofoneormoreplantcreatures.

CureModerateWounds:Cures2d8damage+1/level(max+10).
Darkvision:See60ft.intotaldarkness.
DiminishPlants:Reducessizeorblightsgrowthofnormalplants.
MagicFang,Greater:Onenaturalweaponofsubjectcreaturegets+1/threecasterlevelsonattackanddamagerolls
(max+5).
NeutralizePoison:Immunizessubjectagainstpoison,detoxifiesvenominoronsubject.
PlantGrowth:Growsvegetation,improvescrops.
ReduceAnimal:Shrinksonewillinganimal.
RemoveDisease:Curesalldiseasesaffectingsubject.
RepelVermin:Insects,spiders,andotherverminstay10ft.away.
SummonNaturesAllyIII:Callsanimaltofightforyou.
TreeShape:Youlookexactlylikeatreefor1hour/level.
WaterWalk:Subjecttreadsonwaterasifsolid.

4thLevelRangerSpells
AnimalGrowth:Oneanimal/twolevelsdoublesinsize.

CommunewithNature:Learnaboutterrainfor1mile/level.
CureSeriousWounds:Cures3d8damage+1/level(max+15).
FreedomofMovement:Subjectmovesnormallydespiteimpediments.
NondetectionM:Hidessubjectfromdivination,scrying.
SummonNaturesAllyIV:Callsanimaltofightforyou.
TreeStride:Stepfromonetreetoanotherfaraway.

Page204of462
Sorcerer/WizardSpells
0LevelSorcerer/WizardSpells(Cantrips)
Abjur:
Resistance:Subjectgains+1onsavingthrows.
Conj:
AcidSplash:Orbdeals1d3aciddamage.
Div:
DetectPoison:Detectspoisoninonecreatureorsmallobject.
DetectMagic:Detectsspellsandmagicitemswithin60ft.
ReadMagic:Readscrollsandspellbooks.
Ench:
Daze:Humanoidcreatureof4HDorlesslosesnextaction.
Evoc:
DancingLights:Createstorchesorotherlights.
Flare:Dazzlesonecreature(1onattackrolls).
Light:Objectshineslikeatorch.
RayofFrost:Raydeals1d3colddamage.
Illus:
GhostSound:Figmentsounds.
Necro:
DisruptUndead:Deals1d6damagetooneundead.
TouchofFatigue:Touchattackfatiguestarget.
Trans:
MageHand:5poundtelekinesis.
Mending:Makesminorrepairsonanobject.
Message:Whisperedconversationatdistance.
Open/Close:Opensorclosessmallorlightthings.
Univ:
ArcaneMark:Inscribesapersonalrune(visibleorinvisible).
Prestidigitation:Performsminortricks.

1stLevelSorcerer/WizardSpells
Abjur:
Alarm:Wardsanareafor2hours/level.
EndureElements:Existcomfortablyinhotorcoldenvironments.
HoldPortal:Holdsdoorshut.
ProtectionfromChaos/Evil/Good/Law:+2toACandsaves,countermindcontrol,hedgeoutelementalsandoutsiders.
Shield:Invisiblediscgives+4toAC,blocksmagicmissiles.
Conj:
Grease:Makes10ft.squareoroneobjectslippery.

Page205of462
MageArmor:Givessubject+4armorbonus.
Mount:Summonsridinghorsefor2hours/level.
ObscuringMist:Fogsurroundsyou.
SummonMonsterI:Callsextraplanarcreaturetofightforyou.
UnseenServant:Invisibleforceobeysyourcommands.
Div:
ComprehendLanguages:Youunderstandallspokenandwrittenlanguages.
DetectSecretDoors:Revealshiddendoorswithin60ft.
DetectUndead:Revealsundeadwithin60ft.
IdentifyM:Determinespropertiesofmagicitem.
TrueStrike:+20onyournextattackroll.
Ench:
CharmPerson:Makesonepersonyourfriend.
Hypnotism:Fascinates2d4HDofcreatures.
Sleep:Puts4HDofcreaturesintomagicalslumber.
Evoc:
BurningHands:1d4/levelfiredamage(max5d4).
FloatingDisk:Creates3ft.diameterhorizontaldiskthatholds100lb./level.
MagicMissile:1d4+1damage;+1missilepertwolevelsabove1st(max5).
ShockingGrasp:Touchdelivers1d6/levelelectricitydamage(max5d6).
Illus:
ColorSpray:Knocksunconscious,blinds,and/orstuns1d6weakcreatures.
DisguiseSelf:Changesyourappearance.
MagicAura:Altersobjectsmagicaura.
SilentImage:Createsminorillusionofyourdesign.
Ventriloquism:Throwsvoicefor1min./level.
Necro:
CauseFear:Onecreatureof5HDorlessfleesfor1d4rounds.
ChillTouch:Onetouch/leveldeals1d6damageandpossibly1Strdamage.
RayofEnfeeblement:Raydeals1d6+1pertwolevelsStrdamage.
Trans:
AnimateRope:Makesaropemoveatyourcommand.
EnlargePerson:Humanoidcreaturedoublesinsize.
Erase:Mundaneormagicalwritingvanishes.
ExpeditiousRetreat:Yourspeedincreasesby30ft.
FeatherFall:Objectsorcreaturesfallslowly.
Jump:SubjectgetsbonusonJumpchecks.
MagicWeapon:Weapongains+1bonus.
ReducePerson:Humanoidcreaturehalvesinsize.

Page206of462
2ndLevelSorcerer/WizardSpells
Abjur:
ArcaneLockM:Magicallylocksaportalorchest.
ObscureObject:Masksobjectagainstscrying.
ProtectionfromArrows:Subjectimmunetomostrangedattacks.
ResistEnergy:Ignoresfirst10(ormore)pointsofdamage/attackfromspecifiedenergytype.
Conj:
AcidArrow:Rangedtouchattack;2d4damagefor1round+1round/threelevels.
FogCloud:Fogobscuresvision.
Glitterdust:Blindscreatures,outlinesinvisiblecreatures.
SummonMonsterII:Callsextraplanarcreaturetofightforyou.
SummonSwarm:Summonsswarmofbats,rats,orspiders.
Web:Fills20ft.radiusspreadwithstickyspiderwebs.
Div:
DetectThoughts:Allowslisteningtosurfacethoughts.
LocateObject:Sensesdirectiontowardobject(specificortype).
SeeInvisibility:Revealsinvisiblecreaturesorobjects.
Ench:
DazeMonster:Livingcreatureof6HDorlesslosesnextaction.
HideousLaughter:Subjectlosesactionsfor1round/level.
TouchofIdiocy:Subjecttakes1d6pointsofInt,Wis,andChadamage.
Evoc:
ContinualFlameM:Makesapermanent,heatlesstorch.
Darkness:20ft.radiusofsupernaturalshadow.
FlamingSphere:Createsrollingballoffire,2d6damage,lasts1round/level.
GustofWind:Blowsawayorknocksdownsmallercreatures.
ScorchingRay:Rangedtouchattackdeals4d6firedamage,+1ray/fourlevels(max3).
Shatter:Sonicvibrationdamagesobjectsorcrystallinecreatures.
Illus:
Blur:Attacksmisssubject20%ofthetime.
HypnoticPattern:Fascinates(2d4+level)HDofcreatures.
Invisibility:Subjectisinvisiblefor1min./leveloruntilitattacks.
MagicMouthM:Speaksoncewhentriggered.
MinorImage:Assilentimage,plussomesound.
MirrorImage:Createsdecoyduplicatesofyou(1d4+1perthreelevels,max8).
Misdirection:Misleadsdivinationsforonecreatureorobject.
PhantomTrapM:Makesitemseemtrapped.
Necro:
Blindness/Deafness:Makessubjectblindedordeafened.

Page207of462
CommandUndead:Undeadcreatureobeysyourcommands.
FalseLife:Gain1d10temporaryhp+1/level(max+10).
GhoulTouch:Paralyzesonesubject,whichexudesstEnch
thatmakesthosenearbysickened.
Scare:Panicscreaturesoflessthan6HD.
SpectralHand:Createsdisembodiedglowinghandtodelivertouchattacks.
Trans:
AlterSelf:Assumeformofasimilarcreature.
BearsEndurance:Subjectgains+4toConfor1min./level.
BullsStrength:Subjectgains+4toStrfor1min./level.
CatsGrace:Subjectgains+4toDexfor1min./level.
Darkvision:See60ft.intotaldarkness.
EaglesSplendor:Subjectgains+4toChafor1min./level.
FoxsCunning:Subjectgains+4Intfor1min./level.
Knock:Openslockedormagicallysealeddoor.
Levitate:Subjectmovesupanddownatyourdirection.
OwlsWisdom:Subjectgains+4toWisfor1min./level.
Pyrotechnics:Turnsfireintoblindinglightorchokingsmoke.
RopeTrick:Asmanyaseightcreatureshideinextradimensionalspace.
SpiderClimb:Grantsabilitytowalkonwallsandceilings.
WhisperingWind:Sendsashortmessage1mile/level.

3rdLevelSorcerer/WizardSpells
Abjur:
DispelMagic:Cancelsmagicalspellsandeffects.
ExplosiveRunes:Deals6d6damagewhenread.
MagicCircleagainstChaos/Evil/Good/Law:Asprotectionspells,but10ft.radiusand10min./level.
NondetectionM:Hidessubjectfromdivination,scrying.
ProtectionfromEnergy:Absorb12points/levelofdamagefromonekindofenergy.
Conj:
PhantomSteed:Magichorseappearsfor1hour/level.
SepiaSnakeSigilM:Createstextsymbolthatimmobilizesreader.
SleetStorm:Hampersvisionandmovement.
StinkingCloud:Nauseatingvapors,1round/level.
SummonMonsterIII:Callsextraplanarcreaturetofightforyou.
Div:
ArcaneSight:Magicalaurasbecomevisibletoyou.
Clairaudience/Clairvoyance:Hearorseeatadistancefor1min./level.
Tongues:Speakanylanguage.
Ench:

Page208of462
DeepSlumber:Puts10HDofcreaturestosleep.
Heroism:Gives+2bonusonattackrolls,saves,skillchecks.
HoldPerson:Paralyzesonehumanoidfor1round/level.
Rage:Subjectsgains+2toStrandCon,+1onWillsaves,2toAC.
Suggestion:Compelssubjecttofollowstatedcourseofaction.
Evoc:
Daylight:60ft.radiusofbrightlight.
Fireball:1d6damageperlevel,20ft.radius.
LightningBolt:Electricitydeals1d6/leveldamage.
TinyHut:Createsshelterfortencreatures.
WindWall:Deflectsarrows,smallercreatures,andgases.
Illus:
Displacement:Attacksmisssubject50%.
IllusoryScriptM:Onlyintendedreadercandecipher.
InvisibilitySphere:Makeseveryonewithin10ft.invisible.
MajorImage:Assilentimage,plussound,smellandthermaleffects.
Necro:
GentleRepose:Preservesonecorpse.
HaltUndead:Immobilizesundeadfor1round/level.
RayofExhaustion:Raymakessubjectexhausted.
VampiricTouch:Touchdeals1d6/twolevelsdamage;castergainsdamageashp.
Trans:
Blink:Yourandomlyvanishandreappearfor1round/level.
FlameArrow:Arrowsdeal+1d6firedamage.
Fly:Subjectfliesatspeedof60ft.
GaseousForm:Subjectbecomesinsubstantialandcanflyslowly.
Haste:Onecreature/levelmovesfaster,+1onattackrolls,AC,andReflexsaves.
KeenEdge:Doublesnormalweaponsthreatrange.
MagicWeapon,Greater:+1/fourlevels(max+5).
SecretPage:Changesonepagetohideitsrealcontent.
ShrinkItem:Objectshrinkstoonesixteenthsize.
Slow:Onesubject/leveltakesonlyoneaction/round,2toAC,2onattackrolls.
WaterBreathing:Subjectscanbreatheunderwater.

4thLevelSorcerer/WizardSpells
Abjur:
DimensionalAnchor:Barsextradimensionalmovement.
FireTrapM:Openedobjectdeals1d4damage+1/level.
GlobeofInvulnerability,Lesser:Stops1stthrough3rdlevelspelleffects.
RemoveCurse:Freesobjectorpersonfromcurse.

Page209of462
StoneskinM:Ignore10pointsofdamageperattack.
Conj:
BlackTentacles:Tentaclesgrappleallwithin15ft.spread.
DimensionDoor:Teleportsyoushortdistance.
MinorCreation:Createsoneclothorwoodobject.
SecureShelter:Createssturdycottage.
SolidFog:Blocksvisionandslowsmovement.
SummonMonsterIV:Callsextraplanarcreaturetofightforyou.
Div:
ArcaneEye:Invisiblefloatingeyemoves30ft./round.
DetectScrying:Alertsyouofmagicaleavesdropping.
LocateCreature:Indicatesdirectiontofamiliarcreature.
ScryingF:Spiesonsubjectfromadistance.
Ench:
CharmMonster:Makesmonsterbelieveitisyourally.
Confusion:Subjectsbehaveoddlyfor1round/level.
CrushingDespair:Subjectstake2onattackrolls,damagerolls,saves,andchecks.
Geas,Lesser:Commandssubjectof7HDorless.
Evoc:
FireShield:Creaturesattackingyoutakefiredamage;youreprotectedfromheatorcold.
IceStorm:Haildeals5d6damageincylinder40ft.across.
ResilientSphere:Forceglobeprotectsbuttrapsonesubject.
Shout:Deafensallwithinconeanddeals5d6sonicdamage.
WallofFire:Deals2d4firedamageoutto10ft.and1d4outto20ft.Passingthroughwalldeals2d6damage+1/level.
WallofIce:Iceplanecreateswallwith15hp+1/level,orhemispherecantrapcreaturesinside.
Illus:
HallucinatoryTerrain:Makesonetypeofterrainappearlikeanother(fieldintoforest,orthelike).
IllusoryWall:Wall,floor,orceilinglooksreal,butanythingcanpassthrough.
Invisibility,Greater:Asinvisibility,butsubjectcanattackandstayinvisible.
PhantasmalKiller:Fearsomeillusionkillssubjectordeals3d6damage.
RainbowPattern:Lightsfascinate24HDofcreatures.
ShadowConjuration:Mimicsconjurationbelow4thlevel,butonly20%real.
Necro:
AnimateDeadM:Createsundeadskeletonsandzombies.
BestowCurse:6toanabilityscore;4onattackrolls,saves,andchecks;or50%chanceoflosingeachaction.
Contagion:Infectssubjectwithchosendisease.
Enervation:Subjectgains1d4negativelevels.
Fear:Subjectswithinconefleefor1round/level.
Trans:

Page210of462
EnlargePerson,Mass:Enlargesseveralcreatures.
MnemonicEnhancerF:Wizardonly.Preparesextraspellsorretainsonejustcast.
Polymorph:Givesonewillingsubjectanewform.
ReducePerson,Mass:Reducesseveralcreatures.
StoneShape:Sculptsstoneintoanyshape.

5thLevelSorcerer/WizardSpells
Abjur:
BreakEnchantment:Freessubjectsfromenchantments,alterations,curses,andpetrification.
Dismissal:Forcesacreaturetoreturntonativeplane.
MagesPrivateSanctum:Preventsanyonefromviewingorscryinganareafor24hours.
Conj:
Cloudkill:Kills3HDorless;46HDsaveordie,6+HDtakeCondamage.
MagesFaithfulHound:Phantomdogcanguard,attack.
MajorCreation:Asminorcreation,plusstoneandmetal.
PlanarBinding,Lesser:Trapsextraplanarcreatureof6HDorlessuntilitperformsatask.
SecretChestF:HidesexpensivechestonEtherealPlane;youretrieveitatwill.
SummonMonsterV:Callsextraplanarcreaturetofightforyou.
Teleport:Instantlytransportsyouasfaras100miles/level.
WallofStone:Createsastonewallthatcanbeshaped.
Div:
ContactOtherPlane:Letsyouaskquestionofextraplanarentity.
PryingEyes:1d4+1/levelfloatingeyesscoutforyou.
TelepathicBond:Linkletsalliescommunicate.
Ench:
DominatePerson:Controlshumanoidtelepathically.
Feeblemind:SubjectsIntandChadropto1.
HoldMonster:Asholdperson,butanycreature.
MindFog:Subjectsinfogget10toWisandWillchecks.
SymbolofSleepM:Triggeredruneputsnearbycreaturesintocatatonicslumber.
Evoc:
ConeofCold:1d6/levelcolddamage.
InterposingHand:Handprovidescoveragainstoneopponent.
Sending:Deliversshortmessageanywhere,instantly.
WallofForce:Wallisimmunetodamage.
Illus:
Dream:Sendsmessagetoanyonesleeping.
FalseVisionM:Foolsscryingwithanillusion.
MirageArcana:Ashallucinatoryterrain,plusstructures.
Nightmare:Sendsvisiondealing1d10damage,fatigue.

Page211of462
PersistentImage:Asmajorimage,butnoconcentrationrequired.
Seeming:Changesappearanceofonepersonpertwolevels.
ShadowEvocation:Mimicsevocationbelow5thlevel,butonly20%real.
Necro:
Blight:Withersoneplantordeals1d6/leveldamagetoplantcreature.
MagicJarF:Enablespossessionofanothercreature.
SymbolofPainM:Triggeredrunewracksnearbycreatureswithpain.
WavesofFatigue:Severaltargetsbecomefatigued.
Trans:
AnimalGrowth:Oneanimal/twolevelsdoublesinsize.
BalefulPolymorph:Transformssubjectintoharmlessanimal.
Fabricate:Transformsrawmaterialsintofinisheditems.
OverlandFlight:Youflyataspeedof40ft.andcanhustleoverlongdistances.
Passwall:Createspassagethroughwoodorstonewall.
Telekinesis:Movesobject,attackscreature,orhurlsobjectorcreature.
TransmuteMudtoRock:Transformstwo10ft.cubesperlevel.
TransmuteRocktoMud:Transformstwo10ft.cubesperlevel.
Univ:
PermanencyX:Makescertainspellspermanent.

6thLevelSorcerer/WizardSpells
Abjur:
AntimagicField:Negatesmagicwithin10ft.
DispelMagic,Greater:Asdispelmagic,but+20oncheck.
GlobeofInvulnerability:Aslesserglobeofinvulnerability,plus4thlevelspelleffects.
GuardsandWards:Arrayofmagiceffectsprotectarea.
Repulsion:Creaturescantapproachyou.
Conj:
AcidFog:Fogdealsaciddamage.
PlanarBinding:Aslesserplanarbinding,butupto12HD.
SummonMonsterVI:Callsextraplanarcreaturetofightforyou.
WallofIronM:30hp/fourlevels;cantoppleontofoes.
Div:
AnalyzeDweomerF:Revealsmagicalaspectsofsubject.
LegendLoreMF:Letsyoulearntalesaboutaperson,place,orthing.
TrueSeeingM:Letsyouseeallthingsastheyreallyare.
Ench:
Geas/Quest:Aslessergeas,plusitaffectsanycreature.
Heroism,Greater:Gives+4bonusonattackrolls,saves,skillchecks;immunitytofear;temporaryhp.
Suggestion,Mass:Assuggestion,plusonesubject/level.

Page212of462
SymbolofPersuasionM:Triggeredrunecharmsnearbycreatures.
Evoc:
ChainLightning:1d6/leveldamage;1secondarybolt/leveleachdealshalfdamage.
ContingencyF:Setstriggerconditionforanotherspell.
ForcefulHand:Handpushescreaturesaway.
FreezingSphere:Freezeswaterordealscolddamage.
Illus:
Mislead:Turnsyouinvisibleandcreatesillusorydouble.
PermanentImage:Includessight,sound,andsmell.
ProgrammedImageM:Asmajorimage,plustriggeredbyevent.
ShadowWalk:Stepintoshadowtotravelrapidly.
Veil:Changesappearanceofgroupofcreatures.
Necro:
CircleofDeathM:Kills1d4/levelHDofcreatures.
CreateUndeadM:Createsghouls,ghasts,mummies,ormohrgs.
Eyebite:Targetbecomespanicked,sickened,andcomatose.
SymbolofFearM:Triggeredrunepanicsnearbycreatures.
UndeathtoDeathM:Destroys1d4/levelHDofundead(max20d4).
Trans:
BearsEndurance,Mass:Asbearsendurance,affectsonesubject/level.
BullsStrength,Mass:Asbullsstrength,affectsonesubject/level.
CatsGrace,Mass:Ascatsgrace,affectsonesubject/level.
ControlWater:Raisesorlowersbodiesofwater.
Disintegrate:Makesonecreatureorobjectvanish.
EaglesSplendor,Mass:Aseaglessplendor,affectsonesubject/level.
FleshtoStone:Turnssubjectcreatureintostatue.
FoxsCunning,Mass:Asfoxscunning,affectsonesubject/level.
MagesLucubration:Wizardonly.Recallsspellof5thlevelorlower.
MoveEarth:Digstrenchesandbuildhills.
OwlsWisdom,Mass:Asowlswisdom,affectsonesubject/level.
StonetoFlesh:Restorespetrifiedcreature.
TransformationM:Yougaincombatbonuses.

7thLevelSorcerer/WizardSpells
Abjur:
Banishment:Banishes2HD/levelofextraplanarcreatures.
Sequester:Subjectisinvisibletosightandscrying;renderscreaturecomatose.
SpellTurning:Reflect1d4+6spelllevelsbackatcaster.
Conj:
InstantSummonsM:Preparedobjectappearsinyourhand.

Page213of462
MagesMagnificentMansionF:Doorleadstoextradimensionalmansion.
PhaseDoor:Createsaninvisiblepassagethroughwoodorstone.
PlaneShiftF:Asmanyaseightsubjectstraveltoanotherplane.
SummonMonsterVII:Callsextraplanarcreaturetofightforyou.
Teleport,Greater:Asteleport,butnorangelimitandnoofftargetarrival.
TeleportObject:Asteleport,butaffectsatouchedobject.
Div:
ArcaneSight,Greater:Asarcanesight,butalsorevealsmagiceffectsoncreaturesandobjects.
Scrying,Greater:Asscrying,butfasterandlonger.
VisionMX:Aslegendlore,butquickerandstrenuous.
Ench:
HoldPerson,Mass:Asholdperson,butallwithin30ft.
Insanity:Subjectsufferscontinuousconfusion.
PowerWordBlind:Blindscreaturewith200hporless.
SymbolofStunningM:Triggeredrunestunsnearbycreatures.
Evoc:
DelayedBlastFireball:1d6/levelfiredamage;youcanpostponeblastfor5rounds.
ForcecageM:Cubeorcageofforceimprisonsallinside.
GraspingHand:Handprovidescover,pushes,orgrapples.
MagesSwordF:Floatingmagicbladestrikesopponents.
PrismaticSpray:Rayshitsubjectswithvarietyofeffects.
Illus:
Invisibility,Mass:Asinvisibility,butaffectsallinrange.
ProjectImage:Illusorydoublecantalkandcastspells.
ShadowConjuration,Greater:Asshadowconjuration,butupto6thleveland60%real.
SimulacrumMX:Createspartiallyrealdoubleofacreature.
Necro:
ControlUndead:Undeaddontattackyouwhileunderyourcommand.
FingerofDeath:Killsonesubject.
SymbolofWeaknessM:Triggeredruneweakensnearbycreatures.
WavesofExhaustion:Severaltargetsbecomeexhausted.
Trans:
ControlWeather:Changesweatherinlocalarea.
EtherealJaunt:Youbecomeetherealfor1round/level.
ReverseGravity:Objectsandcreaturesfallupward.
Statue:Subjectcanbecomeastatueatwill.
Univ:
LimitedWishX:Altersrealitywithinspelllimits.

Page214of462
8thLevelSorcerer/WizardSpells
Abjur:
DimensionalLock:Teleportationandinterplanartravelblockedforoneday/level.
MindBlank:Subjectisimmunetomental/emotionalmagicandscrying.
PrismaticWall:Wallscolorshavearrayofeffects.
ProtectionfromSpellsMF:Confers+8resistancebonus.
Conj:
IncendiaryCloud:Clouddeals4d6firedamage/round.
Maze:Trapssubjectinextradimensionalmaze.
PlanarBinding,Greater:Aslesserplanarbinding,butupto18HD.
SummonMonsterVIII:Callsextraplanarcreaturetofightforyou.
TraptheSoulMF:Imprisonssubjectwithingem.
Div:
DiscernLocation:Revealsexactlocationofcreatureorobject.
MomentofPrescience:Yougaininsightbonusonsingleattackroll,check,orsave.
PryingEyes,Greater:Aspryingeyes,buteyeshavetrueseeing.
Ench:
Antipathy:Objectorlocationaffectedbyspellrepelscertaincreatures.
BindingM:Utilizesanarrayoftechniquestoimprisonacreature.
CharmMonster,Mass:Ascharmmonster,butallwithin30ft.
Demand:Assending,plusyoucansendsuggestion.
IrresistibleDance:Forcessubjecttodance.
PowerWordStun:Stunscreaturewith150hporless.
SymbolofInsanityM:Triggeredrunerendersnearbycreaturesinsane.
SympathyF:Objectorlocationattractscertaincreatures.
Evoc:
ClenchedFist:Largehandprovidescover,pushes,orattacksyourfoes.
PolarRay:Rangedtouchattackdeals1d6/levelcolddamage.
Shout,Greater:Devastatingyelldeals10d6sonicdamage;stunscreatures,damagesobjects.
Sunburst:Blindsallwithin10ft.,deals6d6damage.
Illus:
ScintillatingPattern:Twistingcolorsconfuse,stun,orrenderunconscious.
Screen:Illusionhidesareafromvision,scrying.
ShadowEvocation,Greater:Asshadowevocation,butupto7thleveland60%real.
TelekineticSphere:Asresilientsphere,butyoumovespheretelekinetically.
Necro:
CloneMF:Duplicateawakenswhenoriginaldies.
CreateGreaterUndeadM:Createshadows,wraiths,spectres,ordevourers.
HorridWilting:Deals1d6/leveldamagewithin30ft.

Page215of462
SymbolofDeathM:Triggeredruneslaysnearbycreatures.
Trans:
IronBody:Yourbodybecomeslivingiron.
PolymorphAnyObject:Changesanysubjectintoanythingelse.
TemporalStasisM:Putssubjectintosuspendedanimation.

9thLevelSorcerer/WizardSpells
Abjur:
Freedom:Releasescreaturefromimprisonment.
Imprisonment:Entombssubjectbeneaththeearth.
MagesDisjunction:Dispelsmagic,disenchantsmagicitems.
PrismaticSphere:Asprismaticwall,butsurroundsonallsides.
Conj:
GateX:Connectstwoplanesfortravelorsummoning.
RefugeM:Altersitemtotransportitspossessortoyou.
SummonMonsterIX:Callsextraplanarcreaturetofightforyou.
TeleportationCircleM:Circleteleportsanycreatureinsidetodesignatedspot.
Div:
Foresight:Sixthsensewarnsofimpendingdanger.
Ench:
DominateMonster:Asdominateperson,butanycreature.
HoldMonster,Mass:Asholdmonster,butallwithin30ft.
PowerWordKill:Killsonecreaturewith100hporless.
Evoc:
CrushingHand:Largehandprovidescover,pushes,orcrushesyourfoes.
MeteorSwarm:Fourexplodingsphereseachdeal6d6firedamage.
Illus:
Shades:Asshadowconjuration,butupto8thleveland80%real.
Weird:Asphantasmalkiller,butaffectsallwithin30ft.
Necro:
AstralProjectionM:ProjectsyouandcompanionsontoAstralPlane.
EnergyDrain:Subjectgains2d4negativelevels.
SoulBindF:Trapsnewlydeadsoultopreventresurrection.
WailoftheBanshee:Killsonecreature/level.
Trans:
Etherealness:TraveltoEtherealPlanewithcompanions.
ShapechangeF:Transformsyouintoanycreature,andchangeformsonceperround.
TimeStop:Youactfreelyfor1d4+1rounds.
Univ:
WishX:Aslimitedwish,butwithfewerlimits.

Page216of462
Spells
AcidArrow
Conjuration(Creation)[Acid]
Level:Sor/Wiz2
Components:V,S,M,F
CastingTime:1standardaction
Range:Long(400ft.+40ft./level)
Effect:Onearrowofacid
Duration:1round+1roundperthreelevels
SavingThrow:None
SpellResistance:No
Amagicalarrowofacidspringsfromyourhandandspeedstoitstarget.Youmustsucceedonarangedtouchattacktohit
yourtarget.Thearrowdeals2d4pointsofaciddamagewithnosplashdamage.Foreverythreecasterlevels(toa
maximumof18th),theacid,unlesssomehowneutralized,lastsforanotherround,dealinganother2d4pointsofdamagein
thatround.
MaterialComponent:Powderedrhubarbleafandanaddersstomach.
Focus:Adart.

AcidFog
Conjuration(Creation)[Acid]
Level:Sor/Wiz6,Water7
Components:V,S,M/DF
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Effect:Fogspreadsin20ft.radius,20ft.high
Duration:1round/level
SavingThrow:None
SpellResistance:No
Acidfogcreatesabillowingmassofmistyvaporssimilartothatproducedbyasolidfogspell.Inadditiontoslowing
creaturesdownandobscuringsight,thisspellsvaporsarehighlyacidic.Eachroundonyourturn,startingwhenyoucast
thespell,thefogdeals2d6pointsofaciddamagetoeachcreatureandobjectwithinit.
ArcaneMaterialComponent:Apinchofdried,powderedpeascombinedwithpowderedanimalhoof.

AcidSplash
Conjuration(Creation)[Acid]
Level:Sor/Wiz0
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Effect:Onemissileofacid
Duration:Instantaneous
SavingThrow:None
SpellResistance:No

Page217of462
Youfireasmallorbofacidatthetarget.Youmustsucceedonarangedtouchattacktohityourtarget.Theorbdeals1d3
pointsofaciddamage.

Aid
Enchantment(Compulsion)[MindAffecting]
Level:Clr2,Good2,Luck2
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Target:Livingcreaturetouched
Duration:1min./level
SavingThrow:None
SpellResistance:Yes(harmless)
Aidgrantsthetargeta+1moralebonusonattackrollsandsavesagainstfeareffects,plustemporaryhitpointsequalto
1d8+casterlevel(toamaximumof1d8+10temporaryhitpointsatcasterlevel10th).

AirWalk
Transmutation[Air]
Level:Air4,Clr4,Drd4
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Target:Creature(Gargantuanorsmaller)touched
Duration:10min./level
SavingThrow:None
SpellResistance:Yes(harmless)
Thesubjectcantreadonairasifwalkingonsolidground.Movingupwardissimilartowalkingupahill.Themaximum
upwardordownwardanglepossibleis45degrees,atarateequaltoonehalftheairwalkersnormalspeed.
Astrongwind(21+mph)canpushthesubjectalongorholditback.Attheendofitsturneachround,thewindblowsthe
airwalker5feetforeach5milesperhourofwindspeed.Thecreaturemaybesubjecttoadditionalpenaltiesin
exceptionallystrongorturbulentwinds,suchaslossofcontrolovermovementorphysicaldamagefrombeingbuffeted
about.
Shouldthespelldurationexpirewhilethesubjectisstillaloft,themagicfailsslowly.Thesubjectfloatsdownward60feet
perroundfor1d6rounds.Ifitreachesthegroundinthatamountoftime,itlandssafely.Ifnot,itfallstherestofthe
distance,taking1d6pointsofdamageper10feetoffall.Sincedispellingaspelleffectivelyendsit,thesubjectalso
descendsinthiswayiftheairwalkspellisdispelled,butnotifitisnegatedbyanantimagicfield.
Youcancastairwalkonaspeciallytrainedmountsoitcanberiddenthroughtheair.Youcantrainamounttomovewith
theaidofairwalk(countsasatrick;seeHandleAnimalskill)withoneweekofworkandaDC25HandleAnimalcheck.

Alarm
Abjuration
Level:Brd1,Rgr1,Sor/Wiz1
Components:V,S,F/DF
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Area:20ft.radiusemanationcenteredonapointinspace
Page218of462
Duration:2hours/level(D)
SavingThrow:None
SpellResistance:No
AlarmsoundsamentaloraudiblealarmeachtimeacreatureofTinyorlargersizeentersthewardedareaortouchesit.A
creaturethatspeaksthepassword(determinedbyyouatthetimeofcasting)doesnotsetoffthealarm.Youdecideatthe
timeofcastingwhetherthealarmwillbementaloraudible.
MentalAlarm:Amentalalarmalertsyou(andonlyyou)solongasyouremainwithin1mileofthewardedarea.Younote
asinglementalpingthatawakensyoufromnormalsleepbutdoesnototherwisedisturbconcentration.Asilencespellhas
noeffectonamentalalarm.
AudibleAlarm:Anaudiblealarmproducesthesoundofahandbell,andanyonewithin60feetofthewardedareacanhear
itclearly.Reducethedistanceby10feetforeachinterposingcloseddoorandby20feetforeachsubstantialinterposing
wall.
Inquietconditions,theringingcanbeheardfaintlyasfaras180feetaway.Thesoundlastsfor1round.Creatureswithina
silencespellcannotheartheringing.
Etherealorastralcreaturesdonottriggerthealarm.
Alarmcanbemadepermanentwithapermanencyspell.
ArcaneFocus:Atinybellandapieceofveryfinesilverwire

AlignWeapon
Transmutation[seetext]
Level:Clr2
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Target:Weapontouchedorfiftyprojectiles(allofwhichmustbeincontactwitheachotheratthetimeofcasting)
Duration:1min./level
SavingThrow:Willnegates(harmless,object)
SpellResistance:Yes(harmless,object)
Alignweaponmakesaweapongood,evil,lawful,orchaotic,asyouchoose.Aweaponthatisalignedcanbypassthe
damagereductionofcertaincreatures.Thisspellhasnoeffectonaweaponthatalreadyhasanalignment.
Youcantcastthisspellonanaturalweapon,suchasanunarmedstrike.
Whenyoumakeaweapongood,evil,lawful,orchaotic,alignweaponisagood,evil,lawful,orchaoticspell,respectively.

AlterSelf
Transmutation
Level:Brd2,Sor/Wiz2
Components:V,S
CastingTime:1standardaction
Range:Personal
Target:You
Duration:10min./level(D)
Youassumetheformofacreatureofthesametypeasyournormalform.Thenewformmustbewithinonesizecategoryof
yournormalsize.ThemaximumHDofanassumedformisequaltoyourcasterlevel,toamaximumof5HDat5thlevel.
Youcanchangeintoamemberofyourownkindorevenintoyourself.

Page219of462
Youretainyourownabilityscores.Yourclassandlevel,hitpoints,alignment,baseattackbonus,andbasesavebonusesall
remainthesame.Youretainallsupernaturalandspelllikespecialattacksandqualitiesofyournormalform,exceptfor
thoserequiringabodypartthatthenewformdoesnothave(suchasamouthforabreathweaponoreyesforagaze
attack).
Youkeepallextraordinaryspecialattacksandqualitiesderivedfromclasslevels,butyouloseanyfromyournormalform
thatarenotderivedfromclasslevels.
Ifthenewformiscapableofspeech,youcancommunicatenormally.Youretainanyspellcastingabilityyouhadinyour
originalform,butthenewformmustbeabletospeakintelligibly(thatis,speakalanguage)touseverbalcomponentsand
musthavelimbscapableoffinemanipulationtousesomaticormaterialcomponents.
Youacquirethephysicalqualitiesofthenewformwhileretainingyourownmind.Physicalqualitiesincludenaturalsize,
mundanemovementcapabilities(suchasburrowing,climbing,walking,swimming,andflightwithwings,toamaximum
speedof120feetforflyingor60feetfornonflyingmovement),naturalarmorbonus,naturalweapons(suchasclaws,bite,
andsoon),racialskillbonuses,racialbonusfeats,andanygrossphysicalqualities(presenceorabsenceofwings,number
ofextremities,andsoforth).Abodywithextralimbsdoesnotallowyoutomakemoreattacks(ormoreadvantageoustwo
weaponattacks)thannormal.
Youdonotgainanyextraordinaryspecialattacksorspecialqualitiesnotnotedaboveunderphysicalqualities,suchas
darkvision,lowlightvision,blindsense,blindsight,fasthealing,regeneration,scent,andsoforth.
Youdonotgainanysupernaturalspecialattacks,specialqualities,orspelllikeabilitiesofthenewform.Yourcreaturetype
andsubtype(ifany)remainthesameregardlessofyournewform.Youcannottaketheformofanycreaturewitha
template,evenifthattemplatedoesntchangethecreaturetypeorsubtype.
Youcanfreelydesignatethenewformsminorphysicalqualities(suchashaircolor,hairtexture,andskincolor)withinthe
normalrangesforacreatureofthatkind.Thenewformssignificantphysicalqualities(suchasheight,weight,andgender)
arealsounderyourcontrol,buttheymustfallwithinthenormsforthenewformskind.Youareeffectivelydisguisedasan
averagememberofthenewformsrace.Ifyouusethisspelltocreateadisguise,yougeta+10bonusonyourDisguise
check.
Whenthechangeoccurs,yourequipment,ifany,eitherremainswornorheldbythenewform(ifitiscapableofwearingor
holdingtheitem),ormeldsintothenewformandbecomesnonfunctional.Whenyoureverttoyourtrueform,anyobjects
previouslymeldedintothenewformreappearinthesamelocationonyourbodytheypreviouslyoccupiedandareonce
againfunctional.Anynewitemsyouworeintheassumedformandcantwearinyournormalformfalloffandlandatyour
feet;anythatyoucouldwearineitherformorcarryinabodypartcommontobothformsatthetimeofreversionarestill
heldinthesameway.Anypartofthebodyorpieceofequipmentthatisseparatedfromthewholerevertstoitstrueform.

AnalyzeDweomer
Divination
Level:Brd6,Sor/Wiz6
Components:V,S,F
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:Oneobjectorcreaturepercasterlevel
Duration:1round/level(D)
SavingThrow:NoneorWillnegates;seetext
SpellResistance:No
Youdiscernallspellsandmagicalpropertiespresentinanumberofcreaturesorobjects.Eachround,youmayexaminea
singlecreatureorobjectthatyoucanseeasafreeaction.Inthecaseofamagicitem,youlearnitsfunctions,howto
activateitsfunctions(ifappropriate),andhowmanychargesareleft(ifitusescharges).Inthecaseofanobjectorcreature
withactivespellscastuponit,youlearneachspell,itseffect,anditscasterlevel.
AnattendedobjectmayattemptaWillsavetoresistthiseffectifitsholdersodesires.Ifthesavesucceeds,youlearn
nothingabouttheobjectexceptwhatyoucandiscernbylookingatit.Anobjectthatmakesitssavecannotbeaffectedby
anyotheranalyzedweomerspellsfor24hours.

Page220of462
Analyzedweomerdoesnotfunctionwhenusedonanartifact.
Focus:Atinylensofrubyorsapphiresetinasmallgoldenloop.Thegemstonemustbeworthatleast1,500gp.

AnimalGrowth
Transmutation
Level:Drd5,Rgr4,Sor/Wiz5
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Targets:Uptooneanimal(Gargantuanorsmaller)pertwolevels,notwoofwhichcanbemorethan30ft.apart
Duration:1min./level
SavingThrow:Fortitudenegates
SpellResistance:Yes
Anumberofanimalsgrowtotwicetheirnormalsizeandeighttimestheirnormalweight.Thisalterationchangeseach
animalssizecategorytothenextlargest,grantsita+8sizebonustoStrengthanda+4sizebonustoConstitution(and
thusanextra2hitpointsperHD),andimposesa2sizepenaltytoDexterity.Thecreaturesexistingnaturalarmorbonus
increasesby2.ThesizechangealsoaffectstheanimalsmodifiertoACandattackrollsanditsbasedamage.Theanimals
spaceandreachchangeasappropriatetothenewsize,butitsspeeddoesnotchange.
Thespellalsograntseachsubjectdamagereduction10/magicanda+4resistancebonusonsavingthrows.Ifinsufficient
roomisavailableforthedesiredgrowth,thecreatureattainsthemaximumpossiblesizeandmaymakeaStrengthcheck
(usingitsincreasedStrength)toburstanyenclosuresintheprocess.Ifitfails,itisconstrainedwithoutharmbythe
materialsenclosingitthespellcannotbeusedtocrushacreaturebyincreasingitssize.
Allequipmentwornorcarriedbyananimalissimilarlyenlargedbythespell,thoughthischangehasnoeffectonthe
magicalpropertiesofanysuchequipment.
Anyenlargeditemthatleavestheenlargedcreaturespossessioninstantlyreturnstoitsnormalsize.
Thespellgivesnomeansofcommandorinfluenceovertheenlargedanimals.
Multiplemagicaleffectsthatincreasesizedonotstack.

AnimalMessenger
Enchantment(Compulsion)[MindAffecting]
Level:Brd2,Drd2,Rgr1
Components:V,S,M
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:OneTinyanimal
Duration:Oneday/level
SavingThrow:None;seetext
SpellResistance:Yes
YoucompelaTinyanimaltogotoaspotyoudesignate.Themostcommonuseforthisspellistogetananimaltocarrya
messagetoyourallies.Theanimalcannotbeonetamedortrainedbysomeoneelse,includingsuchcreaturesasfamiliars
andanimalcompanions.
Usingsometypeoffooddesirabletotheanimalasalure,youcalltheanimaltoyou.Itadvancesandawaitsyourbidding.
Youcanmentallyimpressontheanimalacertainplacewellknowntoyouoranobviouslandmark.Thedirectionsmustbe
simple,becausetheanimaldependsonyourknowledgeandcantfindadestinationonitsown.Youcanattachsomesmall
itemornotetothemessenger.Theanimalthengoestothedesignatedlocationandwaitsthereuntilthedurationofthe
spellexpires,whereuponitresumesitsnormalactivities.

Page221of462
Duringthisperiodofwaiting,themessengerallowsotherstoapproachitandremoveanyscrollortokenitcarries.The
intendedrecipientgainsnospecialabilitytocommunicatewiththeanimalorreadanyattachedmessage(ifitswrittenina
languageheorshedoesntknow,forexample).
MaterialComponent:Amorseloffoodtheanimallikes.

AnimalShapes
Transmutation
Level:Animal7,Drd8
Components:V,S,DF
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:Uptoonewillingcreatureperlevel,allwithin30ft.ofeachother
Duration:1hour/level(D)
SavingThrow:None;seetext
SpellResistance:Yes(harmless)
Aspolymorph,exceptyoupolymorphuptoonewillingcreaturepercasterlevelintoananimalofyourchoice;thespellhas
noeffectonunwillingcreatures.Allcreaturesmusttakethesamekindofanimalform.Recipientsremainintheanimal
formuntilthespellexpiresoruntilyoudismissitforallrecipients.Inaddition,anindividualsubjectmaychoosetoresume
itsnormalformasafullroundaction;doingsoendsthespellforthatsubjectalone.ThemaximumHDofanassumedform
isequaltothesubjectsHDoryourcasterlevel,whicheverislower,toamaximumof20HDat20thlevel.

AnimalTrance
Enchantment(Compulsion)[MindAffecting,Sonic]
Level:Brd2,Drd2
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:AnimalsormagicalbeastswithIntelligence1or2
Duration:Concentration
SavingThrow:Willnegates;seetext
SpellResistance:Yes
Yourswayingmotionsandmusic(orsinging,orchanting)compelanimalsandmagicalbeaststodonothingbutwatchyou.
OnlyacreaturewithanIntelligencescoreof1or2canbefascinatedbythisspell.Roll2d6todeterminethetotalnumber
ofHDworthofcreaturesthatyoufascinate.Theclosesttargetsareselectedfirstuntilnomoretargetswithinrangecanbe
affected.
Amagicalbeast,adireanimal,orananimaltrainedtoattackorguardisallowedasavingthrow;ananimalnottrainedto
attackorguardisnot.

AnimateDead
Necromancy[Evil]
Level:Clr3,Death3,Sor/Wiz4
Components:V,S,M
CastingTime:1standardaction
Range:Touch
Targets:Oneormorecorpsestouched
Duration:Instantaneous
Page222of462
SavingThrow:None
SpellResistance:No
Thisspellturnsthebonesorbodiesofdeadcreaturesintoundeadskeletonsorzombiesthatfollowyourspokencommands.
Theundeadcanfollowyou,ortheycanremaininanareaandattackanycreature(orjustaspecifickindofcreature)
enteringtheplace.Theyremainanimateduntiltheyaredestroyed.(Adestroyedskeletonorzombiecantbeanimated
again.)
Regardlessofthetypeofundeadyoucreatewiththisspell,youcantcreatemoreHDofundeadthantwiceyourcasterlevel
withasinglecastingofanimatedead.(Thedesecratespelldoublesthislimit)
Theundeadyoucreateremainunderyourcontrolindefinitely.Nomatterhowmanytimesyouusethisspell,however,you
cancontrolonly4HDworthofundeadcreaturespercasterlevel.Ifyouexceedthisnumber,allthenewlycreatedcreatures
fallunderyourcontrol,andanyexcessundeadfrompreviouscastingsbecomeuncontrolled.(Youchoosewhichcreatures
arereleased.)Ifyouareacleric,anyundeadyoumightcommandbyvirtueofyourpowertocommandorrebukeundead
donotcounttowardthelimit.
Skeletons:Askeletoncanbecreatedonlyfromamostlyintactcorpseorskeleton.Thecorpsemusthavebones.Ifaskeleton
ismadefromacorpse,thefleshfallsoffthebones.
Zombies:Azombiecanbecreatedonlyfromamostlyintactcorpse.Thecorpsemustbethatofacreaturewithatrue
anatomy.
MaterialComponent:Youmustplaceablackonyxgemworthatleast25gpperHitDieoftheundeadintothemouthor
eyesocketofeachcorpseyouintendtoanimate.Themagicofthespellturnsthesegemsintoworthless,burnedoutshells.

AnimateObjects
Transmutation
Level:Brd6,Chaos6,Clr6
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Targets:OneSmallobjectpercasterlevel;seetext
Duration:1round/level
SavingThrow:None
SpellResistance:No
Youimbueinanimateobjectswithmobilityandasemblanceoflife.Eachsuchanimatedobjectthenimmediatelyattacks
whomeverorwhateveryouinitiallydesignate.
Ananimatedobjectcanbeofanynonmagicalmaterial.YoumayanimateoneSmallorsmallerobjectoranequivalent
numberoflargerobjectspercasterlevel.AMediumobjectcountsastwoSmallorsmallerobjects,aLargeobjectasfour,a
Hugeobjectaseight,aGargantuanobjectassixteen,andaColossalobjectasthirtytwo.Youcanchangethedesignated
targetortargetsasamoveaction,asifdirectinganactivespell.
Thisspellcannotanimateobjectscarriedorwornbyacreature.
Animateobjectscanbemadepermanentwithapermanencyspell.

AnimatePlants
Transmutation
Level:Drd7,Plant7
Components:V
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:OneLargeplantperthreecasterlevelsorallplantswithinrange;seetext

Page223of462
Duration:1round/levelor1hour/level;seetext
SavingThrow:None
SpellResistance:No
Youimbueinanimateplantswithmobilityandasemblanceoflife.Eachanimatedplantthenimmediatelyattacks
whomeverorwhateveryouinitiallydesignateasthoughitwereananimatedobjectoftheappropriatesizecategory.You
mayanimateoneLargeorsmallerplant,oranequivalentnumberoflargerplants,perthreecasterlevels.AHugeplant
countsastwoLargeorsmallerplants,aGargantuanplantasfour,andaColossalplantaseight.Youcanchangethe
designatedtargetortargetsasamoveaction,asifdirectinganactivespell.
Usethestatisticsforanimatedobjects,exceptthatplantssmallerthanLargeusuallydonthavehardness.
Animateplantscannotaffectplantcreatures,nordoesitaffectnonlivingvegetablematerial.
Entangle:Alternatively,youmayimbueallplantswithinrangewithadegreeofmobility,whichallowsthemtoentwine
aroundcreaturesinthearea.Thisusageofthespellduplicatestheeffectofanentanglespell.Spellresistancedoesnotkeep
creaturesfrombeingentangled.Thiseffectlasts1hourpercasterlevel.

AnimateRope
Transmutation
Level:Brd1,Sor/Wiz1
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Target:Oneropelikeobject,lengthupto50ft.+5ft./level;seetext
Duration:1round/level
SavingThrow:None
SpellResistance:No
Youcananimateanonlivingropelikeobject.Themaximumlengthassumesaropewitha1inchdiameter.
Reducethemaximumlengthby50%foreveryadditionalinchofthickness,andincreaseitby50%foreachreductionofthe
ropesdiameterbyhalf.
Thepossiblecommandsarecoil(formaneat,coiledstack),coilandknot,loop,loopandknot,tieandknot,and
theoppositesofalloftheabove(uncoil,andsoforth).Youcangiveonecommandeachroundasamoveaction,asif
directinganactivespell.
Theropecanenwraponlyacreatureoranobjectwithin1footofititdoesnotsnakeoutwardsoitmustbethrownnear
theintendedtarget.Doingsorequiresasuccessfulrangedtouchattackroll(rangeincrement10feet).Atypical1inch
diameterhempenropehas2hitpoints,AC10,andrequiresaDC23Strengthchecktoburstit.Theropedoesnotdeal
damage,butitcanbeusedasatriplineortocauseasingleopponentthatfailsaReflexsavingthrowtobecomeentangled.
AcreaturecapableofspellcastingthatisboundbythisspellmustmakeaDC15Concentrationchecktocastaspell.An
entangledcreaturecanslipfreewithaDC20EscapeArtistcheck.
Theropeitselfandanyknotstiedinitarenotmagical.
Thisspellgrantsa+2bonusonanyUseRopechecksyoumakewhenusingthetransmutedrope.
Thespellcannotanimateobjectscarriedorwornbyacreature.

AntilifeShell
Abjuration
Level:Animal6,Clr6,Drd6
Components:V,S,DF
CastingTime:1round
Range:10ft.

Page224of462
Area:10ft.radiusemanation,centeredonyou
Duration:10min./level(D)
SavingThrow:None
SpellResistance:Yes
Youbringintobeingamobile,hemisphericalenergyfieldthatpreventstheentranceofmosttypesoflivingcreatures.
Theeffecthedgesoutanimals,aberrations,dragons,fey,giants,humanoids,magicalbeasts,monstroushumanoids,oozes,
plants,andvermin,butnotconstructs,elementals,outsiders,orundead.
Thisspellmaybeusedonlydefensively,notaggressively.Forcinganabjurationbarrieragainstcreaturesthatthespellkeeps
atbaycollapsesthebarrier.

AntimagicField
Abjuration
Level:Clr8,Magic6,Protection6,Sor/Wiz6
Components:V,S,M/DF
CastingTime:1standardaction
Range:10ft.
Area:10ft.radiusemanation,centeredonyou
Duration:10min./level(D)
SavingThrow:None
SpellResistance:Seetext
Aninvisiblebarriersurroundsyouandmoveswithyou.Thespacewithinthisbarrierisimpervioustomostmagicaleffects,
includingspells,spelllikeabilities,andsupernaturalabilities.Likewise,itpreventsthefunctioningofanymagicitemsor
spellswithinitsconfines.
Anantimagicfieldsuppressesanyspellormagicaleffectusedwithin,broughtinto,orcastintothearea,butdoesnotdispel
it.Timespentwithinanantimagicfieldcountsagainstthesuppressedspellsduration.
Summonedcreaturesofanytypeandincorporealundeadwinkoutiftheyenteranantimagicfield.Theyreappearinthe
samespotoncethefieldgoesaway.Timespentwinkedoutcountsnormallyagainstthedurationoftheconjurationthatis
maintainingthecreature.Ifyoucastantimagicfieldinanareaoccupiedbyasummonedcreaturethathasspellresistance,
youmustmakeacasterlevelcheck(1d20+casterlevel)againstthecreaturesspellresistancetomakeitwinkout.(The
effectsofinstantaneousconjurationsarenotaffectedbyanantimagicfieldbecausetheconjurationitselfisnolongerin
effect,onlyitsresult.)
Anormalcreaturecanenterthearea,ascannormalmissiles.Furthermore,whileamagicsworddoesnotfunction
magicallywithinthearea,itisstillasword(andamasterworkswordatthat).Thespellhasnoeffectongolemsandother
constructsthatareimbuedwithmagicduringtheircreationprocessandarethereafterselfsupporting(unlesstheyhave
beensummoned,inwhichcasetheyaretreatedlikeanyothersummonedcreatures).Elementals,corporealundead,and
outsidersarelikewiseunaffectedunlesssummoned.Thesecreaturesspelllikeorsupernaturalabilities,however,maybe
temporarilynullifiedbythefield.Dispelmagicdoesnotremovethefield.
Twoormoreantimagicfieldssharinganyofthesamespacehavenoeffectoneachother.Certainspells,suchaswallof
force,prismaticsphere,andprismaticwall,remainunaffectedbyantimagicfield(seetheindividualspelldescriptions).
Artifactsanddeitiesareunaffectedbymortalmagicsuchasthis.
Shouldacreaturebelargerthantheareaenclosedbythebarrier,anypartofitthatliesoutsidethebarrierisunaffectedby
thefield.
ArcaneMaterialComponent:Apinchofpowderedironorironfilings.

Antipathy
Enchantment(Compulsion)[MindAffecting]
Level:Drd9,Sor/Wiz8

Page225of462
Components:V,S,M/DF
CastingTime:1hour
Range:Close(25ft.+5ft./2levels)
Target:Onelocation(uptoa10ft.cube/level)oroneobject
Duration:2hours/level(D)
SavingThrow:Willpartial
SpellResistance:Yes
Youcauseanobjectorlocationtoemanatemagicalvibrationsthatrepeleitheraspecifickindofintelligentcreatureor
creaturesofaparticularalignment,asdefinedbyyou.Thekindofcreaturetobeaffectedmustbenamedspecifically.A
creaturesubtypeisnotspecificenough.Likewise,thespecificalignmenttoberepelledmustbenamed.
Creaturesofthedesignatedkindoralignmentfeelanoverpoweringurgetoleavetheareaortoavoidtheaffecteditem.
Acompulsionforcesthemtoabandontheareaoritem,shunningitandneverwillinglyreturningtoitwhilethespellisin
effect.Acreaturethatmakesasuccessfulsavingthrowcanstayintheareaortouchtheitembutfeelsuncomfortabledoing
so.ThisdistractingdiscomfortreducesthecreaturesDexterityscoreby4points.
Antipathycountersanddispelssympathy.
ArcaneMaterialComponent:Alumpofalumsoakedinvinegar.

AntiplantShell
Abjuration
Level:Drd4
Components:V,S,DF
CastingTime:1standardaction
Range:10ft.
Area:10ft.radiusemanation,centeredonyou
Duration:10min./level(D)
SavingThrow:None
SpellResistance:Yes
Theantiplantshellspellcreatesaninvisible,mobilebarrierthatkeepsallcreatureswithintheshellprotectedfromattacks
byplantcreaturesoranimatedplants.Aswithmanyabjurationspells,forcingthebarrieragainstcreaturesthatthespell
keepsatbaystrainsandcollapsesthefield.

ArcaneEye
Divination(Scrying)
Level:Sor/Wiz4
Components:V,S,M
CastingTime:10minutes
Range:Unlimited
Effect:Magicalsensor
Duration:1min./level(D)
SavingThrow:None
SpellResistance:No
Youcreateaninvisiblemagicalsensorthatsendsyouvisualinformation.Youcancreatethearcaneeyeatanypointyoucan
see,butitcanthentraveloutsideyourlineofsightwithouthindrance.Anarcaneeyetravelsat30feetperround(300feet
perminute)ifviewinganareaaheadasahumanwould(primarilylookingatthefloor)or10feetperround(100feetper

Page226of462
minute)ifexaminingtheceilingandwallsaswellasthefloorahead.Itseesexactlyasyouwouldseeifyouwerethere.
Theeyecantravelinanydirectionaslongasthespelllasts.Solidbarriersblockitspassage,butitcanpassthroughahole
orspaceassmallas1inchindiameter.Theeyecantenteranotherplaneofexistence,eventhroughagateorsimilar
magicalportal.
Youmustconcentratetouseanarcaneeye.Ifyoudonotconcentrate,theeyeisinertuntilyouagainconcentrate.
MaterialComponent:Abitofbatfur.

ArcaneLock
Abjuration
Level:Sor/Wiz2
Components:V,S,M
CastingTime:1standardaction
Range:Touch
Target:Thedoor,chest,orportaltouched,upto30sq.ft./levelinsize
Duration:Permanent
SavingThrow:None
SpellResistance:No
Anarcanelockspellcastuponadoor,chest,orportalmagicallylocksit.Youcanfreelypassyourownarcanelockwithout
affectingit;otherwise,adoororobjectsecuredwiththisspellcanbeopenedonlybybreakinginorwithasuccessfuldispel
magicorknockspell.Add10tothenormalDCtobreakopenadoororportalaffectedbythisspell.(Aknockspelldoesnot
removeanarcanelock;itonlysuppressestheeffectfor10minutes.)
MaterialComponent:Golddustworth25gp.

ArcaneMark
Universal
Level:Sor/Wiz0
Components:V,S
CastingTime:1standardaction
Range:0ft.
Effect:Onepersonalruneormark,allofwhichmustfitwithin1sq.ft.
Duration:Permanent
SavingThrow:None
SpellResistance:No
Thisspellallowsyoutoinscribeyourpersonalruneormark,whichcanconsistofnomorethansixcharacters.Thewriting
canbevisibleorinvisible.Anarcanemarkspellenablesyoutoetchtheruneuponanysubstancewithoutharmtothe
materialuponwhichitisplaced.Ifaninvisiblemarkismade,adetectmagicspellcausesittoglowandbevisible,though
notnecessarilyunderstandable.
Seeinvisibility,trueseeing,agemofseeing,orarobeofeyeslikewiseallowstheusertoseeaninvisiblearcanemark.A
readmagicspellrevealsthewords,ifany.Themarkcannotbedispelled,butitcanberemovedbythecasterorbyanerase
spell.
Ifanarcanemarkisplacedonalivingbeing,normalweargraduallycausestheeffecttofadeinaboutamonth.
Arcanemarkmustbecastonanobjectpriortocastinginstantsummonsonthesameobject(seethatspelldescriptionfor
details).

ArcaneSight
Divination

Page227of462
Level:Sor/Wiz3
Components:V,S
CastingTime:1standardaction
Range:Personal
Target:You
Duration:1min./level(D)
Thisspellmakesyoureyesglowblueandallowsyoutoseemagicalauraswithin120feetofyou.Theeffectissimilarto
thatofadetectmagicspell,butarcanesightdoesnotrequireconcentrationanddiscernsauralocationandpowermore
quickly.
Youknowthelocationandpowerofallmagicalauraswithinyoursight.Anauraspowerdependsonaspellsfunctioning
leveloranitemscasterlevel,asnotedinthedescriptionofthedetectmagicspell.Iftheitemsorcreaturesbearingthe
aurasareinlineofsight,youcanmakeSpellcraftskillcheckstodeterminetheschoolofmagicinvolvedineach.(Makeone
checkperaura;DC15+spelllevel,or15+onehalfcasterlevelforanonspelleffect.)
Ifyouconcentrateonaspecificcreaturewithin120feetofyouasastandardaction,youcandeterminewhetherithasany
spellcastingorspelllikeabilities,whetherthesearearcaneordivine(spelllikeabilitiesregisterasarcane),andthestrength
ofthemostpowerfulspellorspelllikeabilitythecreaturecurrentlyhasavailableforuse.
Arcanesightcanbemadepermanentwithapermanencyspell.

ArcaneSight,Greater
Divination
Level:Sor/Wiz7
Thisspellfunctionslikearcanesight,exceptthatyouautomaticallyknowwhichspellsormagicaleffectsareactiveupon
anyindividualorobjectyousee.
Greaterarcanesightdoesntletyouidentifymagicitems.
Unlikearcanesight,thisspellcannotbemadepermanentwithapermanencyspell.

AstralProjection
Necromancy
Level:Clr9,Sor/Wiz9,Travel9
Components:V,S,M
CastingTime:30minutes
Range:Touch
Targets:Youplusoneadditionalwillingcreaturetouchedpertwocasterlevels
Duration:Seetext
SavingThrow:None
SpellResistance:Yes
Byfreeingyourspiritfromyourphysicalbody,thisspellallowsyoutoprojectanastralbodyontoanotherplanealtogether.
Youcanbringtheastralformsofotherwillingcreatureswithyou,providedthatthesesubjectsarelinkedinacirclewith
youatthetimeofthecasting.Thesefellowtravelersaredependentuponyouandmustaccompanyyouatalltimes.If
somethinghappenstoyouduringthejourney,yourcompanionsarestrandedwhereveryouleftthem.
YouprojectyourastralselfontotheAstralPlane,leavingyourphysicalbodybehindontheMaterialPlaneinastateof
suspendedanimation.ThespellprojectsanastralcopyofyouandallyouwearorcarryontotheAstralPlane.Sincethe
AstralPlanetouchesuponotherplanes,youcantravelastrallytoanyoftheseotherplanesasyouwill.Toenterone,you
leavetheAstralPlane,forminganewphysicalbody(andequipment)ontheplaneofexistenceyouhavechosentoenter.
WhileyouareontheAstralPlane,yourastralbodyisconnectedatalltimestoyourphysicalbodybyasilverycord.Ifthe
cordisbroken,youarekilled,astrallyandphysically.Luckily,veryfewthingscandestroyasilvercord.Whenasecondbody

Page228of462
isformedonadifferentplane,theincorporealsilverycordremainsinvisiblyattachedtothenewbody.Ifthesecondbody
ortheastralformisslain,thecordsimplyreturnstoyourbodywhereitrestsontheMaterialPlane,therebyrevivingitfrom
itsstateofsuspendedanimation.AlthoughastralprojectionsareabletofunctionontheAstralPlane,theiractionsaffect
onlycreaturesexistingontheAstralPlane;aphysicalbodymustbematerializedonotherplanes.
YouandyourcompanionsmaytravelthroughtheAstralPlaneindefinitely.Yourbodiessimplywaitbehindinastateof
suspendedanimationuntilyouchoosetoreturnyourspiritstothem.Thespelllastsuntilyoudesiretoendit,oruntilitis
terminatedbysomeoutsidemeans,suchasdispelmagiccastuponeitherthephysicalbodyortheastralform,thebreaking
ofthesilvercord,orthedestructionofyourbodybackontheMaterialPlane(whichkillsyou).
MaterialComponent:Ajacinthworthatleast1,000gp,plusasilverbarworth5gpforeachpersontobeaffected.

Atonement
Abjuration
Level:Clr5,Drd5
Components:V,S,M,F,DF,XP
CastingTime:1hour
Range:Touch
Target:Livingcreaturetouched
Duration:Instantaneous
SavingThrow:None
SpellResistance:Yes
Thisspellremovestheburdenofevilactsormisdeedsfromthesubject.Thecreatureseekingatonementmustbetruly
repentantanddesirousofsettingrightitsmisdeeds.Iftheatoningcreaturecommittedtheevilactunwittinglyorunder
someformofcompulsion,atonementoperatesnormallyatnocosttoyou.However,inthecaseofacreatureatoningfor
deliberatemisdeedsandactsofaknowingandwillfulnature,youmustintercedewithyourdeity(requiringyoutoexpend
500XP)inordertoexpungethesubjectsburden.Manycastersfirstassignasubjectofthissortaquest(seegeas/quest)or
similarpenancetodeterminewhetherthecreatureistrulycontritebeforecastingtheatonementspellonitsbehalf.
Atonementmaybecastforoneofseveralpurposes,dependingontheversionselected.
ReverseMagicalAlignmentChange:Ifacreaturehashaditsalignmentmagicallychanged,atonementreturnsitsalignment
toitsoriginalstatusatnocostinexperiencepoints.
RestoreClass:Apaladinwhohaslostherclassfeaturesduetocommittinganevilactmayhaveherpaladinhoodrestoredto
herbythisspell.
RestoreClericorDruidSpellPowers:Aclericordruidwhohaslosttheabilitytocastspellsbyincurringtheangerofhisor
herdeitymayregainthatabilitybyseekingatonementfromanotherclericofthesamedeityoranotherdruid.Ifthe
transgressionwasintentional,thecastingclericloses500XPforhisintercession.Ifthetransgressionwasunintentional,he
doesnotloseXP.
RedemptionorTemptation:Youmaycastthisspelluponacreatureofanopposingalignmentinordertoofferitachanceto
changeitsalignmenttomatchyours.Theprospectivesubjectmustbepresentfortheentirecastingprocess.Upon
completionofthespell,thesubjectfreelychooseswhetheritretainsitsoriginalalignmentoracquiescestoyourofferand
changestoyouralignment.Noduress,compulsion,ormagicalinfluencecanforcethesubjecttotakeadvantageofthe
opportunityofferedifitisunwillingtoabandonitsoldalignment.Thisuseofthespelldoesnotworkonoutsidersorany
creatureincapableofchangingitsalignmentnaturally.
Thoughthespelldescriptionreferstoevilacts,atonementcanalsobeusedonanycreaturethathasperformedactsagainst
itsalignment,whetherthoseactsareevil,good,chaotic,orlawful.
Note:Normally,changingalignmentisuptotheplayer.Thisuseofatonementsimplyoffersabelievablewayforacharacter
tochangehisorheralignmentdrastically,suddenly,anddefinitively.
MaterialComponent:Burningincense.
Focus:Inadditiontoyourholysymbolornormaldivinefocus,youneedasetofprayerbeads(orotherprayerdevice,such
asaprayerwheelorprayerbook)worthatleast500gp.

Page229of462
XPCost:Whencastforthebenefitofacreaturewhoseguiltwastheresultofdeliberateacts,thecosttoyouis500XPper
casting(seeabove).

Augury
Divination
Level:Clr2
Components:V,S,M,F
CastingTime:1minute
Range:Personal
Target:You
Duration:Instantaneous
Anaugurycantellyouwhetheraparticularactionwillbringgoodorbadresultsforyouintheimmediatefuture.
Thebasechanceforreceivingameaningfulreplyis70%+1%percasterlevel,toamaximumof90%;thisrollismade
secretly.Aquestionmaybesostraightforwardthatasuccessfulresultisautomatic,orsovagueastohavenochanceof
success.Iftheaugurysucceeds,yougetoneoffourresults:
Weal(iftheactionwillprobablybringgoodresults).
Woe(forbadresults).
Wealandwoe(forboth).
Nothing(foractionsthatdonthaveespeciallygoodorbadresults).
Ifthespellfails,yougetthenothingresult.Aclericwhogetsthenothingresulthasnowaytotellwhetheritwasthe
consequenceofafailedorsuccessfulaugury.
Theaugurycanseeintothefutureonlyabouthalfanhour,soanythingthatmighthappenafterthatdoesnotaffectthe
result.Thus,theresultmightnottakeintoaccountthelongtermconsequencesofacontemplatedaction.Allauguriescast
bythesamepersonaboutthesametopicusethesamediceresultasthefirstcasting.
MaterialComponent:Incenseworthatleast25gp.
Focus:Asetofmarkedsticks,bones,orsimilartokensofatleast25gpvalue.

Awaken
Transmutation
Level:Drd5
Components:V,S,DF,XP
CastingTime:24hours
Range:Touch
Target:Animalortreetouched
Duration:Instantaneous
SavingThrow:Willnegates
SpellResistance:Yes
Youawakenatreeoranimaltohumanlikesentience.Tosucceed,youmustmakeaWillsave(DC10+theanimalscurrent
HD,ortheHDthetreewillhaveonceawakened).
Theawakenedanimalortreeisfriendlytowardyou.Youhavenospecialempathyorconnectionwithacreatureyou
awaken,althoughitservesyouinspecifictasksorendeavorsifyoucommunicateyourdesirestoit.
Anawakenedtreehascharacteristicsasifitwereananimatedobject,exceptthatitgainstheplanttypeanditsIntelligence,
Wisdom,andCharismascoresareeach3d6.Anawakenedplantgainstheabilitytomoveitslimbs,roots,vines,creepers,
andsoforth,andithassensessimilartoahumans.

Page230of462
Anawakenedanimalgets3d6Intelligence,+1d3Charisma,and+2HD.Itstypebecomesmagicalbeast(augmented
animal).Anawakenedanimalcantserveasananimalcompanion,familiar,orspecialmount.
Anawakenedtreeoranimalcanspeakonelanguagethatyouknow,plusoneadditionallanguagethatyouknowperpoint
ofIntelligencebonus(ifany).
XPCost:250XP.

BalefulPolymorph
Transmutation
Level:Drd5,Sor/Wiz5
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:Onecreature
Duration:Permanent
SavingThrow:Fortitudenegates,Willpartial;seetext
SpellResistance:Yes
Aspolymorph,exceptthatyouchangethesubjectintoaSmallorsmalleranimalofnomorethan1HD.Ifthenewform
wouldprovefataltothecreaturethesubjectgetsa+4bonusonthesave.
Ifthespellsucceeds,thesubjectmustalsomakeaWillsave.Ifthissecondsavefails,thecreaturelosesitsextraordinary,
supernatural,andspelllikeabilities,losesitsabilitytocastspells(ifithadtheability),andgainsthealignment,special
abilities,andIntelligence,Wisdom,andCharismascoresofitsnewforminplaceofitsown.Itstillretainsitsclassandlevel
(orHD),aswellasallbenefitsderivingtherefrom(suchasbaseattackbonus,basesavebonuses,andhitpoints).Itretains
anyclassfeatures(otherthanspellcasting)thatarentextraordinary,supernatural,orspelllikeabilities.
Incorporealorgaseouscreaturesareimmunetobeingpolymorphed,andacreaturewiththeshapechangersubtypecan
reverttoitsnaturalformasastandardaction.

Bane
Enchantment(Compulsion)[Fear,MindAffecting]
Level:Clr1
Components:V,S,DF
CastingTime:1standardaction
Range:50ft.
Area:Allenemieswithin50ft.
Duration:1min./level
SavingThrow:Willnegates
SpellResistance:Yes
Banefillsyourenemieswithfearanddoubt.Eachaffectedcreaturetakesa1penaltyonattackrollsanda1penaltyon
savingthrowsagainstfeareffects.
Banecountersanddispelsbless.

Banishment
Abjuration
Level:Clr6,Sor/Wiz7
Components:V,S,F
CastingTime:1standardaction

Page231of462
Range:Close(25ft.+5ft./2levels)
Targets:Oneormoreextraplanarcreatures,notwoofwhichcanbemorethan30ft.apart
Duration:Instantaneous
SavingThrow:Willnegates
SpellResistance:Yes
Abanishmentspellisamorepowerfulversionofthedismissalspell.Itenablesyoutoforceextraplanarcreaturesoutof
yourhomeplane.Asmanyas2HitDiceofcreaturespercasterlevelcanbebanished.
Youcanimprovethespellschanceofsuccessbypresentingatleastoneobjectorsubstancethatthetargethates,fears,or
otherwiseopposes.Foreachsuchobjectorsubstance,yougaina+1bonusonyourcasterlevelchecktoovercomethe
targetsspellresistance(ifany),thesavingthrowDCincreasesby2.
Certainrareitemsmightworktwiceaswellasanormalitemforthepurposeofthebonuses(eachprovidinga+2bonuson
thecasterlevelcheckagainstspellresistanceandincreasingthesaveDCby4).
ArcaneFocus:Anyitemthatisdistastefultothesubject(optional,seeabove).

Barkskin
Transmutation
Level:Drd2,Rgr2,Plant2
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Target:Livingcreaturetouched
Duration:10min./level
SavingThrow:None
SpellResistance:Yes(harmless)
Barkskintoughensacreaturesskin.Theeffectgrantsa+2enhancementbonustothecreaturesexistingnaturalarmor
bonus.Thisenhancementbonusincreasesby1foreverythreecasterlevelsabove3rd,toamaximumof+5atcasterlevel
12th.
Theenhancementbonusprovidedbybarkskinstackswiththetargetsnaturalarmorbonus,butnotwithother
enhancementbonusestonaturalarmor.Acreaturewithoutnaturalarmorhasaneffectivenaturalarmorbonusof+0.

BearsEndurance
Transmutation
Level:Clr2,Drd2,Rgr2,Sor/Wiz2
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Target:Creaturetouched
Duration:1min./level
SavingThrow:Willnegates(harmless)
SpellResistance:Yes
Theaffectedcreaturegainsgreatervitalityandstamina.Thespellgrantsthesubjecta+4enhancementbonusto
Constitution,whichaddstheusualbenefitstohitpoints,Fortitudesaves,Constitutionchecks,andsoforth.
HitpointsgainedbyatemporaryincreaseinConstitutionscorearenottemporaryhitpoints.Theygoawaywhenthe
subjectsConstitutiondropsbacktonormal.Theyarenotlostfirstastemporaryhitpointsare.

Page232of462
BearsEndurance,Mass
Transmutation
Level:Clr6,Drd6,Sor/Wiz6
Range:Close(25ft.+5ft./2levels)
Targets:Onecreature/level,notwoofwhichcanbemorethan30ft.apart
Massbearsenduranceworkslikebearsendurance,exceptthatitaffectsmultiplecreatures.

BestowCurse
Necromancy
Level:Clr3,Sor/Wiz4
Components:V,S
CastingTime:1standardaction
Range:Touch
Target:Creaturetouched
Duration:Permanent
SavingThrow:Willnegates
SpellResistance:Yes
Youplaceacurseonthesubject.Chooseoneofthefollowingthreeeffects.
6decreasetoanabilityscore(minimum1).
4penaltyonattackrolls,saves,abilitychecks,andskillchecks.
Eachturn,thetargethasa50%chancetoactnormally;otherwise,ittakesnoaction.
Youmayalsoinventyourowncurse,butitshouldbenomorepowerfulthanthosedescribedabove.
Thecursebestowedbythisspellcannotbedispelled,butitcanberemovedwithabreakenchantment,limitedwish,
miracle,removecurse,orwishspell.
Bestowcursecountersremovecurse.

Binding
Enchantment(Compulsion)[MindAffecting]
Level:Sor/Wiz8
Components:V,S,M
CastingTime:Oneminute
Range:Close(25ft.+5ft./2levels)
Target:Onelivingcreature
Duration:Seetext(D)
SavingThrow:Willnegates;seetext
SpellResistance:Yes
Abindingspellcreatesamagicalrestrainttoholdacreature.ThetargetgetsaninitialsavingthrowonlyifitsHitDice
equalatleastonehalfyourcasterlevel.
Youmayhaveasmanyassixassistantshelpyouwiththespell.Foreachassistantwhocastssuggestion,yourcasterlevelfor
thiscastingofbindingincreasesby1.Foreachassistantwhocastsdominateanimal,dominateperson,ordominate
monster,yourcasterlevelforthiscastingofbindingincreasesbyanumberequaltoonethirdofthatassistantslevel,
providedthatthespellstargetisappropriateforabindingspell.Sincetheassistantsspellsarecastsimplytoimproveyour
casterlevelforthepurposeofthebindingspell,savingthrowsandspellresistanceagainsttheassistantsspellsare
irrelevant.YourcasterleveldetermineswhetherthetargetgetsaninitialWillsavingthrowandhowlongthebindinglasts.

Page233of462
Allbindingspellsaredismissible.
Regardlessoftheversionofbindingyoucast,youcanspecifytriggeringconditionsthatendthespellandreleasethe
creaturewhenevertheyoccur.Thesetriggerscanbeassimpleorelaborateasyoudesire,buttheconditionmustbe
reasonableandhavealikelihoodofcomingtopass.Theconditionscanbebasedonacreaturesname,identity,or
alignmentbutotherwisemustbebasedonobservableactionsorqualities.Intangiblessuchaslevel,class,HitDice,orhit
pointsdontqualify.Oncethespelliscast,itstriggeringconditionscannotbechanged.Settingareleaseconditionincreases
thesaveDC(assumingasavingthrowisallowed)by2.
Ifyouarecastinganyofthefirstthreeversionsofbinding(thosewithlimiteddurations),youmaycastadditionalbinding
spellstoprolongtheeffect,sincethedurationsoverlap.Ifyoudoso,thetargetgetsasavingthrowattheendofthefirst
spellsduration,evenifyourcasterlevelwashighenoughtodisallowaninitialsavingthrow.Ifthecreaturesucceedson
thissave,allthebindingspellsithasreceivedarebroken.
Thebindingspellhassixversions.Chooseoneofthefollowingversionswhenyoucastthespell.
Chaining:Thesubjectisconfinedbyrestraintsthatgenerateanantipathyspellaffectingallcreatureswhoapproachthe
subject,exceptyou.Thedurationisoneyearpercasterlevel.Thesubjectofthisformofbindingisconfinedtothespotit
occupiedwhenitreceivedthespell.
Slumber:Thisversioncausesthesubjecttobecomecomatoseforaslongasoneyearpercasterlevel.Thesubjectdoesnot
needtoeatordrinkwhileslumbering,nordoesitage.Thisformofbindingismoredifficulttocastthanchaining,making
itslightlyeasiertoresist.ReducethespellssaveDCby1.
BoundSlumber:Thiscombinationofchainingandslumberlastsforaslongasonemonthpercasterlevel.Reducethesave
DCby2.
HedgedPrison:Thesubjectistransportedtoorotherwisebroughtwithinaconfinedareafromwhichitcannotwanderby
anymeans.Theeffectispermanent.ReducethesaveDCby3.
Metamorphosis:Thesubjectassumesgaseousform,exceptforitsheadorface.Itisheldharmlessinajarorother
container,whichmaybetransparentifyousochoose.Thecreatureremainsawareofitssurroundingsandcanspeak,butit
cannotleavethecontainer,attack,oruseanyofitspowersorabilities.Thebindingispermanent.Thesubjectdoesnotneed
tobreathe,eat,ordrinkwhilemetamorphosed,nordoesitage.ReducethesaveDCby4.
MinimusContainment:Thesubjectisshrunktoaheightof1inchorevenlessandheldwithinsomegem,jar,orsimilar
object.Thebindingispermanent.Thesubjectdoesnotneedtobreathe,eat,ordrinkwhilecontained,nordoesitage.
ReducethesaveDCby4.
Youcantdispelabindingspellwithdispelmagicorasimilareffect,thoughanantimagicfieldorMagesdisjunctionaffects
itnormally.Aboundextraplanarcreaturecannotbesentbacktoitshomeplaneduetodismissal,banishment,orasimilar
effect.
Components:Thecomponentsforabindingspellvaryaccordingtotheversionofthespell,buttheyalwaysincludea
continuouschantingutterancereadfromthescrollorspellbookpagecontainingthespell,somaticgestures,andmaterials
appropriatetotheformofbindingused.Thesecomponentscanincludesuchitemsasminiaturechainsofspecialmetals,
soporificherbsoftherarestsort(forslumberbindings),abelljarofthefinestcrystal,andthelike.
Inadditiontothespeciallymadepropssuitedtothespecifictypeofbinding(cost500gp),thespellrequiresopalsworthat
least500gpforeachHDofthetargetandavellumdepictionorcarvedstatuetteofthesubjecttobecaptured.

BlackTentacles
Conjuration(Creation)
Level:Sor/Wiz4
Components:V,S,M
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Area:20ft.radiusspread
Duration:1round/level(D)
SavingThrow:None

Page234of462
SpellResistance:No
Thisspellconjuresafieldofrubberyblacktentacles,each10feetlong.Thesewavingmembersseemtospringforthfrom
theearth,floor,orwhateversurfaceisunderfootincludingwater.Theygraspandentwinearoundcreaturesthatenterthe
area,holdingthemfastandcrushingthemwithgreatstrength.
Everycreaturewithintheareaofthespellmustmakeagrapplecheck,opposedbythegrapplecheckofthetentacles.Treat
thetentaclesattackingaparticulartargetasaLargecreaturewithabaseattackbonusequaltoyourcasterlevelanda
Strengthscoreof19.Thus,itsgrapplecheckmodifierisequaltoyourcasterlevel+8.Thetentaclesareimmunetoalltypes
ofdamage.
Oncethetentaclesgrappleanopponent,theymaymakeagrapplecheckeachroundonyourturntodeal1d6+4pointsof
bludgeoningdamage.Thetentaclescontinuetocrushtheopponentuntilthespellendsortheopponentescapes.
Anycreaturethatenterstheareaofthespellisimmediatelyattackedbythetentacles.Evencreatureswhoarentgrappling
withthetentaclesmaymovethroughtheareaatonlyhalfnormalspeed.
MaterialComponent:Apieceoftentaclefromagiantoctopusoragiantsquid.

BladeBarrier
Evocation[Force]
Level:Clr6,Good6,War6
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Effect:Wallofwhirlingbladesupto20ft.long/level,oraringedwallofwhirlingbladeswitharadiusofupto5ft.per
twolevels;eitherform20ft.high
Duration:1min./level(D)
SavingThrow:ReflexhalforReflexnegates;seetext
SpellResistance:Yes
Animmobile,verticalcurtainofwhirlingbladesshapedofpureforcespringsintoexistence.Anycreaturepassingthrough
thewalltakes1d6pointsofdamagepercasterlevel(maximum15d6),withaReflexsaveforhalfdamage.
Ifyouevokethebarriersothatitappearswherecreaturesare,eachcreaturetakesdamageasifpassingthroughthewall.
Eachsuchcreaturecanavoidthewall(endinguponthesideofitschoice)andthustakenodamagebymakingasuccessful
Reflexsave.
Abladebarrierprovidescover(+4bonustoAC,+2bonusonReflexsaves)againstattacksmadethroughit.

Blasphemy
Evocation[Evil,Sonic]
Level:Clr7,Evil7
Components:V
CastingTime:1standardaction
Range:30ft.
Area:Nonevilcreaturesina40ft.radiusspreadcenteredonyou
Duration:Instantaneous
SavingThrow:NoneorWillnegates;seetext
SpellResistance:Yes
Anynonevilcreaturewithintheareaofablasphemyspellsuffersthefollowingilleffects.
Table:BlasphemyEffects
HD EFFECT
Equaltocasterlevel Dazed

Page235of462
HD EFFECT
Uptocasterlevel1 Weakened,dazed
Uptocasterlevel5 Paralyzed,weakened,dazed
Uptocasterlevel10 Killed,paralyzed,weakened,dazed
Theeffectsarecumulativeandconcurrent.
Nosavingthrowisallowedagainsttheseeffects.
Dazed:Thecreaturecantakenoactionsfor1round,thoughitdefendsitselfnormally.
Weakened:ThecreaturesStrengthscoredecreasesby2d6pointsfor2d4rounds.
Paralyzed:Thecreatureisparalyzedandhelplessfor1d10minutes.
Killed:Livingcreaturesdie.Undeadcreaturesaredestroyed.
Furthermore,ifyouareonyourhomeplanewhenyoucastthisspell,nonevilextraplanarcreatureswithintheareaare
instantlybanishedbacktotheirhomeplanes.Creaturessobanishedcannotreturnforatleast24hours.Thiseffecttakes
placeregardlessofwhetherthecreaturesheartheblasphemy.ThebanishmenteffectallowsaWillsave(ata4penalty)to
negate.
CreatureswhoseHitDiceexceedyourcasterlevelareunaffectedbyblasphemy.

Bless
Enchantment(Compulsion)[MindAffecting]
Level:Clr1,Pal1
Components:V,S,DF
CastingTime:1standardaction
Range:50ft.
Area:Thecasterandallallieswithina50ft.burst,centeredonthecaster
Duration:1min./level
SavingThrow:None
SpellResistance:Yes(harmless)
Blessfillsyourallieswithcourage.Eachallygainsa+1moralebonusonattackrollsandonsavingthrowsagainstfear
effects.
Blesscountersanddispelsbane.

BlessWater
Transmutation[Good]
Level:Clr1,Pal1
Components:V,S,M
CastingTime:1minute
Range:Touch
Target:Flaskofwatertouched
Duration:Instantaneous
SavingThrow:Willnegates(object)
SpellResistance:Yes(object)
Thistransmutationimbuesaflask(1pint)ofwaterwithpositiveenergy,turningitintoholywater.
MaterialComponent:5poundsofpowderedsilver(worth25gp).

BlessWeapon
Transmutation

Page236of462
Level:Pal1
Components:V,S
CastingTime:1standardaction
Range:Touch
Target:Weapontouched
Duration:1min./level
SavingThrow:None
SpellResistance:No
Thistransmutationmakesaweaponstriketrueagainstevilfoes.Theweaponistreatedashavinga+1enhancementbonus
forthepurposeofbypassingthedamagereductionofevilcreaturesorstrikingevilincorporealcreatures(thoughthespell
doesntgrantanactualenhancementbonus).Theweaponalsobecomesgood,whichmeansitcanbypassthedamage
reductionofcertaincreatures.(Thiseffectoverridesandsuppressesanyotheralignmenttheweaponmighthave.)
Individualarrowsorboltscanbetransmuted,butaffectedprojectileweapons(suchasbows)dontconferthebenefittothe
projectilestheyshoot.
Inaddition,allcriticalhitrollsagainstevilfoesareautomaticallysuccessful,soeverythreatisacriticalhit.Thislasteffect
doesnotapplytoanyweaponthatalreadyhasamagicaleffectrelatedtocriticalhits,suchasakeenweaponoravorpal
sword.

Blight
Necromancy
Level:Drd4,Sor/Wiz5
Components:V,S,DF
CastingTime:1standardaction
Range:Touch
Duration:Instantaneous
SavingThrow:Fortitudehalf;seetext
SpellResistance:Yes
Thisspellwithersasingleplantofanysize.Anaffectedplantcreaturetakes1d6pointsofdamageperlevel(maximum
15d6)andmayattemptaFortitudesavingthrowforhalfdamage.Aplantthatisntacreaturedoesntreceiveasaveand
immediatelywithersanddies.
Thisspellhasnoeffectonthesoilorsurroundingplantlife.

Blindness/Deafness
Necromancy
Level:Brd2,Clr3,Sor/Wiz2
Components:V
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Target:Onelivingcreature
Duration:Permanent(D)
SavingThrow:Fortitudenegates
SpellResistance:Yes
Youcalluponthepowersofunlifetorenderthesubjectblindedordeafened,asyouchoose.

Page237of462
Blink
Transmutation
Level:Brd3,Sor/Wiz3
Components:V,S
CastingTime:1standardaction
Range:Personal
Target:You
Duration:1round/level(D)
YoublinkbackandforthbetweentheMaterialPlaneandtheEtherealPlane.Youlookasthoughyourewinkinginand
outofrealityveryquicklyandatrandom.
Blinkinghasseveraleffects,asfollows.
Physicalattacksagainstyouhavea50%misschance,andtheBlindFightfeatdoesnthelpopponents,sinceyoureethereal
andnotmerelyinvisible.Iftheattackiscapableofstrikingetherealcreatures,themisschanceisonly20%(for
concealment).
Iftheattackercanseeinvisiblecreatures,themisschanceisalsoonly20%.(Foranattackerwhocanbothseeandstrike
etherealcreatures,thereisnomisschance.)Likewise,yourownattackshavea20%misschance,sinceyousometimesgo
etherealjustasyouareabouttostrike.
Anyindividuallytargetedspellhasa50%chancetofailagainstyouwhileyoureblinkingunlessyourattackercantarget
invisible,etherealcreatures.Yourownspellshavea20%chancetoactivatejustasyougoethereal,inwhichcasethey
typicallydonotaffecttheMaterialPlane.
Whileblinking,youtakeonlyhalfdamagefromareaattacks(butfulldamagefromthosethatextendontotheEthereal
Plane).Youstrikeasaninvisiblecreature(witha+2bonusonattackrolls),denyingyourtargetanyDexteritybonustoAC.
Youtakeonlyhalfdamagefromfalling,sinceyoufallonlywhileyouarematerial.
Whileblinking,youcanstepthrough(butnotseethrough)solidobjects.Foreach5feetofsolidmaterialyouwalkthrough,
thereisa50%chancethatyoubecomematerial.Ifthisoccurs,youareshuntedofftothenearestopenspaceandtake1d6
pointsofdamageper5feetsotraveled.Youcanmoveatonlythreequartersspeed(becausemovementontheEthereal
Planeisathalfspeed,andyouspendabouthalfyourtimethereandhalfyourtimematerial.)
SinceyouspendabouthalfyourtimeontheEtherealPlane,youcanseeandevenattacketherealcreatures.Youinteract
withetherealcreaturesroughlythesamewayyouinteractwithmaterialones.
Anetherealcreatureisinvisible,incorporeal,andcapableofmovinginanydirection,evenupordown.Asanincorporeal
creature,youcanmovethroughsolidobjects,includinglivingcreatures.
AnetherealcreaturecanseeandheartheMaterialPlane,buteverythinglooksgrayandinsubstantial.Sightandhearingon
theMaterialPlanearelimitedto60feet.
Forceeffectsandabjurationsaffectyounormally.TheireffectsextendontotheEtherealPlanefromtheMaterialPlane,but
notviceversa.Anetherealcreaturecantattackmaterialcreatures,andspellsyoucastwhileetherealaffectonlyother
etherealthings.CertainmaterialcreaturesorobjectshaveattacksoreffectsthatworkontheEtherealPlane.Treatother
etherealcreaturesandobjectsasmaterial.

Blur
Illusion(Glamer)
Level:Brd2,Sor/Wiz2
Components:V
CastingTime:1standardaction
Range:Touch
Target:Creaturetouched
Duration:1min./level(D)

Page238of462
SavingThrow:Willnegates(harmless)
SpellResistance:Yes(harmless)
Thesubjectsoutlineappearsblurred,shiftingandwavering.Thisdistortiongrantsthesubjectconcealment(20%miss
chance).
Aseeinvisibilityspelldoesnotcounteracttheblureffect,butatrueseeingspelldoes.
Opponentsthatcannotseethesubjectignorethespellseffect(thoughfightinganunseenopponentcarriespenaltiesofits
own).

BreakEnchantment
Abjuration
Level:Brd4,Clr5,Luck5,Pal4,Sor/Wiz5
Components:V,S
CastingTime:1minute
Range:Close(25ft.+5ft./2levels)
Targets:Uptoonecreatureperlevel,allwithin30ft.ofeachother
Duration:Instantaneous
SavingThrow:Seetext
SpellResistance:No
Thisspellfreesvictimsfromenchantments,transmutations,andcurses.Breakenchantmentcanreverseevenan
instantaneouseffect.Foreachsucheffect,youmakeacasterlevelcheck(1d20+casterlevel,maximum+15)againstaDC
of11+casterleveloftheeffect.Successmeansthatthecreatureisfreeofthespell,curse,oreffect.Foracursedmagic
item,theDCis25.
Ifthespellisonethatcannotbedispelledbydispelmagic,breakenchantmentworksonlyifthatspellis5thlevelorlower.
Iftheeffectcomesfromsomepermanentmagicitembreakenchantmentdoesnotremovethecursefromtheitem,butit
doesfreesthevictimfromtheitemseffects.

BullsStrength
Transmutation
Level:Clr2,Drd2,Pal2,Sor/Wiz2,Strength2
Components:V,S,M/DF
CastingTime:1standardaction
Range:Touch
Target:Creaturetouched
Duration:1min./level
SavingThrow:Willnegates(harmless)
SpellResistance:Yes(harmless)
Thesubjectbecomesstronger.Thespellgrantsa+4enhancementbonustoStrength,addingtheusualbenefitstomelee
attackrolls,meleedamagerolls,andotherusesoftheStrengthmodifier.
ArcaneMaterialComponent:Afewhairs,orapinchofdung,fromabull.

BullsStrength,Mass
Transmutation
Level:Clr6,Drd6,Sor/Wiz6
Range:Close(25ft.+5ft./2levels)
Targets:Onecreature/level,notwoofwhichcanbemorethan30ft.apart
Page239of462
Thisspellfunctionslikebullsstrength,exceptthatitaffectsmultiplecreatures.

BurningHands
Evocation[Fire]
Level:Fire1,Sor/Wiz1
Components:V,S
CastingTime:1standardaction
Range:15ft.
Area:Coneshapedburst
Duration:Instantaneous
SavingThrow:Reflexhalf
SpellResistance:Yes
Aconeofsearingflameshootsfromyourfingertips.Anycreatureintheareaoftheflamestakes1d4pointsoffiredamage
percasterlevel(maximum5d4).Flammablematerialsburniftheflamestouchthem.Acharactercanextinguishburning
itemsasafullroundaction.

CallLightning
Evocation[Electricity]
Level:Drd3
Components:V,S
CastingTime:1round
Range:Medium(100ft.+10ft./level)
Effect:Oneormore30ft.longverticallinesoflightning
Duration:1min./level
SavingThrow:Reflexhalf
SpellResistance:Yes
Immediatelyuponcompletionofthespell,andonceperroundthereafter,youmaycalldowna5footwide,30footlong,
verticalboltoflightningthatdeals3d6pointsofelectricitydamage.Theboltoflightningflashesdowninaverticalstroke
atwhatevertargetpointyouchoosewithinthespellsrange(measuredfromyourpositionatthetime).Anycreatureinthe
targetsquareorinthepathoftheboltisaffected.
Youneednotcallaboltoflightningimmediately;otheractions,evenspellcasting,canbeperformed.However,eachround
afterthefirstyoumayuseastandardaction(concentratingonthespell)tocallabolt.Youmaycallatotalnumberofbolts
equaltoyourcasterlevel(maximum10bolts).
Ifyouareoutdoorsandinastormyareaarainshower,cloudsandwind,hotandcloudyconditions,orevenatornado
(includingawhirlwindformedbyadjinnioranairelementalofatleastLargesize)eachboltdeals3d10pointsof
electricitydamageinsteadof3d6.
Thisspellfunctionsindoorsorundergroundbutnotunderwater.

CallLightningStorm
Evocation[Electricity]
Level:Drd5
Range:Long(400ft.+40ft./level)
Thisspellfunctionslikecalllightning,exceptthateachboltdeals5d6pointsofelectricitydamage(or5d10ifcreated
outdoorsinastormyarea),andyoumaycallamaximumof15bolts.

CalmAnimals
Enchantment(Compulsion)[MindAffecting]
Page240of462
Level:Animal1,Drd1,Rgr1
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:Animalswithin30ft.ofeachother
Duration:1min./level
SavingThrow:Willnegates;seetext
SpellResistance:Yes
Thisspellsoothesandquietsanimals,renderingthemdocileandharmless.Onlyordinaryanimals(thosewithIntelligence
scoresof1or2)canbeaffectedbythisspell.Allthesubjectsmustbeofthesamekind,andnotwomaybemorethan30
feetapart.ThemaximumnumberofHitDiceofanimalsyoucanaffectisequalto2d4+casterlevel.Adireanimaloran
animaltrainedtoattackorguardisallowedasavingthrow;otheranimalsarenot.
Theaffectedcreaturesremainwheretheyareanddonotattackorflee.Theyarenothelplessanddefendthemselves
normallyifattacked.Anythreatbreaksthespellonthethreatenedcreatures.

CalmEmotions
Enchantment(Compulsion)[MindAffecting]
Level:Brd2,Clr2,Law2
Components:V,S,DF
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Area:Creaturesina20ft.radiusspread
Duration:Concentration,upto1round/level(D)
SavingThrow:Willnegates
SpellResistance:Yes
Thisspellcalmsagitatedcreatures.Youhavenocontrolovertheaffectedcreatures,butcalmemotionscanstopraging
creaturesfromfightingorjoyousonesfromreveling.Creaturessoaffectedcannottakeviolentactions(althoughtheycan
defendthemselves)ordoanythingdestructive.Anyaggressiveactionagainstordamagedealttoacalmedcreature
immediatelybreaksthespellonallcalmedcreatures.
Thisspellautomaticallysuppresses(butdoesnotdispel)anymoralebonusesgrantedbyspellssuchasbless,goodhope,
andrage,aswellasnegatingabardsabilitytoinspirecourageorabarbariansrageability.Italsosuppressesanyfear
effectsandremovestheconfusedconditionfromalltargets.Whilethespelllasts,asuppressedspelloreffecthasnoeffect.
Whenthecalmemotionsspellends,theoriginalspelloreffecttakesholdofthecreatureagain,providedthatitsduration
hasnotexpiredinthemeantime.

CatsGrace
Transmutation
Level:Brd2,Drd2,Rgr2,Sor/Wiz2
Components:V,S,M
CastingTime:1standardaction
Range:Touch
Target:Creaturetouched
Duration:1min./level
SavingThrow:Willnegates(harmless)
SpellResistance:Yes

Page241of462
Thetransmutedcreaturebecomesmoregraceful,agile,andcoordinated.Thespellgrantsa+4enhancementbonusto
Dexterity,addingtheusualbenefitstoAC,Reflexsaves,andotherusesoftheDexteritymodifier.
MaterialComponent:Apinchofcatfur.

CatsGrace,Mass
Transmutation
Level:Brd6,Drd6,Sor/Wiz6
Range:Close(25ft.+5ft./2levels)
Targets:Onecreature/level,notwoofwhichcanbemorethan30ft.apart
Thisspellfunctionslikecatsgrace,exceptthatitaffectsmultiplecreatures.

CauseFear
Necromancy[Fear,MindAffecting]
Level:Brd1,Clr1,Death1,Sor/Wiz1
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:Onelivingcreaturewith5orfewerHD
Duration:1d4roundsor1round;seetext
SavingThrow:Willpartial
SpellResistance:Yes
Theaffectedcreaturebecomesfrightened.IfthesubjectsucceedsonaWillsave,itisshakenfor1round.Creatureswith6
ormoreHitDiceareimmunetothiseffect.
Causefearcountersanddispelsremovefear.

ChainLightning
Evocation[Electricity]
Level:Air6,Sor/Wiz6
Components:V,S,F
CastingTime:1standardaction
Range:Long(400ft.+40ft./level)
Targets:Oneprimarytarget,plusonesecondarytarget/level(eachofwhichmustbewithin30ft.oftheprimarytarget)
Duration:Instantaneous
SavingThrow:Reflexhalf
SpellResistance:Yes
Thisspellcreatesanelectricaldischargethatbeginsasasinglestrokecommencingfromyourfingertips.Unlikelightning
bolt,chainlightningstrikesoneobjectorcreatureinitially,thenarcstoothertargets.
Theboltdeals1d6pointsofelectricitydamagepercasterlevel(maximum20d6)totheprimarytarget.Afteritstrikes,
lightningcanarctoanumberofsecondarytargetsequaltoyourcasterlevel(maximum20).Thesecondaryboltseach
strikeonetargetanddealhalfasmuchdamageastheprimaryonedid(roundeddown).
EachtargetcanattemptaReflexsavingthrowforhalfdamage.Youchoosesecondarytargetsasyoulike,buttheymustall
bewithin30feetoftheprimarytarget,andnotargetcanbestruckmorethanonce.Youcanchoosetoaffectfewer
secondarytargetsthanthemaximum.
Focus:Abitoffur;apieceofamber,glass,oracrystalrod;plusonesilverpinforeachofyourcasterlevels.

Page242of462
Changestaff
Transmutation
Level:Drd7
Components:V,S,F
CastingTime:1round
Range:Touch
Target:Yourtouchedstaff
Duration:1hour/level(D)
SavingThrow:None
SpellResistance:No
YouchangeaspeciallypreparedquarterstaffintoaHugetreantlikecreature,about24feettall.Whenyouplanttheendof
thestaffinthegroundandspeakaspecialcommandtoconcludethecastingofthespell,yourstaffturnsintoacreature
thatlooksandfightsjustlikeatreant.Thestafftreantdefendsyouandobeysanyspokencommands.However,itisbyno
meansatruetreant;itcannotconversewithactualtreantsorcontroltrees.Ifthestafftreantisreducedto0orfewerhit
points,itcrumblestopowderandthestaffisdestroyed.Otherwise,thestaffreturnstoitsnormalformwhenthespell
durationexpires(orwhenthespellisdismissed),anditcanbeusedasthefocusforanothercastingofthespell.Thestaff
treantisalwaysatfullstrengthwhencreated,despiteanywoundsitmayhaveincurredthelasttimeitappeared.
Focus:Thequarterstaff,whichmustbespeciallyprepared.Thestaffmustbeasoundlimbcutfromanash,oak,oryew,
thencured,shaped,carved,andpolished(aprocessrequiringtwentyeightdays).
Youcannotadventureorengageinotherstrenuousactivityduringtheshapingandcarvingofthestaff.

ChaosHammer
Evocation[Chaotic]
Level:Chaos4
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Area:20ft.radiusburst
Duration:Instantaneous(1d6rounds);seetext
SavingThrow:Willpartial;seetext
SpellResistance:Yes
Youunleashchaoticpowertosmiteyourenemies.Thepowertakestheformofamulticoloredexplosionofleaping,
ricochetingenergy.Onlylawfulandneutral(notchaotic)creaturesareharmedbythespell.
Thespelldeals1d8pointsofdamagepertwocasterlevels(maximum5d8)tolawfulcreatures(or1d6pointsofdamage
percasterlevel,maximum10d6,tolawfuloutsiders)andslowsthemfor1d6rounds.
Aslowedcreaturecantakeonlyasinglestandardactionormoveactiononeachofitsturns,plusfreeactionsasnormal.In
addition,ittakesa2penaltytoAC,attackrolls,damagerolls,andReflexsaves.AsuccessfulWillsavereducesthedamage
byhalfandnegatesthesloweffect.
Thespelldealsonlyhalfdamageagainstcreatureswhoareneitherlawfulnorchaotic,andtheyarenotslowed.Sucha
creaturecanreducethedamagebyhalfagain(downtoonequarter)withasuccessfulWillsave.

CharmAnimal
Enchantment(Charm)[MindAffecting]
Level:Drd1,Rgr1
Target:Oneanimal

Page243of462
Thisspellfunctionslikecharmperson,exceptthatitaffectsacreatureoftheanimaltype.

CharmMonster
Enchantment(Charm)[MindAffecting]
Level:Brd3,Sor/Wiz4
Target:Onelivingcreature
Duration:Oneday/level
Thisspellfunctionslikecharmperson,exceptthattheeffectisnotrestrictedbycreaturetypeorsize.

CharmMonster,Mass
Enchantment(Charm)[MindAffecting]
Level:Brd6,Sor/Wiz8
Components:V
Targets:Oneormorecreatures,notwoofwhichcanbemorethan30ft.apart
Duration:Oneday/level
Thisspellfunctionslikecharmmonster,exceptthatmasscharmmonsteraffectsanumberofcreatureswhosecombinedHD
donotexceedtwiceyourlevel,oratleastonecreatureregardlessofHD.Iftherearemorepotentialtargetsthanyoucan
affect,youchoosethemoneatatimeuntilyouchooseacreaturewithtoomanyHD.

CharmPerson
Enchantment(Charm)[MindAffecting]
Level:Brd1,Sor/Wiz1
Components:V,S
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:Onehumanoidcreature
Duration:1hour/level
SavingThrow:Willnegates
SpellResistance:Yes
Thischarmmakesahumanoidcreatureregardyouasitstrustedfriendandally(treatthetargetsattitudeasfriendly).If
thecreatureiscurrentlybeingthreatenedorattackedbyyouoryourallies,however,itreceivesa+5bonusonitssaving
throw.
Thespelldoesnotenableyoutocontrolthecharmedpersonasifitwereanautomaton,butitperceivesyourwordsand
actionsinthemostfavorableway.Youcantrytogivethesubjectorders,butyoumustwinanopposedCharismacheckto
convinceittodoanythingitwouldntordinarilydo.(Retriesarenotallowed.)Anaffectedcreatureneverobeyssuicidalor
obviouslyharmfulorders,butitmightbeconvincedthatsomethingverydangerousisworthdoing.Anyactbyyouoryour
apparentalliesthatthreatensthecharmedpersonbreaksthespell.Youmustspeakthepersonslanguagetocommunicate
yourcommands,orelsebegoodatpantomiming.

ChillMetal
Transmutation[Cold]
Level:Drd2
Components:V,S,DF
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:Metalequipmentofonecreaturepertwolevels,notwoofwhichcanbemorethan30ft.apart;or25lb.of
metal/level,noneofwhichcanbemorethan30ft.awayfromanyoftherest
Page244of462
Duration:7rounds
SavingThrow:Willnegates(object)
SpellResistance:Yes(object)
Chillmetalmakesmetalextremelycold.Unattended,nonmagicalmetalgetsnosavingthrow.Magicalmetalisalloweda
savingthrowagainstthespell.Aniteminacreaturespossessionusesthecreaturessavingthrowbonusunlessitsownis
higher.
Acreaturetakescolddamageifitsequipmentischilled.Ittakesfulldamageifitsarmorisaffectedorifitisholding,
touching,wearing,orcarryingmetalweighingonefifthofitsweight.Thecreaturetakesminimumdamage(1pointor2
points;seethetable)ifitsnotwearingmetalarmorandthemetalthatitscarryingweighslessthanonefifthofitsweight.
Onthefirstroundofthespell,themetalbecomeschillyanduncomfortabletotouchbutdealsnodamage.Thesameeffect
alsooccursonthelastroundofthespellsduration.Duringthesecond(andalsothenexttolast)round,icycoldnesscauses
painanddamage.Inthethird,fourth,andfifthrounds,themetalisfreezingcold,causingmoredamage,asshownonthe
tablebelow.
Table:ChillMetalDamage
ROUND METALTEMPERATURE DAMAGE
1 Cold None
2 Icy 1d4points
35 Freezing 2d4points
6 Icy 1d4points
7 Cold None
Anyheatintenseenoughtodamagethecreaturenegatescolddamagefromthespell(andviceversa)onapointforpoint
basis.Underwater,chillmetaldealsnodamage,buticeimmediatelyformsaroundtheaffectedmetal,makingitmore
buoyant.
Chillmetalcountersanddispelsheatmetal.

ChillTouch
Necromancy
Level:Sor/Wiz1
Components:V,S
CastingTime:1standardaction
Range:Touch
Targets:Creatureorcreaturestouched(uptoone/level)
Duration:Instantaneous
SavingThrow:FortitudepartialorWillnegates;seetext
SpellResistance:Yes
Atouchfromyourhand,whichglowswithblueenergy,disruptsthelifeforceoflivingcreatures.Eachtouchchannels
negativeenergythatdeals1d6pointsofdamage.Thetouchedcreaturealsotakes1pointofStrengthdamageunlessit
makesasuccessfulFortitudesavingthrow.Youcanusethismeleetouchattackuptoonetimeperlevel.
Anundeadcreatureyoutouchtakesnodamageofeithersort,butitmustmakeasuccessfulWillsavingthroworfleeasif
panickedfor1d4rounds+1roundpercasterlevel.

CircleofDeath
Necromancy[Death]
Level:Sor/Wiz6
Components:V,S,M
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Area:Severallivingcreatureswithina40ft.radiusburst
Page245of462
Duration:Instantaneous
SavingThrow:Fortitudenegates
SpellResistance:Yes
Acircleofdeathsnuffsoutthelifeforceoflivingcreatures,killingtheminstantly.
Thespellslays1d4HDworthoflivingcreaturespercasterlevel(maximum20d4).CreatureswiththefewestHDare
affectedfirst;amongcreatureswithequalHD,thosewhoareclosesttotheburstspointoforiginareaffectedfirst.No
creatureof9ormoreHDcanbeaffected,andHitDicethatarenotsufficienttoaffectacreaturearewasted.
MaterialComponent:Thepowderofacrushedblackpearlwithaminimumvalueof500gp.

Clairaudience/Clairvoyance
Divination(Scrying)
Level:Brd3,Knowledge3,Sor/Wiz3
Components:V,S,F/DF
CastingTime:10minutes
Range:Long(400ft.+40ft./level)
Effect:Magicalsensor
Duration:1min./level(D)
SavingThrow:None
SpellResistance:No
Clairaudience/clairvoyancecreatesaninvisiblemagicalsensorataspecificlocationthatenablesyoutohearorsee(your
choice)almostasifyouwerethere.Youdontneedlineofsightorlineofeffect,butthelocalemustbeknownaplace
familiartoyouoranobviousone.Onceyouhaveselectedthelocale,thesensordoesntmove,butyoucanrotateitinall
directionstoviewtheareaasdesired.Unlikeotherscryingspells,thisspelldoesnotallowmagicallyorsupernaturally
enhancedsensestoworkthroughit.Ifthechosenlocaleismagicallydark,youseenothing.Ifitisnaturallypitchblack,you
canseeina10footradiusaroundthecenterofthespellseffect.Clairaudience/clairvoyancefunctionsonlyontheplaneof
existenceyouarecurrentlyoccupying.
ArcaneFocus:Asmallhorn(forhearing)oraglasseye(forseeing).

ClenchedFist
Evocation[Force]
Level:Sor/Wiz8,Strength8
Components:V,S,F/DF
Thisspellfunctionslikeinterposinghand,exceptthatthehandcaninterposeitself,push,orstrikeoneopponentthatyou
select.Thefloatinghandcanmoveasfaras60feetandcanattackinthesameround.Sincethishandisdirectedbyyou,its
abilitytonoticeorattackinvisibleorconcealedcreaturesisnobetterthanyours.
Thehandattacksonceperround,anditsattackbonusequalsyourcasterlevel+yourIntelligence,Wisdom,orCharisma
modifier(forawizard,cleric,orsorcerer,respectively),+11forthehandsStrengthscore(33),1forbeingLarge.The
handdeals1d8+11pointsofdamageoneachattack,andanycreaturestruckmustmakeaFortitudesave(againstthis
spellssaveDC)orbestunnedfor1round.Directingthespelltoanewtargetisamoveaction.
Theclenchedfistcanalsointerposeitselfasinterposinghanddoes,oritcanbullrushanopponentasforcefulhanddoes,
butata+15bonusontheStrengthcheck.
Clericswhocastthisspellnameitfortheirdeities.
ArcaneFocus:Aleatherglove.

CloakofChaos
Abjuration[Chaotic]
Level:Chaos8,Clr8

Page246of462
Components:V,S,F
CastingTime:1standardaction
Range:20ft.
Targets:Onecreature/levelina20ft.radiusburstcenteredonyou
Duration:1round/level(D)
SavingThrow:Seetext
SpellResistance:Yes(harmless)
Arandompatternofcolorsurroundsthesubjects,protectingthemfromattacks,grantingthemresistancetospellscastby
lawfulcreatures,andcausinglawfulcreaturesthatstrikethesubjectstobecomeconfused.Thisabjurationhasfoureffects.
First,eachwardedcreaturegainsa+4deflectionbonustoACanda+4resistancebonusonsaves.Unlikeprotectionfrom
law,thebenefitofthisspellappliesagainstallattacks,notjustagainstattacksbylawfulcreatures.
Second,eachwardedcreaturegainsspellresistance25againstlawfulspellsandspellscastbylawfulcreatures.
Third,theabjurationblockspossessionandmentalinfluence,justasprotectionfromlawdoes.
Finally,ifalawfulcreaturesucceedsonameleeattackagainstawardedcreature,theoffendingattackerisconfusedfor1
round(Willsavenegates,aswiththeconfusionspell,butagainstthesaveDCofcloakofchaos).
Focus:Atinyreliquarycontainingsomesacredrelic,suchasascrapofparchmentfromachaotictext.Thereliquarycostsat
least500gp.

Clone
Necromancy
Level:Sor/Wiz8
Components:V,S,M,F
CastingTime:10minutes
Range:0ft.
Effect:Oneclone
Duration:Instantaneous
SavingThrow:None
SpellResistance:No
Thisspellmakesaninertduplicateofacreature.Iftheoriginalindividualhasbeenslain,itssoulimmediatelytransfersto
theclone,creatingareplacement(providedthatthesoulisfreeandwillingtoreturn).Theoriginalsphysicalremains,
shouldtheystillexist,becomeinertandcannotthereafterberestoredtolife.Iftheoriginalcreaturehasreachedtheendof
itsnaturallifespan(thatis,ithasdiedofnaturalcauses),anycloningattemptfails.
Tocreatetheduplicate,youmusthaveapieceofflesh(nothair,nails,scales,orthelike)withavolumeofatleast1cubic
inchthatwastakenfromtheoriginalcreatureslivingbody.Thepieceoffleshneednotbefresh,butitmustbekeptfrom
rotting.Oncethespelliscast,theduplicatemustbegrowninalaboratoryfor2d4months.
Whenthecloneiscompleted,theoriginalssoulentersitimmediately,ifthatcreatureisalreadydead.Thecloneis
physicallyidenticalwiththeoriginalandpossessesthesamepersonalityandmemoriesastheoriginal.Inotherrespects,
treatthecloneasifitweretheoriginalcharacterraisedfromthedead,includingthelossofonelevelor2pointsof
Constitution(iftheoriginalwasa1stlevelcharacter).IfthisConstitutionadjustmentwouldgivethecloneaConstitution
scoreof0,thespellfails.Iftheoriginalcreaturehaslostlevelssincethefleshsamplewastakenanddiedatalowerlevel
thantheclonewouldotherwisebe,thecloneisonelevelbelowthelevelatwhichtheoriginaldied.
Thespellduplicatesonlytheoriginalsbodyandmind,notitsequipment.
Aduplicatecanbegrownwhiletheoriginalstilllives,orwhentheoriginalsoulisunavailable,buttheresultingbodyis
merelyasoullessbitofinertflesh,whichrotsifnotpreserved.
MaterialComponent:Thepieceoffleshandvariouslaboratorysupplies(cost1,000gp).

Page247of462
Focus:Speciallaboratoryequipment(cost500gp).

Cloudkill
Conjuration(Creation)
Level:Sor/Wiz5
Components:V,S
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Effect:Cloudspreadsin20ft.radius,20ft.high
Duration:1min./level
SavingThrow:Fortitudepartial;seetext
SpellResistance:No
Thisspellgeneratesabankoffog,similartoafogcloud,exceptthatitsvaporsareyellowishgreenandpoisonous.These
vaporsautomaticallykillanylivingcreaturewith3orfewerHD(nosave).Alivingcreaturewith4to6HDisslainunlessit
succeedsonaFortitudesave(inwhichcaseittakes1d4pointsofConstitutiondamageonyourturneachroundwhilein
thecloud).
Alivingcreaturewith6ormoreHDtakes1d4pointsofConstitutiondamageonyourturneachroundwhileinthecloud(a
successfulFortitudesavehalvesthisdamage).Holdingonesbreathdoesnthelp,butcreaturesimmunetopoisonare
unaffectedbythespell.
Unlikeafogcloud,thecloudkillmovesawayfromyouat10feetperround,rollingalongthesurfaceoftheground.
Figureoutthecloudsnewspreadeachroundbasedonitsnewpointoforigin,whichis10feetfartherawayfromthepoint
oforiginwhereyoucastthespell.
Becausethevaporsareheavierthanair,theysinktothelowestleveloftheland,evenpouringdowndenorsinkhole
openings.Itcannotpenetrateliquids,norcanitbecastunderwater.

ColorSpray
Illusion(Pattern)[MindAffecting]
Level:Sor/Wiz1
Components:V,S,M
CastingTime:1standardaction
Range:15ft.
Area:Coneshapedburst
Duration:Instantaneous;seetext
SavingThrow:Willnegates
SpellResistance:Yes
Avividconeofclashingcolorsspringsforthfromyourhand,causingcreaturestobecomestunned,perhapsalsoblinded,
andpossiblyknockingthemunconscious.
EachcreaturewithintheconeisaffectedaccordingtoitsHitDice.
2HDorless:Thecreatureisunconscious,blinded,andstunnedfor2d4rounds,thenblindedandstunnedfor1d4rounds,
andthenstunnedfor1round.(Onlylivingcreaturesareknockedunconscious.)
3or4HD:Thecreatureisblindedandstunnedfor1d4rounds,thenstunnedfor1round.
5ormoreHD:Thecreatureisstunnedfor1round.
Sightlesscreaturesarenotaffectedbycolorspray.

Page248of462
MaterialComponent:Apincheachofpowderorsandthatiscoloredred,yellow,andblue.

Command
Enchantment(Compulsion)[LanguageDependent,MindAffecting]
Level:Clr1
Components:V
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Target:Onelivingcreature
Duration:1round
SavingThrow:Willnegates
SpellResistance:Yes
Yougivethesubjectasinglecommand,whichitobeystothebestofitsabilityatitsearliestopportunity.Youmayselect
fromthefollowingoptions.
Approach:Onitsturn,thesubjectmovestowardyouasquicklyanddirectlyaspossiblefor1round.Thecreaturemaydo
nothingbutmoveduringitsturn,anditprovokesattacksofopportunityforthismovementasnormal.
Drop:Onitsturn,thesubjectdropswhateveritisholding.Itcantpickupanydroppeditemuntilitsnextturn.
Fall:Onitsturn,thesubjectfallstothegroundandremainspronefor1round.Itmayactnormallywhilepronebuttakes
anyappropriatepenalties.
Flee:Onitsturn,thesubjectmovesawayfromyouasquicklyaspossiblefor1round.Itmaydonothingbutmoveduring
itsturn,anditprovokesattacksofopportunityforthismovementasnormal.
Halt:Thesubjectstandsinplacefor1round.Itmaynottakeanyactionsbutisnotconsideredhelpless.
Ifthesubjectcantcarryoutyourcommandonitsnextturn,thespellautomaticallyfails.

Command,Greater
Enchantment(Compulsion)[LanguageDependent,MindAffecting]
Level:Clr5
Targets:Onecreature/level,notwoofwhichcanbemorethan30ft.apart
Duration:1round/level
Thisspellfunctionslikecommand,exceptthatuptoonecreatureperlevelmaybeaffected,andtheactivitiescontinue
beyond1round.Atthestartofeachcommandedcreaturesactionafterthefirst,itgetsanotherWillsavetoattemptto
breakfreefromthespell.Eachcreaturemustreceivethesamecommand.

CommandPlants
Transmutation
Level:Drd4,Plant4,Rgr3
Components:V
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:Upto2HD/levelofplantcreatures,notwoofwhichcanbemorethan30ft.apart
Duration:Oneday/level
SavingThrow:Willnegates
SpellResistance:Yes
Thisspellallowsyousomedegreeofcontroloveroneormoreplantcreatures.Affectedplantcreaturescanunderstandyou,
andtheyperceiveyourwordsandactionsinthemostfavorableway(treattheirattitudeasfriendly).Theywillnotattack
Page249of462
youwhilethespelllasts.Youcantrytogiveasubjectorders,butyoumustwinanopposedCharismachecktoconvinceitto
doanythingitwouldntordinarilydo.(Retriesarenotallowed.)Acommandedplantneverobeyssuicidalorobviously
harmfulorders,butitmightbeconvincedthatsomethingverydangerousisworthdoing.
YoucanaffectanumberofplantcreatureswhosecombinedlevelorHDdonotexceedtwiceyourlevel.

CommandUndead
Necromancy
Level:Sor/Wiz2
Components:V,S,M
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Targets:Oneundeadcreature
Duration:Oneday/level
SavingThrow:Willnegates;seetext
SpellResistance:Yes
Thisspellallowsyousomedegreeofcontroloveranundeadcreature.Assumingthesubjectisintelligent,itperceivesyour
wordsandactionsinthemostfavorableway(treatitsattitudeasfriendly).Itwillnotattackyouwhilethespelllasts.You
cantrytogivethesubjectorders,butyoumustwinanopposedCharismachecktoconvinceittodoanythingitwouldnt
ordinarilydo.(Retriesarenotallowed.)Anintelligentcommandedundeadneverobeyssuicidalorobviouslyharmful
orders,butitmightbeconvincedthatsomethingverydangerousisworthdoing.
Anonintelligentundeadcreaturegetsnosavingthrowagainstthisspell.Whenyoucontrolamindlessbeing,youcan
communicateonlybasiccommands,suchascomehere,gothere,fight,standstill,andsoon.Nonintelligentundead
wontresistsuicidalorobviouslyharmfulorders.
Anyactbyyouoryourapparentalliesthatthreatensthecommandedundead(regardlessofitsIntelligence)breaksthe
spell.
Yourcommandsarenottelepathic.Theundeadcreaturemustbeabletohearyou.
MaterialComponent:Ashredofrawmeatandasplinterofbone.

Commune
Divination
Level:Clr5
Components:V,S,M,DF,XP
CastingTime:10minutes
Range:Personal
Target:You
Duration:1round/level
Youcontactyourdeityoragentsthereofandaskquestionsthatcanbeansweredbyasimpleyesorno.(Aclericofno
particulardeitycontactsaphilosophicallyallieddeity.)Youareallowedonesuchquestionpercasterlevel.Theanswers
givenarecorrectwithinthelimitsoftheentitysknowledge.Unclearisalegitimateanswer,becausepowerfulbeingsof
theOuterPlanesarenotnecessarilyomniscient.Incaseswhereaonewordanswerwouldbemisleadingorcontrarytothe
deitysinterests,ashortphrase(fivewordsorless)maybegivenasananswerinstead.
Thespell,atbest,providesinformationtoaidcharacterdecisions.Theentitiescontactedstructuretheiranswerstofurther
theirownpurposes.Ifyoulag,discusstheanswers,orgoofftodoanythingelse,thespellends.
MaterialComponent:Holy(orunholy)waterandincense.
XPCost:100XP.

Page250of462
CommunewithNature
Divination
Level:Animal5,Drd5,Rgr4
Components:V,S
CastingTime:10minutes
Range:Personal
Target:You
Duration:Instantaneous
Youbecomeonewithnature,attainingknowledgeofthesurroundingterritory.Youinstantlygainknowledgeofasmanyas
threefactsfromamongthefollowingsubjects:thegroundorterrain,plants,minerals,bodiesofwater,people,general
animalpopulation,presenceofwoodlandcreatures,presenceofpowerfulunnaturalcreatures,oreventhegeneralstateof
thenaturalsetting.
Inoutdoorsettings,thespelloperatesinaradiusof1milepercasterlevel.Innaturalundergroundsettingscaves,
caverns,andtheliketheradiusislimitedto100feetpercasterlevel.Thespelldoesnotfunctionwherenaturehasbeen
replacedbyconstructionorsettlement,suchasindungeonsandtowns.

ComprehendLanguages
Divination
Level:Brd1,Clr1,Sor/Wiz1
Components:V,S,M/DF
CastingTime:1standardaction
Range:Personal
Target:You
Duration:10min./level
Youcanunderstandthespokenwordsofcreaturesorreadotherwiseincomprehensiblewrittenmessages.Ineithercase,
youmusttouchthecreatureorthewriting.Theabilitytoreaddoesnotnecessarilyimpartinsightintothematerial,merely
itsliteralmeaning.Thespellenablesyoutounderstandorreadanunknownlanguage,notspeakorwriteit.
Writtenmaterialcanbereadattherateofonepage(250words)perminute.Magicalwritingcannotberead,thoughthe
spellrevealsthatitismagical.Thisspellcanbefoiledbycertainwardingmagic(suchasthesecretpageandillusoryscript
spells).Itdoesnotdeciphercodesorrevealmessagesconcealedinotherwisenormaltext.
Comprehendlanguagescanbemadepermanentwithapermanencyspell.
ArcaneMaterialComponent:Apinchofsootandafewgrainsofsalt.

ConeofCold
Evocation[Cold]
Level:Sor/Wiz5,Water6
Components:V,S,M/DF
CastingTime:1standardaction
Range:60ft.
Area:Coneshapedburst
Duration:Instantaneous
SavingThrow:Reflexhalf
SpellResistance:Yes
Coneofcoldcreatesanareaofextremecold,originatingatyourhandandextendingoutwardinacone.Itdrainsheat,
dealing1d6pointsofcolddamagepercasterlevel(maximum15d6).

Page251of462
ArcaneMaterialComponent:Averysmallcrystalorglasscone.

Confusion
Enchantment(Compulsion)[MindAffecting]
Level:Brd3,Sor/Wiz4,Trickery4
Components:V,S,M/DF
CastingTime:1standardaction
Range:Medium(100ft.+10ft./level)
Targets:Allcreaturesina15ft.radiusburst
Duration:1round/level
SavingThrow:Willnegates
SpellResistance:Yes
Thisspellcausesthetargetstobecomeconfused,makingthemunabletoindependentlydeterminewhattheywilldo.
Rollonthefollowingtableatthebeginningofeachsubjectsturneachroundtoseewhatthesubjectdoesinthatround.
Table:ConfusionEffects
D% BEHAVIOR
0110 Attackcasterwithmeleeorrangedweapons(orclosewithcasterifattackisnotpossible).
1120 Actnormally.
2150 Donothingbutbabbleincoherently.
5170 Fleeawayfromcasterattoppossiblespeed.
71100 Attacknearestcreature(forthispurpose,afamiliarcountsaspartofthesubjectsself).
Aconfusedcharacterwhocantcarryouttheindicatedactiondoesnothingbutbabbleincoherently.Attackersarenotatany
specialadvantagewhenattackingaconfusedcharacter.Anyconfusedcharacterwhoisattackedautomaticallyattacksits
attackersonitsnextturn,aslongasitisstillconfusedwhenitsturncomes.Notethataconfusedcharacterwillnotmake
attacksofopportunityagainstanycreaturethatitisnotalreadydevotedtoattacking(eitherbecauseofitsmostrecent
actionorbecauseithasjustbeenattacked).
ArcaneMaterialComponent:Asetofthreenutshells.

Confusion,Lesser
Enchantment(Compulsion)[MindAffecting]
Level:Brd1
Components:V,S,DF
Range:Close(25ft.+5ft./2levels)
Target:Onelivingcreature
Duration:1round
Thisspellcausesasinglecreaturetobecomeconfusedfor1round.Seetheconfusionspell,above,todeterminetheexact
effectonthesubject.

Consecrate
Evocation[Good]
Level:Clr2
Components:V,S,M,DF
CastingTime:1standardaction
Range:Close(25ft.+5ft./2levels)
Area:20ft.radiusemanation
Duration:2hours/level
SavingThrow:None
Page252of462
SpellResistance:No
Thisspellblessesanareawithpositiveenergy.EachCharismacheckmadetoturnundeadwithinthisareagainsa+3
sacredbonus.Everyundeadcreatureenteringaconsecratedareasuffersminordisruption,givingita1penaltyonattack
rolls,damagerolls,andsaves.Undeadcannotbecreatedwithinorsummonedintoaconsecratedarea.
Iftheconsecratedareacontainsanaltar,shrine,orotherpermanentfixturededicatedtoyourdeity,pantheon,oraligned
higherpower,themodifiersgivenabovearedoubled(+6sacredbonusonturningchecks,2penaltiesforundeadinthe
area).Youcannotconsecrateanar